NMR Restraints Grid

Result table
 (Save to zip file containing files for each block)

image mrblock_id pdb_id bmrb_id cing stage program type subtype item_count
508389 2eow 10207 cing 4-filtered-FRED STAR entry full 392


data_FRED_restraints_with_modified_coordinates_PDB_code_2eow

# This FRED archive file contains, for PDB entry <2eow>:
# 
# - Coordinates and sequence information from the PDB mmCIF file
# - NMR restraints from the PDB MR file
# 
# In this file, the coordinates and NMR restraints share the same atom names,
# and in this way can differ from the data deposited at the wwPDB. To achieve
# this aim, the NMR restraints were parsed from their original format files, and
# the coordinates and NMR restraints information were subsequently harmonized.
# 
# Due to the complexity of this harmonization process and the filtering process
# used in creating these files, the NMR restraints information in these files
# may differ significantly from that in the originally deposited file. Other 
# modifications could have occurred to the NMR restraints information, or data 
# could have been lost because of parsing or conversion errors. The PDB file 
# remains the authoritative reference for the atomic coordinates and the 
# originally deposited restraints files remain the primary reference for these 
# data.
# 
# This file is generated at the BioMagResBank (BMRB) in collaboration with the 
# PDBe (formerly MSD) group at the European Bioinformatics Institute (EBI) and 
# the CMBI/IMM group at the Radboud University of Nijmegen.
# 
# Several software packages were used to produce this file:
# 
# - Wattos (BMRB and CMBI/IMM).
# - FormatConverter and NMRStarExport (PDBe).
# - CCPN framework (http://www.ccpn.ac.uk/).
# 
# More information about this process can be found in the references below.
# Please cite the original reference for this PDB entry.
# 
# JF Doreleijers, A Nederveen, W Vranken, J Lin, AM Bonvin, R Kaptein, JL
# Markley, and EL Ulrich (2005). BioMagResBank databases DOCR and FRED
# containing converted and filtered sets of experimental NMR restraints and
# coordinates from over 500 protein PDB structures. J. Biomol. NMR 32, 1-12.
# 
# WF Vranken, W Boucher, TJ Stevens, RH Fogh, A Pajon, M Llinas, EL Ulrich, JL
# Markley, J Ionides, ED Laue (2005). The CCPN data model for NMR spectroscopy:
# development of a software pipeline. Proteins 59, 687-696. 
# 
# JF Doreleijers, WF Vranken, C Schulte, J Lin, JR Wedell, CJ Penkett, GW Vuister, 
# G Vriend, JL Markley, and EL Ulrich (2009). The NMR Restraints Grid at BMRB for 
# 5,266 Protein and Nucleic Acid PDB Entries. J Biomol. NMR 45, 389?396.




save_Conversion_project_for_entry_Name_1
    _Study_list.Sf_category  study_list
    _Study_list.Entry_ID     1
    _Study_list.ID           1

    loop_
       _Study.ID
       _Study.Name
       _Study.Type
       _Study.Details
       _Study.Entry_ID
       _Study.Study_list_ID

       1 "Conversion project for entry 1" NMR . 1 1 
    stop_

save_


save_originalConstraints_1
    _Entry.PDB_coordinate_file_version  .
    _Entry.Sf_category                  entry_information
    _Entry.ID                           1
    _Entry.Title                        "Data for entry 1"
    _Entry.NMR_STAR_version             3.1.0.8
    _Entry.Experimental_method          NMR
    _Entry.Details                      .

save_


save_assembly_2eow
    _Assembly.Sf_category           assembly
    _Assembly.Entry_ID              1
    _Assembly.ID                    1
    _Assembly.Name                  2eow
    _Assembly.Number_of_components  2
    _Assembly.Organic_ligands       .
    _Assembly.Metal_ions            .
    _Assembly.Paramagnetic          .
    _Assembly.Thiol_state           "all other bound"
    _Assembly.Molecular_mass        4643.33

    loop_
       _Entity_assembly.ID
       _Entity_assembly.Entity_assembly_name
       _Entity_assembly.Entity_ID
       _Entity_assembly.Entity_label
       _Entity_assembly.Asym_ID
       _Entity_assembly.Details
       _Entity_assembly.Entry_ID
       _Entity_assembly.Assembly_ID

       1 . 1 $Zinc_finger_protein_347 A . 1 1 
       2 . 2 $ZINC_ION                B . 1 1 
    stop_

    loop_
       _PDBX_nonpoly_scheme.Entity_assembly_ID
       _PDBX_nonpoly_scheme.Entity_ID
       _PDBX_nonpoly_scheme.Mon_ID
       _PDBX_nonpoly_scheme.Comp_index_ID
       _PDBX_nonpoly_scheme.Comp_ID
       _PDBX_nonpoly_scheme.Entry_ID
       _PDBX_nonpoly_scheme.Assembly_ID

       2 2 ZN 1 ZN 1 1 
    stop_

save_


save_Zinc_finger_protein_347
    _Entity.Sf_category                  entity
    _Entity.Entry_ID                     1
    _Entity.ID                           1
    _Entity.Name                         "Zinc finger protein 347"
    _Entity.Type                         polymer
    _Entity.Polymer_type                 polypeptide(L)
    _Entity.Polymer_seq_one_letter_code  GSSGSSGTGEKPYKCNECGKAFRARSSLAIHQATHSGEKPSGPSSG
    _Entity.Number_of_monomers           46

    loop_
       _Entity_comp_index.ID
       _Entity_comp_index.Comp_ID
       _Entity_comp_index.Comp_label
       _Entity_comp_index.Entry_ID
       _Entity_comp_index.Entity_ID

        1 GLY . 1 1 
        2 SER . 1 1 
        3 SER . 1 1 
        4 GLY . 1 1 
        5 SER . 1 1 
        6 SER . 1 1 
        7 GLY . 1 1 
        8 THR . 1 1 
        9 GLY . 1 1 
       10 GLU . 1 1 
       11 LYS . 1 1 
       12 PRO . 1 1 
       13 TYR . 1 1 
       14 LYS . 1 1 
       15 CYS . 1 1 
       16 ASN . 1 1 
       17 GLU . 1 1 
       18 CYS . 1 1 
       19 GLY . 1 1 
       20 LYS . 1 1 
       21 ALA . 1 1 
       22 PHE . 1 1 
       23 ARG . 1 1 
       24 ALA . 1 1 
       25 ARG . 1 1 
       26 SER . 1 1 
       27 SER . 1 1 
       28 LEU . 1 1 
       29 ALA . 1 1 
       30 ILE . 1 1 
       31 HIS . 1 1 
       32 GLN . 1 1 
       33 ALA . 1 1 
       34 THR . 1 1 
       35 HIS . 1 1 
       36 SER . 1 1 
       37 GLY . 1 1 
       38 GLU . 1 1 
       39 LYS . 1 1 
       40 PRO . 1 1 
       41 SER . 1 1 
       42 GLY . 1 1 
       43 PRO . 1 1 
       44 SER . 1 1 
       45 SER . 1 1 
       46 GLY . 1 1 
    stop_

    loop_
       _Entity_poly_seq.Mon_ID
       _Entity_poly_seq.Num
       _Entity_poly_seq.Comp_index_ID
       _Entity_poly_seq.Entry_ID
       _Entity_poly_seq.Entity_ID

       GLY  1  1 1 1 
       SER  2  2 1 1 
       SER  3  3 1 1 
       GLY  4  4 1 1 
       SER  5  5 1 1 
       SER  6  6 1 1 
       GLY  7  7 1 1 
       THR  8  8 1 1 
       GLY  9  9 1 1 
       GLU 10 10 1 1 
       LYS 11 11 1 1 
       PRO 12 12 1 1 
       TYR 13 13 1 1 
       LYS 14 14 1 1 
       CYS 15 15 1 1 
       ASN 16 16 1 1 
       GLU 17 17 1 1 
       CYS 18 18 1 1 
       GLY 19 19 1 1 
       LYS 20 20 1 1 
       ALA 21 21 1 1 
       PHE 22 22 1 1 
       ARG 23 23 1 1 
       ALA 24 24 1 1 
       ARG 25 25 1 1 
       SER 26 26 1 1 
       SER 27 27 1 1 
       LEU 28 28 1 1 
       ALA 29 29 1 1 
       ILE 30 30 1 1 
       HIS 31 31 1 1 
       GLN 32 32 1 1 
       ALA 33 33 1 1 
       THR 34 34 1 1 
       HIS 35 35 1 1 
       SER 36 36 1 1 
       GLY 37 37 1 1 
       GLU 38 38 1 1 
       LYS 39 39 1 1 
       PRO 40 40 1 1 
       SER 41 41 1 1 
       GLY 42 42 1 1 
       PRO 43 43 1 1 
       SER 44 44 1 1 
       SER 45 45 1 1 
       GLY 46 46 1 1 
    stop_

save_


save_ZINC_ION
    _Entity.Sf_category  entity
    _Entity.Entry_ID     1
    _Entity.ID           2
    _Entity.Name         "ZINC ION"
    _Entity.Type         non-polymer

    loop_
       _Entity_comp_index.ID
       _Entity_comp_index.Comp_ID
       _Entity_comp_index.Comp_label
       _Entity_comp_index.Entry_ID
       _Entity_comp_index.Entity_ID

       1 ZN $ZN 1 2 
    stop_

save_


save_ZN
    _Chem_comp.Sf_category  chem_comp
    _Chem_comp.Entry_ID     1
    _Chem_comp.ID           ZN
    _Chem_comp.Type         non-polymer

save_


save_DYANA/DIANA_distance_constraints_2_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  1
    _Distance_constraint_list.Constraint_type     "general distance"
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

        1 1 . . . 1 1 
        2 1 . . . 1 1 
        3 1 . . . 1 1 
        4 1 . . . 1 1 
        5 1 . . . 1 1 
        6 1 . . . 1 1 
        7 1 . . . 1 1 
        8 1 . . . 1 1 
        9 1 . . . 1 1 
       10 1 . . . 1 1 
       11 1 . . . 1 1 
       12 1 . . . 1 1 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

        1 1 1 1 1 15 CYS SG  .  15 CYSS SG  1 1 
        1 1 2 2 2  1 ZN  ZN  . 201 ZN   ZN  1 1 
        2 1 1 1 1 15 CYS CB  .  15 CYSS CB  1 1 
        2 1 2 2 2  1 ZN  ZN  . 201 ZN   ZN  1 1 
        3 1 1 1 1 18 CYS SG  .  18 CYSS SG  1 1 
        3 1 2 2 2  1 ZN  ZN  . 201 ZN   ZN  1 1 
        4 1 1 1 1 18 CYS CB  .  18 CYSS CB  1 1 
        4 1 2 2 2  1 ZN  ZN  . 201 ZN   ZN  1 1 
        5 1 1 1 1 31 HIS NE2 .  31 HIS  NE2 1 1 
        5 1 2 2 2  1 ZN  ZN  . 201 ZN   ZN  1 1 
        6 1 1 1 1 35 HIS NE2 .  35 HIS  NE2 1 1 
        6 1 2 2 2  1 ZN  ZN  . 201 ZN   ZN  1 1 
        7 1 1 1 1 15 CYS SG  .  15 CYSS SG  1 1 
        7 1 2 1 1 18 CYS SG  .  18 CYSS SG  1 1 
        8 1 1 1 1 15 CYS SG  .  15 CYSS SG  1 1 
        8 1 2 1 1 31 HIS NE2 .  31 HIS  NE2 1 1 
        9 1 1 1 1 15 CYS SG  .  15 CYSS SG  1 1 
        9 1 2 1 1 35 HIS NE2 .  35 HIS  NE2 1 1 
       10 1 1 1 1 18 CYS SG  .  18 CYSS SG  1 1 
       10 1 2 1 1 31 HIS NE2 .  31 HIS  NE2 1 1 
       11 1 1 1 1 18 CYS SG  .  18 CYSS SG  1 1 
       11 1 2 1 1 35 HIS NE2 .  35 HIS  NE2 1 1 
       12 1 1 1 1 31 HIS NE2 .  31 HIS  NE2 1 1 
       12 1 2 1 1 35 HIS NE2 .  35 HIS  NE2 1 1 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

        1 1 . . . . . . 2.19 2.39 1 1 
        2 1 . . . . . . 3.25 3.51 1 1 
        3 1 . . . . . . 2.19 2.39 1 1 
        4 1 . . . . . . 3.25 3.51 1 1 
        5 1 . . . . . .  1.9  2.1 1 1 
        6 1 . . . . . .  1.9  2.1 1 1 
        7 1 . . . . . . 3.56 3.96 1 1 
        8 1 . . . . . . 3.32 3.72 1 1 
        9 1 . . . . . . 3.32 3.72 1 1 
       10 1 . . . . . . 3.32 3.72 1 1 
       11 1 . . . . . . 3.32 3.72 1 1 
       12 1 . . . . . .  3.0  3.6 1 1 
    stop_

save_


save_DYANA/DIANA_distance_constraints_5_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  2
    _Distance_constraint_list.Constraint_type     NOE
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

         1 1 . . . 1 2 
         2 1 . . . 1 2 
         3 1 . . . 1 2 
         4 1 . . . 1 2 
         5 1 . . . 1 2 
         6 1 . . . 1 2 
         7 1 . . . 1 2 
         8 1 . . . 1 2 
         9 1 . . . 1 2 
        10 1 . . . 1 2 
        11 1 . . . 1 2 
        12 1 . . . 1 2 
        13 1 . . . 1 2 
        14 1 . . . 1 2 
        15 1 . . . 1 2 
        16 1 . . . 1 2 
        17 1 . . . 1 2 
        18 1 . . . 1 2 
        19 1 . . . 1 2 
        20 1 . . . 1 2 
        21 1 . . . 1 2 
        22 1 . . . 1 2 
        23 1 . . . 1 2 
        24 1 . . . 1 2 
        25 1 . . . 1 2 
        26 1 . . . 1 2 
        27 1 . . . 1 2 
        28 1 . . . 1 2 
        29 1 . . . 1 2 
        30 1 . . . 1 2 
        31 1 . . . 1 2 
        32 1 . . . 1 2 
        33 1 . . . 1 2 
        34 1 . . . 1 2 
        35 1 . . . 1 2 
        36 1 . . . 1 2 
        37 1 . . . 1 2 
        38 1 . . . 1 2 
        39 1 . . . 1 2 
        40 1 . . . 1 2 
        41 1 . . . 1 2 
        42 1 . . . 1 2 
        43 1 . . . 1 2 
        44 1 . . . 1 2 
        45 1 . . . 1 2 
        46 1 . . . 1 2 
        47 1 . . . 1 2 
        48 1 . . . 1 2 
        49 1 . . . 1 2 
        50 1 . . . 1 2 
        51 1 . . . 1 2 
        52 1 . . . 1 2 
        53 1 . . . 1 2 
        54 1 . . . 1 2 
        55 1 . . . 1 2 
        56 1 . . . 1 2 
        57 1 . . . 1 2 
        58 1 . . . 1 2 
        59 1 . . . 1 2 
        60 1 . . . 1 2 
        61 1 . . . 1 2 
        62 1 . . . 1 2 
        63 1 . . . 1 2 
        64 1 . . . 1 2 
        65 1 . . . 1 2 
        66 1 . . . 1 2 
        67 1 . . . 1 2 
        68 1 . . . 1 2 
        69 1 . . . 1 2 
        70 1 . . . 1 2 
        71 1 . . . 1 2 
        72 1 . . . 1 2 
        73 1 . . . 1 2 
        74 1 . . . 1 2 
        75 1 . . . 1 2 
        76 1 . . . 1 2 
        77 1 . . . 1 2 
        78 1 . . . 1 2 
        79 1 . . . 1 2 
        80 1 . . . 1 2 
        81 1 . . . 1 2 
        82 1 . . . 1 2 
        83 1 . . . 1 2 
        84 1 . . . 1 2 
        85 1 . . . 1 2 
        86 1 . . . 1 2 
        87 1 . . . 1 2 
        88 1 . . . 1 2 
        89 1 . . . 1 2 
        90 1 . . . 1 2 
        91 1 . . . 1 2 
        92 1 . . . 1 2 
        93 1 . . . 1 2 
        94 1 . . . 1 2 
        95 1 . . . 1 2 
        96 1 . . . 1 2 
        97 1 . . . 1 2 
        98 1 . . . 1 2 
        99 1 . . . 1 2 
       100 1 . . . 1 2 
       101 1 . . . 1 2 
       102 1 . . . 1 2 
       103 1 . . . 1 2 
       104 1 . . . 1 2 
       105 1 . . . 1 2 
       106 1 . . . 1 2 
       107 1 . . . 1 2 
       108 1 . . . 1 2 
       109 1 . . . 1 2 
       110 1 . . . 1 2 
       111 1 . . . 1 2 
       112 1 . . . 1 2 
       113 1 . . . 1 2 
       114 1 . . . 1 2 
       115 1 . . . 1 2 
       116 1 . . . 1 2 
       117 1 . . . 1 2 
       118 1 . . . 1 2 
       119 1 . . . 1 2 
       120 1 . . . 1 2 
       121 1 . . . 1 2 
       122 1 . . . 1 2 
       123 1 . . . 1 2 
       124 1 . . . 1 2 
       125 1 . . . 1 2 
       126 1 . . . 1 2 
       127 1 . . . 1 2 
       128 1 . . . 1 2 
       129 1 . . . 1 2 
       130 1 . . . 1 2 
       131 1 . . . 1 2 
       132 1 . . . 1 2 
       133 1 . . . 1 2 
       134 1 . . . 1 2 
       135 1 . . . 1 2 
       136 1 . . . 1 2 
       137 1 . . . 1 2 
       138 1 . . . 1 2 
       139 1 . . . 1 2 
       140 1 . . . 1 2 
       141 1 . . . 1 2 
       142 1 . . . 1 2 
       143 1 . . . 1 2 
       144 1 . . . 1 2 
       145 1 . . . 1 2 
       146 1 . . . 1 2 
       147 1 . . . 1 2 
       148 1 . . . 1 2 
       149 1 . . . 1 2 
       150 1 . . . 1 2 
       151 1 . . . 1 2 
       152 1 . . . 1 2 
       153 1 . . . 1 2 
       154 1 . . . 1 2 
       155 1 . . . 1 2 
       156 1 . . . 1 2 
       157 1 . . . 1 2 
       158 1 . . . 1 2 
       159 1 . . . 1 2 
       160 1 . . . 1 2 
       161 1 . . . 1 2 
       162 1 . . . 1 2 
       163 1 . . . 1 2 
       164 1 . . . 1 2 
       165 1 . . . 1 2 
       166 1 . . . 1 2 
       167 1 . . . 1 2 
       168 1 . . . 1 2 
       169 1 . . . 1 2 
       170 1 . . . 1 2 
       171 1 . . . 1 2 
       172 1 . . . 1 2 
       173 1 . . . 1 2 
       174 1 . . . 1 2 
       175 1 . . . 1 2 
       176 1 . . . 1 2 
       177 1 . . . 1 2 
       178 1 . . . 1 2 
       179 1 . . . 1 2 
       180 1 . . . 1 2 
       181 1 . . . 1 2 
       182 1 . . . 1 2 
       183 1 . . . 1 2 
       184 1 . . . 1 2 
       185 1 . . . 1 2 
       186 1 . . . 1 2 
       187 1 . . . 1 2 
       188 1 . . . 1 2 
       189 1 . . . 1 2 
       190 1 . . . 1 2 
       191 1 . . . 1 2 
       192 1 . . . 1 2 
       193 1 . . . 1 2 
       194 1 . . . 1 2 
       195 1 . . . 1 2 
       196 1 . . . 1 2 
       197 1 . . . 1 2 
       198 1 . . . 1 2 
       199 1 . . . 1 2 
       200 1 . . . 1 2 
       201 1 . . . 1 2 
       202 1 . . . 1 2 
       203 1 . . . 1 2 
       204 1 . . . 1 2 
       205 1 . . . 1 2 
       206 1 . . . 1 2 
       207 1 . . . 1 2 
       208 1 . . . 1 2 
       209 1 . . . 1 2 
       210 1 . . . 1 2 
       211 1 . . . 1 2 
       212 1 . . . 1 2 
       213 1 . . . 1 2 
       214 1 . . . 1 2 
       215 1 . . . 1 2 
       216 1 . . . 1 2 
       217 1 . . . 1 2 
       218 1 . . . 1 2 
       219 1 . . . 1 2 
       220 1 . . . 1 2 
       221 1 . . . 1 2 
       222 1 . . . 1 2 
       223 1 . . . 1 2 
       224 1 . . . 1 2 
       225 1 . . . 1 2 
       226 1 . . . 1 2 
       227 1 . . . 1 2 
       228 1 . . . 1 2 
       229 1 . . . 1 2 
       230 1 . . . 1 2 
       231 1 . . . 1 2 
       232 1 . . . 1 2 
       233 1 . . . 1 2 
       234 1 . . . 1 2 
       235 1 . . . 1 2 
       236 1 . . . 1 2 
       237 1 . . . 1 2 
       238 1 . . . 1 2 
       239 1 . . . 1 2 
       240 1 . . . 1 2 
       241 1 . . . 1 2 
       242 1 . . . 1 2 
       243 1 . . . 1 2 
       244 1 . . . 1 2 
       245 1 . . . 1 2 
       246 1 . . . 1 2 
       247 1 . . . 1 2 
       248 1 . . . 1 2 
       249 1 . . . 1 2 
       250 1 . . . 1 2 
       251 1 . . . 1 2 
       252 1 . . . 1 2 
       253 1 . . . 1 2 
       254 1 . . . 1 2 
       255 1 . . . 1 2 
       256 1 . . . 1 2 
       257 1 . . . 1 2 
       258 1 . . . 1 2 
       259 1 . . . 1 2 
       260 1 . . . 1 2 
       261 1 . . . 1 2 
       262 1 . . . 1 2 
       263 1 . . . 1 2 
       264 1 . . . 1 2 
       265 1 . . . 1 2 
       266 1 . . . 1 2 
       267 1 . . . 1 2 
       268 1 . . . 1 2 
       269 1 . . . 1 2 
       270 1 . . . 1 2 
       271 1 . . . 1 2 
       272 1 . . . 1 2 
       273 1 . . . 1 2 
       274 1 . . . 1 2 
       275 1 . . . 1 2 
       276 1 . . . 1 2 
       277 1 . . . 1 2 
       278 1 . . . 1 2 
       279 1 . . . 1 2 
       280 1 . . . 1 2 
       281 1 . . . 1 2 
       282 1 . . . 1 2 
       283 1 . . . 1 2 
       284 1 . . . 1 2 
       285 1 . . . 1 2 
       286 1 . . . 1 2 
       287 1 . . . 1 2 
       288 1 . . . 1 2 
       289 1 . . . 1 2 
       290 1 . . . 1 2 
       291 1 . . . 1 2 
       292 1 . . . 1 2 
       293 1 . . . 1 2 
       294 1 . . . 1 2 
       295 1 . . . 1 2 
       296 1 . . . 1 2 
       297 1 . . . 1 2 
       298 1 . . . 1 2 
       299 1 . . . 1 2 
       300 1 . . . 1 2 
       301 1 . . . 1 2 
       302 1 . . . 1 2 
       303 1 . . . 1 2 
       304 1 . . . 1 2 
       305 1 . . . 1 2 
       306 1 . . . 1 2 
       307 1 . . . 1 2 
       308 1 . . . 1 2 
       309 1 . . . 1 2 
       310 1 . . . 1 2 
       311 1 . . . 1 2 
       312 1 . . . 1 2 
       313 1 . . . 1 2 
       314 1 . . . 1 2 
       315 1 . . . 1 2 
       316 1 . . . 1 2 
       317 1 . . . 1 2 
       318 1 . . . 1 2 
       319 1 . . . 1 2 
       320 1 . . . 1 2 
       321 1 . . . 1 2 
       322 1 . . . 1 2 
       323 1 . . . 1 2 
       324 1 . . . 1 2 
       325 1 . . . 1 2 
       326 1 . . . 1 2 
       327 1 . . . 1 2 
       328 1 . . . 1 2 
       329 1 . . . 1 2 
       330 1 . . . 1 2 
       331 1 . . . 1 2 
       332 1 . . . 1 2 
       333 1 . . . 1 2 
       334 1 . . . 1 2 
       335 1 . . . 1 2 
       336 1 . . . 1 2 
       337 1 . . . 1 2 
       338 1 . . . 1 2 
       339 1 . . . 1 2 
       340 1 . . . 1 2 
       341 1 . . . 1 2 
       342 1 . . . 1 2 
       343 1 . . . 1 2 
       344 1 . . . 1 2 
       345 1 . . . 1 2 
       346 1 . . . 1 2 
       347 1 . . . 1 2 
       348 1 . . . 1 2 
       349 1 . . . 1 2 
       350 1 . . . 1 2 
       351 1 . . . 1 2 
       352 1 . . . 1 2 
       353 1 . . . 1 2 
       354 1 . . . 1 2 
       355 1 . . . 1 2 
       356 1 . . . 1 2 
       357 1 . . . 1 2 
       358 1 . . . 1 2 
       359 1 . . . 1 2 
       360 1 . . . 1 2 
       361 1 . . . 1 2 
       362 1 . . . 1 2 
       363 1 . . . 1 2 
       364 1 . . . 1 2 
       365 1 . . . 1 2 
       366 1 . . . 1 2 
       367 1 . . . 1 2 
       368 1 . . . 1 2 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

         1 1 1 1 1 42 GLY H    . 42 GLY  HN   1 2 
         1 1 2 1 1 43 PRO HA   . 43 PRO  HA   1 2 
         2 1 1 1 1 29 ALA H    . 29 ALA  HN   1 2 
         2 1 2 1 1 30 ILE H    . 30 ILE  HN   1 2 
         3 1 1 1 1 26 SER HA   . 26 SER  HA   1 2 
         3 1 2 1 1 29 ALA H    . 29 ALA  HN   1 2 
         4 1 1 1 1 26 SER QB   . 26 SER  QB   1 2 
         4 1 2 1 1 29 ALA H    . 29 ALA  HN   1 2 
         5 1 1 1 1 29 ALA H    . 29 ALA  HN   1 2 
         5 1 2 1 1 32 GLN HB2  . 32 GLN  HB2  1 2 
         6 1 1 1 1 28 LEU HB3  . 28 LEU  HB3  1 2 
         6 1 2 1 1 29 ALA H    . 29 ALA  HN   1 2 
         7 1 1 1 1 29 ALA H    . 29 ALA  HN   1 2 
         7 1 2 1 1 29 ALA MB   . 29 ALA  QB   1 2 
         8 1 1 1 1 28 LEU HB2  . 28 LEU  HB2  1 2 
         8 1 2 1 1 29 ALA H    . 29 ALA  HN   1 2 
         9 1 1 1 1 29 ALA H    . 29 ALA  HN   1 2 
         9 1 2 1 1 32 GLN H    . 32 GLN  HN   1 2 
        10 1 1 1 1 27 SER H    . 27 SER  HN   1 2 
        10 1 2 1 1 29 ALA H    . 29 ALA  HN   1 2 
        11 1 1 1 1 29 ALA H    . 29 ALA  HN   1 2 
        11 1 2 1 1 30 ILE HA   . 30 ILE  HA   1 2 
        12 1 1 1 1 29 ALA H    . 29 ALA  HN   1 2 
        12 1 2 1 1 32 GLN QG   . 32 GLN  QG   1 2 
        13 1 1 1 1 29 ALA H    . 29 ALA  HN   1 2 
        13 1 2 1 1 30 ILE HB   . 30 ILE  HB   1 2 
        14 1 1 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
        14 1 2 1 1 29 ALA H    . 29 ALA  HN   1 2 
        15 1 1 1 1 16 ASN H    . 16 ASN  HN   1 2 
        15 1 2 1 1 17 GLU H    . 17 GLU  HN   1 2 
        16 1 1 1 1 16 ASN HD21 . 16 ASN  HD21 1 2 
        16 1 2 1 1 17 GLU H    . 17 GLU  HN   1 2 
        17 1 1 1 1 16 ASN HD22 . 16 ASN  HD22 1 2 
        17 1 2 1 1 17 GLU H    . 17 GLU  HN   1 2 
        18 1 1 1 1 17 GLU H    . 17 GLU  HN   1 2 
        18 1 2 1 1 18 CYS HA   . 18 CYSS HA   1 2 
        19 1 1 1 1 15 CYS HB3  . 15 CYSS HB3  1 2 
        19 1 2 1 1 17 GLU H    . 17 GLU  HN   1 2 
        20 1 1 1 1 17 GLU H    . 17 GLU  HN   1 2 
        20 1 2 1 1 17 GLU HG2  . 17 GLU  HG2  1 2 
        21 1 1 1 1 15 CYS HA   . 15 CYSS HA   1 2 
        21 1 2 1 1 17 GLU H    . 17 GLU  HN   1 2 
        22 1 1 1 1 17 GLU H    . 17 GLU  HN   1 2 
        22 1 2 1 1 19 GLY HA2  . 19 GLY  HA1  1 2 
        23 1 1 1 1 16 ASN QB   . 16 ASN  QB   1 2 
        23 1 2 1 1 17 GLU H    . 17 GLU  HN   1 2 
        24 1 1 1 1 17 GLU H    . 17 GLU  HN   1 2 
        24 1 2 1 1 17 GLU HG3  . 17 GLU  HG3  1 2 
        25 1 1 1 1 17 GLU H    . 17 GLU  HN   1 2 
        25 1 2 1 1 17 GLU HB2  . 17 GLU  HB2  1 2 
        26 1 1 1 1 38 GLU HG2  . 38 GLU  HG2  1 2 
        26 1 2 1 1 39 LYS H    . 39 LYS  HN   1 2 
        27 1 1 1 1 38 GLU HG3  . 38 GLU  HG3  1 2 
        27 1 2 1 1 39 LYS H    . 39 LYS  HN   1 2 
        28 1 1 1 1 38 GLU HA   . 38 GLU  HA   1 2 
        28 1 2 1 1 39 LYS H    . 39 LYS  HN   1 2 
        29 1 1 1 1 39 LYS H    . 39 LYS  HN   1 2 
        29 1 2 1 1 40 PRO QD   . 40 PRO  QD   1 2 
        30 1 1 1 1 39 LYS H    . 39 LYS  HN   1 2 
        30 1 2 1 1 39 LYS HB2  . 39 LYS  HB2  1 2 
        31 1 1 1 1 39 LYS H    . 39 LYS  HN   1 2 
        31 1 2 1 1 39 LYS HB3  . 39 LYS  HB3  1 2 
        32 1 1 1 1 39 LYS H    . 39 LYS  HN   1 2 
        32 1 2 1 1 39 LYS HG2  . 39 LYS  HG2  1 2 
        33 1 1 1 1 39 LYS H    . 39 LYS  HN   1 2 
        33 1 2 1 1 39 LYS HG3  . 39 LYS  HG3  1 2 
        34 1 1 1 1 32 GLN H    . 32 GLN  HN   1 2 
        34 1 2 1 1 35 HIS HD2  . 35 HIS  HD2  1 2 
        35 1 1 1 1 28 LEU HA   . 28 LEU  HA   1 2 
        35 1 2 1 1 32 GLN H    . 32 GLN  HN   1 2 
        36 1 1 1 1 32 GLN QG   . 32 GLN  QG   1 2 
        36 1 2 1 1 33 ALA H    . 33 ALA  HN   1 2 
        37 1 1 1 1 32 GLN H    . 32 GLN  HN   1 2 
        37 1 2 1 1 33 ALA H    . 33 ALA  HN   1 2 
        38 1 1 1 1 10 GLU H    . 10 GLU  HN   1 2 
        38 1 2 1 1 11 LYS H    . 11 LYS  HN   1 2 
        39 1 1 1 1 32 GLN H    . 32 GLN  HN   1 2 
        39 1 2 1 1 32 GLN HE21 . 32 GLN  HE21 1 2 
        40 1 1 1 1 33 ALA H    . 33 ALA  HN   1 2 
        40 1 2 1 1 34 THR H    . 34 THR  HN   1 2 
        41 1 1 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
        41 1 2 1 1 32 GLN H    . 32 GLN  HN   1 2 
        42 1 1 1 1 29 ALA HA   . 29 ALA  HA   1 2 
        42 1 2 1 1 32 GLN H    . 32 GLN  HN   1 2 
        43 1 1 1 1  9 GLY QA   .  9 GLY  QA   1 2 
        43 1 2 1 1 10 GLU H    . 10 GLU  HN   1 2 
        44 1 1 1 1 34 THR H    . 34 THR  HN   1 2 
        44 1 2 1 1 35 HIS HB3  . 35 HIS  HB3  1 2 
        45 1 1 1 1 31 HIS HB3  . 31 HIS  HB3  1 2 
        45 1 2 1 1 32 GLN H    . 32 GLN  HN   1 2 
        46 1 1 1 1 31 HIS HB3  . 31 HIS  HB3  1 2 
        46 1 2 1 1 33 ALA H    . 33 ALA  HN   1 2 
        47 1 1 1 1 32 GLN H    . 32 GLN  HN   1 2 
        47 1 2 1 1 32 GLN QG   . 32 GLN  QG   1 2 
        48 1 1 1 1 32 GLN H    . 32 GLN  HN   1 2 
        48 1 2 1 1 32 GLN HB2  . 32 GLN  HB2  1 2 
        49 1 1 1 1 32 GLN HB2  . 32 GLN  HB2  1 2 
        49 1 2 1 1 33 ALA H    . 33 ALA  HN   1 2 
        50 1 1 1 1 32 GLN H    . 32 GLN  HN   1 2 
        50 1 2 1 1 32 GLN HB3  . 32 GLN  HB3  1 2 
        51 1 1 1 1 32 GLN HB3  . 32 GLN  HB3  1 2 
        51 1 2 1 1 33 ALA H    . 33 ALA  HN   1 2 
        52 1 1 1 1 30 ILE HB   . 30 ILE  HB   1 2 
        52 1 2 1 1 32 GLN H    . 32 GLN  HN   1 2 
        53 1 1 1 1 33 ALA H    . 33 ALA  HN   1 2 
        53 1 2 1 1 33 ALA MB   . 33 ALA  QB   1 2 
        54 1 1 1 1 28 LEU HG   . 28 LEU  HG   1 2 
        54 1 2 1 1 32 GLN H    . 32 GLN  HN   1 2 
        55 1 1 1 1 32 GLN H    . 32 GLN  HN   1 2 
        55 1 2 1 1 33 ALA MB   . 33 ALA  QB   1 2 
        56 1 1 1 1 32 GLN H    . 32 GLN  HN   1 2 
        56 1 2 1 1 34 THR MG   . 34 THR  QG2  1 2 
        57 1 1 1 1 33 ALA H    . 33 ALA  HN   1 2 
        57 1 2 1 1 34 THR MG   . 34 THR  QG2  1 2 
        58 1 1 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
        58 1 2 1 1 32 GLN H    . 32 GLN  HN   1 2 
        59 1 1 1 1 30 ILE MG   . 30 ILE  QG2  1 2 
        59 1 2 1 1 33 ALA H    . 33 ALA  HN   1 2 
        60 1 1 1 1 32 GLN H    . 32 GLN  HN   1 2 
        60 1 2 1 1 34 THR H    . 34 THR  HN   1 2 
        61 1 1 1 1 34 THR H    . 34 THR  HN   1 2 
        61 1 2 1 1 35 HIS H    . 35 HIS  HN   1 2 
        62 1 1 1 1 34 THR H    . 34 THR  HN   1 2 
        62 1 2 1 1 35 HIS HD2  . 35 HIS  HD2  1 2 
        63 1 1 1 1 32 GLN HA   . 32 GLN  HA   1 2 
        63 1 2 1 1 34 THR H    . 34 THR  HN   1 2 
        64 1 1 1 1 34 THR H    . 34 THR  HN   1 2 
        64 1 2 1 1 35 HIS HB2  . 35 HIS  HB2  1 2 
        65 1 1 1 1 32 GLN HB2  . 32 GLN  HB2  1 2 
        65 1 2 1 1 34 THR H    . 34 THR  HN   1 2 
        66 1 1 1 1 32 GLN HB3  . 32 GLN  HB3  1 2 
        66 1 2 1 1 34 THR H    . 34 THR  HN   1 2 
        67 1 1 1 1 33 ALA MB   . 33 ALA  QB   1 2 
        67 1 2 1 1 34 THR H    . 34 THR  HN   1 2 
        68 1 1 1 1 34 THR H    . 34 THR  HN   1 2 
        68 1 2 1 1 34 THR MG   . 34 THR  QG2  1 2 
        69 1 1 1 1 38 GLU H    . 38 GLU  HN   1 2 
        69 1 2 1 1 38 GLU HG2  . 38 GLU  HG2  1 2 
        70 1 1 1 1 38 GLU H    . 38 GLU  HN   1 2 
        70 1 2 1 1 38 GLU HG3  . 38 GLU  HG3  1 2 
        71 1 1 1 1 38 GLU H    . 38 GLU  HN   1 2 
        71 1 2 1 1 38 GLU HB2  . 38 GLU  HB2  1 2 
        72 1 1 1 1 31 HIS H    . 31 HIS  HN   1 2 
        72 1 2 1 1 32 GLN H    . 32 GLN  HN   1 2 
        73 1 1 1 1 22 PHE QE   . 22 PHE  QE   1 2 
        73 1 2 1 1 31 HIS H    . 31 HIS  HN   1 2 
        74 1 1 1 1 31 HIS H    . 31 HIS  HN   1 2 
        74 1 2 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
        75 1 1 1 1 22 PHE HZ   . 22 PHE  HZ   1 2 
        75 1 2 1 1 31 HIS H    . 31 HIS  HN   1 2 
        76 1 1 1 1 28 LEU HA   . 28 LEU  HA   1 2 
        76 1 2 1 1 31 HIS H    . 31 HIS  HN   1 2 
        77 1 1 1 1 31 HIS H    . 31 HIS  HN   1 2 
        77 1 2 1 1 31 HIS HB3  . 31 HIS  HB3  1 2 
        78 1 1 1 1 31 HIS H    . 31 HIS  HN   1 2 
        78 1 2 1 1 31 HIS HB2  . 31 HIS  HB2  1 2 
        79 1 1 1 1 31 HIS H    . 31 HIS  HN   1 2 
        79 1 2 1 1 32 GLN HB2  . 32 GLN  HB2  1 2 
        80 1 1 1 1 30 ILE HB   . 30 ILE  HB   1 2 
        80 1 2 1 1 31 HIS H    . 31 HIS  HN   1 2 
        81 1 1 1 1 30 ILE H    . 30 ILE  HN   1 2 
        81 1 2 1 1 30 ILE MG   . 30 ILE  QG2  1 2 
        82 1 1 1 1 30 ILE MG   . 30 ILE  QG2  1 2 
        82 1 2 1 1 31 HIS H    . 31 HIS  HN   1 2 
        83 1 1 1 1 31 HIS H    . 31 HIS  HN   1 2 
        83 1 2 1 1 33 ALA H    . 33 ALA  HN   1 2 
        84 1 1 1 1 32 GLN H    . 32 GLN  HN   1 2 
        84 1 2 1 1 35 HIS H    . 35 HIS  HN   1 2 
        85 1 1 1 1 35 HIS H    . 35 HIS  HN   1 2 
        85 1 2 1 1 35 HIS HD2  . 35 HIS  HD2  1 2 
        86 1 1 1 1 32 GLN HA   . 32 GLN  HA   1 2 
        86 1 2 1 1 35 HIS H    . 35 HIS  HN   1 2 
        87 1 1 1 1 35 HIS H    . 35 HIS  HN   1 2 
        87 1 2 1 1 35 HIS HB3  . 35 HIS  HB3  1 2 
        88 1 1 1 1 35 HIS H    . 35 HIS  HN   1 2 
        88 1 2 1 1 35 HIS HB2  . 35 HIS  HB2  1 2 
        89 1 1 1 1 30 ILE H    . 30 ILE  HN   1 2 
        89 1 2 1 1 30 ILE HB   . 30 ILE  HB   1 2 
        90 1 1 1 1 30 ILE H    . 30 ILE  HN   1 2 
        90 1 2 1 1 30 ILE HG13 . 30 ILE  HG13 1 2 
        91 1 1 1 1 33 ALA MB   . 33 ALA  QB   1 2 
        91 1 2 1 1 35 HIS H    . 35 HIS  HN   1 2 
        92 1 1 1 1 29 ALA MB   . 29 ALA  QB   1 2 
        92 1 2 1 1 30 ILE H    . 30 ILE  HN   1 2 
        93 1 1 1 1 34 THR MG   . 34 THR  QG2  1 2 
        93 1 2 1 1 35 HIS H    . 35 HIS  HN   1 2 
        94 1 1 1 1 30 ILE H    . 30 ILE  HN   1 2 
        94 1 2 1 1 30 ILE HG12 . 30 ILE  HG12 1 2 
        95 1 1 1 1 24 ALA H    . 24 ALA  HN   1 2 
        95 1 2 1 1 27 SER HA   . 27 SER  HA   1 2 
        96 1 1 1 1 13 TYR H    . 13 TYR  HN   1 2 
        96 1 2 1 1 22 PHE H    . 22 PHE  HN   1 2 
        97 1 1 1 1 13 TYR H    . 13 TYR  HN   1 2 
        97 1 2 1 1 14 LYS H    . 14 LYS  HN   1 2 
        98 1 1 1 1 22 PHE QD   . 22 PHE  QD   1 2 
        98 1 2 1 1 24 ALA H    . 24 ALA  HN   1 2 
        99 1 1 1 1 13 TYR H    . 13 TYR  HN   1 2 
        99 1 2 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       100 1 1 1 1 13 TYR H    . 13 TYR  HN   1 2 
       100 1 2 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       101 1 1 1 1 24 ALA H    . 24 ALA  HN   1 2 
       101 1 2 1 1 27 SER H    . 27 SER  HN   1 2 
       102 1 1 1 1 13 TYR H    . 13 TYR  HN   1 2 
       102 1 2 1 1 21 ALA HA   . 21 ALA  HA   1 2 
       103 1 1 1 1 13 TYR H    . 13 TYR  HN   1 2 
       103 1 2 1 1 14 LYS HA   . 14 LYS  HA   1 2 
       104 1 1 1 1 24 ALA H    . 24 ALA  HN   1 2 
       104 1 2 1 1 27 SER HB2  . 27 SER  HB2  1 2 
       105 1 1 1 1 24 ALA H    . 24 ALA  HN   1 2 
       105 1 2 1 1 27 SER HB3  . 27 SER  HB3  1 2 
       106 1 1 1 1 12 PRO QD   . 12 PRO  QD   1 2 
       106 1 2 1 1 13 TYR H    . 13 TYR  HN   1 2 
       107 1 1 1 1 22 PHE HB3  . 22 PHE  HB3  1 2 
       107 1 2 1 1 24 ALA H    . 24 ALA  HN   1 2 
       108 1 1 1 1 13 TYR H    . 13 TYR  HN   1 2 
       108 1 2 1 1 13 TYR HB3  . 13 TYR  HB3  1 2 
       109 1 1 1 1 13 TYR H    . 13 TYR  HN   1 2 
       109 1 2 1 1 13 TYR HB2  . 13 TYR  HB2  1 2 
       110 1 1 1 1 22 PHE HB2  . 22 PHE  HB2  1 2 
       110 1 2 1 1 24 ALA H    . 24 ALA  HN   1 2 
       111 1 1 1 1 23 ARG HB3  . 23 ARG  HB3  1 2 
       111 1 2 1 1 24 ALA H    . 24 ALA  HN   1 2 
       112 1 1 1 1 12 PRO HB3  . 12 PRO  HB3  1 2 
       112 1 2 1 1 13 TYR H    . 13 TYR  HN   1 2 
       113 1 1 1 1 23 ARG QG   . 23 ARG  QG   1 2 
       113 1 2 1 1 24 ALA H    . 24 ALA  HN   1 2 
       114 1 1 1 1 24 ALA H    . 24 ALA  HN   1 2 
       114 1 2 1 1 24 ALA MB   . 24 ALA  QB   1 2 
       115 1 1 1 1 12 PRO HB2  . 12 PRO  HB2  1 2 
       115 1 2 1 1 13 TYR H    . 13 TYR  HN   1 2 
       116 1 1 1 1 22 PHE H    . 22 PHE  HN   1 2 
       116 1 2 1 1 24 ALA H    . 24 ALA  HN   1 2 
       117 1 1 1 1 13 TYR H    . 13 TYR  HN   1 2 
       117 1 2 1 1 23 ARG HA   . 23 ARG  HA   1 2 
       118 1 1 1 1 24 ALA H    . 24 ALA  HN   1 2 
       118 1 2 1 1 28 LEU HB2  . 28 LEU  HB2  1 2 
       119 1 1 1 1 26 SER QB   . 26 SER  QB   1 2 
       119 1 2 1 1 27 SER H    . 27 SER  HN   1 2 
       120 1 1 1 1 22 PHE HB3  . 22 PHE  HB3  1 2 
       120 1 2 1 1 27 SER H    . 27 SER  HN   1 2 
       121 1 1 1 1 25 ARG HA   . 25 ARG  HA   1 2 
       121 1 2 1 1 27 SER H    . 27 SER  HN   1 2 
       122 1 1 1 1 27 SER H    . 27 SER  HN   1 2 
       122 1 2 1 1 28 LEU HB3  . 28 LEU  HB3  1 2 
       123 1 1 1 1 24 ALA MB   . 24 ALA  QB   1 2 
       123 1 2 1 1 27 SER H    . 27 SER  HN   1 2 
       124 1 1 1 1 27 SER H    . 27 SER  HN   1 2 
       124 1 2 1 1 28 LEU HB2  . 28 LEU  HB2  1 2 
       125 1 1 1 1 22 PHE H    . 22 PHE  HN   1 2 
       125 1 2 1 1 23 ARG HA   . 23 ARG  HA   1 2 
       126 1 1 1 1 22 PHE H    . 22 PHE  HN   1 2 
       126 1 2 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       127 1 1 1 1 22 PHE H    . 22 PHE  HN   1 2 
       127 1 2 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       128 1 1 1 1 21 ALA HA   . 21 ALA  HA   1 2 
       128 1 2 1 1 22 PHE H    . 22 PHE  HN   1 2 
       129 1 1 1 1 14 LYS HA   . 14 LYS  HA   1 2 
       129 1 2 1 1 22 PHE H    . 22 PHE  HN   1 2 
       130 1 1 1 1 22 PHE H    . 22 PHE  HN   1 2 
       130 1 2 1 1 22 PHE HB3  . 22 PHE  HB3  1 2 
       131 1 1 1 1 13 TYR HB3  . 13 TYR  HB3  1 2 
       131 1 2 1 1 22 PHE H    . 22 PHE  HN   1 2 
       132 1 1 1 1 22 PHE H    . 22 PHE  HN   1 2 
       132 1 2 1 1 22 PHE HB2  . 22 PHE  HB2  1 2 
       133 1 1 1 1 21 ALA MB   . 21 ALA  QB   1 2 
       133 1 2 1 1 22 PHE H    . 22 PHE  HN   1 2 
       134 1 1 1 1 22 PHE H    . 22 PHE  HN   1 2 
       134 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       135 1 1 1 1 12 PRO QD   . 12 PRO  QD   1 2 
       135 1 2 1 1 22 PHE H    . 22 PHE  HN   1 2 
       136 1 1 1 1 35 HIS HB2  . 35 HIS  HB2  1 2 
       136 1 2 1 1 36 SER H    . 36 SER  HN   1 2 
       137 1 1 1 1 35 HIS H    . 35 HIS  HN   1 2 
       137 1 2 1 1 36 SER H    . 36 SER  HN   1 2 
       138 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
       138 1 2 1 1 18 CYS H    . 18 CYSS HN   1 2 
       139 1 1 1 1 17 GLU H    . 17 GLU  HN   1 2 
       139 1 2 1 1 18 CYS H    . 18 CYSS HN   1 2 
       140 1 1 1 1 18 CYS H    . 18 CYSS HN   1 2 
       140 1 2 1 1 19 GLY H    . 19 GLY  HN   1 2 
       141 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
       141 1 2 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       142 1 1 1 1 15 CYS HA   . 15 CYSS HA   1 2 
       142 1 2 1 1 18 CYS H    . 18 CYSS HN   1 2 
       143 1 1 1 1 16 ASN HA   . 16 ASN  HA   1 2 
       143 1 2 1 1 18 CYS H    . 18 CYSS HN   1 2 
       144 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
       144 1 2 1 1 19 GLY HA2  . 19 GLY  HA1  1 2 
       145 1 1 1 1 18 CYS H    . 18 CYSS HN   1 2 
       145 1 2 1 1 19 GLY HA2  . 19 GLY  HA1  1 2 
       146 1 1 1 1 15 CYS HB3  . 15 CYSS HB3  1 2 
       146 1 2 1 1 18 CYS H    . 18 CYSS HN   1 2 
       147 1 1 1 1 18 CYS H    . 18 CYSS HN   1 2 
       147 1 2 1 1 18 CYS HB3  . 18 CYSS HB3  1 2 
       148 1 1 1 1 18 CYS H    . 18 CYSS HN   1 2 
       148 1 2 1 1 18 CYS HB2  . 18 CYSS HB2  1 2 
       149 1 1 1 1 17 GLU HG2  . 17 GLU  HG2  1 2 
       149 1 2 1 1 18 CYS H    . 18 CYSS HN   1 2 
       150 1 1 1 1 17 GLU HG3  . 17 GLU  HG3  1 2 
       150 1 2 1 1 18 CYS H    . 18 CYSS HN   1 2 
       151 1 1 1 1 17 GLU HB2  . 17 GLU  HB2  1 2 
       151 1 2 1 1 18 CYS H    . 18 CYSS HN   1 2 
       152 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
       152 1 2 1 1 22 PHE H    . 22 PHE  HN   1 2 
       153 1 1 1 1 14 LYS H    . 14 LYS  HN   1 2 
       153 1 2 1 1 15 CYS H    . 15 CYSS HN   1 2 
       154 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
       154 1 2 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       155 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
       155 1 2 1 1 21 ALA HA   . 21 ALA  HA   1 2 
       156 1 1 1 1 14 LYS HA   . 14 LYS  HA   1 2 
       156 1 2 1 1 15 CYS H    . 15 CYSS HN   1 2 
       157 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
       157 1 2 1 1 15 CYS HB3  . 15 CYSS HB3  1 2 
       158 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
       158 1 2 1 1 15 CYS HB2  . 15 CYSS HB2  1 2 
       159 1 1 1 1 14 LYS HB2  . 14 LYS  HB2  1 2 
       159 1 2 1 1 15 CYS H    . 15 CYSS HN   1 2 
       160 1 1 1 1 14 LYS HB3  . 14 LYS  HB3  1 2 
       160 1 2 1 1 15 CYS H    . 15 CYSS HN   1 2 
       161 1 1 1 1 14 LYS QG   . 14 LYS  QG   1 2 
       161 1 2 1 1 15 CYS H    . 15 CYSS HN   1 2 
       162 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
       162 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       163 1 1 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       163 1 2 1 1 14 LYS H    . 14 LYS  HN   1 2 
       164 1 1 1 1 14 LYS H    . 14 LYS  HN   1 2 
       164 1 2 1 1 21 ALA HA   . 21 ALA  HA   1 2 
       165 1 1 1 1 13 TYR HA   . 13 TYR  HA   1 2 
       165 1 2 1 1 14 LYS H    . 14 LYS  HN   1 2 
       166 1 1 1 1 13 TYR HB3  . 13 TYR  HB3  1 2 
       166 1 2 1 1 14 LYS H    . 14 LYS  HN   1 2 
       167 1 1 1 1 13 TYR HB2  . 13 TYR  HB2  1 2 
       167 1 2 1 1 14 LYS H    . 14 LYS  HN   1 2 
       168 1 1 1 1 14 LYS H    . 14 LYS  HN   1 2 
       168 1 2 1 1 14 LYS QG   . 14 LYS  QG   1 2 
       169 1 1 1 1 14 LYS H    . 14 LYS  HN   1 2 
       169 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       170 1 1 1 1 14 LYS H    . 14 LYS  HN   1 2 
       170 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       171 1 1 1 1 15 CYS HA   . 15 CYSS HA   1 2 
       171 1 2 1 1 19 GLY H    . 19 GLY  HN   1 2 
       172 1 1 1 1 16 ASN HA   . 16 ASN  HA   1 2 
       172 1 2 1 1 19 GLY H    . 19 GLY  HN   1 2 
       173 1 1 1 1 15 CYS HB2  . 15 CYSS HB2  1 2 
       173 1 2 1 1 19 GLY H    . 19 GLY  HN   1 2 
       174 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
       174 1 2 1 1 19 GLY H    . 19 GLY  HN   1 2 
       175 1 1 1 1 17 GLU H    . 17 GLU  HN   1 2 
       175 1 2 1 1 19 GLY H    . 19 GLY  HN   1 2 
       176 1 1 1 1 15 CYS HB3  . 15 CYSS HB3  1 2 
       176 1 2 1 1 19 GLY H    . 19 GLY  HN   1 2 
       177 1 1 1 1 24 ALA MB   . 24 ALA  QB   1 2 
       177 1 2 1 1 25 ARG H    . 25 ARG  HN   1 2 
       178 1 1 1 1 17 GLU HB2  . 17 GLU  HB2  1 2 
       178 1 2 1 1 19 GLY H    . 19 GLY  HN   1 2 
       179 1 1 1 1 19 GLY H    . 19 GLY  HN   1 2 
       179 1 2 1 1 20 LYS HB2  . 20 LYS  HB2  1 2 
       180 1 1 1 1 14 LYS QG   . 14 LYS  QG   1 2 
       180 1 2 1 1 19 GLY H    . 19 GLY  HN   1 2 
       181 1 1 1 1 19 GLY H    . 19 GLY  HN   1 2 
       181 1 2 1 1 20 LYS HB3  . 20 LYS  HB3  1 2 
       182 1 1 1 1 15 CYS HA   . 15 CYSS HA   1 2 
       182 1 2 1 1 32 GLN HE21 . 32 GLN  HE21 1 2 
       183 1 1 1 1 32 GLN HE22 . 32 GLN  HE22 1 2 
       183 1 2 1 1 32 GLN QG   . 32 GLN  QG   1 2 
       184 1 1 1 1 28 LEU HG   . 28 LEU  HG   1 2 
       184 1 2 1 1 32 GLN HE21 . 32 GLN  HE21 1 2 
       185 1 1 1 1 28 LEU HG   . 28 LEU  HG   1 2 
       185 1 2 1 1 32 GLN HE22 . 32 GLN  HE22 1 2 
       186 1 1 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       186 1 2 1 1 32 GLN HE21 . 32 GLN  HE21 1 2 
       187 1 1 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       187 1 2 1 1 32 GLN HE21 . 32 GLN  HE21 1 2 
       188 1 1 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       188 1 2 1 1 32 GLN HE22 . 32 GLN  HE22 1 2 
       189 1 1 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       189 1 2 1 1 32 GLN HE22 . 32 GLN  HE22 1 2 
       190 1 1 1 1 15 CYS HA   . 15 CYSS HA   1 2 
       190 1 2 1 1 32 GLN HE22 . 32 GLN  HE22 1 2 
       191 1 1 1 1 32 GLN HA   . 32 GLN  HA   1 2 
       191 1 2 1 1 32 GLN HE21 . 32 GLN  HE21 1 2 
       192 1 1 1 1 28 LEU HB3  . 28 LEU  HB3  1 2 
       192 1 2 1 1 32 GLN HE21 . 32 GLN  HE21 1 2 
       193 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
       193 1 2 1 1 21 ALA H    . 21 ALA  HN   1 2 
       194 1 1 1 1 21 ALA H    . 21 ALA  HN   1 2 
       194 1 2 1 1 22 PHE H    . 22 PHE  HN   1 2 
       195 1 1 1 1 20 LYS H    . 20 LYS  HN   1 2 
       195 1 2 1 1 21 ALA H    . 21 ALA  HN   1 2 
       196 1 1 1 1 20 LYS HA   . 20 LYS  HA   1 2 
       196 1 2 1 1 21 ALA H    . 21 ALA  HN   1 2 
       197 1 1 1 1 20 LYS QD   . 20 LYS  QD   1 2 
       197 1 2 1 1 21 ALA H    . 21 ALA  HN   1 2 
       198 1 1 1 1 21 ALA H    . 21 ALA  HN   1 2 
       198 1 2 1 1 21 ALA MB   . 21 ALA  QB   1 2 
       199 1 1 1 1 10 GLU HA   . 10 GLU  HA   1 2 
       199 1 2 1 1 11 LYS H    . 11 LYS  HN   1 2 
       200 1 1 1 1 11 LYS H    . 11 LYS  HN   1 2 
       200 1 2 1 1 11 LYS QG   . 11 LYS  QG   1 2 
       201 1 1 1 1 28 LEU H    . 28 LEU  HN   1 2 
       201 1 2 1 1 29 ALA H    . 29 ALA  HN   1 2 
       202 1 1 1 1 24 ALA H    . 24 ALA  HN   1 2 
       202 1 2 1 1 28 LEU H    . 28 LEU  HN   1 2 
       203 1 1 1 1 28 LEU H    . 28 LEU  HN   1 2 
       203 1 2 1 1 30 ILE H    . 30 ILE  HN   1 2 
       204 1 1 1 1 27 SER H    . 27 SER  HN   1 2 
       204 1 2 1 1 28 LEU H    . 28 LEU  HN   1 2 
       205 1 1 1 1 27 SER HB2  . 27 SER  HB2  1 2 
       205 1 2 1 1 28 LEU H    . 28 LEU  HN   1 2 
       206 1 1 1 1 27 SER HB3  . 27 SER  HB3  1 2 
       206 1 2 1 1 28 LEU H    . 28 LEU  HN   1 2 
       207 1 1 1 1 22 PHE HB3  . 22 PHE  HB3  1 2 
       207 1 2 1 1 28 LEU H    . 28 LEU  HN   1 2 
       208 1 1 1 1 22 PHE HB2  . 22 PHE  HB2  1 2 
       208 1 2 1 1 28 LEU H    . 28 LEU  HN   1 2 
       209 1 1 1 1 28 LEU H    . 28 LEU  HN   1 2 
       209 1 2 1 1 28 LEU HB3  . 28 LEU  HB3  1 2 
       210 1 1 1 1 24 ALA MB   . 24 ALA  QB   1 2 
       210 1 2 1 1 28 LEU H    . 28 LEU  HN   1 2 
       211 1 1 1 1 28 LEU H    . 28 LEU  HN   1 2 
       211 1 2 1 1 28 LEU HG   . 28 LEU  HG   1 2 
       212 1 1 1 1 28 LEU H    . 28 LEU  HN   1 2 
       212 1 2 1 1 28 LEU HB2  . 28 LEU  HB2  1 2 
       213 1 1 1 1 28 LEU H    . 28 LEU  HN   1 2 
       213 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       214 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
       214 1 2 1 1 20 LYS H    . 20 LYS  HN   1 2 
       215 1 1 1 1 17 GLU H    . 17 GLU  HN   1 2 
       215 1 2 1 1 20 LYS H    . 20 LYS  HN   1 2 
       216 1 1 1 1 20 LYS H    . 20 LYS  HN   1 2 
       216 1 2 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       217 1 1 1 1 15 CYS HB3  . 15 CYSS HB3  1 2 
       217 1 2 1 1 20 LYS H    . 20 LYS  HN   1 2 
       218 1 1 1 1 15 CYS HB2  . 15 CYSS HB2  1 2 
       218 1 2 1 1 20 LYS H    . 20 LYS  HN   1 2 
       219 1 1 1 1 20 LYS H    . 20 LYS  HN   1 2 
       219 1 2 1 1 20 LYS HB2  . 20 LYS  HB2  1 2 
       220 1 1 1 1 20 LYS H    . 20 LYS  HN   1 2 
       220 1 2 1 1 20 LYS HB3  . 20 LYS  HB3  1 2 
       221 1 1 1 1 20 LYS H    . 20 LYS  HN   1 2 
       221 1 2 1 1 20 LYS HG3  . 20 LYS  HG3  1 2 
       222 1 1 1 1 18 CYS HA   . 18 CYSS HA   1 2 
       222 1 2 1 1 20 LYS H    . 20 LYS  HN   1 2 
       223 1 1 1 1 20 LYS H    . 20 LYS  HN   1 2 
       223 1 2 1 1 21 ALA HA   . 21 ALA  HA   1 2 
       224 1 1 1 1 15 CYS HA   . 15 CYSS HA   1 2 
       224 1 2 1 1 20 LYS H    . 20 LYS  HN   1 2 
       225 1 1 1 1 23 ARG H    . 23 ARG  HN   1 2 
       225 1 2 1 1 24 ALA H    . 24 ALA  HN   1 2 
       226 1 1 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       226 1 2 1 1 24 ALA H    . 24 ALA  HN   1 2 
       227 1 1 1 1 23 ARG HB2  . 23 ARG  HB2  1 2 
       227 1 2 1 1 24 ALA H    . 24 ALA  HN   1 2 
       228 1 1 1 1 29 ALA H    . 29 ALA  HN   1 2 
       228 1 2 1 1 31 HIS H    . 31 HIS  HN   1 2 
       229 1 1 1 1 34 THR H    . 34 THR  HN   1 2 
       229 1 2 1 1 34 THR HB   . 34 THR  HB   1 2 
       230 1 1 1 1 38 GLU H    . 38 GLU  HN   1 2 
       230 1 2 1 1 38 GLU HB3  . 38 GLU  HB3  1 2 
       231 1 1 1 1 22 PHE HB3  . 22 PHE  HB3  1 2 
       231 1 2 1 1 27 SER HB2  . 27 SER  HB2  1 2 
       232 1 1 1 1 30 ILE HA   . 30 ILE  HA   1 2 
       232 1 2 1 1 33 ALA MB   . 33 ALA  QB   1 2 
       233 1 1 1 1 22 PHE HB2  . 22 PHE  HB2  1 2 
       233 1 2 1 1 24 ALA MB   . 24 ALA  QB   1 2 
       234 1 1 1 1 22 PHE HB2  . 22 PHE  HB2  1 2 
       234 1 2 1 1 28 LEU HB2  . 28 LEU  HB2  1 2 
       235 1 1 1 1 28 LEU H    . 28 LEU  HN   1 2 
       235 1 2 1 1 29 ALA MB   . 29 ALA  QB   1 2 
       236 1 1 1 1 23 ARG HA   . 23 ARG  HA   1 2 
       236 1 2 1 1 23 ARG QD   . 23 ARG  QD   1 2 
       237 1 1 1 1 30 ILE MG   . 30 ILE  QG2  1 2 
       237 1 2 1 1 31 HIS HA   . 31 HIS  HA   1 2 
       238 1 1 1 1 30 ILE HA   . 30 ILE  HA   1 2 
       238 1 2 1 1 30 ILE MG   . 30 ILE  QG2  1 2 
       239 1 1 1 1 22 PHE HB2  . 22 PHE  HB2  1 2 
       239 1 2 1 1 28 LEU HB3  . 28 LEU  HB3  1 2 
       240 1 1 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       240 1 2 1 1 25 ARG QG   . 25 ARG  QG   1 2 
       241 1 1 1 1 30 ILE H    . 30 ILE  HN   1 2 
       241 1 2 1 1 30 ILE MD   . 30 ILE  QD1  1 2 
       242 1 1 1 1 30 ILE HA   . 30 ILE  HA   1 2 
       242 1 2 1 1 30 ILE MD   . 30 ILE  QD1  1 2 
       243 1 1 1 1 13 TYR HB2  . 13 TYR  HB2  1 2 
       243 1 2 1 1 28 LEU HB2  . 28 LEU  HB2  1 2 
       244 1 1 1 1 13 TYR HB3  . 13 TYR  HB3  1 2 
       244 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       245 1 1 1 1 13 TYR HB2  . 13 TYR  HB2  1 2 
       245 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       246 1 1 1 1 13 TYR HB3  . 13 TYR  HB3  1 2 
       246 1 2 1 1 28 LEU HB2  . 28 LEU  HB2  1 2 
       247 1 1 1 1 30 ILE HA   . 30 ILE  HA   1 2 
       247 1 2 1 1 30 ILE HG12 . 30 ILE  HG12 1 2 
       248 1 1 1 1 34 THR HA   . 34 THR  HA   1 2 
       248 1 2 1 1 34 THR MG   . 34 THR  QG2  1 2 
       249 1 1 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       249 1 2 1 1 27 SER HB2  . 27 SER  HB2  1 2 
       250 1 1 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       250 1 2 1 1 27 SER HB3  . 27 SER  HB3  1 2 
       251 1 1 1 1 22 PHE HB3  . 22 PHE  HB3  1 2 
       251 1 2 1 1 27 SER HB3  . 27 SER  HB3  1 2 
       252 1 1 1 1 18 CYS HB3  . 18 CYSS HB3  1 2 
       252 1 2 1 1 35 HIS HE1  . 35 HIS  HE1  1 2 
       253 1 1 1 1 18 CYS HB2  . 18 CYSS HB2  1 2 
       253 1 2 1 1 35 HIS HE1  . 35 HIS  HE1  1 2 
       254 1 1 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       254 1 2 1 1 32 GLN QG   . 32 GLN  QG   1 2 
       255 1 1 1 1 29 ALA HA   . 29 ALA  HA   1 2 
       255 1 2 1 1 32 GLN QG   . 32 GLN  QG   1 2 
       256 1 1 1 1 28 LEU HG   . 28 LEU  HG   1 2 
       256 1 2 1 1 32 GLN QG   . 32 GLN  QG   1 2 
       257 1 1 1 1 17 GLU HB3  . 17 GLU  HB3  1 2 
       257 1 2 1 1 35 HIS HE1  . 35 HIS  HE1  1 2 
       258 1 1 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       258 1 2 1 1 32 GLN QG   . 32 GLN  QG   1 2 
       259 1 1 1 1 27 SER HA   . 27 SER  HA   1 2 
       259 1 2 1 1 30 ILE H    . 30 ILE  HN   1 2 
       260 1 1 1 1 27 SER HA   . 27 SER  HA   1 2 
       260 1 2 1 1 30 ILE HB   . 30 ILE  HB   1 2 
       261 1 1 1 1 27 SER HA   . 27 SER  HA   1 2 
       261 1 2 1 1 30 ILE MD   . 30 ILE  QD1  1 2 
       262 1 1 1 1 26 SER HA   . 26 SER  HA   1 2 
       262 1 2 1 1 29 ALA MB   . 29 ALA  QB   1 2 
       263 1 1 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       263 1 2 1 1 32 GLN HA   . 32 GLN  HA   1 2 
       264 1 1 1 1 32 GLN HA   . 32 GLN  HA   1 2 
       264 1 2 1 1 35 HIS HD2  . 35 HIS  HD2  1 2 
       265 1 1 1 1 32 GLN HA   . 32 GLN  HA   1 2 
       265 1 2 1 1 32 GLN QG   . 32 GLN  QG   1 2 
       266 1 1 1 1 32 GLN HA   . 32 GLN  HA   1 2 
       266 1 2 1 1 33 ALA MB   . 33 ALA  QB   1 2 
       267 1 1 1 1 25 ARG HA   . 25 ARG  HA   1 2 
       267 1 2 1 1 28 LEU H    . 28 LEU  HN   1 2 
       268 1 1 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       268 1 2 1 1 25 ARG HA   . 25 ARG  HA   1 2 
       269 1 1 1 1 25 ARG HA   . 25 ARG  HA   1 2 
       269 1 2 1 1 28 LEU HB3  . 28 LEU  HB3  1 2 
       270 1 1 1 1 25 ARG HA   . 25 ARG  HA   1 2 
       270 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       271 1 1 1 1 20 LYS HA   . 20 LYS  HA   1 2 
       271 1 2 1 1 20 LYS QD   . 20 LYS  QD   1 2 
       272 1 1 1 1 12 PRO QD   . 12 PRO  QD   1 2 
       272 1 2 1 1 23 ARG HA   . 23 ARG  HA   1 2 
       273 1 1 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       273 1 2 1 1 28 LEU HA   . 28 LEU  HA   1 2 
       274 1 1 1 1 13 TYR HB3  . 13 TYR  HB3  1 2 
       274 1 2 1 1 28 LEU HA   . 28 LEU  HA   1 2 
       275 1 1 1 1 28 LEU HA   . 28 LEU  HA   1 2 
       275 1 2 1 1 28 LEU HG   . 28 LEU  HG   1 2 
       276 1 1 1 1 28 LEU HA   . 28 LEU  HA   1 2 
       276 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       277 1 1 1 1 15 CYS HB2  . 15 CYSS HB2  1 2 
       277 1 2 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       278 1 1 1 1 15 CYS HB3  . 15 CYSS HB3  1 2 
       278 1 2 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       279 1 1 1 1 15 CYS HB3  . 15 CYSS HB3  1 2 
       279 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       280 1 1 1 1 29 ALA HA   . 29 ALA  HA   1 2 
       280 1 2 1 1 31 HIS H    . 31 HIS  HN   1 2 
       281 1 1 1 1 29 ALA HA   . 29 ALA  HA   1 2 
       281 1 2 1 1 32 GLN HB2  . 32 GLN  HB2  1 2 
       282 1 1 1 1 29 ALA HA   . 29 ALA  HA   1 2 
       282 1 2 1 1 32 GLN HB3  . 32 GLN  HB3  1 2 
       283 1 1 1 1 13 TYR HA   . 13 TYR  HA   1 2 
       283 1 2 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       284 1 1 1 1 30 ILE HA   . 30 ILE  HA   1 2 
       284 1 2 1 1 30 ILE HG13 . 30 ILE  HG13 1 2 
       285 1 1 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       285 1 2 1 1 28 LEU HB2  . 28 LEU  HB2  1 2 
       286 1 1 1 1 12 PRO QD   . 12 PRO  QD   1 2 
       286 1 2 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       287 1 1 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       287 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       288 1 1 1 1 31 HIS HB2  . 31 HIS  HB2  1 2 
       288 1 2 1 1 32 GLN H    . 32 GLN  HN   1 2 
       289 1 1 1 1 28 LEU HA   . 28 LEU  HA   1 2 
       289 1 2 1 1 31 HIS HB2  . 31 HIS  HB2  1 2 
       290 1 1 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       290 1 2 1 1 31 HIS HB3  . 31 HIS  HB3  1 2 
       291 1 1 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       291 1 2 1 1 31 HIS HB2  . 31 HIS  HB2  1 2 
       292 1 1 1 1 21 ALA HA   . 21 ALA  HA   1 2 
       292 1 2 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       293 1 1 1 1 32 GLN HB3  . 32 GLN  HB3  1 2 
       293 1 2 1 1 33 ALA HA   . 33 ALA  HA   1 2 
       294 1 1 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       294 1 2 1 1 28 LEU HB2  . 28 LEU  HB2  1 2 
       295 1 1 1 1 23 ARG HA   . 23 ARG  HA   1 2 
       295 1 2 1 1 23 ARG QG   . 23 ARG  QG   1 2 
       296 1 1 1 1 39 LYS HA   . 39 LYS  HA   1 2 
       296 1 2 1 1 40 PRO QD   . 40 PRO  QD   1 2 
       297 1 1 1 1 39 LYS HA   . 39 LYS  HA   1 2 
       297 1 2 1 1 39 LYS QD   . 39 LYS  QD   1 2 
       298 1 1 1 1 28 LEU H    . 28 LEU  HN   1 2 
       298 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       299 1 1 1 1 15 CYS HB3  . 15 CYSS HB3  1 2 
       299 1 2 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       300 1 1 1 1 13 TYR HB3  . 13 TYR  HB3  1 2 
       300 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       301 1 1 1 1 15 CYS HB2  . 15 CYSS HB2  1 2 
       301 1 2 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       302 1 1 1 1 13 TYR HB2  . 13 TYR  HB2  1 2 
       302 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       303 1 1 1 1 20 LYS HB2  . 20 LYS  HB2  1 2 
       303 1 2 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       304 1 1 1 1 20 LYS HB3  . 20 LYS  HB3  1 2 
       304 1 2 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       305 1 1 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       305 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       306 1 1 1 1 20 LYS H    . 20 LYS  HN   1 2 
       306 1 2 1 1 20 LYS HG2  . 20 LYS  HG2  1 2 
       307 1 1 1 1 22 PHE HZ   . 22 PHE  HZ   1 2 
       307 1 2 1 1 31 HIS HB2  . 31 HIS  HB2  1 2 
       308 1 1 1 1 14 LYS HA   . 14 LYS  HA   1 2 
       308 1 2 1 1 21 ALA HA   . 21 ALA  HA   1 2 
       309 1 1 1 1 38 GLU HA   . 38 GLU  HA   1 2 
       309 1 2 1 1 40 PRO QD   . 40 PRO  QD   1 2 
       310 1 1 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       310 1 2 1 1 25 ARG QD   . 25 ARG  QD   1 2 
       311 1 1 1 1 14 LYS QE   . 14 LYS  QE   1 2 
       311 1 2 1 1 21 ALA MB   . 21 ALA  QB   1 2 
       312 1 1 1 1 20 LYS HA   . 20 LYS  HA   1 2 
       312 1 2 1 1 21 ALA MB   . 21 ALA  QB   1 2 
       313 1 1 1 1 14 LYS HA   . 14 LYS  HA   1 2 
       313 1 2 1 1 21 ALA MB   . 21 ALA  QB   1 2 
       314 1 1 1 1 14 LYS QD   . 14 LYS  QD   1 2 
       314 1 2 1 1 21 ALA MB   . 21 ALA  QB   1 2 
       315 1 1 1 1 22 PHE HB2  . 22 PHE  HB2  1 2 
       315 1 2 1 1 27 SER HB2  . 27 SER  HB2  1 2 
       316 1 1 1 1 22 PHE HB2  . 22 PHE  HB2  1 2 
       316 1 2 1 1 27 SER HB3  . 27 SER  HB3  1 2 
       317 1 1 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       317 1 2 1 1 32 GLN QG   . 32 GLN  QG   1 2 
       318 1 1 1 1 15 CYS HB2  . 15 CYSS HB2  1 2 
       318 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       319 1 1 1 1 15 CYS HA   . 15 CYSS HA   1 2 
       319 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       320 1 1 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       320 1 2 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       321 1 1 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       321 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       322 1 1 1 1 10 GLU H    . 10 GLU  HN   1 2 
       322 1 2 1 1 10 GLU QB   . 10 GLU  QB   1 2 
       323 1 1 1 1 10 GLU H    . 10 GLU  HN   1 2 
       323 1 2 1 1 10 GLU QG   . 10 GLU  QG   1 2 
       324 1 1 1 1 10 GLU QB   . 10 GLU  QB   1 2 
       324 1 2 1 1 11 LYS H    . 11 LYS  HN   1 2 
       325 1 1 1 1 10 GLU QG   . 10 GLU  QG   1 2 
       325 1 2 1 1 11 LYS H    . 11 LYS  HN   1 2 
       326 1 1 1 1 11 LYS H    . 11 LYS  HN   1 2 
       326 1 2 1 1 11 LYS QB   . 11 LYS  QB   1 2 
       327 1 1 1 1 11 LYS QB   . 11 LYS  QB   1 2 
       327 1 2 1 1 12 PRO QD   . 12 PRO  QD   1 2 
       328 1 1 1 1 12 PRO QB   . 12 PRO  QB   1 2 
       328 1 2 1 1 13 TYR H    . 13 TYR  HN   1 2 
       329 1 1 1 1 12 PRO QG   . 12 PRO  QG   1 2 
       329 1 2 1 1 13 TYR H    . 13 TYR  HN   1 2 
       330 1 1 1 1 12 PRO QG   . 12 PRO  QG   1 2 
       330 1 2 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       331 1 1 1 1 12 PRO QG   . 12 PRO  QG   1 2 
       331 1 2 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       332 1 1 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       332 1 2 1 1 25 ARG QB   . 25 ARG  QB   1 2 
       333 1 1 1 1 14 LYS H    . 14 LYS  HN   1 2 
       333 1 2 1 1 14 LYS QB   . 14 LYS  QB   1 2 
       334 1 1 1 1 14 LYS QB   . 14 LYS  QB   1 2 
       334 1 2 1 1 15 CYS H    . 15 CYSS HN   1 2 
       335 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
       335 1 2 1 1 20 LYS QB   . 20 LYS  QB   1 2 
       336 1 1 1 1 17 GLU H    . 17 GLU  HN   1 2 
       336 1 2 1 1 17 GLU QG   . 17 GLU  QG   1 2 
       337 1 1 1 1 17 GLU QG   . 17 GLU  QG   1 2 
       337 1 2 1 1 18 CYS H    . 18 CYSS HN   1 2 
       338 1 1 1 1 18 CYS QB   . 18 CYSS QB   1 2 
       338 1 2 1 1 35 HIS HE1  . 35 HIS  HE1  1 2 
       339 1 1 1 1 19 GLY H    . 19 GLY  HN   1 2 
       339 1 2 1 1 20 LYS QB   . 20 LYS  QB   1 2 
       340 1 1 1 1 20 LYS H    . 20 LYS  HN   1 2 
       340 1 2 1 1 20 LYS QB   . 20 LYS  QB   1 2 
       341 1 1 1 1 20 LYS H    . 20 LYS  HN   1 2 
       341 1 2 1 1 20 LYS QG   . 20 LYS  QG   1 2 
       342 1 1 1 1 20 LYS HA   . 20 LYS  HA   1 2 
       342 1 2 1 1 20 LYS QG   . 20 LYS  QG   1 2 
       343 1 1 1 1 20 LYS QB   . 20 LYS  QB   1 2 
       343 1 2 1 1 21 ALA H    . 21 ALA  HN   1 2 
       344 1 1 1 1 20 LYS QB   . 20 LYS  QB   1 2 
       344 1 2 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       345 1 1 1 1 20 LYS QB   . 20 LYS  QB   1 2 
       345 1 2 1 1 22 PHE HZ   . 22 PHE  HZ   1 2 
       346 1 1 1 1 20 LYS QE   . 20 LYS  QE   1 2 
       346 1 2 1 1 20 LYS QG   . 20 LYS  QG   1 2 
       347 1 1 1 1 20 LYS QG   . 20 LYS  QG   1 2 
       347 1 2 1 1 21 ALA H    . 21 ALA  HN   1 2 
       348 1 1 1 1 20 LYS QG   . 20 LYS  QG   1 2 
       348 1 2 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       349 1 1 1 1 20 LYS QG   . 20 LYS  QG   1 2 
       349 1 2 1 1 22 PHE HZ   . 22 PHE  HZ   1 2 
       350 1 1 1 1 20 LYS QE   . 20 LYS  QE   1 2 
       350 1 2 1 1 21 ALA H    . 21 ALA  HN   1 2 
       351 1 1 1 1 22 PHE H    . 22 PHE  HN   1 2 
       351 1 2 1 1 27 SER QB   . 27 SER  QB   1 2 
       352 1 1 1 1 22 PHE HB3  . 22 PHE  HB3  1 2 
       352 1 2 1 1 27 SER QB   . 27 SER  QB   1 2 
       353 1 1 1 1 23 ARG QB   . 23 ARG  QB   1 2 
       353 1 2 1 1 23 ARG QD   . 23 ARG  QD   1 2 
       354 1 1 1 1 23 ARG QB   . 23 ARG  QB   1 2 
       354 1 2 1 1 24 ALA H    . 24 ALA  HN   1 2 
       355 1 1 1 1 24 ALA H    . 24 ALA  HN   1 2 
       355 1 2 1 1 27 SER QB   . 27 SER  QB   1 2 
       356 1 1 1 1 24 ALA MB   . 24 ALA  QB   1 2 
       356 1 2 1 1 27 SER QB   . 27 SER  QB   1 2 
       357 1 1 1 1 25 ARG QB   . 25 ARG  QB   1 2 
       357 1 2 1 1 27 SER H    . 27 SER  HN   1 2 
       358 1 1 1 1 27 SER H    . 27 SER  HN   1 2 
       358 1 2 1 1 27 SER QB   . 27 SER  QB   1 2 
       359 1 1 1 1 27 SER QB   . 27 SER  QB   1 2 
       359 1 2 1 1 28 LEU H    . 28 LEU  HN   1 2 
       360 1 1 1 1 29 ALA H    . 29 ALA  HN   1 2 
       360 1 2 1 1 30 ILE QG   . 30 ILE  QG1  1 2 
       361 1 1 1 1 30 ILE H    . 30 ILE  HN   1 2 
       361 1 2 1 1 30 ILE QG   . 30 ILE  QG1  1 2 
       362 1 1 1 1 30 ILE HA   . 30 ILE  HA   1 2 
       362 1 2 1 1 30 ILE QG   . 30 ILE  QG1  1 2 
       363 1 1 1 1 38 GLU H    . 38 GLU  HN   1 2 
       363 1 2 1 1 38 GLU QG   . 38 GLU  QG   1 2 
       364 1 1 1 1 38 GLU QB   . 38 GLU  QB   1 2 
       364 1 2 1 1 39 LYS H    . 39 LYS  HN   1 2 
       365 1 1 1 1 39 LYS H    . 39 LYS  HN   1 2 
       365 1 2 1 1 39 LYS QB   . 39 LYS  QB   1 2 
       366 1 1 1 1 39 LYS HA   . 39 LYS  HA   1 2 
       366 1 2 1 1 39 LYS QG   . 39 LYS  QG   1 2 
       367 1 1 1 1 39 LYS QB   . 39 LYS  QB   1 2 
       367 1 2 1 1 40 PRO QD   . 40 PRO  QD   1 2 
       368 1 1 1 1 39 LYS QG   . 39 LYS  QG   1 2 
       368 1 2 1 1 40 PRO QD   . 40 PRO  QD   1 2 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

         1 1 . . . . . . . 4.41 1 2 
         2 1 . . . . . . . 3.24 1 2 
         3 1 . . . . . . .  3.6 1 2 
         4 1 . . . . . . . 5.11 1 2 
         5 1 . . . . . . .  5.5 1 2 
         6 1 . . . . . . . 3.33 1 2 
         7 1 . . . . . . . 2.79 1 2 
         8 1 . . . . . . . 4.09 1 2 
         9 1 . . . . . . . 4.86 1 2 
        10 1 . . . . . . . 4.33 1 2 
        11 1 . . . . . . .  5.5 1 2 
        12 1 . . . . . . . 4.69 1 2 
        13 1 . . . . . . .  5.5 1 2 
        14 1 . . . . . . .  4.1 1 2 
        15 1 . . . . . . . 4.52 1 2 
        16 1 . . . . . . . 5.25 1 2 
        17 1 . . . . . . . 5.25 1 2 
        18 1 . . . . . . . 5.22 1 2 
        19 1 . . . . . . . 4.36 1 2 
        20 1 . . . . . . . 4.11 1 2 
        21 1 . . . . . . . 4.07 1 2 
        22 1 . . . . . . . 5.06 1 2 
        23 1 . . . . . . . 4.11 1 2 
        24 1 . . . . . . . 4.11 1 2 
        25 1 . . . . . . . 2.94 1 2 
        26 1 . . . . . . .  5.5 1 2 
        27 1 . . . . . . .  5.5 1 2 
        28 1 . . . . . . . 3.43 1 2 
        29 1 . . . . . . . 4.63 1 2 
        30 1 . . . . . . . 4.14 1 2 
        31 1 . . . . . . . 4.14 1 2 
        32 1 . . . . . . . 4.71 1 2 
        33 1 . . . . . . . 4.71 1 2 
        34 1 . . . . . . . 4.96 1 2 
        35 1 . . . . . . . 4.57 1 2 
        36 1 . . . . . . . 4.57 1 2 
        37 1 . . . . . . . 3.17 1 2 
        38 1 . . . . . . . 4.63 1 2 
        39 1 . . . . . . . 4.86 1 2 
        40 1 . . . . . . . 3.14 1 2 
        41 1 . . . . . . . 4.15 1 2 
        42 1 . . . . . . . 3.88 1 2 
        43 1 . . . . . . . 3.54 1 2 
        44 1 . . . . . . .  5.5 1 2 
        45 1 . . . . . . . 3.52 1 2 
        46 1 . . . . . . . 4.92 1 2 
        47 1 . . . . . . . 3.27 1 2 
        48 1 . . . . . . . 3.29 1 2 
        49 1 . . . . . . . 3.73 1 2 
        50 1 . . . . . . . 3.81 1 2 
        51 1 . . . . . . . 4.18 1 2 
        52 1 . . . . . . .  5.5 1 2 
        53 1 . . . . . . . 2.76 1 2 
        54 1 . . . . . . . 4.77 1 2 
        55 1 . . . . . . . 5.22 1 2 
        56 1 . . . . . . .  4.9 1 2 
        57 1 . . . . . . . 4.26 1 2 
        58 1 . . . . . . . 4.68 1 2 
        59 1 . . . . . . . 4.82 1 2 
        60 1 . . . . . . . 4.58 1 2 
        61 1 . . . . . . . 2.87 1 2 
        62 1 . . . . . . .  5.1 1 2 
        63 1 . . . . . . .  4.1 1 2 
        64 1 . . . . . . . 4.69 1 2 
        65 1 . . . . . . . 5.25 1 2 
        66 1 . . . . . . . 5.14 1 2 
        67 1 . . . . . . . 3.55 1 2 
        68 1 . . . . . . .  3.1 1 2 
        69 1 . . . . . . .  5.5 1 2 
        70 1 . . . . . . .  5.5 1 2 
        71 1 . . . . . . . 4.12 1 2 
        72 1 . . . . . . . 3.21 1 2 
        73 1 . . . . . . . 4.67 1 2 
        74 1 . . . . . . . 5.26 1 2 
        75 1 . . . . . . . 4.87 1 2 
        76 1 . . . . . . . 3.95 1 2 
        77 1 . . . . . . . 2.96 1 2 
        78 1 . . . . . . . 3.06 1 2 
        79 1 . . . . . . . 4.92 1 2 
        80 1 . . . . . . . 3.78 1 2 
        81 1 . . . . . . . 4.05 1 2 
        82 1 . . . . . . . 4.26 1 2 
        83 1 . . . . . . . 3.99 1 2 
        84 1 . . . . . . .  5.5 1 2 
        85 1 . . . . . . . 4.04 1 2 
        86 1 . . . . . . . 3.98 1 2 
        87 1 . . . . . . . 3.78 1 2 
        88 1 . . . . . . . 3.12 1 2 
        89 1 . . . . . . . 3.14 1 2 
        90 1 . . . . . . . 3.87 1 2 
        91 1 . . . . . . . 5.01 1 2 
        92 1 . . . . . . . 3.22 1 2 
        93 1 . . . . . . . 4.23 1 2 
        94 1 . . . . . . . 3.87 1 2 
        95 1 . . . . . . .  5.5 1 2 
        96 1 . . . . . . . 3.85 1 2 
        97 1 . . . . . . . 4.48 1 2 
        98 1 . . . . . . . 4.89 1 2 
        99 1 . . . . . . .  5.5 1 2 
       100 1 . . . . . . . 3.42 1 2 
       101 1 . . . . . . . 4.51 1 2 
       102 1 . . . . . . . 5.26 1 2 
       103 1 . . . . . . . 5.28 1 2 
       104 1 . . . . . . . 4.31 1 2 
       105 1 . . . . . . . 4.31 1 2 
       106 1 . . . . . . . 3.47 1 2 
       107 1 . . . . . . . 3.36 1 2 
       108 1 . . . . . . . 4.01 1 2 
       109 1 . . . . . . . 3.21 1 2 
       110 1 . . . . . . .  3.6 1 2 
       111 1 . . . . . . . 4.44 1 2 
       112 1 . . . . . . . 4.15 1 2 
       113 1 . . . . . . . 4.54 1 2 
       114 1 . . . . . . . 3.11 1 2 
       115 1 . . . . . . . 4.15 1 2 
       116 1 . . . . . . .  5.5 1 2 
       117 1 . . . . . . . 4.25 1 2 
       118 1 . . . . . . .  5.5 1 2 
       119 1 . . . . . . . 4.13 1 2 
       120 1 . . . . . . . 5.19 1 2 
       121 1 . . . . . . . 4.97 1 2 
       122 1 . . . . . . . 4.95 1 2 
       123 1 . . . . . . . 3.33 1 2 
       124 1 . . . . . . .  5.5 1 2 
       125 1 . . . . . . . 5.16 1 2 
       126 1 . . . . . . .  3.3 1 2 
       127 1 . . . . . . . 4.43 1 2 
       128 1 . . . . . . . 2.93 1 2 
       129 1 . . . . . . . 3.89 1 2 
       130 1 . . . . . . . 3.81 1 2 
       131 1 . . . . . . . 4.44 1 2 
       132 1 . . . . . . . 3.35 1 2 
       133 1 . . . . . . . 3.43 1 2 
       134 1 . . . . . . .  4.4 1 2 
       135 1 . . . . . . . 5.43 1 2 
       136 1 . . . . . . . 5.32 1 2 
       137 1 . . . . . . . 4.34 1 2 
       138 1 . . . . . . .  5.5 1 2 
       139 1 . . . . . . . 2.94 1 2 
       140 1 . . . . . . . 2.75 1 2 
       141 1 . . . . . . . 4.65 1 2 
       142 1 . . . . . . . 5.36 1 2 
       143 1 . . . . . . .  5.5 1 2 
       144 1 . . . . . . . 5.04 1 2 
       145 1 . . . . . . . 4.33 1 2 
       146 1 . . . . . . . 3.58 1 2 
       147 1 . . . . . . . 3.94 1 2 
       148 1 . . . . . . . 3.94 1 2 
       149 1 . . . . . . . 4.86 1 2 
       150 1 . . . . . . . 4.86 1 2 
       151 1 . . . . . . . 3.11 1 2 
       152 1 . . . . . . .  4.9 1 2 
       153 1 . . . . . . . 4.46 1 2 
       154 1 . . . . . . . 4.09 1 2 
       155 1 . . . . . . .  3.9 1 2 
       156 1 . . . . . . . 2.87 1 2 
       157 1 . . . . . . . 3.14 1 2 
       158 1 . . . . . . . 3.21 1 2 
       159 1 . . . . . . .  5.0 1 2 
       160 1 . . . . . . .  5.0 1 2 
       161 1 . . . . . . . 3.81 1 2 
       162 1 . . . . . . . 3.77 1 2 
       163 1 . . . . . . . 4.04 1 2 
       164 1 . . . . . . . 4.94 1 2 
       165 1 . . . . . . . 2.75 1 2 
       166 1 . . . . . . .  3.8 1 2 
       167 1 . . . . . . . 4.37 1 2 
       168 1 . . . . . . . 4.35 1 2 
       169 1 . . . . . . . 4.17 1 2 
       170 1 . . . . . . . 4.52 1 2 
       171 1 . . . . . . . 5.19 1 2 
       172 1 . . . . . . . 5.47 1 2 
       173 1 . . . . . . . 4.38 1 2 
       174 1 . . . . . . . 4.45 1 2 
       175 1 . . . . . . . 3.81 1 2 
       176 1 . . . . . . . 3.52 1 2 
       177 1 . . . . . . . 4.56 1 2 
       178 1 . . . . . . .  4.8 1 2 
       179 1 . . . . . . .  5.5 1 2 
       180 1 . . . . . . .  5.5 1 2 
       181 1 . . . . . . .  5.5 1 2 
       182 1 . . . . . . . 4.67 1 2 
       183 1 . . . . . . . 3.75 1 2 
       184 1 . . . . . . . 4.48 1 2 
       185 1 . . . . . . . 4.61 1 2 
       186 1 . . . . . . . 4.09 1 2 
       187 1 . . . . . . . 4.55 1 2 
       188 1 . . . . . . . 4.23 1 2 
       189 1 . . . . . . . 4.49 1 2 
       190 1 . . . . . . . 5.08 1 2 
       191 1 . . . . . . . 5.16 1 2 
       192 1 . . . . . . . 5.39 1 2 
       193 1 . . . . . . . 5.04 1 2 
       194 1 . . . . . . . 4.49 1 2 
       195 1 . . . . . . .  4.7 1 2 
       196 1 . . . . . . . 2.69 1 2 
       197 1 . . . . . . . 3.37 1 2 
       198 1 . . . . . . . 2.95 1 2 
       199 1 . . . . . . . 3.23 1 2 
       200 1 . . . . . . . 4.46 1 2 
       201 1 . . . . . . . 3.06 1 2 
       202 1 . . . . . . .  4.9 1 2 
       203 1 . . . . . . . 4.81 1 2 
       204 1 . . . . . . . 3.26 1 2 
       205 1 . . . . . . . 3.91 1 2 
       206 1 . . . . . . . 3.91 1 2 
       207 1 . . . . . . . 4.23 1 2 
       208 1 . . . . . . . 3.97 1 2 
       209 1 . . . . . . . 3.08 1 2 
       210 1 . . . . . . . 4.76 1 2 
       211 1 . . . . . . . 5.11 1 2 
       212 1 . . . . . . . 3.19 1 2 
       213 1 . . . . . . . 4.68 1 2 
       214 1 . . . . . . . 4.08 1 2 
       215 1 . . . . . . . 5.27 1 2 
       216 1 . . . . . . . 4.58 1 2 
       217 1 . . . . . . . 3.29 1 2 
       218 1 . . . . . . . 3.62 1 2 
       219 1 . . . . . . . 3.57 1 2 
       220 1 . . . . . . . 3.57 1 2 
       221 1 . . . . . . .  4.8 1 2 
       222 1 . . . . . . .  5.5 1 2 
       223 1 . . . . . . .  5.5 1 2 
       224 1 . . . . . . . 4.89 1 2 
       225 1 . . . . . . . 4.39 1 2 
       226 1 . . . . . . . 4.71 1 2 
       227 1 . . . . . . . 4.44 1 2 
       228 1 . . . . . . . 4.51 1 2 
       229 1 . . . . . . . 3.77 1 2 
       230 1 . . . . . . . 4.12 1 2 
       231 1 . . . . . . . 4.45 1 2 
       232 1 . . . . . . . 4.06 1 2 
       233 1 . . . . . . . 5.31 1 2 
       234 1 . . . . . . .  4.4 1 2 
       235 1 . . . . . . . 4.39 1 2 
       236 1 . . . . . . . 4.47 1 2 
       237 1 . . . . . . . 4.36 1 2 
       238 1 . . . . . . . 3.65 1 2 
       239 1 . . . . . . . 4.67 1 2 
       240 1 . . . . . . . 4.23 1 2 
       241 1 . . . . . . . 4.18 1 2 
       242 1 . . . . . . . 4.16 1 2 
       243 1 . . . . . . . 4.56 1 2 
       244 1 . . . . . . . 4.13 1 2 
       245 1 . . . . . . .  4.7 1 2 
       246 1 . . . . . . . 4.53 1 2 
       247 1 . . . . . . . 4.08 1 2 
       248 1 . . . . . . . 3.44 1 2 
       249 1 . . . . . . . 4.22 1 2 
       250 1 . . . . . . . 4.22 1 2 
       251 1 . . . . . . . 4.45 1 2 
       252 1 . . . . . . . 4.39 1 2 
       253 1 . . . . . . . 4.39 1 2 
       254 1 . . . . . . . 4.29 1 2 
       255 1 . . . . . . . 4.58 1 2 
       256 1 . . . . . . . 3.92 1 2 
       257 1 . . . . . . . 4.14 1 2 
       258 1 . . . . . . . 4.34 1 2 
       259 1 . . . . . . . 4.26 1 2 
       260 1 . . . . . . . 4.04 1 2 
       261 1 . . . . . . . 4.12 1 2 
       262 1 . . . . . . . 3.72 1 2 
       263 1 . . . . . . . 4.31 1 2 
       264 1 . . . . . . . 3.84 1 2 
       265 1 . . . . . . . 3.72 1 2 
       266 1 . . . . . . . 5.01 1 2 
       267 1 . . . . . . . 4.42 1 2 
       268 1 . . . . . . . 4.64 1 2 
       269 1 . . . . . . . 4.01 1 2 
       270 1 . . . . . . . 4.41 1 2 
       271 1 . . . . . . . 4.22 1 2 
       272 1 . . . . . . . 3.88 1 2 
       273 1 . . . . . . . 4.75 1 2 
       274 1 . . . . . . . 5.27 1 2 
       275 1 . . . . . . . 4.22 1 2 
       276 1 . . . . . . . 3.47 1 2 
       277 1 . . . . . . . 3.83 1 2 
       278 1 . . . . . . .  4.2 1 2 
       279 1 . . . . . . . 4.33 1 2 
       280 1 . . . . . . . 5.12 1 2 
       281 1 . . . . . . . 4.08 1 2 
       282 1 . . . . . . . 4.48 1 2 
       283 1 . . . . . . . 3.96 1 2 
       284 1 . . . . . . . 4.08 1 2 
       285 1 . . . . . . . 4.62 1 2 
       286 1 . . . . . . . 4.83 1 2 
       287 1 . . . . . . . 4.23 1 2 
       288 1 . . . . . . . 4.36 1 2 
       289 1 . . . . . . . 4.54 1 2 
       290 1 . . . . . . . 4.48 1 2 
       291 1 . . . . . . . 4.47 1 2 
       292 1 . . . . . . . 4.46 1 2 
       293 1 . . . . . . . 5.24 1 2 
       294 1 . . . . . . . 4.31 1 2 
       295 1 . . . . . . . 3.99 1 2 
       296 1 . . . . . . . 3.48 1 2 
       297 1 . . . . . . . 4.98 1 2 
       298 1 . . . . . . . 4.55 1 2 
       299 1 . . . . . . . 4.53 1 2 
       300 1 . . . . . . .  3.7 1 2 
       301 1 . . . . . . . 4.08 1 2 
       302 1 . . . . . . . 4.34 1 2 
       303 1 . . . . . . . 4.59 1 2 
       304 1 . . . . . . . 4.59 1 2 
       305 1 . . . . . . . 4.19 1 2 
       306 1 . . . . . . .  4.8 1 2 
       307 1 . . . . . . . 4.45 1 2 
       308 1 . . . . . . . 3.77 1 2 
       309 1 . . . . . . . 3.69 1 2 
       310 1 . . . . . . .  4.5 1 2 
       311 1 . . . . . . . 4.37 1 2 
       312 1 . . . . . . . 4.55 1 2 
       313 1 . . . . . . . 4.22 1 2 
       314 1 . . . . . . . 3.61 1 2 
       315 1 . . . . . . .  5.5 1 2 
       316 1 . . . . . . .  5.5 1 2 
       317 1 . . . . . . . 3.59 1 2 
       318 1 . . . . . . . 3.69 1 2 
       319 1 . . . . . . . 3.87 1 2 
       320 1 . . . . . . . 3.72 1 2 
       321 1 . . . . . . .  3.8 1 2 
       322 1 . . . . . . . 3.45 1 2 
       323 1 . . . . . . . 4.21 1 2 
       324 1 . . . . . . .  4.2 1 2 
       325 1 . . . . . . . 4.88 1 2 
       326 1 . . . . . . . 3.49 1 2 
       327 1 . . . . . . . 4.02 1 2 
       328 1 . . . . . . . 3.54 1 2 
       329 1 . . . . . . .  3.7 1 2 
       330 1 . . . . . . . 4.47 1 2 
       331 1 . . . . . . . 5.26 1 2 
       332 1 . . . . . . . 5.34 1 2 
       333 1 . . . . . . .  3.7 1 2 
       334 1 . . . . . . .  4.3 1 2 
       335 1 . . . . . . . 4.62 1 2 
       336 1 . . . . . . . 3.56 1 2 
       337 1 . . . . . . . 4.26 1 2 
       338 1 . . . . . . . 3.74 1 2 
       339 1 . . . . . . . 4.69 1 2 
       340 1 . . . . . . . 2.78 1 2 
       341 1 . . . . . . . 4.22 1 2 
       342 1 . . . . . . . 3.71 1 2 
       343 1 . . . . . . . 4.19 1 2 
       344 1 . . . . . . . 3.96 1 2 
       345 1 . . . . . . . 4.48 1 2 
       346 1 . . . . . . . 3.29 1 2 
       347 1 . . . . . . . 4.46 1 2 
       348 1 . . . . . . . 4.94 1 2 
       349 1 . . . . . . . 4.73 1 2 
       350 1 . . . . . . . 5.34 1 2 
       351 1 . . . . . . . 5.34 1 2 
       352 1 . . . . . . . 3.83 1 2 
       353 1 . . . . . . . 3.48 1 2 
       354 1 . . . . . . . 3.83 1 2 
       355 1 . . . . . . . 3.63 1 2 
       356 1 . . . . . . . 4.21 1 2 
       357 1 . . . . . . . 4.61 1 2 
       358 1 . . . . . . . 3.24 1 2 
       359 1 . . . . . . . 3.38 1 2 
       360 1 . . . . . . . 5.34 1 2 
       361 1 . . . . . . . 3.11 1 2 
       362 1 . . . . . . . 3.52 1 2 
       363 1 . . . . . . . 4.75 1 2 
       364 1 . . . . . . . 4.22 1 2 
       365 1 . . . . . . .  3.6 1 2 
       366 1 . . . . . . . 3.74 1 2 
       367 1 . . . . . . . 4.24 1 2 
       368 1 . . . . . . . 4.61 1 2 
    stop_

save_


save_DYANA/DIANA_dihedral_4
    _Torsion_angle_constraint_list.Sf_category         torsion_angle_constraints
    _Torsion_angle_constraint_list.Entry_ID            1
    _Torsion_angle_constraint_list.ID                  1
    _Torsion_angle_constraint_list.Constraint_file_ID  .
    _Torsion_angle_constraint_list.Block_ID            .

    loop_
       _Torsion_angle_constraint.ID
       _Torsion_angle_constraint.Torsion_angle_name
       _Torsion_angle_constraint.Entity_assembly_ID_1
       _Torsion_angle_constraint.Entity_ID_1
       _Torsion_angle_constraint.Comp_index_ID_1
       _Torsion_angle_constraint.Comp_ID_1
       _Torsion_angle_constraint.Atom_ID_1
       _Torsion_angle_constraint.Entity_assembly_ID_2
       _Torsion_angle_constraint.Entity_ID_2
       _Torsion_angle_constraint.Comp_index_ID_2
       _Torsion_angle_constraint.Comp_ID_2
       _Torsion_angle_constraint.Atom_ID_2
       _Torsion_angle_constraint.Entity_assembly_ID_3
       _Torsion_angle_constraint.Entity_ID_3
       _Torsion_angle_constraint.Comp_index_ID_3
       _Torsion_angle_constraint.Comp_ID_3
       _Torsion_angle_constraint.Atom_ID_3
       _Torsion_angle_constraint.Entity_assembly_ID_4
       _Torsion_angle_constraint.Entity_ID_4
       _Torsion_angle_constraint.Comp_index_ID_4
       _Torsion_angle_constraint.Comp_ID_4
       _Torsion_angle_constraint.Atom_ID_4
       _Torsion_angle_constraint.Angle_lower_bound_val
       _Torsion_angle_constraint.Angle_upper_bound_val
       _Torsion_angle_constraint.Auth_asym_ID_1
       _Torsion_angle_constraint.Auth_seq_ID_1
       _Torsion_angle_constraint.Auth_comp_ID_1
       _Torsion_angle_constraint.Auth_atom_ID_1
       _Torsion_angle_constraint.Auth_asym_ID_2
       _Torsion_angle_constraint.Auth_seq_ID_2
       _Torsion_angle_constraint.Auth_comp_ID_2
       _Torsion_angle_constraint.Auth_atom_ID_2
       _Torsion_angle_constraint.Auth_asym_ID_3
       _Torsion_angle_constraint.Auth_seq_ID_3
       _Torsion_angle_constraint.Auth_comp_ID_3
       _Torsion_angle_constraint.Auth_atom_ID_3
       _Torsion_angle_constraint.Auth_asym_ID_4
       _Torsion_angle_constraint.Auth_seq_ID_4
       _Torsion_angle_constraint.Auth_comp_ID_4
       _Torsion_angle_constraint.Auth_atom_ID_4
       _Torsion_angle_constraint.Entry_ID
       _Torsion_angle_constraint.Torsion_angle_constraint_list_ID

        1 PHI  1 1 25 ARG C 1 1 26 SER N  1 1 26 SER CA 1 1 26 SER C      -96.8 -36.799995 . 26 SER  . . 26 SER  . . 26 SER  . . 26 SER  . 1 1 
        2 PSI  1 1 26 SER N 1 1 26 SER CA 1 1 26 SER C  1 1 27 SER N      -61.3       -1.3 . 26 SER  . . 26 SER  . . 26 SER  . . 26 SER  . 1 1 
        3 PHI  1 1 26 SER C 1 1 27 SER N  1 1 27 SER CA 1 1 27 SER C      -96.2      -36.2 . 27 SER  . . 27 SER  . . 27 SER  . . 27 SER  . 1 1 
        4 PSI  1 1 27 SER N 1 1 27 SER CA 1 1 27 SER C  1 1 28 LEU N  -66.99999       -7.0 . 27 SER  . . 27 SER  . . 27 SER  . . 27 SER  . 1 1 
        5 PHI  1 1 28 LEU C 1 1 29 ALA N  1 1 29 ALA CA 1 1 29 ALA C      -92.1      -32.1 . 29 ALA  . . 29 ALA  . . 29 ALA  . . 29 ALA  . 1 1 
        6 PSI  1 1 29 ALA N 1 1 29 ALA CA 1 1 29 ALA C  1 1 30 ILE N      -68.5       -8.5 . 29 ALA  . . 29 ALA  . . 29 ALA  . . 29 ALA  . 1 1 
        7 PHI  1 1 29 ALA C 1 1 30 ILE N  1 1 30 ILE CA 1 1 30 ILE C      -95.7      -35.7 . 30 ILE  . . 30 ILE  . . 30 ILE  . . 30 ILE  . 1 1 
        8 PSI  1 1 30 ILE N 1 1 30 ILE CA 1 1 30 ILE C  1 1 31 HIS N      -70.2      -10.1 . 30 ILE  . . 30 ILE  . . 30 ILE  . . 30 ILE  . 1 1 
        9 PHI  1 1 30 ILE C 1 1 31 HIS N  1 1 31 HIS CA 1 1 31 HIS C      -93.0      -33.0 . 31 HIS  . . 31 HIS  . . 31 HIS  . . 31 HIS  . 1 1 
       10 PSI  1 1 31 HIS N 1 1 31 HIS CA 1 1 31 HIS C  1 1 32 GLN N      -67.4       -7.4 . 31 HIS  . . 31 HIS  . . 31 HIS  . . 31 HIS  . 1 1 
       11 CHI1 1 1 35 HIS N 1 1 35 HIS CA 1 1 35 HIS CB 1 1 35 HIS CG -89.99999      -30.0 . 35 HIS  . . 35 HIS  . . 35 HIS  . . 35 HIS  . 1 1 
       12 CHI1 1 1 18 CYS N 1 1 18 CYS CA 1 1 18 CYS CB 1 1 18 CYS SG      30.0   89.99999 . 18 CYSS . . 18 CYSS . . 18 CYSS . . 18 CYSS . 1 1 
    stop_

save_


save_conformer_family_coord_set_1
    _Conformer_family_coord_set.Sf_category  conformer_family_coord_set
    _Conformer_family_coord_set.Entry_ID     1
    _Conformer_family_coord_set.ID           1

    loop_
       _Atom_site.Model_ID
       _Atom_site.ID
       _Atom_site.Label_entity_assembly_ID
       _Atom_site.Label_entity_ID
       _Atom_site.Label_comp_index_ID
       _Atom_site.Label_comp_ID
       _Atom_site.Label_atom_ID
       _Atom_site.Type_symbol
       _Atom_site.Cartn_x
       _Atom_site.Cartn_y
       _Atom_site.Cartn_z
       _Atom_site.Occupancy
       _Atom_site.Uncertainty
       _Atom_site.PDBX_label_asym_ID
       _Atom_site.PDB_strand_ID
       _Atom_site.PDB_ins_code
       _Atom_site.PDB_residue_no
       _Atom_site.PDB_residue_name
       _Atom_site.PDB_atom_name
       _Atom_site.Entry_ID
       _Atom_site.Conformer_family_coord_set_ID

        1     1 1 1  1 GLY C    C  -11.947   8.271  14.520 1.00 . A A .   1 GLY C    1 1 
        1     2 1 1  1 GLY CA   C  -12.637   6.950  14.799 1.00 . A A .   1 GLY CA   1 1 
        1     3 1 1  1 GLY H1   H  -12.876   6.986  16.902 1.00 . A A .   1 GLY H1   1 1 
        1     4 1 1  1 GLY HA2  H  -11.894   6.167  14.832 1.00 . A A .   1 GLY HA2  1 1 
        1     5 1 1  1 GLY HA3  H  -13.328   6.742  13.996 1.00 . A A .   1 GLY HA3  1 1 
        1     6 1 1  1 GLY N    N  -13.366   6.958  16.054 1.00 . A A .   1 GLY N    1 1 
        1     7 1 1  1 GLY O    O  -11.556   8.982  15.446 1.00 . A A .   1 GLY O    1 1 
        1     8 1 1  2 SER C    C  -11.620  10.287  11.463 1.00 . A A .   2 SER C    1 1 
        1     9 1 1  2 SER CA   C  -11.145   9.842  12.843 1.00 . A A .   2 SER CA   1 1 
        1    10 1 1  2 SER CB   C   -9.625   9.666  12.839 1.00 . A A .   2 SER CB   1 1 
        1    11 1 1  2 SER H    H  -12.131   7.991  12.549 1.00 . A A .   2 SER H    1 1 
        1    12 1 1  2 SER HA   H  -11.409  10.601  13.564 1.00 . A A .   2 SER HA   1 1 
        1    13 1 1  2 SER HB2  H   -9.347   8.973  12.059 1.00 . A A .   2 SER HB2  1 1 
        1    14 1 1  2 SER HB3  H   -9.155  10.621  12.656 1.00 . A A .   2 SER HB3  1 1 
        1    15 1 1  2 SER HG   H   -8.497   9.749  14.438 1.00 . A A .   2 SER HG   1 1 
        1    16 1 1  2 SER N    N  -11.797   8.600  13.241 1.00 . A A .   2 SER N    1 1 
        1    17 1 1  2 SER O    O  -12.096   9.477  10.667 1.00 . A A .   2 SER O    1 1 
        1    18 1 1  2 SER OG   O   -9.167   9.161  14.082 1.00 . A A .   2 SER OG   1 1 
        1    19 1 1  3 SER C    C  -10.818  11.953   8.853 1.00 . A A .   3 SER C    1 1 
        1    20 1 1  3 SER CA   C  -11.907  12.135   9.906 1.00 . A A .   3 SER CA   1 1 
        1    21 1 1  3 SER CB   C  -12.245  13.620  10.055 1.00 . A A .   3 SER CB   1 1 
        1    22 1 1  3 SER H    H  -11.101  12.175  11.863 1.00 . A A .   3 SER H    1 1 
        1    23 1 1  3 SER HA   H  -12.791  11.604   9.588 1.00 . A A .   3 SER HA   1 1 
        1    24 1 1  3 SER HB2  H  -12.623  13.997   9.117 1.00 . A A .   3 SER HB2  1 1 
        1    25 1 1  3 SER HB3  H  -12.997  13.739  10.821 1.00 . A A .   3 SER HB3  1 1 
        1    26 1 1  3 SER HG   H  -10.413  14.250   9.758 1.00 . A A .   3 SER HG   1 1 
        1    27 1 1  3 SER N    N  -11.488  11.580  11.187 1.00 . A A .   3 SER N    1 1 
        1    28 1 1  3 SER O    O  -11.100  11.877   7.658 1.00 . A A .   3 SER O    1 1 
        1    29 1 1  3 SER OG   O  -11.099  14.370  10.420 1.00 . A A .   3 SER OG   1 1 
        1    30 1 1  4 GLY C    C   -8.488  12.705   7.247 1.00 . A A .   4 GLY C    1 1 
        1    31 1 1  4 GLY CA   C   -8.456  11.712   8.392 1.00 . A A .   4 GLY CA   1 1 
        1    32 1 1  4 GLY H    H   -9.404  11.951  10.270 1.00 . A A .   4 GLY H    1 1 
        1    33 1 1  4 GLY HA2  H   -7.533  11.838   8.938 1.00 . A A .   4 GLY HA2  1 1 
        1    34 1 1  4 GLY HA3  H   -8.490  10.712   7.987 1.00 . A A .   4 GLY HA3  1 1 
        1    35 1 1  4 GLY N    N   -9.570  11.884   9.307 1.00 . A A .   4 GLY N    1 1 
        1    36 1 1  4 GLY O    O   -8.349  12.326   6.084 1.00 . A A .   4 GLY O    1 1 
        1    37 1 1  5 SER C    C   -7.824  16.197   6.944 1.00 . A A .   5 SER C    1 1 
        1    38 1 1  5 SER CA   C   -8.728  15.029   6.564 1.00 . A A .   5 SER CA   1 1 
        1    39 1 1  5 SER CB   C  -10.166  15.520   6.386 1.00 . A A .   5 SER CB   1 1 
        1    40 1 1  5 SER H    H   -8.778  14.219   8.520 1.00 . A A .   5 SER H    1 1 
        1    41 1 1  5 SER HA   H   -8.382  14.609   5.632 1.00 . A A .   5 SER HA   1 1 
        1    42 1 1  5 SER HB2  H  -10.481  16.036   7.280 1.00 . A A .   5 SER HB2  1 1 
        1    43 1 1  5 SER HB3  H  -10.211  16.196   5.545 1.00 . A A .   5 SER HB3  1 1 
        1    44 1 1  5 SER HG   H  -11.899  14.774   5.857 1.00 . A A .   5 SER HG   1 1 
        1    45 1 1  5 SER N    N   -8.673  13.979   7.575 1.00 . A A .   5 SER N    1 1 
        1    46 1 1  5 SER O    O   -8.081  16.905   7.918 1.00 . A A .   5 SER O    1 1 
        1    47 1 1  5 SER OG   O  -11.049  14.437   6.149 1.00 . A A .   5 SER OG   1 1 
        1    48 1 1  6 SER C    C   -5.637  18.343   5.185 1.00 . A A .   6 SER C    1 1 
        1    49 1 1  6 SER CA   C   -5.816  17.472   6.425 1.00 . A A .   6 SER CA   1 1 
        1    50 1 1  6 SER CB   C   -4.465  16.902   6.861 1.00 . A A .   6 SER CB   1 1 
        1    51 1 1  6 SER H    H   -6.611  15.795   5.407 1.00 . A A .   6 SER H    1 1 
        1    52 1 1  6 SER HA   H   -6.215  18.080   7.223 1.00 . A A .   6 SER HA   1 1 
        1    53 1 1  6 SER HB2  H   -4.147  16.154   6.150 1.00 . A A .   6 SER HB2  1 1 
        1    54 1 1  6 SER HB3  H   -3.736  17.699   6.896 1.00 . A A .   6 SER HB3  1 1 
        1    55 1 1  6 SER HG   H   -5.274  16.707   8.634 1.00 . A A .   6 SER HG   1 1 
        1    56 1 1  6 SER N    N   -6.762  16.393   6.168 1.00 . A A .   6 SER N    1 1 
        1    57 1 1  6 SER O    O   -4.831  18.037   4.308 1.00 . A A .   6 SER O    1 1 
        1    58 1 1  6 SER OG   O   -4.553  16.306   8.143 1.00 . A A .   6 SER OG   1 1 
        1    59 1 1  7 GLY C    C   -6.532  19.623   2.664 1.00 . A A .   7 GLY C    1 1 
        1    60 1 1  7 GLY CA   C   -6.308  20.332   3.985 1.00 . A A .   7 GLY CA   1 1 
        1    61 1 1  7 GLY H    H   -7.023  19.627   5.849 1.00 . A A .   7 GLY H    1 1 
        1    62 1 1  7 GLY HA2  H   -7.051  21.108   4.095 1.00 . A A .   7 GLY HA2  1 1 
        1    63 1 1  7 GLY HA3  H   -5.328  20.785   3.975 1.00 . A A .   7 GLY HA3  1 1 
        1    64 1 1  7 GLY N    N   -6.397  19.433   5.120 1.00 . A A .   7 GLY N    1 1 
        1    65 1 1  7 GLY O    O   -7.534  18.929   2.484 1.00 . A A .   7 GLY O    1 1 
        1    66 1 1  8 THR C    C   -5.435  17.672   0.507 1.00 . A A .   8 THR C    1 1 
        1    67 1 1  8 THR CA   C   -5.699  19.171   0.422 1.00 . A A .   8 THR CA   1 1 
        1    68 1 1  8 THR CB   C   -4.711  19.799  -0.578 1.00 . A A .   8 THR CB   1 1 
        1    69 1 1  8 THR CG2  C   -3.273  19.539  -0.154 1.00 . A A .   8 THR CG2  1 1 
        1    70 1 1  8 THR H    H   -4.823  20.362   1.937 1.00 . A A .   8 THR H    1 1 
        1    71 1 1  8 THR HA   H   -6.702  19.330   0.053 1.00 . A A .   8 THR HA   1 1 
        1    72 1 1  8 THR HB   H   -4.876  20.867  -0.602 1.00 . A A .   8 THR HB   1 1 
        1    73 1 1  8 THR HG1  H   -4.114  19.300  -2.390 1.00 . A A .   8 THR HG1  1 1 
        1    74 1 1  8 THR HG21 H   -3.191  18.539   0.244 1.00 . A A .   8 THR HG21 1 1 
        1    75 1 1  8 THR HG22 H   -2.987  20.253   0.604 1.00 . A A .   8 THR HG22 1 1 
        1    76 1 1  8 THR HG23 H   -2.622  19.641  -1.009 1.00 . A A .   8 THR HG23 1 1 
        1    77 1 1  8 THR N    N   -5.598  19.797   1.734 1.00 . A A .   8 THR N    1 1 
        1    78 1 1  8 THR O    O   -4.807  17.195   1.450 1.00 . A A .   8 THR O    1 1 
        1    79 1 1  8 THR OG1  O   -4.932  19.264  -1.888 1.00 . A A .   8 THR OG1  1 1 
        1    80 1 1  9 GLY C    C   -6.331  14.844  -1.733 1.00 . A A .   9 GLY C    1 1 
        1    81 1 1  9 GLY CA   C   -5.724  15.495  -0.506 1.00 . A A .   9 GLY CA   1 1 
        1    82 1 1  9 GLY H    H   -6.413  17.368  -1.214 1.00 . A A .   9 GLY H    1 1 
        1    83 1 1  9 GLY HA2  H   -4.665  15.286  -0.487 1.00 . A A .   9 GLY HA2  1 1 
        1    84 1 1  9 GLY HA3  H   -6.181  15.070   0.376 1.00 . A A .   9 GLY HA3  1 1 
        1    85 1 1  9 GLY N    N   -5.919  16.933  -0.488 1.00 . A A .   9 GLY N    1 1 
        1    86 1 1  9 GLY O    O   -7.439  14.310  -1.676 1.00 . A A .   9 GLY O    1 1 
        1    87 1 1 10 GLU C    C   -5.664  12.836  -4.196 1.00 . A A .  10 GLU C    1 1 
        1    88 1 1 10 GLU CA   C   -6.081  14.300  -4.092 1.00 . A A .  10 GLU CA   1 1 
        1    89 1 1 10 GLU CB   C   -5.540  15.082  -5.291 1.00 . A A .  10 GLU CB   1 1 
        1    90 1 1 10 GLU CD   C   -3.456  16.127  -6.264 1.00 . A A .  10 GLU CD   1 1 
        1    91 1 1 10 GLU CG   C   -4.033  14.983  -5.452 1.00 . A A .  10 GLU CG   1 1 
        1    92 1 1 10 GLU H    H   -4.730  15.329  -2.828 1.00 . A A .  10 GLU H    1 1 
        1    93 1 1 10 GLU HA   H   -7.159  14.356  -4.095 1.00 . A A .  10 GLU HA   1 1 
        1    94 1 1 10 GLU HB2  H   -6.004  14.705  -6.190 1.00 . A A .  10 GLU HB2  1 1 
        1    95 1 1 10 GLU HB3  H   -5.801  16.124  -5.172 1.00 . A A .  10 GLU HB3  1 1 
        1    96 1 1 10 GLU HG2  H   -3.577  14.992  -4.473 1.00 . A A .  10 GLU HG2  1 1 
        1    97 1 1 10 GLU HG3  H   -3.797  14.054  -5.948 1.00 . A A .  10 GLU HG3  1 1 
        1    98 1 1 10 GLU N    N   -5.605  14.889  -2.846 1.00 . A A .  10 GLU N    1 1 
        1    99 1 1 10 GLU O    O   -4.511  12.487  -3.944 1.00 . A A .  10 GLU O    1 1 
        1   100 1 1 10 GLU OE1  O   -3.728  16.185  -7.481 1.00 . A A .  10 GLU OE1  1 1 
        1   101 1 1 10 GLU OE2  O   -2.733  16.963  -5.682 1.00 . A A .  10 GLU OE2  1 1 
        1   102 1 1 11 LYS C    C   -6.313  10.149  -6.177 1.00 . A A .  11 LYS C    1 1 
        1   103 1 1 11 LYS CA   C   -6.346  10.556  -4.708 1.00 . A A .  11 LYS CA   1 1 
        1   104 1 1 11 LYS CB   C   -7.409   9.743  -3.966 1.00 . A A .  11 LYS CB   1 1 
        1   105 1 1 11 LYS CD   C   -9.853   9.201  -3.761 1.00 . A A .  11 LYS CD   1 1 
        1   106 1 1 11 LYS CE   C  -10.252   9.415  -2.309 1.00 . A A .  11 LYS CE   1 1 
        1   107 1 1 11 LYS CG   C   -8.827  10.226  -4.214 1.00 . A A .  11 LYS CG   1 1 
        1   108 1 1 11 LYS H    H   -7.513  12.321  -4.757 1.00 . A A .  11 LYS H    1 1 
        1   109 1 1 11 LYS HA   H   -5.380  10.354  -4.270 1.00 . A A .  11 LYS HA   1 1 
        1   110 1 1 11 LYS HB2  H   -7.342   8.712  -4.281 1.00 . A A .  11 LYS HB2  1 1 
        1   111 1 1 11 LYS HB3  H   -7.212   9.799  -2.905 1.00 . A A .  11 LYS HB3  1 1 
        1   112 1 1 11 LYS HD2  H  -10.734   9.288  -4.381 1.00 . A A .  11 LYS HD2  1 1 
        1   113 1 1 11 LYS HD3  H   -9.432   8.211  -3.868 1.00 . A A .  11 LYS HD3  1 1 
        1   114 1 1 11 LYS HE2  H  -10.659   8.493  -1.922 1.00 . A A .  11 LYS HE2  1 1 
        1   115 1 1 11 LYS HE3  H   -9.371   9.684  -1.744 1.00 . A A .  11 LYS HE3  1 1 
        1   116 1 1 11 LYS HG2  H   -8.986  11.144  -3.667 1.00 . A A .  11 LYS HG2  1 1 
        1   117 1 1 11 LYS HG3  H   -8.956  10.408  -5.272 1.00 . A A .  11 LYS HG3  1 1 
        1   118 1 1 11 LYS HZ1  H  -12.225  10.098  -2.265 1.00 . A A .  11 LYS HZ1  1 1 
        1   119 1 1 11 LYS HZ2  H  -11.126  11.217  -2.899 1.00 . A A .  11 LYS HZ2  1 1 
        1   120 1 1 11 LYS HZ3  H  -11.185  10.941  -1.231 1.00 . A A .  11 LYS HZ3  1 1 
        1   121 1 1 11 LYS N    N   -6.612  11.982  -4.569 1.00 . A A .  11 LYS N    1 1 
        1   122 1 1 11 LYS NZ   N  -11.268  10.493  -2.166 1.00 . A A .  11 LYS NZ   1 1 
        1   123 1 1 11 LYS O    O   -7.286   9.626  -6.723 1.00 . A A .  11 LYS O    1 1 
        1   124 1 1 12 PRO C    C   -4.913   8.551  -8.484 1.00 . A A .  12 PRO C    1 1 
        1   125 1 1 12 PRO CA   C   -4.983  10.056  -8.250 1.00 . A A .  12 PRO CA   1 1 
        1   126 1 1 12 PRO CB   C   -3.646  10.715  -8.597 1.00 . A A .  12 PRO CB   1 1 
        1   127 1 1 12 PRO CD   C   -3.971  11.012  -6.247 1.00 . A A .  12 PRO CD   1 1 
        1   128 1 1 12 PRO CG   C   -2.918  10.801  -7.300 1.00 . A A .  12 PRO CG   1 1 
        1   129 1 1 12 PRO HA   H   -5.765  10.479  -8.864 1.00 . A A .  12 PRO HA   1 1 
        1   130 1 1 12 PRO HB2  H   -3.114  10.101  -9.310 1.00 . A A .  12 PRO HB2  1 1 
        1   131 1 1 12 PRO HB3  H   -3.821  11.694  -9.017 1.00 . A A .  12 PRO HB3  1 1 
        1   132 1 1 12 PRO HD2  H   -3.691  10.517  -5.329 1.00 . A A .  12 PRO HD2  1 1 
        1   133 1 1 12 PRO HD3  H   -4.127  12.067  -6.077 1.00 . A A .  12 PRO HD3  1 1 
        1   134 1 1 12 PRO HG2  H   -2.384   9.881  -7.117 1.00 . A A .  12 PRO HG2  1 1 
        1   135 1 1 12 PRO HG3  H   -2.234  11.636  -7.319 1.00 . A A .  12 PRO HG3  1 1 
        1   136 1 1 12 PRO N    N   -5.170  10.392  -6.835 1.00 . A A .  12 PRO N    1 1 
        1   137 1 1 12 PRO O    O   -5.438   8.042  -9.474 1.00 . A A .  12 PRO O    1 1 
        1   138 1 1 13 TYR C    C   -4.939   5.688  -6.601 1.00 . A A .  13 TYR C    1 1 
        1   139 1 1 13 TYR CA   C   -4.120   6.397  -7.676 1.00 . A A .  13 TYR CA   1 1 
        1   140 1 1 13 TYR CB   C   -2.648   5.997  -7.559 1.00 . A A .  13 TYR CB   1 1 
        1   141 1 1 13 TYR CD1  C   -1.837   5.399  -9.874 1.00 . A A .  13 TYR CD1  1 1 
        1   142 1 1 13 TYR CD2  C   -1.084   7.445  -8.912 1.00 . A A .  13 TYR CD2  1 1 
        1   143 1 1 13 TYR CE1  C   -1.100   5.658 -11.013 1.00 . A A .  13 TYR CE1  1 1 
        1   144 1 1 13 TYR CE2  C   -0.346   7.714 -10.048 1.00 . A A .  13 TYR CE2  1 1 
        1   145 1 1 13 TYR CG   C   -1.841   6.285  -8.804 1.00 . A A .  13 TYR CG   1 1 
        1   146 1 1 13 TYR CZ   C   -0.356   6.817 -11.096 1.00 . A A .  13 TYR CZ   1 1 
        1   147 1 1 13 TYR H    H   -3.863   8.307  -6.800 1.00 . A A .  13 TYR H    1 1 
        1   148 1 1 13 TYR HA   H   -4.488   6.100  -8.647 1.00 . A A .  13 TYR HA   1 1 
        1   149 1 1 13 TYR HB2  H   -2.199   6.538  -6.740 1.00 . A A .  13 TYR HB2  1 1 
        1   150 1 1 13 TYR HB3  H   -2.586   4.937  -7.360 1.00 . A A .  13 TYR HB3  1 1 
        1   151 1 1 13 TYR HD1  H   -2.421   4.492  -9.806 1.00 . A A .  13 TYR HD1  1 1 
        1   152 1 1 13 TYR HD2  H   -1.077   8.146  -8.089 1.00 . A A .  13 TYR HD2  1 1 
        1   153 1 1 13 TYR HE1  H   -1.109   4.957 -11.834 1.00 . A A .  13 TYR HE1  1 1 
        1   154 1 1 13 TYR HE2  H    0.237   8.621 -10.113 1.00 . A A .  13 TYR HE2  1 1 
        1   155 1 1 13 TYR HH   H    0.994   6.360 -12.386 1.00 . A A .  13 TYR HH   1 1 
        1   156 1 1 13 TYR N    N   -4.261   7.844  -7.567 1.00 . A A .  13 TYR N    1 1 
        1   157 1 1 13 TYR O    O   -4.924   6.079  -5.434 1.00 . A A .  13 TYR O    1 1 
        1   158 1 1 13 TYR OH   O    0.377   7.080 -12.230 1.00 . A A .  13 TYR OH   1 1 
        1   159 1 1 14 LYS C    C   -6.177   2.384  -6.190 1.00 . A A .  14 LYS C    1 1 
        1   160 1 1 14 LYS CA   C   -6.477   3.875  -6.078 1.00 . A A .  14 LYS CA   1 1 
        1   161 1 1 14 LYS CB   C   -7.960   4.130  -6.352 1.00 . A A .  14 LYS CB   1 1 
        1   162 1 1 14 LYS CD   C   -8.895   3.744  -4.053 1.00 . A A .  14 LYS CD   1 1 
        1   163 1 1 14 LYS CE   C   -9.676   5.037  -3.881 1.00 . A A .  14 LYS CE   1 1 
        1   164 1 1 14 LYS CG   C   -8.891   3.284  -5.501 1.00 . A A .  14 LYS CG   1 1 
        1   165 1 1 14 LYS H    H   -5.623   4.379  -7.948 1.00 . A A .  14 LYS H    1 1 
        1   166 1 1 14 LYS HA   H   -6.243   4.203  -5.076 1.00 . A A .  14 LYS HA   1 1 
        1   167 1 1 14 LYS HB2  H   -8.176   5.171  -6.159 1.00 . A A .  14 LYS HB2  1 1 
        1   168 1 1 14 LYS HB3  H   -8.164   3.917  -7.392 1.00 . A A .  14 LYS HB3  1 1 
        1   169 1 1 14 LYS HD2  H   -9.349   2.978  -3.442 1.00 . A A .  14 LYS HD2  1 1 
        1   170 1 1 14 LYS HD3  H   -7.875   3.904  -3.732 1.00 . A A .  14 LYS HD3  1 1 
        1   171 1 1 14 LYS HE2  H   -9.542   5.392  -2.870 1.00 . A A .  14 LYS HE2  1 1 
        1   172 1 1 14 LYS HE3  H   -9.289   5.770  -4.574 1.00 . A A .  14 LYS HE3  1 1 
        1   173 1 1 14 LYS HG2  H   -9.893   3.360  -5.894 1.00 . A A .  14 LYS HG2  1 1 
        1   174 1 1 14 LYS HG3  H   -8.564   2.254  -5.541 1.00 . A A .  14 LYS HG3  1 1 
        1   175 1 1 14 LYS HZ1  H  -11.305   4.771  -5.161 1.00 . A A .  14 LYS HZ1  1 1 
        1   176 1 1 14 LYS HZ2  H  -11.669   5.652  -3.763 1.00 . A A .  14 LYS HZ2  1 1 
        1   177 1 1 14 LYS HZ3  H  -11.463   3.976  -3.677 1.00 . A A .  14 LYS HZ3  1 1 
        1   178 1 1 14 LYS N    N   -5.652   4.642  -7.004 1.00 . A A .  14 LYS N    1 1 
        1   179 1 1 14 LYS NZ   N  -11.130   4.846  -4.139 1.00 . A A .  14 LYS NZ   1 1 
        1   180 1 1 14 LYS O    O   -6.201   1.816  -7.283 1.00 . A A .  14 LYS O    1 1 
        1   181 1 1 15 CYS C    C   -6.870  -0.501  -5.139 1.00 . A A .  15 CYS C    1 1 
        1   182 1 1 15 CYS CA   C   -5.595   0.328  -5.024 1.00 . A A .  15 CYS CA   1 1 
        1   183 1 1 15 CYS CB   C   -4.855  -0.030  -3.734 1.00 . A A .  15 CYS CB   1 1 
        1   184 1 1 15 CYS H    H   -5.894   2.261  -4.214 1.00 . A A .  15 CYS H    1 1 
        1   185 1 1 15 CYS HA   H   -4.958   0.106  -5.867 1.00 . A A .  15 CYS HA   1 1 
        1   186 1 1 15 CYS HB2  H   -4.038   0.663  -3.592 1.00 . A A .  15 CYS HB2  1 1 
        1   187 1 1 15 CYS HB3  H   -5.538   0.051  -2.902 1.00 . A A .  15 CYS HB3  1 1 
        1   188 1 1 15 CYS N    N   -5.897   1.754  -5.054 1.00 . A A .  15 CYS N    1 1 
        1   189 1 1 15 CYS O    O   -7.697  -0.517  -4.228 1.00 . A A .  15 CYS O    1 1 
        1   190 1 1 15 CYS SG   S   -4.159  -1.714  -3.719 1.00 . A A .  15 CYS SG   1 1 
        1   191 1 1 16 ASN C    C   -8.048  -3.378  -5.819 1.00 . A A .  16 ASN C    1 1 
        1   192 1 1 16 ASN CA   C   -8.197  -2.021  -6.501 1.00 . A A .  16 ASN CA   1 1 
        1   193 1 1 16 ASN CB   C   -8.420  -2.214  -8.002 1.00 . A A .  16 ASN CB   1 1 
        1   194 1 1 16 ASN CG   C   -7.120  -2.405  -8.759 1.00 . A A .  16 ASN CG   1 1 
        1   195 1 1 16 ASN H    H   -6.329  -1.137  -6.956 1.00 . A A .  16 ASN H    1 1 
        1   196 1 1 16 ASN HA   H   -9.052  -1.513  -6.081 1.00 . A A .  16 ASN HA   1 1 
        1   197 1 1 16 ASN HB2  H   -9.037  -3.087  -8.159 1.00 . A A .  16 ASN HB2  1 1 
        1   198 1 1 16 ASN HB3  H   -8.923  -1.346  -8.400 1.00 . A A .  16 ASN HB3  1 1 
        1   199 1 1 16 ASN HD21 H   -6.733  -4.060  -7.727 1.00 . A A .  16 ASN HD21 1 1 
        1   200 1 1 16 ASN HD22 H   -5.549  -3.614  -8.903 1.00 . A A .  16 ASN HD22 1 1 
        1   201 1 1 16 ASN N    N   -7.023  -1.190  -6.266 1.00 . A A .  16 ASN N    1 1 
        1   202 1 1 16 ASN ND2  N   -6.394  -3.467  -8.430 1.00 . A A .  16 ASN ND2  1 1 
        1   203 1 1 16 ASN O    O   -8.408  -4.410  -6.385 1.00 . A A .  16 ASN O    1 1 
        1   204 1 1 16 ASN OD1  O   -6.773  -1.607  -9.630 1.00 . A A .  16 ASN OD1  1 1 
        1   205 1 1 17 GLU C    C   -7.844  -4.448  -2.418 1.00 . A A .  17 GLU C    1 1 
        1   206 1 1 17 GLU CA   C   -7.319  -4.597  -3.843 1.00 . A A .  17 GLU CA   1 1 
        1   207 1 1 17 GLU CB   C   -5.836  -4.974  -3.815 1.00 . A A .  17 GLU CB   1 1 
        1   208 1 1 17 GLU CD   C   -5.309  -6.460  -5.789 1.00 . A A .  17 GLU CD   1 1 
        1   209 1 1 17 GLU CG   C   -5.206  -5.068  -5.195 1.00 . A A .  17 GLU CG   1 1 
        1   210 1 1 17 GLU H    H   -7.249  -2.513  -4.203 1.00 . A A .  17 GLU H    1 1 
        1   211 1 1 17 GLU HA   H   -7.871  -5.383  -4.337 1.00 . A A .  17 GLU HA   1 1 
        1   212 1 1 17 GLU HB2  H   -5.299  -4.230  -3.246 1.00 . A A .  17 GLU HB2  1 1 
        1   213 1 1 17 GLU HB3  H   -5.730  -5.932  -3.328 1.00 . A A .  17 GLU HB3  1 1 
        1   214 1 1 17 GLU HG2  H   -5.707  -4.375  -5.854 1.00 . A A .  17 GLU HG2  1 1 
        1   215 1 1 17 GLU HG3  H   -4.162  -4.801  -5.119 1.00 . A A .  17 GLU HG3  1 1 
        1   216 1 1 17 GLU N    N   -7.516  -3.367  -4.601 1.00 . A A .  17 GLU N    1 1 
        1   217 1 1 17 GLU O    O   -8.380  -5.394  -1.840 1.00 . A A .  17 GLU O    1 1 
        1   218 1 1 17 GLU OE1  O   -4.580  -7.360  -5.322 1.00 . A A .  17 GLU OE1  1 1 
        1   219 1 1 17 GLU OE2  O   -6.118  -6.648  -6.722 1.00 . A A .  17 GLU OE2  1 1 
        1   220 1 1 18 CYS C    C   -8.896  -1.655  -0.438 1.00 . A A .  18 CYS C    1 1 
        1   221 1 1 18 CYS CA   C   -8.141  -2.979  -0.500 1.00 . A A .  18 CYS CA   1 1 
        1   222 1 1 18 CYS CB   C   -6.952  -2.946   0.463 1.00 . A A .  18 CYS CB   1 1 
        1   223 1 1 18 CYS H    H   -7.249  -2.539  -2.369 1.00 . A A .  18 CYS H    1 1 
        1   224 1 1 18 CYS HA   H   -8.808  -3.775  -0.207 1.00 . A A .  18 CYS HA   1 1 
        1   225 1 1 18 CYS HB2  H   -7.297  -2.634   1.438 1.00 . A A .  18 CYS HB2  1 1 
        1   226 1 1 18 CYS HB3  H   -6.531  -3.938   0.536 1.00 . A A .  18 CYS HB3  1 1 
        1   227 1 1 18 CYS N    N   -7.685  -3.254  -1.857 1.00 . A A .  18 CYS N    1 1 
        1   228 1 1 18 CYS O    O   -9.998  -1.582   0.104 1.00 . A A .  18 CYS O    1 1 
        1   229 1 1 18 CYS SG   S   -5.618  -1.812  -0.041 1.00 . A A .  18 CYS SG   1 1 
        1   230 1 1 19 GLY C    C   -7.971   1.801  -0.583 1.00 . A A .  19 GLY C    1 1 
        1   231 1 1 19 GLY CA   C   -8.926   0.698  -0.996 1.00 . A A .  19 GLY CA   1 1 
        1   232 1 1 19 GLY H    H   -7.417  -0.727  -1.417 1.00 . A A .  19 GLY H    1 1 
        1   233 1 1 19 GLY HA2  H   -9.295   0.909  -1.989 1.00 . A A .  19 GLY HA2  1 1 
        1   234 1 1 19 GLY HA3  H   -9.758   0.682  -0.308 1.00 . A A .  19 GLY HA3  1 1 
        1   235 1 1 19 GLY N    N   -8.295  -0.610  -0.998 1.00 . A A .  19 GLY N    1 1 
        1   236 1 1 19 GLY O    O   -8.381   2.795   0.016 1.00 . A A .  19 GLY O    1 1 
        1   237 1 1 20 LYS C    C   -5.555   3.669  -1.653 1.00 . A A .  20 LYS C    1 1 
        1   238 1 1 20 LYS CA   C   -5.676   2.613  -0.559 1.00 . A A .  20 LYS CA   1 1 
        1   239 1 1 20 LYS CB   C   -4.324   1.929  -0.343 1.00 . A A .  20 LYS CB   1 1 
        1   240 1 1 20 LYS CD   C   -3.570   2.336   2.018 1.00 . A A .  20 LYS CD   1 1 
        1   241 1 1 20 LYS CE   C   -4.657   3.138   2.717 1.00 . A A .  20 LYS CE   1 1 
        1   242 1 1 20 LYS CG   C   -4.160   1.331   1.043 1.00 . A A .  20 LYS CG   1 1 
        1   243 1 1 20 LYS H    H   -6.427   0.811  -1.379 1.00 . A A .  20 LYS H    1 1 
        1   244 1 1 20 LYS HA   H   -5.977   3.095   0.358 1.00 . A A .  20 LYS HA   1 1 
        1   245 1 1 20 LYS HB2  H   -4.215   1.138  -1.070 1.00 . A A .  20 LYS HB2  1 1 
        1   246 1 1 20 LYS HB3  H   -3.539   2.656  -0.494 1.00 . A A .  20 LYS HB3  1 1 
        1   247 1 1 20 LYS HD2  H   -2.994   1.807   2.762 1.00 . A A .  20 LYS HD2  1 1 
        1   248 1 1 20 LYS HD3  H   -2.926   3.014   1.476 1.00 . A A .  20 LYS HD3  1 1 
        1   249 1 1 20 LYS HE2  H   -5.089   3.828   2.008 1.00 . A A .  20 LYS HE2  1 1 
        1   250 1 1 20 LYS HE3  H   -5.419   2.458   3.067 1.00 . A A .  20 LYS HE3  1 1 
        1   251 1 1 20 LYS HG2  H   -5.127   1.017   1.407 1.00 . A A .  20 LYS HG2  1 1 
        1   252 1 1 20 LYS HG3  H   -3.502   0.475   0.980 1.00 . A A .  20 LYS HG3  1 1 
        1   253 1 1 20 LYS HZ1  H   -4.741   3.783   4.702 1.00 . A A .  20 LYS HZ1  1 1 
        1   254 1 1 20 LYS HZ2  H   -4.070   4.917   3.641 1.00 . A A .  20 LYS HZ2  1 1 
        1   255 1 1 20 LYS HZ3  H   -3.168   3.568   4.117 1.00 . A A .  20 LYS HZ3  1 1 
        1   256 1 1 20 LYS N    N   -6.693   1.625  -0.901 1.00 . A A .  20 LYS N    1 1 
        1   257 1 1 20 LYS NZ   N   -4.122   3.905   3.876 1.00 . A A .  20 LYS NZ   1 1 
        1   258 1 1 20 LYS O    O   -5.916   3.428  -2.804 1.00 . A A .  20 LYS O    1 1 
        1   259 1 1 21 ALA C    C   -3.492   6.566  -2.097 1.00 . A A .  21 ALA C    1 1 
        1   260 1 1 21 ALA CA   C   -4.871   5.931  -2.235 1.00 . A A .  21 ALA CA   1 1 
        1   261 1 1 21 ALA CB   C   -5.958   6.977  -2.040 1.00 . A A .  21 ALA CB   1 1 
        1   262 1 1 21 ALA H    H   -4.774   4.971  -0.352 1.00 . A A .  21 ALA H    1 1 
        1   263 1 1 21 ALA HA   H   -4.971   5.525  -3.232 1.00 . A A .  21 ALA HA   1 1 
        1   264 1 1 21 ALA HB1  H   -6.876   6.629  -2.490 1.00 . A A .  21 ALA HB1  1 1 
        1   265 1 1 21 ALA HB2  H   -6.114   7.140  -0.984 1.00 . A A .  21 ALA HB2  1 1 
        1   266 1 1 21 ALA HB3  H   -5.656   7.902  -2.507 1.00 . A A .  21 ALA HB3  1 1 
        1   267 1 1 21 ALA N    N   -5.043   4.839  -1.285 1.00 . A A .  21 ALA N    1 1 
        1   268 1 1 21 ALA O    O   -3.134   7.071  -1.032 1.00 . A A .  21 ALA O    1 1 
        1   269 1 1 22 PHE C    C   -1.318   8.354  -4.061 1.00 . A A .  22 PHE C    1 1 
        1   270 1 1 22 PHE CA   C   -1.380   7.110  -3.178 1.00 . A A .  22 PHE CA   1 1 
        1   271 1 1 22 PHE CB   C   -0.361   6.077  -3.661 1.00 . A A .  22 PHE CB   1 1 
        1   272 1 1 22 PHE CD1  C   -1.408   3.837  -3.230 1.00 . A A .  22 PHE CD1  1 1 
        1   273 1 1 22 PHE CD2  C    0.474   4.480  -1.915 1.00 . A A .  22 PHE CD2  1 1 
        1   274 1 1 22 PHE CE1  C   -1.477   2.636  -2.549 1.00 . A A .  22 PHE CE1  1 1 
        1   275 1 1 22 PHE CE2  C    0.410   3.281  -1.231 1.00 . A A .  22 PHE CE2  1 1 
        1   276 1 1 22 PHE CG   C   -0.433   4.772  -2.920 1.00 . A A .  22 PHE CG   1 1 
        1   277 1 1 22 PHE CZ   C   -0.566   2.357  -1.549 1.00 . A A .  22 PHE CZ   1 1 
        1   278 1 1 22 PHE H    H   -3.063   6.122  -3.998 1.00 . A A .  22 PHE H    1 1 
        1   279 1 1 22 PHE HA   H   -1.142   7.392  -2.164 1.00 . A A .  22 PHE HA   1 1 
        1   280 1 1 22 PHE HB2  H   -0.533   5.873  -4.707 1.00 . A A .  22 PHE HB2  1 1 
        1   281 1 1 22 PHE HB3  H    0.634   6.477  -3.535 1.00 . A A .  22 PHE HB3  1 1 
        1   282 1 1 22 PHE HD1  H   -2.120   4.054  -4.013 1.00 . A A .  22 PHE HD1  1 1 
        1   283 1 1 22 PHE HD2  H    1.239   5.202  -1.665 1.00 . A A .  22 PHE HD2  1 1 
        1   284 1 1 22 PHE HE1  H   -2.241   1.916  -2.801 1.00 . A A .  22 PHE HE1  1 1 
        1   285 1 1 22 PHE HE2  H    1.124   3.066  -0.449 1.00 . A A .  22 PHE HE2  1 1 
        1   286 1 1 22 PHE HZ   H   -0.618   1.420  -1.016 1.00 . A A .  22 PHE HZ   1 1 
        1   287 1 1 22 PHE N    N   -2.721   6.538  -3.179 1.00 . A A .  22 PHE N    1 1 
        1   288 1 1 22 PHE O    O   -2.259   8.653  -4.796 1.00 . A A .  22 PHE O    1 1 
        1   289 1 1 23 ARG C    C    0.537   9.953  -6.153 1.00 . A A .  23 ARG C    1 1 
        1   290 1 1 23 ARG CA   C   -0.019  10.284  -4.772 1.00 . A A .  23 ARG CA   1 1 
        1   291 1 1 23 ARG CB   C    0.922  11.251  -4.050 1.00 . A A .  23 ARG CB   1 1 
        1   292 1 1 23 ARG CD   C    0.195  11.480  -1.655 1.00 . A A .  23 ARG CD   1 1 
        1   293 1 1 23 ARG CG   C    0.223  12.133  -3.028 1.00 . A A .  23 ARG CG   1 1 
        1   294 1 1 23 ARG CZ   C    1.666  11.329   0.309 1.00 . A A .  23 ARG CZ   1 1 
        1   295 1 1 23 ARG H    H    0.511   8.783  -3.377 1.00 . A A .  23 ARG H    1 1 
        1   296 1 1 23 ARG HA   H   -0.983  10.755  -4.888 1.00 . A A .  23 ARG HA   1 1 
        1   297 1 1 23 ARG HB2  H    1.683  10.680  -3.539 1.00 . A A .  23 ARG HB2  1 1 
        1   298 1 1 23 ARG HB3  H    1.394  11.889  -4.782 1.00 . A A .  23 ARG HB3  1 1 
        1   299 1 1 23 ARG HD2  H   -0.538  11.987  -1.045 1.00 . A A .  23 ARG HD2  1 1 
        1   300 1 1 23 ARG HD3  H   -0.086  10.444  -1.770 1.00 . A A .  23 ARG HD3  1 1 
        1   301 1 1 23 ARG HE   H    2.274  11.769  -1.539 1.00 . A A .  23 ARG HE   1 1 
        1   302 1 1 23 ARG HG2  H    0.750  13.073  -2.957 1.00 . A A .  23 ARG HG2  1 1 
        1   303 1 1 23 ARG HG3  H   -0.791  12.310  -3.354 1.00 . A A .  23 ARG HG3  1 1 
        1   304 1 1 23 ARG HH11 H   -0.286  10.966   0.679 1.00 . A A .  23 ARG HH11 1 1 
        1   305 1 1 23 ARG HH12 H    0.762  10.863   2.055 1.00 . A A .  23 ARG HH12 1 1 
        1   306 1 1 23 ARG HH21 H    3.664  11.636   0.264 1.00 . A A .  23 ARG HH21 1 1 
        1   307 1 1 23 ARG HH22 H    3.008  11.245   1.818 1.00 . A A .  23 ARG HH22 1 1 
        1   308 1 1 23 ARG N    N   -0.203   9.073  -3.982 1.00 . A A .  23 ARG N    1 1 
        1   309 1 1 23 ARG NE   N    1.493  11.549  -0.990 1.00 . A A .  23 ARG NE   1 1 
        1   310 1 1 23 ARG NH1  N    0.629  11.028   1.077 1.00 . A A .  23 ARG NH1  1 1 
        1   311 1 1 23 ARG NH2  N    2.879  11.410   0.841 1.00 . A A .  23 ARG NH2  1 1 
        1   312 1 1 23 ARG O    O    0.168  10.577  -7.148 1.00 . A A .  23 ARG O    1 1 
        1   313 1 1 24 ALA C    C    1.983   7.036  -7.625 1.00 . A A .  24 ALA C    1 1 
        1   314 1 1 24 ALA CA   C    2.033   8.552  -7.466 1.00 . A A .  24 ALA CA   1 1 
        1   315 1 1 24 ALA CB   C    3.469   9.047  -7.549 1.00 . A A .  24 ALA CB   1 1 
        1   316 1 1 24 ALA H    H    1.681   8.508  -5.380 1.00 . A A .  24 ALA H    1 1 
        1   317 1 1 24 ALA HA   H    1.474   9.007  -8.271 1.00 . A A .  24 ALA HA   1 1 
        1   318 1 1 24 ALA HB1  H    4.117   8.359  -7.028 1.00 . A A .  24 ALA HB1  1 1 
        1   319 1 1 24 ALA HB2  H    3.768   9.109  -8.586 1.00 . A A .  24 ALA HB2  1 1 
        1   320 1 1 24 ALA HB3  H    3.540  10.024  -7.095 1.00 . A A .  24 ALA HB3  1 1 
        1   321 1 1 24 ALA N    N    1.427   8.967  -6.207 1.00 . A A .  24 ALA N    1 1 
        1   322 1 1 24 ALA O    O    1.554   6.321  -6.720 1.00 . A A .  24 ALA O    1 1 
        1   323 1 1 25 ARG C    C    3.411   4.393  -8.147 1.00 . A A .  25 ARG C    1 1 
        1   324 1 1 25 ARG CA   C    2.429   5.122  -9.060 1.00 . A A .  25 ARG CA   1 1 
        1   325 1 1 25 ARG CB   C    2.792   4.866 -10.524 1.00 . A A .  25 ARG CB   1 1 
        1   326 1 1 25 ARG CD   C    2.147   3.610 -12.603 1.00 . A A .  25 ARG CD   1 1 
        1   327 1 1 25 ARG CG   C    2.200   3.583 -11.083 1.00 . A A .  25 ARG CG   1 1 
        1   328 1 1 25 ARG CZ   C    3.708   3.457 -14.495 1.00 . A A .  25 ARG CZ   1 1 
        1   329 1 1 25 ARG H    H    2.756   7.173  -9.465 1.00 . A A .  25 ARG H    1 1 
        1   330 1 1 25 ARG HA   H    1.435   4.745  -8.874 1.00 . A A .  25 ARG HA   1 1 
        1   331 1 1 25 ARG HB2  H    2.433   5.692 -11.121 1.00 . A A .  25 ARG HB2  1 1 
        1   332 1 1 25 ARG HB3  H    3.866   4.809 -10.611 1.00 . A A .  25 ARG HB3  1 1 
        1   333 1 1 25 ARG HD2  H    1.618   2.733 -12.946 1.00 . A A .  25 ARG HD2  1 1 
        1   334 1 1 25 ARG HD3  H    1.616   4.496 -12.915 1.00 . A A .  25 ARG HD3  1 1 
        1   335 1 1 25 ARG HE   H    4.243   3.757 -12.597 1.00 . A A .  25 ARG HE   1 1 
        1   336 1 1 25 ARG HG2  H    2.811   2.749 -10.770 1.00 . A A .  25 ARG HG2  1 1 
        1   337 1 1 25 ARG HG3  H    1.198   3.462 -10.698 1.00 . A A .  25 ARG HG3  1 1 
        1   338 1 1 25 ARG HH11 H    1.759   3.254 -14.983 1.00 . A A .  25 ARG HH11 1 1 
        1   339 1 1 25 ARG HH12 H    2.870   3.149 -16.308 1.00 . A A .  25 ARG HH12 1 1 
        1   340 1 1 25 ARG HH21 H    5.717   3.621 -14.334 1.00 . A A .  25 ARG HH21 1 1 
        1   341 1 1 25 ARG HH22 H    5.121   3.357 -15.937 1.00 . A A .  25 ARG HH22 1 1 
        1   342 1 1 25 ARG N    N    2.425   6.553  -8.782 1.00 . A A .  25 ARG N    1 1 
        1   343 1 1 25 ARG NE   N    3.481   3.621 -13.197 1.00 . A A .  25 ARG NE   1 1 
        1   344 1 1 25 ARG NH1  N    2.696   3.271 -15.331 1.00 . A A .  25 ARG NH1  1 1 
        1   345 1 1 25 ARG NH2  N    4.951   3.480 -14.960 1.00 . A A .  25 ARG NH2  1 1 
        1   346 1 1 25 ARG O    O    3.023   3.517  -7.374 1.00 . A A .  25 ARG O    1 1 
        1   347 1 1 26 SER C    C    5.212   3.857  -6.019 1.00 . A A .  26 SER C    1 1 
        1   348 1 1 26 SER CA   C    5.723   4.141  -7.428 1.00 . A A .  26 SER CA   1 1 
        1   349 1 1 26 SER CB   C    6.957   5.042  -7.363 1.00 . A A .  26 SER CB   1 1 
        1   350 1 1 26 SER H    H    4.932   5.467  -8.877 1.00 . A A .  26 SER H    1 1 
        1   351 1 1 26 SER HA   H    5.995   3.206  -7.895 1.00 . A A .  26 SER HA   1 1 
        1   352 1 1 26 SER HB2  H    7.090   5.535  -8.314 1.00 . A A .  26 SER HB2  1 1 
        1   353 1 1 26 SER HB3  H    6.818   5.783  -6.589 1.00 . A A .  26 SER HB3  1 1 
        1   354 1 1 26 SER HG   H    8.046   3.417  -7.461 1.00 . A A .  26 SER HG   1 1 
        1   355 1 1 26 SER N    N    4.685   4.762  -8.242 1.00 . A A .  26 SER N    1 1 
        1   356 1 1 26 SER O    O    5.431   2.776  -5.473 1.00 . A A .  26 SER O    1 1 
        1   357 1 1 26 SER OG   O    8.123   4.291  -7.071 1.00 . A A .  26 SER OG   1 1 
        1   358 1 1 27 SER C    C    2.948   3.580  -4.035 1.00 . A A .  27 SER C    1 1 
        1   359 1 1 27 SER CA   C    3.988   4.695  -4.089 1.00 . A A .  27 SER CA   1 1 
        1   360 1 1 27 SER CB   C    3.365   6.013  -3.626 1.00 . A A .  27 SER CB   1 1 
        1   361 1 1 27 SER H    H    4.386   5.675  -5.923 1.00 . A A .  27 SER H    1 1 
        1   362 1 1 27 SER HA   H    4.805   4.441  -3.429 1.00 . A A .  27 SER HA   1 1 
        1   363 1 1 27 SER HB2  H    2.564   6.285  -4.296 1.00 . A A .  27 SER HB2  1 1 
        1   364 1 1 27 SER HB3  H    2.972   5.890  -2.627 1.00 . A A .  27 SER HB3  1 1 
        1   365 1 1 27 SER HG   H    3.954   7.837  -4.029 1.00 . A A .  27 SER HG   1 1 
        1   366 1 1 27 SER N    N    4.528   4.836  -5.436 1.00 . A A .  27 SER N    1 1 
        1   367 1 1 27 SER O    O    2.875   2.829  -3.061 1.00 . A A .  27 SER O    1 1 
        1   368 1 1 27 SER OG   O    4.325   7.055  -3.614 1.00 . A A .  27 SER OG   1 1 
        1   369 1 1 28 LEU C    C    1.717   1.076  -5.378 1.00 . A A .  28 LEU C    1 1 
        1   370 1 1 28 LEU CA   C    1.106   2.456  -5.162 1.00 . A A .  28 LEU CA   1 1 
        1   371 1 1 28 LEU CB   C    0.127   2.777  -6.293 1.00 . A A .  28 LEU CB   1 1 
        1   372 1 1 28 LEU CD1  C   -1.918   1.464  -5.679 1.00 . A A .  28 LEU CD1  1 1 
        1   373 1 1 28 LEU CD2  C   -1.402   1.917  -8.084 1.00 . A A .  28 LEU CD2  1 1 
        1   374 1 1 28 LEU CG   C   -0.813   1.644  -6.708 1.00 . A A .  28 LEU CG   1 1 
        1   375 1 1 28 LEU H    H    2.249   4.106  -5.833 1.00 . A A .  28 LEU H    1 1 
        1   376 1 1 28 LEU HA   H    0.572   2.458  -4.223 1.00 . A A .  28 LEU HA   1 1 
        1   377 1 1 28 LEU HB2  H   -0.480   3.611  -5.978 1.00 . A A .  28 LEU HB2  1 1 
        1   378 1 1 28 LEU HB3  H    0.706   3.062  -7.160 1.00 . A A .  28 LEU HB3  1 1 
        1   379 1 1 28 LEU HD11 H   -2.569   2.324  -5.695 1.00 . A A .  28 LEU HD11 1 1 
        1   380 1 1 28 LEU HD12 H   -1.482   1.361  -4.696 1.00 . A A .  28 LEU HD12 1 1 
        1   381 1 1 28 LEU HD13 H   -2.487   0.576  -5.914 1.00 . A A .  28 LEU HD13 1 1 
        1   382 1 1 28 LEU HD21 H   -0.991   2.835  -8.476 1.00 . A A .  28 LEU HD21 1 1 
        1   383 1 1 28 LEU HD22 H   -2.475   2.009  -8.004 1.00 . A A .  28 LEU HD22 1 1 
        1   384 1 1 28 LEU HD23 H   -1.159   1.100  -8.748 1.00 . A A .  28 LEU HD23 1 1 
        1   385 1 1 28 LEU HG   H   -0.252   0.721  -6.760 1.00 . A A .  28 LEU HG   1 1 
        1   386 1 1 28 LEU N    N    2.144   3.479  -5.087 1.00 . A A .  28 LEU N    1 1 
        1   387 1 1 28 LEU O    O    1.318   0.103  -4.739 1.00 . A A .  28 LEU O    1 1 
        1   388 1 1 29 ALA C    C    3.959  -0.874  -5.320 1.00 . A A .  29 ALA C    1 1 
        1   389 1 1 29 ALA CA   C    3.356  -0.262  -6.580 1.00 . A A .  29 ALA CA   1 1 
        1   390 1 1 29 ALA CB   C    4.433  -0.052  -7.635 1.00 . A A .  29 ALA CB   1 1 
        1   391 1 1 29 ALA H    H    2.961   1.809  -6.760 1.00 . A A .  29 ALA H    1 1 
        1   392 1 1 29 ALA HA   H    2.621  -0.943  -6.983 1.00 . A A .  29 ALA HA   1 1 
        1   393 1 1 29 ALA HB1  H    4.008   0.460  -8.485 1.00 . A A .  29 ALA HB1  1 1 
        1   394 1 1 29 ALA HB2  H    5.232   0.544  -7.218 1.00 . A A .  29 ALA HB2  1 1 
        1   395 1 1 29 ALA HB3  H    4.822  -1.009  -7.947 1.00 . A A .  29 ALA HB3  1 1 
        1   396 1 1 29 ALA N    N    2.688   0.999  -6.283 1.00 . A A .  29 ALA N    1 1 
        1   397 1 1 29 ALA O    O    3.600  -1.983  -4.925 1.00 . A A .  29 ALA O    1 1 
        1   398 1 1 30 ILE C    C    4.535  -1.315  -2.558 1.00 . A A .  30 ILE C    1 1 
        1   399 1 1 30 ILE CA   C    5.530  -0.617  -3.480 1.00 . A A .  30 ILE CA   1 1 
        1   400 1 1 30 ILE CB   C    6.198   0.540  -2.714 1.00 . A A .  30 ILE CB   1 1 
        1   401 1 1 30 ILE CD1  C    7.637   2.601  -3.113 1.00 . A A .  30 ILE CD1  1 1 
        1   402 1 1 30 ILE CG1  C    7.255   1.217  -3.589 1.00 . A A .  30 ILE CG1  1 1 
        1   403 1 1 30 ILE CG2  C    6.819   0.030  -1.422 1.00 . A A .  30 ILE CG2  1 1 
        1   404 1 1 30 ILE H    H    5.122   0.731  -5.059 1.00 . A A .  30 ILE H    1 1 
        1   405 1 1 30 ILE HA   H    6.296  -1.323  -3.766 1.00 . A A .  30 ILE HA   1 1 
        1   406 1 1 30 ILE HB   H    5.436   1.261  -2.459 1.00 . A A .  30 ILE HB   1 1 
        1   407 1 1 30 ILE HD11 H    6.764   3.238  -3.122 1.00 . A A .  30 ILE HD11 1 1 
        1   408 1 1 30 ILE HD12 H    8.027   2.541  -2.107 1.00 . A A .  30 ILE HD12 1 1 
        1   409 1 1 30 ILE HD13 H    8.389   3.013  -3.768 1.00 . A A .  30 ILE HD13 1 1 
        1   410 1 1 30 ILE HG12 H    8.147   0.612  -3.597 1.00 . A A .  30 ILE HG12 1 1 
        1   411 1 1 30 ILE HG13 H    6.874   1.305  -4.596 1.00 . A A .  30 ILE HG13 1 1 
        1   412 1 1 30 ILE HG21 H    7.887  -0.069  -1.551 1.00 . A A .  30 ILE HG21 1 1 
        1   413 1 1 30 ILE HG22 H    6.617   0.731  -0.625 1.00 . A A .  30 ILE HG22 1 1 
        1   414 1 1 30 ILE HG23 H    6.395  -0.931  -1.173 1.00 . A A .  30 ILE HG23 1 1 
        1   415 1 1 30 ILE N    N    4.878  -0.145  -4.695 1.00 . A A .  30 ILE N    1 1 
        1   416 1 1 30 ILE O    O    4.860  -2.320  -1.925 1.00 . A A .  30 ILE O    1 1 
        1   417 1 1 31 HIS C    C    1.749  -2.649  -2.246 1.00 . A A .  31 HIS C    1 1 
        1   418 1 1 31 HIS CA   C    2.278  -1.350  -1.647 1.00 . A A .  31 HIS CA   1 1 
        1   419 1 1 31 HIS CB   C    1.133  -0.353  -1.469 1.00 . A A .  31 HIS CB   1 1 
        1   420 1 1 31 HIS CD2  C   -1.337  -1.115  -1.685 1.00 . A A .  31 HIS CD2  1 1 
        1   421 1 1 31 HIS CE1  C   -1.555  -2.058   0.282 1.00 . A A .  31 HIS CE1  1 1 
        1   422 1 1 31 HIS CG   C   -0.154  -0.989  -1.040 1.00 . A A .  31 HIS CG   1 1 
        1   423 1 1 31 HIS H    H    3.124   0.024  -3.018 1.00 . A A .  31 HIS H    1 1 
        1   424 1 1 31 HIS HA   H    2.711  -1.563  -0.681 1.00 . A A .  31 HIS HA   1 1 
        1   425 1 1 31 HIS HB2  H    1.409   0.373  -0.718 1.00 . A A .  31 HIS HB2  1 1 
        1   426 1 1 31 HIS HB3  H    0.957   0.155  -2.406 1.00 . A A .  31 HIS HB3  1 1 
        1   427 1 1 31 HIS HD1  H    0.358  -1.662   0.889 1.00 . A A .  31 HIS HD1  1 1 
        1   428 1 1 31 HIS HD2  H   -1.568  -0.756  -2.679 1.00 . A A .  31 HIS HD2  1 1 
        1   429 1 1 31 HIS HE1  H   -1.972  -2.578   1.131 1.00 . A A .  31 HIS HE1  1 1 
        1   430 1 1 31 HIS N    N    3.322  -0.777  -2.489 1.00 . A A .  31 HIS N    1 1 
        1   431 1 1 31 HIS ND1  N   -0.323  -1.589   0.189 1.00 . A A .  31 HIS ND1  1 1 
        1   432 1 1 31 HIS NE2  N   -2.191  -1.783  -0.843 1.00 . A A .  31 HIS NE2  1 1 
        1   433 1 1 31 HIS O    O    1.667  -3.669  -1.562 1.00 . A A .  31 HIS O    1 1 
        1   434 1 1 32 GLN C    C    1.775  -4.984  -3.998 1.00 . A A .  32 GLN C    1 1 
        1   435 1 1 32 GLN CA   C    0.868  -3.777  -4.214 1.00 . A A .  32 GLN CA   1 1 
        1   436 1 1 32 GLN CB   C    0.724  -3.494  -5.710 1.00 . A A .  32 GLN CB   1 1 
        1   437 1 1 32 GLN CD   C   -0.747  -2.473  -7.493 1.00 . A A .  32 GLN CD   1 1 
        1   438 1 1 32 GLN CG   C   -0.338  -2.455  -6.033 1.00 . A A .  32 GLN CG   1 1 
        1   439 1 1 32 GLN H    H    1.480  -1.761  -4.016 1.00 . A A .  32 GLN H    1 1 
        1   440 1 1 32 GLN HA   H   -0.106  -3.996  -3.803 1.00 . A A .  32 GLN HA   1 1 
        1   441 1 1 32 GLN HB2  H    1.671  -3.140  -6.090 1.00 . A A .  32 GLN HB2  1 1 
        1   442 1 1 32 GLN HB3  H    0.463  -4.412  -6.215 1.00 . A A .  32 GLN HB3  1 1 
        1   443 1 1 32 GLN HE21 H   -1.466  -0.626  -7.340 1.00 . A A .  32 GLN HE21 1 1 
        1   444 1 1 32 GLN HE22 H   -1.608  -1.360  -8.897 1.00 . A A .  32 GLN HE22 1 1 
        1   445 1 1 32 GLN HG2  H   -1.211  -2.651  -5.429 1.00 . A A .  32 GLN HG2  1 1 
        1   446 1 1 32 GLN HG3  H    0.051  -1.476  -5.795 1.00 . A A .  32 GLN HG3  1 1 
        1   447 1 1 32 GLN N    N    1.391  -2.603  -3.525 1.00 . A A .  32 GLN N    1 1 
        1   448 1 1 32 GLN NE2  N   -1.334  -1.376  -7.957 1.00 . A A .  32 GLN NE2  1 1 
        1   449 1 1 32 GLN O    O    1.360  -6.127  -4.189 1.00 . A A .  32 GLN O    1 1 
        1   450 1 1 32 GLN OE1  O   -0.538  -3.463  -8.196 1.00 . A A .  32 GLN OE1  1 1 
        1   451 1 1 33 ALA C    C    3.774  -6.410  -1.978 1.00 . A A .  33 ALA C    1 1 
        1   452 1 1 33 ALA CA   C    3.980  -5.787  -3.355 1.00 . A A .  33 ALA CA   1 1 
        1   453 1 1 33 ALA CB   C    5.399  -5.254  -3.488 1.00 . A A .  33 ALA CB   1 1 
        1   454 1 1 33 ALA H    H    3.287  -3.791  -3.463 1.00 . A A .  33 ALA H    1 1 
        1   455 1 1 33 ALA HA   H    3.835  -6.548  -4.109 1.00 . A A .  33 ALA HA   1 1 
        1   456 1 1 33 ALA HB1  H    5.536  -4.422  -2.814 1.00 . A A .  33 ALA HB1  1 1 
        1   457 1 1 33 ALA HB2  H    6.101  -6.037  -3.242 1.00 . A A .  33 ALA HB2  1 1 
        1   458 1 1 33 ALA HB3  H    5.566  -4.926  -4.503 1.00 . A A .  33 ALA HB3  1 1 
        1   459 1 1 33 ALA N    N    3.015  -4.722  -3.598 1.00 . A A .  33 ALA N    1 1 
        1   460 1 1 33 ALA O    O    4.634  -7.137  -1.479 1.00 . A A .  33 ALA O    1 1 
        1   461 1 1 34 THR C    C    1.117  -7.596  -0.109 1.00 . A A .  34 THR C    1 1 
        1   462 1 1 34 THR CA   C    2.311  -6.651  -0.048 1.00 . A A .  34 THR CA   1 1 
        1   463 1 1 34 THR CB   C    2.007  -5.521   0.953 1.00 . A A .  34 THR CB   1 1 
        1   464 1 1 34 THR CG2  C    3.210  -4.604   1.115 1.00 . A A .  34 THR CG2  1 1 
        1   465 1 1 34 THR H    H    1.984  -5.536  -1.817 1.00 . A A .  34 THR H    1 1 
        1   466 1 1 34 THR HA   H    3.173  -7.197   0.308 1.00 . A A .  34 THR HA   1 1 
        1   467 1 1 34 THR HB   H    1.778  -5.962   1.912 1.00 . A A .  34 THR HB   1 1 
        1   468 1 1 34 THR HG1  H    0.935  -3.869   0.855 1.00 . A A .  34 THR HG1  1 1 
        1   469 1 1 34 THR HG21 H    3.171  -4.129   2.084 1.00 . A A .  34 THR HG21 1 1 
        1   470 1 1 34 THR HG22 H    3.193  -3.848   0.344 1.00 . A A .  34 THR HG22 1 1 
        1   471 1 1 34 THR HG23 H    4.118  -5.182   1.033 1.00 . A A .  34 THR HG23 1 1 
        1   472 1 1 34 THR N    N    2.629  -6.121  -1.368 1.00 . A A .  34 THR N    1 1 
        1   473 1 1 34 THR O    O    0.999  -8.516   0.702 1.00 . A A .  34 THR O    1 1 
        1   474 1 1 34 THR OG1  O    0.878  -4.761   0.506 1.00 . A A .  34 THR OG1  1 1 
        1   475 1 1 35 HIS C    C   -0.565  -9.631  -1.590 1.00 . A A .  35 HIS C    1 1 
        1   476 1 1 35 HIS CA   C   -0.953  -8.198  -1.241 1.00 . A A .  35 HIS CA   1 1 
        1   477 1 1 35 HIS CB   C   -1.857  -7.622  -2.331 1.00 . A A .  35 HIS CB   1 1 
        1   478 1 1 35 HIS CD2  C   -2.406  -5.110  -1.990 1.00 . A A .  35 HIS CD2  1 1 
        1   479 1 1 35 HIS CE1  C   -4.332  -5.339  -0.967 1.00 . A A .  35 HIS CE1  1 1 
        1   480 1 1 35 HIS CG   C   -2.655  -6.436  -1.883 1.00 . A A .  35 HIS CG   1 1 
        1   481 1 1 35 HIS H    H    0.382  -6.617  -1.689 1.00 . A A .  35 HIS H    1 1 
        1   482 1 1 35 HIS HA   H   -1.490  -8.201  -0.305 1.00 . A A .  35 HIS HA   1 1 
        1   483 1 1 35 HIS HB2  H   -1.249  -7.314  -3.169 1.00 . A A .  35 HIS HB2  1 1 
        1   484 1 1 35 HIS HB3  H   -2.549  -8.385  -2.656 1.00 . A A .  35 HIS HB3  1 1 
        1   485 1 1 35 HIS HD1  H   -4.322  -7.384  -1.011 1.00 . A A .  35 HIS HD1  1 1 
        1   486 1 1 35 HIS HD2  H   -1.538  -4.655  -2.445 1.00 . A A .  35 HIS HD2  1 1 
        1   487 1 1 35 HIS HE1  H   -5.262  -5.116  -0.467 1.00 . A A .  35 HIS HE1  1 1 
        1   488 1 1 35 HIS N    N    0.233  -7.365  -1.074 1.00 . A A .  35 HIS N    1 1 
        1   489 1 1 35 HIS ND1  N   -3.868  -6.546  -1.237 1.00 . A A .  35 HIS ND1  1 1 
        1   490 1 1 35 HIS NE2  N   -3.464  -4.450  -1.414 1.00 . A A .  35 HIS NE2  1 1 
        1   491 1 1 35 HIS O    O   -1.048 -10.582  -0.975 1.00 . A A .  35 HIS O    1 1 
        1   492 1 1 36 SER C    C    0.854 -12.055  -1.830 1.00 . A A .  36 SER C    1 1 
        1   493 1 1 36 SER CA   C    0.758 -11.097  -3.013 1.00 . A A .  36 SER CA   1 1 
        1   494 1 1 36 SER CB   C    2.115 -10.993  -3.711 1.00 . A A .  36 SER CB   1 1 
        1   495 1 1 36 SER H    H    0.658  -8.982  -3.032 1.00 . A A .  36 SER H    1 1 
        1   496 1 1 36 SER HA   H    0.031 -11.481  -3.714 1.00 . A A .  36 SER HA   1 1 
        1   497 1 1 36 SER HB2  H    2.310 -11.906  -4.252 1.00 . A A .  36 SER HB2  1 1 
        1   498 1 1 36 SER HB3  H    2.099 -10.162  -4.402 1.00 . A A .  36 SER HB3  1 1 
        1   499 1 1 36 SER HG   H    3.768 -11.526  -2.804 1.00 . A A .  36 SER HG   1 1 
        1   500 1 1 36 SER N    N    0.309  -9.779  -2.580 1.00 . A A .  36 SER N    1 1 
        1   501 1 1 36 SER O    O    1.453 -11.734  -0.804 1.00 . A A .  36 SER O    1 1 
        1   502 1 1 36 SER OG   O    3.157 -10.786  -2.772 1.00 . A A .  36 SER OG   1 1 
        1   503 1 1 37 GLY C    C   -0.403 -15.513  -1.307 1.00 . A A .  37 GLY C    1 1 
        1   504 1 1 37 GLY CA   C    0.287 -14.221  -0.917 1.00 . A A .  37 GLY CA   1 1 
        1   505 1 1 37 GLY H    H   -0.206 -13.435  -2.820 1.00 . A A .  37 GLY H    1 1 
        1   506 1 1 37 GLY HA2  H    1.315 -14.435  -0.667 1.00 . A A .  37 GLY HA2  1 1 
        1   507 1 1 37 GLY HA3  H   -0.207 -13.811  -0.048 1.00 . A A .  37 GLY HA3  1 1 
        1   508 1 1 37 GLY N    N    0.258 -13.234  -1.980 1.00 . A A .  37 GLY N    1 1 
        1   509 1 1 37 GLY O    O   -1.606 -15.528  -1.566 1.00 . A A .  37 GLY O    1 1 
        1   510 1 1 38 GLU C    C    0.702 -19.029  -1.191 1.00 . A A .  38 GLU C    1 1 
        1   511 1 1 38 GLU CA   C   -0.185 -17.903  -1.713 1.00 . A A .  38 GLU CA   1 1 
        1   512 1 1 38 GLU CB   C   -0.328 -18.014  -3.233 1.00 . A A .  38 GLU CB   1 1 
        1   513 1 1 38 GLU CD   C    0.908 -17.562  -5.389 1.00 . A A .  38 GLU CD   1 1 
        1   514 1 1 38 GLU CG   C    1.001 -18.078  -3.966 1.00 . A A .  38 GLU CG   1 1 
        1   515 1 1 38 GLU H    H    1.314 -16.524  -1.132 1.00 . A A .  38 GLU H    1 1 
        1   516 1 1 38 GLU HA   H   -1.161 -17.991  -1.262 1.00 . A A .  38 GLU HA   1 1 
        1   517 1 1 38 GLU HB2  H   -0.887 -18.908  -3.465 1.00 . A A .  38 GLU HB2  1 1 
        1   518 1 1 38 GLU HB3  H   -0.873 -17.155  -3.594 1.00 . A A .  38 GLU HB3  1 1 
        1   519 1 1 38 GLU HG2  H    1.723 -17.480  -3.430 1.00 . A A .  38 GLU HG2  1 1 
        1   520 1 1 38 GLU HG3  H    1.335 -19.105  -3.992 1.00 . A A .  38 GLU HG3  1 1 
        1   521 1 1 38 GLU N    N    0.361 -16.600  -1.350 1.00 . A A .  38 GLU N    1 1 
        1   522 1 1 38 GLU O    O    1.851 -18.805  -0.810 1.00 . A A .  38 GLU O    1 1 
        1   523 1 1 38 GLU OE1  O    0.948 -16.328  -5.576 1.00 . A A .  38 GLU OE1  1 1 
        1   524 1 1 38 GLU OE2  O    0.794 -18.392  -6.315 1.00 . A A .  38 GLU OE2  1 1 
        1   525 1 1 39 LYS C    C    1.604 -21.102   0.617 1.00 . A A .  39 LYS C    1 1 
        1   526 1 1 39 LYS CA   C    0.900 -21.406  -0.702 1.00 . A A .  39 LYS CA   1 1 
        1   527 1 1 39 LYS CB   C    1.925 -21.846  -1.750 1.00 . A A .  39 LYS CB   1 1 
        1   528 1 1 39 LYS CD   C    2.204 -22.817  -4.050 1.00 . A A .  39 LYS CD   1 1 
        1   529 1 1 39 LYS CE   C    1.953 -24.069  -4.875 1.00 . A A .  39 LYS CE   1 1 
        1   530 1 1 39 LYS CG   C    1.363 -22.806  -2.784 1.00 . A A .  39 LYS CG   1 1 
        1   531 1 1 39 LYS H    H   -0.760 -20.358  -1.493 1.00 . A A .  39 LYS H    1 1 
        1   532 1 1 39 LYS HA   H    0.194 -22.206  -0.543 1.00 . A A .  39 LYS HA   1 1 
        1   533 1 1 39 LYS HB2  H    2.295 -20.971  -2.264 1.00 . A A .  39 LYS HB2  1 1 
        1   534 1 1 39 LYS HB3  H    2.749 -22.332  -1.248 1.00 . A A .  39 LYS HB3  1 1 
        1   535 1 1 39 LYS HD2  H    1.954 -21.951  -4.645 1.00 . A A .  39 LYS HD2  1 1 
        1   536 1 1 39 LYS HD3  H    3.249 -22.779  -3.777 1.00 . A A .  39 LYS HD3  1 1 
        1   537 1 1 39 LYS HE2  H    1.755 -24.892  -4.206 1.00 . A A .  39 LYS HE2  1 1 
        1   538 1 1 39 LYS HE3  H    1.091 -23.902  -5.505 1.00 . A A .  39 LYS HE3  1 1 
        1   539 1 1 39 LYS HG2  H    1.348 -23.802  -2.367 1.00 . A A .  39 LYS HG2  1 1 
        1   540 1 1 39 LYS HG3  H    0.357 -22.503  -3.034 1.00 . A A .  39 LYS HG3  1 1 
        1   541 1 1 39 LYS HZ1  H    3.983 -23.967  -5.357 1.00 . A A .  39 LYS HZ1  1 1 
        1   542 1 1 39 LYS HZ2  H    2.963 -24.072  -6.703 1.00 . A A .  39 LYS HZ2  1 1 
        1   543 1 1 39 LYS HZ3  H    3.257 -25.442  -5.756 1.00 . A A .  39 LYS HZ3  1 1 
        1   544 1 1 39 LYS N    N    0.160 -20.242  -1.176 1.00 . A A .  39 LYS N    1 1 
        1   545 1 1 39 LYS NZ   N    3.121 -24.412  -5.733 1.00 . A A .  39 LYS NZ   1 1 
        1   546 1 1 39 LYS O    O    2.810 -21.303   0.765 1.00 . A A .  39 LYS O    1 1 
        1   547 1 1 40 PRO C    C    1.763 -21.506   3.723 1.00 . A A .  40 PRO C    1 1 
        1   548 1 1 40 PRO CA   C    1.364 -20.270   2.924 1.00 . A A .  40 PRO CA   1 1 
        1   549 1 1 40 PRO CB   C    0.194 -19.550   3.599 1.00 . A A .  40 PRO CB   1 1 
        1   550 1 1 40 PRO CD   C   -0.609 -20.345   1.493 1.00 . A A .  40 PRO CD   1 1 
        1   551 1 1 40 PRO CG   C   -1.020 -20.075   2.914 1.00 . A A .  40 PRO CG   1 1 
        1   552 1 1 40 PRO HA   H    2.209 -19.600   2.854 1.00 . A A .  40 PRO HA   1 1 
        1   553 1 1 40 PRO HB2  H    0.186 -19.784   4.654 1.00 . A A .  40 PRO HB2  1 1 
        1   554 1 1 40 PRO HB3  H    0.295 -18.484   3.462 1.00 . A A .  40 PRO HB3  1 1 
        1   555 1 1 40 PRO HD2  H   -1.131 -21.207   1.106 1.00 . A A .  40 PRO HD2  1 1 
        1   556 1 1 40 PRO HD3  H   -0.798 -19.479   0.875 1.00 . A A .  40 PRO HD3  1 1 
        1   557 1 1 40 PRO HG2  H   -1.344 -20.988   3.390 1.00 . A A .  40 PRO HG2  1 1 
        1   558 1 1 40 PRO HG3  H   -1.806 -19.335   2.942 1.00 . A A .  40 PRO HG3  1 1 
        1   559 1 1 40 PRO N    N    0.836 -20.609   1.599 1.00 . A A .  40 PRO N    1 1 
        1   560 1 1 40 PRO O    O    0.973 -22.437   3.878 1.00 . A A .  40 PRO O    1 1 
        1   561 1 1 41 SER C    C    3.263 -22.405   6.499 1.00 . A A .  41 SER C    1 1 
        1   562 1 1 41 SER CA   C    3.496 -22.631   5.009 1.00 . A A .  41 SER CA   1 1 
        1   563 1 1 41 SER CB   C    4.988 -22.838   4.740 1.00 . A A .  41 SER CB   1 1 
        1   564 1 1 41 SER H    H    3.575 -20.735   4.069 1.00 . A A .  41 SER H    1 1 
        1   565 1 1 41 SER HA   H    2.958 -23.515   4.702 1.00 . A A .  41 SER HA   1 1 
        1   566 1 1 41 SER HB2  H    5.138 -23.038   3.690 1.00 . A A .  41 SER HB2  1 1 
        1   567 1 1 41 SER HB3  H    5.528 -21.944   5.016 1.00 . A A .  41 SER HB3  1 1 
        1   568 1 1 41 SER HG   H    6.158 -23.612   6.107 1.00 . A A .  41 SER HG   1 1 
        1   569 1 1 41 SER N    N    2.992 -21.507   4.228 1.00 . A A .  41 SER N    1 1 
        1   570 1 1 41 SER O    O    4.166 -21.988   7.224 1.00 . A A .  41 SER O    1 1 
        1   571 1 1 41 SER OG   O    5.495 -23.928   5.489 1.00 . A A .  41 SER OG   1 1 
        1   572 1 1 42 GLY C    C    0.371 -21.825   8.548 1.00 . A A .  42 GLY C    1 1 
        1   573 1 1 42 GLY CA   C    1.712 -22.503   8.352 1.00 . A A .  42 GLY CA   1 1 
        1   574 1 1 42 GLY H    H    1.363 -23.012   6.326 1.00 . A A .  42 GLY H    1 1 
        1   575 1 1 42 GLY HA2  H    1.689 -23.470   8.832 1.00 . A A .  42 GLY HA2  1 1 
        1   576 1 1 42 GLY HA3  H    2.478 -21.900   8.817 1.00 . A A .  42 GLY HA3  1 1 
        1   577 1 1 42 GLY N    N    2.044 -22.682   6.950 1.00 . A A .  42 GLY N    1 1 
        1   578 1 1 42 GLY O    O    0.291 -20.662   8.942 1.00 . A A .  42 GLY O    1 1 
        1   579 1 1 43 PRO C    C   -2.475 -21.838   9.867 1.00 . A A .  43 PRO C    1 1 
        1   580 1 1 43 PRO CA   C   -2.080 -22.044   8.408 1.00 . A A .  43 PRO CA   1 1 
        1   581 1 1 43 PRO CB   C   -2.940 -23.138   7.771 1.00 . A A .  43 PRO CB   1 1 
        1   582 1 1 43 PRO CD   C   -0.694 -23.955   7.795 1.00 . A A .  43 PRO CD   1 1 
        1   583 1 1 43 PRO CG   C   -2.132 -24.382   7.904 1.00 . A A .  43 PRO CG   1 1 
        1   584 1 1 43 PRO HA   H   -2.211 -21.119   7.867 1.00 . A A .  43 PRO HA   1 1 
        1   585 1 1 43 PRO HB2  H   -3.879 -23.216   8.302 1.00 . A A .  43 PRO HB2  1 1 
        1   586 1 1 43 PRO HB3  H   -3.126 -22.896   6.735 1.00 . A A .  43 PRO HB3  1 1 
        1   587 1 1 43 PRO HD2  H   -0.070 -24.569   8.427 1.00 . A A .  43 PRO HD2  1 1 
        1   588 1 1 43 PRO HD3  H   -0.362 -24.008   6.768 1.00 . A A .  43 PRO HD3  1 1 
        1   589 1 1 43 PRO HG2  H   -2.316 -24.838   8.864 1.00 . A A .  43 PRO HG2  1 1 
        1   590 1 1 43 PRO HG3  H   -2.381 -25.067   7.107 1.00 . A A .  43 PRO HG3  1 1 
        1   591 1 1 43 PRO N    N   -0.715 -22.561   8.269 1.00 . A A .  43 PRO N    1 1 
        1   592 1 1 43 PRO O    O   -3.606 -21.454  10.165 1.00 . A A .  43 PRO O    1 1 
        1   593 1 1 44 SER C    C   -2.670 -20.725  12.467 1.00 . A A .  44 SER C    1 1 
        1   594 1 1 44 SER CA   C   -1.787 -21.940  12.199 1.00 . A A .  44 SER CA   1 1 
        1   595 1 1 44 SER CB   C   -0.467 -21.803  12.960 1.00 . A A .  44 SER CB   1 1 
        1   596 1 1 44 SER H    H   -0.653 -22.398  10.471 1.00 . A A .  44 SER H    1 1 
        1   597 1 1 44 SER HA   H   -2.301 -22.826  12.543 1.00 . A A .  44 SER HA   1 1 
        1   598 1 1 44 SER HB2  H   -0.666 -21.780  14.020 1.00 . A A .  44 SER HB2  1 1 
        1   599 1 1 44 SER HB3  H    0.167 -22.647  12.730 1.00 . A A .  44 SER HB3  1 1 
        1   600 1 1 44 SER HG   H   -0.427 -19.965  12.284 1.00 . A A .  44 SER HG   1 1 
        1   601 1 1 44 SER N    N   -1.536 -22.095  10.772 1.00 . A A .  44 SER N    1 1 
        1   602 1 1 44 SER O    O   -3.456 -20.711  13.414 1.00 . A A .  44 SER O    1 1 
        1   603 1 1 44 SER OG   O    0.210 -20.612  12.596 1.00 . A A .  44 SER OG   1 1 
        1   604 1 1 45 SER C    C   -4.467 -18.451  10.773 1.00 . A A .  45 SER C    1 1 
        1   605 1 1 45 SER CA   C   -3.314 -18.483  11.772 1.00 . A A .  45 SER CA   1 1 
        1   606 1 1 45 SER CB   C   -2.422 -17.255  11.577 1.00 . A A .  45 SER CB   1 1 
        1   607 1 1 45 SER H    H   -1.889 -19.776  10.889 1.00 . A A .  45 SER H    1 1 
        1   608 1 1 45 SER HA   H   -3.720 -18.467  12.772 1.00 . A A .  45 SER HA   1 1 
        1   609 1 1 45 SER HB2  H   -3.032 -16.365  11.586 1.00 . A A .  45 SER HB2  1 1 
        1   610 1 1 45 SER HB3  H   -1.701 -17.207  12.380 1.00 . A A .  45 SER HB3  1 1 
        1   611 1 1 45 SER HG   H   -2.359 -17.400   9.624 1.00 . A A .  45 SER HG   1 1 
        1   612 1 1 45 SER N    N   -2.533 -19.705  11.625 1.00 . A A .  45 SER N    1 1 
        1   613 1 1 45 SER O    O   -4.298 -18.041   9.625 1.00 . A A .  45 SER O    1 1 
        1   614 1 1 45 SER OG   O   -1.728 -17.320  10.343 1.00 . A A .  45 SER OG   1 1 
        1   615 1 1 46 GLY C    C   -7.062 -20.270   9.749 1.00 . A A .  46 GLY C    1 1 
        1   616 1 1 46 GLY CA   C   -6.805 -18.904  10.352 1.00 . A A .  46 GLY CA   1 1 
        1   617 1 1 46 GLY H    H   -5.717 -19.205  12.144 1.00 . A A .  46 GLY H    1 1 
        1   618 1 1 46 GLY HA2  H   -7.670 -18.606  10.925 1.00 . A A .  46 GLY HA2  1 1 
        1   619 1 1 46 GLY HA3  H   -6.653 -18.193   9.553 1.00 . A A .  46 GLY HA3  1 1 
        1   620 1 1 46 GLY N    N   -5.641 -18.889  11.219 1.00 . A A .  46 GLY N    1 1 
        1   621 1 1 46 GLY O    O   -8.094 -20.457   9.107 1.00 . A A .  46 GLY O    1 1 
        1   622 2 2  1 ZN  ZN   ZN  -4.053  -2.485  -1.461 1.00 . B A . 201 ZN  ZN   1 1 
        2   623 1 1  1 GLY C    C  -18.305   7.845 -10.336 1.00 . A A .   1 GLY C    1 1 
        2   624 1 1  1 GLY CA   C  -17.399   6.634 -10.236 1.00 . A A .   1 GLY CA   1 1 
        2   625 1 1  1 GLY H1   H  -15.656   7.468 -11.101 1.00 . A A .   1 GLY H1   1 1 
        2   626 1 1  1 GLY HA2  H  -17.637   5.952 -11.038 1.00 . A A .   1 GLY HA2  1 1 
        2   627 1 1  1 GLY HA3  H  -17.581   6.141  -9.292 1.00 . A A .   1 GLY HA3  1 1 
        2   628 1 1  1 GLY N    N  -15.993   6.984 -10.318 1.00 . A A .   1 GLY N    1 1 
        2   629 1 1  1 GLY O    O  -17.856   8.938 -10.680 1.00 . A A .   1 GLY O    1 1 
        2   630 1 1  2 SER C    C  -21.027   9.128  -8.702 1.00 . A A .   2 SER C    1 1 
        2   631 1 1  2 SER CA   C  -20.558   8.736 -10.100 1.00 . A A .   2 SER CA   1 1 
        2   632 1 1  2 SER CB   C  -21.758   8.324 -10.955 1.00 . A A .   2 SER CB   1 1 
        2   633 1 1  2 SER H    H  -19.883   6.757  -9.768 1.00 . A A .   2 SER H    1 1 
        2   634 1 1  2 SER HA   H  -20.076   9.587 -10.557 1.00 . A A .   2 SER HA   1 1 
        2   635 1 1  2 SER HB2  H  -22.484   9.123 -10.961 1.00 . A A .   2 SER HB2  1 1 
        2   636 1 1  2 SER HB3  H  -21.427   8.130 -11.965 1.00 . A A .   2 SER HB3  1 1 
        2   637 1 1  2 SER HG   H  -21.758   6.417 -10.504 1.00 . A A .   2 SER HG   1 1 
        2   638 1 1  2 SER N    N  -19.585   7.651 -10.036 1.00 . A A .   2 SER N    1 1 
        2   639 1 1  2 SER O    O  -22.214   9.363  -8.476 1.00 . A A .   2 SER O    1 1 
        2   640 1 1  2 SER OG   O  -22.371   7.153 -10.443 1.00 . A A .   2 SER OG   1 1 
        2   641 1 1  3 SER C    C  -19.126   9.792  -5.583 1.00 . A A .   3 SER C    1 1 
        2   642 1 1  3 SER CA   C  -20.400   9.556  -6.389 1.00 . A A .   3 SER CA   1 1 
        2   643 1 1  3 SER CB   C  -21.237   8.457  -5.731 1.00 . A A .   3 SER CB   1 1 
        2   644 1 1  3 SER H    H  -19.156   8.998  -8.008 1.00 . A A .   3 SER H    1 1 
        2   645 1 1  3 SER HA   H  -20.974  10.470  -6.408 1.00 . A A .   3 SER HA   1 1 
        2   646 1 1  3 SER HB2  H  -21.710   8.850  -4.844 1.00 . A A .   3 SER HB2  1 1 
        2   647 1 1  3 SER HB3  H  -21.994   8.121  -6.425 1.00 . A A .   3 SER HB3  1 1 
        2   648 1 1  3 SER HG   H  -20.246   7.385  -4.424 1.00 . A A .   3 SER HG   1 1 
        2   649 1 1  3 SER N    N  -20.085   9.196  -7.766 1.00 . A A .   3 SER N    1 1 
        2   650 1 1  3 SER O    O  -18.179   9.010  -5.656 1.00 . A A .   3 SER O    1 1 
        2   651 1 1  3 SER OG   O  -20.429   7.351  -5.366 1.00 . A A .   3 SER OG   1 1 
        2   652 1 1  4 GLY C    C  -16.824  11.800  -4.823 1.00 . A A .   4 GLY C    1 1 
        2   653 1 1  4 GLY CA   C  -17.950  11.197  -4.006 1.00 . A A .   4 GLY CA   1 1 
        2   654 1 1  4 GLY H    H  -19.896  11.464  -4.796 1.00 . A A .   4 GLY H    1 1 
        2   655 1 1  4 GLY HA2  H  -18.241  11.900  -3.240 1.00 . A A .   4 GLY HA2  1 1 
        2   656 1 1  4 GLY HA3  H  -17.593  10.293  -3.535 1.00 . A A .   4 GLY HA3  1 1 
        2   657 1 1  4 GLY N    N  -19.111  10.877  -4.815 1.00 . A A .   4 GLY N    1 1 
        2   658 1 1  4 GLY O    O  -15.844  11.123  -5.137 1.00 . A A .   4 GLY O    1 1 
        2   659 1 1  5 SER C    C  -15.628  15.131  -5.354 1.00 . A A .   5 SER C    1 1 
        2   660 1 1  5 SER CA   C  -15.952  13.768  -5.960 1.00 . A A .   5 SER CA   1 1 
        2   661 1 1  5 SER CB   C  -16.431  13.939  -7.402 1.00 . A A .   5 SER CB   1 1 
        2   662 1 1  5 SER H    H  -17.767  13.562  -4.889 1.00 . A A .   5 SER H    1 1 
        2   663 1 1  5 SER HA   H  -15.057  13.164  -5.956 1.00 . A A .   5 SER HA   1 1 
        2   664 1 1  5 SER HB2  H  -15.620  14.319  -8.005 1.00 . A A .   5 SER HB2  1 1 
        2   665 1 1  5 SER HB3  H  -16.749  12.982  -7.789 1.00 . A A .   5 SER HB3  1 1 
        2   666 1 1  5 SER HG   H  -18.324  14.401  -7.205 1.00 . A A .   5 SER HG   1 1 
        2   667 1 1  5 SER N    N  -16.963  13.076  -5.169 1.00 . A A .   5 SER N    1 1 
        2   668 1 1  5 SER O    O  -14.463  15.508  -5.233 1.00 . A A .   5 SER O    1 1 
        2   669 1 1  5 SER OG   O  -17.518  14.846  -7.475 1.00 . A A .   5 SER OG   1 1 
        2   670 1 1  6 SER C    C  -15.260  17.228  -3.494 1.00 . A A .   6 SER C    1 1 
        2   671 1 1  6 SER CA   C  -16.498  17.187  -4.385 1.00 . A A .   6 SER CA   1 1 
        2   672 1 1  6 SER CB   C  -17.737  17.573  -3.575 1.00 . A A .   6 SER CB   1 1 
        2   673 1 1  6 SER H    H  -17.575  15.509  -5.097 1.00 . A A .   6 SER H    1 1 
        2   674 1 1  6 SER HA   H  -16.370  17.895  -5.191 1.00 . A A .   6 SER HA   1 1 
        2   675 1 1  6 SER HB2  H  -17.916  16.824  -2.819 1.00 . A A .   6 SER HB2  1 1 
        2   676 1 1  6 SER HB3  H  -17.571  18.530  -3.102 1.00 . A A .   6 SER HB3  1 1 
        2   677 1 1  6 SER HG   H  -18.829  17.001  -5.098 1.00 . A A .   6 SER HG   1 1 
        2   678 1 1  6 SER N    N  -16.669  15.865  -4.975 1.00 . A A .   6 SER N    1 1 
        2   679 1 1  6 SER O    O  -14.948  16.261  -2.801 1.00 . A A .   6 SER O    1 1 
        2   680 1 1  6 SER OG   O  -18.881  17.665  -4.406 1.00 . A A .   6 SER OG   1 1 
        2   681 1 1  7 GLY C    C  -12.119  18.726  -3.545 1.00 . A A .   7 GLY C    1 1 
        2   682 1 1  7 GLY CA   C  -13.363  18.505  -2.708 1.00 . A A .   7 GLY CA   1 1 
        2   683 1 1  7 GLY H    H  -14.855  19.096  -4.089 1.00 . A A .   7 GLY H    1 1 
        2   684 1 1  7 GLY HA2  H  -13.492  19.347  -2.045 1.00 . A A .   7 GLY HA2  1 1 
        2   685 1 1  7 GLY HA3  H  -13.230  17.611  -2.116 1.00 . A A .   7 GLY HA3  1 1 
        2   686 1 1  7 GLY N    N  -14.559  18.358  -3.517 1.00 . A A .   7 GLY N    1 1 
        2   687 1 1  7 GLY O    O  -12.179  18.711  -4.775 1.00 . A A .   7 GLY O    1 1 
        2   688 1 1  8 THR C    C   -9.379  17.990  -4.483 1.00 . A A .   8 THR C    1 1 
        2   689 1 1  8 THR CA   C   -9.725  19.160  -3.569 1.00 . A A .   8 THR CA   1 1 
        2   690 1 1  8 THR CB   C   -8.571  19.377  -2.573 1.00 . A A .   8 THR CB   1 1 
        2   691 1 1  8 THR CG2  C   -8.738  20.693  -1.829 1.00 . A A .   8 THR CG2  1 1 
        2   692 1 1  8 THR H    H  -11.005  18.932  -1.899 1.00 . A A .   8 THR H    1 1 
        2   693 1 1  8 THR HA   H   -9.828  20.054  -4.168 1.00 . A A .   8 THR HA   1 1 
        2   694 1 1  8 THR HB   H   -7.641  19.407  -3.123 1.00 . A A .   8 THR HB   1 1 
        2   695 1 1  8 THR HG1  H   -9.404  17.927  -1.527 1.00 . A A .   8 THR HG1  1 1 
        2   696 1 1  8 THR HG21 H   -9.466  20.571  -1.042 1.00 . A A .   8 THR HG21 1 1 
        2   697 1 1  8 THR HG22 H   -9.075  21.455  -2.516 1.00 . A A .   8 THR HG22 1 1 
        2   698 1 1  8 THR HG23 H   -7.791  20.988  -1.401 1.00 . A A .   8 THR HG23 1 1 
        2   699 1 1  8 THR N    N  -10.988  18.932  -2.879 1.00 . A A .   8 THR N    1 1 
        2   700 1 1  8 THR O    O   -8.740  18.167  -5.520 1.00 . A A .   8 THR O    1 1 
        2   701 1 1  8 THR OG1  O   -8.524  18.296  -1.635 1.00 . A A .   8 THR OG1  1 1 
        2   702 1 1  9 GLY C    C   -8.067  15.488  -5.258 1.00 . A A .   9 GLY C    1 1 
        2   703 1 1  9 GLY CA   C   -9.532  15.611  -4.889 1.00 . A A .   9 GLY CA   1 1 
        2   704 1 1  9 GLY H    H  -10.312  16.712  -3.256 1.00 . A A .   9 GLY H    1 1 
        2   705 1 1  9 GLY HA2  H   -9.826  14.737  -4.328 1.00 . A A .   9 GLY HA2  1 1 
        2   706 1 1  9 GLY HA3  H  -10.118  15.659  -5.795 1.00 . A A .   9 GLY HA3  1 1 
        2   707 1 1  9 GLY N    N   -9.806  16.793  -4.092 1.00 . A A .   9 GLY N    1 1 
        2   708 1 1  9 GLY O    O   -7.633  16.014  -6.282 1.00 . A A .   9 GLY O    1 1 
        2   709 1 1 10 GLU C    C   -5.502  13.128  -4.581 1.00 . A A .  10 GLU C    1 1 
        2   710 1 1 10 GLU CA   C   -5.879  14.604  -4.666 1.00 . A A .  10 GLU CA   1 1 
        2   711 1 1 10 GLU CB   C   -5.056  15.411  -3.659 1.00 . A A .  10 GLU CB   1 1 
        2   712 1 1 10 GLU CD   C   -2.690  15.693  -2.819 1.00 . A A .  10 GLU CD   1 1 
        2   713 1 1 10 GLU CG   C   -3.587  15.530  -4.031 1.00 . A A .  10 GLU CG   1 1 
        2   714 1 1 10 GLU H    H   -7.708  14.396  -3.622 1.00 . A A .  10 GLU H    1 1 
        2   715 1 1 10 GLU HA   H   -5.663  14.961  -5.662 1.00 . A A .  10 GLU HA   1 1 
        2   716 1 1 10 GLU HB2  H   -5.470  16.405  -3.588 1.00 . A A .  10 GLU HB2  1 1 
        2   717 1 1 10 GLU HB3  H   -5.123  14.933  -2.693 1.00 . A A .  10 GLU HB3  1 1 
        2   718 1 1 10 GLU HG2  H   -3.290  14.639  -4.563 1.00 . A A .  10 GLU HG2  1 1 
        2   719 1 1 10 GLU HG3  H   -3.460  16.390  -4.672 1.00 . A A .  10 GLU HG3  1 1 
        2   720 1 1 10 GLU N    N   -7.304  14.792  -4.422 1.00 . A A .  10 GLU N    1 1 
        2   721 1 1 10 GLU O    O   -4.475  12.769  -4.005 1.00 . A A .  10 GLU O    1 1 
        2   722 1 1 10 GLU OE1  O   -2.722  16.776  -2.199 1.00 . A A .  10 GLU OE1  1 1 
        2   723 1 1 10 GLU OE2  O   -1.957  14.737  -2.491 1.00 . A A .  10 GLU OE2  1 1 
        2   724 1 1 11 LYS C    C   -6.052  10.285  -6.570 1.00 . A A .  11 LYS C    1 1 
        2   725 1 1 11 LYS CA   C   -6.099  10.837  -5.149 1.00 . A A .  11 LYS CA   1 1 
        2   726 1 1 11 LYS CB   C   -7.187  10.120  -4.347 1.00 . A A .  11 LYS CB   1 1 
        2   727 1 1 11 LYS CD   C   -7.780  11.505  -2.337 1.00 . A A .  11 LYS CD   1 1 
        2   728 1 1 11 LYS CE   C   -9.223  11.179  -1.984 1.00 . A A .  11 LYS CE   1 1 
        2   729 1 1 11 LYS CG   C   -7.039  10.279  -2.844 1.00 . A A .  11 LYS CG   1 1 
        2   730 1 1 11 LYS H    H   -7.144  12.621  -5.602 1.00 . A A .  11 LYS H    1 1 
        2   731 1 1 11 LYS HA   H   -5.143  10.665  -4.677 1.00 . A A .  11 LYS HA   1 1 
        2   732 1 1 11 LYS HB2  H   -8.150  10.515  -4.637 1.00 . A A .  11 LYS HB2  1 1 
        2   733 1 1 11 LYS HB3  H   -7.154   9.066  -4.582 1.00 . A A .  11 LYS HB3  1 1 
        2   734 1 1 11 LYS HD2  H   -7.281  11.877  -1.454 1.00 . A A .  11 LYS HD2  1 1 
        2   735 1 1 11 LYS HD3  H   -7.769  12.265  -3.106 1.00 . A A .  11 LYS HD3  1 1 
        2   736 1 1 11 LYS HE2  H   -9.238  10.287  -1.376 1.00 . A A .  11 LYS HE2  1 1 
        2   737 1 1 11 LYS HE3  H   -9.638  12.004  -1.424 1.00 . A A .  11 LYS HE3  1 1 
        2   738 1 1 11 LYS HG2  H   -7.441   9.402  -2.357 1.00 . A A .  11 LYS HG2  1 1 
        2   739 1 1 11 LYS HG3  H   -5.990  10.378  -2.603 1.00 . A A .  11 LYS HG3  1 1 
        2   740 1 1 11 LYS HZ1  H  -11.062  10.972  -2.952 1.00 . A A .  11 LYS HZ1  1 1 
        2   741 1 1 11 LYS HZ2  H   -9.828  10.025  -3.617 1.00 . A A .  11 LYS HZ2  1 1 
        2   742 1 1 11 LYS HZ3  H   -9.864  11.691  -3.905 1.00 . A A .  11 LYS HZ3  1 1 
        2   743 1 1 11 LYS N    N   -6.342  12.275  -5.158 1.00 . A A .  11 LYS N    1 1 
        2   744 1 1 11 LYS NZ   N  -10.053  10.951  -3.200 1.00 . A A .  11 LYS NZ   1 1 
        2   745 1 1 11 LYS O    O   -7.002   9.669  -7.054 1.00 . A A .  11 LYS O    1 1 
        2   746 1 1 12 PRO C    C   -4.590   8.520  -8.711 1.00 . A A .  12 PRO C    1 1 
        2   747 1 1 12 PRO CA   C   -4.722  10.037  -8.630 1.00 . A A .  12 PRO CA   1 1 
        2   748 1 1 12 PRO CB   C   -3.414  10.711  -9.050 1.00 . A A .  12 PRO CB   1 1 
        2   749 1 1 12 PRO CD   C   -3.747  11.232  -6.741 1.00 . A A .  12 PRO CD   1 1 
        2   750 1 1 12 PRO CG   C   -2.688  10.958  -7.773 1.00 . A A .  12 PRO CG   1 1 
        2   751 1 1 12 PRO HA   H   -5.522  10.362  -9.279 1.00 . A A .  12 PRO HA   1 1 
        2   752 1 1 12 PRO HB2  H   -2.858  10.050  -9.700 1.00 . A A .  12 PRO HB2  1 1 
        2   753 1 1 12 PRO HB3  H   -3.630  11.634  -9.566 1.00 . A A .  12 PRO HB3  1 1 
        2   754 1 1 12 PRO HD2  H   -3.445  10.845  -5.779 1.00 . A A .  12 PRO HD2  1 1 
        2   755 1 1 12 PRO HD3  H   -3.947  12.292  -6.678 1.00 . A A .  12 PRO HD3  1 1 
        2   756 1 1 12 PRO HG2  H   -2.116  10.084  -7.500 1.00 . A A .  12 PRO HG2  1 1 
        2   757 1 1 12 PRO HG3  H   -2.039  11.815  -7.880 1.00 . A A .  12 PRO HG3  1 1 
        2   758 1 1 12 PRO N    N   -4.920  10.506  -7.255 1.00 . A A .  12 PRO N    1 1 
        2   759 1 1 12 PRO O    O   -4.980   7.905  -9.703 1.00 . A A .  12 PRO O    1 1 
        2   760 1 1 13 TYR C    C   -4.626   5.865  -6.449 1.00 . A A .  13 TYR C    1 1 
        2   761 1 1 13 TYR CA   C   -3.852   6.477  -7.614 1.00 . A A .  13 TYR CA   1 1 
        2   762 1 1 13 TYR CB   C   -2.367   6.136  -7.488 1.00 . A A .  13 TYR CB   1 1 
        2   763 1 1 13 TYR CD1  C   -1.708   5.599  -9.866 1.00 . A A .  13 TYR CD1  1 1 
        2   764 1 1 13 TYR CD2  C   -0.692   7.482  -8.815 1.00 . A A .  13 TYR CD2  1 1 
        2   765 1 1 13 TYR CE1  C   -0.985   5.845 -11.017 1.00 . A A .  13 TYR CE1  1 1 
        2   766 1 1 13 TYR CE2  C    0.034   7.737  -9.963 1.00 . A A .  13 TYR CE2  1 1 
        2   767 1 1 13 TYR CG   C   -1.574   6.410  -8.746 1.00 . A A .  13 TYR CG   1 1 
        2   768 1 1 13 TYR CZ   C   -0.116   6.915 -11.061 1.00 . A A .  13 TYR CZ   1 1 
        2   769 1 1 13 TYR H    H   -3.747   8.466  -6.899 1.00 . A A .  13 TYR H    1 1 
        2   770 1 1 13 TYR HA   H   -4.229   6.064  -8.538 1.00 . A A .  13 TYR HA   1 1 
        2   771 1 1 13 TYR HB2  H   -1.936   6.722  -6.691 1.00 . A A .  13 TYR HB2  1 1 
        2   772 1 1 13 TYR HB3  H   -2.264   5.087  -7.253 1.00 . A A .  13 TYR HB3  1 1 
        2   773 1 1 13 TYR HD1  H   -2.390   4.761  -9.828 1.00 . A A .  13 TYR HD1  1 1 
        2   774 1 1 13 TYR HD2  H   -0.577   8.123  -7.954 1.00 . A A .  13 TYR HD2  1 1 
        2   775 1 1 13 TYR HE1  H   -1.102   5.202 -11.877 1.00 . A A .  13 TYR HE1  1 1 
        2   776 1 1 13 TYR HE2  H    0.714   8.574  -9.998 1.00 . A A .  13 TYR HE2  1 1 
        2   777 1 1 13 TYR HH   H    0.003   7.267 -12.947 1.00 . A A .  13 TYR HH   1 1 
        2   778 1 1 13 TYR N    N   -4.038   7.922  -7.660 1.00 . A A .  13 TYR N    1 1 
        2   779 1 1 13 TYR O    O   -4.675   6.429  -5.356 1.00 . A A .  13 TYR O    1 1 
        2   780 1 1 13 TYR OH   O    0.605   7.165 -12.206 1.00 . A A .  13 TYR OH   1 1 
        2   781 1 1 14 LYS C    C   -6.070   2.519  -5.954 1.00 . A A .  14 LYS C    1 1 
        2   782 1 1 14 LYS CA   C   -6.000   4.015  -5.666 1.00 . A A .  14 LYS CA   1 1 
        2   783 1 1 14 LYS CB   C   -7.413   4.596  -5.581 1.00 . A A .  14 LYS CB   1 1 
        2   784 1 1 14 LYS CD   C   -9.310   5.223  -4.059 1.00 . A A .  14 LYS CD   1 1 
        2   785 1 1 14 LYS CE   C   -9.631   5.403  -2.583 1.00 . A A .  14 LYS CE   1 1 
        2   786 1 1 14 LYS CG   C   -8.108   4.315  -4.260 1.00 . A A .  14 LYS CG   1 1 
        2   787 1 1 14 LYS H    H   -5.154   4.306  -7.584 1.00 . A A .  14 LYS H    1 1 
        2   788 1 1 14 LYS HA   H   -5.502   4.164  -4.720 1.00 . A A .  14 LYS HA   1 1 
        2   789 1 1 14 LYS HB2  H   -7.358   5.666  -5.715 1.00 . A A .  14 LYS HB2  1 1 
        2   790 1 1 14 LYS HB3  H   -8.011   4.173  -6.376 1.00 . A A .  14 LYS HB3  1 1 
        2   791 1 1 14 LYS HD2  H   -9.097   6.190  -4.490 1.00 . A A .  14 LYS HD2  1 1 
        2   792 1 1 14 LYS HD3  H  -10.167   4.787  -4.554 1.00 . A A .  14 LYS HD3  1 1 
        2   793 1 1 14 LYS HE2  H   -8.715   5.334  -2.018 1.00 . A A .  14 LYS HE2  1 1 
        2   794 1 1 14 LYS HE3  H  -10.069   6.381  -2.441 1.00 . A A .  14 LYS HE3  1 1 
        2   795 1 1 14 LYS HG2  H   -8.441   3.288  -4.250 1.00 . A A .  14 LYS HG2  1 1 
        2   796 1 1 14 LYS HG3  H   -7.407   4.477  -3.454 1.00 . A A .  14 LYS HG3  1 1 
        2   797 1 1 14 LYS HZ1  H  -11.011   4.674  -1.194 1.00 . A A .  14 LYS HZ1  1 1 
        2   798 1 1 14 LYS HZ2  H  -10.086   3.469  -1.940 1.00 . A A .  14 LYS HZ2  1 1 
        2   799 1 1 14 LYS HZ3  H  -11.340   4.220  -2.790 1.00 . A A .  14 LYS HZ3  1 1 
        2   800 1 1 14 LYS N    N   -5.229   4.707  -6.692 1.00 . A A .  14 LYS N    1 1 
        2   801 1 1 14 LYS NZ   N  -10.584   4.369  -2.092 1.00 . A A .  14 LYS NZ   1 1 
        2   802 1 1 14 LYS O    O   -6.260   2.105  -7.098 1.00 . A A .  14 LYS O    1 1 
        2   803 1 1 15 CYS C    C   -7.407  -0.239  -5.041 1.00 . A A .  15 CYS C    1 1 
        2   804 1 1 15 CYS CA   C   -5.966   0.261  -5.050 1.00 . A A .  15 CYS CA   1 1 
        2   805 1 1 15 CYS CB   C   -5.176  -0.407  -3.923 1.00 . A A .  15 CYS CB   1 1 
        2   806 1 1 15 CYS H    H   -5.770   2.101  -4.021 1.00 . A A .  15 CYS H    1 1 
        2   807 1 1 15 CYS HA   H   -5.514   0.004  -5.995 1.00 . A A .  15 CYS HA   1 1 
        2   808 1 1 15 CYS HB2  H   -4.228   0.099  -3.809 1.00 . A A .  15 CYS HB2  1 1 
        2   809 1 1 15 CYS HB3  H   -5.735  -0.323  -3.002 1.00 . A A .  15 CYS HB3  1 1 
        2   810 1 1 15 CYS N    N   -5.918   1.712  -4.909 1.00 . A A .  15 CYS N    1 1 
        2   811 1 1 15 CYS O    O   -8.277   0.353  -4.404 1.00 . A A .  15 CYS O    1 1 
        2   812 1 1 15 CYS SG   S   -4.830  -2.173  -4.203 1.00 . A A .  15 CYS SG   1 1 
        2   813 1 1 16 ASN C    C   -9.083  -3.172  -4.970 1.00 . A A .  16 ASN C    1 1 
        2   814 1 1 16 ASN CA   C   -8.987  -1.915  -5.829 1.00 . A A .  16 ASN CA   1 1 
        2   815 1 1 16 ASN CB   C   -9.341  -2.247  -7.280 1.00 . A A .  16 ASN CB   1 1 
        2   816 1 1 16 ASN CG   C   -8.209  -2.949  -8.005 1.00 . A A .  16 ASN CG   1 1 
        2   817 1 1 16 ASN H    H   -6.917  -1.762  -6.241 1.00 . A A .  16 ASN H    1 1 
        2   818 1 1 16 ASN HA   H   -9.688  -1.183  -5.455 1.00 . A A .  16 ASN HA   1 1 
        2   819 1 1 16 ASN HB2  H  -10.207  -2.892  -7.295 1.00 . A A .  16 ASN HB2  1 1 
        2   820 1 1 16 ASN HB3  H   -9.569  -1.333  -7.807 1.00 . A A .  16 ASN HB3  1 1 
        2   821 1 1 16 ASN HD21 H   -8.922  -4.721  -7.452 1.00 . A A .  16 ASN HD21 1 1 
        2   822 1 1 16 ASN HD22 H   -7.484  -4.756  -8.409 1.00 . A A .  16 ASN HD22 1 1 
        2   823 1 1 16 ASN N    N   -7.651  -1.334  -5.754 1.00 . A A .  16 ASN N    1 1 
        2   824 1 1 16 ASN ND2  N   -8.205  -4.276  -7.950 1.00 . A A .  16 ASN ND2  1 1 
        2   825 1 1 16 ASN O    O  -10.162  -3.739  -4.801 1.00 . A A .  16 ASN O    1 1 
        2   826 1 1 16 ASN OD1  O   -7.349  -2.306  -8.607 1.00 . A A .  16 ASN OD1  1 1 
        2   827 1 1 17 GLU C    C   -8.221  -4.444  -2.138 1.00 . A A .  17 GLU C    1 1 
        2   828 1 1 17 GLU CA   C   -7.903  -4.792  -3.589 1.00 . A A .  17 GLU CA   1 1 
        2   829 1 1 17 GLU CB   C   -6.527  -5.455  -3.676 1.00 . A A .  17 GLU CB   1 1 
        2   830 1 1 17 GLU CD   C   -6.642  -7.309  -5.389 1.00 . A A .  17 GLU CD   1 1 
        2   831 1 1 17 GLU CG   C   -6.156  -5.906  -5.079 1.00 . A A .  17 GLU CG   1 1 
        2   832 1 1 17 GLU H    H   -7.119  -3.107  -4.602 1.00 . A A .  17 GLU H    1 1 
        2   833 1 1 17 GLU HA   H   -8.649  -5.483  -3.953 1.00 . A A .  17 GLU HA   1 1 
        2   834 1 1 17 GLU HB2  H   -5.780  -4.753  -3.337 1.00 . A A .  17 GLU HB2  1 1 
        2   835 1 1 17 GLU HB3  H   -6.516  -6.319  -3.029 1.00 . A A .  17 GLU HB3  1 1 
        2   836 1 1 17 GLU HG2  H   -6.597  -5.224  -5.791 1.00 . A A .  17 GLU HG2  1 1 
        2   837 1 1 17 GLU HG3  H   -5.081  -5.883  -5.179 1.00 . A A .  17 GLU HG3  1 1 
        2   838 1 1 17 GLU N    N   -7.947  -3.601  -4.430 1.00 . A A .  17 GLU N    1 1 
        2   839 1 1 17 GLU O    O   -8.992  -5.140  -1.476 1.00 . A A .  17 GLU O    1 1 
        2   840 1 1 17 GLU OE1  O   -6.586  -8.170  -4.486 1.00 . A A .  17 GLU OE1  1 1 
        2   841 1 1 17 GLU OE2  O   -7.080  -7.545  -6.534 1.00 . A A .  17 GLU OE2  1 1 
        2   842 1 1 18 CYS C    C   -8.510  -1.553  -0.245 1.00 . A A .  18 CYS C    1 1 
        2   843 1 1 18 CYS CA   C   -7.839  -2.923  -0.277 1.00 . A A .  18 CYS CA   1 1 
        2   844 1 1 18 CYS CB   C   -6.510  -2.870   0.480 1.00 . A A .  18 CYS CB   1 1 
        2   845 1 1 18 CYS H    H   -7.017  -2.850  -2.226 1.00 . A A .  18 CYS H    1 1 
        2   846 1 1 18 CYS HA   H   -8.488  -3.640   0.203 1.00 . A A .  18 CYS HA   1 1 
        2   847 1 1 18 CYS HB2  H   -6.689  -2.501   1.480 1.00 . A A .  18 CYS HB2  1 1 
        2   848 1 1 18 CYS HB3  H   -6.098  -3.867   0.539 1.00 . A A .  18 CYS HB3  1 1 
        2   849 1 1 18 CYS N    N   -7.622  -3.364  -1.649 1.00 . A A .  18 CYS N    1 1 
        2   850 1 1 18 CYS O    O   -9.462  -1.333   0.503 1.00 . A A .  18 CYS O    1 1 
        2   851 1 1 18 CYS SG   S   -5.258  -1.795  -0.290 1.00 . A A .  18 CYS SG   1 1 
        2   852 1 1 19 GLY C    C   -7.599   1.758  -0.623 1.00 . A A .  19 GLY C    1 1 
        2   853 1 1 19 GLY CA   C   -8.569   0.702  -1.115 1.00 . A A .  19 GLY CA   1 1 
        2   854 1 1 19 GLY H    H   -7.247  -0.867  -1.638 1.00 . A A .  19 GLY H    1 1 
        2   855 1 1 19 GLY HA2  H   -8.843   0.927  -2.135 1.00 . A A .  19 GLY HA2  1 1 
        2   856 1 1 19 GLY HA3  H   -9.456   0.731  -0.499 1.00 . A A .  19 GLY HA3  1 1 
        2   857 1 1 19 GLY N    N   -8.006  -0.635  -1.064 1.00 . A A .  19 GLY N    1 1 
        2   858 1 1 19 GLY O    O   -8.009   2.785  -0.080 1.00 . A A .  19 GLY O    1 1 
        2   859 1 1 20 LYS C    C   -4.991   3.475  -1.469 1.00 . A A .  20 LYS C    1 1 
        2   860 1 1 20 LYS CA   C   -5.275   2.443  -0.382 1.00 . A A .  20 LYS CA   1 1 
        2   861 1 1 20 LYS CB   C   -3.990   1.691  -0.029 1.00 . A A .  20 LYS CB   1 1 
        2   862 1 1 20 LYS CD   C   -3.676   2.618   2.284 1.00 . A A .  20 LYS CD   1 1 
        2   863 1 1 20 LYS CE   C   -2.726   3.333   3.232 1.00 . A A .  20 LYS CE   1 1 
        2   864 1 1 20 LYS CG   C   -3.069   2.462   0.900 1.00 . A A .  20 LYS CG   1 1 
        2   865 1 1 20 LYS H    H   -6.043   0.671  -1.249 1.00 . A A .  20 LYS H    1 1 
        2   866 1 1 20 LYS HA   H   -5.636   2.955   0.497 1.00 . A A .  20 LYS HA   1 1 
        2   867 1 1 20 LYS HB2  H   -4.253   0.759   0.450 1.00 . A A .  20 LYS HB2  1 1 
        2   868 1 1 20 LYS HB3  H   -3.451   1.477  -0.941 1.00 . A A .  20 LYS HB3  1 1 
        2   869 1 1 20 LYS HD2  H   -4.588   3.191   2.206 1.00 . A A .  20 LYS HD2  1 1 
        2   870 1 1 20 LYS HD3  H   -3.897   1.638   2.683 1.00 . A A .  20 LYS HD3  1 1 
        2   871 1 1 20 LYS HE2  H   -2.449   4.281   2.796 1.00 . A A .  20 LYS HE2  1 1 
        2   872 1 1 20 LYS HE3  H   -3.234   3.503   4.170 1.00 . A A .  20 LYS HE3  1 1 
        2   873 1 1 20 LYS HG2  H   -2.133   1.932   0.986 1.00 . A A .  20 LYS HG2  1 1 
        2   874 1 1 20 LYS HG3  H   -2.892   3.444   0.482 1.00 . A A .  20 LYS HG3  1 1 
        2   875 1 1 20 LYS HZ1  H   -0.776   2.750   2.762 1.00 . A A .  20 LYS HZ1  1 1 
        2   876 1 1 20 LYS HZ2  H   -1.710   1.522   3.457 1.00 . A A .  20 LYS HZ2  1 1 
        2   877 1 1 20 LYS HZ3  H   -1.104   2.771   4.422 1.00 . A A .  20 LYS HZ3  1 1 
        2   878 1 1 20 LYS N    N   -6.308   1.507  -0.810 1.00 . A A .  20 LYS N    1 1 
        2   879 1 1 20 LYS NZ   N   -1.492   2.539   3.486 1.00 . A A .  20 LYS NZ   1 1 
        2   880 1 1 20 LYS O    O   -4.473   3.140  -2.534 1.00 . A A .  20 LYS O    1 1 
        2   881 1 1 21 ALA C    C   -3.739   6.447  -1.942 1.00 . A A .  21 ALA C    1 1 
        2   882 1 1 21 ALA CA   C   -5.109   5.809  -2.145 1.00 . A A .  21 ALA CA   1 1 
        2   883 1 1 21 ALA CB   C   -6.205   6.857  -2.021 1.00 . A A .  21 ALA CB   1 1 
        2   884 1 1 21 ALA H    H   -5.741   4.933  -0.326 1.00 . A A .  21 ALA H    1 1 
        2   885 1 1 21 ALA HA   H   -5.156   5.391  -3.141 1.00 . A A .  21 ALA HA   1 1 
        2   886 1 1 21 ALA HB1  H   -5.844   7.687  -1.433 1.00 . A A .  21 ALA HB1  1 1 
        2   887 1 1 21 ALA HB2  H   -6.483   7.205  -3.005 1.00 . A A .  21 ALA HB2  1 1 
        2   888 1 1 21 ALA HB3  H   -7.067   6.421  -1.537 1.00 . A A .  21 ALA HB3  1 1 
        2   889 1 1 21 ALA N    N   -5.332   4.729  -1.192 1.00 . A A .  21 ALA N    1 1 
        2   890 1 1 21 ALA O    O   -3.396   6.866  -0.836 1.00 . A A .  21 ALA O    1 1 
        2   891 1 1 22 PHE C    C   -1.571   8.414  -3.734 1.00 . A A .  22 PHE C    1 1 
        2   892 1 1 22 PHE CA   C   -1.625   7.104  -2.955 1.00 . A A .  22 PHE CA   1 1 
        2   893 1 1 22 PHE CB   C   -0.589   6.124  -3.509 1.00 . A A .  22 PHE CB   1 1 
        2   894 1 1 22 PHE CD1  C   -1.597   3.841  -3.243 1.00 . A A .  22 PHE CD1  1 1 
        2   895 1 1 22 PHE CD2  C    0.270   4.422  -1.878 1.00 . A A .  22 PHE CD2  1 1 
        2   896 1 1 22 PHE CE1  C   -1.646   2.594  -2.650 1.00 . A A .  22 PHE CE1  1 1 
        2   897 1 1 22 PHE CE2  C    0.226   3.176  -1.281 1.00 . A A .  22 PHE CE2  1 1 
        2   898 1 1 22 PHE CG   C   -0.640   4.769  -2.864 1.00 . A A .  22 PHE CG   1 1 
        2   899 1 1 22 PHE CZ   C   -0.733   2.260  -1.669 1.00 . A A .  22 PHE CZ   1 1 
        2   900 1 1 22 PHE H    H   -3.289   6.167  -3.870 1.00 . A A .  22 PHE H    1 1 
        2   901 1 1 22 PHE HA   H   -1.400   7.305  -1.919 1.00 . A A .  22 PHE HA   1 1 
        2   902 1 1 22 PHE HB2  H   -0.758   5.993  -4.567 1.00 . A A .  22 PHE HB2  1 1 
        2   903 1 1 22 PHE HB3  H    0.399   6.530  -3.354 1.00 . A A .  22 PHE HB3  1 1 
        2   904 1 1 22 PHE HD1  H   -2.311   4.100  -4.011 1.00 . A A .  22 PHE HD1  1 1 
        2   905 1 1 22 PHE HD2  H    1.021   5.138  -1.574 1.00 . A A .  22 PHE HD2  1 1 
        2   906 1 1 22 PHE HE1  H   -2.396   1.880  -2.955 1.00 . A A .  22 PHE HE1  1 1 
        2   907 1 1 22 PHE HE2  H    0.941   2.919  -0.514 1.00 . A A .  22 PHE HE2  1 1 
        2   908 1 1 22 PHE HZ   H   -0.770   1.287  -1.203 1.00 . A A .  22 PHE HZ   1 1 
        2   909 1 1 22 PHE N    N   -2.960   6.518  -3.016 1.00 . A A .  22 PHE N    1 1 
        2   910 1 1 22 PHE O    O   -2.577   8.867  -4.280 1.00 . A A .  22 PHE O    1 1 
        2   911 1 1 23 ARG C    C    0.405  10.040  -5.871 1.00 . A A .  23 ARG C    1 1 
        2   912 1 1 23 ARG CA   C   -0.202  10.279  -4.491 1.00 . A A .  23 ARG CA   1 1 
        2   913 1 1 23 ARG CB   C    0.696  11.217  -3.683 1.00 . A A .  23 ARG CB   1 1 
        2   914 1 1 23 ARG CD   C    1.546  13.567  -3.423 1.00 . A A .  23 ARG CD   1 1 
        2   915 1 1 23 ARG CG   C    0.407  12.690  -3.919 1.00 . A A .  23 ARG CG   1 1 
        2   916 1 1 23 ARG CZ   C    2.627  15.648  -4.165 1.00 . A A .  23 ARG CZ   1 1 
        2   917 1 1 23 ARG H    H    0.377   8.609  -3.326 1.00 . A A .  23 ARG H    1 1 
        2   918 1 1 23 ARG HA   H   -1.171  10.738  -4.612 1.00 . A A .  23 ARG HA   1 1 
        2   919 1 1 23 ARG HB2  H    0.560  11.010  -2.632 1.00 . A A .  23 ARG HB2  1 1 
        2   920 1 1 23 ARG HB3  H    1.725  11.027  -3.948 1.00 . A A .  23 ARG HB3  1 1 
        2   921 1 1 23 ARG HD2  H    1.441  13.703  -2.357 1.00 . A A .  23 ARG HD2  1 1 
        2   922 1 1 23 ARG HD3  H    2.482  13.071  -3.633 1.00 . A A .  23 ARG HD3  1 1 
        2   923 1 1 23 ARG HE   H    0.705  15.197  -4.450 1.00 . A A .  23 ARG HE   1 1 
        2   924 1 1 23 ARG HG2  H    0.274  12.856  -4.977 1.00 . A A .  23 ARG HG2  1 1 
        2   925 1 1 23 ARG HG3  H   -0.497  12.958  -3.393 1.00 . A A .  23 ARG HG3  1 1 
        2   926 1 1 23 ARG HH11 H    3.844  14.352  -3.205 1.00 . A A .  23 ARG HH11 1 1 
        2   927 1 1 23 ARG HH12 H    4.593  15.822  -3.733 1.00 . A A .  23 ARG HH12 1 1 
        2   928 1 1 23 ARG HH21 H    1.680  17.137  -5.150 1.00 . A A .  23 ARG HH21 1 1 
        2   929 1 1 23 ARG HH22 H    3.361  17.406  -4.839 1.00 . A A .  23 ARG HH22 1 1 
        2   930 1 1 23 ARG N    N   -0.388   9.019  -3.781 1.00 . A A .  23 ARG N    1 1 
        2   931 1 1 23 ARG NE   N    1.549  14.877  -4.069 1.00 . A A .  23 ARG NE   1 1 
        2   932 1 1 23 ARG NH1  N    3.783  15.241  -3.659 1.00 . A A .  23 ARG NH1  1 1 
        2   933 1 1 23 ARG NH2  N    2.549  16.827  -4.767 1.00 . A A .  23 ARG NH2  1 1 
        2   934 1 1 23 ARG O    O    0.198  10.826  -6.795 1.00 . A A .  23 ARG O    1 1 
        2   935 1 1 24 ALA C    C    1.836   7.096  -7.467 1.00 . A A .  24 ALA C    1 1 
        2   936 1 1 24 ALA CA   C    1.789   8.607  -7.268 1.00 . A A .  24 ALA CA   1 1 
        2   937 1 1 24 ALA CB   C    3.192   9.194  -7.331 1.00 . A A .  24 ALA CB   1 1 
        2   938 1 1 24 ALA H    H    1.281   8.362  -5.228 1.00 . A A .  24 ALA H    1 1 
        2   939 1 1 24 ALA HA   H    1.205   9.047  -8.064 1.00 . A A .  24 ALA HA   1 1 
        2   940 1 1 24 ALA HB1  H    3.389   9.548  -8.332 1.00 . A A .  24 ALA HB1  1 1 
        2   941 1 1 24 ALA HB2  H    3.268  10.017  -6.636 1.00 . A A .  24 ALA HB2  1 1 
        2   942 1 1 24 ALA HB3  H    3.912   8.433  -7.069 1.00 . A A .  24 ALA HB3  1 1 
        2   943 1 1 24 ALA N    N    1.154   8.950  -6.002 1.00 . A A .  24 ALA N    1 1 
        2   944 1 1 24 ALA O    O    1.512   6.330  -6.559 1.00 . A A .  24 ALA O    1 1 
        2   945 1 1 25 ARG C    C    3.368   4.562  -8.100 1.00 . A A .  25 ARG C    1 1 
        2   946 1 1 25 ARG CA   C    2.329   5.253  -8.978 1.00 . A A .  25 ARG CA   1 1 
        2   947 1 1 25 ARG CB   C    2.684   5.060 -10.454 1.00 . A A .  25 ARG CB   1 1 
        2   948 1 1 25 ARG CD   C    2.461   3.656 -12.526 1.00 . A A .  25 ARG CD   1 1 
        2   949 1 1 25 ARG CG   C    2.188   3.745 -11.033 1.00 . A A .  25 ARG CG   1 1 
        2   950 1 1 25 ARG CZ   C    4.375   3.159 -13.986 1.00 . A A .  25 ARG CZ   1 1 
        2   951 1 1 25 ARG H    H    2.487   7.332  -9.343 1.00 . A A .  25 ARG H    1 1 
        2   952 1 1 25 ARG HA   H    1.363   4.810  -8.789 1.00 . A A .  25 ARG HA   1 1 
        2   953 1 1 25 ARG HB2  H    2.249   5.867 -11.025 1.00 . A A .  25 ARG HB2  1 1 
        2   954 1 1 25 ARG HB3  H    3.758   5.093 -10.560 1.00 . A A .  25 ARG HB3  1 1 
        2   955 1 1 25 ARG HD2  H    1.694   3.048 -12.983 1.00 . A A .  25 ARG HD2  1 1 
        2   956 1 1 25 ARG HD3  H    2.428   4.651 -12.944 1.00 . A A .  25 ARG HD3  1 1 
        2   957 1 1 25 ARG HE   H    4.208   2.573 -12.087 1.00 . A A .  25 ARG HE   1 1 
        2   958 1 1 25 ARG HG2  H    2.694   2.930 -10.536 1.00 . A A .  25 ARG HG2  1 1 
        2   959 1 1 25 ARG HG3  H    1.124   3.668 -10.864 1.00 . A A .  25 ARG HG3  1 1 
        2   960 1 1 25 ARG HH11 H    2.907   4.245 -14.850 1.00 . A A .  25 ARG HH11 1 1 
        2   961 1 1 25 ARG HH12 H    4.262   3.888 -15.868 1.00 . A A .  25 ARG HH12 1 1 
        2   962 1 1 25 ARG HH21 H    5.998   2.097 -13.418 1.00 . A A .  25 ARG HH21 1 1 
        2   963 1 1 25 ARG HH22 H    6.020   2.665 -15.053 1.00 . A A .  25 ARG HH22 1 1 
        2   964 1 1 25 ARG N    N    2.242   6.673  -8.660 1.00 . A A .  25 ARG N    1 1 
        2   965 1 1 25 ARG NE   N    3.766   3.065 -12.810 1.00 . A A .  25 ARG NE   1 1 
        2   966 1 1 25 ARG NH1  N    3.801   3.818 -14.983 1.00 . A A .  25 ARG NH1  1 1 
        2   967 1 1 25 ARG NH2  N    5.562   2.594 -14.167 1.00 . A A .  25 ARG NH2  1 1 
        2   968 1 1 25 ARG O    O    3.057   3.609  -7.386 1.00 . A A .  25 ARG O    1 1 
        2   969 1 1 26 SER C    C    5.213   4.121  -5.966 1.00 . A A .  26 SER C    1 1 
        2   970 1 1 26 SER CA   C    5.689   4.476  -7.372 1.00 . A A .  26 SER CA   1 1 
        2   971 1 1 26 SER CB   C    6.862   5.455  -7.293 1.00 . A A .  26 SER CB   1 1 
        2   972 1 1 26 SER H    H    4.789   5.811  -8.747 1.00 . A A .  26 SER H    1 1 
        2   973 1 1 26 SER HA   H    6.017   3.574  -7.867 1.00 . A A .  26 SER HA   1 1 
        2   974 1 1 26 SER HB2  H    6.907   6.033  -8.204 1.00 . A A .  26 SER HB2  1 1 
        2   975 1 1 26 SER HB3  H    6.718   6.119  -6.452 1.00 . A A .  26 SER HB3  1 1 
        2   976 1 1 26 SER HG   H    8.690   5.008  -7.836 1.00 . A A .  26 SER HG   1 1 
        2   977 1 1 26 SER N    N    4.603   5.049  -8.158 1.00 . A A .  26 SER N    1 1 
        2   978 1 1 26 SER O    O    5.532   3.054  -5.442 1.00 . A A .  26 SER O    1 1 
        2   979 1 1 26 SER OG   O    8.090   4.768  -7.127 1.00 . A A .  26 SER OG   1 1 
        2   980 1 1 27 SER C    C    2.972   3.622  -3.985 1.00 . A A .  27 SER C    1 1 
        2   981 1 1 27 SER CA   C    3.930   4.809  -4.016 1.00 . A A .  27 SER CA   1 1 
        2   982 1 1 27 SER CB   C    3.217   6.067  -3.514 1.00 . A A .  27 SER CB   1 1 
        2   983 1 1 27 SER H    H    4.228   5.856  -5.832 1.00 . A A .  27 SER H    1 1 
        2   984 1 1 27 SER HA   H    4.768   4.598  -3.368 1.00 . A A .  27 SER HA   1 1 
        2   985 1 1 27 SER HB2  H    2.434   6.334  -4.207 1.00 . A A .  27 SER HB2  1 1 
        2   986 1 1 27 SER HB3  H    2.787   5.870  -2.542 1.00 . A A .  27 SER HB3  1 1 
        2   987 1 1 27 SER HG   H    3.637   7.947  -3.157 1.00 . A A .  27 SER HG   1 1 
        2   988 1 1 27 SER N    N    4.448   5.024  -5.362 1.00 . A A .  27 SER N    1 1 
        2   989 1 1 27 SER O    O    2.920   2.877  -3.006 1.00 . A A .  27 SER O    1 1 
        2   990 1 1 27 SER OG   O    4.120   7.154  -3.402 1.00 . A A .  27 SER OG   1 1 
        2   991 1 1 28 LEU C    C    1.974   1.028  -5.391 1.00 . A A .  28 LEU C    1 1 
        2   992 1 1 28 LEU CA   C    1.259   2.355  -5.163 1.00 . A A .  28 LEU CA   1 1 
        2   993 1 1 28 LEU CB   C    0.269   2.617  -6.299 1.00 . A A .  28 LEU CB   1 1 
        2   994 1 1 28 LEU CD1  C   -1.851   1.391  -5.766 1.00 . A A .  28 LEU CD1  1 1 
        2   995 1 1 28 LEU CD2  C   -1.070   1.561  -8.136 1.00 . A A .  28 LEU CD2  1 1 
        2   996 1 1 28 LEU CG   C   -0.638   1.447  -6.681 1.00 . A A .  28 LEU CG   1 1 
        2   997 1 1 28 LEU H    H    2.303   4.078  -5.812 1.00 . A A .  28 LEU H    1 1 
        2   998 1 1 28 LEU HA   H    0.718   2.303  -4.230 1.00 . A A .  28 LEU HA   1 1 
        2   999 1 1 28 LEU HB2  H   -0.361   3.442  -6.005 1.00 . A A .  28 LEU HB2  1 1 
        2  1000 1 1 28 LEU HB3  H    0.838   2.896  -7.175 1.00 . A A .  28 LEU HB3  1 1 
        2  1001 1 1 28 LEU HD11 H   -1.894   2.290  -5.170 1.00 . A A .  28 LEU HD11 1 1 
        2  1002 1 1 28 LEU HD12 H   -1.772   0.531  -5.116 1.00 . A A .  28 LEU HD12 1 1 
        2  1003 1 1 28 LEU HD13 H   -2.748   1.309  -6.362 1.00 . A A .  28 LEU HD13 1 1 
        2  1004 1 1 28 LEU HD21 H   -1.463   2.550  -8.318 1.00 . A A .  28 LEU HD21 1 1 
        2  1005 1 1 28 LEU HD22 H   -1.834   0.825  -8.342 1.00 . A A .  28 LEU HD22 1 1 
        2  1006 1 1 28 LEU HD23 H   -0.220   1.386  -8.779 1.00 . A A .  28 LEU HD23 1 1 
        2  1007 1 1 28 LEU HG   H   -0.090   0.522  -6.566 1.00 . A A .  28 LEU HG   1 1 
        2  1008 1 1 28 LEU N    N    2.216   3.452  -5.064 1.00 . A A .  28 LEU N    1 1 
        2  1009 1 1 28 LEU O    O    1.597   0.003  -4.824 1.00 . A A .  28 LEU O    1 1 
        2  1010 1 1 29 ALA C    C    4.273  -0.815  -5.246 1.00 . A A .  29 ALA C    1 1 
        2  1011 1 1 29 ALA CA   C    3.780  -0.146  -6.524 1.00 . A A .  29 ALA CA   1 1 
        2  1012 1 1 29 ALA CB   C    4.954   0.194  -7.431 1.00 . A A .  29 ALA CB   1 1 
        2  1013 1 1 29 ALA H    H    3.262   1.902  -6.646 1.00 . A A .  29 ALA H    1 1 
        2  1014 1 1 29 ALA HA   H    3.135  -0.833  -7.053 1.00 . A A .  29 ALA HA   1 1 
        2  1015 1 1 29 ALA HB1  H    5.873  -0.129  -6.966 1.00 . A A .  29 ALA HB1  1 1 
        2  1016 1 1 29 ALA HB2  H    4.832  -0.311  -8.379 1.00 . A A .  29 ALA HB2  1 1 
        2  1017 1 1 29 ALA HB3  H    4.987   1.261  -7.593 1.00 . A A .  29 ALA HB3  1 1 
        2  1018 1 1 29 ALA N    N    3.009   1.055  -6.224 1.00 . A A .  29 ALA N    1 1 
        2  1019 1 1 29 ALA O    O    3.941  -1.968  -4.971 1.00 . A A .  29 ALA O    1 1 
        2  1020 1 1 30 ILE C    C    4.540  -1.373  -2.441 1.00 . A A .  30 ILE C    1 1 
        2  1021 1 1 30 ILE CA   C    5.605  -0.609  -3.221 1.00 . A A .  30 ILE CA   1 1 
        2  1022 1 1 30 ILE CB   C    6.167   0.517  -2.333 1.00 . A A .  30 ILE CB   1 1 
        2  1023 1 1 30 ILE CD1  C    7.417   2.715  -2.622 1.00 . A A .  30 ILE CD1  1 1 
        2  1024 1 1 30 ILE CG1  C    7.267   1.280  -3.075 1.00 . A A .  30 ILE CG1  1 1 
        2  1025 1 1 30 ILE CG2  C    6.700  -0.054  -1.027 1.00 . A A .  30 ILE CG2  1 1 
        2  1026 1 1 30 ILE H    H    5.296   0.827  -4.743 1.00 . A A .  30 ILE H    1 1 
        2  1027 1 1 30 ILE HA   H    6.413  -1.286  -3.464 1.00 . A A .  30 ILE HA   1 1 
        2  1028 1 1 30 ILE HB   H    5.362   1.196  -2.100 1.00 . A A .  30 ILE HB   1 1 
        2  1029 1 1 30 ILE HD11 H    7.855   3.300  -3.418 1.00 . A A .  30 ILE HD11 1 1 
        2  1030 1 1 30 ILE HD12 H    6.446   3.119  -2.374 1.00 . A A .  30 ILE HD12 1 1 
        2  1031 1 1 30 ILE HD13 H    8.057   2.754  -1.753 1.00 . A A .  30 ILE HD13 1 1 
        2  1032 1 1 30 ILE HG12 H    8.210   0.783  -2.918 1.00 . A A .  30 ILE HG12 1 1 
        2  1033 1 1 30 ILE HG13 H    7.039   1.287  -4.132 1.00 . A A .  30 ILE HG13 1 1 
        2  1034 1 1 30 ILE HG21 H    7.780  -0.031  -1.039 1.00 . A A .  30 ILE HG21 1 1 
        2  1035 1 1 30 ILE HG22 H    6.337   0.540  -0.201 1.00 . A A .  30 ILE HG22 1 1 
        2  1036 1 1 30 ILE HG23 H    6.362  -1.073  -0.915 1.00 . A A .  30 ILE HG23 1 1 
        2  1037 1 1 30 ILE N    N    5.067  -0.085  -4.470 1.00 . A A .  30 ILE N    1 1 
        2  1038 1 1 30 ILE O    O    4.828  -2.391  -1.810 1.00 . A A .  30 ILE O    1 1 
        2  1039 1 1 31 HIS C    C    1.813  -2.824  -2.462 1.00 . A A .  31 HIS C    1 1 
        2  1040 1 1 31 HIS CA   C    2.199  -1.511  -1.788 1.00 . A A .  31 HIS CA   1 1 
        2  1041 1 1 31 HIS CB   C    0.992  -0.574  -1.742 1.00 . A A .  31 HIS CB   1 1 
        2  1042 1 1 31 HIS CD2  C   -1.427  -1.218  -2.421 1.00 . A A .  31 HIS CD2  1 1 
        2  1043 1 1 31 HIS CE1  C   -1.830  -2.670  -0.829 1.00 . A A .  31 HIS CE1  1 1 
        2  1044 1 1 31 HIS CG   C   -0.319  -1.290  -1.646 1.00 . A A .  31 HIS CG   1 1 
        2  1045 1 1 31 HIS H    H    3.143  -0.061  -3.008 1.00 . A A .  31 HIS H    1 1 
        2  1046 1 1 31 HIS HA   H    2.520  -1.720  -0.779 1.00 . A A .  31 HIS HA   1 1 
        2  1047 1 1 31 HIS HB2  H    1.080   0.074  -0.882 1.00 . A A .  31 HIS HB2  1 1 
        2  1048 1 1 31 HIS HB3  H    0.978   0.028  -2.640 1.00 . A A .  31 HIS HB3  1 1 
        2  1049 1 1 31 HIS HD1  H    0.001  -2.480   0.063 1.00 . A A .  31 HIS HD1  1 1 
        2  1050 1 1 31 HIS HD2  H   -1.559  -0.595  -3.295 1.00 . A A .  31 HIS HD2  1 1 
        2  1051 1 1 31 HIS HE1  H   -2.324  -3.401  -0.207 1.00 . A A .  31 HIS HE1  1 1 
        2  1052 1 1 31 HIS N    N    3.309  -0.875  -2.489 1.00 . A A .  31 HIS N    1 1 
        2  1053 1 1 31 HIS ND1  N   -0.605  -2.207  -0.657 1.00 . A A .  31 HIS ND1  1 1 
        2  1054 1 1 31 HIS NE2  N   -2.351  -2.085  -1.893 1.00 . A A .  31 HIS NE2  1 1 
        2  1055 1 1 31 HIS O    O    1.551  -3.823  -1.792 1.00 . A A .  31 HIS O    1 1 
        2  1056 1 1 32 GLN C    C    2.283  -5.194  -4.141 1.00 . A A .  32 GLN C    1 1 
        2  1057 1 1 32 GLN CA   C    1.423  -4.004  -4.555 1.00 . A A .  32 GLN CA   1 1 
        2  1058 1 1 32 GLN CB   C    1.582  -3.741  -6.053 1.00 . A A .  32 GLN CB   1 1 
        2  1059 1 1 32 GLN CD   C   -0.891  -3.327  -6.366 1.00 . A A .  32 GLN CD   1 1 
        2  1060 1 1 32 GLN CG   C    0.515  -2.822  -6.626 1.00 . A A .  32 GLN CG   1 1 
        2  1061 1 1 32 GLN H    H    1.998  -1.988  -4.269 1.00 . A A .  32 GLN H    1 1 
        2  1062 1 1 32 GLN HA   H    0.389  -4.234  -4.347 1.00 . A A .  32 GLN HA   1 1 
        2  1063 1 1 32 GLN HB2  H    2.547  -3.289  -6.227 1.00 . A A .  32 GLN HB2  1 1 
        2  1064 1 1 32 GLN HB3  H    1.534  -4.683  -6.579 1.00 . A A .  32 GLN HB3  1 1 
        2  1065 1 1 32 GLN HE21 H   -1.549  -1.462  -6.162 1.00 . A A .  32 GLN HE21 1 1 
        2  1066 1 1 32 GLN HE22 H   -2.737  -2.702  -5.974 1.00 . A A .  32 GLN HE22 1 1 
        2  1067 1 1 32 GLN HG2  H    0.619  -1.846  -6.176 1.00 . A A .  32 GLN HG2  1 1 
        2  1068 1 1 32 GLN HG3  H    0.662  -2.743  -7.693 1.00 . A A .  32 GLN HG3  1 1 
        2  1069 1 1 32 GLN N    N    1.779  -2.814  -3.791 1.00 . A A .  32 GLN N    1 1 
        2  1070 1 1 32 GLN NE2  N   -1.820  -2.404  -6.144 1.00 . A A .  32 GLN NE2  1 1 
        2  1071 1 1 32 GLN O    O    1.956  -6.342  -4.439 1.00 . A A .  32 GLN O    1 1 
        2  1072 1 1 32 GLN OE1  O   -1.140  -4.533  -6.364 1.00 . A A .  32 GLN OE1  1 1 
        2  1073 1 1 33 ALA C    C    3.782  -6.605  -1.716 1.00 . A A .  33 ALA C    1 1 
        2  1074 1 1 33 ALA CA   C    4.292  -5.957  -2.999 1.00 . A A .  33 ALA CA   1 1 
        2  1075 1 1 33 ALA CB   C    5.688  -5.391  -2.788 1.00 . A A .  33 ALA CB   1 1 
        2  1076 1 1 33 ALA H    H    3.592  -3.976  -3.248 1.00 . A A .  33 ALA H    1 1 
        2  1077 1 1 33 ALA HA   H    4.348  -6.710  -3.772 1.00 . A A .  33 ALA HA   1 1 
        2  1078 1 1 33 ALA HB1  H    5.990  -4.842  -3.667 1.00 . A A .  33 ALA HB1  1 1 
        2  1079 1 1 33 ALA HB2  H    5.682  -4.730  -1.934 1.00 . A A .  33 ALA HB2  1 1 
        2  1080 1 1 33 ALA HB3  H    6.381  -6.200  -2.613 1.00 . A A .  33 ALA HB3  1 1 
        2  1081 1 1 33 ALA N    N    3.385  -4.911  -3.454 1.00 . A A .  33 ALA N    1 1 
        2  1082 1 1 33 ALA O    O    4.524  -7.298  -1.020 1.00 . A A .  33 ALA O    1 1 
        2  1083 1 1 34 THR C    C    0.730  -7.844  -0.557 1.00 . A A .  34 THR C    1 1 
        2  1084 1 1 34 THR CA   C    1.901  -6.933  -0.206 1.00 . A A .  34 THR CA   1 1 
        2  1085 1 1 34 THR CB   C    1.408  -5.824   0.742 1.00 . A A .  34 THR CB   1 1 
        2  1086 1 1 34 THR CG2  C    0.026  -5.338   0.335 1.00 . A A .  34 THR CG2  1 1 
        2  1087 1 1 34 THR H    H    1.969  -5.813  -2.001 1.00 . A A .  34 THR H    1 1 
        2  1088 1 1 34 THR HA   H    2.653  -7.512   0.310 1.00 . A A .  34 THR HA   1 1 
        2  1089 1 1 34 THR HB   H    2.096  -4.993   0.688 1.00 . A A .  34 THR HB   1 1 
        2  1090 1 1 34 THR HG1  H    2.243  -6.626   2.340 1.00 . A A .  34 THR HG1  1 1 
        2  1091 1 1 34 THR HG21 H   -0.269  -4.517   0.971 1.00 . A A .  34 THR HG21 1 1 
        2  1092 1 1 34 THR HG22 H   -0.685  -6.146   0.438 1.00 . A A .  34 THR HG22 1 1 
        2  1093 1 1 34 THR HG23 H    0.049  -5.008  -0.693 1.00 . A A .  34 THR HG23 1 1 
        2  1094 1 1 34 THR N    N    2.510  -6.374  -1.407 1.00 . A A .  34 THR N    1 1 
        2  1095 1 1 34 THR O    O    0.403  -8.767   0.191 1.00 . A A .  34 THR O    1 1 
        2  1096 1 1 34 THR OG1  O    1.371  -6.312   2.088 1.00 . A A .  34 THR OG1  1 1 
        2  1097 1 1 35 HIS C    C   -0.562  -9.681  -2.787 1.00 . A A .  35 HIS C    1 1 
        2  1098 1 1 35 HIS CA   C   -1.033  -8.378  -2.148 1.00 . A A .  35 HIS CA   1 1 
        2  1099 1 1 35 HIS CB   C   -1.878  -7.584  -3.145 1.00 . A A .  35 HIS CB   1 1 
        2  1100 1 1 35 HIS CD2  C   -2.748  -5.213  -2.554 1.00 . A A .  35 HIS CD2  1 1 
        2  1101 1 1 35 HIS CE1  C   -4.420  -5.798  -1.262 1.00 . A A .  35 HIS CE1  1 1 
        2  1102 1 1 35 HIS CG   C   -2.766  -6.566  -2.499 1.00 . A A .  35 HIS CG   1 1 
        2  1103 1 1 35 HIS H    H    0.409  -6.832  -2.250 1.00 . A A .  35 HIS H    1 1 
        2  1104 1 1 35 HIS HA   H   -1.637  -8.613  -1.285 1.00 . A A .  35 HIS HA   1 1 
        2  1105 1 1 35 HIS HB2  H   -1.223  -7.066  -3.830 1.00 . A A .  35 HIS HB2  1 1 
        2  1106 1 1 35 HIS HB3  H   -2.505  -8.268  -3.700 1.00 . A A .  35 HIS HB3  1 1 
        2  1107 1 1 35 HIS HD1  H   -4.100  -7.810  -1.445 1.00 . A A .  35 HIS HD1  1 1 
        2  1108 1 1 35 HIS HD2  H   -2.047  -4.603  -3.106 1.00 . A A .  35 HIS HD2  1 1 
        2  1109 1 1 35 HIS HE1  H   -5.279  -5.752  -0.609 1.00 . A A .  35 HIS HE1  1 1 
        2  1110 1 1 35 HIS N    N    0.102  -7.580  -1.698 1.00 . A A .  35 HIS N    1 1 
        2  1111 1 1 35 HIS ND1  N   -3.825  -6.900  -1.681 1.00 . A A .  35 HIS ND1  1 1 
        2  1112 1 1 35 HIS NE2  N   -3.785  -4.760  -1.777 1.00 . A A .  35 HIS NE2  1 1 
        2  1113 1 1 35 HIS O    O   -0.091  -9.692  -3.924 1.00 . A A .  35 HIS O    1 1 
        2  1114 1 1 36 SER C    C   -1.480 -12.908  -2.983 1.00 . A A .  36 SER C    1 1 
        2  1115 1 1 36 SER CA   C   -0.275 -12.086  -2.539 1.00 . A A .  36 SER CA   1 1 
        2  1116 1 1 36 SER CB   C    0.500 -12.839  -1.456 1.00 . A A .  36 SER CB   1 1 
        2  1117 1 1 36 SER H    H   -1.074 -10.705  -1.148 1.00 . A A .  36 SER H    1 1 
        2  1118 1 1 36 SER HA   H    0.372 -11.929  -3.390 1.00 . A A .  36 SER HA   1 1 
        2  1119 1 1 36 SER HB2  H    1.040 -12.131  -0.846 1.00 . A A .  36 SER HB2  1 1 
        2  1120 1 1 36 SER HB3  H   -0.194 -13.391  -0.839 1.00 . A A .  36 SER HB3  1 1 
        2  1121 1 1 36 SER HG   H    2.250 -13.293  -2.210 1.00 . A A .  36 SER HG   1 1 
        2  1122 1 1 36 SER N    N   -0.692 -10.778  -2.047 1.00 . A A .  36 SER N    1 1 
        2  1123 1 1 36 SER O    O   -2.624 -12.564  -2.688 1.00 . A A .  36 SER O    1 1 
        2  1124 1 1 36 SER OG   O    1.424 -13.747  -2.029 1.00 . A A .  36 SER OG   1 1 
        2  1125 1 1 37 GLY C    C   -3.153 -15.378  -3.042 1.00 . A A .  37 GLY C    1 1 
        2  1126 1 1 37 GLY CA   C   -2.287 -14.855  -4.171 1.00 . A A .  37 GLY CA   1 1 
        2  1127 1 1 37 GLY H    H   -0.283 -14.224  -3.902 1.00 . A A .  37 GLY H    1 1 
        2  1128 1 1 37 GLY HA2  H   -2.905 -14.293  -4.855 1.00 . A A .  37 GLY HA2  1 1 
        2  1129 1 1 37 GLY HA3  H   -1.856 -15.694  -4.697 1.00 . A A .  37 GLY HA3  1 1 
        2  1130 1 1 37 GLY N    N   -1.215 -13.999  -3.696 1.00 . A A .  37 GLY N    1 1 
        2  1131 1 1 37 GLY O    O   -2.961 -15.011  -1.883 1.00 . A A .  37 GLY O    1 1 
        2  1132 1 1 38 GLU C    C   -5.780 -15.712  -1.656 1.00 . A A .  38 GLU C    1 1 
        2  1133 1 1 38 GLU CA   C   -5.010 -16.808  -2.387 1.00 . A A .  38 GLU CA   1 1 
        2  1134 1 1 38 GLU CB   C   -4.225 -17.653  -1.382 1.00 . A A .  38 GLU CB   1 1 
        2  1135 1 1 38 GLU CD   C   -2.773 -19.702  -1.108 1.00 . A A .  38 GLU CD   1 1 
        2  1136 1 1 38 GLU CG   C   -3.904 -19.051  -1.882 1.00 . A A .  38 GLU CG   1 1 
        2  1137 1 1 38 GLU H    H   -4.213 -16.490  -4.323 1.00 . A A .  38 GLU H    1 1 
        2  1138 1 1 38 GLU HA   H   -5.715 -17.442  -2.904 1.00 . A A .  38 GLU HA   1 1 
        2  1139 1 1 38 GLU HB2  H   -3.296 -17.151  -1.156 1.00 . A A .  38 GLU HB2  1 1 
        2  1140 1 1 38 GLU HB3  H   -4.805 -17.742  -0.475 1.00 . A A .  38 GLU HB3  1 1 
        2  1141 1 1 38 GLU HG2  H   -4.786 -19.666  -1.785 1.00 . A A .  38 GLU HG2  1 1 
        2  1142 1 1 38 GLU HG3  H   -3.621 -18.992  -2.922 1.00 . A A .  38 GLU HG3  1 1 
        2  1143 1 1 38 GLU N    N   -4.110 -16.236  -3.382 1.00 . A A .  38 GLU N    1 1 
        2  1144 1 1 38 GLU O    O   -5.940 -15.758  -0.436 1.00 . A A .  38 GLU O    1 1 
        2  1145 1 1 38 GLU OE1  O   -3.044 -20.274  -0.032 1.00 . A A .  38 GLU OE1  1 1 
        2  1146 1 1 38 GLU OE2  O   -1.619 -19.640  -1.579 1.00 . A A .  38 GLU OE2  1 1 
        2  1147 1 1 39 LYS C    C   -8.465 -13.660  -2.286 1.00 . A A .  39 LYS C    1 1 
        2  1148 1 1 39 LYS CA   C   -7.008 -13.618  -1.836 1.00 . A A .  39 LYS CA   1 1 
        2  1149 1 1 39 LYS CB   C   -6.377 -12.283  -2.238 1.00 . A A .  39 LYS CB   1 1 
        2  1150 1 1 39 LYS CD   C   -6.653 -10.635  -0.362 1.00 . A A .  39 LYS CD   1 1 
        2  1151 1 1 39 LYS CE   C   -7.422 -11.330   0.751 1.00 . A A .  39 LYS CE   1 1 
        2  1152 1 1 39 LYS CG   C   -7.142 -11.072  -1.733 1.00 . A A .  39 LYS CG   1 1 
        2  1153 1 1 39 LYS H    H   -6.094 -14.745  -3.377 1.00 . A A .  39 LYS H    1 1 
        2  1154 1 1 39 LYS HA   H   -6.972 -13.714  -0.761 1.00 . A A .  39 LYS HA   1 1 
        2  1155 1 1 39 LYS HB2  H   -5.373 -12.239  -1.842 1.00 . A A .  39 LYS HB2  1 1 
        2  1156 1 1 39 LYS HB3  H   -6.332 -12.230  -3.316 1.00 . A A .  39 LYS HB3  1 1 
        2  1157 1 1 39 LYS HD2  H   -5.606 -10.880  -0.268 1.00 . A A .  39 LYS HD2  1 1 
        2  1158 1 1 39 LYS HD3  H   -6.785  -9.567  -0.266 1.00 . A A .  39 LYS HD3  1 1 
        2  1159 1 1 39 LYS HE2  H   -8.479 -11.178   0.591 1.00 . A A .  39 LYS HE2  1 1 
        2  1160 1 1 39 LYS HE3  H   -7.202 -12.387   0.717 1.00 . A A .  39 LYS HE3  1 1 
        2  1161 1 1 39 LYS HG2  H   -7.007 -10.256  -2.428 1.00 . A A .  39 LYS HG2  1 1 
        2  1162 1 1 39 LYS HG3  H   -8.191 -11.322  -1.668 1.00 . A A .  39 LYS HG3  1 1 
        2  1163 1 1 39 LYS HZ1  H   -6.157 -11.220   2.409 1.00 . A A .  39 LYS HZ1  1 1 
        2  1164 1 1 39 LYS HZ2  H   -7.796 -11.035   2.785 1.00 . A A .  39 LYS HZ2  1 1 
        2  1165 1 1 39 LYS HZ3  H   -6.948  -9.767   2.053 1.00 . A A .  39 LYS HZ3  1 1 
        2  1166 1 1 39 LYS N    N   -6.254 -14.726  -2.410 1.00 . A A .  39 LYS N    1 1 
        2  1167 1 1 39 LYS NZ   N   -7.054 -10.801   2.094 1.00 . A A .  39 LYS NZ   1 1 
        2  1168 1 1 39 LYS O    O   -8.875 -12.954  -3.207 1.00 . A A .  39 LYS O    1 1 
        2  1169 1 1 40 PRO C    C  -11.503 -13.426  -1.548 1.00 . A A .  40 PRO C    1 1 
        2  1170 1 1 40 PRO CA   C  -10.690 -14.656  -1.934 1.00 . A A .  40 PRO CA   1 1 
        2  1171 1 1 40 PRO CB   C  -11.112 -15.863  -1.091 1.00 . A A .  40 PRO CB   1 1 
        2  1172 1 1 40 PRO CD   C   -8.845 -15.376  -0.511 1.00 . A A .  40 PRO CD   1 1 
        2  1173 1 1 40 PRO CG   C  -10.145 -15.890   0.042 1.00 . A A .  40 PRO CG   1 1 
        2  1174 1 1 40 PRO HA   H  -10.845 -14.875  -2.981 1.00 . A A .  40 PRO HA   1 1 
        2  1175 1 1 40 PRO HB2  H  -12.126 -15.724  -0.743 1.00 . A A .  40 PRO HB2  1 1 
        2  1176 1 1 40 PRO HB3  H  -11.049 -16.762  -1.685 1.00 . A A .  40 PRO HB3  1 1 
        2  1177 1 1 40 PRO HD2  H   -8.311 -14.813   0.240 1.00 . A A .  40 PRO HD2  1 1 
        2  1178 1 1 40 PRO HD3  H   -8.239 -16.194  -0.874 1.00 . A A .  40 PRO HD3  1 1 
        2  1179 1 1 40 PRO HG2  H  -10.493 -15.249   0.837 1.00 . A A .  40 PRO HG2  1 1 
        2  1180 1 1 40 PRO HG3  H  -10.026 -16.902   0.398 1.00 . A A .  40 PRO HG3  1 1 
        2  1181 1 1 40 PRO N    N   -9.266 -14.505  -1.621 1.00 . A A .  40 PRO N    1 1 
        2  1182 1 1 40 PRO O    O  -10.948 -12.405  -1.142 1.00 . A A .  40 PRO O    1 1 
        2  1183 1 1 41 SER C    C  -13.175 -11.633  -0.153 1.00 . A A .  41 SER C    1 1 
        2  1184 1 1 41 SER CA   C  -13.712 -12.423  -1.343 1.00 . A A .  41 SER CA   1 1 
        2  1185 1 1 41 SER CB   C  -15.116 -12.945  -1.031 1.00 . A A .  41 SER CB   1 1 
        2  1186 1 1 41 SER H    H  -13.206 -14.369  -2.005 1.00 . A A .  41 SER H    1 1 
        2  1187 1 1 41 SER HA   H  -13.763 -11.769  -2.201 1.00 . A A .  41 SER HA   1 1 
        2  1188 1 1 41 SER HB2  H  -15.067 -13.623  -0.192 1.00 . A A .  41 SER HB2  1 1 
        2  1189 1 1 41 SER HB3  H  -15.760 -12.114  -0.785 1.00 . A A .  41 SER HB3  1 1 
        2  1190 1 1 41 SER HG   H  -16.258 -13.051  -2.619 1.00 . A A .  41 SER HG   1 1 
        2  1191 1 1 41 SER N    N  -12.822 -13.529  -1.676 1.00 . A A .  41 SER N    1 1 
        2  1192 1 1 41 SER O    O  -12.814 -10.464  -0.281 1.00 . A A .  41 SER O    1 1 
        2  1193 1 1 41 SER OG   O  -15.662 -13.634  -2.142 1.00 . A A .  41 SER OG   1 1 
        2  1194 1 1 42 GLY C    C  -13.182 -12.245   3.472 1.00 . A A .  42 GLY C    1 1 
        2  1195 1 1 42 GLY CA   C  -12.631 -11.626   2.203 1.00 . A A .  42 GLY CA   1 1 
        2  1196 1 1 42 GLY H    H  -13.426 -13.214   1.049 1.00 . A A .  42 GLY H    1 1 
        2  1197 1 1 42 GLY HA2  H  -11.554 -11.695   2.219 1.00 . A A .  42 GLY HA2  1 1 
        2  1198 1 1 42 GLY HA3  H  -12.915 -10.585   2.172 1.00 . A A .  42 GLY HA3  1 1 
        2  1199 1 1 42 GLY N    N  -13.125 -12.282   1.006 1.00 . A A .  42 GLY N    1 1 
        2  1200 1 1 42 GLY O    O  -14.161 -11.769   4.047 1.00 . A A .  42 GLY O    1 1 
        2  1201 1 1 43 PRO C    C  -12.691 -13.236   6.407 1.00 . A A .  43 PRO C    1 1 
        2  1202 1 1 43 PRO CA   C  -12.962 -14.044   5.142 1.00 . A A .  43 PRO CA   1 1 
        2  1203 1 1 43 PRO CB   C  -12.104 -15.312   5.124 1.00 . A A .  43 PRO CB   1 1 
        2  1204 1 1 43 PRO CD   C  -11.372 -13.958   3.295 1.00 . A A .  43 PRO CD   1 1 
        2  1205 1 1 43 PRO CG   C  -10.900 -14.943   4.328 1.00 . A A .  43 PRO CG   1 1 
        2  1206 1 1 43 PRO HA   H  -14.007 -14.314   5.106 1.00 . A A .  43 PRO HA   1 1 
        2  1207 1 1 43 PRO HB2  H  -11.841 -15.586   6.136 1.00 . A A .  43 PRO HB2  1 1 
        2  1208 1 1 43 PRO HB3  H  -12.654 -16.115   4.658 1.00 . A A .  43 PRO HB3  1 1 
        2  1209 1 1 43 PRO HD2  H  -10.606 -13.223   3.096 1.00 . A A .  43 PRO HD2  1 1 
        2  1210 1 1 43 PRO HD3  H  -11.652 -14.470   2.386 1.00 . A A .  43 PRO HD3  1 1 
        2  1211 1 1 43 PRO HG2  H  -10.161 -14.487   4.970 1.00 . A A .  43 PRO HG2  1 1 
        2  1212 1 1 43 PRO HG3  H  -10.493 -15.821   3.850 1.00 . A A .  43 PRO HG3  1 1 
        2  1213 1 1 43 PRO N    N  -12.546 -13.335   3.929 1.00 . A A .  43 PRO N    1 1 
        2  1214 1 1 43 PRO O    O  -11.795 -12.392   6.436 1.00 . A A .  43 PRO O    1 1 
        2  1215 1 1 44 SER C    C  -11.871 -12.858   9.202 1.00 . A A .  44 SER C    1 1 
        2  1216 1 1 44 SER CA   C  -13.316 -12.795   8.718 1.00 . A A .  44 SER CA   1 1 
        2  1217 1 1 44 SER CB   C  -14.246 -13.394   9.775 1.00 . A A .  44 SER CB   1 1 
        2  1218 1 1 44 SER H    H  -14.167 -14.185   7.366 1.00 . A A .  44 SER H    1 1 
        2  1219 1 1 44 SER HA   H  -13.585 -11.762   8.557 1.00 . A A .  44 SER HA   1 1 
        2  1220 1 1 44 SER HB2  H  -15.224 -13.549   9.344 1.00 . A A .  44 SER HB2  1 1 
        2  1221 1 1 44 SER HB3  H  -13.846 -14.340  10.109 1.00 . A A .  44 SER HB3  1 1 
        2  1222 1 1 44 SER HG   H  -13.760 -12.805  11.579 1.00 . A A .  44 SER HG   1 1 
        2  1223 1 1 44 SER N    N  -13.470 -13.501   7.451 1.00 . A A .  44 SER N    1 1 
        2  1224 1 1 44 SER O    O  -11.284 -11.841   9.573 1.00 . A A .  44 SER O    1 1 
        2  1225 1 1 44 SER OG   O  -14.371 -12.530  10.892 1.00 . A A .  44 SER OG   1 1 
        2  1226 1 1 45 SER C    C   -8.970 -14.265   8.450 1.00 . A A .  45 SER C    1 1 
        2  1227 1 1 45 SER CA   C   -9.927 -14.257   9.638 1.00 . A A .  45 SER CA   1 1 
        2  1228 1 1 45 SER CB   C   -9.802 -15.568  10.416 1.00 . A A .  45 SER CB   1 1 
        2  1229 1 1 45 SER H    H  -11.822 -14.832   8.889 1.00 . A A .  45 SER H    1 1 
        2  1230 1 1 45 SER HA   H   -9.667 -13.436  10.289 1.00 . A A .  45 SER HA   1 1 
        2  1231 1 1 45 SER HB2  H   -8.813 -15.640  10.840 1.00 . A A .  45 SER HB2  1 1 
        2  1232 1 1 45 SER HB3  H  -10.536 -15.584  11.209 1.00 . A A .  45 SER HB3  1 1 
        2  1233 1 1 45 SER HG   H   -9.217 -17.210   9.523 1.00 . A A .  45 SER HG   1 1 
        2  1234 1 1 45 SER N    N  -11.303 -14.059   9.196 1.00 . A A .  45 SER N    1 1 
        2  1235 1 1 45 SER O    O   -9.250 -14.872   7.417 1.00 . A A .  45 SER O    1 1 
        2  1236 1 1 45 SER OG   O  -10.019 -16.685   9.571 1.00 . A A .  45 SER OG   1 1 
        2  1237 1 1 46 GLY C    C   -5.464 -13.213   8.047 1.00 . A A .  46 GLY C    1 1 
        2  1238 1 1 46 GLY CA   C   -6.857 -13.525   7.537 1.00 . A A .  46 GLY CA   1 1 
        2  1239 1 1 46 GLY H    H   -7.669 -13.119   9.450 1.00 . A A .  46 GLY H    1 1 
        2  1240 1 1 46 GLY HA2  H   -6.838 -14.476   7.027 1.00 . A A .  46 GLY HA2  1 1 
        2  1241 1 1 46 GLY HA3  H   -7.151 -12.757   6.836 1.00 . A A .  46 GLY HA3  1 1 
        2  1242 1 1 46 GLY N    N   -7.839 -13.584   8.604 1.00 . A A .  46 GLY N    1 1 
        2  1243 1 1 46 GLY O    O   -4.655 -14.130   8.180 1.00 . A A .  46 GLY O    1 1 
        2  1244 2 2  1 ZN  ZN   ZN  -4.190  -2.924  -2.104 1.00 . B A . 201 ZN  ZN   1 1 
        3  1245 1 1  1 GLY C    C  -30.292  24.261  -0.136 1.00 . A A .   1 GLY C    1 1 
        3  1246 1 1  1 GLY CA   C  -30.938  25.107  -1.215 1.00 . A A .   1 GLY CA   1 1 
        3  1247 1 1  1 GLY H1   H  -30.968  26.741   0.131 1.00 . A A .   1 GLY H1   1 1 
        3  1248 1 1  1 GLY HA2  H  -31.837  24.615  -1.554 1.00 . A A .   1 GLY HA2  1 1 
        3  1249 1 1  1 GLY HA3  H  -30.253  25.194  -2.046 1.00 . A A .   1 GLY HA3  1 1 
        3  1250 1 1  1 GLY N    N  -31.279  26.438  -0.747 1.00 . A A .   1 GLY N    1 1 
        3  1251 1 1  1 GLY O    O  -30.837  24.116   0.958 1.00 . A A .   1 GLY O    1 1 
        3  1252 1 1  2 SER C    C  -26.908  23.130   0.445 1.00 . A A .   2 SER C    1 1 
        3  1253 1 1  2 SER CA   C  -28.408  22.859   0.506 1.00 . A A .   2 SER CA   1 1 
        3  1254 1 1  2 SER CB   C  -28.683  21.381   0.221 1.00 . A A .   2 SER CB   1 1 
        3  1255 1 1  2 SER H    H  -28.743  23.853  -1.333 1.00 . A A .   2 SER H    1 1 
        3  1256 1 1  2 SER HA   H  -28.766  23.098   1.497 1.00 . A A .   2 SER HA   1 1 
        3  1257 1 1  2 SER HB2  H  -28.421  21.160  -0.802 1.00 . A A .   2 SER HB2  1 1 
        3  1258 1 1  2 SER HB3  H  -28.087  20.772   0.885 1.00 . A A .   2 SER HB3  1 1 
        3  1259 1 1  2 SER HG   H  -30.403  21.610   1.131 1.00 . A A .   2 SER HG   1 1 
        3  1260 1 1  2 SER N    N  -29.127  23.700  -0.444 1.00 . A A .   2 SER N    1 1 
        3  1261 1 1  2 SER O    O  -26.373  23.487  -0.604 1.00 . A A .   2 SER O    1 1 
        3  1262 1 1  2 SER OG   O  -30.051  21.069   0.420 1.00 . A A .   2 SER OG   1 1 
        3  1263 1 1  3 SER C    C  -24.061  21.900   2.012 1.00 . A A .   3 SER C    1 1 
        3  1264 1 1  3 SER CA   C  -24.798  23.187   1.657 1.00 . A A .   3 SER CA   1 1 
        3  1265 1 1  3 SER CB   C  -24.488  24.269   2.694 1.00 . A A .   3 SER CB   1 1 
        3  1266 1 1  3 SER H    H  -26.719  22.672   2.382 1.00 . A A .   3 SER H    1 1 
        3  1267 1 1  3 SER HA   H  -24.463  23.524   0.687 1.00 . A A .   3 SER HA   1 1 
        3  1268 1 1  3 SER HB2  H  -25.054  24.075   3.592 1.00 . A A .   3 SER HB2  1 1 
        3  1269 1 1  3 SER HB3  H  -23.432  24.252   2.923 1.00 . A A .   3 SER HB3  1 1 
        3  1270 1 1  3 SER HG   H  -24.415  26.225   2.755 1.00 . A A .   3 SER HG   1 1 
        3  1271 1 1  3 SER N    N  -26.236  22.958   1.579 1.00 . A A .   3 SER N    1 1 
        3  1272 1 1  3 SER O    O  -24.608  21.022   2.679 1.00 . A A .   3 SER O    1 1 
        3  1273 1 1  3 SER OG   O  -24.830  25.555   2.207 1.00 . A A .   3 SER OG   1 1 
        3  1274 1 1  4 GLY C    C  -20.695  20.617   1.108 1.00 . A A .   4 GLY C    1 1 
        3  1275 1 1  4 GLY CA   C  -22.021  20.612   1.842 1.00 . A A .   4 GLY CA   1 1 
        3  1276 1 1  4 GLY H    H  -22.430  22.527   1.035 1.00 . A A .   4 GLY H    1 1 
        3  1277 1 1  4 GLY HA2  H  -21.834  20.560   2.904 1.00 . A A .   4 GLY HA2  1 1 
        3  1278 1 1  4 GLY HA3  H  -22.581  19.738   1.542 1.00 . A A .   4 GLY HA3  1 1 
        3  1279 1 1  4 GLY N    N  -22.814  21.795   1.562 1.00 . A A .   4 GLY N    1 1 
        3  1280 1 1  4 GLY O    O  -20.654  20.747  -0.115 1.00 . A A .   4 GLY O    1 1 
        3  1281 1 1  5 SER C    C  -17.257  19.862   2.236 1.00 . A A .   5 SER C    1 1 
        3  1282 1 1  5 SER CA   C  -18.270  20.470   1.272 1.00 . A A .   5 SER CA   1 1 
        3  1283 1 1  5 SER CB   C  -17.847  21.892   0.899 1.00 . A A .   5 SER CB   1 1 
        3  1284 1 1  5 SER H    H  -19.703  20.376   2.828 1.00 . A A .   5 SER H    1 1 
        3  1285 1 1  5 SER HA   H  -18.304  19.867   0.376 1.00 . A A .   5 SER HA   1 1 
        3  1286 1 1  5 SER HB2  H  -17.971  22.538   1.755 1.00 . A A .   5 SER HB2  1 1 
        3  1287 1 1  5 SER HB3  H  -16.810  21.889   0.598 1.00 . A A .   5 SER HB3  1 1 
        3  1288 1 1  5 SER HG   H  -19.301  22.989   0.177 1.00 . A A .   5 SER HG   1 1 
        3  1289 1 1  5 SER N    N  -19.606  20.476   1.857 1.00 . A A .   5 SER N    1 1 
        3  1290 1 1  5 SER O    O  -16.916  20.462   3.256 1.00 . A A .   5 SER O    1 1 
        3  1291 1 1  5 SER OG   O  -18.632  22.394  -0.169 1.00 . A A .   5 SER OG   1 1 
        3  1292 1 1  6 SER C    C  -14.460  17.861   2.034 1.00 . A A .   6 SER C    1 1 
        3  1293 1 1  6 SER CA   C  -15.806  17.974   2.744 1.00 . A A .   6 SER CA   1 1 
        3  1294 1 1  6 SER CB   C  -16.320  16.581   3.113 1.00 . A A .   6 SER CB   1 1 
        3  1295 1 1  6 SER H    H  -17.088  18.239   1.080 1.00 . A A .   6 SER H    1 1 
        3  1296 1 1  6 SER HA   H  -15.676  18.552   3.647 1.00 . A A .   6 SER HA   1 1 
        3  1297 1 1  6 SER HB2  H  -16.542  16.031   2.212 1.00 . A A .   6 SER HB2  1 1 
        3  1298 1 1  6 SER HB3  H  -15.560  16.058   3.677 1.00 . A A .   6 SER HB3  1 1 
        3  1299 1 1  6 SER HG   H  -18.066  17.354   3.552 1.00 . A A .   6 SER HG   1 1 
        3  1300 1 1  6 SER N    N  -16.778  18.667   1.906 1.00 . A A .   6 SER N    1 1 
        3  1301 1 1  6 SER O    O  -14.074  16.784   1.580 1.00 . A A .   6 SER O    1 1 
        3  1302 1 1  6 SER OG   O  -17.496  16.664   3.899 1.00 . A A .   6 SER OG   1 1 
        3  1303 1 1  7 GLY C    C  -12.393  18.025   0.117 1.00 . A A .   7 GLY C    1 1 
        3  1304 1 1  7 GLY CA   C  -12.455  18.987   1.287 1.00 . A A .   7 GLY CA   1 1 
        3  1305 1 1  7 GLY H    H  -14.108  19.810   2.324 1.00 . A A .   7 GLY H    1 1 
        3  1306 1 1  7 GLY HA2  H  -12.248  19.985   0.932 1.00 . A A .   7 GLY HA2  1 1 
        3  1307 1 1  7 GLY HA3  H  -11.699  18.708   2.007 1.00 . A A .   7 GLY HA3  1 1 
        3  1308 1 1  7 GLY N    N  -13.750  18.981   1.943 1.00 . A A .   7 GLY N    1 1 
        3  1309 1 1  7 GLY O    O  -12.025  16.861   0.278 1.00 . A A .   7 GLY O    1 1 
        3  1310 1 1  8 THR C    C  -11.335  17.567  -2.837 1.00 . A A .   8 THR C    1 1 
        3  1311 1 1  8 THR CA   C  -12.743  17.687  -2.267 1.00 . A A .   8 THR CA   1 1 
        3  1312 1 1  8 THR CB   C  -13.676  18.259  -3.351 1.00 . A A .   8 THR CB   1 1 
        3  1313 1 1  8 THR CG2  C  -13.666  17.381  -4.593 1.00 . A A .   8 THR CG2  1 1 
        3  1314 1 1  8 THR H    H  -13.040  19.447  -1.130 1.00 . A A .   8 THR H    1 1 
        3  1315 1 1  8 THR HA   H  -13.098  16.702  -2.000 1.00 . A A .   8 THR HA   1 1 
        3  1316 1 1  8 THR HB   H  -13.326  19.245  -3.623 1.00 . A A .   8 THR HB   1 1 
        3  1317 1 1  8 THR HG1  H  -15.258  17.533  -2.423 1.00 . A A .   8 THR HG1  1 1 
        3  1318 1 1  8 THR HG21 H  -14.307  17.814  -5.346 1.00 . A A .   8 THR HG21 1 1 
        3  1319 1 1  8 THR HG22 H  -14.025  16.394  -4.340 1.00 . A A .   8 THR HG22 1 1 
        3  1320 1 1  8 THR HG23 H  -12.658  17.310  -4.975 1.00 . A A .   8 THR HG23 1 1 
        3  1321 1 1  8 THR N    N  -12.756  18.511  -1.066 1.00 . A A .   8 THR N    1 1 
        3  1322 1 1  8 THR O    O  -10.954  18.312  -3.740 1.00 . A A .   8 THR O    1 1 
        3  1323 1 1  8 THR OG1  O  -15.012  18.361  -2.844 1.00 . A A .   8 THR OG1  1 1 
        3  1324 1 1  9 GLY C    C   -9.032  15.110  -3.508 1.00 . A A .   9 GLY C    1 1 
        3  1325 1 1  9 GLY CA   C   -9.205  16.424  -2.773 1.00 . A A .   9 GLY CA   1 1 
        3  1326 1 1  9 GLY H    H  -10.920  16.060  -1.587 1.00 . A A .   9 GLY H    1 1 
        3  1327 1 1  9 GLY HA2  H   -8.942  17.234  -3.438 1.00 . A A .   9 GLY HA2  1 1 
        3  1328 1 1  9 GLY HA3  H   -8.537  16.438  -1.924 1.00 . A A .   9 GLY HA3  1 1 
        3  1329 1 1  9 GLY N    N  -10.563  16.624  -2.304 1.00 . A A .   9 GLY N    1 1 
        3  1330 1 1  9 GLY O    O   -8.563  14.128  -2.934 1.00 . A A .   9 GLY O    1 1 
        3  1331 1 1 10 GLU C    C   -7.926  13.246  -5.432 1.00 . A A .  10 GLU C    1 1 
        3  1332 1 1 10 GLU CA   C   -9.302  13.885  -5.594 1.00 . A A .  10 GLU CA   1 1 
        3  1333 1 1 10 GLU CB   C   -9.555  14.211  -7.067 1.00 . A A .  10 GLU CB   1 1 
        3  1334 1 1 10 GLU CD   C   -8.813  15.487  -9.117 1.00 . A A .  10 GLU CD   1 1 
        3  1335 1 1 10 GLU CG   C   -8.507  15.128  -7.676 1.00 . A A .  10 GLU CG   1 1 
        3  1336 1 1 10 GLU H    H   -9.782  15.906  -5.183 1.00 . A A .  10 GLU H    1 1 
        3  1337 1 1 10 GLU HA   H  -10.052  13.186  -5.256 1.00 . A A .  10 GLU HA   1 1 
        3  1338 1 1 10 GLU HB2  H   -9.568  13.289  -7.630 1.00 . A A .  10 GLU HB2  1 1 
        3  1339 1 1 10 GLU HB3  H  -10.518  14.691  -7.157 1.00 . A A .  10 GLU HB3  1 1 
        3  1340 1 1 10 GLU HG2  H   -8.464  16.038  -7.097 1.00 . A A .  10 GLU HG2  1 1 
        3  1341 1 1 10 GLU HG3  H   -7.548  14.633  -7.639 1.00 . A A .  10 GLU HG3  1 1 
        3  1342 1 1 10 GLU N    N   -9.415  15.091  -4.781 1.00 . A A .  10 GLU N    1 1 
        3  1343 1 1 10 GLU O    O   -6.922  13.940  -5.266 1.00 . A A .  10 GLU O    1 1 
        3  1344 1 1 10 GLU OE1  O   -8.487  14.678 -10.011 1.00 . A A .  10 GLU OE1  1 1 
        3  1345 1 1 10 GLU OE2  O   -9.378  16.576  -9.351 1.00 . A A .  10 GLU OE2  1 1 
        3  1346 1 1 11 LYS C    C   -6.094  10.765  -6.703 1.00 . A A .  11 LYS C    1 1 
        3  1347 1 1 11 LYS CA   C   -6.635  11.185  -5.340 1.00 . A A .  11 LYS CA   1 1 
        3  1348 1 1 11 LYS CB   C   -6.840   9.950  -4.458 1.00 . A A .  11 LYS CB   1 1 
        3  1349 1 1 11 LYS CD   C   -8.197   7.875  -4.058 1.00 . A A .  11 LYS CD   1 1 
        3  1350 1 1 11 LYS CE   C   -9.374   8.388  -3.241 1.00 . A A .  11 LYS CE   1 1 
        3  1351 1 1 11 LYS CG   C   -7.742   8.900  -5.083 1.00 . A A .  11 LYS CG   1 1 
        3  1352 1 1 11 LYS H    H   -8.720  11.421  -5.614 1.00 . A A .  11 LYS H    1 1 
        3  1353 1 1 11 LYS HA   H   -5.917  11.839  -4.867 1.00 . A A .  11 LYS HA   1 1 
        3  1354 1 1 11 LYS HB2  H   -5.879   9.499  -4.262 1.00 . A A .  11 LYS HB2  1 1 
        3  1355 1 1 11 LYS HB3  H   -7.280  10.261  -3.521 1.00 . A A .  11 LYS HB3  1 1 
        3  1356 1 1 11 LYS HD2  H   -8.496   6.973  -4.571 1.00 . A A .  11 LYS HD2  1 1 
        3  1357 1 1 11 LYS HD3  H   -7.376   7.656  -3.391 1.00 . A A .  11 LYS HD3  1 1 
        3  1358 1 1 11 LYS HE2  H   -9.491   7.762  -2.370 1.00 . A A .  11 LYS HE2  1 1 
        3  1359 1 1 11 LYS HE3  H   -9.165   9.402  -2.931 1.00 . A A .  11 LYS HE3  1 1 
        3  1360 1 1 11 LYS HG2  H   -8.611   9.387  -5.500 1.00 . A A .  11 LYS HG2  1 1 
        3  1361 1 1 11 LYS HG3  H   -7.199   8.393  -5.868 1.00 . A A .  11 LYS HG3  1 1 
        3  1362 1 1 11 LYS HZ1  H  -11.029   9.335  -4.094 1.00 . A A .  11 LYS HZ1  1 1 
        3  1363 1 1 11 LYS HZ2  H  -11.341   7.760  -3.558 1.00 . A A .  11 LYS HZ2  1 1 
        3  1364 1 1 11 LYS HZ3  H  -10.464   8.010  -4.982 1.00 . A A .  11 LYS HZ3  1 1 
        3  1365 1 1 11 LYS N    N   -7.886  11.919  -5.480 1.00 . A A .  11 LYS N    1 1 
        3  1366 1 1 11 LYS NZ   N  -10.641   8.373  -4.024 1.00 . A A .  11 LYS NZ   1 1 
        3  1367 1 1 11 LYS O    O   -6.846  10.425  -7.617 1.00 . A A .  11 LYS O    1 1 
        3  1368 1 1 12 PRO C    C   -4.195   8.914  -8.376 1.00 . A A .  12 PRO C    1 1 
        3  1369 1 1 12 PRO CA   C   -4.091  10.408  -8.092 1.00 . A A .  12 PRO CA   1 1 
        3  1370 1 1 12 PRO CB   C   -2.633  10.805  -7.846 1.00 . A A .  12 PRO CB   1 1 
        3  1371 1 1 12 PRO CD   C   -3.804  11.180  -5.796 1.00 . A A .  12 PRO CD   1 1 
        3  1372 1 1 12 PRO CG   C   -2.475  10.767  -6.365 1.00 . A A .  12 PRO CG   1 1 
        3  1373 1 1 12 PRO HA   H   -4.479  10.962  -8.934 1.00 . A A .  12 PRO HA   1 1 
        3  1374 1 1 12 PRO HB2  H   -1.977  10.096  -8.332 1.00 . A A .  12 PRO HB2  1 1 
        3  1375 1 1 12 PRO HB3  H   -2.455  11.795  -8.236 1.00 . A A .  12 PRO HB3  1 1 
        3  1376 1 1 12 PRO HD2  H   -4.001  10.650  -4.875 1.00 . A A .  12 PRO HD2  1 1 
        3  1377 1 1 12 PRO HD3  H   -3.830  12.247  -5.633 1.00 . A A .  12 PRO HD3  1 1 
        3  1378 1 1 12 PRO HG2  H   -2.225   9.766  -6.047 1.00 . A A .  12 PRO HG2  1 1 
        3  1379 1 1 12 PRO HG3  H   -1.706  11.461  -6.060 1.00 . A A .  12 PRO HG3  1 1 
        3  1380 1 1 12 PRO N    N   -4.761  10.786  -6.844 1.00 . A A .  12 PRO N    1 1 
        3  1381 1 1 12 PRO O    O   -4.550   8.506  -9.483 1.00 . A A .  12 PRO O    1 1 
        3  1382 1 1 13 TYR C    C   -4.716   6.020  -6.362 1.00 . A A .  13 TYR C    1 1 
        3  1383 1 1 13 TYR CA   C   -3.942   6.652  -7.515 1.00 . A A .  13 TYR CA   1 1 
        3  1384 1 1 13 TYR CB   C   -2.530   6.068  -7.576 1.00 . A A .  13 TYR CB   1 1 
        3  1385 1 1 13 TYR CD1  C   -1.038   7.719  -8.770 1.00 . A A .  13 TYR CD1  1 1 
        3  1386 1 1 13 TYR CD2  C   -1.695   5.748  -9.938 1.00 . A A .  13 TYR CD2  1 1 
        3  1387 1 1 13 TYR CE1  C   -0.315   8.136  -9.871 1.00 . A A .  13 TYR CE1  1 1 
        3  1388 1 1 13 TYR CE2  C   -0.974   6.157 -11.043 1.00 . A A .  13 TYR CE2  1 1 
        3  1389 1 1 13 TYR CG   C   -1.740   6.520  -8.784 1.00 . A A .  13 TYR CG   1 1 
        3  1390 1 1 13 TYR CZ   C   -0.286   7.351 -11.005 1.00 . A A .  13 TYR CZ   1 1 
        3  1391 1 1 13 TYR H    H   -3.609   8.486  -6.514 1.00 . A A .  13 TYR H    1 1 
        3  1392 1 1 13 TYR HA   H   -4.453   6.430  -8.441 1.00 . A A .  13 TYR HA   1 1 
        3  1393 1 1 13 TYR HB2  H   -1.985   6.367  -6.694 1.00 . A A .  13 TYR HB2  1 1 
        3  1394 1 1 13 TYR HB3  H   -2.594   4.990  -7.606 1.00 . A A .  13 TYR HB3  1 1 
        3  1395 1 1 13 TYR HD1  H   -1.063   8.332  -7.881 1.00 . A A .  13 TYR HD1  1 1 
        3  1396 1 1 13 TYR HD2  H   -2.236   4.813  -9.965 1.00 . A A .  13 TYR HD2  1 1 
        3  1397 1 1 13 TYR HE1  H    0.224   9.072  -9.842 1.00 . A A .  13 TYR HE1  1 1 
        3  1398 1 1 13 TYR HE2  H   -0.951   5.542 -11.931 1.00 . A A .  13 TYR HE2  1 1 
        3  1399 1 1 13 TYR HH   H   -0.152   7.824 -12.863 1.00 . A A .  13 TYR HH   1 1 
        3  1400 1 1 13 TYR N    N   -3.885   8.102  -7.372 1.00 . A A .  13 TYR N    1 1 
        3  1401 1 1 13 TYR O    O   -5.128   6.706  -5.426 1.00 . A A .  13 TYR O    1 1 
        3  1402 1 1 13 TYR OH   O    0.433   7.763 -12.104 1.00 . A A .  13 TYR OH   1 1 
        3  1403 1 1 14 LYS C    C   -5.556   2.476  -5.638 1.00 . A A .  14 LYS C    1 1 
        3  1404 1 1 14 LYS CA   C   -5.632   3.981  -5.400 1.00 . A A .  14 LYS CA   1 1 
        3  1405 1 1 14 LYS CB   C   -7.095   4.428  -5.359 1.00 . A A .  14 LYS CB   1 1 
        3  1406 1 1 14 LYS CD   C   -9.131   4.376  -3.889 1.00 . A A .  14 LYS CD   1 1 
        3  1407 1 1 14 LYS CE   C   -9.927   3.564  -2.878 1.00 . A A .  14 LYS CE   1 1 
        3  1408 1 1 14 LYS CG   C   -7.965   3.579  -4.449 1.00 . A A .  14 LYS CG   1 1 
        3  1409 1 1 14 LYS H    H   -4.557   4.216  -7.208 1.00 . A A .  14 LYS H    1 1 
        3  1410 1 1 14 LYS HA   H   -5.168   4.207  -4.452 1.00 . A A .  14 LYS HA   1 1 
        3  1411 1 1 14 LYS HB2  H   -7.136   5.450  -5.010 1.00 . A A .  14 LYS HB2  1 1 
        3  1412 1 1 14 LYS HB3  H   -7.501   4.381  -6.358 1.00 . A A .  14 LYS HB3  1 1 
        3  1413 1 1 14 LYS HD2  H   -8.750   5.261  -3.402 1.00 . A A .  14 LYS HD2  1 1 
        3  1414 1 1 14 LYS HD3  H   -9.783   4.663  -4.701 1.00 . A A .  14 LYS HD3  1 1 
        3  1415 1 1 14 LYS HE2  H   -9.239   3.093  -2.193 1.00 . A A .  14 LYS HE2  1 1 
        3  1416 1 1 14 LYS HE3  H  -10.578   4.232  -2.333 1.00 . A A .  14 LYS HE3  1 1 
        3  1417 1 1 14 LYS HG2  H   -8.353   2.744  -5.014 1.00 . A A .  14 LYS HG2  1 1 
        3  1418 1 1 14 LYS HG3  H   -7.364   3.213  -3.629 1.00 . A A .  14 LYS HG3  1 1 
        3  1419 1 1 14 LYS HZ1  H  -11.703   2.881  -3.740 1.00 . A A .  14 LYS HZ1  1 1 
        3  1420 1 1 14 LYS HZ2  H  -10.837   1.685  -2.915 1.00 . A A .  14 LYS HZ2  1 1 
        3  1421 1 1 14 LYS HZ3  H  -10.308   2.219  -4.430 1.00 . A A .  14 LYS HZ3  1 1 
        3  1422 1 1 14 LYS N    N   -4.910   4.708  -6.437 1.00 . A A .  14 LYS N    1 1 
        3  1423 1 1 14 LYS NZ   N  -10.752   2.514  -3.537 1.00 . A A .  14 LYS NZ   1 1 
        3  1424 1 1 14 LYS O    O   -5.738   2.005  -6.761 1.00 . A A .  14 LYS O    1 1 
        3  1425 1 1 15 CYS C    C   -6.567  -0.353  -4.863 1.00 . A A .  15 CYS C    1 1 
        3  1426 1 1 15 CYS CA   C   -5.190   0.274  -4.667 1.00 . A A .  15 CYS CA   1 1 
        3  1427 1 1 15 CYS CB   C   -4.533  -0.295  -3.407 1.00 . A A .  15 CYS CB   1 1 
        3  1428 1 1 15 CYS H    H   -5.153   2.159  -3.705 1.00 . A A .  15 CYS H    1 1 
        3  1429 1 1 15 CYS HA   H   -4.575   0.037  -5.521 1.00 . A A .  15 CYS HA   1 1 
        3  1430 1 1 15 CYS HB2  H   -3.605   0.227  -3.228 1.00 . A A .  15 CYS HB2  1 1 
        3  1431 1 1 15 CYS HB3  H   -5.194  -0.143  -2.566 1.00 . A A .  15 CYS HB3  1 1 
        3  1432 1 1 15 CYS N    N   -5.288   1.726  -4.574 1.00 . A A .  15 CYS N    1 1 
        3  1433 1 1 15 CYS O    O   -7.414  -0.307  -3.972 1.00 . A A .  15 CYS O    1 1 
        3  1434 1 1 15 CYS SG   S   -4.157  -2.074  -3.504 1.00 . A A .  15 CYS SG   1 1 
        3  1435 1 1 16 ASN C    C   -8.115  -2.987  -5.777 1.00 . A A .  16 ASN C    1 1 
        3  1436 1 1 16 ASN CA   C   -8.057  -1.575  -6.351 1.00 . A A .  16 ASN CA   1 1 
        3  1437 1 1 16 ASN CB   C   -8.269  -1.619  -7.865 1.00 . A A .  16 ASN CB   1 1 
        3  1438 1 1 16 ASN CG   C   -7.004  -1.989  -8.616 1.00 . A A .  16 ASN CG   1 1 
        3  1439 1 1 16 ASN H    H   -6.068  -0.943  -6.708 1.00 . A A .  16 ASN H    1 1 
        3  1440 1 1 16 ASN HA   H   -8.841  -0.984  -5.903 1.00 . A A .  16 ASN HA   1 1 
        3  1441 1 1 16 ASN HB2  H   -9.028  -2.352  -8.095 1.00 . A A .  16 ASN HB2  1 1 
        3  1442 1 1 16 ASN HB3  H   -8.597  -0.648  -8.205 1.00 . A A .  16 ASN HB3  1 1 
        3  1443 1 1 16 ASN HD21 H   -7.022  -3.802  -7.801 1.00 . A A .  16 ASN HD21 1 1 
        3  1444 1 1 16 ASN HD22 H   -5.717  -3.479  -8.886 1.00 . A A .  16 ASN HD22 1 1 
        3  1445 1 1 16 ASN N    N   -6.783  -0.939  -6.037 1.00 . A A .  16 ASN N    1 1 
        3  1446 1 1 16 ASN ND2  N   -6.534  -3.214  -8.414 1.00 . A A .  16 ASN ND2  1 1 
        3  1447 1 1 16 ASN O    O   -8.602  -3.912  -6.427 1.00 . A A .  16 ASN O    1 1 
        3  1448 1 1 16 ASN OD1  O   -6.458  -1.182  -9.369 1.00 . A A .  16 ASN OD1  1 1 
        3  1449 1 1 17 GLU C    C   -8.145  -4.332  -2.469 1.00 . A A .  17 GLU C    1 1 
        3  1450 1 1 17 GLU CA   C   -7.612  -4.445  -3.894 1.00 . A A .  17 GLU CA   1 1 
        3  1451 1 1 17 GLU CB   C   -6.198  -5.029  -3.877 1.00 . A A .  17 GLU CB   1 1 
        3  1452 1 1 17 GLU CD   C   -4.557  -6.389  -5.232 1.00 . A A .  17 GLU CD   1 1 
        3  1453 1 1 17 GLU CG   C   -5.651  -5.339  -5.260 1.00 . A A .  17 GLU CG   1 1 
        3  1454 1 1 17 GLU H    H   -7.242  -2.369  -4.087 1.00 . A A .  17 GLU H    1 1 
        3  1455 1 1 17 GLU HA   H   -8.257  -5.104  -4.455 1.00 . A A .  17 GLU HA   1 1 
        3  1456 1 1 17 GLU HB2  H   -5.536  -4.322  -3.400 1.00 . A A .  17 GLU HB2  1 1 
        3  1457 1 1 17 GLU HB3  H   -6.207  -5.943  -3.303 1.00 . A A .  17 GLU HB3  1 1 
        3  1458 1 1 17 GLU HG2  H   -6.458  -5.698  -5.880 1.00 . A A .  17 GLU HG2  1 1 
        3  1459 1 1 17 GLU HG3  H   -5.247  -4.432  -5.685 1.00 . A A .  17 GLU HG3  1 1 
        3  1460 1 1 17 GLU N    N   -7.617  -3.145  -4.555 1.00 . A A .  17 GLU N    1 1 
        3  1461 1 1 17 GLU O    O   -8.900  -5.189  -2.006 1.00 . A A .  17 GLU O    1 1 
        3  1462 1 1 17 GLU OE1  O   -4.892  -7.593  -5.221 1.00 . A A .  17 GLU OE1  1 1 
        3  1463 1 1 17 GLU OE2  O   -3.368  -6.009  -5.221 1.00 . A A .  17 GLU OE2  1 1 
        3  1464 1 1 18 CYS C    C   -8.826  -1.668  -0.257 1.00 . A A .  18 CYS C    1 1 
        3  1465 1 1 18 CYS CA   C   -8.183  -3.044  -0.404 1.00 . A A .  18 CYS CA   1 1 
        3  1466 1 1 18 CYS CB   C   -6.998  -3.171   0.556 1.00 . A A .  18 CYS CB   1 1 
        3  1467 1 1 18 CYS H    H   -7.145  -2.622  -2.200 1.00 . A A .  18 CYS H    1 1 
        3  1468 1 1 18 CYS HA   H   -8.915  -3.798  -0.159 1.00 . A A .  18 CYS HA   1 1 
        3  1469 1 1 18 CYS HB2  H   -7.330  -2.939   1.558 1.00 . A A .  18 CYS HB2  1 1 
        3  1470 1 1 18 CYS HB3  H   -6.631  -4.186   0.531 1.00 . A A .  18 CYS HB3  1 1 
        3  1471 1 1 18 CYS N    N   -7.747  -3.270  -1.777 1.00 . A A .  18 CYS N    1 1 
        3  1472 1 1 18 CYS O    O   -9.911  -1.535   0.306 1.00 . A A .  18 CYS O    1 1 
        3  1473 1 1 18 CYS SG   S   -5.604  -2.066   0.167 1.00 . A A .  18 CYS SG   1 1 
        3  1474 1 1 19 GLY C    C   -7.634   1.694  -0.175 1.00 . A A .  19 GLY C    1 1 
        3  1475 1 1 19 GLY CA   C   -8.666   0.707  -0.683 1.00 . A A .  19 GLY CA   1 1 
        3  1476 1 1 19 GLY H    H   -7.285  -0.811  -1.205 1.00 . A A .  19 GLY H    1 1 
        3  1477 1 1 19 GLY HA2  H   -8.993   1.017  -1.664 1.00 . A A .  19 GLY HA2  1 1 
        3  1478 1 1 19 GLY HA3  H   -9.513   0.713  -0.014 1.00 . A A .  19 GLY HA3  1 1 
        3  1479 1 1 19 GLY N    N   -8.146  -0.646  -0.767 1.00 . A A .  19 GLY N    1 1 
        3  1480 1 1 19 GLY O    O   -7.944   2.564   0.639 1.00 . A A .  19 GLY O    1 1 
        3  1481 1 1 20 LYS C    C   -5.159   3.600  -1.226 1.00 . A A .  20 LYS C    1 1 
        3  1482 1 1 20 LYS CA   C   -5.319   2.445  -0.243 1.00 . A A .  20 LYS CA   1 1 
        3  1483 1 1 20 LYS CB   C   -4.007   1.665  -0.137 1.00 . A A .  20 LYS CB   1 1 
        3  1484 1 1 20 LYS CD   C   -3.396   2.008   2.275 1.00 . A A .  20 LYS CD   1 1 
        3  1485 1 1 20 LYS CE   C   -3.649   1.473   3.676 1.00 . A A .  20 LYS CE   1 1 
        3  1486 1 1 20 LYS CG   C   -3.801   1.000   1.212 1.00 . A A .  20 LYS CG   1 1 
        3  1487 1 1 20 LYS H    H   -6.216   0.845  -1.300 1.00 . A A .  20 LYS H    1 1 
        3  1488 1 1 20 LYS HA   H   -5.569   2.846   0.728 1.00 . A A .  20 LYS HA   1 1 
        3  1489 1 1 20 LYS HB2  H   -3.995   0.899  -0.899 1.00 . A A .  20 LYS HB2  1 1 
        3  1490 1 1 20 LYS HB3  H   -3.184   2.344  -0.310 1.00 . A A .  20 LYS HB3  1 1 
        3  1491 1 1 20 LYS HD2  H   -2.344   2.226   2.170 1.00 . A A .  20 LYS HD2  1 1 
        3  1492 1 1 20 LYS HD3  H   -3.969   2.914   2.136 1.00 . A A .  20 LYS HD3  1 1 
        3  1493 1 1 20 LYS HE2  H   -3.405   0.422   3.695 1.00 . A A .  20 LYS HE2  1 1 
        3  1494 1 1 20 LYS HE3  H   -3.013   2.003   4.370 1.00 . A A .  20 LYS HE3  1 1 
        3  1495 1 1 20 LYS HG2  H   -4.723   0.526   1.514 1.00 . A A .  20 LYS HG2  1 1 
        3  1496 1 1 20 LYS HG3  H   -3.023   0.255   1.121 1.00 . A A .  20 LYS HG3  1 1 
        3  1497 1 1 20 LYS HZ1  H   -5.425   2.569   3.762 1.00 . A A .  20 LYS HZ1  1 1 
        3  1498 1 1 20 LYS HZ2  H   -5.148   1.606   5.125 1.00 . A A .  20 LYS HZ2  1 1 
        3  1499 1 1 20 LYS HZ3  H   -5.657   0.896   3.677 1.00 . A A .  20 LYS HZ3  1 1 
        3  1500 1 1 20 LYS N    N   -6.402   1.558  -0.653 1.00 . A A .  20 LYS N    1 1 
        3  1501 1 1 20 LYS NZ   N   -5.069   1.649   4.089 1.00 . A A .  20 LYS NZ   1 1 
        3  1502 1 1 20 LYS O    O   -5.538   3.492  -2.392 1.00 . A A .  20 LYS O    1 1 
        3  1503 1 1 21 ALA C    C   -2.933   6.347  -1.514 1.00 . A A .  21 ALA C    1 1 
        3  1504 1 1 21 ALA CA   C   -4.382   5.878  -1.585 1.00 . A A .  21 ALA CA   1 1 
        3  1505 1 1 21 ALA CB   C   -5.323   6.999  -1.172 1.00 . A A .  21 ALA CB   1 1 
        3  1506 1 1 21 ALA H    H   -4.314   4.729   0.191 1.00 . A A .  21 ALA H    1 1 
        3  1507 1 1 21 ALA HA   H   -4.611   5.605  -2.606 1.00 . A A .  21 ALA HA   1 1 
        3  1508 1 1 21 ALA HB1  H   -5.789   6.749  -0.231 1.00 . A A .  21 ALA HB1  1 1 
        3  1509 1 1 21 ALA HB2  H   -4.763   7.917  -1.066 1.00 . A A .  21 ALA HB2  1 1 
        3  1510 1 1 21 ALA HB3  H   -6.084   7.127  -1.928 1.00 . A A .  21 ALA HB3  1 1 
        3  1511 1 1 21 ALA N    N   -4.595   4.704  -0.748 1.00 . A A .  21 ALA N    1 1 
        3  1512 1 1 21 ALA O    O   -2.371   6.496  -0.429 1.00 . A A .  21 ALA O    1 1 
        3  1513 1 1 22 PHE C    C   -0.846   8.360  -3.487 1.00 . A A .  22 PHE C    1 1 
        3  1514 1 1 22 PHE CA   C   -0.948   7.031  -2.746 1.00 . A A .  22 PHE CA   1 1 
        3  1515 1 1 22 PHE CB   C   -0.080   5.979  -3.440 1.00 . A A .  22 PHE CB   1 1 
        3  1516 1 1 22 PHE CD1  C   -1.452   3.878  -3.400 1.00 . A A .  22 PHE CD1  1 1 
        3  1517 1 1 22 PHE CD2  C    0.530   3.962  -2.077 1.00 . A A .  22 PHE CD2  1 1 
        3  1518 1 1 22 PHE CE1  C   -1.693   2.589  -2.962 1.00 . A A .  22 PHE CE1  1 1 
        3  1519 1 1 22 PHE CE2  C    0.294   2.673  -1.636 1.00 . A A .  22 PHE CE2  1 1 
        3  1520 1 1 22 PHE CG   C   -0.339   4.578  -2.963 1.00 . A A .  22 PHE CG   1 1 
        3  1521 1 1 22 PHE CZ   C   -0.818   1.986  -2.080 1.00 . A A .  22 PHE CZ   1 1 
        3  1522 1 1 22 PHE H    H   -2.833   6.442  -3.509 1.00 . A A .  22 PHE H    1 1 
        3  1523 1 1 22 PHE HA   H   -0.594   7.167  -1.736 1.00 . A A .  22 PHE HA   1 1 
        3  1524 1 1 22 PHE HB2  H   -0.272   6.007  -4.502 1.00 . A A .  22 PHE HB2  1 1 
        3  1525 1 1 22 PHE HB3  H    0.960   6.205  -3.260 1.00 . A A .  22 PHE HB3  1 1 
        3  1526 1 1 22 PHE HD1  H   -2.136   4.348  -4.091 1.00 . A A .  22 PHE HD1  1 1 
        3  1527 1 1 22 PHE HD2  H    1.401   4.499  -1.729 1.00 . A A .  22 PHE HD2  1 1 
        3  1528 1 1 22 PHE HE1  H   -2.563   2.054  -3.311 1.00 . A A .  22 PHE HE1  1 1 
        3  1529 1 1 22 PHE HE2  H    0.980   2.205  -0.946 1.00 . A A .  22 PHE HE2  1 1 
        3  1530 1 1 22 PHE HZ   H   -1.005   0.980  -1.736 1.00 . A A .  22 PHE HZ   1 1 
        3  1531 1 1 22 PHE N    N   -2.333   6.579  -2.677 1.00 . A A .  22 PHE N    1 1 
        3  1532 1 1 22 PHE O    O   -1.844   8.888  -3.978 1.00 . A A .  22 PHE O    1 1 
        3  1533 1 1 23 ARG C    C    1.693  10.023  -5.300 1.00 . A A .  23 ARG C    1 1 
        3  1534 1 1 23 ARG CA   C    0.602  10.165  -4.244 1.00 . A A .  23 ARG CA   1 1 
        3  1535 1 1 23 ARG CB   C    0.992  11.245  -3.233 1.00 . A A .  23 ARG CB   1 1 
        3  1536 1 1 23 ARG CD   C    0.961  13.676  -2.598 1.00 . A A .  23 ARG CD   1 1 
        3  1537 1 1 23 ARG CG   C    0.578  12.647  -3.650 1.00 . A A .  23 ARG CG   1 1 
        3  1538 1 1 23 ARG CZ   C    3.070  14.689  -3.351 1.00 . A A .  23 ARG CZ   1 1 
        3  1539 1 1 23 ARG H    H    1.125   8.428  -3.153 1.00 . A A .  23 ARG H    1 1 
        3  1540 1 1 23 ARG HA   H   -0.318  10.455  -4.730 1.00 . A A .  23 ARG HA   1 1 
        3  1541 1 1 23 ARG HB2  H    0.523  11.022  -2.286 1.00 . A A .  23 ARG HB2  1 1 
        3  1542 1 1 23 ARG HB3  H    2.064  11.232  -3.107 1.00 . A A .  23 ARG HB3  1 1 
        3  1543 1 1 23 ARG HD2  H    0.484  14.614  -2.841 1.00 . A A .  23 ARG HD2  1 1 
        3  1544 1 1 23 ARG HD3  H    0.611  13.334  -1.635 1.00 . A A .  23 ARG HD3  1 1 
        3  1545 1 1 23 ARG HE   H    2.903  13.392  -1.845 1.00 . A A .  23 ARG HE   1 1 
        3  1546 1 1 23 ARG HG2  H    1.071  12.897  -4.578 1.00 . A A .  23 ARG HG2  1 1 
        3  1547 1 1 23 ARG HG3  H   -0.492  12.669  -3.791 1.00 . A A .  23 ARG HG3  1 1 
        3  1548 1 1 23 ARG HH11 H    1.433  15.266  -4.385 1.00 . A A .  23 ARG HH11 1 1 
        3  1549 1 1 23 ARG HH12 H    2.927  15.973  -4.905 1.00 . A A .  23 ARG HH12 1 1 
        3  1550 1 1 23 ARG HH21 H    4.876  14.316  -2.521 1.00 . A A .  23 ARG HH21 1 1 
        3  1551 1 1 23 ARG HH22 H    4.884  15.432  -3.845 1.00 . A A .  23 ARG HH22 1 1 
        3  1552 1 1 23 ARG N    N    0.368   8.896  -3.564 1.00 . A A .  23 ARG N    1 1 
        3  1553 1 1 23 ARG NE   N    2.405  13.881  -2.533 1.00 . A A .  23 ARG NE   1 1 
        3  1554 1 1 23 ARG NH1  N    2.424  15.364  -4.291 1.00 . A A .  23 ARG NH1  1 1 
        3  1555 1 1 23 ARG NH2  N    4.385  14.824  -3.229 1.00 . A A .  23 ARG NH2  1 1 
        3  1556 1 1 23 ARG O    O    2.258  11.014  -5.761 1.00 . A A .  23 ARG O    1 1 
        3  1557 1 1 24 ALA C    C    2.790   7.150  -7.333 1.00 . A A .  24 ALA C    1 1 
        3  1558 1 1 24 ALA CA   C    3.008   8.511  -6.681 1.00 . A A .  24 ALA CA   1 1 
        3  1559 1 1 24 ALA CB   C    4.393   8.583  -6.055 1.00 . A A .  24 ALA CB   1 1 
        3  1560 1 1 24 ALA H    H    1.501   8.033  -5.275 1.00 . A A .  24 ALA H    1 1 
        3  1561 1 1 24 ALA HA   H    2.943   9.277  -7.441 1.00 . A A .  24 ALA HA   1 1 
        3  1562 1 1 24 ALA HB1  H    4.761   9.597  -6.112 1.00 . A A .  24 ALA HB1  1 1 
        3  1563 1 1 24 ALA HB2  H    4.336   8.278  -5.021 1.00 . A A .  24 ALA HB2  1 1 
        3  1564 1 1 24 ALA HB3  H    5.064   7.926  -6.589 1.00 . A A .  24 ALA HB3  1 1 
        3  1565 1 1 24 ALA N    N    1.986   8.783  -5.679 1.00 . A A .  24 ALA N    1 1 
        3  1566 1 1 24 ALA O    O    2.685   6.133  -6.647 1.00 . A A .  24 ALA O    1 1 
        3  1567 1 1 25 ARG C    C    3.282   4.747  -8.764 1.00 . A A .  25 ARG C    1 1 
        3  1568 1 1 25 ARG CA   C    2.516   5.901  -9.404 1.00 . A A .  25 ARG CA   1 1 
        3  1569 1 1 25 ARG CB   C    2.957   6.076 -10.858 1.00 . A A .  25 ARG CB   1 1 
        3  1570 1 1 25 ARG CD   C    3.159   5.076 -13.155 1.00 . A A .  25 ARG CD   1 1 
        3  1571 1 1 25 ARG CG   C    2.718   4.845 -11.718 1.00 . A A .  25 ARG CG   1 1 
        3  1572 1 1 25 ARG CZ   C    3.541   3.711 -15.163 1.00 . A A .  25 ARG CZ   1 1 
        3  1573 1 1 25 ARG H    H    2.814   7.981  -9.151 1.00 . A A .  25 ARG H    1 1 
        3  1574 1 1 25 ARG HA   H    1.461   5.674  -9.381 1.00 . A A .  25 ARG HA   1 1 
        3  1575 1 1 25 ARG HB2  H    2.411   6.901 -11.291 1.00 . A A .  25 ARG HB2  1 1 
        3  1576 1 1 25 ARG HB3  H    4.012   6.302 -10.877 1.00 . A A .  25 ARG HB3  1 1 
        3  1577 1 1 25 ARG HD2  H    2.593   5.900 -13.564 1.00 . A A .  25 ARG HD2  1 1 
        3  1578 1 1 25 ARG HD3  H    4.210   5.326 -13.159 1.00 . A A .  25 ARG HD3  1 1 
        3  1579 1 1 25 ARG HE   H    2.334   3.209 -13.656 1.00 . A A .  25 ARG HE   1 1 
        3  1580 1 1 25 ARG HG2  H    3.279   4.018 -11.310 1.00 . A A .  25 ARG HG2  1 1 
        3  1581 1 1 25 ARG HG3  H    1.665   4.609 -11.708 1.00 . A A .  25 ARG HG3  1 1 
        3  1582 1 1 25 ARG HH11 H    4.563   5.452 -15.113 1.00 . A A .  25 ARG HH11 1 1 
        3  1583 1 1 25 ARG HH12 H    4.823   4.480 -16.523 1.00 . A A .  25 ARG HH12 1 1 
        3  1584 1 1 25 ARG HH21 H    2.668   1.920 -15.508 1.00 . A A .  25 ARG HH21 1 1 
        3  1585 1 1 25 ARG HH22 H    3.744   2.471 -16.747 1.00 . A A .  25 ARG HH22 1 1 
        3  1586 1 1 25 ARG N    N    2.723   7.138  -8.660 1.00 . A A .  25 ARG N    1 1 
        3  1587 1 1 25 ARG NE   N    2.948   3.896 -13.989 1.00 . A A .  25 ARG NE   1 1 
        3  1588 1 1 25 ARG NH1  N    4.377   4.623 -15.639 1.00 . A A .  25 ARG NH1  1 1 
        3  1589 1 1 25 ARG NH2  N    3.298   2.610 -15.864 1.00 . A A .  25 ARG NH2  1 1 
        3  1590 1 1 25 ARG O    O    2.699   3.722  -8.410 1.00 . A A .  25 ARG O    1 1 
        3  1591 1 1 26 SER C    C    4.944   3.520  -6.631 1.00 . A A .  26 SER C    1 1 
        3  1592 1 1 26 SER CA   C    5.438   3.893  -8.025 1.00 . A A .  26 SER CA   1 1 
        3  1593 1 1 26 SER CB   C    6.888   4.376  -7.952 1.00 . A A .  26 SER CB   1 1 
        3  1594 1 1 26 SER H    H    4.998   5.761  -8.920 1.00 . A A .  26 SER H    1 1 
        3  1595 1 1 26 SER HA   H    5.390   3.019  -8.657 1.00 . A A .  26 SER HA   1 1 
        3  1596 1 1 26 SER HB2  H    7.131   4.916  -8.855 1.00 . A A .  26 SER HB2  1 1 
        3  1597 1 1 26 SER HB3  H    7.005   5.029  -7.099 1.00 . A A .  26 SER HB3  1 1 
        3  1598 1 1 26 SER HG   H    8.538   3.417  -8.396 1.00 . A A .  26 SER HG   1 1 
        3  1599 1 1 26 SER N    N    4.591   4.921  -8.618 1.00 . A A .  26 SER N    1 1 
        3  1600 1 1 26 SER O    O    4.913   2.345  -6.265 1.00 . A A .  26 SER O    1 1 
        3  1601 1 1 26 SER OG   O    7.783   3.285  -7.818 1.00 . A A .  26 SER OG   1 1 
        3  1602 1 1 27 SER C    C    3.004   3.217  -4.479 1.00 . A A .  27 SER C    1 1 
        3  1603 1 1 27 SER CA   C    4.068   4.309  -4.501 1.00 . A A .  27 SER CA   1 1 
        3  1604 1 1 27 SER CB   C    3.497   5.606  -3.926 1.00 . A A .  27 SER CB   1 1 
        3  1605 1 1 27 SER H    H    4.606   5.444  -6.206 1.00 . A A .  27 SER H    1 1 
        3  1606 1 1 27 SER HA   H    4.904   3.994  -3.894 1.00 . A A .  27 SER HA   1 1 
        3  1607 1 1 27 SER HB2  H    4.196   6.411  -4.095 1.00 . A A .  27 SER HB2  1 1 
        3  1608 1 1 27 SER HB3  H    2.561   5.833  -4.416 1.00 . A A .  27 SER HB3  1 1 
        3  1609 1 1 27 SER HG   H    2.685   6.196  -2.243 1.00 . A A .  27 SER HG   1 1 
        3  1610 1 1 27 SER N    N    4.558   4.529  -5.857 1.00 . A A .  27 SER N    1 1 
        3  1611 1 1 27 SER O    O    3.080   2.275  -3.688 1.00 . A A .  27 SER O    1 1 
        3  1612 1 1 27 SER OG   O    3.265   5.488  -2.533 1.00 . A A .  27 SER OG   1 1 
        3  1613 1 1 28 LEU C    C    1.481   0.959  -5.575 1.00 . A A .  28 LEU C    1 1 
        3  1614 1 1 28 LEU CA   C    0.929   2.374  -5.434 1.00 . A A .  28 LEU CA   1 1 
        3  1615 1 1 28 LEU CB   C    0.014   2.696  -6.616 1.00 . A A .  28 LEU CB   1 1 
        3  1616 1 1 28 LEU CD1  C   -2.141   1.607  -5.942 1.00 . A A .  28 LEU CD1  1 1 
        3  1617 1 1 28 LEU CD2  C   -1.584   1.877  -8.366 1.00 . A A .  28 LEU CD2  1 1 
        3  1618 1 1 28 LEU CG   C   -1.023   1.630  -6.973 1.00 . A A .  28 LEU CG   1 1 
        3  1619 1 1 28 LEU H    H    2.005   4.120  -5.956 1.00 . A A .  28 LEU H    1 1 
        3  1620 1 1 28 LEU HA   H    0.358   2.435  -4.520 1.00 . A A .  28 LEU HA   1 1 
        3  1621 1 1 28 LEU HB2  H   -0.516   3.608  -6.385 1.00 . A A .  28 LEU HB2  1 1 
        3  1622 1 1 28 LEU HB3  H    0.639   2.855  -7.484 1.00 . A A .  28 LEU HB3  1 1 
        3  1623 1 1 28 LEU HD11 H   -2.062   0.710  -5.346 1.00 . A A .  28 LEU HD11 1 1 
        3  1624 1 1 28 LEU HD12 H   -3.095   1.621  -6.446 1.00 . A A .  28 LEU HD12 1 1 
        3  1625 1 1 28 LEU HD13 H   -2.059   2.473  -5.302 1.00 . A A .  28 LEU HD13 1 1 
        3  1626 1 1 28 LEU HD21 H   -2.456   1.259  -8.517 1.00 . A A .  28 LEU HD21 1 1 
        3  1627 1 1 28 LEU HD22 H   -0.835   1.631  -9.104 1.00 . A A .  28 LEU HD22 1 1 
        3  1628 1 1 28 LEU HD23 H   -1.857   2.918  -8.464 1.00 . A A .  28 LEU HD23 1 1 
        3  1629 1 1 28 LEU HG   H   -0.547   0.659  -6.971 1.00 . A A .  28 LEU HG   1 1 
        3  1630 1 1 28 LEU N    N    2.011   3.349  -5.352 1.00 . A A .  28 LEU N    1 1 
        3  1631 1 1 28 LEU O    O    0.987   0.023  -4.946 1.00 . A A .  28 LEU O    1 1 
        3  1632 1 1 29 ALA C    C    3.759  -1.023  -5.339 1.00 . A A .  29 ALA C    1 1 
        3  1633 1 1 29 ALA CA   C    3.132  -0.490  -6.623 1.00 . A A .  29 ALA CA   1 1 
        3  1634 1 1 29 ALA CB   C    4.179  -0.394  -7.723 1.00 . A A .  29 ALA CB   1 1 
        3  1635 1 1 29 ALA H    H    2.860   1.594  -6.876 1.00 . A A .  29 ALA H    1 1 
        3  1636 1 1 29 ALA HA   H    2.364  -1.176  -6.949 1.00 . A A .  29 ALA HA   1 1 
        3  1637 1 1 29 ALA HB1  H    4.349   0.643  -7.969 1.00 . A A .  29 ALA HB1  1 1 
        3  1638 1 1 29 ALA HB2  H    5.102  -0.840  -7.380 1.00 . A A .  29 ALA HB2  1 1 
        3  1639 1 1 29 ALA HB3  H    3.829  -0.919  -8.599 1.00 . A A .  29 ALA HB3  1 1 
        3  1640 1 1 29 ALA N    N    2.510   0.810  -6.403 1.00 . A A .  29 ALA N    1 1 
        3  1641 1 1 29 ALA O    O    3.496  -2.155  -4.933 1.00 . A A .  29 ALA O    1 1 
        3  1642 1 1 30 ILE C    C    4.298  -1.348  -2.548 1.00 . A A .  30 ILE C    1 1 
        3  1643 1 1 30 ILE CA   C    5.251  -0.591  -3.467 1.00 . A A .  30 ILE CA   1 1 
        3  1644 1 1 30 ILE CB   C    5.806   0.634  -2.716 1.00 . A A .  30 ILE CB   1 1 
        3  1645 1 1 30 ILE CD1  C    7.877   0.647  -4.195 1.00 . A A .  30 ILE CD1  1 1 
        3  1646 1 1 30 ILE CG1  C    6.724   1.447  -3.630 1.00 . A A .  30 ILE CG1  1 1 
        3  1647 1 1 30 ILE CG2  C    6.550   0.194  -1.464 1.00 . A A .  30 ILE CG2  1 1 
        3  1648 1 1 30 ILE H    H    4.757   0.689  -5.078 1.00 . A A .  30 ILE H    1 1 
        3  1649 1 1 30 ILE HA   H    6.078  -1.237  -3.722 1.00 . A A .  30 ILE HA   1 1 
        3  1650 1 1 30 ILE HB   H    4.973   1.250  -2.413 1.00 . A A .  30 ILE HB   1 1 
        3  1651 1 1 30 ILE HD11 H    8.435   1.261  -4.888 1.00 . A A .  30 ILE HD11 1 1 
        3  1652 1 1 30 ILE HD12 H    8.526   0.333  -3.391 1.00 . A A .  30 ILE HD12 1 1 
        3  1653 1 1 30 ILE HD13 H    7.495  -0.220  -4.711 1.00 . A A .  30 ILE HD13 1 1 
        3  1654 1 1 30 ILE HG12 H    6.149   1.830  -4.458 1.00 . A A .  30 ILE HG12 1 1 
        3  1655 1 1 30 ILE HG13 H    7.136   2.274  -3.070 1.00 . A A .  30 ILE HG13 1 1 
        3  1656 1 1 30 ILE HG21 H    7.611   0.338  -1.607 1.00 . A A .  30 ILE HG21 1 1 
        3  1657 1 1 30 ILE HG22 H    6.219   0.784  -0.623 1.00 . A A .  30 ILE HG22 1 1 
        3  1658 1 1 30 ILE HG23 H    6.351  -0.849  -1.273 1.00 . A A .  30 ILE HG23 1 1 
        3  1659 1 1 30 ILE N    N    4.588  -0.201  -4.705 1.00 . A A .  30 ILE N    1 1 
        3  1660 1 1 30 ILE O    O    4.694  -2.299  -1.873 1.00 . A A .  30 ILE O    1 1 
        3  1661 1 1 31 HIS C    C    1.557  -2.870  -2.319 1.00 . A A .  31 HIS C    1 1 
        3  1662 1 1 31 HIS CA   C    2.028  -1.561  -1.694 1.00 . A A .  31 HIS CA   1 1 
        3  1663 1 1 31 HIS CB   C    0.839  -0.623  -1.488 1.00 . A A .  31 HIS CB   1 1 
        3  1664 1 1 31 HIS CD2  C   -1.542  -1.644  -1.349 1.00 . A A .  31 HIS CD2  1 1 
        3  1665 1 1 31 HIS CE1  C   -1.527  -2.204   0.771 1.00 . A A .  31 HIS CE1  1 1 
        3  1666 1 1 31 HIS CG   C   -0.340  -1.283  -0.841 1.00 . A A .  31 HIS CG   1 1 
        3  1667 1 1 31 HIS H    H    2.785  -0.159  -3.088 1.00 . A A .  31 HIS H    1 1 
        3  1668 1 1 31 HIS HA   H    2.476  -1.775  -0.735 1.00 . A A .  31 HIS HA   1 1 
        3  1669 1 1 31 HIS HB2  H    1.143   0.201  -0.860 1.00 . A A .  31 HIS HB2  1 1 
        3  1670 1 1 31 HIS HB3  H    0.520  -0.240  -2.448 1.00 . A A .  31 HIS HB3  1 1 
        3  1671 1 1 31 HIS HD1  H    0.367  -1.517   1.130 1.00 . A A .  31 HIS HD1  1 1 
        3  1672 1 1 31 HIS HD2  H   -1.875  -1.508  -2.369 1.00 . A A .  31 HIS HD2  1 1 
        3  1673 1 1 31 HIS HE1  H   -1.828  -2.586   1.734 1.00 . A A .  31 HIS HE1  1 1 
        3  1674 1 1 31 HIS N    N    3.039  -0.921  -2.528 1.00 . A A .  31 HIS N    1 1 
        3  1675 1 1 31 HIS ND1  N   -0.362  -1.647   0.488 1.00 . A A .  31 HIS ND1  1 1 
        3  1676 1 1 31 HIS NE2  N   -2.261  -2.214  -0.327 1.00 . A A .  31 HIS NE2  1 1 
        3  1677 1 1 31 HIS O    O    1.477  -3.897  -1.645 1.00 . A A .  31 HIS O    1 1 
        3  1678 1 1 32 GLN C    C    1.694  -5.201  -4.056 1.00 . A A .  32 GLN C    1 1 
        3  1679 1 1 32 GLN CA   C    0.781  -4.009  -4.325 1.00 . A A .  32 GLN CA   1 1 
        3  1680 1 1 32 GLN CB   C    0.717  -3.730  -5.828 1.00 . A A .  32 GLN CB   1 1 
        3  1681 1 1 32 GLN CD   C   -0.606  -2.666  -7.699 1.00 . A A .  32 GLN CD   1 1 
        3  1682 1 1 32 GLN CG   C   -0.324  -2.690  -6.210 1.00 . A A .  32 GLN CG   1 1 
        3  1683 1 1 32 GLN H    H    1.331  -1.978  -4.094 1.00 . A A .  32 GLN H    1 1 
        3  1684 1 1 32 GLN HA   H   -0.210  -4.243  -3.969 1.00 . A A .  32 GLN HA   1 1 
        3  1685 1 1 32 GLN HB2  H    1.683  -3.380  -6.159 1.00 . A A .  32 GLN HB2  1 1 
        3  1686 1 1 32 GLN HB3  H    0.480  -4.650  -6.342 1.00 . A A .  32 GLN HB3  1 1 
        3  1687 1 1 32 GLN HE21 H   -1.613  -0.963  -7.505 1.00 . A A .  32 GLN HE21 1 1 
        3  1688 1 1 32 GLN HE22 H   -1.512  -1.597  -9.109 1.00 . A A .  32 GLN HE22 1 1 
        3  1689 1 1 32 GLN HG2  H   -1.244  -2.912  -5.689 1.00 . A A .  32 GLN HG2  1 1 
        3  1690 1 1 32 GLN HG3  H    0.033  -1.716  -5.909 1.00 . A A .  32 GLN HG3  1 1 
        3  1691 1 1 32 GLN N    N    1.246  -2.826  -3.611 1.00 . A A .  32 GLN N    1 1 
        3  1692 1 1 32 GLN NE2  N   -1.316  -1.639  -8.150 1.00 . A A .  32 GLN NE2  1 1 
        3  1693 1 1 32 GLN O    O    1.300  -6.351  -4.244 1.00 . A A .  32 GLN O    1 1 
        3  1694 1 1 32 GLN OE1  O   -0.190  -3.560  -8.436 1.00 . A A .  32 GLN OE1  1 1 
        3  1695 1 1 33 ALA C    C    3.597  -6.610  -1.965 1.00 . A A .  33 ALA C    1 1 
        3  1696 1 1 33 ALA CA   C    3.882  -5.966  -3.317 1.00 . A A .  33 ALA CA   1 1 
        3  1697 1 1 33 ALA CB   C    5.296  -5.405  -3.349 1.00 . A A .  33 ALA CB   1 1 
        3  1698 1 1 33 ALA H    H    3.170  -3.981  -3.484 1.00 . A A .  33 ALA H    1 1 
        3  1699 1 1 33 ALA HA   H    3.804  -6.721  -4.087 1.00 . A A .  33 ALA HA   1 1 
        3  1700 1 1 33 ALA HB1  H    5.989  -6.154  -2.995 1.00 . A A .  33 ALA HB1  1 1 
        3  1701 1 1 33 ALA HB2  H    5.550  -5.128  -4.362 1.00 . A A .  33 ALA HB2  1 1 
        3  1702 1 1 33 ALA HB3  H    5.351  -4.534  -2.713 1.00 . A A .  33 ALA HB3  1 1 
        3  1703 1 1 33 ALA N    N    2.915  -4.918  -3.614 1.00 . A A .  33 ALA N    1 1 
        3  1704 1 1 33 ALA O    O    4.410  -7.375  -1.445 1.00 . A A .  33 ALA O    1 1 
        3  1705 1 1 34 THR C    C    0.878  -7.811  -0.248 1.00 . A A .  34 THR C    1 1 
        3  1706 1 1 34 THR CA   C    2.044  -6.841  -0.105 1.00 . A A .  34 THR CA   1 1 
        3  1707 1 1 34 THR CB   C    1.650  -5.724   0.880 1.00 . A A .  34 THR CB   1 1 
        3  1708 1 1 34 THR CG2  C    2.785  -4.726   1.049 1.00 . A A .  34 THR CG2  1 1 
        3  1709 1 1 34 THR H    H    1.831  -5.679  -1.861 1.00 . A A .  34 THR H    1 1 
        3  1710 1 1 34 THR HA   H    2.892  -7.370   0.305 1.00 . A A .  34 THR HA   1 1 
        3  1711 1 1 34 THR HB   H    1.438  -6.171   1.841 1.00 . A A .  34 THR HB   1 1 
        3  1712 1 1 34 THR HG1  H    0.425  -4.180   0.818 1.00 . A A .  34 THR HG1  1 1 
        3  1713 1 1 34 THR HG21 H    3.696  -5.147   0.652 1.00 . A A .  34 THR HG21 1 1 
        3  1714 1 1 34 THR HG22 H    2.918  -4.505   2.098 1.00 . A A .  34 THR HG22 1 1 
        3  1715 1 1 34 THR HG23 H    2.547  -3.817   0.517 1.00 . A A .  34 THR HG23 1 1 
        3  1716 1 1 34 THR N    N    2.436  -6.295  -1.398 1.00 . A A .  34 THR N    1 1 
        3  1717 1 1 34 THR O    O    0.681  -8.690   0.591 1.00 . A A .  34 THR O    1 1 
        3  1718 1 1 34 THR OG1  O    0.479  -5.048   0.411 1.00 . A A .  34 THR OG1  1 1 
        3  1719 1 1 35 HIS C    C   -0.598  -9.839  -2.179 1.00 . A A .  35 HIS C    1 1 
        3  1720 1 1 35 HIS CA   C   -1.042  -8.511  -1.573 1.00 . A A .  35 HIS CA   1 1 
        3  1721 1 1 35 HIS CB   C   -2.033  -7.816  -2.506 1.00 . A A .  35 HIS CB   1 1 
        3  1722 1 1 35 HIS CD2  C   -2.778  -5.357  -2.155 1.00 . A A .  35 HIS CD2  1 1 
        3  1723 1 1 35 HIS CE1  C   -4.103  -5.666  -0.436 1.00 . A A .  35 HIS CE1  1 1 
        3  1724 1 1 35 HIS CG   C   -2.765  -6.678  -1.863 1.00 . A A .  35 HIS CG   1 1 
        3  1725 1 1 35 HIS H    H    0.313  -6.929  -1.951 1.00 . A A .  35 HIS H    1 1 
        3  1726 1 1 35 HIS HA   H   -1.526  -8.705  -0.628 1.00 . A A .  35 HIS HA   1 1 
        3  1727 1 1 35 HIS HB2  H   -1.499  -7.426  -3.361 1.00 . A A .  35 HIS HB2  1 1 
        3  1728 1 1 35 HIS HB3  H   -2.766  -8.535  -2.843 1.00 . A A .  35 HIS HB3  1 1 
        3  1729 1 1 35 HIS HD1  H   -3.805  -7.687  -0.334 1.00 . A A .  35 HIS HD1  1 1 
        3  1730 1 1 35 HIS HD2  H   -2.230  -4.869  -2.949 1.00 . A A .  35 HIS HD2  1 1 
        3  1731 1 1 35 HIS HE1  H   -4.791  -5.486   0.376 1.00 . A A .  35 HIS HE1  1 1 
        3  1732 1 1 35 HIS N    N    0.106  -7.648  -1.318 1.00 . A A .  35 HIS N    1 1 
        3  1733 1 1 35 HIS ND1  N   -3.604  -6.839  -0.781 1.00 . A A .  35 HIS ND1  1 1 
        3  1734 1 1 35 HIS NE2  N   -3.617  -4.749  -1.254 1.00 . A A .  35 HIS NE2  1 1 
        3  1735 1 1 35 HIS O    O   -1.194 -10.323  -3.142 1.00 . A A .  35 HIS O    1 1 
        3  1736 1 1 36 SER C    C    1.253 -12.647  -0.940 1.00 . A A .  36 SER C    1 1 
        3  1737 1 1 36 SER CA   C    0.977 -11.693  -2.098 1.00 . A A .  36 SER CA   1 1 
        3  1738 1 1 36 SER CB   C    2.259 -11.463  -2.901 1.00 . A A .  36 SER CB   1 1 
        3  1739 1 1 36 SER H    H    0.884  -9.988  -0.846 1.00 . A A .  36 SER H    1 1 
        3  1740 1 1 36 SER HA   H    0.232 -12.134  -2.743 1.00 . A A .  36 SER HA   1 1 
        3  1741 1 1 36 SER HB2  H    2.880 -10.747  -2.386 1.00 . A A .  36 SER HB2  1 1 
        3  1742 1 1 36 SER HB3  H    2.792 -12.398  -2.999 1.00 . A A .  36 SER HB3  1 1 
        3  1743 1 1 36 SER HG   H    2.749 -10.546  -4.562 1.00 . A A .  36 SER HG   1 1 
        3  1744 1 1 36 SER N    N    0.451 -10.423  -1.610 1.00 . A A .  36 SER N    1 1 
        3  1745 1 1 36 SER O    O    2.292 -13.305  -0.897 1.00 . A A .  36 SER O    1 1 
        3  1746 1 1 36 SER OG   O    1.967 -10.967  -4.196 1.00 . A A .  36 SER OG   1 1 
        3  1747 1 1 37 GLY C    C   -0.115 -14.970   0.908 1.00 . A A .  37 GLY C    1 1 
        3  1748 1 1 37 GLY CA   C    0.474 -13.593   1.144 1.00 . A A .  37 GLY CA   1 1 
        3  1749 1 1 37 GLY H    H   -0.494 -12.169  -0.089 1.00 . A A .  37 GLY H    1 1 
        3  1750 1 1 37 GLY HA2  H    1.526 -13.695   1.361 1.00 . A A .  37 GLY HA2  1 1 
        3  1751 1 1 37 GLY HA3  H   -0.018 -13.145   1.996 1.00 . A A .  37 GLY HA3  1 1 
        3  1752 1 1 37 GLY N    N    0.314 -12.717  -0.002 1.00 . A A .  37 GLY N    1 1 
        3  1753 1 1 37 GLY O    O    0.613 -15.925   0.641 1.00 . A A .  37 GLY O    1 1 
        3  1754 1 1 38 GLU C    C   -2.702 -16.431  -0.601 1.00 . A A .  38 GLU C    1 1 
        3  1755 1 1 38 GLU CA   C   -2.121 -16.343   0.807 1.00 . A A .  38 GLU CA   1 1 
        3  1756 1 1 38 GLU CB   C   -3.236 -16.518   1.842 1.00 . A A .  38 GLU CB   1 1 
        3  1757 1 1 38 GLU CD   C   -5.557 -15.837   2.569 1.00 . A A .  38 GLU CD   1 1 
        3  1758 1 1 38 GLU CG   C   -4.355 -15.500   1.708 1.00 . A A .  38 GLU CG   1 1 
        3  1759 1 1 38 GLU H    H   -1.963 -14.274   1.225 1.00 . A A .  38 GLU H    1 1 
        3  1760 1 1 38 GLU HA   H   -1.397 -17.134   0.935 1.00 . A A .  38 GLU HA   1 1 
        3  1761 1 1 38 GLU HB2  H   -3.659 -17.505   1.734 1.00 . A A .  38 GLU HB2  1 1 
        3  1762 1 1 38 GLU HB3  H   -2.810 -16.425   2.830 1.00 . A A .  38 GLU HB3  1 1 
        3  1763 1 1 38 GLU HG2  H   -3.981 -14.531   2.003 1.00 . A A .  38 GLU HG2  1 1 
        3  1764 1 1 38 GLU HG3  H   -4.670 -15.463   0.675 1.00 . A A .  38 GLU HG3  1 1 
        3  1765 1 1 38 GLU N    N   -1.437 -15.072   1.009 1.00 . A A .  38 GLU N    1 1 
        3  1766 1 1 38 GLU O    O   -3.833 -16.878  -0.793 1.00 . A A .  38 GLU O    1 1 
        3  1767 1 1 38 GLU OE1  O   -5.922 -17.029   2.638 1.00 . A A .  38 GLU OE1  1 1 
        3  1768 1 1 38 GLU OE2  O   -6.131 -14.908   3.175 1.00 . A A .  38 GLU OE2  1 1 
        3  1769 1 1 39 LYS C    C   -1.358 -16.799  -3.840 1.00 . A A .  39 LYS C    1 1 
        3  1770 1 1 39 LYS CA   C   -2.353 -16.030  -2.977 1.00 . A A .  39 LYS CA   1 1 
        3  1771 1 1 39 LYS CB   C   -2.514 -14.605  -3.512 1.00 . A A .  39 LYS CB   1 1 
        3  1772 1 1 39 LYS CD   C   -3.951 -13.251  -5.064 1.00 . A A .  39 LYS CD   1 1 
        3  1773 1 1 39 LYS CE   C   -5.317 -13.327  -4.398 1.00 . A A .  39 LYS CE   1 1 
        3  1774 1 1 39 LYS CG   C   -3.170 -14.541  -4.881 1.00 . A A .  39 LYS CG   1 1 
        3  1775 1 1 39 LYS H    H   -1.027 -15.655  -1.369 1.00 . A A .  39 LYS H    1 1 
        3  1776 1 1 39 LYS HA   H   -3.308 -16.530  -3.016 1.00 . A A .  39 LYS HA   1 1 
        3  1777 1 1 39 LYS HB2  H   -3.118 -14.039  -2.819 1.00 . A A .  39 LYS HB2  1 1 
        3  1778 1 1 39 LYS HB3  H   -1.537 -14.147  -3.582 1.00 . A A .  39 LYS HB3  1 1 
        3  1779 1 1 39 LYS HD2  H   -3.395 -12.437  -4.624 1.00 . A A .  39 LYS HD2  1 1 
        3  1780 1 1 39 LYS HD3  H   -4.085 -13.068  -6.121 1.00 . A A .  39 LYS HD3  1 1 
        3  1781 1 1 39 LYS HE2  H   -5.744 -14.299  -4.593 1.00 . A A .  39 LYS HE2  1 1 
        3  1782 1 1 39 LYS HE3  H   -5.192 -13.196  -3.334 1.00 . A A .  39 LYS HE3  1 1 
        3  1783 1 1 39 LYS HG2  H   -2.404 -14.596  -5.640 1.00 . A A .  39 LYS HG2  1 1 
        3  1784 1 1 39 LYS HG3  H   -3.845 -15.378  -4.986 1.00 . A A .  39 LYS HG3  1 1 
        3  1785 1 1 39 LYS HZ1  H   -6.893 -12.689  -5.612 1.00 . A A .  39 LYS HZ1  1 1 
        3  1786 1 1 39 LYS HZ2  H   -5.702 -11.514  -5.361 1.00 . A A .  39 LYS HZ2  1 1 
        3  1787 1 1 39 LYS HZ3  H   -6.800 -11.881  -4.128 1.00 . A A .  39 LYS HZ3  1 1 
        3  1788 1 1 39 LYS N    N   -1.919 -16.000  -1.585 1.00 . A A .  39 LYS N    1 1 
        3  1789 1 1 39 LYS NZ   N   -6.243 -12.280  -4.911 1.00 . A A .  39 LYS NZ   1 1 
        3  1790 1 1 39 LYS O    O   -0.573 -16.220  -4.590 1.00 . A A .  39 LYS O    1 1 
        3  1791 1 1 40 PRO C    C   -0.837 -19.025  -5.987 1.00 . A A .  40 PRO C    1 1 
        3  1792 1 1 40 PRO CA   C   -0.502 -19.014  -4.500 1.00 . A A .  40 PRO CA   1 1 
        3  1793 1 1 40 PRO CB   C   -0.749 -20.394  -3.886 1.00 . A A .  40 PRO CB   1 1 
        3  1794 1 1 40 PRO CD   C   -2.303 -18.894  -2.860 1.00 . A A .  40 PRO CD   1 1 
        3  1795 1 1 40 PRO CG   C   -2.125 -20.315  -3.319 1.00 . A A .  40 PRO CG   1 1 
        3  1796 1 1 40 PRO HA   H    0.535 -18.740  -4.368 1.00 . A A .  40 PRO HA   1 1 
        3  1797 1 1 40 PRO HB2  H   -0.680 -21.150  -4.655 1.00 . A A .  40 PRO HB2  1 1 
        3  1798 1 1 40 PRO HB3  H   -0.016 -20.586  -3.117 1.00 . A A .  40 PRO HB3  1 1 
        3  1799 1 1 40 PRO HD2  H   -3.326 -18.577  -3.001 1.00 . A A .  40 PRO HD2  1 1 
        3  1800 1 1 40 PRO HD3  H   -2.014 -18.793  -1.824 1.00 . A A .  40 PRO HD3  1 1 
        3  1801 1 1 40 PRO HG2  H   -2.850 -20.556  -4.081 1.00 . A A .  40 PRO HG2  1 1 
        3  1802 1 1 40 PRO HG3  H   -2.217 -20.993  -2.484 1.00 . A A .  40 PRO HG3  1 1 
        3  1803 1 1 40 PRO N    N   -1.392 -18.136  -3.734 1.00 . A A .  40 PRO N    1 1 
        3  1804 1 1 40 PRO O    O   -1.615 -19.858  -6.452 1.00 . A A .  40 PRO O    1 1 
        3  1805 1 1 41 SER C    C    0.819 -17.741  -8.916 1.00 . A A .  41 SER C    1 1 
        3  1806 1 1 41 SER CA   C   -0.484 -17.996  -8.165 1.00 . A A .  41 SER CA   1 1 
        3  1807 1 1 41 SER CB   C   -1.484 -16.877  -8.461 1.00 . A A .  41 SER CB   1 1 
        3  1808 1 1 41 SER H    H    0.366 -17.459  -6.301 1.00 . A A .  41 SER H    1 1 
        3  1809 1 1 41 SER HA   H   -0.899 -18.936  -8.498 1.00 . A A .  41 SER HA   1 1 
        3  1810 1 1 41 SER HB2  H   -1.118 -15.951  -8.044 1.00 . A A .  41 SER HB2  1 1 
        3  1811 1 1 41 SER HB3  H   -1.595 -16.771  -9.530 1.00 . A A .  41 SER HB3  1 1 
        3  1812 1 1 41 SER HG   H   -2.722 -17.011  -6.949 1.00 . A A .  41 SER HG   1 1 
        3  1813 1 1 41 SER N    N   -0.245 -18.095  -6.730 1.00 . A A .  41 SER N    1 1 
        3  1814 1 1 41 SER O    O    1.474 -16.718  -8.717 1.00 . A A .  41 SER O    1 1 
        3  1815 1 1 41 SER OG   O   -2.752 -17.163  -7.896 1.00 . A A .  41 SER OG   1 1 
        3  1816 1 1 42 GLY C    C    3.266 -19.791 -10.517 1.00 . A A .  42 GLY C    1 1 
        3  1817 1 1 42 GLY CA   C    2.413 -18.538 -10.551 1.00 . A A .  42 GLY CA   1 1 
        3  1818 1 1 42 GLY H    H    0.628 -19.474  -9.900 1.00 . A A .  42 GLY H    1 1 
        3  1819 1 1 42 GLY HA2  H    2.157 -18.317 -11.576 1.00 . A A .  42 GLY HA2  1 1 
        3  1820 1 1 42 GLY HA3  H    2.985 -17.716 -10.147 1.00 . A A .  42 GLY HA3  1 1 
        3  1821 1 1 42 GLY N    N    1.190 -18.679  -9.782 1.00 . A A .  42 GLY N    1 1 
        3  1822 1 1 42 GLY O    O    4.200 -19.910  -9.724 1.00 . A A .  42 GLY O    1 1 
        3  1823 1 1 43 PRO C    C    5.083 -21.842 -12.043 1.00 . A A .  43 PRO C    1 1 
        3  1824 1 1 43 PRO CA   C    3.676 -22.021 -11.481 1.00 . A A .  43 PRO CA   1 1 
        3  1825 1 1 43 PRO CB   C    2.822 -22.859 -12.435 1.00 . A A .  43 PRO CB   1 1 
        3  1826 1 1 43 PRO CD   C    1.844 -20.679 -12.369 1.00 . A A .  43 PRO CD   1 1 
        3  1827 1 1 43 PRO CG   C    2.091 -21.861 -13.265 1.00 . A A .  43 PRO CG   1 1 
        3  1828 1 1 43 PRO HA   H    3.734 -22.512 -10.520 1.00 . A A .  43 PRO HA   1 1 
        3  1829 1 1 43 PRO HB2  H    3.463 -23.485 -13.040 1.00 . A A .  43 PRO HB2  1 1 
        3  1830 1 1 43 PRO HB3  H    2.141 -23.475 -11.867 1.00 . A A .  43 PRO HB3  1 1 
        3  1831 1 1 43 PRO HD2  H    1.891 -19.760 -12.935 1.00 . A A .  43 PRO HD2  1 1 
        3  1832 1 1 43 PRO HD3  H    0.887 -20.772 -11.877 1.00 . A A .  43 PRO HD3  1 1 
        3  1833 1 1 43 PRO HG2  H    2.698 -21.572 -14.109 1.00 . A A .  43 PRO HG2  1 1 
        3  1834 1 1 43 PRO HG3  H    1.154 -22.279 -13.600 1.00 . A A .  43 PRO HG3  1 1 
        3  1835 1 1 43 PRO N    N    2.945 -20.754 -11.394 1.00 . A A .  43 PRO N    1 1 
        3  1836 1 1 43 PRO O    O    5.451 -20.754 -12.485 1.00 . A A .  43 PRO O    1 1 
        3  1837 1 1 44 SER C    C    7.251 -22.552 -14.019 1.00 . A A .  44 SER C    1 1 
        3  1838 1 1 44 SER CA   C    7.232 -22.877 -12.529 1.00 . A A .  44 SER CA   1 1 
        3  1839 1 1 44 SER CB   C    7.930 -24.215 -12.277 1.00 . A A .  44 SER CB   1 1 
        3  1840 1 1 44 SER H    H    5.513 -23.756 -11.658 1.00 . A A .  44 SER H    1 1 
        3  1841 1 1 44 SER HA   H    7.759 -22.100 -11.996 1.00 . A A .  44 SER HA   1 1 
        3  1842 1 1 44 SER HB2  H    7.324 -25.015 -12.675 1.00 . A A .  44 SER HB2  1 1 
        3  1843 1 1 44 SER HB3  H    8.892 -24.213 -12.769 1.00 . A A .  44 SER HB3  1 1 
        3  1844 1 1 44 SER HG   H    7.551 -25.147 -10.596 1.00 . A A .  44 SER HG   1 1 
        3  1845 1 1 44 SER N    N    5.864 -22.917 -12.023 1.00 . A A .  44 SER N    1 1 
        3  1846 1 1 44 SER O    O    6.271 -22.780 -14.728 1.00 . A A .  44 SER O    1 1 
        3  1847 1 1 44 SER OG   O    8.125 -24.436 -10.891 1.00 . A A .  44 SER OG   1 1 
        3  1848 1 1 45 SER C    C    9.911 -22.026 -16.405 1.00 . A A .  45 SER C    1 1 
        3  1849 1 1 45 SER CA   C    8.522 -21.659 -15.893 1.00 . A A .  45 SER CA   1 1 
        3  1850 1 1 45 SER CB   C    8.274 -20.162 -16.087 1.00 . A A .  45 SER CB   1 1 
        3  1851 1 1 45 SER H    H    9.121 -21.862 -13.873 1.00 . A A .  45 SER H    1 1 
        3  1852 1 1 45 SER HA   H    7.785 -22.213 -16.456 1.00 . A A .  45 SER HA   1 1 
        3  1853 1 1 45 SER HB2  H    8.922 -19.604 -15.427 1.00 . A A .  45 SER HB2  1 1 
        3  1854 1 1 45 SER HB3  H    8.486 -19.894 -17.112 1.00 . A A .  45 SER HB3  1 1 
        3  1855 1 1 45 SER HG   H    6.593 -19.232 -16.472 1.00 . A A .  45 SER HG   1 1 
        3  1856 1 1 45 SER N    N    8.374 -22.019 -14.488 1.00 . A A .  45 SER N    1 1 
        3  1857 1 1 45 SER O    O   10.844 -22.209 -15.625 1.00 . A A .  45 SER O    1 1 
        3  1858 1 1 45 SER OG   O    6.928 -19.826 -15.796 1.00 . A A .  45 SER OG   1 1 
        3  1859 1 1 46 GLY C    C   11.186 -22.900 -19.770 1.00 . A A .  46 GLY C    1 1 
        3  1860 1 1 46 GLY CA   C   11.317 -22.478 -18.320 1.00 . A A .  46 GLY CA   1 1 
        3  1861 1 1 46 GLY H    H    9.261 -21.975 -18.298 1.00 . A A .  46 GLY H    1 1 
        3  1862 1 1 46 GLY HA2  H   11.972 -21.621 -18.263 1.00 . A A .  46 GLY HA2  1 1 
        3  1863 1 1 46 GLY HA3  H   11.755 -23.291 -17.759 1.00 . A A .  46 GLY HA3  1 1 
        3  1864 1 1 46 GLY N    N   10.040 -22.133 -17.725 1.00 . A A .  46 GLY N    1 1 
        3  1865 1 1 46 GLY O    O   10.064 -23.024 -20.258 1.00 . A A .  46 GLY O    1 1 
        3  1866 2 2  1 ZN  ZN   ZN  -4.034  -2.707  -1.250 1.00 . B A . 201 ZN  ZN   1 1 
        4  1867 1 1  1 GLY C    C  -16.529  31.961 -17.772 1.00 . A A .   1 GLY C    1 1 
        4  1868 1 1  1 GLY CA   C  -16.683  31.754 -19.266 1.00 . A A .   1 GLY CA   1 1 
        4  1869 1 1  1 GLY H1   H  -16.152  30.106 -20.485 1.00 . A A .   1 GLY H1   1 1 
        4  1870 1 1  1 GLY HA2  H  -16.433  32.673 -19.774 1.00 . A A .   1 GLY HA2  1 1 
        4  1871 1 1  1 GLY HA3  H  -17.712  31.504 -19.479 1.00 . A A .   1 GLY HA3  1 1 
        4  1872 1 1  1 GLY N    N  -15.830  30.693 -19.769 1.00 . A A .   1 GLY N    1 1 
        4  1873 1 1  1 GLY O    O  -15.774  31.247 -17.113 1.00 . A A .   1 GLY O    1 1 
        4  1874 1 1  2 SER C    C  -18.358  32.621 -15.069 1.00 . A A .   2 SER C    1 1 
        4  1875 1 1  2 SER CA   C  -17.182  33.248 -15.811 1.00 . A A .   2 SER CA   1 1 
        4  1876 1 1  2 SER CB   C  -17.173  34.761 -15.591 1.00 . A A .   2 SER CB   1 1 
        4  1877 1 1  2 SER H    H  -17.830  33.479 -17.813 1.00 . A A .   2 SER H    1 1 
        4  1878 1 1  2 SER HA   H  -16.264  32.831 -15.425 1.00 . A A .   2 SER HA   1 1 
        4  1879 1 1  2 SER HB2  H  -18.033  35.198 -16.076 1.00 . A A .   2 SER HB2  1 1 
        4  1880 1 1  2 SER HB3  H  -17.215  34.968 -14.531 1.00 . A A .   2 SER HB3  1 1 
        4  1881 1 1  2 SER HG   H  -16.156  36.280 -16.295 1.00 . A A .   2 SER HG   1 1 
        4  1882 1 1  2 SER N    N  -17.246  32.944 -17.236 1.00 . A A .   2 SER N    1 1 
        4  1883 1 1  2 SER O    O  -19.358  33.284 -14.794 1.00 . A A .   2 SER O    1 1 
        4  1884 1 1  2 SER OG   O  -15.999  35.348 -16.125 1.00 . A A .   2 SER OG   1 1 
        4  1885 1 1  3 SER C    C  -18.821  29.216 -13.656 1.00 . A A .   3 SER C    1 1 
        4  1886 1 1  3 SER CA   C  -19.284  30.618 -14.040 1.00 . A A .   3 SER CA   1 1 
        4  1887 1 1  3 SER CB   C  -20.542  30.533 -14.906 1.00 . A A .   3 SER CB   1 1 
        4  1888 1 1  3 SER H    H  -17.410  30.862 -14.994 1.00 . A A .   3 SER H    1 1 
        4  1889 1 1  3 SER HA   H  -19.513  31.168 -13.140 1.00 . A A .   3 SER HA   1 1 
        4  1890 1 1  3 SER HB2  H  -20.617  31.419 -15.517 1.00 . A A .   3 SER HB2  1 1 
        4  1891 1 1  3 SER HB3  H  -20.480  29.661 -15.542 1.00 . A A .   3 SER HB3  1 1 
        4  1892 1 1  3 SER HG   H  -22.281  29.748 -14.458 1.00 . A A .   3 SER HG   1 1 
        4  1893 1 1  3 SER N    N  -18.231  31.337 -14.747 1.00 . A A .   3 SER N    1 1 
        4  1894 1 1  3 SER O    O  -18.199  28.515 -14.454 1.00 . A A .   3 SER O    1 1 
        4  1895 1 1  3 SER OG   O  -21.707  30.432 -14.105 1.00 . A A .   3 SER OG   1 1 
        4  1896 1 1  4 GLY C    C  -17.708  27.561 -10.847 1.00 . A A .   4 GLY C    1 1 
        4  1897 1 1  4 GLY CA   C  -18.737  27.497 -11.958 1.00 . A A .   4 GLY CA   1 1 
        4  1898 1 1  4 GLY H    H  -19.626  29.415 -11.834 1.00 . A A .   4 GLY H    1 1 
        4  1899 1 1  4 GLY HA2  H  -19.613  26.981 -11.594 1.00 . A A .   4 GLY HA2  1 1 
        4  1900 1 1  4 GLY HA3  H  -18.322  26.941 -12.786 1.00 . A A .   4 GLY HA3  1 1 
        4  1901 1 1  4 GLY N    N  -19.129  28.813 -12.427 1.00 . A A .   4 GLY N    1 1 
        4  1902 1 1  4 GLY O    O  -16.672  28.210 -10.988 1.00 . A A .   4 GLY O    1 1 
        4  1903 1 1  5 SER C    C  -16.052  25.762  -8.737 1.00 . A A .   5 SER C    1 1 
        4  1904 1 1  5 SER CA   C  -17.088  26.873  -8.596 1.00 . A A .   5 SER CA   1 1 
        4  1905 1 1  5 SER CB   C  -17.874  26.692  -7.296 1.00 . A A .   5 SER CB   1 1 
        4  1906 1 1  5 SER H    H  -18.837  26.388  -9.686 1.00 . A A .   5 SER H    1 1 
        4  1907 1 1  5 SER HA   H  -16.576  27.824  -8.567 1.00 . A A .   5 SER HA   1 1 
        4  1908 1 1  5 SER HB2  H  -18.855  27.126  -7.408 1.00 . A A .   5 SER HB2  1 1 
        4  1909 1 1  5 SER HB3  H  -17.969  25.637  -7.080 1.00 . A A .   5 SER HB3  1 1 
        4  1910 1 1  5 SER HG   H  -17.395  28.266  -6.232 1.00 . A A .   5 SER HG   1 1 
        4  1911 1 1  5 SER N    N  -17.994  26.886  -9.738 1.00 . A A .   5 SER N    1 1 
        4  1912 1 1  5 SER O    O  -16.357  24.586  -8.538 1.00 . A A .   5 SER O    1 1 
        4  1913 1 1  5 SER OG   O  -17.217  27.323  -6.210 1.00 . A A .   5 SER OG   1 1 
        4  1914 1 1  6 SER C    C  -13.776  24.127  -8.149 1.00 . A A .   6 SER C    1 1 
        4  1915 1 1  6 SER CA   C  -13.746  25.180  -9.253 1.00 . A A .   6 SER CA   1 1 
        4  1916 1 1  6 SER CB   C  -12.393  25.894  -9.255 1.00 . A A .   6 SER CB   1 1 
        4  1917 1 1  6 SER H    H  -14.646  27.096  -9.225 1.00 . A A .   6 SER H    1 1 
        4  1918 1 1  6 SER HA   H  -13.886  24.690 -10.205 1.00 . A A .   6 SER HA   1 1 
        4  1919 1 1  6 SER HB2  H  -11.620  25.195  -9.536 1.00 . A A .   6 SER HB2  1 1 
        4  1920 1 1  6 SER HB3  H  -12.419  26.707  -9.966 1.00 . A A .   6 SER HB3  1 1 
        4  1921 1 1  6 SER HG   H  -11.359  25.929  -7.591 1.00 . A A .   6 SER HG   1 1 
        4  1922 1 1  6 SER N    N  -14.826  26.143  -9.081 1.00 . A A .   6 SER N    1 1 
        4  1923 1 1  6 SER O    O  -14.392  24.326  -7.103 1.00 . A A .   6 SER O    1 1 
        4  1924 1 1  6 SER OG   O  -12.091  26.418  -7.973 1.00 . A A .   6 SER OG   1 1 
        4  1925 1 1  7 GLY C    C  -12.531  20.640  -7.985 1.00 . A A .   7 GLY C    1 1 
        4  1926 1 1  7 GLY CA   C  -13.068  21.936  -7.411 1.00 . A A .   7 GLY CA   1 1 
        4  1927 1 1  7 GLY H    H  -12.633  22.901  -9.244 1.00 . A A .   7 GLY H    1 1 
        4  1928 1 1  7 GLY HA2  H  -12.440  22.241  -6.587 1.00 . A A .   7 GLY HA2  1 1 
        4  1929 1 1  7 GLY HA3  H  -14.069  21.765  -7.043 1.00 . A A .   7 GLY HA3  1 1 
        4  1930 1 1  7 GLY N    N  -13.105  23.005  -8.392 1.00 . A A .   7 GLY N    1 1 
        4  1931 1 1  7 GLY O    O  -13.108  20.077  -8.916 1.00 . A A .   7 GLY O    1 1 
        4  1932 1 1  8 THR C    C  -10.359  18.061  -6.722 1.00 . A A .   8 THR C    1 1 
        4  1933 1 1  8 THR CA   C  -10.803  18.929  -7.895 1.00 . A A .   8 THR CA   1 1 
        4  1934 1 1  8 THR CB   C   -9.587  19.212  -8.798 1.00 . A A .   8 THR CB   1 1 
        4  1935 1 1  8 THR CG2  C  -10.026  19.825 -10.119 1.00 . A A .   8 THR CG2  1 1 
        4  1936 1 1  8 THR H    H  -11.006  20.658  -6.692 1.00 . A A .   8 THR H    1 1 
        4  1937 1 1  8 THR HA   H  -11.536  18.386  -8.474 1.00 . A A .   8 THR HA   1 1 
        4  1938 1 1  8 THR HB   H   -9.083  18.278  -9.001 1.00 . A A .   8 THR HB   1 1 
        4  1939 1 1  8 THR HG1  H   -9.130  20.920  -7.923 1.00 . A A .   8 THR HG1  1 1 
        4  1940 1 1  8 THR HG21 H  -10.854  19.259 -10.520 1.00 . A A .   8 THR HG21 1 1 
        4  1941 1 1  8 THR HG22 H   -9.203  19.802 -10.818 1.00 . A A .   8 THR HG22 1 1 
        4  1942 1 1  8 THR HG23 H  -10.334  20.847  -9.957 1.00 . A A .   8 THR HG23 1 1 
        4  1943 1 1  8 THR N    N  -11.420  20.164  -7.430 1.00 . A A .   8 THR N    1 1 
        4  1944 1 1  8 THR O    O  -10.393  18.493  -5.571 1.00 . A A .   8 THR O    1 1 
        4  1945 1 1  8 THR OG1  O   -8.680  20.098  -8.133 1.00 . A A .   8 THR OG1  1 1 
        4  1946 1 1  9 GLY C    C   -8.002  15.678  -6.031 1.00 . A A .   9 GLY C    1 1 
        4  1947 1 1  9 GLY CA   C   -9.496  15.927  -5.983 1.00 . A A .   9 GLY CA   1 1 
        4  1948 1 1  9 GLY H    H   -9.936  16.545  -7.960 1.00 . A A .   9 GLY H    1 1 
        4  1949 1 1  9 GLY HA2  H   -9.749  16.347  -5.021 1.00 . A A .   9 GLY HA2  1 1 
        4  1950 1 1  9 GLY HA3  H  -10.010  14.984  -6.100 1.00 . A A .   9 GLY HA3  1 1 
        4  1951 1 1  9 GLY N    N   -9.941  16.835  -7.023 1.00 . A A .   9 GLY N    1 1 
        4  1952 1 1  9 GLY O    O   -7.299  16.245  -6.867 1.00 . A A .   9 GLY O    1 1 
        4  1953 1 1 10 GLU C    C   -5.879  13.002  -4.954 1.00 . A A .  10 GLU C    1 1 
        4  1954 1 1 10 GLU CA   C   -6.093  14.509  -5.075 1.00 . A A .  10 GLU CA   1 1 
        4  1955 1 1 10 GLU CB   C   -5.434  15.225  -3.895 1.00 . A A .  10 GLU CB   1 1 
        4  1956 1 1 10 GLU CD   C   -7.422  15.519  -2.365 1.00 . A A .  10 GLU CD   1 1 
        4  1957 1 1 10 GLU CG   C   -6.057  14.885  -2.551 1.00 . A A .  10 GLU CG   1 1 
        4  1958 1 1 10 GLU H    H   -8.126  14.408  -4.492 1.00 . A A .  10 GLU H    1 1 
        4  1959 1 1 10 GLU HA   H   -5.639  14.852  -5.992 1.00 . A A .  10 GLU HA   1 1 
        4  1960 1 1 10 GLU HB2  H   -4.389  14.954  -3.863 1.00 . A A .  10 GLU HB2  1 1 
        4  1961 1 1 10 GLU HB3  H   -5.515  16.291  -4.046 1.00 . A A .  10 GLU HB3  1 1 
        4  1962 1 1 10 GLU HG2  H   -6.161  13.813  -2.478 1.00 . A A .  10 GLU HG2  1 1 
        4  1963 1 1 10 GLU HG3  H   -5.403  15.237  -1.766 1.00 . A A .  10 GLU HG3  1 1 
        4  1964 1 1 10 GLU N    N   -7.515  14.828  -5.132 1.00 . A A .  10 GLU N    1 1 
        4  1965 1 1 10 GLU O    O   -5.122  12.538  -4.102 1.00 . A A .  10 GLU O    1 1 
        4  1966 1 1 10 GLU OE1  O   -7.708  16.524  -3.049 1.00 . A A .  10 GLU OE1  1 1 
        4  1967 1 1 10 GLU OE2  O   -8.204  15.010  -1.535 1.00 . A A .  10 GLU OE2  1 1 
        4  1968 1 1 11 LYS C    C   -6.013  10.271  -7.175 1.00 . A A .  11 LYS C    1 1 
        4  1969 1 1 11 LYS CA   C   -6.437  10.791  -5.805 1.00 . A A .  11 LYS CA   1 1 
        4  1970 1 1 11 LYS CB   C   -7.768  10.155  -5.396 1.00 . A A .  11 LYS CB   1 1 
        4  1971 1 1 11 LYS CD   C   -9.540  10.168  -3.616 1.00 . A A .  11 LYS CD   1 1 
        4  1972 1 1 11 LYS CE   C  -10.020   8.727  -3.527 1.00 . A A .  11 LYS CE   1 1 
        4  1973 1 1 11 LYS CG   C   -8.050  10.240  -3.906 1.00 . A A .  11 LYS CG   1 1 
        4  1974 1 1 11 LYS H    H   -7.141  12.673  -6.470 1.00 . A A .  11 LYS H    1 1 
        4  1975 1 1 11 LYS HA   H   -5.682  10.522  -5.082 1.00 . A A .  11 LYS HA   1 1 
        4  1976 1 1 11 LYS HB2  H   -8.568  10.654  -5.922 1.00 . A A .  11 LYS HB2  1 1 
        4  1977 1 1 11 LYS HB3  H   -7.757   9.113  -5.680 1.00 . A A .  11 LYS HB3  1 1 
        4  1978 1 1 11 LYS HD2  H   -9.739  10.660  -2.675 1.00 . A A .  11 LYS HD2  1 1 
        4  1979 1 1 11 LYS HD3  H  -10.077  10.670  -4.408 1.00 . A A .  11 LYS HD3  1 1 
        4  1980 1 1 11 LYS HE2  H   -9.212   8.114  -3.159 1.00 . A A .  11 LYS HE2  1 1 
        4  1981 1 1 11 LYS HE3  H  -10.851   8.680  -2.838 1.00 . A A .  11 LYS HE3  1 1 
        4  1982 1 1 11 LYS HG2  H   -7.556   9.419  -3.408 1.00 . A A .  11 LYS HG2  1 1 
        4  1983 1 1 11 LYS HG3  H   -7.664  11.177  -3.529 1.00 . A A .  11 LYS HG3  1 1 
        4  1984 1 1 11 LYS HZ1  H   -9.736   7.572  -5.244 1.00 . A A .  11 LYS HZ1  1 1 
        4  1985 1 1 11 LYS HZ2  H  -10.609   8.995  -5.513 1.00 . A A .  11 LYS HZ2  1 1 
        4  1986 1 1 11 LYS HZ3  H  -11.350   7.680  -4.751 1.00 . A A .  11 LYS HZ3  1 1 
        4  1987 1 1 11 LYS N    N   -6.552  12.244  -5.813 1.00 . A A .  11 LYS N    1 1 
        4  1988 1 1 11 LYS NZ   N  -10.459   8.207  -4.852 1.00 . A A .  11 LYS NZ   1 1 
        4  1989 1 1 11 LYS O    O   -6.831   9.807  -7.970 1.00 . A A .  11 LYS O    1 1 
        4  1990 1 1 12 PRO C    C   -4.183   8.370  -8.869 1.00 . A A .  12 PRO C    1 1 
        4  1991 1 1 12 PRO CA   C   -4.142   9.888  -8.733 1.00 . A A .  12 PRO CA   1 1 
        4  1992 1 1 12 PRO CB   C   -2.695  10.382  -8.680 1.00 . A A .  12 PRO CB   1 1 
        4  1993 1 1 12 PRO CD   C   -3.673  10.890  -6.559 1.00 . A A .  12 PRO CD   1 1 
        4  1994 1 1 12 PRO CG   C   -2.385  10.495  -7.228 1.00 . A A .  12 PRO CG   1 1 
        4  1995 1 1 12 PRO HA   H   -4.648  10.338  -9.575 1.00 . A A .  12 PRO HA   1 1 
        4  1996 1 1 12 PRO HB2  H   -2.049   9.666  -9.168 1.00 . A A .  12 PRO HB2  1 1 
        4  1997 1 1 12 PRO HB3  H   -2.619  11.339  -9.175 1.00 . A A .  12 PRO HB3  1 1 
        4  1998 1 1 12 PRO HD2  H   -3.742  10.442  -5.579 1.00 . A A .  12 PRO HD2  1 1 
        4  1999 1 1 12 PRO HD3  H   -3.748  11.965  -6.490 1.00 . A A .  12 PRO HD3  1 1 
        4  2000 1 1 12 PRO HG2  H   -2.043   9.543  -6.850 1.00 . A A .  12 PRO HG2  1 1 
        4  2001 1 1 12 PRO HG3  H   -1.633  11.254  -7.071 1.00 . A A .  12 PRO HG3  1 1 
        4  2002 1 1 12 PRO N    N   -4.704  10.348  -7.459 1.00 . A A .  12 PRO N    1 1 
        4  2003 1 1 12 PRO O    O   -4.552   7.841  -9.918 1.00 . A A .  12 PRO O    1 1 
        4  2004 1 1 13 TYR C    C   -4.387   5.666  -6.513 1.00 . A A .  13 TYR C    1 1 
        4  2005 1 1 13 TYR CA   C   -3.792   6.217  -7.806 1.00 . A A .  13 TYR CA   1 1 
        4  2006 1 1 13 TYR CB   C   -2.366   5.695  -7.987 1.00 . A A .  13 TYR CB   1 1 
        4  2007 1 1 13 TYR CD1  C   -2.156   5.353 -10.480 1.00 . A A .  13 TYR CD1  1 1 
        4  2008 1 1 13 TYR CD2  C   -0.805   7.028  -9.457 1.00 . A A .  13 TYR CD2  1 1 
        4  2009 1 1 13 TYR CE1  C   -1.609   5.656 -11.712 1.00 . A A .  13 TYR CE1  1 1 
        4  2010 1 1 13 TYR CE2  C   -0.253   7.339 -10.685 1.00 . A A .  13 TYR CE2  1 1 
        4  2011 1 1 13 TYR CG   C   -1.764   6.031  -9.333 1.00 . A A .  13 TYR CG   1 1 
        4  2012 1 1 13 TYR CZ   C   -0.658   6.650 -11.809 1.00 . A A .  13 TYR CZ   1 1 
        4  2013 1 1 13 TYR H    H   -3.518   8.153  -6.997 1.00 . A A .  13 TYR H    1 1 
        4  2014 1 1 13 TYR HA   H   -4.395   5.882  -8.637 1.00 . A A .  13 TYR HA   1 1 
        4  2015 1 1 13 TYR HB2  H   -1.733   6.125  -7.225 1.00 . A A .  13 TYR HB2  1 1 
        4  2016 1 1 13 TYR HB3  H   -2.367   4.620  -7.883 1.00 . A A .  13 TYR HB3  1 1 
        4  2017 1 1 13 TYR HD1  H   -2.902   4.575 -10.400 1.00 . A A .  13 TYR HD1  1 1 
        4  2018 1 1 13 TYR HD2  H   -0.489   7.566  -8.575 1.00 . A A .  13 TYR HD2  1 1 
        4  2019 1 1 13 TYR HE1  H   -1.926   5.117 -12.592 1.00 . A A .  13 TYR HE1  1 1 
        4  2020 1 1 13 TYR HE2  H    0.493   8.117 -10.762 1.00 . A A .  13 TYR HE2  1 1 
        4  2021 1 1 13 TYR HH   H    0.609   7.581 -12.916 1.00 . A A .  13 TYR HH   1 1 
        4  2022 1 1 13 TYR N    N   -3.801   7.675  -7.804 1.00 . A A .  13 TYR N    1 1 
        4  2023 1 1 13 TYR O    O   -4.646   6.411  -5.568 1.00 . A A .  13 TYR O    1 1 
        4  2024 1 1 13 TYR OH   O   -0.111   6.956 -13.034 1.00 . A A .  13 TYR OH   1 1 
        4  2025 1 1 14 LYS C    C   -5.132   2.184  -5.459 1.00 . A A .  14 LYS C    1 1 
        4  2026 1 1 14 LYS CA   C   -5.162   3.701  -5.304 1.00 . A A .  14 LYS CA   1 1 
        4  2027 1 1 14 LYS CB   C   -6.599   4.173  -5.071 1.00 . A A .  14 LYS CB   1 1 
        4  2028 1 1 14 LYS CD   C   -8.835   4.394  -6.193 1.00 . A A .  14 LYS CD   1 1 
        4  2029 1 1 14 LYS CE   C   -8.572   5.494  -7.211 1.00 . A A .  14 LYS CE   1 1 
        4  2030 1 1 14 LYS CG   C   -7.612   3.516  -5.993 1.00 . A A .  14 LYS CG   1 1 
        4  2031 1 1 14 LYS H    H   -4.373   3.814  -7.265 1.00 . A A .  14 LYS H    1 1 
        4  2032 1 1 14 LYS HA   H   -4.559   3.976  -4.451 1.00 . A A .  14 LYS HA   1 1 
        4  2033 1 1 14 LYS HB2  H   -6.877   3.952  -4.050 1.00 . A A .  14 LYS HB2  1 1 
        4  2034 1 1 14 LYS HB3  H   -6.644   5.241  -5.224 1.00 . A A .  14 LYS HB3  1 1 
        4  2035 1 1 14 LYS HD2  H   -9.653   3.783  -6.545 1.00 . A A .  14 LYS HD2  1 1 
        4  2036 1 1 14 LYS HD3  H   -9.102   4.846  -5.248 1.00 . A A .  14 LYS HD3  1 1 
        4  2037 1 1 14 LYS HE2  H   -7.791   6.136  -6.833 1.00 . A A .  14 LYS HE2  1 1 
        4  2038 1 1 14 LYS HE3  H   -8.248   5.040  -8.136 1.00 . A A .  14 LYS HE3  1 1 
        4  2039 1 1 14 LYS HG2  H   -7.149   3.338  -6.952 1.00 . A A .  14 LYS HG2  1 1 
        4  2040 1 1 14 LYS HG3  H   -7.922   2.575  -5.560 1.00 . A A .  14 LYS HG3  1 1 
        4  2041 1 1 14 LYS HZ1  H   -9.539   7.320  -7.518 1.00 . A A .  14 LYS HZ1  1 1 
        4  2042 1 1 14 LYS HZ2  H  -10.483   6.172  -6.709 1.00 . A A .  14 LYS HZ2  1 1 
        4  2043 1 1 14 LYS HZ3  H  -10.221   6.030  -8.374 1.00 . A A .  14 LYS HZ3  1 1 
        4  2044 1 1 14 LYS N    N   -4.600   4.355  -6.479 1.00 . A A .  14 LYS N    1 1 
        4  2045 1 1 14 LYS NZ   N   -9.789   6.311  -7.472 1.00 . A A .  14 LYS NZ   1 1 
        4  2046 1 1 14 LYS O    O   -5.048   1.665  -6.572 1.00 . A A .  14 LYS O    1 1 
        4  2047 1 1 15 CYS C    C   -6.595  -0.540  -4.516 1.00 . A A .  15 CYS C    1 1 
        4  2048 1 1 15 CYS CA   C   -5.186   0.020  -4.346 1.00 . A A .  15 CYS CA   1 1 
        4  2049 1 1 15 CYS CB   C   -4.567  -0.513  -3.052 1.00 . A A .  15 CYS CB   1 1 
        4  2050 1 1 15 CYS H    H   -5.269   1.948  -3.477 1.00 . A A .  15 CYS H    1 1 
        4  2051 1 1 15 CYS HA   H   -4.581  -0.299  -5.181 1.00 . A A .  15 CYS HA   1 1 
        4  2052 1 1 15 CYS HB2  H   -3.592  -0.067  -2.918 1.00 . A A .  15 CYS HB2  1 1 
        4  2053 1 1 15 CYS HB3  H   -5.199  -0.239  -2.220 1.00 . A A .  15 CYS HB3  1 1 
        4  2054 1 1 15 CYS N    N   -5.203   1.478  -4.335 1.00 . A A .  15 CYS N    1 1 
        4  2055 1 1 15 CYS O    O   -7.450  -0.370  -3.649 1.00 . A A .  15 CYS O    1 1 
        4  2056 1 1 15 CYS SG   S   -4.356  -2.322  -3.018 1.00 . A A .  15 CYS SG   1 1 
        4  2057 1 1 16 ASN C    C   -8.270  -3.164  -5.270 1.00 . A A .  16 ASN C    1 1 
        4  2058 1 1 16 ASN CA   C   -8.133  -1.794  -5.927 1.00 . A A .  16 ASN CA   1 1 
        4  2059 1 1 16 ASN CB   C   -8.340  -1.917  -7.437 1.00 . A A .  16 ASN CB   1 1 
        4  2060 1 1 16 ASN CG   C   -7.697  -3.165  -8.010 1.00 . A A .  16 ASN CG   1 1 
        4  2061 1 1 16 ASN H    H   -6.105  -1.311  -6.295 1.00 . A A .  16 ASN H    1 1 
        4  2062 1 1 16 ASN HA   H   -8.886  -1.136  -5.521 1.00 . A A .  16 ASN HA   1 1 
        4  2063 1 1 16 ASN HB2  H   -9.400  -1.953  -7.647 1.00 . A A .  16 ASN HB2  1 1 
        4  2064 1 1 16 ASN HB3  H   -7.910  -1.055  -7.926 1.00 . A A .  16 ASN HB3  1 1 
        4  2065 1 1 16 ASN HD21 H   -5.914  -2.285  -7.990 1.00 . A A .  16 ASN HD21 1 1 
        4  2066 1 1 16 ASN HD22 H   -5.944  -3.906  -8.586 1.00 . A A .  16 ASN HD22 1 1 
        4  2067 1 1 16 ASN N    N   -6.827  -1.209  -5.641 1.00 . A A .  16 ASN N    1 1 
        4  2068 1 1 16 ASN ND2  N   -6.386  -3.113  -8.216 1.00 . A A .  16 ASN ND2  1 1 
        4  2069 1 1 16 ASN O    O   -8.888  -4.071  -5.827 1.00 . A A .  16 ASN O    1 1 
        4  2070 1 1 16 ASN OD1  O   -8.371  -4.163  -8.264 1.00 . A A .  16 ASN OD1  1 1 
        4  2071 1 1 17 GLU C    C   -8.206  -4.340  -1.913 1.00 . A A .  17 GLU C    1 1 
        4  2072 1 1 17 GLU CA   C   -7.747  -4.566  -3.351 1.00 . A A .  17 GLU CA   1 1 
        4  2073 1 1 17 GLU CB   C   -6.377  -5.249  -3.359 1.00 . A A .  17 GLU CB   1 1 
        4  2074 1 1 17 GLU CD   C   -6.360  -6.836  -5.324 1.00 . A A .  17 GLU CD   1 1 
        4  2075 1 1 17 GLU CG   C   -5.845  -5.529  -4.754 1.00 . A A .  17 GLU CG   1 1 
        4  2076 1 1 17 GLU H    H   -7.210  -2.546  -3.690 1.00 . A A .  17 GLU H    1 1 
        4  2077 1 1 17 GLU HA   H   -8.460  -5.206  -3.847 1.00 . A A .  17 GLU HA   1 1 
        4  2078 1 1 17 GLU HB2  H   -5.669  -4.616  -2.845 1.00 . A A .  17 GLU HB2  1 1 
        4  2079 1 1 17 GLU HB3  H   -6.455  -6.188  -2.831 1.00 . A A .  17 GLU HB3  1 1 
        4  2080 1 1 17 GLU HG2  H   -6.147  -4.725  -5.408 1.00 . A A .  17 GLU HG2  1 1 
        4  2081 1 1 17 GLU HG3  H   -4.766  -5.571  -4.712 1.00 . A A .  17 GLU HG3  1 1 
        4  2082 1 1 17 GLU N    N   -7.689  -3.306  -4.083 1.00 . A A .  17 GLU N    1 1 
        4  2083 1 1 17 GLU O    O   -8.988  -5.120  -1.369 1.00 . A A .  17 GLU O    1 1 
        4  2084 1 1 17 GLU OE1  O   -7.582  -6.938  -5.561 1.00 . A A .  17 GLU OE1  1 1 
        4  2085 1 1 17 GLU OE2  O   -5.542  -7.756  -5.533 1.00 . A A .  17 GLU OE2  1 1 
        4  2086 1 1 18 CYS C    C   -8.777  -1.584   0.140 1.00 . A A .  18 CYS C    1 1 
        4  2087 1 1 18 CYS CA   C   -8.072  -2.936   0.071 1.00 . A A .  18 CYS CA   1 1 
        4  2088 1 1 18 CYS CB   C   -6.823  -2.918   0.955 1.00 . A A .  18 CYS CB   1 1 
        4  2089 1 1 18 CYS H    H   -7.094  -2.682  -1.789 1.00 . A A .  18 CYS H    1 1 
        4  2090 1 1 18 CYS HA   H   -8.745  -3.698   0.431 1.00 . A A .  18 CYS HA   1 1 
        4  2091 1 1 18 CYS HB2  H   -7.112  -2.682   1.968 1.00 . A A .  18 CYS HB2  1 1 
        4  2092 1 1 18 CYS HB3  H   -6.363  -3.895   0.935 1.00 . A A .  18 CYS HB3  1 1 
        4  2093 1 1 18 CYS N    N   -7.714  -3.266  -1.303 1.00 . A A .  18 CYS N    1 1 
        4  2094 1 1 18 CYS O    O   -9.811  -1.444   0.791 1.00 . A A .  18 CYS O    1 1 
        4  2095 1 1 18 CYS SG   S   -5.567  -1.702   0.441 1.00 . A A .  18 CYS SG   1 1 
        4  2096 1 1 19 GLY C    C   -7.826   1.800  -0.067 1.00 . A A .  19 GLY C    1 1 
        4  2097 1 1 19 GLY CA   C   -8.796   0.735  -0.542 1.00 . A A .  19 GLY CA   1 1 
        4  2098 1 1 19 GLY H    H   -7.384  -0.762  -1.040 1.00 . A A .  19 GLY H    1 1 
        4  2099 1 1 19 GLY HA2  H   -9.114   0.974  -1.546 1.00 . A A .  19 GLY HA2  1 1 
        4  2100 1 1 19 GLY HA3  H   -9.659   0.736   0.108 1.00 . A A .  19 GLY HA3  1 1 
        4  2101 1 1 19 GLY N    N   -8.209  -0.592  -0.538 1.00 . A A .  19 GLY N    1 1 
        4  2102 1 1 19 GLY O    O   -8.196   2.692   0.697 1.00 . A A .  19 GLY O    1 1 
        4  2103 1 1 20 LYS C    C   -5.211   3.591  -1.302 1.00 . A A .  20 LYS C    1 1 
        4  2104 1 1 20 LYS CA   C   -5.553   2.668  -0.137 1.00 . A A .  20 LYS CA   1 1 
        4  2105 1 1 20 LYS CB   C   -4.294   1.939   0.337 1.00 . A A .  20 LYS CB   1 1 
        4  2106 1 1 20 LYS CD   C   -3.652   3.385   2.287 1.00 . A A .  20 LYS CD   1 1 
        4  2107 1 1 20 LYS CE   C   -3.418   2.348   3.375 1.00 . A A .  20 LYS CE   1 1 
        4  2108 1 1 20 LYS CG   C   -3.239   2.862   0.921 1.00 . A A .  20 LYS CG   1 1 
        4  2109 1 1 20 LYS H    H   -6.346   0.973  -1.126 1.00 . A A .  20 LYS H    1 1 
        4  2110 1 1 20 LYS HA   H   -5.941   3.262   0.676 1.00 . A A .  20 LYS HA   1 1 
        4  2111 1 1 20 LYS HB2  H   -4.572   1.219   1.093 1.00 . A A .  20 LYS HB2  1 1 
        4  2112 1 1 20 LYS HB3  H   -3.858   1.416  -0.503 1.00 . A A .  20 LYS HB3  1 1 
        4  2113 1 1 20 LYS HD2  H   -3.072   4.267   2.516 1.00 . A A .  20 LYS HD2  1 1 
        4  2114 1 1 20 LYS HD3  H   -4.702   3.639   2.263 1.00 . A A .  20 LYS HD3  1 1 
        4  2115 1 1 20 LYS HE2  H   -3.899   1.427   3.085 1.00 . A A .  20 LYS HE2  1 1 
        4  2116 1 1 20 LYS HE3  H   -2.355   2.184   3.474 1.00 . A A .  20 LYS HE3  1 1 
        4  2117 1 1 20 LYS HG2  H   -2.312   2.318   1.021 1.00 . A A .  20 LYS HG2  1 1 
        4  2118 1 1 20 LYS HG3  H   -3.097   3.700   0.253 1.00 . A A .  20 LYS HG3  1 1 
        4  2119 1 1 20 LYS HZ1  H   -3.592   3.728   4.934 1.00 . A A .  20 LYS HZ1  1 1 
        4  2120 1 1 20 LYS HZ2  H   -3.696   2.114   5.432 1.00 . A A .  20 LYS HZ2  1 1 
        4  2121 1 1 20 LYS HZ3  H   -5.003   2.841   4.643 1.00 . A A .  20 LYS HZ3  1 1 
        4  2122 1 1 20 LYS N    N   -6.580   1.706  -0.519 1.00 . A A .  20 LYS N    1 1 
        4  2123 1 1 20 LYS NZ   N   -3.965   2.789   4.688 1.00 . A A .  20 LYS NZ   1 1 
        4  2124 1 1 20 LYS O    O   -4.634   3.160  -2.299 1.00 . A A .  20 LYS O    1 1 
        4  2125 1 1 21 ALA C    C   -3.941   6.510  -1.995 1.00 . A A .  21 ALA C    1 1 
        4  2126 1 1 21 ALA CA   C   -5.298   5.848  -2.207 1.00 . A A .  21 ALA CA   1 1 
        4  2127 1 1 21 ALA CB   C   -6.399   6.898  -2.242 1.00 . A A .  21 ALA CB   1 1 
        4  2128 1 1 21 ALA H    H   -6.028   5.147  -0.349 1.00 . A A .  21 ALA H    1 1 
        4  2129 1 1 21 ALA HA   H   -5.293   5.336  -3.159 1.00 . A A .  21 ALA HA   1 1 
        4  2130 1 1 21 ALA HB1  H   -7.360   6.409  -2.310 1.00 . A A .  21 ALA HB1  1 1 
        4  2131 1 1 21 ALA HB2  H   -6.359   7.489  -1.339 1.00 . A A .  21 ALA HB2  1 1 
        4  2132 1 1 21 ALA HB3  H   -6.259   7.538  -3.099 1.00 . A A .  21 ALA HB3  1 1 
        4  2133 1 1 21 ALA N    N   -5.570   4.864  -1.167 1.00 . A A .  21 ALA N    1 1 
        4  2134 1 1 21 ALA O    O   -3.656   7.034  -0.919 1.00 . A A .  21 ALA O    1 1 
        4  2135 1 1 22 PHE C    C   -1.716   8.372  -3.758 1.00 . A A .  22 PHE C    1 1 
        4  2136 1 1 22 PHE CA   C   -1.777   7.076  -2.955 1.00 . A A .  22 PHE CA   1 1 
        4  2137 1 1 22 PHE CB   C   -0.724   6.093  -3.472 1.00 . A A .  22 PHE CB   1 1 
        4  2138 1 1 22 PHE CD1  C   -1.715   3.802  -3.213 1.00 . A A .  22 PHE CD1  1 1 
        4  2139 1 1 22 PHE CD2  C    0.088   4.425  -1.782 1.00 . A A .  22 PHE CD2  1 1 
        4  2140 1 1 22 PHE CE1  C   -1.773   2.563  -2.604 1.00 . A A .  22 PHE CE1  1 1 
        4  2141 1 1 22 PHE CE2  C    0.035   3.187  -1.169 1.00 . A A .  22 PHE CE2  1 1 
        4  2142 1 1 22 PHE CG   C   -0.785   4.747  -2.809 1.00 . A A .  22 PHE CG   1 1 
        4  2143 1 1 22 PHE CZ   C   -0.897   2.254  -1.582 1.00 . A A .  22 PHE CZ   1 1 
        4  2144 1 1 22 PHE H    H   -3.390   6.047  -3.861 1.00 . A A .  22 PHE H    1 1 
        4  2145 1 1 22 PHE HA   H   -1.571   7.298  -1.919 1.00 . A A .  22 PHE HA   1 1 
        4  2146 1 1 22 PHE HB2  H   -0.868   5.947  -4.532 1.00 . A A .  22 PHE HB2  1 1 
        4  2147 1 1 22 PHE HB3  H    0.258   6.505  -3.299 1.00 . A A .  22 PHE HB3  1 1 
        4  2148 1 1 22 PHE HD1  H   -2.400   4.041  -4.013 1.00 . A A .  22 PHE HD1  1 1 
        4  2149 1 1 22 PHE HD2  H    0.817   5.155  -1.458 1.00 . A A .  22 PHE HD2  1 1 
        4  2150 1 1 22 PHE HE1  H   -2.502   1.835  -2.928 1.00 . A A .  22 PHE HE1  1 1 
        4  2151 1 1 22 PHE HE2  H    0.721   2.950  -0.370 1.00 . A A .  22 PHE HE2  1 1 
        4  2152 1 1 22 PHE HZ   H   -0.940   1.287  -1.104 1.00 . A A .  22 PHE HZ   1 1 
        4  2153 1 1 22 PHE N    N   -3.106   6.481  -3.029 1.00 . A A .  22 PHE N    1 1 
        4  2154 1 1 22 PHE O    O   -2.685   8.754  -4.414 1.00 . A A .  22 PHE O    1 1 
        4  2155 1 1 23 ARG C    C    0.537  10.103  -5.620 1.00 . A A .  23 ARG C    1 1 
        4  2156 1 1 23 ARG CA   C   -0.384  10.299  -4.419 1.00 . A A .  23 ARG CA   1 1 
        4  2157 1 1 23 ARG CB   C    0.195  11.364  -3.487 1.00 . A A .  23 ARG CB   1 1 
        4  2158 1 1 23 ARG CD   C    0.876  13.761  -3.158 1.00 . A A .  23 ARG CD   1 1 
        4  2159 1 1 23 ARG CG   C    0.250  12.751  -4.107 1.00 . A A .  23 ARG CG   1 1 
        4  2160 1 1 23 ARG CZ   C    3.274  13.868  -3.690 1.00 . A A .  23 ARG CZ   1 1 
        4  2161 1 1 23 ARG H    H    0.165   8.689  -3.158 1.00 . A A .  23 ARG H    1 1 
        4  2162 1 1 23 ARG HA   H   -1.350  10.627  -4.770 1.00 . A A .  23 ARG HA   1 1 
        4  2163 1 1 23 ARG HB2  H   -0.413  11.416  -2.596 1.00 . A A .  23 ARG HB2  1 1 
        4  2164 1 1 23 ARG HB3  H    1.199  11.078  -3.212 1.00 . A A .  23 ARG HB3  1 1 
        4  2165 1 1 23 ARG HD2  H    0.797  14.745  -3.598 1.00 . A A .  23 ARG HD2  1 1 
        4  2166 1 1 23 ARG HD3  H    0.335  13.740  -2.224 1.00 . A A .  23 ARG HD3  1 1 
        4  2167 1 1 23 ARG HE   H    2.499  12.951  -2.097 1.00 . A A .  23 ARG HE   1 1 
        4  2168 1 1 23 ARG HG2  H    0.840  12.709  -5.010 1.00 . A A .  23 ARG HG2  1 1 
        4  2169 1 1 23 ARG HG3  H   -0.755  13.068  -4.345 1.00 . A A .  23 ARG HG3  1 1 
        4  2170 1 1 23 ARG HH11 H    2.067  14.803  -5.013 1.00 . A A .  23 ARG HH11 1 1 
        4  2171 1 1 23 ARG HH12 H    3.760  14.871  -5.376 1.00 . A A .  23 ARG HH12 1 1 
        4  2172 1 1 23 ARG HH21 H    4.730  13.034  -2.564 1.00 . A A .  23 ARG HH21 1 1 
        4  2173 1 1 23 ARG HH22 H    5.274  13.864  -3.982 1.00 . A A .  23 ARG HH22 1 1 
        4  2174 1 1 23 ARG N    N   -0.571   9.044  -3.699 1.00 . A A .  23 ARG N    1 1 
        4  2175 1 1 23 ARG NE   N    2.283  13.470  -2.899 1.00 . A A .  23 ARG NE   1 1 
        4  2176 1 1 23 ARG NH1  N    3.012  14.571  -4.783 1.00 . A A .  23 ARG NH1  1 1 
        4  2177 1 1 23 ARG NH2  N    4.529  13.564  -3.387 1.00 . A A .  23 ARG NH2  1 1 
        4  2178 1 1 23 ARG O    O    0.491  10.872  -6.581 1.00 . A A .  23 ARG O    1 1 
        4  2179 1 1 24 ALA C    C    2.175   7.323  -7.091 1.00 . A A .  24 ALA C    1 1 
        4  2180 1 1 24 ALA CA   C    2.301   8.775  -6.641 1.00 . A A .  24 ALA CA   1 1 
        4  2181 1 1 24 ALA CB   C    3.729   9.073  -6.207 1.00 . A A .  24 ALA CB   1 1 
        4  2182 1 1 24 ALA H    H    1.361   8.495  -4.766 1.00 . A A .  24 ALA H    1 1 
        4  2183 1 1 24 ALA HA   H    2.062   9.421  -7.473 1.00 . A A .  24 ALA HA   1 1 
        4  2184 1 1 24 ALA HB1  H    3.717   9.575  -5.251 1.00 . A A .  24 ALA HB1  1 1 
        4  2185 1 1 24 ALA HB2  H    4.279   8.147  -6.121 1.00 . A A .  24 ALA HB2  1 1 
        4  2186 1 1 24 ALA HB3  H    4.203   9.706  -6.942 1.00 . A A .  24 ALA HB3  1 1 
        4  2187 1 1 24 ALA N    N    1.372   9.071  -5.558 1.00 . A A .  24 ALA N    1 1 
        4  2188 1 1 24 ALA O    O    1.863   6.441  -6.291 1.00 . A A .  24 ALA O    1 1 
        4  2189 1 1 25 ARG C    C    3.236   4.775  -8.170 1.00 . A A .  25 ARG C    1 1 
        4  2190 1 1 25 ARG CA   C    2.330   5.738  -8.931 1.00 . A A .  25 ARG CA   1 1 
        4  2191 1 1 25 ARG CB   C    2.710   5.750 -10.413 1.00 . A A .  25 ARG CB   1 1 
        4  2192 1 1 25 ARG CD   C    2.542   4.623 -12.653 1.00 . A A .  25 ARG CD   1 1 
        4  2193 1 1 25 ARG CG   C    2.293   4.493 -11.158 1.00 . A A .  25 ARG CG   1 1 
        4  2194 1 1 25 ARG CZ   C    4.810   5.529 -12.940 1.00 . A A .  25 ARG CZ   1 1 
        4  2195 1 1 25 ARG H    H    2.663   7.828  -8.963 1.00 . A A .  25 ARG H    1 1 
        4  2196 1 1 25 ARG HA   H    1.308   5.405  -8.833 1.00 . A A .  25 ARG HA   1 1 
        4  2197 1 1 25 ARG HB2  H    2.237   6.597 -10.887 1.00 . A A .  25 ARG HB2  1 1 
        4  2198 1 1 25 ARG HB3  H    3.782   5.853 -10.496 1.00 . A A .  25 ARG HB3  1 1 
        4  2199 1 1 25 ARG HD2  H    2.000   3.842 -13.164 1.00 . A A .  25 ARG HD2  1 1 
        4  2200 1 1 25 ARG HD3  H    2.182   5.586 -12.981 1.00 . A A .  25 ARG HD3  1 1 
        4  2201 1 1 25 ARG HE   H    4.295   3.628 -13.250 1.00 . A A .  25 ARG HE   1 1 
        4  2202 1 1 25 ARG HG2  H    2.863   3.656 -10.781 1.00 . A A .  25 ARG HG2  1 1 
        4  2203 1 1 25 ARG HG3  H    1.241   4.319 -10.991 1.00 . A A .  25 ARG HG3  1 1 
        4  2204 1 1 25 ARG HH11 H    3.426   6.874 -12.343 1.00 . A A .  25 ARG HH11 1 1 
        4  2205 1 1 25 ARG HH12 H    5.028   7.500 -12.549 1.00 . A A .  25 ARG HH12 1 1 
        4  2206 1 1 25 ARG HH21 H    6.408   4.439 -13.525 1.00 . A A .  25 ARG HH21 1 1 
        4  2207 1 1 25 ARG HH22 H    6.724   6.114 -13.222 1.00 . A A .  25 ARG HH22 1 1 
        4  2208 1 1 25 ARG N    N    2.419   7.083  -8.375 1.00 . A A .  25 ARG N    1 1 
        4  2209 1 1 25 ARG NE   N    3.960   4.509 -12.983 1.00 . A A .  25 ARG NE   1 1 
        4  2210 1 1 25 ARG NH1  N    4.386   6.734 -12.582 1.00 . A A .  25 ARG NH1  1 1 
        4  2211 1 1 25 ARG NH2  N    6.085   5.346 -13.255 1.00 . A A .  25 ARG NH2  1 1 
        4  2212 1 1 25 ARG O    O    2.795   3.719  -7.715 1.00 . A A .  25 ARG O    1 1 
        4  2213 1 1 26 SER C    C    4.943   3.893  -5.967 1.00 . A A .  26 SER C    1 1 
        4  2214 1 1 26 SER CA   C    5.475   4.312  -7.334 1.00 . A A .  26 SER CA   1 1 
        4  2215 1 1 26 SER CB   C    6.799   5.061  -7.171 1.00 . A A .  26 SER CB   1 1 
        4  2216 1 1 26 SER H    H    4.798   5.998  -8.421 1.00 . A A .  26 SER H    1 1 
        4  2217 1 1 26 SER HA   H    5.643   3.426  -7.929 1.00 . A A .  26 SER HA   1 1 
        4  2218 1 1 26 SER HB2  H    7.559   4.373  -6.833 1.00 . A A .  26 SER HB2  1 1 
        4  2219 1 1 26 SER HB3  H    7.092   5.481  -8.123 1.00 . A A .  26 SER HB3  1 1 
        4  2220 1 1 26 SER HG   H    6.420   5.747  -5.376 1.00 . A A .  26 SER HG   1 1 
        4  2221 1 1 26 SER N    N    4.506   5.145  -8.036 1.00 . A A .  26 SER N    1 1 
        4  2222 1 1 26 SER O    O    5.094   2.743  -5.555 1.00 . A A .  26 SER O    1 1 
        4  2223 1 1 26 SER OG   O    6.679   6.110  -6.226 1.00 . A A .  26 SER OG   1 1 
        4  2224 1 1 27 SER C    C    2.772   3.413  -3.996 1.00 . A A .  27 SER C    1 1 
        4  2225 1 1 27 SER CA   C    3.767   4.568  -3.945 1.00 . A A .  27 SER CA   1 1 
        4  2226 1 1 27 SER CB   C    3.085   5.820  -3.390 1.00 . A A .  27 SER CB   1 1 
        4  2227 1 1 27 SER H    H    4.230   5.734  -5.650 1.00 . A A .  27 SER H    1 1 
        4  2228 1 1 27 SER HA   H    4.584   4.295  -3.294 1.00 . A A .  27 SER HA   1 1 
        4  2229 1 1 27 SER HB2  H    2.478   6.268  -4.162 1.00 . A A .  27 SER HB2  1 1 
        4  2230 1 1 27 SER HB3  H    2.458   5.544  -2.554 1.00 . A A .  27 SER HB3  1 1 
        4  2231 1 1 27 SER HG   H    3.830   7.047  -2.057 1.00 . A A .  27 SER HG   1 1 
        4  2232 1 1 27 SER N    N    4.319   4.836  -5.268 1.00 . A A .  27 SER N    1 1 
        4  2233 1 1 27 SER O    O    2.722   2.580  -3.090 1.00 . A A .  27 SER O    1 1 
        4  2234 1 1 27 SER OG   O    4.041   6.769  -2.951 1.00 . A A .  27 SER OG   1 1 
        4  2235 1 1 28 LEU C    C    1.655   0.960  -5.432 1.00 . A A .  28 LEU C    1 1 
        4  2236 1 1 28 LEU CA   C    0.985   2.316  -5.233 1.00 . A A .  28 LEU CA   1 1 
        4  2237 1 1 28 LEU CB   C    0.081   2.631  -6.426 1.00 . A A .  28 LEU CB   1 1 
        4  2238 1 1 28 LEU CD1  C   -2.061   1.486  -5.807 1.00 . A A .  28 LEU CD1  1 1 
        4  2239 1 1 28 LEU CD2  C   -1.460   1.789  -8.216 1.00 . A A .  28 LEU CD2  1 1 
        4  2240 1 1 28 LEU CG   C   -0.923   1.544  -6.813 1.00 . A A .  28 LEU CG   1 1 
        4  2241 1 1 28 LEU H    H    2.066   4.060  -5.751 1.00 . A A .  28 LEU H    1 1 
        4  2242 1 1 28 LEU HA   H    0.384   2.280  -4.337 1.00 . A A .  28 LEU HA   1 1 
        4  2243 1 1 28 LEU HB2  H   -0.475   3.526  -6.193 1.00 . A A .  28 LEU HB2  1 1 
        4  2244 1 1 28 LEU HB3  H    0.716   2.816  -7.281 1.00 . A A .  28 LEU HB3  1 1 
        4  2245 1 1 28 LEU HD11 H   -1.724   1.877  -4.859 1.00 . A A .  28 LEU HD11 1 1 
        4  2246 1 1 28 LEU HD12 H   -2.379   0.462  -5.681 1.00 . A A .  28 LEU HD12 1 1 
        4  2247 1 1 28 LEU HD13 H   -2.890   2.078  -6.167 1.00 . A A .  28 LEU HD13 1 1 
        4  2248 1 1 28 LEU HD21 H   -2.187   2.587  -8.188 1.00 . A A .  28 LEU HD21 1 1 
        4  2249 1 1 28 LEU HD22 H   -1.928   0.888  -8.584 1.00 . A A .  28 LEU HD22 1 1 
        4  2250 1 1 28 LEU HD23 H   -0.646   2.065  -8.870 1.00 . A A .  28 LEU HD23 1 1 
        4  2251 1 1 28 LEU HG   H   -0.424   0.584  -6.808 1.00 . A A .  28 LEU HG   1 1 
        4  2252 1 1 28 LEU N    N    1.980   3.369  -5.062 1.00 . A A .  28 LEU N    1 1 
        4  2253 1 1 28 LEU O    O    1.248  -0.037  -4.837 1.00 . A A .  28 LEU O    1 1 
        4  2254 1 1 29 ALA C    C    3.935  -0.927  -5.256 1.00 . A A .  29 ALA C    1 1 
        4  2255 1 1 29 ALA CA   C    3.414  -0.300  -6.544 1.00 . A A .  29 ALA CA   1 1 
        4  2256 1 1 29 ALA CB   C    4.563  -0.031  -7.505 1.00 . A A .  29 ALA CB   1 1 
        4  2257 1 1 29 ALA H    H    2.962   1.761  -6.715 1.00 . A A .  29 ALA H    1 1 
        4  2258 1 1 29 ALA HA   H    2.734  -0.991  -7.020 1.00 . A A .  29 ALA HA   1 1 
        4  2259 1 1 29 ALA HB1  H    4.216  -0.143  -8.521 1.00 . A A .  29 ALA HB1  1 1 
        4  2260 1 1 29 ALA HB2  H    4.927   0.976  -7.357 1.00 . A A .  29 ALA HB2  1 1 
        4  2261 1 1 29 ALA HB3  H    5.361  -0.733  -7.317 1.00 . A A .  29 ALA HB3  1 1 
        4  2262 1 1 29 ALA N    N    2.685   0.933  -6.271 1.00 . A A .  29 ALA N    1 1 
        4  2263 1 1 29 ALA O    O    3.562  -2.047  -4.905 1.00 . A A .  29 ALA O    1 1 
        4  2264 1 1 30 ILE C    C    4.321  -1.402  -2.464 1.00 . A A .  30 ILE C    1 1 
        4  2265 1 1 30 ILE CA   C    5.371  -0.685  -3.306 1.00 . A A .  30 ILE CA   1 1 
        4  2266 1 1 30 ILE CB   C    5.977   0.465  -2.480 1.00 . A A .  30 ILE CB   1 1 
        4  2267 1 1 30 ILE CD1  C    7.260   2.624  -2.891 1.00 . A A .  30 ILE CD1  1 1 
        4  2268 1 1 30 ILE CG1  C    7.071   1.175  -3.280 1.00 . A A .  30 ILE CG1  1 1 
        4  2269 1 1 30 ILE CG2  C    6.533  -0.064  -1.166 1.00 . A A .  30 ILE CG2  1 1 
        4  2270 1 1 30 ILE H    H    5.058   0.686  -4.888 1.00 . A A .  30 ILE H    1 1 
        4  2271 1 1 30 ILE HA   H    6.159  -1.382  -3.550 1.00 . A A .  30 ILE HA   1 1 
        4  2272 1 1 30 ILE HB   H    5.192   1.169  -2.254 1.00 . A A .  30 ILE HB   1 1 
        4  2273 1 1 30 ILE HD11 H    7.905   2.683  -2.026 1.00 . A A .  30 ILE HD11 1 1 
        4  2274 1 1 30 ILE HD12 H    7.711   3.162  -3.712 1.00 . A A .  30 ILE HD12 1 1 
        4  2275 1 1 30 ILE HD13 H    6.302   3.062  -2.655 1.00 . A A .  30 ILE HD13 1 1 
        4  2276 1 1 30 ILE HG12 H    8.009   0.665  -3.126 1.00 . A A .  30 ILE HG12 1 1 
        4  2277 1 1 30 ILE HG13 H    6.817   1.143  -4.330 1.00 . A A .  30 ILE HG13 1 1 
        4  2278 1 1 30 ILE HG21 H    7.591   0.147  -1.112 1.00 . A A .  30 ILE HG21 1 1 
        4  2279 1 1 30 ILE HG22 H    6.029   0.419  -0.343 1.00 . A A .  30 ILE HG22 1 1 
        4  2280 1 1 30 ILE HG23 H    6.375  -1.130  -1.111 1.00 . A A .  30 ILE HG23 1 1 
        4  2281 1 1 30 ILE N    N    4.799  -0.199  -4.556 1.00 . A A .  30 ILE N    1 1 
        4  2282 1 1 30 ILE O    O    4.608  -2.415  -1.825 1.00 . A A .  30 ILE O    1 1 
        4  2283 1 1 31 HIS C    C    1.580  -2.795  -2.315 1.00 . A A .  31 HIS C    1 1 
        4  2284 1 1 31 HIS CA   C    2.008  -1.462  -1.707 1.00 . A A .  31 HIS CA   1 1 
        4  2285 1 1 31 HIS CB   C    0.817  -0.505  -1.659 1.00 . A A .  31 HIS CB   1 1 
        4  2286 1 1 31 HIS CD2  C   -1.618  -1.277  -1.208 1.00 . A A .  31 HIS CD2  1 1 
        4  2287 1 1 31 HIS CE1  C   -1.410  -1.770   0.918 1.00 . A A .  31 HIS CE1  1 1 
        4  2288 1 1 31 HIS CG   C   -0.336  -1.023  -0.855 1.00 . A A .  31 HIS CG   1 1 
        4  2289 1 1 31 HIS H    H    2.936  -0.063  -2.997 1.00 . A A .  31 HIS H    1 1 
        4  2290 1 1 31 HIS HA   H    2.360  -1.636  -0.701 1.00 . A A .  31 HIS HA   1 1 
        4  2291 1 1 31 HIS HB2  H    1.133   0.430  -1.220 1.00 . A A .  31 HIS HB2  1 1 
        4  2292 1 1 31 HIS HB3  H    0.467  -0.325  -2.665 1.00 . A A .  31 HIS HB3  1 1 
        4  2293 1 1 31 HIS HD1  H    0.570  -1.266   1.031 1.00 . A A .  31 HIS HD1  1 1 
        4  2294 1 1 31 HIS HD2  H   -2.053  -1.140  -2.188 1.00 . A A .  31 HIS HD2  1 1 
        4  2295 1 1 31 HIS HE1  H   -1.632  -2.090   1.925 1.00 . A A .  31 HIS HE1  1 1 
        4  2296 1 1 31 HIS N    N    3.102  -0.871  -2.469 1.00 . A A .  31 HIS N    1 1 
        4  2297 1 1 31 HIS ND1  N   -0.238  -1.341   0.483 1.00 . A A .  31 HIS ND1  1 1 
        4  2298 1 1 31 HIS NE2  N   -2.264  -1.740  -0.089 1.00 . A A .  31 HIS NE2  1 1 
        4  2299 1 1 31 HIS O    O    1.522  -3.811  -1.624 1.00 . A A .  31 HIS O    1 1 
        4  2300 1 1 32 GLN C    C    1.860  -5.119  -4.098 1.00 . A A .  32 GLN C    1 1 
        4  2301 1 1 32 GLN CA   C    0.859  -3.988  -4.309 1.00 . A A .  32 GLN CA   1 1 
        4  2302 1 1 32 GLN CB   C    0.697  -3.707  -5.804 1.00 . A A .  32 GLN CB   1 1 
        4  2303 1 1 32 GLN CD   C   -0.838  -2.680  -7.528 1.00 . A A .  32 GLN CD   1 1 
        4  2304 1 1 32 GLN CG   C   -0.305  -2.605  -6.111 1.00 . A A .  32 GLN CG   1 1 
        4  2305 1 1 32 GLN H    H    1.349  -1.939  -4.106 1.00 . A A .  32 GLN H    1 1 
        4  2306 1 1 32 GLN HA   H   -0.095  -4.288  -3.903 1.00 . A A .  32 GLN HA   1 1 
        4  2307 1 1 32 GLN HB2  H    1.655  -3.416  -6.209 1.00 . A A .  32 GLN HB2  1 1 
        4  2308 1 1 32 GLN HB3  H    0.367  -4.610  -6.294 1.00 . A A .  32 GLN HB3  1 1 
        4  2309 1 1 32 GLN HE21 H   -1.829  -0.975  -7.271 1.00 . A A .  32 GLN HE21 1 1 
        4  2310 1 1 32 GLN HE22 H   -1.992  -1.712  -8.825 1.00 . A A .  32 GLN HE22 1 1 
        4  2311 1 1 32 GLN HG2  H   -1.135  -2.691  -5.426 1.00 . A A .  32 GLN HG2  1 1 
        4  2312 1 1 32 GLN HG3  H    0.178  -1.649  -5.973 1.00 . A A .  32 GLN HG3  1 1 
        4  2313 1 1 32 GLN N    N    1.283  -2.780  -3.610 1.00 . A A .  32 GLN N    1 1 
        4  2314 1 1 32 GLN NE2  N   -1.634  -1.690  -7.914 1.00 . A A .  32 GLN NE2  1 1 
        4  2315 1 1 32 GLN O    O    1.510  -6.295  -4.186 1.00 . A A .  32 GLN O    1 1 
        4  2316 1 1 32 GLN OE1  O   -0.538  -3.618  -8.268 1.00 . A A .  32 GLN OE1  1 1 
        4  2317 1 1 33 ALA C    C    3.723  -6.783  -2.572 1.00 . A A .  33 ALA C    1 1 
        4  2318 1 1 33 ALA CA   C    4.159  -5.738  -3.594 1.00 . A A .  33 ALA CA   1 1 
        4  2319 1 1 33 ALA CB   C    5.436  -5.050  -3.137 1.00 . A A .  33 ALA CB   1 1 
        4  2320 1 1 33 ALA H    H    3.325  -3.800  -3.763 1.00 . A A .  33 ALA H    1 1 
        4  2321 1 1 33 ALA HA   H    4.361  -6.231  -4.534 1.00 . A A .  33 ALA HA   1 1 
        4  2322 1 1 33 ALA HB1  H    5.329  -3.981  -3.248 1.00 . A A .  33 ALA HB1  1 1 
        4  2323 1 1 33 ALA HB2  H    5.621  -5.288  -2.099 1.00 . A A .  33 ALA HB2  1 1 
        4  2324 1 1 33 ALA HB3  H    6.265  -5.393  -3.737 1.00 . A A .  33 ALA HB3  1 1 
        4  2325 1 1 33 ALA N    N    3.107  -4.754  -3.819 1.00 . A A .  33 ALA N    1 1 
        4  2326 1 1 33 ALA O    O    4.290  -7.874  -2.503 1.00 . A A .  33 ALA O    1 1 
        4  2327 1 1 34 THR C    C    0.877  -7.969  -1.187 1.00 . A A .  34 THR C    1 1 
        4  2328 1 1 34 THR CA   C    2.203  -7.349  -0.758 1.00 . A A .  34 THR CA   1 1 
        4  2329 1 1 34 THR CB   C    2.007  -6.628   0.589 1.00 . A A .  34 THR CB   1 1 
        4  2330 1 1 34 THR CG2  C    0.827  -5.670   0.524 1.00 . A A .  34 THR CG2  1 1 
        4  2331 1 1 34 THR H    H    2.302  -5.558  -1.881 1.00 . A A .  34 THR H    1 1 
        4  2332 1 1 34 THR HA   H    2.929  -8.137  -0.619 1.00 . A A .  34 THR HA   1 1 
        4  2333 1 1 34 THR HB   H    2.900  -6.061   0.809 1.00 . A A .  34 THR HB   1 1 
        4  2334 1 1 34 THR HG1  H    2.502  -7.520   2.277 1.00 . A A .  34 THR HG1  1 1 
        4  2335 1 1 34 THR HG21 H   -0.023  -6.113   1.019 1.00 . A A .  34 THR HG21 1 1 
        4  2336 1 1 34 THR HG22 H    0.579  -5.474  -0.509 1.00 . A A .  34 THR HG22 1 1 
        4  2337 1 1 34 THR HG23 H    1.088  -4.744   1.014 1.00 . A A .  34 THR HG23 1 1 
        4  2338 1 1 34 THR N    N    2.713  -6.442  -1.778 1.00 . A A .  34 THR N    1 1 
        4  2339 1 1 34 THR O    O    0.478  -9.018  -0.680 1.00 . A A .  34 THR O    1 1 
        4  2340 1 1 34 THR OG1  O    1.794  -7.586   1.631 1.00 . A A .  34 THR OG1  1 1 
        4  2341 1 1 35 HIS C    C   -0.878  -8.836  -3.724 1.00 . A A .  35 HIS C    1 1 
        4  2342 1 1 35 HIS CA   C   -1.083  -7.802  -2.621 1.00 . A A .  35 HIS CA   1 1 
        4  2343 1 1 35 HIS CB   C   -1.926  -6.639  -3.146 1.00 . A A .  35 HIS CB   1 1 
        4  2344 1 1 35 HIS CD2  C   -2.564  -4.849  -1.381 1.00 . A A .  35 HIS CD2  1 1 
        4  2345 1 1 35 HIS CE1  C   -4.473  -5.707  -0.729 1.00 . A A .  35 HIS CE1  1 1 
        4  2346 1 1 35 HIS CG   C   -2.764  -5.983  -2.091 1.00 . A A .  35 HIS CG   1 1 
        4  2347 1 1 35 HIS H    H    0.568  -6.483  -2.488 1.00 . A A .  35 HIS H    1 1 
        4  2348 1 1 35 HIS HA   H   -1.602  -8.269  -1.798 1.00 . A A .  35 HIS HA   1 1 
        4  2349 1 1 35 HIS HB2  H   -1.272  -5.888  -3.564 1.00 . A A .  35 HIS HB2  1 1 
        4  2350 1 1 35 HIS HB3  H   -2.588  -7.003  -3.918 1.00 . A A .  35 HIS HB3  1 1 
        4  2351 1 1 35 HIS HD1  H   -4.389  -7.320  -1.985 1.00 . A A .  35 HIS HD1  1 1 
        4  2352 1 1 35 HIS HD2  H   -1.716  -4.183  -1.460 1.00 . A A .  35 HIS HD2  1 1 
        4  2353 1 1 35 HIS HE1  H   -5.408  -5.859  -0.210 1.00 . A A .  35 HIS HE1  1 1 
        4  2354 1 1 35 HIS N    N    0.198  -7.313  -2.123 1.00 . A A .  35 HIS N    1 1 
        4  2355 1 1 35 HIS ND1  N   -3.968  -6.498  -1.659 1.00 . A A .  35 HIS ND1  1 1 
        4  2356 1 1 35 HIS NE2  N   -3.641  -4.699  -0.542 1.00 . A A .  35 HIS NE2  1 1 
        4  2357 1 1 35 HIS O    O   -1.627  -8.872  -4.701 1.00 . A A .  35 HIS O    1 1 
        4  2358 1 1 36 SER C    C    0.679 -12.053  -3.866 1.00 . A A .  36 SER C    1 1 
        4  2359 1 1 36 SER CA   C    0.445 -10.707  -4.545 1.00 . A A .  36 SER CA   1 1 
        4  2360 1 1 36 SER CB   C    1.677 -10.314  -5.361 1.00 . A A .  36 SER CB   1 1 
        4  2361 1 1 36 SER H    H    0.700  -9.596  -2.761 1.00 . A A .  36 SER H    1 1 
        4  2362 1 1 36 SER HA   H   -0.403 -10.794  -5.208 1.00 . A A .  36 SER HA   1 1 
        4  2363 1 1 36 SER HB2  H    1.543  -9.318  -5.755 1.00 . A A .  36 SER HB2  1 1 
        4  2364 1 1 36 SER HB3  H    2.550 -10.334  -4.724 1.00 . A A .  36 SER HB3  1 1 
        4  2365 1 1 36 SER HG   H    2.543 -10.848  -7.036 1.00 . A A .  36 SER HG   1 1 
        4  2366 1 1 36 SER N    N    0.140  -9.675  -3.561 1.00 . A A .  36 SER N    1 1 
        4  2367 1 1 36 SER O    O    1.784 -12.349  -3.413 1.00 . A A .  36 SER O    1 1 
        4  2368 1 1 36 SER OG   O    1.880 -11.208  -6.442 1.00 . A A .  36 SER OG   1 1 
        4  2369 1 1 37 GLY C    C   -0.977 -15.251  -3.959 1.00 . A A .  37 GLY C    1 1 
        4  2370 1 1 37 GLY CA   C   -0.262 -14.170  -3.173 1.00 . A A .  37 GLY CA   1 1 
        4  2371 1 1 37 GLY H    H   -1.229 -12.576  -4.177 1.00 . A A .  37 GLY H    1 1 
        4  2372 1 1 37 GLY HA2  H    0.783 -14.431  -3.091 1.00 . A A .  37 GLY HA2  1 1 
        4  2373 1 1 37 GLY HA3  H   -0.688 -14.119  -2.183 1.00 . A A .  37 GLY HA3  1 1 
        4  2374 1 1 37 GLY N    N   -0.372 -12.865  -3.799 1.00 . A A .  37 GLY N    1 1 
        4  2375 1 1 37 GLY O    O   -0.405 -16.304  -4.240 1.00 . A A .  37 GLY O    1 1 
        4  2376 1 1 38 GLU C    C   -2.753 -15.830  -6.563 1.00 . A A .  38 GLU C    1 1 
        4  2377 1 1 38 GLU CA   C   -3.027 -15.954  -5.066 1.00 . A A .  38 GLU CA   1 1 
        4  2378 1 1 38 GLU CB   C   -4.518 -15.745  -4.791 1.00 . A A .  38 GLU CB   1 1 
        4  2379 1 1 38 GLU CD   C   -6.369 -16.279  -3.157 1.00 . A A .  38 GLU CD   1 1 
        4  2380 1 1 38 GLU CG   C   -4.901 -15.943  -3.334 1.00 . A A .  38 GLU CG   1 1 
        4  2381 1 1 38 GLU H    H   -2.633 -14.135  -4.057 1.00 . A A .  38 GLU H    1 1 
        4  2382 1 1 38 GLU HA   H   -2.746 -16.944  -4.742 1.00 . A A .  38 GLU HA   1 1 
        4  2383 1 1 38 GLU HB2  H   -4.788 -14.740  -5.079 1.00 . A A .  38 GLU HB2  1 1 
        4  2384 1 1 38 GLU HB3  H   -5.083 -16.445  -5.388 1.00 . A A .  38 GLU HB3  1 1 
        4  2385 1 1 38 GLU HG2  H   -4.311 -16.751  -2.927 1.00 . A A .  38 GLU HG2  1 1 
        4  2386 1 1 38 GLU HG3  H   -4.687 -15.034  -2.791 1.00 . A A .  38 GLU HG3  1 1 
        4  2387 1 1 38 GLU N    N   -2.232 -14.992  -4.311 1.00 . A A .  38 GLU N    1 1 
        4  2388 1 1 38 GLU O    O   -2.832 -14.742  -7.132 1.00 . A A .  38 GLU O    1 1 
        4  2389 1 1 38 GLU OE1  O   -6.869 -17.157  -3.892 1.00 . A A .  38 GLU OE1  1 1 
        4  2390 1 1 38 GLU OE2  O   -7.018 -15.665  -2.285 1.00 . A A .  38 GLU OE2  1 1 
        4  2391 1 1 39 LYS C    C   -1.045 -15.978  -8.973 1.00 . A A .  39 LYS C    1 1 
        4  2392 1 1 39 LYS CA   C   -2.146 -16.975  -8.623 1.00 . A A .  39 LYS CA   1 1 
        4  2393 1 1 39 LYS CB   C   -3.411 -16.653  -9.422 1.00 . A A .  39 LYS CB   1 1 
        4  2394 1 1 39 LYS CD   C   -4.180 -18.876 -10.306 1.00 . A A .  39 LYS CD   1 1 
        4  2395 1 1 39 LYS CE   C   -4.709 -18.576 -11.700 1.00 . A A .  39 LYS CE   1 1 
        4  2396 1 1 39 LYS CG   C   -4.472 -17.738  -9.342 1.00 . A A .  39 LYS CG   1 1 
        4  2397 1 1 39 LYS H    H   -2.385 -17.791  -6.685 1.00 . A A .  39 LYS H    1 1 
        4  2398 1 1 39 LYS HA   H   -1.811 -17.968  -8.881 1.00 . A A .  39 LYS HA   1 1 
        4  2399 1 1 39 LYS HB2  H   -3.837 -15.735  -9.045 1.00 . A A .  39 LYS HB2  1 1 
        4  2400 1 1 39 LYS HB3  H   -3.143 -16.517 -10.459 1.00 . A A .  39 LYS HB3  1 1 
        4  2401 1 1 39 LYS HD2  H   -3.111 -19.022 -10.363 1.00 . A A .  39 LYS HD2  1 1 
        4  2402 1 1 39 LYS HD3  H   -4.649 -19.777  -9.938 1.00 . A A .  39 LYS HD3  1 1 
        4  2403 1 1 39 LYS HE2  H   -5.724 -18.935 -11.770 1.00 . A A .  39 LYS HE2  1 1 
        4  2404 1 1 39 LYS HE3  H   -4.695 -17.507 -11.854 1.00 . A A .  39 LYS HE3  1 1 
        4  2405 1 1 39 LYS HG2  H   -4.499 -18.130  -8.337 1.00 . A A .  39 LYS HG2  1 1 
        4  2406 1 1 39 LYS HG3  H   -5.433 -17.308  -9.588 1.00 . A A .  39 LYS HG3  1 1 
        4  2407 1 1 39 LYS HZ1  H   -4.505 -19.728 -13.430 1.00 . A A .  39 LYS HZ1  1 1 
        4  2408 1 1 39 LYS HZ2  H   -3.234 -19.914 -12.329 1.00 . A A .  39 LYS HZ2  1 1 
        4  2409 1 1 39 LYS HZ3  H   -3.336 -18.515 -13.273 1.00 . A A .  39 LYS HZ3  1 1 
        4  2410 1 1 39 LYS N    N   -2.431 -16.954  -7.194 1.00 . A A .  39 LYS N    1 1 
        4  2411 1 1 39 LYS NZ   N   -3.889 -19.229 -12.757 1.00 . A A .  39 LYS NZ   1 1 
        4  2412 1 1 39 LYS O    O   -1.211 -15.108  -9.828 1.00 . A A .  39 LYS O    1 1 
        4  2413 1 1 40 PRO C    C    1.912 -15.464  -9.880 1.00 . A A .  40 PRO C    1 1 
        4  2414 1 1 40 PRO CA   C    1.258 -15.228  -8.523 1.00 . A A .  40 PRO CA   1 1 
        4  2415 1 1 40 PRO CB   C    2.219 -15.607  -7.393 1.00 . A A .  40 PRO CB   1 1 
        4  2416 1 1 40 PRO CD   C    0.375 -17.123  -7.266 1.00 . A A .  40 PRO CD   1 1 
        4  2417 1 1 40 PRO CG   C    1.858 -17.009  -7.043 1.00 . A A .  40 PRO CG   1 1 
        4  2418 1 1 40 PRO HA   H    0.986 -14.187  -8.432 1.00 . A A .  40 PRO HA   1 1 
        4  2419 1 1 40 PRO HB2  H    3.239 -15.537  -7.746 1.00 . A A .  40 PRO HB2  1 1 
        4  2420 1 1 40 PRO HB3  H    2.076 -14.941  -6.556 1.00 . A A .  40 PRO HB3  1 1 
        4  2421 1 1 40 PRO HD2  H    0.122 -18.110  -7.621 1.00 . A A .  40 PRO HD2  1 1 
        4  2422 1 1 40 PRO HD3  H   -0.162 -16.897  -6.357 1.00 . A A .  40 PRO HD3  1 1 
        4  2423 1 1 40 PRO HG2  H    2.388 -17.696  -7.684 1.00 . A A .  40 PRO HG2  1 1 
        4  2424 1 1 40 PRO HG3  H    2.096 -17.201  -6.007 1.00 . A A .  40 PRO HG3  1 1 
        4  2425 1 1 40 PRO N    N    0.107 -16.107  -8.299 1.00 . A A .  40 PRO N    1 1 
        4  2426 1 1 40 PRO O    O    2.610 -16.458 -10.079 1.00 . A A .  40 PRO O    1 1 
        4  2427 1 1 41 SER C    C    3.753 -14.887 -12.088 1.00 . A A .  41 SER C    1 1 
        4  2428 1 1 41 SER CA   C    2.247 -14.652 -12.151 1.00 . A A .  41 SER CA   1 1 
        4  2429 1 1 41 SER CB   C    1.949 -13.387 -12.958 1.00 . A A .  41 SER CB   1 1 
        4  2430 1 1 41 SER H    H    1.117 -13.772 -10.591 1.00 . A A .  41 SER H    1 1 
        4  2431 1 1 41 SER HA   H    1.783 -15.497 -12.638 1.00 . A A .  41 SER HA   1 1 
        4  2432 1 1 41 SER HB2  H    2.456 -12.548 -12.507 1.00 . A A .  41 SER HB2  1 1 
        4  2433 1 1 41 SER HB3  H    2.301 -13.519 -13.971 1.00 . A A .  41 SER HB3  1 1 
        4  2434 1 1 41 SER HG   H    0.070 -13.935 -12.865 1.00 . A A .  41 SER HG   1 1 
        4  2435 1 1 41 SER N    N    1.682 -14.543 -10.811 1.00 . A A .  41 SER N    1 1 
        4  2436 1 1 41 SER O    O    4.273 -15.823 -12.694 1.00 . A A .  41 SER O    1 1 
        4  2437 1 1 41 SER OG   O    0.558 -13.117 -12.988 1.00 . A A .  41 SER OG   1 1 
        4  2438 1 1 42 GLY C    C    6.496 -13.061 -10.368 1.00 . A A .  42 GLY C    1 1 
        4  2439 1 1 42 GLY CA   C    5.889 -14.157 -11.221 1.00 . A A .  42 GLY CA   1 1 
        4  2440 1 1 42 GLY H    H    3.981 -13.300 -10.889 1.00 . A A .  42 GLY H    1 1 
        4  2441 1 1 42 GLY HA2  H    6.115 -15.114 -10.774 1.00 . A A .  42 GLY HA2  1 1 
        4  2442 1 1 42 GLY HA3  H    6.332 -14.118 -12.205 1.00 . A A .  42 GLY HA3  1 1 
        4  2443 1 1 42 GLY N    N    4.449 -14.028 -11.350 1.00 . A A .  42 GLY N    1 1 
        4  2444 1 1 42 GLY O    O    7.193 -12.175 -10.862 1.00 . A A .  42 GLY O    1 1 
        4  2445 1 1 43 PRO C    C    8.249 -12.239  -7.901 1.00 . A A .  43 PRO C    1 1 
        4  2446 1 1 43 PRO CA   C    6.742 -12.121  -8.104 1.00 . A A .  43 PRO CA   1 1 
        4  2447 1 1 43 PRO CB   C    6.001 -12.455  -6.807 1.00 . A A .  43 PRO CB   1 1 
        4  2448 1 1 43 PRO CD   C    5.404 -14.138  -8.397 1.00 . A A .  43 PRO CD   1 1 
        4  2449 1 1 43 PRO CG   C    5.650 -13.898  -6.933 1.00 . A A .  43 PRO CG   1 1 
        4  2450 1 1 43 PRO HA   H    6.500 -11.114  -8.410 1.00 . A A .  43 PRO HA   1 1 
        4  2451 1 1 43 PRO HB2  H    6.650 -12.278  -5.962 1.00 . A A .  43 PRO HB2  1 1 
        4  2452 1 1 43 PRO HB3  H    5.117 -11.841  -6.725 1.00 . A A .  43 PRO HB3  1 1 
        4  2453 1 1 43 PRO HD2  H    5.728 -15.130  -8.676 1.00 . A A .  43 PRO HD2  1 1 
        4  2454 1 1 43 PRO HD3  H    4.358 -14.001  -8.631 1.00 . A A .  43 PRO HD3  1 1 
        4  2455 1 1 43 PRO HG2  H    6.471 -14.507  -6.586 1.00 . A A .  43 PRO HG2  1 1 
        4  2456 1 1 43 PRO HG3  H    4.757 -14.109  -6.363 1.00 . A A .  43 PRO HG3  1 1 
        4  2457 1 1 43 PRO N    N    6.228 -13.111  -9.055 1.00 . A A .  43 PRO N    1 1 
        4  2458 1 1 43 PRO O    O    8.837 -11.511  -7.102 1.00 . A A .  43 PRO O    1 1 
        4  2459 1 1 44 SER C    C   11.016 -12.927  -9.802 1.00 . A A .  44 SER C    1 1 
        4  2460 1 1 44 SER CA   C   10.307 -13.378  -8.528 1.00 . A A .  44 SER CA   1 1 
        4  2461 1 1 44 SER CB   C   10.605 -14.855  -8.261 1.00 . A A .  44 SER CB   1 1 
        4  2462 1 1 44 SER H    H    8.345 -13.712  -9.251 1.00 . A A .  44 SER H    1 1 
        4  2463 1 1 44 SER HA   H   10.673 -12.790  -7.700 1.00 . A A .  44 SER HA   1 1 
        4  2464 1 1 44 SER HB2  H   11.666 -14.985  -8.116 1.00 . A A .  44 SER HB2  1 1 
        4  2465 1 1 44 SER HB3  H   10.079 -15.169  -7.371 1.00 . A A .  44 SER HB3  1 1 
        4  2466 1 1 44 SER HG   H   10.636 -15.379 -10.148 1.00 . A A .  44 SER HG   1 1 
        4  2467 1 1 44 SER N    N    8.869 -13.162  -8.631 1.00 . A A .  44 SER N    1 1 
        4  2468 1 1 44 SER O    O   10.587 -13.247 -10.911 1.00 . A A .  44 SER O    1 1 
        4  2469 1 1 44 SER OG   O   10.189 -15.663  -9.348 1.00 . A A .  44 SER OG   1 1 
        4  2470 1 1 45 SER C    C   13.925 -12.699 -11.201 1.00 . A A .  45 SER C    1 1 
        4  2471 1 1 45 SER CA   C   12.872 -11.683 -10.769 1.00 . A A .  45 SER CA   1 1 
        4  2472 1 1 45 SER CB   C   13.544 -10.356 -10.413 1.00 . A A .  45 SER CB   1 1 
        4  2473 1 1 45 SER H    H   12.396 -11.961  -8.724 1.00 . A A .  45 SER H    1 1 
        4  2474 1 1 45 SER HA   H   12.186 -11.522 -11.588 1.00 . A A .  45 SER HA   1 1 
        4  2475 1 1 45 SER HB2  H   12.920  -9.814  -9.718 1.00 . A A .  45 SER HB2  1 1 
        4  2476 1 1 45 SER HB3  H   14.504 -10.552  -9.958 1.00 . A A .  45 SER HB3  1 1 
        4  2477 1 1 45 SER HG   H   13.053  -9.751 -12.211 1.00 . A A .  45 SER HG   1 1 
        4  2478 1 1 45 SER N    N   12.104 -12.182  -9.634 1.00 . A A .  45 SER N    1 1 
        4  2479 1 1 45 SER O    O   15.083 -12.621 -10.794 1.00 . A A .  45 SER O    1 1 
        4  2480 1 1 45 SER OG   O   13.739  -9.558 -11.568 1.00 . A A .  45 SER OG   1 1 
        4  2481 1 1 46 GLY C    C   15.451 -15.067 -11.455 1.00 . A A .  46 GLY C    1 1 
        4  2482 1 1 46 GLY CA   C   14.431 -14.672 -12.504 1.00 . A A .  46 GLY CA   1 1 
        4  2483 1 1 46 GLY H    H   12.577 -13.667 -12.321 1.00 . A A .  46 GLY H    1 1 
        4  2484 1 1 46 GLY HA2  H   13.865 -15.547 -12.789 1.00 . A A .  46 GLY HA2  1 1 
        4  2485 1 1 46 GLY HA3  H   14.952 -14.295 -13.372 1.00 . A A .  46 GLY HA3  1 1 
        4  2486 1 1 46 GLY N    N   13.512 -13.654 -12.030 1.00 . A A .  46 GLY N    1 1 
        4  2487 1 1 46 GLY O    O   16.648 -14.933 -11.704 1.00 . A A .  46 GLY O    1 1 
        4  2488 2 2  1 ZN  ZN   ZN  -3.881  -2.818  -0.751 1.00 . B A . 201 ZN  ZN   1 1 
        5  2489 1 1  1 GLY C    C  -22.216  11.135   0.529 1.00 . A A .   1 GLY C    1 1 
        5  2490 1 1  1 GLY CA   C  -23.460  10.356   0.152 1.00 . A A .   1 GLY CA   1 1 
        5  2491 1 1  1 GLY H1   H  -22.601   8.512   0.738 1.00 . A A .   1 GLY H1   1 1 
        5  2492 1 1  1 GLY HA2  H  -23.799  10.686  -0.819 1.00 . A A .   1 GLY HA2  1 1 
        5  2493 1 1  1 GLY HA3  H  -24.232  10.560   0.879 1.00 . A A .   1 GLY HA3  1 1 
        5  2494 1 1  1 GLY N    N  -23.227   8.924   0.106 1.00 . A A .   1 GLY N    1 1 
        5  2495 1 1  1 GLY O    O  -21.332  10.614   1.209 1.00 . A A .   1 GLY O    1 1 
        5  2496 1 1  2 SER C    C  -21.431  14.684   0.581 1.00 . A A .   2 SER C    1 1 
        5  2497 1 1  2 SER CA   C  -20.997  13.236   0.374 1.00 . A A .   2 SER CA   1 1 
        5  2498 1 1  2 SER CB   C  -19.976  13.156  -0.762 1.00 . A A .   2 SER CB   1 1 
        5  2499 1 1  2 SER H    H  -22.882  12.744  -0.454 1.00 . A A .   2 SER H    1 1 
        5  2500 1 1  2 SER HA   H  -20.539  12.876   1.284 1.00 . A A .   2 SER HA   1 1 
        5  2501 1 1  2 SER HB2  H  -19.619  12.141  -0.851 1.00 . A A .   2 SER HB2  1 1 
        5  2502 1 1  2 SER HB3  H  -20.447  13.454  -1.688 1.00 . A A .   2 SER HB3  1 1 
        5  2503 1 1  2 SER HG   H  -18.613  13.942   0.405 1.00 . A A .   2 SER HG   1 1 
        5  2504 1 1  2 SER N    N  -22.145  12.386   0.084 1.00 . A A .   2 SER N    1 1 
        5  2505 1 1  2 SER O    O  -22.405  15.143  -0.016 1.00 . A A .   2 SER O    1 1 
        5  2506 1 1  2 SER OG   O  -18.871  14.009  -0.517 1.00 . A A .   2 SER OG   1 1 
        5  2507 1 1  3 SER C    C  -20.046  17.727   1.000 1.00 . A A .   3 SER C    1 1 
        5  2508 1 1  3 SER CA   C  -21.013  16.793   1.722 1.00 . A A .   3 SER CA   1 1 
        5  2509 1 1  3 SER CB   C  -20.955  17.048   3.230 1.00 . A A .   3 SER CB   1 1 
        5  2510 1 1  3 SER H    H  -19.937  14.976   1.877 1.00 . A A .   3 SER H    1 1 
        5  2511 1 1  3 SER HA   H  -22.014  16.989   1.370 1.00 . A A .   3 SER HA   1 1 
        5  2512 1 1  3 SER HB2  H  -21.555  16.309   3.740 1.00 . A A .   3 SER HB2  1 1 
        5  2513 1 1  3 SER HB3  H  -19.931  16.974   3.566 1.00 . A A .   3 SER HB3  1 1 
        5  2514 1 1  3 SER HG   H  -20.750  18.985   3.434 1.00 . A A .   3 SER HG   1 1 
        5  2515 1 1  3 SER N    N  -20.701  15.398   1.432 1.00 . A A .   3 SER N    1 1 
        5  2516 1 1  3 SER O    O  -18.978  17.309   0.555 1.00 . A A .   3 SER O    1 1 
        5  2517 1 1  3 SER OG   O  -21.449  18.337   3.548 1.00 . A A .   3 SER OG   1 1 
        5  2518 1 1  4 GLY C    C  -18.146  19.905   0.685 1.00 . A A .   4 GLY C    1 1 
        5  2519 1 1  4 GLY CA   C  -19.587  19.969   0.219 1.00 . A A .   4 GLY CA   1 1 
        5  2520 1 1  4 GLY H    H  -21.293  19.271   1.262 1.00 . A A .   4 GLY H    1 1 
        5  2521 1 1  4 GLY HA2  H  -19.620  19.787  -0.845 1.00 . A A .   4 GLY HA2  1 1 
        5  2522 1 1  4 GLY HA3  H  -19.974  20.958   0.417 1.00 . A A .   4 GLY HA3  1 1 
        5  2523 1 1  4 GLY N    N  -20.430  18.995   0.888 1.00 . A A .   4 GLY N    1 1 
        5  2524 1 1  4 GLY O    O  -17.870  19.967   1.883 1.00 . A A .   4 GLY O    1 1 
        5  2525 1 1  5 SER C    C  -14.967  20.395  -1.016 1.00 . A A .   5 SER C    1 1 
        5  2526 1 1  5 SER CA   C  -15.804  19.700   0.055 1.00 . A A .   5 SER CA   1 1 
        5  2527 1 1  5 SER CB   C  -15.369  18.240   0.190 1.00 . A A .   5 SER CB   1 1 
        5  2528 1 1  5 SER H    H  -17.507  19.734  -1.202 1.00 . A A .   5 SER H    1 1 
        5  2529 1 1  5 SER HA   H  -15.648  20.202   0.998 1.00 . A A .   5 SER HA   1 1 
        5  2530 1 1  5 SER HB2  H  -15.613  17.709  -0.718 1.00 . A A .   5 SER HB2  1 1 
        5  2531 1 1  5 SER HB3  H  -14.302  18.198   0.356 1.00 . A A .   5 SER HB3  1 1 
        5  2532 1 1  5 SER HG   H  -16.234  18.265   1.948 1.00 . A A .   5 SER HG   1 1 
        5  2533 1 1  5 SER N    N  -17.224  19.779  -0.265 1.00 . A A .   5 SER N    1 1 
        5  2534 1 1  5 SER O    O  -15.386  20.512  -2.167 1.00 . A A .   5 SER O    1 1 
        5  2535 1 1  5 SER OG   O  -16.026  17.611   1.276 1.00 . A A .   5 SER OG   1 1 
        5  2536 1 1  6 SER C    C  -12.063  20.538  -2.354 1.00 . A A .   6 SER C    1 1 
        5  2537 1 1  6 SER CA   C  -12.887  21.540  -1.551 1.00 . A A .   6 SER CA   1 1 
        5  2538 1 1  6 SER CB   C  -11.958  22.485  -0.787 1.00 . A A .   6 SER CB   1 1 
        5  2539 1 1  6 SER H    H  -13.504  20.729   0.305 1.00 . A A .   6 SER H    1 1 
        5  2540 1 1  6 SER HA   H  -13.493  22.118  -2.232 1.00 . A A .   6 SER HA   1 1 
        5  2541 1 1  6 SER HB2  H  -11.213  22.877  -1.462 1.00 . A A .   6 SER HB2  1 1 
        5  2542 1 1  6 SER HB3  H  -12.536  23.300  -0.376 1.00 . A A .   6 SER HB3  1 1 
        5  2543 1 1  6 SER HG   H  -11.427  22.299   1.090 1.00 . A A .   6 SER HG   1 1 
        5  2544 1 1  6 SER N    N  -13.782  20.853  -0.627 1.00 . A A .   6 SER N    1 1 
        5  2545 1 1  6 SER O    O  -11.982  20.624  -3.579 1.00 . A A .   6 SER O    1 1 
        5  2546 1 1  6 SER OG   O  -11.303  21.810   0.273 1.00 . A A .   6 SER OG   1 1 
        5  2547 1 1  7 GLY C    C  -10.765  17.217  -1.668 1.00 . A A .   7 GLY C    1 1 
        5  2548 1 1  7 GLY CA   C  -10.643  18.581  -2.318 1.00 . A A .   7 GLY CA   1 1 
        5  2549 1 1  7 GLY H    H  -11.553  19.567  -0.679 1.00 . A A .   7 GLY H    1 1 
        5  2550 1 1  7 GLY HA2  H  -10.954  18.507  -3.349 1.00 . A A .   7 GLY HA2  1 1 
        5  2551 1 1  7 GLY HA3  H   -9.608  18.891  -2.286 1.00 . A A .   7 GLY HA3  1 1 
        5  2552 1 1  7 GLY N    N  -11.453  19.586  -1.654 1.00 . A A .   7 GLY N    1 1 
        5  2553 1 1  7 GLY O    O   -9.836  16.748  -1.010 1.00 . A A .   7 GLY O    1 1 
        5  2554 1 1  8 THR C    C  -12.382  14.217  -2.365 1.00 . A A .   8 THR C    1 1 
        5  2555 1 1  8 THR CA   C  -12.158  15.260  -1.276 1.00 . A A .   8 THR CA   1 1 
        5  2556 1 1  8 THR CB   C  -13.377  15.273  -0.335 1.00 . A A .   8 THR CB   1 1 
        5  2557 1 1  8 THR CG2  C  -13.620  13.892   0.255 1.00 . A A .   8 THR CG2  1 1 
        5  2558 1 1  8 THR H    H  -12.618  17.003  -2.386 1.00 . A A .   8 THR H    1 1 
        5  2559 1 1  8 THR HA   H  -11.287  14.983  -0.700 1.00 . A A .   8 THR HA   1 1 
        5  2560 1 1  8 THR HB   H  -14.248  15.565  -0.903 1.00 . A A .   8 THR HB   1 1 
        5  2561 1 1  8 THR HG1  H  -12.568  16.905   0.423 1.00 . A A .   8 THR HG1  1 1 
        5  2562 1 1  8 THR HG21 H  -13.738  13.176  -0.544 1.00 . A A .   8 THR HG21 1 1 
        5  2563 1 1  8 THR HG22 H  -14.517  13.911   0.857 1.00 . A A .   8 THR HG22 1 1 
        5  2564 1 1  8 THR HG23 H  -12.779  13.611   0.871 1.00 . A A .   8 THR HG23 1 1 
        5  2565 1 1  8 THR N    N  -11.916  16.577  -1.851 1.00 . A A .   8 THR N    1 1 
        5  2566 1 1  8 THR O    O  -13.457  14.149  -2.961 1.00 . A A .   8 THR O    1 1 
        5  2567 1 1  8 THR OG1  O  -13.170  16.219   0.721 1.00 . A A .   8 THR OG1  1 1 
        5  2568 1 1  9 GLY C    C  -10.743  12.747  -4.917 1.00 . A A .   9 GLY C    1 1 
        5  2569 1 1  9 GLY CA   C  -11.468  12.376  -3.638 1.00 . A A .   9 GLY CA   1 1 
        5  2570 1 1  9 GLY H    H  -10.528  13.506  -2.114 1.00 . A A .   9 GLY H    1 1 
        5  2571 1 1  9 GLY HA2  H  -11.049  11.458  -3.252 1.00 . A A .   9 GLY HA2  1 1 
        5  2572 1 1  9 GLY HA3  H  -12.512  12.216  -3.863 1.00 . A A .   9 GLY HA3  1 1 
        5  2573 1 1  9 GLY N    N  -11.361  13.405  -2.621 1.00 . A A .   9 GLY N    1 1 
        5  2574 1 1  9 GLY O    O  -11.243  12.501  -6.014 1.00 . A A .   9 GLY O    1 1 
        5  2575 1 1 10 GLU C    C   -7.419  13.041  -5.938 1.00 . A A .  10 GLU C    1 1 
        5  2576 1 1 10 GLU CA   C   -8.770  13.749  -5.929 1.00 . A A .  10 GLU CA   1 1 
        5  2577 1 1 10 GLU CB   C   -8.564  15.265  -5.924 1.00 . A A .  10 GLU CB   1 1 
        5  2578 1 1 10 GLU CD   C   -7.877  17.262  -4.538 1.00 . A A .  10 GLU CD   1 1 
        5  2579 1 1 10 GLU CG   C   -7.749  15.765  -4.743 1.00 . A A .  10 GLU CG   1 1 
        5  2580 1 1 10 GLU H    H   -9.218  13.511  -3.873 1.00 . A A .  10 GLU H    1 1 
        5  2581 1 1 10 GLU HA   H   -9.314  13.472  -6.819 1.00 . A A .  10 GLU HA   1 1 
        5  2582 1 1 10 GLU HB2  H   -8.055  15.550  -6.833 1.00 . A A .  10 GLU HB2  1 1 
        5  2583 1 1 10 GLU HB3  H   -9.530  15.747  -5.897 1.00 . A A .  10 GLU HB3  1 1 
        5  2584 1 1 10 GLU HG2  H   -8.090  15.265  -3.849 1.00 . A A .  10 GLU HG2  1 1 
        5  2585 1 1 10 GLU HG3  H   -6.709  15.527  -4.913 1.00 . A A .  10 GLU HG3  1 1 
        5  2586 1 1 10 GLU N    N   -9.563  13.342  -4.775 1.00 . A A .  10 GLU N    1 1 
        5  2587 1 1 10 GLU O    O   -6.414  13.601  -6.378 1.00 . A A .  10 GLU O    1 1 
        5  2588 1 1 10 GLU OE1  O   -7.996  17.990  -5.545 1.00 . A A .  10 GLU OE1  1 1 
        5  2589 1 1 10 GLU OE2  O   -7.858  17.705  -3.370 1.00 . A A .  10 GLU OE2  1 1 
        5  2590 1 1 11 LYS C    C   -5.768  10.559  -6.795 1.00 . A A .  11 LYS C    1 1 
        5  2591 1 1 11 LYS CA   C   -6.175  11.019  -5.399 1.00 . A A .  11 LYS CA   1 1 
        5  2592 1 1 11 LYS CB   C   -6.359   9.806  -4.484 1.00 . A A .  11 LYS CB   1 1 
        5  2593 1 1 11 LYS CD   C   -5.260  10.525  -2.342 1.00 . A A .  11 LYS CD   1 1 
        5  2594 1 1 11 LYS CE   C   -5.495  11.148  -0.974 1.00 . A A .  11 LYS CE   1 1 
        5  2595 1 1 11 LYS CG   C   -6.571  10.172  -3.025 1.00 . A A .  11 LYS CG   1 1 
        5  2596 1 1 11 LYS H    H   -8.234  11.414  -5.111 1.00 . A A .  11 LYS H    1 1 
        5  2597 1 1 11 LYS HA   H   -5.393  11.647  -4.998 1.00 . A A .  11 LYS HA   1 1 
        5  2598 1 1 11 LYS HB2  H   -7.216   9.243  -4.821 1.00 . A A .  11 LYS HB2  1 1 
        5  2599 1 1 11 LYS HB3  H   -5.479   9.182  -4.553 1.00 . A A .  11 LYS HB3  1 1 
        5  2600 1 1 11 LYS HD2  H   -4.674   9.626  -2.220 1.00 . A A .  11 LYS HD2  1 1 
        5  2601 1 1 11 LYS HD3  H   -4.720  11.228  -2.961 1.00 . A A .  11 LYS HD3  1 1 
        5  2602 1 1 11 LYS HE2  H   -6.122  10.488  -0.396 1.00 . A A .  11 LYS HE2  1 1 
        5  2603 1 1 11 LYS HE3  H   -4.542  11.265  -0.479 1.00 . A A .  11 LYS HE3  1 1 
        5  2604 1 1 11 LYS HG2  H   -7.234  11.022  -2.969 1.00 . A A .  11 LYS HG2  1 1 
        5  2605 1 1 11 LYS HG3  H   -7.018   9.331  -2.514 1.00 . A A .  11 LYS HG3  1 1 
        5  2606 1 1 11 LYS HZ1  H   -6.669  12.554  -1.977 1.00 . A A .  11 LYS HZ1  1 1 
        5  2607 1 1 11 LYS HZ2  H   -5.443  13.235  -1.032 1.00 . A A .  11 LYS HZ2  1 1 
        5  2608 1 1 11 LYS HZ3  H   -6.828  12.605  -0.294 1.00 . A A .  11 LYS HZ3  1 1 
        5  2609 1 1 11 LYS N    N   -7.401  11.806  -5.448 1.00 . A A .  11 LYS N    1 1 
        5  2610 1 1 11 LYS NZ   N   -6.155  12.478  -1.077 1.00 . A A .  11 LYS NZ   1 1 
        5  2611 1 1 11 LYS O    O   -6.606  10.241  -7.639 1.00 . A A .  11 LYS O    1 1 
        5  2612 1 1 12 PRO C    C   -4.093   8.607  -8.589 1.00 . A A .  12 PRO C    1 1 
        5  2613 1 1 12 PRO CA   C   -3.903  10.099  -8.339 1.00 . A A .  12 PRO CA   1 1 
        5  2614 1 1 12 PRO CB   C   -2.414  10.435  -8.220 1.00 . A A .  12 PRO CB   1 1 
        5  2615 1 1 12 PRO CD   C   -3.395  10.886  -6.087 1.00 . A A .  12 PRO CD   1 1 
        5  2616 1 1 12 PRO CG   C   -2.135  10.410  -6.757 1.00 . A A .  12 PRO CG   1 1 
        5  2617 1 1 12 PRO HA   H   -4.336  10.658  -9.155 1.00 . A A .  12 PRO HA   1 1 
        5  2618 1 1 12 PRO HB2  H   -1.832   9.693  -8.747 1.00 . A A .  12 PRO HB2  1 1 
        5  2619 1 1 12 PRO HB3  H   -2.228  11.412  -8.640 1.00 . A A .  12 PRO HB3  1 1 
        5  2620 1 1 12 PRO HD2  H   -3.536  10.378  -5.145 1.00 . A A .  12 PRO HD2  1 1 
        5  2621 1 1 12 PRO HD3  H   -3.362  11.956  -5.940 1.00 . A A .  12 PRO HD3  1 1 
        5  2622 1 1 12 PRO HG2  H   -1.903   9.403  -6.445 1.00 . A A .  12 PRO HG2  1 1 
        5  2623 1 1 12 PRO HG3  H   -1.315  11.074  -6.528 1.00 . A A .  12 PRO HG3  1 1 
        5  2624 1 1 12 PRO N    N   -4.451  10.521  -7.046 1.00 . A A .  12 PRO N    1 1 
        5  2625 1 1 12 PRO O    O   -4.555   8.200  -9.656 1.00 . A A .  12 PRO O    1 1 
        5  2626 1 1 13 TYR C    C   -4.594   5.768  -6.507 1.00 . A A .  13 TYR C    1 1 
        5  2627 1 1 13 TYR CA   C   -3.864   6.347  -7.715 1.00 . A A .  13 TYR CA   1 1 
        5  2628 1 1 13 TYR CB   C   -2.485   5.700  -7.851 1.00 . A A .  13 TYR CB   1 1 
        5  2629 1 1 13 TYR CD1  C   -1.138   7.044  -9.510 1.00 . A A .  13 TYR CD1  1 1 
        5  2630 1 1 13 TYR CD2  C   -1.982   4.924 -10.200 1.00 . A A .  13 TYR CD2  1 1 
        5  2631 1 1 13 TYR CE1  C   -0.563   7.225 -10.753 1.00 . A A .  13 TYR CE1  1 1 
        5  2632 1 1 13 TYR CE2  C   -1.408   5.095 -11.445 1.00 . A A .  13 TYR CE2  1 1 
        5  2633 1 1 13 TYR CG   C   -1.857   5.892  -9.212 1.00 . A A .  13 TYR CG   1 1 
        5  2634 1 1 13 TYR CZ   C   -0.700   6.247 -11.717 1.00 . A A .  13 TYR CZ   1 1 
        5  2635 1 1 13 TYR H    H   -3.373   8.178  -6.775 1.00 . A A .  13 TYR H    1 1 
        5  2636 1 1 13 TYR HA   H   -4.439   6.135  -8.605 1.00 . A A .  13 TYR HA   1 1 
        5  2637 1 1 13 TYR HB2  H   -1.821   6.127  -7.116 1.00 . A A .  13 TYR HB2  1 1 
        5  2638 1 1 13 TYR HB3  H   -2.575   4.638  -7.673 1.00 . A A .  13 TYR HB3  1 1 
        5  2639 1 1 13 TYR HD1  H   -1.032   7.807  -8.753 1.00 . A A .  13 TYR HD1  1 1 
        5  2640 1 1 13 TYR HD2  H   -2.537   4.023  -9.984 1.00 . A A .  13 TYR HD2  1 1 
        5  2641 1 1 13 TYR HE1  H   -0.008   8.126 -10.967 1.00 . A A .  13 TYR HE1  1 1 
        5  2642 1 1 13 TYR HE2  H   -1.516   4.331 -12.200 1.00 . A A .  13 TYR HE2  1 1 
        5  2643 1 1 13 TYR HH   H   -0.434   5.733 -13.550 1.00 . A A .  13 TYR HH   1 1 
        5  2644 1 1 13 TYR N    N   -3.735   7.795  -7.601 1.00 . A A .  13 TYR N    1 1 
        5  2645 1 1 13 TYR O    O   -4.582   6.350  -5.422 1.00 . A A .  13 TYR O    1 1 
        5  2646 1 1 13 TYR OH   O   -0.129   6.423 -12.957 1.00 . A A .  13 TYR OH   1 1 
        5  2647 1 1 14 LYS C    C   -5.921   2.441  -5.798 1.00 . A A .  14 LYS C    1 1 
        5  2648 1 1 14 LYS CA   C   -5.964   3.956  -5.632 1.00 . A A .  14 LYS CA   1 1 
        5  2649 1 1 14 LYS CB   C   -7.417   4.437  -5.609 1.00 . A A .  14 LYS CB   1 1 
        5  2650 1 1 14 LYS CD   C   -9.430   5.004  -4.218 1.00 . A A .  14 LYS CD   1 1 
        5  2651 1 1 14 LYS CE   C   -9.282   6.516  -4.141 1.00 . A A .  14 LYS CE   1 1 
        5  2652 1 1 14 LYS CG   C   -8.077   4.313  -4.247 1.00 . A A .  14 LYS CG   1 1 
        5  2653 1 1 14 LYS H    H   -5.202   4.203  -7.591 1.00 . A A .  14 LYS H    1 1 
        5  2654 1 1 14 LYS HA   H   -5.493   4.217  -4.696 1.00 . A A .  14 LYS HA   1 1 
        5  2655 1 1 14 LYS HB2  H   -7.444   5.475  -5.906 1.00 . A A .  14 LYS HB2  1 1 
        5  2656 1 1 14 LYS HB3  H   -7.987   3.853  -6.317 1.00 . A A .  14 LYS HB3  1 1 
        5  2657 1 1 14 LYS HD2  H   -9.973   4.752  -5.117 1.00 . A A .  14 LYS HD2  1 1 
        5  2658 1 1 14 LYS HD3  H   -9.982   4.660  -3.354 1.00 . A A .  14 LYS HD3  1 1 
        5  2659 1 1 14 LYS HE2  H   -8.417   6.749  -3.539 1.00 . A A .  14 LYS HE2  1 1 
        5  2660 1 1 14 LYS HE3  H   -9.140   6.902  -5.140 1.00 . A A .  14 LYS HE3  1 1 
        5  2661 1 1 14 LYS HG2  H   -8.215   3.266  -4.018 1.00 . A A .  14 LYS HG2  1 1 
        5  2662 1 1 14 LYS HG3  H   -7.436   4.765  -3.504 1.00 . A A .  14 LYS HG3  1 1 
        5  2663 1 1 14 LYS HZ1  H  -10.191   7.842  -2.808 1.00 . A A .  14 LYS HZ1  1 1 
        5  2664 1 1 14 LYS HZ2  H  -11.092   6.441  -3.102 1.00 . A A .  14 LYS HZ2  1 1 
        5  2665 1 1 14 LYS HZ3  H  -11.023   7.662  -4.270 1.00 . A A .  14 LYS HZ3  1 1 
        5  2666 1 1 14 LYS N    N   -5.229   4.618  -6.703 1.00 . A A .  14 LYS N    1 1 
        5  2667 1 1 14 LYS NZ   N  -10.481   7.161  -3.538 1.00 . A A .  14 LYS NZ   1 1 
        5  2668 1 1 14 LYS O    O   -6.057   1.923  -6.907 1.00 . A A .  14 LYS O    1 1 
        5  2669 1 1 15 CYS C    C   -7.070  -0.322  -4.855 1.00 . A A .  15 CYS C    1 1 
        5  2670 1 1 15 CYS CA   C   -5.674   0.277  -4.711 1.00 . A A .  15 CYS CA   1 1 
        5  2671 1 1 15 CYS CB   C   -5.012  -0.247  -3.434 1.00 . A A .  15 CYS CB   1 1 
        5  2672 1 1 15 CYS H    H   -5.632   2.203  -3.833 1.00 . A A .  15 CYS H    1 1 
        5  2673 1 1 15 CYS HA   H   -5.079  -0.018  -5.561 1.00 . A A .  15 CYS HA   1 1 
        5  2674 1 1 15 CYS HB2  H   -4.110   0.318  -3.248 1.00 . A A .  15 CYS HB2  1 1 
        5  2675 1 1 15 CYS HB3  H   -5.692  -0.114  -2.605 1.00 . A A .  15 CYS HB3  1 1 
        5  2676 1 1 15 CYS N    N   -5.733   1.733  -4.689 1.00 . A A .  15 CYS N    1 1 
        5  2677 1 1 15 CYS O    O   -8.039   0.196  -4.302 1.00 . A A .  15 CYS O    1 1 
        5  2678 1 1 15 CYS SG   S   -4.557  -2.009  -3.502 1.00 . A A .  15 CYS SG   1 1 
        5  2679 1 1 16 ASN C    C   -8.572  -3.313  -4.924 1.00 . A A .  16 ASN C    1 1 
        5  2680 1 1 16 ASN CA   C   -8.440  -2.087  -5.822 1.00 . A A .  16 ASN CA   1 1 
        5  2681 1 1 16 ASN CB   C   -8.580  -2.498  -7.289 1.00 . A A .  16 ASN CB   1 1 
        5  2682 1 1 16 ASN CG   C   -7.565  -3.550  -7.694 1.00 . A A .  16 ASN CG   1 1 
        5  2683 1 1 16 ASN H    H   -6.355  -1.783  -6.019 1.00 . A A .  16 ASN H    1 1 
        5  2684 1 1 16 ASN HA   H   -9.227  -1.389  -5.576 1.00 . A A .  16 ASN HA   1 1 
        5  2685 1 1 16 ASN HB2  H   -9.570  -2.899  -7.451 1.00 . A A .  16 ASN HB2  1 1 
        5  2686 1 1 16 ASN HB3  H   -8.441  -1.630  -7.915 1.00 . A A .  16 ASN HB3  1 1 
        5  2687 1 1 16 ASN HD21 H   -6.682  -2.260  -8.923 1.00 . A A .  16 ASN HD21 1 1 
        5  2688 1 1 16 ASN HD22 H   -5.984  -3.840  -8.863 1.00 . A A .  16 ASN HD22 1 1 
        5  2689 1 1 16 ASN N    N   -7.163  -1.417  -5.603 1.00 . A A .  16 ASN N    1 1 
        5  2690 1 1 16 ASN ND2  N   -6.652  -3.179  -8.583 1.00 . A A .  16 ASN ND2  1 1 
        5  2691 1 1 16 ASN O    O   -9.533  -4.073  -5.032 1.00 . A A .  16 ASN O    1 1 
        5  2692 1 1 16 ASN OD1  O   -7.603  -4.682  -7.212 1.00 . A A .  16 ASN OD1  1 1 
        5  2693 1 1 17 GLU C    C   -8.106  -4.213  -1.741 1.00 . A A .  17 GLU C    1 1 
        5  2694 1 1 17 GLU CA   C   -7.606  -4.632  -3.120 1.00 . A A .  17 GLU CA   1 1 
        5  2695 1 1 17 GLU CB   C   -6.204  -5.233  -3.006 1.00 . A A .  17 GLU CB   1 1 
        5  2696 1 1 17 GLU CD   C   -4.948  -4.564  -5.093 1.00 . A A .  17 GLU CD   1 1 
        5  2697 1 1 17 GLU CG   C   -5.627  -5.688  -4.336 1.00 . A A .  17 GLU CG   1 1 
        5  2698 1 1 17 GLU H    H   -6.858  -2.857  -3.999 1.00 . A A .  17 GLU H    1 1 
        5  2699 1 1 17 GLU HA   H   -8.276  -5.377  -3.521 1.00 . A A .  17 GLU HA   1 1 
        5  2700 1 1 17 GLU HB2  H   -5.541  -4.492  -2.584 1.00 . A A .  17 GLU HB2  1 1 
        5  2701 1 1 17 GLU HB3  H   -6.244  -6.086  -2.345 1.00 . A A .  17 GLU HB3  1 1 
        5  2702 1 1 17 GLU HG2  H   -4.901  -6.467  -4.152 1.00 . A A .  17 GLU HG2  1 1 
        5  2703 1 1 17 GLU HG3  H   -6.427  -6.081  -4.946 1.00 . A A .  17 GLU HG3  1 1 
        5  2704 1 1 17 GLU N    N   -7.599  -3.497  -4.037 1.00 . A A .  17 GLU N    1 1 
        5  2705 1 1 17 GLU O    O   -9.024  -4.820  -1.189 1.00 . A A .  17 GLU O    1 1 
        5  2706 1 1 17 GLU OE1  O   -3.745  -4.330  -4.854 1.00 . A A .  17 GLU OE1  1 1 
        5  2707 1 1 17 GLU OE2  O   -5.619  -3.917  -5.925 1.00 . A A .  17 GLU OE2  1 1 
        5  2708 1 1 18 CYS C    C   -8.547  -1.304   0.016 1.00 . A A .  18 CYS C    1 1 
        5  2709 1 1 18 CYS CA   C   -7.875  -2.669   0.127 1.00 . A A .  18 CYS CA   1 1 
        5  2710 1 1 18 CYS CB   C   -6.646  -2.572   1.034 1.00 . A A .  18 CYS CB   1 1 
        5  2711 1 1 18 CYS H    H   -6.769  -2.726  -1.677 1.00 . A A .  18 CYS H    1 1 
        5  2712 1 1 18 CYS HA   H   -8.575  -3.367   0.559 1.00 . A A .  18 CYS HA   1 1 
        5  2713 1 1 18 CYS HB2  H   -6.930  -2.101   1.964 1.00 . A A .  18 CYS HB2  1 1 
        5  2714 1 1 18 CYS HB3  H   -6.279  -3.568   1.238 1.00 . A A .  18 CYS HB3  1 1 
        5  2715 1 1 18 CYS N    N   -7.494  -3.170  -1.188 1.00 . A A .  18 CYS N    1 1 
        5  2716 1 1 18 CYS O    O   -9.579  -1.055   0.637 1.00 . A A .  18 CYS O    1 1 
        5  2717 1 1 18 CYS SG   S   -5.272  -1.609   0.324 1.00 . A A .  18 CYS SG   1 1 
        5  2718 1 1 19 GLY C    C   -7.562   1.998  -0.497 1.00 . A A .  19 GLY C    1 1 
        5  2719 1 1 19 GLY CA   C   -8.507   0.908  -0.961 1.00 . A A .  19 GLY CA   1 1 
        5  2720 1 1 19 GLY H    H   -7.131  -0.675  -1.253 1.00 . A A .  19 GLY H    1 1 
        5  2721 1 1 19 GLY HA2  H   -8.726   1.057  -2.008 1.00 . A A .  19 GLY HA2  1 1 
        5  2722 1 1 19 GLY HA3  H   -9.426   0.981  -0.398 1.00 . A A .  19 GLY HA3  1 1 
        5  2723 1 1 19 GLY N    N   -7.953  -0.421  -0.782 1.00 . A A .  19 GLY N    1 1 
        5  2724 1 1 19 GLY O    O   -7.996   3.079  -0.099 1.00 . A A .  19 GLY O    1 1 
        5  2725 1 1 20 LYS C    C   -4.855   3.586  -1.286 1.00 . A A .  20 LYS C    1 1 
        5  2726 1 1 20 LYS CA   C   -5.254   2.678  -0.127 1.00 . A A .  20 LYS CA   1 1 
        5  2727 1 1 20 LYS CB   C   -4.020   1.952   0.414 1.00 . A A .  20 LYS CB   1 1 
        5  2728 1 1 20 LYS CD   C   -3.376   3.582   2.213 1.00 . A A .  20 LYS CD   1 1 
        5  2729 1 1 20 LYS CE   C   -3.315   2.640   3.406 1.00 . A A .  20 LYS CE   1 1 
        5  2730 1 1 20 LYS CG   C   -2.943   2.887   0.933 1.00 . A A .  20 LYS CG   1 1 
        5  2731 1 1 20 LYS H    H   -5.980   0.835  -0.873 1.00 . A A .  20 LYS H    1 1 
        5  2732 1 1 20 LYS HA   H   -5.679   3.283   0.659 1.00 . A A .  20 LYS HA   1 1 
        5  2733 1 1 20 LYS HB2  H   -4.325   1.303   1.222 1.00 . A A .  20 LYS HB2  1 1 
        5  2734 1 1 20 LYS HB3  H   -3.595   1.351  -0.378 1.00 . A A .  20 LYS HB3  1 1 
        5  2735 1 1 20 LYS HD2  H   -2.722   4.421   2.397 1.00 . A A .  20 LYS HD2  1 1 
        5  2736 1 1 20 LYS HD3  H   -4.392   3.933   2.095 1.00 . A A .  20 LYS HD3  1 1 
        5  2737 1 1 20 LYS HE2  H   -3.923   1.774   3.197 1.00 . A A .  20 LYS HE2  1 1 
        5  2738 1 1 20 LYS HE3  H   -2.290   2.333   3.553 1.00 . A A .  20 LYS HE3  1 1 
        5  2739 1 1 20 LYS HG2  H   -2.048   2.316   1.132 1.00 . A A .  20 LYS HG2  1 1 
        5  2740 1 1 20 LYS HG3  H   -2.735   3.635   0.181 1.00 . A A .  20 LYS HG3  1 1 
        5  2741 1 1 20 LYS HZ1  H   -4.797   3.590   4.531 1.00 . A A .  20 LYS HZ1  1 1 
        5  2742 1 1 20 LYS HZ2  H   -3.229   4.125   4.873 1.00 . A A .  20 LYS HZ2  1 1 
        5  2743 1 1 20 LYS HZ3  H   -3.755   2.624   5.448 1.00 . A A .  20 LYS HZ3  1 1 
        5  2744 1 1 20 LYS N    N   -6.265   1.714  -0.546 1.00 . A A .  20 LYS N    1 1 
        5  2745 1 1 20 LYS NZ   N   -3.809   3.290   4.652 1.00 . A A .  20 LYS NZ   1 1 
        5  2746 1 1 20 LYS O    O   -4.352   3.120  -2.307 1.00 . A A .  20 LYS O    1 1 
        5  2747 1 1 21 ALA C    C   -3.388   6.501  -1.873 1.00 . A A .  21 ALA C    1 1 
        5  2748 1 1 21 ALA CA   C   -4.742   5.858  -2.149 1.00 . A A .  21 ALA CA   1 1 
        5  2749 1 1 21 ALA CB   C   -5.824   6.924  -2.246 1.00 . A A .  21 ALA CB   1 1 
        5  2750 1 1 21 ALA H    H   -5.486   5.196  -0.282 1.00 . A A .  21 ALA H    1 1 
        5  2751 1 1 21 ALA HA   H   -4.697   5.340  -3.096 1.00 . A A .  21 ALA HA   1 1 
        5  2752 1 1 21 ALA HB1  H   -5.625   7.564  -3.092 1.00 . A A .  21 ALA HB1  1 1 
        5  2753 1 1 21 ALA HB2  H   -6.786   6.449  -2.372 1.00 . A A .  21 ALA HB2  1 1 
        5  2754 1 1 21 ALA HB3  H   -5.830   7.514  -1.341 1.00 . A A .  21 ALA HB3  1 1 
        5  2755 1 1 21 ALA N    N   -5.082   4.885  -1.119 1.00 . A A .  21 ALA N    1 1 
        5  2756 1 1 21 ALA O    O   -3.153   7.038  -0.790 1.00 . A A .  21 ALA O    1 1 
        5  2757 1 1 22 PHE C    C   -1.053   8.324  -3.499 1.00 . A A .  22 PHE C    1 1 
        5  2758 1 1 22 PHE CA   C   -1.165   7.017  -2.720 1.00 . A A .  22 PHE CA   1 1 
        5  2759 1 1 22 PHE CB   C   -0.106   6.026  -3.208 1.00 . A A .  22 PHE CB   1 1 
        5  2760 1 1 22 PHE CD1  C   -1.125   3.761  -2.852 1.00 . A A .  22 PHE CD1  1 1 
        5  2761 1 1 22 PHE CD2  C    0.750   4.383  -1.516 1.00 . A A .  22 PHE CD2  1 1 
        5  2762 1 1 22 PHE CE1  C   -1.178   2.538  -2.211 1.00 . A A .  22 PHE CE1  1 1 
        5  2763 1 1 22 PHE CE2  C    0.702   3.161  -0.872 1.00 . A A .  22 PHE CE2  1 1 
        5  2764 1 1 22 PHE CG   C   -0.161   4.697  -2.511 1.00 . A A .  22 PHE CG   1 1 
        5  2765 1 1 22 PHE CZ   C   -0.263   2.237  -1.221 1.00 . A A .  22 PHE CZ   1 1 
        5  2766 1 1 22 PHE H    H   -2.743   6.000  -3.698 1.00 . A A .  22 PHE H    1 1 
        5  2767 1 1 22 PHE HA   H   -0.999   7.220  -1.673 1.00 . A A .  22 PHE HA   1 1 
        5  2768 1 1 22 PHE HB2  H   -0.246   5.852  -4.265 1.00 . A A .  22 PHE HB2  1 1 
        5  2769 1 1 22 PHE HB3  H    0.874   6.448  -3.044 1.00 . A A .  22 PHE HB3  1 1 
        5  2770 1 1 22 PHE HD1  H   -1.840   3.994  -3.626 1.00 . A A .  22 PHE HD1  1 1 
        5  2771 1 1 22 PHE HD2  H    1.506   5.106  -1.242 1.00 . A A .  22 PHE HD2  1 1 
        5  2772 1 1 22 PHE HE1  H   -1.934   1.817  -2.486 1.00 . A A .  22 PHE HE1  1 1 
        5  2773 1 1 22 PHE HE2  H    1.418   2.929  -0.098 1.00 . A A .  22 PHE HE2  1 1 
        5  2774 1 1 22 PHE HZ   H   -0.304   1.282  -0.719 1.00 . A A .  22 PHE HZ   1 1 
        5  2775 1 1 22 PHE N    N   -2.498   6.442  -2.858 1.00 . A A .  22 PHE N    1 1 
        5  2776 1 1 22 PHE O    O   -2.029   8.799  -4.079 1.00 . A A .  22 PHE O    1 1 
        5  2777 1 1 23 ARG C    C    1.565  10.020  -5.172 1.00 . A A .  23 ARG C    1 1 
        5  2778 1 1 23 ARG CA   C    0.385  10.153  -4.213 1.00 . A A .  23 ARG CA   1 1 
        5  2779 1 1 23 ARG CB   C    0.650  11.282  -3.215 1.00 . A A .  23 ARG CB   1 1 
        5  2780 1 1 23 ARG CD   C    0.526  13.739  -2.699 1.00 . A A .  23 ARG CD   1 1 
        5  2781 1 1 23 ARG CG   C    0.209  12.650  -3.712 1.00 . A A .  23 ARG CG   1 1 
        5  2782 1 1 23 ARG CZ   C    0.007  12.840  -0.470 1.00 . A A .  23 ARG CZ   1 1 
        5  2783 1 1 23 ARG H    H    0.885   8.473  -3.026 1.00 . A A .  23 ARG H    1 1 
        5  2784 1 1 23 ARG HA   H   -0.502  10.389  -4.782 1.00 . A A .  23 ARG HA   1 1 
        5  2785 1 1 23 ARG HB2  H    0.121  11.069  -2.298 1.00 . A A .  23 ARG HB2  1 1 
        5  2786 1 1 23 ARG HB3  H    1.709  11.323  -3.009 1.00 . A A .  23 ARG HB3  1 1 
        5  2787 1 1 23 ARG HD2  H    1.566  13.661  -2.420 1.00 . A A .  23 ARG HD2  1 1 
        5  2788 1 1 23 ARG HD3  H    0.347  14.700  -3.157 1.00 . A A .  23 ARG HD3  1 1 
        5  2789 1 1 23 ARG HE   H   -1.116  14.160  -1.456 1.00 . A A .  23 ARG HE   1 1 
        5  2790 1 1 23 ARG HG2  H    0.725  12.871  -4.635 1.00 . A A .  23 ARG HG2  1 1 
        5  2791 1 1 23 ARG HG3  H   -0.856  12.632  -3.888 1.00 . A A .  23 ARG HG3  1 1 
        5  2792 1 1 23 ARG HH11 H    1.714  12.140  -1.293 1.00 . A A .  23 ARG HH11 1 1 
        5  2793 1 1 23 ARG HH12 H    1.336  11.514   0.278 1.00 . A A .  23 ARG HH12 1 1 
        5  2794 1 1 23 ARG HH21 H   -1.624  13.344   0.612 1.00 . A A .  23 ARG HH21 1 1 
        5  2795 1 1 23 ARG HH22 H   -0.563  12.199   1.360 1.00 . A A .  23 ARG HH22 1 1 
        5  2796 1 1 23 ARG N    N    0.145   8.900  -3.507 1.00 . A A .  23 ARG N    1 1 
        5  2797 1 1 23 ARG NE   N   -0.297  13.625  -1.498 1.00 . A A .  23 ARG NE   1 1 
        5  2798 1 1 23 ARG NH1  N    1.109  12.104  -0.498 1.00 . A A .  23 ARG NH1  1 1 
        5  2799 1 1 23 ARG NH2  N   -0.792  12.790   0.588 1.00 . A A .  23 ARG NH2  1 1 
        5  2800 1 1 23 ARG O    O    2.226  11.004  -5.499 1.00 . A A .  23 ARG O    1 1 
        5  2801 1 1 24 ALA C    C    2.791   7.148  -7.168 1.00 . A A .  24 ALA C    1 1 
        5  2802 1 1 24 ALA CA   C    2.920   8.532  -6.540 1.00 . A A .  24 ALA CA   1 1 
        5  2803 1 1 24 ALA CB   C    4.255   8.666  -5.822 1.00 . A A .  24 ALA CB   1 1 
        5  2804 1 1 24 ALA H    H    1.259   8.050  -5.321 1.00 . A A .  24 ALA H    1 1 
        5  2805 1 1 24 ALA HA   H    2.884   9.276  -7.323 1.00 . A A .  24 ALA HA   1 1 
        5  2806 1 1 24 ALA HB1  H    4.471   7.751  -5.291 1.00 . A A .  24 ALA HB1  1 1 
        5  2807 1 1 24 ALA HB2  H    5.034   8.855  -6.546 1.00 . A A .  24 ALA HB2  1 1 
        5  2808 1 1 24 ALA HB3  H    4.206   9.486  -5.122 1.00 . A A .  24 ALA HB3  1 1 
        5  2809 1 1 24 ALA N    N    1.822   8.794  -5.618 1.00 . A A .  24 ALA N    1 1 
        5  2810 1 1 24 ALA O    O    2.537   6.163  -6.475 1.00 . A A .  24 ALA O    1 1 
        5  2811 1 1 25 ARG C    C    3.610   4.710  -8.463 1.00 . A A .  25 ARG C    1 1 
        5  2812 1 1 25 ARG CA   C    2.868   5.819  -9.204 1.00 . A A .  25 ARG CA   1 1 
        5  2813 1 1 25 ARG CB   C    3.433   5.968 -10.618 1.00 . A A .  25 ARG CB   1 1 
        5  2814 1 1 25 ARG CD   C    3.203   7.393 -12.676 1.00 . A A .  25 ARG CD   1 1 
        5  2815 1 1 25 ARG CG   C    2.466   6.617 -11.595 1.00 . A A .  25 ARG CG   1 1 
        5  2816 1 1 25 ARG CZ   C    2.140   6.810 -14.814 1.00 . A A .  25 ARG CZ   1 1 
        5  2817 1 1 25 ARG H    H    3.167   7.902  -8.981 1.00 . A A .  25 ARG H    1 1 
        5  2818 1 1 25 ARG HA   H    1.823   5.555  -9.270 1.00 . A A .  25 ARG HA   1 1 
        5  2819 1 1 25 ARG HB2  H    4.326   6.574 -10.574 1.00 . A A .  25 ARG HB2  1 1 
        5  2820 1 1 25 ARG HB3  H    3.690   4.990 -10.995 1.00 . A A .  25 ARG HB3  1 1 
        5  2821 1 1 25 ARG HD2  H    3.547   8.328 -12.258 1.00 . A A .  25 ARG HD2  1 1 
        5  2822 1 1 25 ARG HD3  H    4.052   6.812 -13.002 1.00 . A A .  25 ARG HD3  1 1 
        5  2823 1 1 25 ARG HE   H    1.912   8.549 -13.864 1.00 . A A .  25 ARG HE   1 1 
        5  2824 1 1 25 ARG HG2  H    1.871   5.847 -12.063 1.00 . A A .  25 ARG HG2  1 1 
        5  2825 1 1 25 ARG HG3  H    1.822   7.294 -11.054 1.00 . A A .  25 ARG HG3  1 1 
        5  2826 1 1 25 ARG HH11 H    3.314   5.367 -14.027 1.00 . A A .  25 ARG HH11 1 1 
        5  2827 1 1 25 ARG HH12 H    2.558   4.969 -15.534 1.00 . A A .  25 ARG HH12 1 1 
        5  2828 1 1 25 ARG HH21 H    0.911   8.037 -15.849 1.00 . A A .  25 ARG HH21 1 1 
        5  2829 1 1 25 ARG HH22 H    1.192   6.488 -16.570 1.00 . A A .  25 ARG HH22 1 1 
        5  2830 1 1 25 ARG N    N    2.967   7.082  -8.483 1.00 . A A .  25 ARG N    1 1 
        5  2831 1 1 25 ARG NE   N    2.349   7.674 -13.827 1.00 . A A .  25 ARG NE   1 1 
        5  2832 1 1 25 ARG NH1  N    2.719   5.618 -14.790 1.00 . A A .  25 ARG NH1  1 1 
        5  2833 1 1 25 ARG NH2  N    1.349   7.139 -15.828 1.00 . A A .  25 ARG NH2  1 1 
        5  2834 1 1 25 ARG O    O    3.106   3.595  -8.329 1.00 . A A .  25 ARG O    1 1 
        5  2835 1 1 26 SER C    C    5.049   3.795  -5.870 1.00 . A A .  26 SER C    1 1 
        5  2836 1 1 26 SER CA   C    5.622   4.055  -7.261 1.00 . A A .  26 SER CA   1 1 
        5  2837 1 1 26 SER CB   C    7.064   4.551  -7.146 1.00 . A A .  26 SER CB   1 1 
        5  2838 1 1 26 SER H    H    5.156   5.931  -8.123 1.00 . A A .  26 SER H    1 1 
        5  2839 1 1 26 SER HA   H    5.611   3.131  -7.820 1.00 . A A .  26 SER HA   1 1 
        5  2840 1 1 26 SER HB2  H    7.645   3.837  -6.582 1.00 . A A .  26 SER HB2  1 1 
        5  2841 1 1 26 SER HB3  H    7.486   4.656  -8.135 1.00 . A A .  26 SER HB3  1 1 
        5  2842 1 1 26 SER HG   H    6.935   5.687  -5.555 1.00 . A A .  26 SER HG   1 1 
        5  2843 1 1 26 SER N    N    4.809   5.025  -7.984 1.00 . A A .  26 SER N    1 1 
        5  2844 1 1 26 SER O    O    5.059   2.665  -5.384 1.00 . A A .  26 SER O    1 1 
        5  2845 1 1 26 SER OG   O    7.121   5.806  -6.489 1.00 . A A .  26 SER OG   1 1 
        5  2846 1 1 27 SER C    C    2.895   3.666  -3.862 1.00 . A A .  27 SER C    1 1 
        5  2847 1 1 27 SER CA   C    3.977   4.741  -3.900 1.00 . A A .  27 SER CA   1 1 
        5  2848 1 1 27 SER CB   C    3.393   6.084  -3.460 1.00 . A A .  27 SER CB   1 1 
        5  2849 1 1 27 SER H    H    4.572   5.727  -5.677 1.00 . A A .  27 SER H    1 1 
        5  2850 1 1 27 SER HA   H    4.769   4.462  -3.221 1.00 . A A .  27 SER HA   1 1 
        5  2851 1 1 27 SER HB2  H    2.779   6.485  -4.252 1.00 . A A .  27 SER HB2  1 1 
        5  2852 1 1 27 SER HB3  H    2.789   5.939  -2.575 1.00 . A A .  27 SER HB3  1 1 
        5  2853 1 1 27 SER HG   H    5.033   6.625  -2.535 1.00 . A A .  27 SER HG   1 1 
        5  2854 1 1 27 SER N    N    4.551   4.852  -5.236 1.00 . A A .  27 SER N    1 1 
        5  2855 1 1 27 SER O    O    2.742   2.957  -2.866 1.00 . A A .  27 SER O    1 1 
        5  2856 1 1 27 SER OG   O    4.420   7.014  -3.164 1.00 . A A .  27 SER OG   1 1 
        5  2857 1 1 28 LEU C    C    1.639   1.179  -5.357 1.00 . A A .  28 LEU C    1 1 
        5  2858 1 1 28 LEU CA   C    1.076   2.562  -5.045 1.00 . A A .  28 LEU CA   1 1 
        5  2859 1 1 28 LEU CB   C    0.070   2.970  -6.122 1.00 . A A .  28 LEU CB   1 1 
        5  2860 1 1 28 LEU CD1  C   -2.046   1.728  -5.609 1.00 . A A .  28 LEU CD1  1 1 
        5  2861 1 1 28 LEU CD2  C   -1.415   2.188  -7.985 1.00 . A A .  28 LEU CD2  1 1 
        5  2862 1 1 28 LEU CG   C   -0.893   1.878  -6.589 1.00 . A A .  28 LEU CG   1 1 
        5  2863 1 1 28 LEU H    H    2.314   4.143  -5.714 1.00 . A A .  28 LEU H    1 1 
        5  2864 1 1 28 LEU HA   H    0.574   2.526  -4.090 1.00 . A A .  28 LEU HA   1 1 
        5  2865 1 1 28 LEU HB2  H   -0.520   3.785  -5.732 1.00 . A A .  28 LEU HB2  1 1 
        5  2866 1 1 28 LEU HB3  H    0.628   3.311  -6.983 1.00 . A A .  28 LEU HB3  1 1 
        5  2867 1 1 28 LEU HD11 H   -2.316   0.686  -5.528 1.00 . A A .  28 LEU HD11 1 1 
        5  2868 1 1 28 LEU HD12 H   -2.895   2.294  -5.962 1.00 . A A .  28 LEU HD12 1 1 
        5  2869 1 1 28 LEU HD13 H   -1.745   2.098  -4.640 1.00 . A A .  28 LEU HD13 1 1 
        5  2870 1 1 28 LEU HD21 H   -2.412   2.595  -7.914 1.00 . A A .  28 LEU HD21 1 1 
        5  2871 1 1 28 LEU HD22 H   -1.437   1.280  -8.570 1.00 . A A .  28 LEU HD22 1 1 
        5  2872 1 1 28 LEU HD23 H   -0.764   2.907  -8.461 1.00 . A A .  28 LEU HD23 1 1 
        5  2873 1 1 28 LEU HG   H   -0.366   0.935  -6.630 1.00 . A A .  28 LEU HG   1 1 
        5  2874 1 1 28 LEU N    N    2.145   3.550  -4.952 1.00 . A A .  28 LEU N    1 1 
        5  2875 1 1 28 LEU O    O    1.254   0.188  -4.737 1.00 . A A .  28 LEU O    1 1 
        5  2876 1 1 29 ALA C    C    3.809  -0.834  -5.511 1.00 . A A .  29 ALA C    1 1 
        5  2877 1 1 29 ALA CA   C    3.172  -0.140  -6.710 1.00 . A A .  29 ALA CA   1 1 
        5  2878 1 1 29 ALA CB   C    4.209   0.096  -7.798 1.00 . A A .  29 ALA CB   1 1 
        5  2879 1 1 29 ALA H    H    2.819   1.945  -6.777 1.00 . A A .  29 ALA H    1 1 
        5  2880 1 1 29 ALA HA   H    2.401  -0.779  -7.115 1.00 . A A .  29 ALA HA   1 1 
        5  2881 1 1 29 ALA HB1  H    3.921  -0.437  -8.691 1.00 . A A .  29 ALA HB1  1 1 
        5  2882 1 1 29 ALA HB2  H    4.270   1.153  -8.013 1.00 . A A .  29 ALA HB2  1 1 
        5  2883 1 1 29 ALA HB3  H    5.172  -0.259  -7.460 1.00 . A A .  29 ALA HB3  1 1 
        5  2884 1 1 29 ALA N    N    2.553   1.121  -6.319 1.00 . A A .  29 ALA N    1 1 
        5  2885 1 1 29 ALA O    O    3.430  -1.949  -5.153 1.00 . A A .  29 ALA O    1 1 
        5  2886 1 1 30 ILE C    C    4.499  -1.466  -2.823 1.00 . A A .  30 ILE C    1 1 
        5  2887 1 1 30 ILE CA   C    5.467  -0.720  -3.734 1.00 . A A .  30 ILE CA   1 1 
        5  2888 1 1 30 ILE CB   C    6.174   0.381  -2.921 1.00 . A A .  30 ILE CB   1 1 
        5  2889 1 1 30 ILE CD1  C    7.396   2.562  -3.398 1.00 . A A .  30 ILE CD1  1 1 
        5  2890 1 1 30 ILE CG1  C    7.192   1.117  -3.795 1.00 . A A .  30 ILE CG1  1 1 
        5  2891 1 1 30 ILE CG2  C    6.852  -0.217  -1.697 1.00 . A A .  30 ILE CG2  1 1 
        5  2892 1 1 30 ILE H    H    5.036   0.718  -5.225 1.00 . A A .  30 ILE H    1 1 
        5  2893 1 1 30 ILE HA   H    6.216  -1.413  -4.091 1.00 . A A .  30 ILE HA   1 1 
        5  2894 1 1 30 ILE HB   H    5.427   1.082  -2.582 1.00 . A A .  30 ILE HB   1 1 
        5  2895 1 1 30 ILE HD11 H    8.212   2.630  -2.692 1.00 . A A .  30 ILE HD11 1 1 
        5  2896 1 1 30 ILE HD12 H    7.632   3.147  -4.275 1.00 . A A .  30 ILE HD12 1 1 
        5  2897 1 1 30 ILE HD13 H    6.494   2.942  -2.942 1.00 . A A .  30 ILE HD13 1 1 
        5  2898 1 1 30 ILE HG12 H    8.145   0.617  -3.725 1.00 . A A .  30 ILE HG12 1 1 
        5  2899 1 1 30 ILE HG13 H    6.855   1.098  -4.821 1.00 . A A .  30 ILE HG13 1 1 
        5  2900 1 1 30 ILE HG21 H    6.417  -1.182  -1.480 1.00 . A A .  30 ILE HG21 1 1 
        5  2901 1 1 30 ILE HG22 H    7.907  -0.335  -1.893 1.00 . A A .  30 ILE HG22 1 1 
        5  2902 1 1 30 ILE HG23 H    6.713   0.439  -0.852 1.00 . A A .  30 ILE HG23 1 1 
        5  2903 1 1 30 ILE N    N    4.779  -0.167  -4.894 1.00 . A A .  30 ILE N    1 1 
        5  2904 1 1 30 ILE O    O    4.839  -2.504  -2.255 1.00 . A A .  30 ILE O    1 1 
        5  2905 1 1 31 HIS C    C    1.681  -2.783  -2.528 1.00 . A A .  31 HIS C    1 1 
        5  2906 1 1 31 HIS CA   C    2.268  -1.549  -1.851 1.00 . A A .  31 HIS CA   1 1 
        5  2907 1 1 31 HIS CB   C    1.157  -0.545  -1.542 1.00 . A A .  31 HIS CB   1 1 
        5  2908 1 1 31 HIS CD2  C   -1.334  -1.204  -1.835 1.00 . A A .  31 HIS CD2  1 1 
        5  2909 1 1 31 HIS CE1  C   -1.580  -2.359   0.012 1.00 . A A .  31 HIS CE1  1 1 
        5  2910 1 1 31 HIS CG   C   -0.148  -1.188  -1.184 1.00 . A A .  31 HIS CG   1 1 
        5  2911 1 1 31 HIS H    H    3.077  -0.103  -3.169 1.00 . A A .  31 HIS H    1 1 
        5  2912 1 1 31 HIS HA   H    2.737  -1.849  -0.926 1.00 . A A .  31 HIS HA   1 1 
        5  2913 1 1 31 HIS HB2  H    1.461   0.073  -0.710 1.00 . A A .  31 HIS HB2  1 1 
        5  2914 1 1 31 HIS HB3  H    0.994   0.080  -2.408 1.00 . A A .  31 HIS HB3  1 1 
        5  2915 1 1 31 HIS HD1  H    0.343  -2.091   0.655 1.00 . A A .  31 HIS HD1  1 1 
        5  2916 1 1 31 HIS HD2  H   -1.554  -0.728  -2.781 1.00 . A A .  31 HIS HD2  1 1 
        5  2917 1 1 31 HIS HE1  H   -2.012  -2.959   0.799 1.00 . A A .  31 HIS HE1  1 1 
        5  2918 1 1 31 HIS N    N    3.289  -0.932  -2.691 1.00 . A A .  31 HIS N    1 1 
        5  2919 1 1 31 HIS ND1  N   -0.335  -1.919  -0.030 1.00 . A A .  31 HIS ND1  1 1 
        5  2920 1 1 31 HIS NE2  N   -2.208  -1.938  -1.071 1.00 . A A .  31 HIS NE2  1 1 
        5  2921 1 1 31 HIS O    O    1.530  -3.832  -1.902 1.00 . A A .  31 HIS O    1 1 
        5  2922 1 1 32 GLN C    C    1.608  -5.023  -4.393 1.00 . A A .  32 GLN C    1 1 
        5  2923 1 1 32 GLN CA   C    0.779  -3.755  -4.568 1.00 . A A .  32 GLN CA   1 1 
        5  2924 1 1 32 GLN CB   C    0.692  -3.390  -6.051 1.00 . A A .  32 GLN CB   1 1 
        5  2925 1 1 32 GLN CD   C   -0.844  -2.292  -7.731 1.00 . A A .  32 GLN CD   1 1 
        5  2926 1 1 32 GLN CG   C   -0.248  -2.230  -6.338 1.00 . A A .  32 GLN CG   1 1 
        5  2927 1 1 32 GLN H    H    1.496  -1.789  -4.252 1.00 . A A .  32 GLN H    1 1 
        5  2928 1 1 32 GLN HA   H   -0.216  -3.935  -4.192 1.00 . A A .  32 GLN HA   1 1 
        5  2929 1 1 32 GLN HB2  H    1.677  -3.123  -6.403 1.00 . A A .  32 GLN HB2  1 1 
        5  2930 1 1 32 GLN HB3  H    0.343  -4.251  -6.602 1.00 . A A .  32 GLN HB3  1 1 
        5  2931 1 1 32 GLN HE21 H   -1.902  -0.646  -7.377 1.00 . A A .  32 GLN HE21 1 1 
        5  2932 1 1 32 GLN HE22 H   -2.104  -1.348  -8.943 1.00 . A A .  32 GLN HE22 1 1 
        5  2933 1 1 32 GLN HG2  H   -1.052  -2.248  -5.618 1.00 . A A .  32 GLN HG2  1 1 
        5  2934 1 1 32 GLN HG3  H    0.302  -1.306  -6.238 1.00 . A A .  32 GLN HG3  1 1 
        5  2935 1 1 32 GLN N    N    1.351  -2.650  -3.808 1.00 . A A .  32 GLN N    1 1 
        5  2936 1 1 32 GLN NE2  N   -1.704  -1.332  -8.050 1.00 . A A .  32 GLN NE2  1 1 
        5  2937 1 1 32 GLN O    O    1.129  -6.129  -4.643 1.00 . A A .  32 GLN O    1 1 
        5  2938 1 1 32 GLN OE1  O   -0.534  -3.193  -8.511 1.00 . A A .  32 GLN OE1  1 1 
        5  2939 1 1 33 ALA C    C    3.432  -6.700  -2.441 1.00 . A A .  33 ALA C    1 1 
        5  2940 1 1 33 ALA CA   C    3.749  -5.986  -3.751 1.00 . A A .  33 ALA CA   1 1 
        5  2941 1 1 33 ALA CB   C    5.198  -5.523  -3.765 1.00 . A A .  33 ALA CB   1 1 
        5  2942 1 1 33 ALA H    H    3.178  -3.949  -3.780 1.00 . A A .  33 ALA H    1 1 
        5  2943 1 1 33 ALA HA   H    3.610  -6.679  -4.569 1.00 . A A .  33 ALA HA   1 1 
        5  2944 1 1 33 ALA HB1  H    5.461  -5.135  -2.793 1.00 . A A .  33 ALA HB1  1 1 
        5  2945 1 1 33 ALA HB2  H    5.839  -6.358  -4.006 1.00 . A A .  33 ALA HB2  1 1 
        5  2946 1 1 33 ALA HB3  H    5.321  -4.749  -4.508 1.00 . A A .  33 ALA HB3  1 1 
        5  2947 1 1 33 ALA N    N    2.854  -4.855  -3.962 1.00 . A A .  33 ALA N    1 1 
        5  2948 1 1 33 ALA O    O    4.175  -7.580  -2.006 1.00 . A A .  33 ALA O    1 1 
        5  2949 1 1 34 THR C    C    0.666  -7.776  -0.737 1.00 . A A .  34 THR C    1 1 
        5  2950 1 1 34 THR CA   C    1.911  -6.916  -0.553 1.00 . A A .  34 THR CA   1 1 
        5  2951 1 1 34 THR CB   C    1.627  -5.842   0.514 1.00 . A A .  34 THR CB   1 1 
        5  2952 1 1 34 THR CG2  C    0.322  -5.119   0.220 1.00 . A A .  34 THR CG2  1 1 
        5  2953 1 1 34 THR H    H    1.774  -5.608  -2.212 1.00 . A A .  34 THR H    1 1 
        5  2954 1 1 34 THR HA   H    2.720  -7.540  -0.201 1.00 . A A .  34 THR HA   1 1 
        5  2955 1 1 34 THR HB   H    2.432  -5.122   0.502 1.00 . A A .  34 THR HB   1 1 
        5  2956 1 1 34 THR HG1  H    2.369  -6.940   1.975 1.00 . A A .  34 THR HG1  1 1 
        5  2957 1 1 34 THR HG21 H    0.520  -4.068   0.068 1.00 . A A .  34 THR HG21 1 1 
        5  2958 1 1 34 THR HG22 H   -0.353  -5.240   1.054 1.00 . A A .  34 THR HG22 1 1 
        5  2959 1 1 34 THR HG23 H   -0.127  -5.533  -0.670 1.00 . A A .  34 THR HG23 1 1 
        5  2960 1 1 34 THR N    N    2.325  -6.314  -1.815 1.00 . A A .  34 THR N    1 1 
        5  2961 1 1 34 THR O    O    0.378  -8.651   0.081 1.00 . A A .  34 THR O    1 1 
        5  2962 1 1 34 THR OG1  O    1.562  -6.447   1.811 1.00 . A A .  34 THR OG1  1 1 
        5  2963 1 1 35 HIS C    C   -0.963  -9.537  -2.904 1.00 . A A .  35 HIS C    1 1 
        5  2964 1 1 35 HIS CA   C   -1.284  -8.277  -2.106 1.00 . A A .  35 HIS CA   1 1 
        5  2965 1 1 35 HIS CB   C   -2.275  -7.407  -2.880 1.00 . A A .  35 HIS CB   1 1 
        5  2966 1 1 35 HIS CD2  C   -2.804  -5.041  -1.958 1.00 . A A .  35 HIS CD2  1 1 
        5  2967 1 1 35 HIS CE1  C   -4.365  -5.598  -0.523 1.00 . A A .  35 HIS CE1  1 1 
        5  2968 1 1 35 HIS CG   C   -2.964  -6.384  -2.031 1.00 . A A .  35 HIS CG   1 1 
        5  2969 1 1 35 HIS H    H    0.212  -6.814  -2.429 1.00 . A A .  35 HIS H    1 1 
        5  2970 1 1 35 HIS HA   H   -1.728  -8.565  -1.165 1.00 . A A .  35 HIS HA   1 1 
        5  2971 1 1 35 HIS HB2  H   -1.749  -6.886  -3.666 1.00 . A A .  35 HIS HB2  1 1 
        5  2972 1 1 35 HIS HB3  H   -3.033  -8.040  -3.318 1.00 . A A .  35 HIS HB3  1 1 
        5  2973 1 1 35 HIS HD1  H   -4.291  -7.600  -0.937 1.00 . A A .  35 HIS HD1  1 1 
        5  2974 1 1 35 HIS HD2  H   -2.111  -4.445  -2.535 1.00 . A A .  35 HIS HD2  1 1 
        5  2975 1 1 35 HIS HE1  H   -5.130  -5.540   0.237 1.00 . A A .  35 HIS HE1  1 1 
        5  2976 1 1 35 HIS N    N   -0.069  -7.523  -1.815 1.00 . A A .  35 HIS N    1 1 
        5  2977 1 1 35 HIS ND1  N   -3.948  -6.701  -1.119 1.00 . A A .  35 HIS ND1  1 1 
        5  2978 1 1 35 HIS NE2  N   -3.686  -4.577  -1.014 1.00 . A A .  35 HIS NE2  1 1 
        5  2979 1 1 35 HIS O    O   -1.432 -10.627  -2.576 1.00 . A A .  35 HIS O    1 1 
        5  2980 1 1 36 SER C    C    0.649 -11.699  -3.956 1.00 . A A .  36 SER C    1 1 
        5  2981 1 1 36 SER CA   C    0.217 -10.504  -4.800 1.00 . A A .  36 SER CA   1 1 
        5  2982 1 1 36 SER CB   C    1.348 -10.098  -5.747 1.00 . A A .  36 SER CB   1 1 
        5  2983 1 1 36 SER H    H    0.179  -8.485  -4.163 1.00 . A A .  36 SER H    1 1 
        5  2984 1 1 36 SER HA   H   -0.646 -10.785  -5.385 1.00 . A A .  36 SER HA   1 1 
        5  2985 1 1 36 SER HB2  H    1.989  -9.383  -5.253 1.00 . A A .  36 SER HB2  1 1 
        5  2986 1 1 36 SER HB3  H    1.924 -10.973  -6.012 1.00 . A A .  36 SER HB3  1 1 
        5  2987 1 1 36 SER HG   H    1.380  -8.758  -7.176 1.00 . A A .  36 SER HG   1 1 
        5  2988 1 1 36 SER N    N   -0.162  -9.380  -3.953 1.00 . A A .  36 SER N    1 1 
        5  2989 1 1 36 SER O    O    1.193 -11.538  -2.864 1.00 . A A .  36 SER O    1 1 
        5  2990 1 1 36 SER OG   O    0.837  -9.511  -6.931 1.00 . A A .  36 SER OG   1 1 
        5  2991 1 1 37 GLY C    C   -0.077 -15.298  -4.146 1.00 . A A .  37 GLY C    1 1 
        5  2992 1 1 37 GLY CA   C    0.773 -14.105  -3.753 1.00 . A A .  37 GLY CA   1 1 
        5  2993 1 1 37 GLY H    H   -0.033 -12.968  -5.347 1.00 . A A .  37 GLY H    1 1 
        5  2994 1 1 37 GLY HA2  H    1.808 -14.331  -3.958 1.00 . A A .  37 GLY HA2  1 1 
        5  2995 1 1 37 GLY HA3  H    0.656 -13.929  -2.694 1.00 . A A .  37 GLY HA3  1 1 
        5  2996 1 1 37 GLY N    N    0.403 -12.900  -4.472 1.00 . A A .  37 GLY N    1 1 
        5  2997 1 1 37 GLY O    O   -0.723 -15.914  -3.299 1.00 . A A .  37 GLY O    1 1 
        5  2998 1 1 38 GLU C    C   -2.343 -16.552  -5.653 1.00 . A A .  38 GLU C    1 1 
        5  2999 1 1 38 GLU CA   C   -0.856 -16.749  -5.938 1.00 . A A .  38 GLU CA   1 1 
        5  3000 1 1 38 GLU CB   C   -0.373 -18.055  -5.305 1.00 . A A .  38 GLU CB   1 1 
        5  3001 1 1 38 GLU CD   C    0.996 -20.155  -5.621 1.00 . A A .  38 GLU CD   1 1 
        5  3002 1 1 38 GLU CG   C    0.740 -18.734  -6.085 1.00 . A A .  38 GLU CG   1 1 
        5  3003 1 1 38 GLU H    H    0.458 -15.094  -6.062 1.00 . A A .  38 GLU H    1 1 
        5  3004 1 1 38 GLU HA   H   -0.711 -16.802  -7.006 1.00 . A A .  38 GLU HA   1 1 
        5  3005 1 1 38 GLU HB2  H   -0.012 -17.847  -4.309 1.00 . A A .  38 GLU HB2  1 1 
        5  3006 1 1 38 GLU HB3  H   -1.207 -18.739  -5.240 1.00 . A A .  38 GLU HB3  1 1 
        5  3007 1 1 38 GLU HG2  H    0.468 -18.757  -7.130 1.00 . A A .  38 GLU HG2  1 1 
        5  3008 1 1 38 GLU HG3  H    1.648 -18.162  -5.964 1.00 . A A .  38 GLU HG3  1 1 
        5  3009 1 1 38 GLU N    N   -0.077 -15.623  -5.435 1.00 . A A .  38 GLU N    1 1 
        5  3010 1 1 38 GLU O    O   -3.039 -17.485  -5.252 1.00 . A A .  38 GLU O    1 1 
        5  3011 1 1 38 GLU OE1  O    0.058 -20.977  -5.682 1.00 . A A .  38 GLU OE1  1 1 
        5  3012 1 1 38 GLU OE2  O    2.133 -20.444  -5.195 1.00 . A A .  38 GLU OE2  1 1 
        5  3013 1 1 39 LYS C    C   -4.938 -14.700  -6.943 1.00 . A A .  39 LYS C    1 1 
        5  3014 1 1 39 LYS CA   C   -4.226 -15.009  -5.630 1.00 . A A .  39 LYS CA   1 1 
        5  3015 1 1 39 LYS CB   C   -4.346 -13.817  -4.679 1.00 . A A .  39 LYS CB   1 1 
        5  3016 1 1 39 LYS CD   C   -4.275 -12.980  -2.312 1.00 . A A .  39 LYS CD   1 1 
        5  3017 1 1 39 LYS CE   C   -5.765 -12.836  -2.045 1.00 . A A .  39 LYS CE   1 1 
        5  3018 1 1 39 LYS CG   C   -3.985 -14.146  -3.241 1.00 . A A .  39 LYS CG   1 1 
        5  3019 1 1 39 LYS H    H   -2.218 -14.628  -6.183 1.00 . A A .  39 LYS H    1 1 
        5  3020 1 1 39 LYS HA   H   -4.692 -15.870  -5.176 1.00 . A A .  39 LYS HA   1 1 
        5  3021 1 1 39 LYS HB2  H   -3.689 -13.030  -5.022 1.00 . A A .  39 LYS HB2  1 1 
        5  3022 1 1 39 LYS HB3  H   -5.365 -13.457  -4.699 1.00 . A A .  39 LYS HB3  1 1 
        5  3023 1 1 39 LYS HD2  H   -3.767 -13.144  -1.373 1.00 . A A .  39 LYS HD2  1 1 
        5  3024 1 1 39 LYS HD3  H   -3.910 -12.070  -2.766 1.00 . A A .  39 LYS HD3  1 1 
        5  3025 1 1 39 LYS HE2  H   -5.935 -11.911  -1.515 1.00 . A A .  39 LYS HE2  1 1 
        5  3026 1 1 39 LYS HE3  H   -6.286 -12.809  -2.992 1.00 . A A .  39 LYS HE3  1 1 
        5  3027 1 1 39 LYS HG2  H   -4.564 -15.000  -2.921 1.00 . A A .  39 LYS HG2  1 1 
        5  3028 1 1 39 LYS HG3  H   -2.932 -14.383  -3.189 1.00 . A A .  39 LYS HG3  1 1 
        5  3029 1 1 39 LYS HZ1  H   -5.863 -14.860  -1.540 1.00 . A A .  39 LYS HZ1  1 1 
        5  3030 1 1 39 LYS HZ2  H   -7.327 -14.034  -1.346 1.00 . A A .  39 LYS HZ2  1 1 
        5  3031 1 1 39 LYS HZ3  H   -6.077 -13.815  -0.227 1.00 . A A .  39 LYS HZ3  1 1 
        5  3032 1 1 39 LYS N    N   -2.823 -15.331  -5.863 1.00 . A A .  39 LYS N    1 1 
        5  3033 1 1 39 LYS NZ   N   -6.295 -13.966  -1.232 1.00 . A A .  39 LYS NZ   1 1 
        5  3034 1 1 39 LYS O    O   -5.135 -13.542  -7.312 1.00 . A A .  39 LYS O    1 1 
        5  3035 1 1 40 PRO C    C   -7.449 -15.082  -8.782 1.00 . A A .  40 PRO C    1 1 
        5  3036 1 1 40 PRO CA   C   -6.034 -15.624  -8.947 1.00 . A A .  40 PRO CA   1 1 
        5  3037 1 1 40 PRO CB   C   -6.069 -17.058  -9.483 1.00 . A A .  40 PRO CB   1 1 
        5  3038 1 1 40 PRO CD   C   -5.133 -17.167  -7.286 1.00 . A A .  40 PRO CD   1 1 
        5  3039 1 1 40 PRO CG   C   -5.988 -17.918  -8.270 1.00 . A A .  40 PRO CG   1 1 
        5  3040 1 1 40 PRO HA   H   -5.486 -14.995  -9.634 1.00 . A A .  40 PRO HA   1 1 
        5  3041 1 1 40 PRO HB2  H   -6.992 -17.220 -10.022 1.00 . A A .  40 PRO HB2  1 1 
        5  3042 1 1 40 PRO HB3  H   -5.229 -17.221 -10.140 1.00 . A A .  40 PRO HB3  1 1 
        5  3043 1 1 40 PRO HD2  H   -5.473 -17.347  -6.277 1.00 . A A .  40 PRO HD2  1 1 
        5  3044 1 1 40 PRO HD3  H   -4.097 -17.449  -7.394 1.00 . A A .  40 PRO HD3  1 1 
        5  3045 1 1 40 PRO HG2  H   -6.975 -18.076  -7.864 1.00 . A A .  40 PRO HG2  1 1 
        5  3046 1 1 40 PRO HG3  H   -5.528 -18.862  -8.520 1.00 . A A .  40 PRO HG3  1 1 
        5  3047 1 1 40 PRO N    N   -5.335 -15.758  -7.666 1.00 . A A .  40 PRO N    1 1 
        5  3048 1 1 40 PRO O    O   -8.192 -14.952  -9.755 1.00 . A A .  40 PRO O    1 1 
        5  3049 1 1 41 SER C    C   -9.233 -12.759  -7.608 1.00 . A A .  41 SER C    1 1 
        5  3050 1 1 41 SER CA   C   -9.144 -14.240  -7.252 1.00 . A A .  41 SER CA   1 1 
        5  3051 1 1 41 SER CB   C   -9.481 -14.441  -5.773 1.00 . A A .  41 SER CB   1 1 
        5  3052 1 1 41 SER H    H   -7.179 -14.891  -6.810 1.00 . A A .  41 SER H    1 1 
        5  3053 1 1 41 SER HA   H   -9.857 -14.786  -7.852 1.00 . A A .  41 SER HA   1 1 
        5  3054 1 1 41 SER HB2  H  -10.506 -14.151  -5.597 1.00 . A A .  41 SER HB2  1 1 
        5  3055 1 1 41 SER HB3  H   -9.353 -15.483  -5.516 1.00 . A A .  41 SER HB3  1 1 
        5  3056 1 1 41 SER HG   H   -8.321 -12.899  -5.440 1.00 . A A .  41 SER HG   1 1 
        5  3057 1 1 41 SER N    N   -7.816 -14.765  -7.545 1.00 . A A .  41 SER N    1 1 
        5  3058 1 1 41 SER O    O   -9.630 -11.934  -6.786 1.00 . A A .  41 SER O    1 1 
        5  3059 1 1 41 SER OG   O   -8.637 -13.659  -4.947 1.00 . A A .  41 SER OG   1 1 
        5  3060 1 1 42 GLY C    C   -7.633 -10.628  -9.997 1.00 . A A .  42 GLY C    1 1 
        5  3061 1 1 42 GLY CA   C   -8.904 -11.049  -9.286 1.00 . A A .  42 GLY CA   1 1 
        5  3062 1 1 42 GLY H    H   -8.552 -13.130  -9.454 1.00 . A A .  42 GLY H    1 1 
        5  3063 1 1 42 GLY HA2  H   -9.739 -10.926  -9.960 1.00 . A A .  42 GLY HA2  1 1 
        5  3064 1 1 42 GLY HA3  H   -9.051 -10.411  -8.427 1.00 . A A .  42 GLY HA3  1 1 
        5  3065 1 1 42 GLY N    N   -8.860 -12.430  -8.841 1.00 . A A .  42 GLY N    1 1 
        5  3066 1 1 42 GLY O    O   -6.859  -9.810  -9.498 1.00 . A A .  42 GLY O    1 1 
        5  3067 1 1 43 PRO C    C   -6.250  -9.475 -12.564 1.00 . A A .  43 PRO C    1 1 
        5  3068 1 1 43 PRO CA   C   -6.216 -10.889 -11.995 1.00 . A A .  43 PRO CA   1 1 
        5  3069 1 1 43 PRO CB   C   -6.278 -11.921 -13.124 1.00 . A A .  43 PRO CB   1 1 
        5  3070 1 1 43 PRO CD   C   -8.281 -12.177 -11.846 1.00 . A A .  43 PRO CD   1 1 
        5  3071 1 1 43 PRO CG   C   -7.721 -12.271 -13.238 1.00 . A A .  43 PRO CG   1 1 
        5  3072 1 1 43 PRO HA   H   -5.306 -11.026 -11.429 1.00 . A A .  43 PRO HA   1 1 
        5  3073 1 1 43 PRO HB2  H   -5.904 -11.481 -14.038 1.00 . A A .  43 PRO HB2  1 1 
        5  3074 1 1 43 PRO HB3  H   -5.682 -12.782 -12.862 1.00 . A A .  43 PRO HB3  1 1 
        5  3075 1 1 43 PRO HD2  H   -9.302 -11.824 -11.872 1.00 . A A .  43 PRO HD2  1 1 
        5  3076 1 1 43 PRO HD3  H   -8.225 -13.135 -11.350 1.00 . A A .  43 PRO HD3  1 1 
        5  3077 1 1 43 PRO HG2  H   -8.219 -11.571 -13.891 1.00 . A A .  43 PRO HG2  1 1 
        5  3078 1 1 43 PRO HG3  H   -7.826 -13.278 -13.616 1.00 . A A .  43 PRO HG3  1 1 
        5  3079 1 1 43 PRO N    N   -7.402 -11.195 -11.190 1.00 . A A .  43 PRO N    1 1 
        5  3080 1 1 43 PRO O    O   -5.344  -9.066 -13.291 1.00 . A A .  43 PRO O    1 1 
        5  3081 1 1 44 SER C    C   -6.097  -6.674 -12.826 1.00 . A A .  44 SER C    1 1 
        5  3082 1 1 44 SER CA   C   -7.453  -7.363 -12.708 1.00 . A A .  44 SER CA   1 1 
        5  3083 1 1 44 SER CB   C   -8.362  -6.569 -11.768 1.00 . A A .  44 SER CB   1 1 
        5  3084 1 1 44 SER H    H   -7.989  -9.114 -11.645 1.00 . A A .  44 SER H    1 1 
        5  3085 1 1 44 SER HA   H   -7.909  -7.404 -13.686 1.00 . A A .  44 SER HA   1 1 
        5  3086 1 1 44 SER HB2  H   -7.938  -6.572 -10.775 1.00 . A A .  44 SER HB2  1 1 
        5  3087 1 1 44 SER HB3  H   -8.441  -5.552 -12.123 1.00 . A A .  44 SER HB3  1 1 
        5  3088 1 1 44 SER HG   H   -9.588  -8.089 -11.615 1.00 . A A .  44 SER HG   1 1 
        5  3089 1 1 44 SER N    N   -7.300  -8.732 -12.228 1.00 . A A .  44 SER N    1 1 
        5  3090 1 1 44 SER O    O   -5.608  -6.427 -13.928 1.00 . A A .  44 SER O    1 1 
        5  3091 1 1 44 SER OG   O   -9.659  -7.136 -11.713 1.00 . A A .  44 SER OG   1 1 
        5  3092 1 1 45 SER C    C   -3.076  -6.708 -11.417 1.00 . A A .  45 SER C    1 1 
        5  3093 1 1 45 SER CA   C   -4.197  -5.701 -11.655 1.00 . A A .  45 SER CA   1 1 
        5  3094 1 1 45 SER CB   C   -4.173  -4.627 -10.566 1.00 . A A .  45 SER CB   1 1 
        5  3095 1 1 45 SER H    H   -5.936  -6.589 -10.835 1.00 . A A .  45 SER H    1 1 
        5  3096 1 1 45 SER HA   H   -4.046  -5.232 -12.615 1.00 . A A .  45 SER HA   1 1 
        5  3097 1 1 45 SER HB2  H   -4.674  -5.000  -9.685 1.00 . A A .  45 SER HB2  1 1 
        5  3098 1 1 45 SER HB3  H   -3.148  -4.388 -10.323 1.00 . A A .  45 SER HB3  1 1 
        5  3099 1 1 45 SER HG   H   -4.436  -3.147 -11.822 1.00 . A A .  45 SER HG   1 1 
        5  3100 1 1 45 SER N    N   -5.495  -6.366 -11.681 1.00 . A A .  45 SER N    1 1 
        5  3101 1 1 45 SER O    O   -2.833  -7.128 -10.286 1.00 . A A .  45 SER O    1 1 
        5  3102 1 1 45 SER OG   O   -4.828  -3.447 -10.999 1.00 . A A .  45 SER OG   1 1 
        5  3103 1 1 46 GLY C    C   -1.790  -9.431 -11.992 1.00 . A A .  46 GLY C    1 1 
        5  3104 1 1 46 GLY CA   C   -1.309  -8.047 -12.381 1.00 . A A .  46 GLY CA   1 1 
        5  3105 1 1 46 GLY H    H   -2.634  -6.724 -13.370 1.00 . A A .  46 GLY H    1 1 
        5  3106 1 1 46 GLY HA2  H   -0.799  -8.108 -13.331 1.00 . A A .  46 GLY HA2  1 1 
        5  3107 1 1 46 GLY HA3  H   -0.613  -7.697 -11.633 1.00 . A A .  46 GLY HA3  1 1 
        5  3108 1 1 46 GLY N    N   -2.396  -7.092 -12.493 1.00 . A A .  46 GLY N    1 1 
        5  3109 1 1 46 GLY O    O   -1.788 -10.325 -12.837 1.00 . A A .  46 GLY O    1 1 
        5  3110 2 2  1 ZN  ZN   ZN  -4.132  -2.575  -1.323 1.00 . B A . 201 ZN  ZN   1 1 
        6  3111 1 1  1 GLY C    C  -11.474  16.579  18.046 1.00 . A A .   1 GLY C    1 1 
        6  3112 1 1  1 GLY CA   C  -12.133  16.512  19.410 1.00 . A A .   1 GLY CA   1 1 
        6  3113 1 1  1 GLY H1   H  -10.868  15.995  21.027 1.00 . A A .   1 GLY H1   1 1 
        6  3114 1 1  1 GLY HA2  H  -12.574  15.535  19.537 1.00 . A A .   1 GLY HA2  1 1 
        6  3115 1 1  1 GLY HA3  H  -12.913  17.257  19.456 1.00 . A A .   1 GLY HA3  1 1 
        6  3116 1 1  1 GLY N    N  -11.194  16.748  20.491 1.00 . A A .   1 GLY N    1 1 
        6  3117 1 1  1 GLY O    O  -10.361  17.086  17.911 1.00 . A A .   1 GLY O    1 1 
        6  3118 1 1  2 SER C    C  -12.741  16.352  14.661 1.00 . A A .   2 SER C    1 1 
        6  3119 1 1  2 SER CA   C  -11.636  16.063  15.672 1.00 . A A .   2 SER CA   1 1 
        6  3120 1 1  2 SER CB   C  -10.981  14.716  15.358 1.00 . A A .   2 SER CB   1 1 
        6  3121 1 1  2 SER H    H  -13.046  15.674  17.203 1.00 . A A .   2 SER H    1 1 
        6  3122 1 1  2 SER HA   H  -10.890  16.840  15.605 1.00 . A A .   2 SER HA   1 1 
        6  3123 1 1  2 SER HB2  H  -10.644  14.713  14.333 1.00 . A A .   2 SER HB2  1 1 
        6  3124 1 1  2 SER HB3  H  -10.136  14.568  16.015 1.00 . A A .   2 SER HB3  1 1 
        6  3125 1 1  2 SER HG   H  -12.783  13.949  15.337 1.00 . A A .   2 SER HG   1 1 
        6  3126 1 1  2 SER N    N  -12.163  16.064  17.032 1.00 . A A .   2 SER N    1 1 
        6  3127 1 1  2 SER O    O  -13.810  15.743  14.702 1.00 . A A .   2 SER O    1 1 
        6  3128 1 1  2 SER OG   O  -11.895  13.649  15.543 1.00 . A A .   2 SER OG   1 1 
        6  3129 1 1  3 SER C    C  -12.808  17.654  11.347 1.00 . A A .   3 SER C    1 1 
        6  3130 1 1  3 SER CA   C  -13.446  17.659  12.732 1.00 . A A .   3 SER CA   1 1 
        6  3131 1 1  3 SER CB   C  -14.027  19.042  13.034 1.00 . A A .   3 SER CB   1 1 
        6  3132 1 1  3 SER H    H  -11.603  17.735  13.772 1.00 . A A .   3 SER H    1 1 
        6  3133 1 1  3 SER HA   H  -14.243  16.931  12.751 1.00 . A A .   3 SER HA   1 1 
        6  3134 1 1  3 SER HB2  H  -14.297  19.096  14.077 1.00 . A A .   3 SER HB2  1 1 
        6  3135 1 1  3 SER HB3  H  -13.286  19.796  12.813 1.00 . A A .   3 SER HB3  1 1 
        6  3136 1 1  3 SER HG   H  -15.045  20.083  11.724 1.00 . A A .   3 SER HG   1 1 
        6  3137 1 1  3 SER N    N  -12.474  17.285  13.753 1.00 . A A .   3 SER N    1 1 
        6  3138 1 1  3 SER O    O  -13.048  18.548  10.537 1.00 . A A .   3 SER O    1 1 
        6  3139 1 1  3 SER OG   O  -15.181  19.292  12.250 1.00 . A A .   3 SER OG   1 1 
        6  3140 1 1  4 GLY C    C  -10.052  17.345   9.731 1.00 . A A .   4 GLY C    1 1 
        6  3141 1 1  4 GLY CA   C  -11.331  16.534   9.793 1.00 . A A .   4 GLY CA   1 1 
        6  3142 1 1  4 GLY H    H  -11.838  15.953  11.765 1.00 . A A .   4 GLY H    1 1 
        6  3143 1 1  4 GLY HA2  H  -11.097  15.497   9.603 1.00 . A A .   4 GLY HA2  1 1 
        6  3144 1 1  4 GLY HA3  H  -12.005  16.887   9.026 1.00 . A A .   4 GLY HA3  1 1 
        6  3145 1 1  4 GLY N    N  -11.992  16.638  11.081 1.00 . A A .   4 GLY N    1 1 
        6  3146 1 1  4 GLY O    O  -10.087  18.555   9.507 1.00 . A A .   4 GLY O    1 1 
        6  3147 1 1  5 SER C    C   -7.087  17.429   8.477 1.00 . A A .   5 SER C    1 1 
        6  3148 1 1  5 SER CA   C   -7.624  17.347   9.902 1.00 . A A .   5 SER CA   1 1 
        6  3149 1 1  5 SER CB   C   -6.625  16.607  10.794 1.00 . A A .   5 SER CB   1 1 
        6  3150 1 1  5 SER H    H   -8.957  15.715  10.105 1.00 . A A .   5 SER H    1 1 
        6  3151 1 1  5 SER HA   H   -7.759  18.349  10.282 1.00 . A A .   5 SER HA   1 1 
        6  3152 1 1  5 SER HB2  H   -6.438  15.626  10.384 1.00 . A A .   5 SER HB2  1 1 
        6  3153 1 1  5 SER HB3  H   -5.700  17.164  10.833 1.00 . A A .   5 SER HB3  1 1 
        6  3154 1 1  5 SER HG   H   -7.223  15.530  12.318 1.00 . A A .   5 SER HG   1 1 
        6  3155 1 1  5 SER N    N   -8.920  16.679   9.931 1.00 . A A .   5 SER N    1 1 
        6  3156 1 1  5 SER O    O   -7.403  16.590   7.633 1.00 . A A .   5 SER O    1 1 
        6  3157 1 1  5 SER OG   O   -7.127  16.463  12.112 1.00 . A A .   5 SER OG   1 1 
        6  3158 1 1  6 SER C    C   -4.958  17.386   6.430 1.00 . A A .   6 SER C    1 1 
        6  3159 1 1  6 SER CA   C   -5.692  18.641   6.892 1.00 . A A .   6 SER CA   1 1 
        6  3160 1 1  6 SER CB   C   -4.733  19.832   6.902 1.00 . A A .   6 SER CB   1 1 
        6  3161 1 1  6 SER H    H   -6.057  19.081   8.931 1.00 . A A .   6 SER H    1 1 
        6  3162 1 1  6 SER HA   H   -6.499  18.845   6.204 1.00 . A A .   6 SER HA   1 1 
        6  3163 1 1  6 SER HB2  H   -4.353  19.994   5.905 1.00 . A A .   6 SER HB2  1 1 
        6  3164 1 1  6 SER HB3  H   -5.262  20.714   7.234 1.00 . A A .   6 SER HB3  1 1 
        6  3165 1 1  6 SER HG   H   -3.041  18.965   7.375 1.00 . A A .   6 SER HG   1 1 
        6  3166 1 1  6 SER N    N   -6.271  18.446   8.216 1.00 . A A .   6 SER N    1 1 
        6  3167 1 1  6 SER O    O   -4.653  16.502   7.229 1.00 . A A .   6 SER O    1 1 
        6  3168 1 1  6 SER OG   O   -3.640  19.599   7.775 1.00 . A A .   6 SER OG   1 1 
        6  3169 1 1  7 GLY C    C   -4.539  15.737   3.242 1.00 . A A .   7 GLY C    1 1 
        6  3170 1 1  7 GLY CA   C   -3.982  16.166   4.584 1.00 . A A .   7 GLY CA   1 1 
        6  3171 1 1  7 GLY H    H   -4.946  18.051   4.542 1.00 . A A .   7 GLY H    1 1 
        6  3172 1 1  7 GLY HA2  H   -2.937  16.414   4.467 1.00 . A A .   7 GLY HA2  1 1 
        6  3173 1 1  7 GLY HA3  H   -4.070  15.342   5.278 1.00 . A A .   7 GLY HA3  1 1 
        6  3174 1 1  7 GLY N    N   -4.678  17.316   5.132 1.00 . A A .   7 GLY N    1 1 
        6  3175 1 1  7 GLY O    O   -3.787  15.497   2.296 1.00 . A A .   7 GLY O    1 1 
        6  3176 1 1  8 THR C    C   -6.311  16.265   0.821 1.00 . A A .   8 THR C    1 1 
        6  3177 1 1  8 THR CA   C   -6.519  15.230   1.920 1.00 . A A .   8 THR CA   1 1 
        6  3178 1 1  8 THR CB   C   -8.030  15.018   2.131 1.00 . A A .   8 THR CB   1 1 
        6  3179 1 1  8 THR CG2  C   -8.286  13.865   3.089 1.00 . A A .   8 THR CG2  1 1 
        6  3180 1 1  8 THR H    H   -6.407  15.841   3.944 1.00 . A A .   8 THR H    1 1 
        6  3181 1 1  8 THR HA   H   -6.085  14.292   1.605 1.00 . A A .   8 THR HA   1 1 
        6  3182 1 1  8 THR HB   H   -8.481  14.782   1.178 1.00 . A A .   8 THR HB   1 1 
        6  3183 1 1  8 THR HG1  H   -8.559  16.913   1.990 1.00 . A A .   8 THR HG1  1 1 
        6  3184 1 1  8 THR HG21 H   -7.935  14.132   4.075 1.00 . A A .   8 THR HG21 1 1 
        6  3185 1 1  8 THR HG22 H   -7.760  12.987   2.745 1.00 . A A .   8 THR HG22 1 1 
        6  3186 1 1  8 THR HG23 H   -9.345  13.658   3.128 1.00 . A A .   8 THR HG23 1 1 
        6  3187 1 1  8 THR N    N   -5.861  15.637   3.156 1.00 . A A .   8 THR N    1 1 
        6  3188 1 1  8 THR O    O   -6.059  17.437   1.098 1.00 . A A .   8 THR O    1 1 
        6  3189 1 1  8 THR OG1  O   -8.625  16.215   2.646 1.00 . A A .   8 THR OG1  1 1 
        6  3190 1 1  9 GLY C    C   -6.661  16.104  -2.868 1.00 . A A .   9 GLY C    1 1 
        6  3191 1 1  9 GLY CA   C   -6.240  16.726  -1.552 1.00 . A A .   9 GLY CA   1 1 
        6  3192 1 1  9 GLY H    H   -6.621  14.879  -0.590 1.00 . A A .   9 GLY H    1 1 
        6  3193 1 1  9 GLY HA2  H   -6.827  17.616  -1.382 1.00 . A A .   9 GLY HA2  1 1 
        6  3194 1 1  9 GLY HA3  H   -5.197  17.002  -1.615 1.00 . A A .   9 GLY HA3  1 1 
        6  3195 1 1  9 GLY N    N   -6.418  15.824  -0.429 1.00 . A A .   9 GLY N    1 1 
        6  3196 1 1  9 GLY O    O   -7.678  16.487  -3.445 1.00 . A A .   9 GLY O    1 1 
        6  3197 1 1 10 GLU C    C   -5.849  12.981  -4.513 1.00 . A A .  10 GLU C    1 1 
        6  3198 1 1 10 GLU CA   C   -6.172  14.469  -4.604 1.00 . A A .  10 GLU CA   1 1 
        6  3199 1 1 10 GLU CB   C   -5.381  15.106  -5.748 1.00 . A A .  10 GLU CB   1 1 
        6  3200 1 1 10 GLU CD   C   -3.144  15.731  -4.754 1.00 . A A .  10 GLU CD   1 1 
        6  3201 1 1 10 GLU CG   C   -3.891  14.808  -5.697 1.00 . A A .  10 GLU CG   1 1 
        6  3202 1 1 10 GLU H    H   -5.078  14.882  -2.839 1.00 . A A .  10 GLU H    1 1 
        6  3203 1 1 10 GLU HA   H   -7.227  14.584  -4.801 1.00 . A A .  10 GLU HA   1 1 
        6  3204 1 1 10 GLU HB2  H   -5.769  14.738  -6.686 1.00 . A A .  10 GLU HB2  1 1 
        6  3205 1 1 10 GLU HB3  H   -5.514  16.177  -5.709 1.00 . A A .  10 GLU HB3  1 1 
        6  3206 1 1 10 GLU HG2  H   -3.752  13.790  -5.366 1.00 . A A .  10 GLU HG2  1 1 
        6  3207 1 1 10 GLU HG3  H   -3.480  14.922  -6.689 1.00 . A A .  10 GLU HG3  1 1 
        6  3208 1 1 10 GLU N    N   -5.875  15.143  -3.345 1.00 . A A .  10 GLU N    1 1 
        6  3209 1 1 10 GLU O    O   -4.926  12.576  -3.806 1.00 . A A .  10 GLU O    1 1 
        6  3210 1 1 10 GLU OE1  O   -3.141  16.955  -5.001 1.00 . A A .  10 GLU OE1  1 1 
        6  3211 1 1 10 GLU OE2  O   -2.563  15.229  -3.769 1.00 . A A .  10 GLU OE2  1 1 
        6  3212 1 1 11 LYS C    C   -6.281  10.198  -6.662 1.00 . A A .  11 LYS C    1 1 
        6  3213 1 1 11 LYS CA   C   -6.412  10.726  -5.237 1.00 . A A .  11 LYS CA   1 1 
        6  3214 1 1 11 LYS CB   C   -7.573  10.025  -4.528 1.00 . A A .  11 LYS CB   1 1 
        6  3215 1 1 11 LYS CD   C   -7.912  11.288  -2.383 1.00 . A A .  11 LYS CD   1 1 
        6  3216 1 1 11 LYS CE   C   -9.403  11.243  -2.085 1.00 . A A .  11 LYS CE   1 1 
        6  3217 1 1 11 LYS CG   C   -7.432   9.993  -3.016 1.00 . A A .  11 LYS CG   1 1 
        6  3218 1 1 11 LYS H    H   -7.336  12.552  -5.778 1.00 . A A .  11 LYS H    1 1 
        6  3219 1 1 11 LYS HA   H   -5.498  10.518  -4.703 1.00 . A A .  11 LYS HA   1 1 
        6  3220 1 1 11 LYS HB2  H   -8.491  10.539  -4.772 1.00 . A A .  11 LYS HB2  1 1 
        6  3221 1 1 11 LYS HB3  H   -7.635   9.007  -4.884 1.00 . A A .  11 LYS HB3  1 1 
        6  3222 1 1 11 LYS HD2  H   -7.377  11.447  -1.459 1.00 . A A .  11 LYS HD2  1 1 
        6  3223 1 1 11 LYS HD3  H   -7.714  12.105  -3.062 1.00 . A A .  11 LYS HD3  1 1 
        6  3224 1 1 11 LYS HE2  H   -9.798  12.246  -2.135 1.00 . A A .  11 LYS HE2  1 1 
        6  3225 1 1 11 LYS HE3  H   -9.887  10.628  -2.829 1.00 . A A .  11 LYS HE3  1 1 
        6  3226 1 1 11 LYS HG2  H   -8.019   9.174  -2.626 1.00 . A A .  11 LYS HG2  1 1 
        6  3227 1 1 11 LYS HG3  H   -6.391   9.844  -2.764 1.00 . A A .  11 LYS HG3  1 1 
        6  3228 1 1 11 LYS HZ1  H   -9.944   9.676  -0.813 1.00 . A A .  11 LYS HZ1  1 1 
        6  3229 1 1 11 LYS HZ2  H  -10.465  11.197  -0.287 1.00 . A A .  11 LYS HZ2  1 1 
        6  3230 1 1 11 LYS HZ3  H   -8.838  10.761  -0.132 1.00 . A A .  11 LYS HZ3  1 1 
        6  3231 1 1 11 LYS N    N   -6.616  12.170  -5.234 1.00 . A A .  11 LYS N    1 1 
        6  3232 1 1 11 LYS NZ   N   -9.682  10.679  -0.735 1.00 . A A .  11 LYS NZ   1 1 
        6  3233 1 1 11 LYS O    O   -7.230   9.676  -7.246 1.00 . A A .  11 LYS O    1 1 
        6  3234 1 1 12 PRO C    C   -4.779   8.355  -8.707 1.00 . A A .  12 PRO C    1 1 
        6  3235 1 1 12 PRO CA   C   -4.791   9.876  -8.599 1.00 . A A .  12 PRO CA   1 1 
        6  3236 1 1 12 PRO CB   C   -3.398  10.444  -8.880 1.00 . A A .  12 PRO CB   1 1 
        6  3237 1 1 12 PRO CD   C   -3.899  10.948  -6.598 1.00 . A A .  12 PRO CD   1 1 
        6  3238 1 1 12 PRO CG   C   -2.775  10.604  -7.537 1.00 . A A .  12 PRO CG   1 1 
        6  3239 1 1 12 PRO HA   H   -5.497  10.281  -9.309 1.00 . A A .  12 PRO HA   1 1 
        6  3240 1 1 12 PRO HB2  H   -2.841   9.751  -9.495 1.00 . A A .  12 PRO HB2  1 1 
        6  3241 1 1 12 PRO HB3  H   -3.488  11.392  -9.389 1.00 . A A .  12 PRO HB3  1 1 
        6  3242 1 1 12 PRO HD2  H   -3.721  10.519  -5.623 1.00 . A A .  12 PRO HD2  1 1 
        6  3243 1 1 12 PRO HD3  H   -4.015  12.020  -6.525 1.00 . A A .  12 PRO HD3  1 1 
        6  3244 1 1 12 PRO HG2  H   -2.306   9.680  -7.237 1.00 . A A .  12 PRO HG2  1 1 
        6  3245 1 1 12 PRO HG3  H   -2.050  11.404  -7.561 1.00 . A A .  12 PRO HG3  1 1 
        6  3246 1 1 12 PRO N    N   -5.076  10.335  -7.236 1.00 . A A .  12 PRO N    1 1 
        6  3247 1 1 12 PRO O    O   -5.365   7.784  -9.628 1.00 . A A .  12 PRO O    1 1 
        6  3248 1 1 13 TYR C    C   -4.776   5.664  -6.567 1.00 . A A .  13 TYR C    1 1 
        6  3249 1 1 13 TYR CA   C   -4.018   6.250  -7.754 1.00 . A A .  13 TYR CA   1 1 
        6  3250 1 1 13 TYR CB   C   -2.554   5.809  -7.706 1.00 . A A .  13 TYR CB   1 1 
        6  3251 1 1 13 TYR CD1  C   -1.121   7.489  -8.932 1.00 . A A .  13 TYR CD1  1 1 
        6  3252 1 1 13 TYR CD2  C   -1.617   5.427 -10.020 1.00 . A A .  13 TYR CD2  1 1 
        6  3253 1 1 13 TYR CE1  C   -0.386   7.896 -10.028 1.00 . A A .  13 TYR CE1  1 1 
        6  3254 1 1 13 TYR CE2  C   -0.882   5.825 -11.120 1.00 . A A .  13 TYR CE2  1 1 
        6  3255 1 1 13 TYR CG   C   -1.749   6.249  -8.908 1.00 . A A .  13 TYR CG   1 1 
        6  3256 1 1 13 TYR CZ   C   -0.269   7.060 -11.119 1.00 . A A .  13 TYR CZ   1 1 
        6  3257 1 1 13 TYR H    H   -3.662   8.216  -7.056 1.00 . A A .  13 TYR H    1 1 
        6  3258 1 1 13 TYR HA   H   -4.464   5.884  -8.668 1.00 . A A .  13 TYR HA   1 1 
        6  3259 1 1 13 TYR HB2  H   -2.089   6.225  -6.826 1.00 . A A .  13 TYR HB2  1 1 
        6  3260 1 1 13 TYR HB3  H   -2.511   4.731  -7.655 1.00 . A A .  13 TYR HB3  1 1 
        6  3261 1 1 13 TYR HD1  H   -1.215   8.141  -8.076 1.00 . A A .  13 TYR HD1  1 1 
        6  3262 1 1 13 TYR HD2  H   -2.100   4.460 -10.017 1.00 . A A .  13 TYR HD2  1 1 
        6  3263 1 1 13 TYR HE1  H    0.095   8.863 -10.028 1.00 . A A .  13 TYR HE1  1 1 
        6  3264 1 1 13 TYR HE2  H   -0.791   5.171 -11.974 1.00 . A A .  13 TYR HE2  1 1 
        6  3265 1 1 13 TYR HH   H    0.739   6.690 -12.714 1.00 . A A .  13 TYR HH   1 1 
        6  3266 1 1 13 TYR N    N   -4.108   7.705  -7.763 1.00 . A A .  13 TYR N    1 1 
        6  3267 1 1 13 TYR O    O   -4.740   6.207  -5.462 1.00 . A A .  13 TYR O    1 1 
        6  3268 1 1 13 TYR OH   O    0.463   7.461 -12.213 1.00 . A A .  13 TYR OH   1 1 
        6  3269 1 1 14 LYS C    C   -6.207   2.374  -5.940 1.00 . A A .  14 LYS C    1 1 
        6  3270 1 1 14 LYS CA   C   -6.230   3.888  -5.755 1.00 . A A .  14 LYS CA   1 1 
        6  3271 1 1 14 LYS CB   C   -7.675   4.391  -5.756 1.00 . A A .  14 LYS CB   1 1 
        6  3272 1 1 14 LYS CD   C   -8.552   4.258  -3.406 1.00 . A A .  14 LYS CD   1 1 
        6  3273 1 1 14 LYS CE   C   -9.814   3.929  -2.623 1.00 . A A .  14 LYS CE   1 1 
        6  3274 1 1 14 LYS CG   C   -8.581   3.642  -4.794 1.00 . A A .  14 LYS CG   1 1 
        6  3275 1 1 14 LYS H    H   -5.453   4.166  -7.705 1.00 . A A .  14 LYS H    1 1 
        6  3276 1 1 14 LYS HA   H   -5.774   4.130  -4.807 1.00 . A A .  14 LYS HA   1 1 
        6  3277 1 1 14 LYS HB2  H   -7.680   5.436  -5.482 1.00 . A A .  14 LYS HB2  1 1 
        6  3278 1 1 14 LYS HB3  H   -8.079   4.287  -6.753 1.00 . A A .  14 LYS HB3  1 1 
        6  3279 1 1 14 LYS HD2  H   -7.698   3.874  -2.868 1.00 . A A .  14 LYS HD2  1 1 
        6  3280 1 1 14 LYS HD3  H   -8.467   5.332  -3.500 1.00 . A A .  14 LYS HD3  1 1 
        6  3281 1 1 14 LYS HE2  H  -10.642   3.862  -3.312 1.00 . A A .  14 LYS HE2  1 1 
        6  3282 1 1 14 LYS HE3  H   -9.678   2.977  -2.130 1.00 . A A .  14 LYS HE3  1 1 
        6  3283 1 1 14 LYS HG2  H   -9.593   3.672  -5.169 1.00 . A A .  14 LYS HG2  1 1 
        6  3284 1 1 14 LYS HG3  H   -8.250   2.615  -4.729 1.00 . A A .  14 LYS HG3  1 1 
        6  3285 1 1 14 LYS HZ1  H  -10.396   5.855  -2.062 1.00 . A A .  14 LYS HZ1  1 1 
        6  3286 1 1 14 LYS HZ2  H   -9.280   5.142  -1.009 1.00 . A A .  14 LYS HZ2  1 1 
        6  3287 1 1 14 LYS HZ3  H  -10.898   4.648  -0.989 1.00 . A A .  14 LYS HZ3  1 1 
        6  3288 1 1 14 LYS N    N   -5.463   4.552  -6.803 1.00 . A A .  14 LYS N    1 1 
        6  3289 1 1 14 LYS NZ   N  -10.118   4.966  -1.599 1.00 . A A .  14 LYS NZ   1 1 
        6  3290 1 1 14 LYS O    O   -6.408   1.870  -7.045 1.00 . A A .  14 LYS O    1 1 
        6  3291 1 1 15 CYS C    C   -7.320  -0.395  -4.828 1.00 . A A .  15 CYS C    1 1 
        6  3292 1 1 15 CYS CA   C   -5.915   0.197  -4.891 1.00 . A A .  15 CYS CA   1 1 
        6  3293 1 1 15 CYS CB   C   -5.071  -0.339  -3.734 1.00 . A A .  15 CYS CB   1 1 
        6  3294 1 1 15 CYS H    H   -5.810   2.113  -3.997 1.00 . A A .  15 CYS H    1 1 
        6  3295 1 1 15 CYS HA   H   -5.457  -0.094  -5.824 1.00 . A A .  15 CYS HA   1 1 
        6  3296 1 1 15 CYS HB2  H   -4.196   0.284  -3.618 1.00 . A A .  15 CYS HB2  1 1 
        6  3297 1 1 15 CYS HB3  H   -5.655  -0.303  -2.826 1.00 . A A .  15 CYS HB3  1 1 
        6  3298 1 1 15 CYS N    N   -5.963   1.653  -4.850 1.00 . A A .  15 CYS N    1 1 
        6  3299 1 1 15 CYS O    O   -8.002  -0.294  -3.810 1.00 . A A .  15 CYS O    1 1 
        6  3300 1 1 15 CYS SG   S   -4.502  -2.055  -3.960 1.00 . A A .  15 CYS SG   1 1 
        6  3301 1 1 16 ASN C    C   -9.062  -3.012  -5.363 1.00 . A A .  16 ASN C    1 1 
        6  3302 1 1 16 ASN CA   C   -9.068  -1.623  -5.994 1.00 . A A .  16 ASN CA   1 1 
        6  3303 1 1 16 ASN CB   C   -9.535  -1.714  -7.449 1.00 . A A .  16 ASN CB   1 1 
        6  3304 1 1 16 ASN CG   C   -9.115  -3.012  -8.111 1.00 . A A .  16 ASN CG   1 1 
        6  3305 1 1 16 ASN H    H   -7.155  -1.063  -6.706 1.00 . A A .  16 ASN H    1 1 
        6  3306 1 1 16 ASN HA   H   -9.752  -0.993  -5.445 1.00 . A A .  16 ASN HA   1 1 
        6  3307 1 1 16 ASN HB2  H  -10.613  -1.650  -7.479 1.00 . A A .  16 ASN HB2  1 1 
        6  3308 1 1 16 ASN HB3  H   -9.113  -0.893  -8.008 1.00 . A A .  16 ASN HB3  1 1 
        6  3309 1 1 16 ASN HD21 H   -7.206  -2.456  -8.046 1.00 . A A .  16 ASN HD21 1 1 
        6  3310 1 1 16 ASN HD22 H   -7.515  -4.003  -8.751 1.00 . A A .  16 ASN HD22 1 1 
        6  3311 1 1 16 ASN N    N   -7.745  -1.015  -5.925 1.00 . A A .  16 ASN N    1 1 
        6  3312 1 1 16 ASN ND2  N   -7.814  -3.174  -8.324 1.00 . A A .  16 ASN ND2  1 1 
        6  3313 1 1 16 ASN O    O   -9.996  -3.792  -5.547 1.00 . A A .  16 ASN O    1 1 
        6  3314 1 1 16 ASN OD1  O   -9.950  -3.860  -8.426 1.00 . A A .  16 ASN OD1  1 1 
        6  3315 1 1 17 GLU C    C   -8.185  -4.492  -2.468 1.00 . A A .  17 GLU C    1 1 
        6  3316 1 1 17 GLU CA   C   -7.877  -4.607  -3.958 1.00 . A A .  17 GLU CA   1 1 
        6  3317 1 1 17 GLU CB   C   -6.468  -5.169  -4.157 1.00 . A A .  17 GLU CB   1 1 
        6  3318 1 1 17 GLU CD   C   -4.813  -6.078  -5.835 1.00 . A A .  17 GLU CD   1 1 
        6  3319 1 1 17 GLU CG   C   -6.019  -5.188  -5.609 1.00 . A A .  17 GLU CG   1 1 
        6  3320 1 1 17 GLU H    H   -7.292  -2.648  -4.507 1.00 . A A .  17 GLU H    1 1 
        6  3321 1 1 17 GLU HA   H   -8.590  -5.280  -4.410 1.00 . A A .  17 GLU HA   1 1 
        6  3322 1 1 17 GLU HB2  H   -5.770  -4.568  -3.593 1.00 . A A .  17 GLU HB2  1 1 
        6  3323 1 1 17 GLU HB3  H   -6.441  -6.182  -3.781 1.00 . A A .  17 GLU HB3  1 1 
        6  3324 1 1 17 GLU HG2  H   -6.833  -5.550  -6.219 1.00 . A A .  17 GLU HG2  1 1 
        6  3325 1 1 17 GLU HG3  H   -5.767  -4.181  -5.907 1.00 . A A .  17 GLU HG3  1 1 
        6  3326 1 1 17 GLU N    N   -8.004  -3.312  -4.617 1.00 . A A .  17 GLU N    1 1 
        6  3327 1 1 17 GLU O    O   -8.764  -5.400  -1.870 1.00 . A A .  17 GLU O    1 1 
        6  3328 1 1 17 GLU OE1  O   -3.678  -5.608  -5.613 1.00 . A A .  17 GLU OE1  1 1 
        6  3329 1 1 17 GLU OE2  O   -5.004  -7.246  -6.234 1.00 . A A .  17 GLU OE2  1 1 
        6  3330 1 1 18 CYS C    C   -8.697  -1.783  -0.229 1.00 . A A .  18 CYS C    1 1 
        6  3331 1 1 18 CYS CA   C   -8.025  -3.135  -0.454 1.00 . A A .  18 CYS CA   1 1 
        6  3332 1 1 18 CYS CB   C   -6.704  -3.194   0.317 1.00 . A A .  18 CYS CB   1 1 
        6  3333 1 1 18 CYS H    H   -7.336  -2.683  -2.404 1.00 . A A .  18 CYS H    1 1 
        6  3334 1 1 18 CYS HA   H   -8.679  -3.913  -0.091 1.00 . A A .  18 CYS HA   1 1 
        6  3335 1 1 18 CYS HB2  H   -6.891  -2.958   1.354 1.00 . A A .  18 CYS HB2  1 1 
        6  3336 1 1 18 CYS HB3  H   -6.300  -4.193   0.247 1.00 . A A .  18 CYS HB3  1 1 
        6  3337 1 1 18 CYS N    N   -7.793  -3.370  -1.874 1.00 . A A .  18 CYS N    1 1 
        6  3338 1 1 18 CYS O    O   -9.677  -1.681   0.508 1.00 . A A .  18 CYS O    1 1 
        6  3339 1 1 18 CYS SG   S   -5.436  -2.037  -0.293 1.00 . A A .  18 CYS SG   1 1 
        6  3340 1 1 19 GLY C    C   -7.686   1.609  -0.321 1.00 . A A .  19 GLY C    1 1 
        6  3341 1 1 19 GLY CA   C   -8.725   0.582  -0.729 1.00 . A A .  19 GLY CA   1 1 
        6  3342 1 1 19 GLY H    H   -7.382  -0.890  -1.446 1.00 . A A .  19 GLY H    1 1 
        6  3343 1 1 19 GLY HA2  H   -9.159   0.880  -1.671 1.00 . A A .  19 GLY HA2  1 1 
        6  3344 1 1 19 GLY HA3  H   -9.501   0.555   0.022 1.00 . A A .  19 GLY HA3  1 1 
        6  3345 1 1 19 GLY N    N   -8.164  -0.749  -0.871 1.00 . A A .  19 GLY N    1 1 
        6  3346 1 1 19 GLY O    O   -8.008   2.607   0.324 1.00 . A A .  19 GLY O    1 1 
        6  3347 1 1 20 LYS C    C   -5.012   3.176  -1.549 1.00 . A A .  20 LYS C    1 1 
        6  3348 1 1 20 LYS CA   C   -5.345   2.273  -0.365 1.00 . A A .  20 LYS CA   1 1 
        6  3349 1 1 20 LYS CB   C   -4.103   1.483   0.052 1.00 . A A .  20 LYS CB   1 1 
        6  3350 1 1 20 LYS CD   C   -3.137   2.906   1.883 1.00 . A A .  20 LYS CD   1 1 
        6  3351 1 1 20 LYS CE   C   -1.967   3.776   2.314 1.00 . A A .  20 LYS CE   1 1 
        6  3352 1 1 20 LYS CG   C   -2.939   2.360   0.479 1.00 . A A .  20 LYS CG   1 1 
        6  3353 1 1 20 LYS H    H   -6.241   0.551  -1.209 1.00 . A A .  20 LYS H    1 1 
        6  3354 1 1 20 LYS HA   H   -5.665   2.888   0.462 1.00 . A A .  20 LYS HA   1 1 
        6  3355 1 1 20 LYS HB2  H   -4.362   0.837   0.878 1.00 . A A .  20 LYS HB2  1 1 
        6  3356 1 1 20 LYS HB3  H   -3.781   0.875  -0.781 1.00 . A A .  20 LYS HB3  1 1 
        6  3357 1 1 20 LYS HD2  H   -4.039   3.499   1.906 1.00 . A A .  20 LYS HD2  1 1 
        6  3358 1 1 20 LYS HD3  H   -3.231   2.078   2.572 1.00 . A A .  20 LYS HD3  1 1 
        6  3359 1 1 20 LYS HE2  H   -1.849   4.577   1.599 1.00 . A A .  20 LYS HE2  1 1 
        6  3360 1 1 20 LYS HE3  H   -2.183   4.192   3.287 1.00 . A A .  20 LYS HE3  1 1 
        6  3361 1 1 20 LYS HG2  H   -2.031   1.775   0.457 1.00 . A A .  20 LYS HG2  1 1 
        6  3362 1 1 20 LYS HG3  H   -2.852   3.188  -0.210 1.00 . A A .  20 LYS HG3  1 1 
        6  3363 1 1 20 LYS HZ1  H   -0.040   3.455   3.055 1.00 . A A .  20 LYS HZ1  1 1 
        6  3364 1 1 20 LYS HZ2  H   -0.249   2.960   1.450 1.00 . A A .  20 LYS HZ2  1 1 
        6  3365 1 1 20 LYS HZ3  H   -0.888   2.032   2.711 1.00 . A A .  20 LYS HZ3  1 1 
        6  3366 1 1 20 LYS N    N   -6.435   1.364  -0.696 1.00 . A A .  20 LYS N    1 1 
        6  3367 1 1 20 LYS NZ   N   -0.697   3.002   2.388 1.00 . A A .  20 LYS NZ   1 1 
        6  3368 1 1 20 LYS O    O   -4.693   2.697  -2.637 1.00 . A A .  20 LYS O    1 1 
        6  3369 1 1 21 ALA C    C   -3.485   6.189  -2.090 1.00 . A A .  21 ALA C    1 1 
        6  3370 1 1 21 ALA CA   C   -4.790   5.454  -2.376 1.00 . A A .  21 ALA CA   1 1 
        6  3371 1 1 21 ALA CB   C   -5.936   6.445  -2.518 1.00 . A A .  21 ALA CB   1 1 
        6  3372 1 1 21 ALA H    H   -5.347   4.805  -0.440 1.00 . A A .  21 ALA H    1 1 
        6  3373 1 1 21 ALA HA   H   -4.692   4.918  -3.309 1.00 . A A .  21 ALA HA   1 1 
        6  3374 1 1 21 ALA HB1  H   -6.850   5.991  -2.166 1.00 . A A .  21 ALA HB1  1 1 
        6  3375 1 1 21 ALA HB2  H   -5.723   7.327  -1.931 1.00 . A A .  21 ALA HB2  1 1 
        6  3376 1 1 21 ALA HB3  H   -6.046   6.720  -3.556 1.00 . A A .  21 ALA HB3  1 1 
        6  3377 1 1 21 ALA N    N   -5.087   4.485  -1.329 1.00 . A A .  21 ALA N    1 1 
        6  3378 1 1 21 ALA O    O   -3.203   6.553  -0.948 1.00 . A A .  21 ALA O    1 1 
        6  3379 1 1 22 PHE C    C   -1.401   8.384  -3.808 1.00 . A A .  22 PHE C    1 1 
        6  3380 1 1 22 PHE CA   C   -1.414   7.094  -2.994 1.00 . A A .  22 PHE CA   1 1 
        6  3381 1 1 22 PHE CB   C   -0.267   6.185  -3.439 1.00 . A A .  22 PHE CB   1 1 
        6  3382 1 1 22 PHE CD1  C   -1.384   3.946  -3.240 1.00 . A A .  22 PHE CD1  1 1 
        6  3383 1 1 22 PHE CD2  C    0.604   4.336  -1.983 1.00 . A A .  22 PHE CD2  1 1 
        6  3384 1 1 22 PHE CE1  C   -1.464   2.667  -2.723 1.00 . A A .  22 PHE CE1  1 1 
        6  3385 1 1 22 PHE CE2  C    0.530   3.058  -1.463 1.00 . A A .  22 PHE CE2  1 1 
        6  3386 1 1 22 PHE CG   C   -0.351   4.795  -2.876 1.00 . A A .  22 PHE CG   1 1 
        6  3387 1 1 22 PHE CZ   C   -0.505   2.222  -1.834 1.00 . A A .  22 PHE CZ   1 1 
        6  3388 1 1 22 PHE H    H   -2.971   6.090  -4.019 1.00 . A A .  22 PHE H    1 1 
        6  3389 1 1 22 PHE HA   H   -1.283   7.339  -1.951 1.00 . A A .  22 PHE HA   1 1 
        6  3390 1 1 22 PHE HB2  H   -0.276   6.107  -4.516 1.00 . A A .  22 PHE HB2  1 1 
        6  3391 1 1 22 PHE HB3  H    0.670   6.617  -3.122 1.00 . A A .  22 PHE HB3  1 1 
        6  3392 1 1 22 PHE HD1  H   -2.134   4.293  -3.936 1.00 . A A .  22 PHE HD1  1 1 
        6  3393 1 1 22 PHE HD2  H    1.415   4.989  -1.692 1.00 . A A .  22 PHE HD2  1 1 
        6  3394 1 1 22 PHE HE1  H   -2.273   2.016  -3.015 1.00 . A A .  22 PHE HE1  1 1 
        6  3395 1 1 22 PHE HE2  H    1.282   2.713  -0.768 1.00 . A A .  22 PHE HE2  1 1 
        6  3396 1 1 22 PHE HZ   H   -0.565   1.223  -1.428 1.00 . A A .  22 PHE HZ   1 1 
        6  3397 1 1 22 PHE N    N   -2.691   6.404  -3.133 1.00 . A A .  22 PHE N    1 1 
        6  3398 1 1 22 PHE O    O   -2.408   8.762  -4.407 1.00 . A A .  22 PHE O    1 1 
        6  3399 1 1 23 ARG C    C    0.582  10.066  -5.902 1.00 . A A .  23 ARG C    1 1 
        6  3400 1 1 23 ARG CA   C   -0.110  10.304  -4.563 1.00 . A A .  23 ARG CA   1 1 
        6  3401 1 1 23 ARG CB   C    0.684  11.319  -3.740 1.00 . A A .  23 ARG CB   1 1 
        6  3402 1 1 23 ARG CD   C    2.137  12.679  -5.275 1.00 . A A .  23 ARG CD   1 1 
        6  3403 1 1 23 ARG CG   C    0.868  12.658  -4.437 1.00 . A A .  23 ARG CG   1 1 
        6  3404 1 1 23 ARG CZ   C    3.155  14.231  -6.887 1.00 . A A .  23 ARG CZ   1 1 
        6  3405 1 1 23 ARG H    H    0.513   8.703  -3.327 1.00 . A A .  23 ARG H    1 1 
        6  3406 1 1 23 ARG HA   H   -1.098  10.697  -4.747 1.00 . A A .  23 ARG HA   1 1 
        6  3407 1 1 23 ARG HB2  H    0.167  11.492  -2.808 1.00 . A A .  23 ARG HB2  1 1 
        6  3408 1 1 23 ARG HB3  H    1.661  10.910  -3.530 1.00 . A A .  23 ARG HB3  1 1 
        6  3409 1 1 23 ARG HD2  H    2.965  12.361  -4.659 1.00 . A A .  23 ARG HD2  1 1 
        6  3410 1 1 23 ARG HD3  H    2.019  11.994  -6.101 1.00 . A A .  23 ARG HD3  1 1 
        6  3411 1 1 23 ARG HE   H    2.051  14.779  -5.319 1.00 . A A .  23 ARG HE   1 1 
        6  3412 1 1 23 ARG HG2  H    0.021  12.836  -5.083 1.00 . A A .  23 ARG HG2  1 1 
        6  3413 1 1 23 ARG HG3  H    0.926  13.436  -3.691 1.00 . A A .  23 ARG HG3  1 1 
        6  3414 1 1 23 ARG HH11 H    3.510  12.276  -7.249 1.00 . A A .  23 ARG HH11 1 1 
        6  3415 1 1 23 ARG HH12 H    4.222  13.380  -8.378 1.00 . A A .  23 ARG HH12 1 1 
        6  3416 1 1 23 ARG HH21 H    2.983  16.243  -6.799 1.00 . A A .  23 ARG HH21 1 1 
        6  3417 1 1 23 ARG HH22 H    3.922  15.637  -8.121 1.00 . A A .  23 ARG HH22 1 1 
        6  3418 1 1 23 ARG N    N   -0.254   9.055  -3.824 1.00 . A A .  23 ARG N    1 1 
        6  3419 1 1 23 ARG NE   N    2.423  14.012  -5.801 1.00 . A A .  23 ARG NE   1 1 
        6  3420 1 1 23 ARG NH1  N    3.672  13.212  -7.559 1.00 . A A .  23 ARG NH1  1 1 
        6  3421 1 1 23 ARG NH2  N    3.371  15.473  -7.303 1.00 . A A .  23 ARG NH2  1 1 
        6  3422 1 1 23 ARG O    O    0.287  10.734  -6.892 1.00 . A A .  23 ARG O    1 1 
        6  3423 1 1 24 ALA C    C    2.134   7.296  -7.462 1.00 . A A .  24 ALA C    1 1 
        6  3424 1 1 24 ALA CA   C    2.238   8.783  -7.141 1.00 . A A .  24 ALA CA   1 1 
        6  3425 1 1 24 ALA CB   C    3.696   9.195  -7.006 1.00 . A A .  24 ALA CB   1 1 
        6  3426 1 1 24 ALA H    H    1.696   8.611  -5.103 1.00 . A A .  24 ALA H    1 1 
        6  3427 1 1 24 ALA HA   H    1.804   9.347  -7.954 1.00 . A A .  24 ALA HA   1 1 
        6  3428 1 1 24 ALA HB1  H    4.271   8.362  -6.629 1.00 . A A .  24 ALA HB1  1 1 
        6  3429 1 1 24 ALA HB2  H    4.078   9.488  -7.973 1.00 . A A .  24 ALA HB2  1 1 
        6  3430 1 1 24 ALA HB3  H    3.773  10.026  -6.321 1.00 . A A .  24 ALA HB3  1 1 
        6  3431 1 1 24 ALA N    N    1.505   9.110  -5.924 1.00 . A A .  24 ALA N    1 1 
        6  3432 1 1 24 ALA O    O    1.817   6.484  -6.592 1.00 . A A .  24 ALA O    1 1 
        6  3433 1 1 25 ARG C    C    3.323   4.694  -8.371 1.00 . A A .  25 ARG C    1 1 
        6  3434 1 1 25 ARG CA   C    2.335   5.556  -9.152 1.00 . A A .  25 ARG CA   1 1 
        6  3435 1 1 25 ARG CB   C    2.627   5.454 -10.650 1.00 . A A .  25 ARG CB   1 1 
        6  3436 1 1 25 ARG CD   C    3.040   3.939 -12.611 1.00 . A A .  25 ARG CD   1 1 
        6  3437 1 1 25 ARG CG   C    2.465   4.050 -11.208 1.00 . A A .  25 ARG CG   1 1 
        6  3438 1 1 25 ARG CZ   C    2.640   4.994 -14.795 1.00 . A A .  25 ARG CZ   1 1 
        6  3439 1 1 25 ARG H    H    2.647   7.638  -9.364 1.00 . A A .  25 ARG H    1 1 
        6  3440 1 1 25 ARG HA   H    1.334   5.196  -8.964 1.00 . A A .  25 ARG HA   1 1 
        6  3441 1 1 25 ARG HB2  H    1.952   6.109 -11.182 1.00 . A A .  25 ARG HB2  1 1 
        6  3442 1 1 25 ARG HB3  H    3.642   5.775 -10.829 1.00 . A A .  25 ARG HB3  1 1 
        6  3443 1 1 25 ARG HD2  H    4.021   4.390 -12.621 1.00 . A A .  25 ARG HD2  1 1 
        6  3444 1 1 25 ARG HD3  H    3.123   2.893 -12.870 1.00 . A A .  25 ARG HD3  1 1 
        6  3445 1 1 25 ARG HE   H    1.266   4.776 -13.365 1.00 . A A .  25 ARG HE   1 1 
        6  3446 1 1 25 ARG HG2  H    2.980   3.354 -10.563 1.00 . A A .  25 ARG HG2  1 1 
        6  3447 1 1 25 ARG HG3  H    1.414   3.804 -11.239 1.00 . A A .  25 ARG HG3  1 1 
        6  3448 1 1 25 ARG HH11 H    4.524   4.325 -14.508 1.00 . A A .  25 ARG HH11 1 1 
        6  3449 1 1 25 ARG HH12 H    4.228   5.071 -16.043 1.00 . A A .  25 ARG HH12 1 1 
        6  3450 1 1 25 ARG HH21 H    0.864   5.761 -15.383 1.00 . A A .  25 ARG HH21 1 1 
        6  3451 1 1 25 ARG HH22 H    2.146   5.888 -16.540 1.00 . A A .  25 ARG HH22 1 1 
        6  3452 1 1 25 ARG N    N    2.401   6.946  -8.716 1.00 . A A .  25 ARG N    1 1 
        6  3453 1 1 25 ARG NE   N    2.202   4.607 -13.602 1.00 . A A .  25 ARG NE   1 1 
        6  3454 1 1 25 ARG NH1  N    3.901   4.780 -15.144 1.00 . A A .  25 ARG NH1  1 1 
        6  3455 1 1 25 ARG NH2  N    1.816   5.597 -15.642 1.00 . A A .  25 ARG NH2  1 1 
        6  3456 1 1 25 ARG O    O    2.930   3.754  -7.679 1.00 . A A .  25 ARG O    1 1 
        6  3457 1 1 26 SER C    C    5.226   3.941  -6.369 1.00 . A A .  26 SER C    1 1 
        6  3458 1 1 26 SER CA   C    5.650   4.274  -7.796 1.00 . A A .  26 SER CA   1 1 
        6  3459 1 1 26 SER CB   C    6.953   5.075  -7.779 1.00 . A A .  26 SER CB   1 1 
        6  3460 1 1 26 SER H    H    4.856   5.780  -9.054 1.00 . A A .  26 SER H    1 1 
        6  3461 1 1 26 SER HA   H    5.812   3.352  -8.336 1.00 . A A .  26 SER HA   1 1 
        6  3462 1 1 26 SER HB2  H    7.760   4.439  -7.447 1.00 . A A .  26 SER HB2  1 1 
        6  3463 1 1 26 SER HB3  H    7.165   5.434  -8.776 1.00 . A A .  26 SER HB3  1 1 
        6  3464 1 1 26 SER HG   H    6.736   6.988  -7.417 1.00 . A A .  26 SER HG   1 1 
        6  3465 1 1 26 SER N    N    4.606   5.020  -8.487 1.00 . A A .  26 SER N    1 1 
        6  3466 1 1 26 SER O    O    5.407   2.816  -5.903 1.00 . A A .  26 SER O    1 1 
        6  3467 1 1 26 SER OG   O    6.858   6.186  -6.904 1.00 . A A .  26 SER OG   1 1 
        6  3468 1 1 27 SER C    C    3.237   3.574  -4.204 1.00 . A A .  27 SER C    1 1 
        6  3469 1 1 27 SER CA   C    4.215   4.742  -4.305 1.00 . A A .  27 SER CA   1 1 
        6  3470 1 1 27 SER CB   C    3.555   6.020  -3.784 1.00 . A A .  27 SER CB   1 1 
        6  3471 1 1 27 SER H    H    4.545   5.802  -6.108 1.00 . A A .  27 SER H    1 1 
        6  3472 1 1 27 SER HA   H    5.083   4.523  -3.701 1.00 . A A .  27 SER HA   1 1 
        6  3473 1 1 27 SER HB2  H    2.898   6.418  -4.542 1.00 . A A .  27 SER HB2  1 1 
        6  3474 1 1 27 SER HB3  H    2.983   5.790  -2.896 1.00 . A A .  27 SER HB3  1 1 
        6  3475 1 1 27 SER HG   H    5.320   6.847  -3.978 1.00 . A A .  27 SER HG   1 1 
        6  3476 1 1 27 SER N    N    4.661   4.927  -5.681 1.00 . A A .  27 SER N    1 1 
        6  3477 1 1 27 SER O    O    3.388   2.695  -3.355 1.00 . A A .  27 SER O    1 1 
        6  3478 1 1 27 SER OG   O    4.526   7.000  -3.461 1.00 . A A .  27 SER OG   1 1 
        6  3479 1 1 28 LEU C    C    1.889   1.143  -5.221 1.00 . A A .  28 LEU C    1 1 
        6  3480 1 1 28 LEU CA   C    1.233   2.513  -5.088 1.00 . A A .  28 LEU CA   1 1 
        6  3481 1 1 28 LEU CB   C    0.245   2.732  -6.235 1.00 . A A .  28 LEU CB   1 1 
        6  3482 1 1 28 LEU CD1  C   -1.830   1.527  -5.508 1.00 . A A .  28 LEU CD1  1 1 
        6  3483 1 1 28 LEU CD2  C   -1.269   1.691  -7.940 1.00 . A A .  28 LEU CD2  1 1 
        6  3484 1 1 28 LEU CG   C   -0.706   1.571  -6.532 1.00 . A A .  28 LEU CG   1 1 
        6  3485 1 1 28 LEU H    H    2.169   4.299  -5.730 1.00 . A A .  28 LEU H    1 1 
        6  3486 1 1 28 LEU HA   H    0.698   2.554  -4.151 1.00 . A A .  28 LEU HA   1 1 
        6  3487 1 1 28 LEU HB2  H   -0.354   3.597  -5.995 1.00 . A A .  28 LEU HB2  1 1 
        6  3488 1 1 28 LEU HB3  H    0.817   2.929  -7.130 1.00 . A A .  28 LEU HB3  1 1 
        6  3489 1 1 28 LEU HD11 H   -2.680   1.011  -5.929 1.00 . A A .  28 LEU HD11 1 1 
        6  3490 1 1 28 LEU HD12 H   -2.116   2.535  -5.244 1.00 . A A .  28 LEU HD12 1 1 
        6  3491 1 1 28 LEU HD13 H   -1.492   1.006  -4.625 1.00 . A A .  28 LEU HD13 1 1 
        6  3492 1 1 28 LEU HD21 H   -0.501   2.056  -8.605 1.00 . A A .  28 LEU HD21 1 1 
        6  3493 1 1 28 LEU HD22 H   -2.102   2.379  -7.938 1.00 . A A .  28 LEU HD22 1 1 
        6  3494 1 1 28 LEU HD23 H   -1.606   0.721  -8.277 1.00 . A A .  28 LEU HD23 1 1 
        6  3495 1 1 28 LEU HG   H   -0.160   0.641  -6.467 1.00 . A A .  28 LEU HG   1 1 
        6  3496 1 1 28 LEU N    N    2.236   3.572  -5.077 1.00 . A A .  28 LEU N    1 1 
        6  3497 1 1 28 LEU O    O    1.502   0.190  -4.545 1.00 . A A .  28 LEU O    1 1 
        6  3498 1 1 29 ALA C    C    4.192  -0.728  -5.012 1.00 . A A .  29 ALA C    1 1 
        6  3499 1 1 29 ALA CA   C    3.599  -0.201  -6.314 1.00 . A A .  29 ALA CA   1 1 
        6  3500 1 1 29 ALA CB   C    4.691  -0.011  -7.356 1.00 . A A .  29 ALA CB   1 1 
        6  3501 1 1 29 ALA H    H    3.148   1.847  -6.605 1.00 . A A .  29 ALA H    1 1 
        6  3502 1 1 29 ALA HA   H    2.893  -0.924  -6.695 1.00 . A A .  29 ALA HA   1 1 
        6  3503 1 1 29 ALA HB1  H    4.701   1.017  -7.684 1.00 . A A .  29 ALA HB1  1 1 
        6  3504 1 1 29 ALA HB2  H    5.648  -0.260  -6.922 1.00 . A A .  29 ALA HB2  1 1 
        6  3505 1 1 29 ALA HB3  H    4.499  -0.657  -8.200 1.00 . A A .  29 ALA HB3  1 1 
        6  3506 1 1 29 ALA N    N    2.886   1.052  -6.096 1.00 . A A .  29 ALA N    1 1 
        6  3507 1 1 29 ALA O    O    4.004  -1.893  -4.661 1.00 . A A .  29 ALA O    1 1 
        6  3508 1 1 30 ILE C    C    4.575  -1.069  -2.183 1.00 . A A .  30 ILE C    1 1 
        6  3509 1 1 30 ILE CA   C    5.531  -0.245  -3.039 1.00 . A A .  30 ILE CA   1 1 
        6  3510 1 1 30 ILE CB   C    5.982   0.991  -2.239 1.00 . A A .  30 ILE CB   1 1 
        6  3511 1 1 30 ILE CD1  C    8.154   1.138  -3.559 1.00 . A A .  30 ILE CD1  1 1 
        6  3512 1 1 30 ILE CG1  C    6.912   1.862  -3.086 1.00 . A A .  30 ILE CG1  1 1 
        6  3513 1 1 30 ILE CG2  C    6.673   0.566  -0.952 1.00 . A A .  30 ILE CG2  1 1 
        6  3514 1 1 30 ILE H    H    5.024   1.050  -4.634 1.00 . A A .  30 ILE H    1 1 
        6  3515 1 1 30 ILE HA   H    6.403  -0.842  -3.263 1.00 . A A .  30 ILE HA   1 1 
        6  3516 1 1 30 ILE HB   H    5.105   1.563  -1.977 1.00 . A A .  30 ILE HB   1 1 
        6  3517 1 1 30 ILE HD11 H    9.031   1.659  -3.203 1.00 . A A .  30 ILE HD11 1 1 
        6  3518 1 1 30 ILE HD12 H    8.153   0.130  -3.172 1.00 . A A .  30 ILE HD12 1 1 
        6  3519 1 1 30 ILE HD13 H    8.166   1.110  -4.638 1.00 . A A .  30 ILE HD13 1 1 
        6  3520 1 1 30 ILE HG12 H    6.378   2.207  -3.957 1.00 . A A .  30 ILE HG12 1 1 
        6  3521 1 1 30 ILE HG13 H    7.227   2.714  -2.501 1.00 . A A .  30 ILE HG13 1 1 
        6  3522 1 1 30 ILE HG21 H    6.474  -0.479  -0.765 1.00 . A A .  30 ILE HG21 1 1 
        6  3523 1 1 30 ILE HG22 H    7.738   0.717  -1.048 1.00 . A A .  30 ILE HG22 1 1 
        6  3524 1 1 30 ILE HG23 H    6.298   1.156  -0.130 1.00 . A A .  30 ILE HG23 1 1 
        6  3525 1 1 30 ILE N    N    4.910   0.135  -4.302 1.00 . A A .  30 ILE N    1 1 
        6  3526 1 1 30 ILE O    O    4.996  -1.967  -1.453 1.00 . A A .  30 ILE O    1 1 
        6  3527 1 1 31 HIS C    C    1.847  -2.751  -2.235 1.00 . A A .  31 HIS C    1 1 
        6  3528 1 1 31 HIS CA   C    2.269  -1.474  -1.515 1.00 . A A .  31 HIS CA   1 1 
        6  3529 1 1 31 HIS CB   C    1.052  -0.578  -1.285 1.00 . A A .  31 HIS CB   1 1 
        6  3530 1 1 31 HIS CD2  C   -1.342  -1.438  -1.790 1.00 . A A .  31 HIS CD2  1 1 
        6  3531 1 1 31 HIS CE1  C   -1.628  -2.663   0.006 1.00 . A A .  31 HIS CE1  1 1 
        6  3532 1 1 31 HIS CG   C   -0.215  -1.339  -1.046 1.00 . A A .  31 HIS CG   1 1 
        6  3533 1 1 31 HIS H    H    3.013  -0.034  -2.878 1.00 . A A .  31 HIS H    1 1 
        6  3534 1 1 31 HIS HA   H    2.697  -1.738  -0.560 1.00 . A A .  31 HIS HA   1 1 
        6  3535 1 1 31 HIS HB2  H    1.231   0.046  -0.421 1.00 . A A .  31 HIS HB2  1 1 
        6  3536 1 1 31 HIS HB3  H    0.905   0.049  -2.152 1.00 . A A .  31 HIS HB3  1 1 
        6  3537 1 1 31 HIS HD1  H    0.209  -2.251   0.805 1.00 . A A .  31 HIS HD1  1 1 
        6  3538 1 1 31 HIS HD2  H   -1.529  -0.956  -2.739 1.00 . A A .  31 HIS HD2  1 1 
        6  3539 1 1 31 HIS HE1  H   -2.066  -3.320   0.742 1.00 . A A .  31 HIS HE1  1 1 
        6  3540 1 1 31 HIS N    N    3.286  -0.760  -2.279 1.00 . A A .  31 HIS N    1 1 
        6  3541 1 1 31 HIS ND1  N   -0.427  -2.117   0.073 1.00 . A A .  31 HIS ND1  1 1 
        6  3542 1 1 31 HIS NE2  N   -2.205  -2.266  -1.114 1.00 . A A .  31 HIS NE2  1 1 
        6  3543 1 1 31 HIS O    O    1.664  -3.795  -1.608 1.00 . A A .  31 HIS O    1 1 
        6  3544 1 1 32 GLN C    C    2.137  -5.032  -4.018 1.00 . A A .  32 GLN C    1 1 
        6  3545 1 1 32 GLN CA   C    1.291  -3.809  -4.355 1.00 . A A .  32 GLN CA   1 1 
        6  3546 1 1 32 GLN CB   C    1.413  -3.484  -5.844 1.00 . A A .  32 GLN CB   1 1 
        6  3547 1 1 32 GLN CD   C   -0.964  -2.891  -6.463 1.00 . A A .  32 GLN CD   1 1 
        6  3548 1 1 32 GLN CG   C    0.460  -2.394  -6.309 1.00 . A A .  32 GLN CG   1 1 
        6  3549 1 1 32 GLN H    H    1.854  -1.801  -3.993 1.00 . A A .  32 GLN H    1 1 
        6  3550 1 1 32 GLN HA   H    0.259  -4.027  -4.127 1.00 . A A .  32 GLN HA   1 1 
        6  3551 1 1 32 GLN HB2  H    2.423  -3.161  -6.049 1.00 . A A .  32 GLN HB2  1 1 
        6  3552 1 1 32 GLN HB3  H    1.207  -4.378  -6.414 1.00 . A A .  32 GLN HB3  1 1 
        6  3553 1 1 32 GLN HE21 H   -1.625  -1.022  -6.617 1.00 . A A .  32 GLN HE21 1 1 
        6  3554 1 1 32 GLN HE22 H   -2.830  -2.255  -6.714 1.00 . A A .  32 GLN HE22 1 1 
        6  3555 1 1 32 GLN HG2  H    0.469  -1.593  -5.586 1.00 . A A .  32 GLN HG2  1 1 
        6  3556 1 1 32 GLN HG3  H    0.800  -2.020  -7.264 1.00 . A A .  32 GLN HG3  1 1 
        6  3557 1 1 32 GLN N    N    1.694  -2.660  -3.552 1.00 . A A .  32 GLN N    1 1 
        6  3558 1 1 32 GLN NE2  N   -1.902  -1.962  -6.612 1.00 . A A .  32 GLN NE2  1 1 
        6  3559 1 1 32 GLN O    O    1.752  -6.164  -4.308 1.00 . A A .  32 GLN O    1 1 
        6  3560 1 1 32 GLN OE1  O   -1.219  -4.095  -6.446 1.00 . A A .  32 GLN OE1  1 1 
        6  3561 1 1 33 ALA C    C    3.702  -6.587  -1.769 1.00 . A A .  33 ALA C    1 1 
        6  3562 1 1 33 ALA CA   C    4.193  -5.878  -3.027 1.00 . A A .  33 ALA CA   1 1 
        6  3563 1 1 33 ALA CB   C    5.602  -5.344  -2.818 1.00 . A A .  33 ALA CB   1 1 
        6  3564 1 1 33 ALA H    H    3.544  -3.871  -3.200 1.00 . A A .  33 ALA H    1 1 
        6  3565 1 1 33 ALA HA   H    4.220  -6.588  -3.841 1.00 . A A .  33 ALA HA   1 1 
        6  3566 1 1 33 ALA HB1  H    5.635  -4.762  -1.909 1.00 . A A .  33 ALA HB1  1 1 
        6  3567 1 1 33 ALA HB2  H    6.292  -6.171  -2.741 1.00 . A A .  33 ALA HB2  1 1 
        6  3568 1 1 33 ALA HB3  H    5.878  -4.720  -3.655 1.00 . A A .  33 ALA HB3  1 1 
        6  3569 1 1 33 ALA N    N    3.293  -4.795  -3.405 1.00 . A A .  33 ALA N    1 1 
        6  3570 1 1 33 ALA O    O    4.403  -7.425  -1.202 1.00 . A A .  33 ALA O    1 1 
        6  3571 1 1 34 THR C    C    0.782  -7.807  -0.509 1.00 . A A .  34 THR C    1 1 
        6  3572 1 1 34 THR CA   C    1.908  -6.846  -0.144 1.00 . A A .  34 THR CA   1 1 
        6  3573 1 1 34 THR CB   C    1.361  -5.773   0.816 1.00 . A A .  34 THR CB   1 1 
        6  3574 1 1 34 THR CG2  C   -0.026  -5.320   0.388 1.00 . A A .  34 THR CG2  1 1 
        6  3575 1 1 34 THR H    H    1.982  -5.569  -1.831 1.00 . A A .  34 THR H    1 1 
        6  3576 1 1 34 THR HA   H    2.686  -7.395   0.367 1.00 . A A .  34 THR HA   1 1 
        6  3577 1 1 34 THR HB   H    2.025  -4.921   0.795 1.00 . A A .  34 THR HB   1 1 
        6  3578 1 1 34 THR HG1  H    1.963  -6.987   2.250 1.00 . A A .  34 THR HG1  1 1 
        6  3579 1 1 34 THR HG21 H   -0.699  -6.164   0.395 1.00 . A A .  34 THR HG21 1 1 
        6  3580 1 1 34 THR HG22 H    0.022  -4.907  -0.609 1.00 . A A .  34 THR HG22 1 1 
        6  3581 1 1 34 THR HG23 H   -0.386  -4.566   1.072 1.00 . A A .  34 THR HG23 1 1 
        6  3582 1 1 34 THR N    N    2.492  -6.244  -1.336 1.00 . A A .  34 THR N    1 1 
        6  3583 1 1 34 THR O    O    0.564  -8.810   0.171 1.00 . A A .  34 THR O    1 1 
        6  3584 1 1 34 THR OG1  O    1.308  -6.291   2.150 1.00 . A A .  34 THR OG1  1 1 
        6  3585 1 1 35 HIS C    C   -0.528  -9.701  -2.489 1.00 . A A .  35 HIS C    1 1 
        6  3586 1 1 35 HIS CA   C   -1.033  -8.332  -2.044 1.00 . A A .  35 HIS CA   1 1 
        6  3587 1 1 35 HIS CB   C   -1.777  -7.652  -3.193 1.00 . A A .  35 HIS CB   1 1 
        6  3588 1 1 35 HIS CD2  C   -2.710  -5.280  -2.710 1.00 . A A .  35 HIS CD2  1 1 
        6  3589 1 1 35 HIS CE1  C   -4.673  -5.861  -1.927 1.00 . A A .  35 HIS CE1  1 1 
        6  3590 1 1 35 HIS CG   C   -2.776  -6.632  -2.740 1.00 . A A .  35 HIS CG   1 1 
        6  3591 1 1 35 HIS H    H    0.293  -6.682  -2.088 1.00 . A A .  35 HIS H    1 1 
        6  3592 1 1 35 HIS HA   H   -1.713  -8.465  -1.216 1.00 . A A .  35 HIS HA   1 1 
        6  3593 1 1 35 HIS HB2  H   -1.061  -7.154  -3.831 1.00 . A A .  35 HIS HB2  1 1 
        6  3594 1 1 35 HIS HB3  H   -2.303  -8.401  -3.767 1.00 . A A .  35 HIS HB3  1 1 
        6  3595 1 1 35 HIS HD1  H   -4.367  -7.873  -2.137 1.00 . A A .  35 HIS HD1  1 1 
        6  3596 1 1 35 HIS HD2  H   -1.875  -4.671  -3.028 1.00 . A A .  35 HIS HD2  1 1 
        6  3597 1 1 35 HIS HE1  H   -5.670  -5.814  -1.515 1.00 . A A .  35 HIS HE1  1 1 
        6  3598 1 1 35 HIS N    N    0.070  -7.495  -1.587 1.00 . A A .  35 HIS N    1 1 
        6  3599 1 1 35 HIS ND1  N   -4.018  -6.964  -2.242 1.00 . A A .  35 HIS ND1  1 1 
        6  3600 1 1 35 HIS NE2  N   -3.901  -4.825  -2.201 1.00 . A A .  35 HIS NE2  1 1 
        6  3601 1 1 35 HIS O    O   -0.113  -9.878  -3.634 1.00 . A A .  35 HIS O    1 1 
        6  3602 1 1 36 SER C    C   -0.564 -12.453  -3.262 1.00 . A A .  36 SER C    1 1 
        6  3603 1 1 36 SER CA   C   -0.109 -12.019  -1.872 1.00 . A A .  36 SER CA   1 1 
        6  3604 1 1 36 SER CB   C   -0.633 -13.000  -0.822 1.00 . A A .  36 SER CB   1 1 
        6  3605 1 1 36 SER H    H   -0.909 -10.463  -0.680 1.00 . A A .  36 SER H    1 1 
        6  3606 1 1 36 SER HA   H    0.971 -12.017  -1.844 1.00 . A A .  36 SER HA   1 1 
        6  3607 1 1 36 SER HB2  H   -0.159 -13.959  -0.961 1.00 . A A .  36 SER HB2  1 1 
        6  3608 1 1 36 SER HB3  H   -0.402 -12.624   0.164 1.00 . A A .  36 SER HB3  1 1 
        6  3609 1 1 36 SER HG   H   -2.278 -14.048  -0.651 1.00 . A A .  36 SER HG   1 1 
        6  3610 1 1 36 SER N    N   -0.567 -10.666  -1.575 1.00 . A A .  36 SER N    1 1 
        6  3611 1 1 36 SER O    O   -1.547 -11.940  -3.795 1.00 . A A .  36 SER O    1 1 
        6  3612 1 1 36 SER OG   O   -2.036 -13.163  -0.932 1.00 . A A .  36 SER OG   1 1 
        6  3613 1 1 37 GLY C    C    1.037 -14.114  -6.039 1.00 . A A .  37 GLY C    1 1 
        6  3614 1 1 37 GLY CA   C   -0.183 -13.893  -5.167 1.00 . A A .  37 GLY CA   1 1 
        6  3615 1 1 37 GLY H    H    0.934 -13.778  -3.372 1.00 . A A .  37 GLY H    1 1 
        6  3616 1 1 37 GLY HA2  H   -0.715 -14.827  -5.067 1.00 . A A .  37 GLY HA2  1 1 
        6  3617 1 1 37 GLY HA3  H   -0.829 -13.173  -5.648 1.00 . A A .  37 GLY HA3  1 1 
        6  3618 1 1 37 GLY N    N    0.160 -13.404  -3.845 1.00 . A A .  37 GLY N    1 1 
        6  3619 1 1 37 GLY O    O    1.431 -15.253  -6.288 1.00 . A A .  37 GLY O    1 1 
        6  3620 1 1 38 GLU C    C    4.034 -12.508  -6.655 1.00 . A A .  38 GLU C    1 1 
        6  3621 1 1 38 GLU CA   C    2.816 -13.103  -7.357 1.00 . A A .  38 GLU CA   1 1 
        6  3622 1 1 38 GLU CB   C    2.569 -12.374  -8.679 1.00 . A A .  38 GLU CB   1 1 
        6  3623 1 1 38 GLU CD   C    3.582 -11.711 -10.897 1.00 . A A .  38 GLU CD   1 1 
        6  3624 1 1 38 GLU CG   C    3.584 -12.713  -9.759 1.00 . A A .  38 GLU CG   1 1 
        6  3625 1 1 38 GLU H    H    1.273 -12.142  -6.272 1.00 . A A .  38 GLU H    1 1 
        6  3626 1 1 38 GLU HA   H    3.007 -14.146  -7.561 1.00 . A A .  38 GLU HA   1 1 
        6  3627 1 1 38 GLU HB2  H    1.586 -12.635  -9.043 1.00 . A A .  38 GLU HB2  1 1 
        6  3628 1 1 38 GLU HB3  H    2.606 -11.310  -8.502 1.00 . A A .  38 GLU HB3  1 1 
        6  3629 1 1 38 GLU HG2  H    4.569 -12.731  -9.317 1.00 . A A .  38 GLU HG2  1 1 
        6  3630 1 1 38 GLU HG3  H    3.352 -13.690 -10.159 1.00 . A A .  38 GLU HG3  1 1 
        6  3631 1 1 38 GLU N    N    1.635 -13.022  -6.505 1.00 . A A .  38 GLU N    1 1 
        6  3632 1 1 38 GLU O    O    4.386 -11.349  -6.873 1.00 . A A .  38 GLU O    1 1 
        6  3633 1 1 38 GLU OE1  O    4.324 -10.710 -10.806 1.00 . A A .  38 GLU OE1  1 1 
        6  3634 1 1 38 GLU OE2  O    2.838 -11.926 -11.876 1.00 . A A .  38 GLU OE2  1 1 
        6  3635 1 1 39 LYS C    C    7.066 -13.720  -5.430 1.00 . A A .  39 LYS C    1 1 
        6  3636 1 1 39 LYS CA   C    5.852 -12.867  -5.077 1.00 . A A .  39 LYS CA   1 1 
        6  3637 1 1 39 LYS CB   C    5.593 -12.929  -3.570 1.00 . A A .  39 LYS CB   1 1 
        6  3638 1 1 39 LYS CD   C    6.843 -11.068  -2.436 1.00 . A A .  39 LYS CD   1 1 
        6  3639 1 1 39 LYS CE   C    6.103 -10.733  -1.150 1.00 . A A .  39 LYS CE   1 1 
        6  3640 1 1 39 LYS CG   C    6.803 -12.559  -2.729 1.00 . A A .  39 LYS CG   1 1 
        6  3641 1 1 39 LYS H    H    4.344 -14.225  -5.679 1.00 . A A .  39 LYS H    1 1 
        6  3642 1 1 39 LYS HA   H    6.052 -11.844  -5.357 1.00 . A A .  39 LYS HA   1 1 
        6  3643 1 1 39 LYS HB2  H    4.790 -12.249  -3.326 1.00 . A A .  39 LYS HB2  1 1 
        6  3644 1 1 39 LYS HB3  H    5.294 -13.934  -3.309 1.00 . A A .  39 LYS HB3  1 1 
        6  3645 1 1 39 LYS HD2  H    7.872 -10.757  -2.337 1.00 . A A .  39 LYS HD2  1 1 
        6  3646 1 1 39 LYS HD3  H    6.381 -10.536  -3.256 1.00 . A A .  39 LYS HD3  1 1 
        6  3647 1 1 39 LYS HE2  H    6.609 -11.210  -0.324 1.00 . A A .  39 LYS HE2  1 1 
        6  3648 1 1 39 LYS HE3  H    6.117  -9.662  -1.011 1.00 . A A .  39 LYS HE3  1 1 
        6  3649 1 1 39 LYS HG2  H    6.758 -13.098  -1.794 1.00 . A A .  39 LYS HG2  1 1 
        6  3650 1 1 39 LYS HG3  H    7.700 -12.836  -3.264 1.00 . A A .  39 LYS HG3  1 1 
        6  3651 1 1 39 LYS HZ1  H    4.651 -12.210  -1.428 1.00 . A A .  39 LYS HZ1  1 1 
        6  3652 1 1 39 LYS HZ2  H    4.155 -10.663  -1.899 1.00 . A A .  39 LYS HZ2  1 1 
        6  3653 1 1 39 LYS HZ3  H    4.243 -11.059  -0.257 1.00 . A A .  39 LYS HZ3  1 1 
        6  3654 1 1 39 LYS N    N    4.673 -13.311  -5.811 1.00 . A A .  39 LYS N    1 1 
        6  3655 1 1 39 LYS NZ   N    4.689 -11.199  -1.186 1.00 . A A .  39 LYS NZ   1 1 
        6  3656 1 1 39 LYS O    O    7.478 -14.600  -4.674 1.00 . A A .  39 LYS O    1 1 
        6  3657 1 1 40 PRO C    C   10.083 -13.865  -6.273 1.00 . A A .  40 PRO C    1 1 
        6  3658 1 1 40 PRO CA   C    8.832 -14.185  -7.084 1.00 . A A .  40 PRO CA   1 1 
        6  3659 1 1 40 PRO CB   C    8.991 -13.697  -8.526 1.00 . A A .  40 PRO CB   1 1 
        6  3660 1 1 40 PRO CD   C    7.219 -12.418  -7.557 1.00 . A A .  40 PRO CD   1 1 
        6  3661 1 1 40 PRO CG   C    8.352 -12.351  -8.543 1.00 . A A .  40 PRO CG   1 1 
        6  3662 1 1 40 PRO HA   H    8.665 -15.252  -7.080 1.00 . A A .  40 PRO HA   1 1 
        6  3663 1 1 40 PRO HB2  H   10.041 -13.640  -8.776 1.00 . A A .  40 PRO HB2  1 1 
        6  3664 1 1 40 PRO HB3  H    8.491 -14.379  -9.198 1.00 . A A .  40 PRO HB3  1 1 
        6  3665 1 1 40 PRO HD2  H    7.093 -11.467  -7.061 1.00 . A A .  40 PRO HD2  1 1 
        6  3666 1 1 40 PRO HD3  H    6.305 -12.712  -8.052 1.00 . A A .  40 PRO HD3  1 1 
        6  3667 1 1 40 PRO HG2  H    9.067 -11.601  -8.242 1.00 . A A .  40 PRO HG2  1 1 
        6  3668 1 1 40 PRO HG3  H    7.975 -12.136  -9.532 1.00 . A A .  40 PRO HG3  1 1 
        6  3669 1 1 40 PRO N    N    7.655 -13.454  -6.605 1.00 . A A .  40 PRO N    1 1 
        6  3670 1 1 40 PRO O    O   11.172 -14.354  -6.574 1.00 . A A .  40 PRO O    1 1 
        6  3671 1 1 41 SER C    C   11.185 -13.616  -3.215 1.00 . A A .  41 SER C    1 1 
        6  3672 1 1 41 SER CA   C   11.038 -12.653  -4.390 1.00 . A A .  41 SER CA   1 1 
        6  3673 1 1 41 SER CB   C   10.841 -11.227  -3.873 1.00 . A A .  41 SER CB   1 1 
        6  3674 1 1 41 SER H    H    9.027 -12.684  -5.053 1.00 . A A .  41 SER H    1 1 
        6  3675 1 1 41 SER HA   H   11.938 -12.691  -4.985 1.00 . A A .  41 SER HA   1 1 
        6  3676 1 1 41 SER HB2  H   10.321 -10.645  -4.619 1.00 . A A .  41 SER HB2  1 1 
        6  3677 1 1 41 SER HB3  H   10.256 -11.253  -2.965 1.00 . A A .  41 SER HB3  1 1 
        6  3678 1 1 41 SER HG   H   11.946  -9.677  -3.409 1.00 . A A .  41 SER HG   1 1 
        6  3679 1 1 41 SER N    N    9.920 -13.041  -5.243 1.00 . A A .  41 SER N    1 1 
        6  3680 1 1 41 SER O    O   12.176 -14.336  -3.109 1.00 . A A .  41 SER O    1 1 
        6  3681 1 1 41 SER OG   O   12.086 -10.608  -3.597 1.00 . A A .  41 SER OG   1 1 
        6  3682 1 1 42 GLY C    C    9.186 -14.130  -0.138 1.00 . A A .  42 GLY C    1 1 
        6  3683 1 1 42 GLY CA   C   10.225 -14.498  -1.179 1.00 . A A .  42 GLY CA   1 1 
        6  3684 1 1 42 GLY H    H    9.422 -13.025  -2.471 1.00 . A A .  42 GLY H    1 1 
        6  3685 1 1 42 GLY HA2  H   10.049 -15.513  -1.505 1.00 . A A .  42 GLY HA2  1 1 
        6  3686 1 1 42 GLY HA3  H   11.205 -14.440  -0.728 1.00 . A A .  42 GLY HA3  1 1 
        6  3687 1 1 42 GLY N    N   10.188 -13.622  -2.335 1.00 . A A .  42 GLY N    1 1 
        6  3688 1 1 42 GLY O    O    9.471 -13.430   0.834 1.00 . A A .  42 GLY O    1 1 
        6  3689 1 1 43 PRO C    C    7.002 -15.049   1.916 1.00 . A A .  43 PRO C    1 1 
        6  3690 1 1 43 PRO CA   C    6.838 -14.334   0.579 1.00 . A A .  43 PRO CA   1 1 
        6  3691 1 1 43 PRO CB   C    5.618 -14.875  -0.170 1.00 . A A .  43 PRO CB   1 1 
        6  3692 1 1 43 PRO CD   C    7.537 -15.446  -1.476 1.00 . A A .  43 PRO CD   1 1 
        6  3693 1 1 43 PRO CG   C    6.165 -15.918  -1.081 1.00 . A A .  43 PRO CG   1 1 
        6  3694 1 1 43 PRO HA   H    6.716 -13.274   0.752 1.00 . A A .  43 PRO HA   1 1 
        6  3695 1 1 43 PRO HB2  H    4.915 -15.295   0.536 1.00 . A A .  43 PRO HB2  1 1 
        6  3696 1 1 43 PRO HB3  H    5.147 -14.076  -0.723 1.00 . A A .  43 PRO HB3  1 1 
        6  3697 1 1 43 PRO HD2  H    8.205 -16.286  -1.596 1.00 . A A .  43 PRO HD2  1 1 
        6  3698 1 1 43 PRO HD3  H    7.489 -14.865  -2.385 1.00 . A A .  43 PRO HD3  1 1 
        6  3699 1 1 43 PRO HG2  H    6.228 -16.863  -0.562 1.00 . A A .  43 PRO HG2  1 1 
        6  3700 1 1 43 PRO HG3  H    5.535 -16.010  -1.954 1.00 . A A .  43 PRO HG3  1 1 
        6  3701 1 1 43 PRO N    N    7.948 -14.606  -0.338 1.00 . A A .  43 PRO N    1 1 
        6  3702 1 1 43 PRO O    O    7.504 -16.171   1.973 1.00 . A A .  43 PRO O    1 1 
        6  3703 1 1 44 SER C    C    5.970 -14.083   5.351 1.00 . A A .  44 SER C    1 1 
        6  3704 1 1 44 SER CA   C    6.679 -14.964   4.327 1.00 . A A .  44 SER CA   1 1 
        6  3705 1 1 44 SER CB   C    8.148 -15.139   4.718 1.00 . A A .  44 SER CB   1 1 
        6  3706 1 1 44 SER H    H    6.185 -13.500   2.880 1.00 . A A .  44 SER H    1 1 
        6  3707 1 1 44 SER HA   H    6.202 -15.932   4.311 1.00 . A A .  44 SER HA   1 1 
        6  3708 1 1 44 SER HB2  H    8.206 -15.545   5.716 1.00 . A A .  44 SER HB2  1 1 
        6  3709 1 1 44 SER HB3  H    8.623 -15.819   4.025 1.00 . A A .  44 SER HB3  1 1 
        6  3710 1 1 44 SER HG   H    9.780 -14.060   4.622 1.00 . A A .  44 SER HG   1 1 
        6  3711 1 1 44 SER N    N    6.576 -14.392   2.990 1.00 . A A .  44 SER N    1 1 
        6  3712 1 1 44 SER O    O    6.040 -12.856   5.285 1.00 . A A .  44 SER O    1 1 
        6  3713 1 1 44 SER OG   O    8.835 -13.901   4.687 1.00 . A A .  44 SER OG   1 1 
        6  3714 1 1 45 SER C    C    5.529 -13.277   8.274 1.00 . A A .  45 SER C    1 1 
        6  3715 1 1 45 SER CA   C    4.563 -13.994   7.335 1.00 . A A .  45 SER CA   1 1 
        6  3716 1 1 45 SER CB   C    3.677 -14.953   8.133 1.00 . A A .  45 SER CB   1 1 
        6  3717 1 1 45 SER H    H    5.271 -15.699   6.298 1.00 . A A .  45 SER H    1 1 
        6  3718 1 1 45 SER HA   H    3.938 -13.259   6.851 1.00 . A A .  45 SER HA   1 1 
        6  3719 1 1 45 SER HB2  H    4.300 -15.631   8.696 1.00 . A A .  45 SER HB2  1 1 
        6  3720 1 1 45 SER HB3  H    3.057 -14.385   8.812 1.00 . A A .  45 SER HB3  1 1 
        6  3721 1 1 45 SER HG   H    2.705 -16.582   7.646 1.00 . A A .  45 SER HG   1 1 
        6  3722 1 1 45 SER N    N    5.288 -14.719   6.299 1.00 . A A .  45 SER N    1 1 
        6  3723 1 1 45 SER O    O    6.352 -13.907   8.936 1.00 . A A .  45 SER O    1 1 
        6  3724 1 1 45 SER OG   O    2.840 -15.708   7.274 1.00 . A A .  45 SER OG   1 1 
        6  3725 1 1 46 GLY C    C    7.695 -11.044   8.628 1.00 . A A .  46 GLY C    1 1 
        6  3726 1 1 46 GLY CA   C    6.290 -11.170   9.184 1.00 . A A .  46 GLY CA   1 1 
        6  3727 1 1 46 GLY H    H    4.746 -11.503   7.774 1.00 . A A .  46 GLY H    1 1 
        6  3728 1 1 46 GLY HA2  H    5.870 -10.182   9.299 1.00 . A A .  46 GLY HA2  1 1 
        6  3729 1 1 46 GLY HA3  H    6.341 -11.644  10.153 1.00 . A A .  46 GLY HA3  1 1 
        6  3730 1 1 46 GLY N    N    5.421 -11.952   8.325 1.00 . A A .  46 GLY N    1 1 
        6  3731 1 1 46 GLY O    O    8.443 -12.019   8.664 1.00 . A A .  46 GLY O    1 1 
        6  3732 2 2  1 ZN  ZN   ZN  -3.926  -2.779  -1.761 1.00 . B A . 201 ZN  ZN   1 1 
        7  3733 1 1  1 GLY C    C  -20.927   3.552   3.880 1.00 . A A .   1 GLY C    1 1 
        7  3734 1 1  1 GLY CA   C  -21.853   3.311   5.056 1.00 . A A .   1 GLY CA   1 1 
        7  3735 1 1  1 GLY H1   H  -23.110   2.166   3.794 1.00 . A A .   1 GLY H1   1 1 
        7  3736 1 1  1 GLY HA2  H  -22.263   4.257   5.377 1.00 . A A .   1 GLY HA2  1 1 
        7  3737 1 1  1 GLY HA3  H  -21.281   2.884   5.867 1.00 . A A .   1 GLY HA3  1 1 
        7  3738 1 1  1 GLY N    N  -22.944   2.413   4.728 1.00 . A A .   1 GLY N    1 1 
        7  3739 1 1  1 GLY O    O  -21.011   2.862   2.864 1.00 . A A .   1 GLY O    1 1 
        7  3740 1 1  2 SER C    C  -18.043   5.848   3.453 1.00 . A A .   2 SER C    1 1 
        7  3741 1 1  2 SER CA   C  -19.100   4.868   2.954 1.00 . A A .   2 SER CA   1 1 
        7  3742 1 1  2 SER CB   C  -19.841   5.465   1.756 1.00 . A A .   2 SER CB   1 1 
        7  3743 1 1  2 SER H    H  -20.024   5.048   4.851 1.00 . A A .   2 SER H    1 1 
        7  3744 1 1  2 SER HA   H  -18.611   3.956   2.646 1.00 . A A .   2 SER HA   1 1 
        7  3745 1 1  2 SER HB2  H  -20.621   4.787   1.444 1.00 . A A .   2 SER HB2  1 1 
        7  3746 1 1  2 SER HB3  H  -20.279   6.410   2.042 1.00 . A A .   2 SER HB3  1 1 
        7  3747 1 1  2 SER HG   H  -19.060   4.970   0.029 1.00 . A A .   2 SER HG   1 1 
        7  3748 1 1  2 SER N    N  -20.042   4.534   4.016 1.00 . A A .   2 SER N    1 1 
        7  3749 1 1  2 SER O    O  -18.185   6.438   4.524 1.00 . A A .   2 SER O    1 1 
        7  3750 1 1  2 SER OG   O  -18.960   5.680   0.667 1.00 . A A .   2 SER OG   1 1 
        7  3751 1 1  3 SER C    C  -15.053   7.272   1.811 1.00 . A A .   3 SER C    1 1 
        7  3752 1 1  3 SER CA   C  -15.900   6.922   3.031 1.00 . A A .   3 SER CA   1 1 
        7  3753 1 1  3 SER CB   C  -15.021   6.292   4.113 1.00 . A A .   3 SER CB   1 1 
        7  3754 1 1  3 SER H    H  -16.929   5.518   1.826 1.00 . A A .   3 SER H    1 1 
        7  3755 1 1  3 SER HA   H  -16.341   7.828   3.420 1.00 . A A .   3 SER HA   1 1 
        7  3756 1 1  3 SER HB2  H  -15.624   5.645   4.732 1.00 . A A .   3 SER HB2  1 1 
        7  3757 1 1  3 SER HB3  H  -14.237   5.715   3.645 1.00 . A A .   3 SER HB3  1 1 
        7  3758 1 1  3 SER HG   H  -13.916   6.865   5.626 1.00 . A A .   3 SER HG   1 1 
        7  3759 1 1  3 SER N    N  -16.984   6.017   2.668 1.00 . A A .   3 SER N    1 1 
        7  3760 1 1  3 SER O    O  -15.272   6.749   0.719 1.00 . A A .   3 SER O    1 1 
        7  3761 1 1  3 SER OG   O  -14.430   7.286   4.933 1.00 . A A .   3 SER OG   1 1 
        7  3762 1 1  4 GLY C    C  -12.695   9.979   1.084 1.00 . A A .   4 GLY C    1 1 
        7  3763 1 1  4 GLY CA   C  -13.218   8.566   0.915 1.00 . A A .   4 GLY CA   1 1 
        7  3764 1 1  4 GLY H    H  -13.956   8.545   2.900 1.00 . A A .   4 GLY H    1 1 
        7  3765 1 1  4 GLY HA2  H  -12.380   7.887   0.864 1.00 . A A .   4 GLY HA2  1 1 
        7  3766 1 1  4 GLY HA3  H  -13.773   8.508  -0.010 1.00 . A A .   4 GLY HA3  1 1 
        7  3767 1 1  4 GLY N    N  -14.084   8.161   2.007 1.00 . A A .   4 GLY N    1 1 
        7  3768 1 1  4 GLY O    O  -12.566  10.471   2.205 1.00 . A A .   4 GLY O    1 1 
        7  3769 1 1  5 SER C    C  -12.558  12.860  -1.059 1.00 . A A .   5 SER C    1 1 
        7  3770 1 1  5 SER CA   C  -11.873  11.996  -0.004 1.00 . A A .   5 SER CA   1 1 
        7  3771 1 1  5 SER CB   C  -10.361  11.995  -0.232 1.00 . A A .   5 SER CB   1 1 
        7  3772 1 1  5 SER H    H  -12.516  10.187  -0.897 1.00 . A A .   5 SER H    1 1 
        7  3773 1 1  5 SER HA   H  -12.081  12.408   0.973 1.00 . A A .   5 SER HA   1 1 
        7  3774 1 1  5 SER HB2  H  -10.004  13.013  -0.269 1.00 . A A .   5 SER HB2  1 1 
        7  3775 1 1  5 SER HB3  H   -9.877  11.473   0.581 1.00 . A A .   5 SER HB3  1 1 
        7  3776 1 1  5 SER HG   H  -10.123  11.971  -2.177 1.00 . A A .   5 SER HG   1 1 
        7  3777 1 1  5 SER N    N  -12.391  10.633  -0.033 1.00 . A A .   5 SER N    1 1 
        7  3778 1 1  5 SER O    O  -12.442  12.603  -2.257 1.00 . A A .   5 SER O    1 1 
        7  3779 1 1  5 SER OG   O  -10.030  11.350  -1.450 1.00 . A A .   5 SER OG   1 1 
        7  3780 1 1  6 SER C    C  -13.424  16.202  -1.405 1.00 . A A .   6 SER C    1 1 
        7  3781 1 1  6 SER CA   C  -13.979  14.785  -1.506 1.00 . A A .   6 SER CA   1 1 
        7  3782 1 1  6 SER CB   C  -15.476  14.787  -1.190 1.00 . A A .   6 SER CB   1 1 
        7  3783 1 1  6 SER H    H  -13.326  14.037   0.364 1.00 . A A .   6 SER H    1 1 
        7  3784 1 1  6 SER HA   H  -13.833  14.425  -2.514 1.00 . A A .   6 SER HA   1 1 
        7  3785 1 1  6 SER HB2  H  -15.864  13.786  -1.294 1.00 . A A .   6 SER HB2  1 1 
        7  3786 1 1  6 SER HB3  H  -15.625  15.128  -0.175 1.00 . A A .   6 SER HB3  1 1 
        7  3787 1 1  6 SER HG   H  -16.972  15.201  -2.384 1.00 . A A .   6 SER HG   1 1 
        7  3788 1 1  6 SER N    N  -13.272  13.884  -0.603 1.00 . A A .   6 SER N    1 1 
        7  3789 1 1  6 SER O    O  -13.852  16.990  -0.562 1.00 . A A .   6 SER O    1 1 
        7  3790 1 1  6 SER OG   O  -16.182  15.645  -2.069 1.00 . A A .   6 SER OG   1 1 
        7  3791 1 1  7 GLY C    C  -10.366  17.799  -2.470 1.00 . A A .   7 GLY C    1 1 
        7  3792 1 1  7 GLY CA   C  -11.867  17.842  -2.263 1.00 . A A .   7 GLY CA   1 1 
        7  3793 1 1  7 GLY H    H  -12.164  15.851  -2.921 1.00 . A A .   7 GLY H    1 1 
        7  3794 1 1  7 GLY HA2  H  -12.313  18.432  -3.050 1.00 . A A .   7 GLY HA2  1 1 
        7  3795 1 1  7 GLY HA3  H  -12.074  18.312  -1.313 1.00 . A A .   7 GLY HA3  1 1 
        7  3796 1 1  7 GLY N    N  -12.466  16.520  -2.271 1.00 . A A .   7 GLY N    1 1 
        7  3797 1 1  7 GLY O    O   -9.835  18.464  -3.361 1.00 . A A .   7 GLY O    1 1 
        7  3798 1 1  8 THR C    C   -7.835  15.719  -2.630 1.00 . A A .   8 THR C    1 1 
        7  3799 1 1  8 THR CA   C   -8.229  16.893  -1.740 1.00 . A A .   8 THR CA   1 1 
        7  3800 1 1  8 THR CB   C   -7.589  16.707  -0.351 1.00 . A A .   8 THR CB   1 1 
        7  3801 1 1  8 THR CG2  C   -7.791  17.946   0.508 1.00 . A A .   8 THR CG2  1 1 
        7  3802 1 1  8 THR H    H  -10.158  16.512  -0.955 1.00 . A A .   8 THR H    1 1 
        7  3803 1 1  8 THR HA   H   -7.844  17.805  -2.172 1.00 . A A .   8 THR HA   1 1 
        7  3804 1 1  8 THR HB   H   -6.528  16.545  -0.479 1.00 . A A .   8 THR HB   1 1 
        7  3805 1 1  8 THR HG1  H   -7.466  14.937   0.511 1.00 . A A .   8 THR HG1  1 1 
        7  3806 1 1  8 THR HG21 H   -6.903  18.125   1.095 1.00 . A A .   8 THR HG21 1 1 
        7  3807 1 1  8 THR HG22 H   -8.633  17.793   1.167 1.00 . A A .   8 THR HG22 1 1 
        7  3808 1 1  8 THR HG23 H   -7.981  18.798  -0.128 1.00 . A A .   8 THR HG23 1 1 
        7  3809 1 1  8 THR N    N   -9.678  17.017  -1.645 1.00 . A A .   8 THR N    1 1 
        7  3810 1 1  8 THR O    O   -8.625  14.802  -2.850 1.00 . A A .   8 THR O    1 1 
        7  3811 1 1  8 THR OG1  O   -8.159  15.568   0.303 1.00 . A A .   8 THR OG1  1 1 
        7  3812 1 1  9 GLY C    C   -6.870  14.633  -5.320 1.00 . A A .   9 GLY C    1 1 
        7  3813 1 1  9 GLY CA   C   -6.130  14.687  -3.998 1.00 . A A .   9 GLY CA   1 1 
        7  3814 1 1  9 GLY H    H   -6.021  16.511  -2.928 1.00 . A A .   9 GLY H    1 1 
        7  3815 1 1  9 GLY HA2  H   -5.078  14.838  -4.192 1.00 . A A .   9 GLY HA2  1 1 
        7  3816 1 1  9 GLY HA3  H   -6.259  13.744  -3.488 1.00 . A A .   9 GLY HA3  1 1 
        7  3817 1 1  9 GLY N    N   -6.607  15.754  -3.138 1.00 . A A .   9 GLY N    1 1 
        7  3818 1 1  9 GLY O    O   -8.013  15.078  -5.417 1.00 . A A .   9 GLY O    1 1 
        7  3819 1 1 10 GLU C    C   -6.912  12.520  -8.102 1.00 . A A .  10 GLU C    1 1 
        7  3820 1 1 10 GLU CA   C   -6.819  13.979  -7.664 1.00 . A A .  10 GLU CA   1 1 
        7  3821 1 1 10 GLU CB   C   -6.007  14.779  -8.685 1.00 . A A .  10 GLU CB   1 1 
        7  3822 1 1 10 GLU CD   C   -7.011  17.094  -8.800 1.00 . A A .  10 GLU CD   1 1 
        7  3823 1 1 10 GLU CG   C   -5.848  16.246  -8.323 1.00 . A A .  10 GLU CG   1 1 
        7  3824 1 1 10 GLU H    H   -5.306  13.750  -6.201 1.00 . A A .  10 GLU H    1 1 
        7  3825 1 1 10 GLU HA   H   -7.815  14.390  -7.608 1.00 . A A .  10 GLU HA   1 1 
        7  3826 1 1 10 GLU HB2  H   -5.024  14.341  -8.769 1.00 . A A .  10 GLU HB2  1 1 
        7  3827 1 1 10 GLU HB3  H   -6.500  14.719  -9.645 1.00 . A A .  10 GLU HB3  1 1 
        7  3828 1 1 10 GLU HG2  H   -5.777  16.332  -7.249 1.00 . A A .  10 GLU HG2  1 1 
        7  3829 1 1 10 GLU HG3  H   -4.940  16.618  -8.774 1.00 . A A .  10 GLU HG3  1 1 
        7  3830 1 1 10 GLU N    N   -6.215  14.087  -6.341 1.00 . A A .  10 GLU N    1 1 
        7  3831 1 1 10 GLU O    O   -6.639  12.187  -9.255 1.00 . A A .  10 GLU O    1 1 
        7  3832 1 1 10 GLU OE1  O   -8.003  17.216  -8.052 1.00 . A A .  10 GLU OE1  1 1 
        7  3833 1 1 10 GLU OE2  O   -6.927  17.637  -9.922 1.00 . A A .  10 GLU OE2  1 1 
        7  3834 1 1 11 LYS C    C   -6.302   9.752  -8.366 1.00 . A A .  11 LYS C    1 1 
        7  3835 1 1 11 LYS CA   C   -7.432  10.230  -7.460 1.00 . A A .  11 LYS CA   1 1 
        7  3836 1 1 11 LYS CB   C   -8.784   9.945  -8.119 1.00 . A A .  11 LYS CB   1 1 
        7  3837 1 1 11 LYS CD   C  -11.265   9.676  -7.836 1.00 . A A .  11 LYS CD   1 1 
        7  3838 1 1 11 LYS CE   C  -11.479   8.176  -7.703 1.00 . A A .  11 LYS CE   1 1 
        7  3839 1 1 11 LYS CG   C   -9.966  10.113  -7.181 1.00 . A A .  11 LYS CG   1 1 
        7  3840 1 1 11 LYS H    H   -7.506  11.980  -6.271 1.00 . A A .  11 LYS H    1 1 
        7  3841 1 1 11 LYS HA   H   -7.378   9.696  -6.524 1.00 . A A .  11 LYS HA   1 1 
        7  3842 1 1 11 LYS HB2  H   -8.914  10.619  -8.953 1.00 . A A .  11 LYS HB2  1 1 
        7  3843 1 1 11 LYS HB3  H   -8.784   8.928  -8.486 1.00 . A A .  11 LYS HB3  1 1 
        7  3844 1 1 11 LYS HD2  H  -12.088  10.189  -7.362 1.00 . A A .  11 LYS HD2  1 1 
        7  3845 1 1 11 LYS HD3  H  -11.234   9.935  -8.885 1.00 . A A .  11 LYS HD3  1 1 
        7  3846 1 1 11 LYS HE2  H  -10.871   7.672  -8.437 1.00 . A A .  11 LYS HE2  1 1 
        7  3847 1 1 11 LYS HE3  H  -11.177   7.869  -6.712 1.00 . A A .  11 LYS HE3  1 1 
        7  3848 1 1 11 LYS HG2  H   -9.801   9.514  -6.298 1.00 . A A .  11 LYS HG2  1 1 
        7  3849 1 1 11 LYS HG3  H  -10.046  11.154  -6.901 1.00 . A A .  11 LYS HG3  1 1 
        7  3850 1 1 11 LYS HZ1  H  -13.222   7.163  -7.153 1.00 . A A .  11 LYS HZ1  1 1 
        7  3851 1 1 11 LYS HZ2  H  -13.014   7.313  -8.826 1.00 . A A .  11 LYS HZ2  1 1 
        7  3852 1 1 11 LYS HZ3  H  -13.503   8.649  -7.912 1.00 . A A .  11 LYS HZ3  1 1 
        7  3853 1 1 11 LYS N    N   -7.301  11.654  -7.173 1.00 . A A .  11 LYS N    1 1 
        7  3854 1 1 11 LYS NZ   N  -12.905   7.799  -7.913 1.00 . A A .  11 LYS NZ   1 1 
        7  3855 1 1 11 LYS O    O   -6.528   9.146  -9.414 1.00 . A A .  11 LYS O    1 1 
        7  3856 1 1 12 PRO C    C   -3.642   8.124  -8.697 1.00 . A A .  12 PRO C    1 1 
        7  3857 1 1 12 PRO CA   C   -3.865   9.632  -8.713 1.00 . A A .  12 PRO CA   1 1 
        7  3858 1 1 12 PRO CB   C   -2.726  10.349  -7.985 1.00 . A A .  12 PRO CB   1 1 
        7  3859 1 1 12 PRO CD   C   -4.712  10.746  -6.716 1.00 . A A .  12 PRO CD   1 1 
        7  3860 1 1 12 PRO CG   C   -3.227  10.543  -6.595 1.00 . A A .  12 PRO CG   1 1 
        7  3861 1 1 12 PRO HA   H   -3.914   9.976  -9.736 1.00 . A A .  12 PRO HA   1 1 
        7  3862 1 1 12 PRO HB2  H   -1.839   9.732  -8.003 1.00 . A A .  12 PRO HB2  1 1 
        7  3863 1 1 12 PRO HB3  H   -2.524  11.294  -8.467 1.00 . A A .  12 PRO HB3  1 1 
        7  3864 1 1 12 PRO HD2  H   -5.221  10.316  -5.866 1.00 . A A .  12 PRO HD2  1 1 
        7  3865 1 1 12 PRO HD3  H   -4.943  11.797  -6.804 1.00 . A A .  12 PRO HD3  1 1 
        7  3866 1 1 12 PRO HG2  H   -3.015   9.666  -6.003 1.00 . A A .  12 PRO HG2  1 1 
        7  3867 1 1 12 PRO HG3  H   -2.764  11.415  -6.157 1.00 . A A .  12 PRO HG3  1 1 
        7  3868 1 1 12 PRO N    N   -5.055  10.027  -7.954 1.00 . A A .  12 PRO N    1 1 
        7  3869 1 1 12 PRO O    O   -3.454   7.503  -9.744 1.00 . A A .  12 PRO O    1 1 
        7  3870 1 1 13 TYR C    C   -4.212   5.574  -6.133 1.00 . A A .  13 TYR C    1 1 
        7  3871 1 1 13 TYR CA   C   -3.463   6.104  -7.352 1.00 . A A .  13 TYR CA   1 1 
        7  3872 1 1 13 TYR CB   C   -1.972   5.788  -7.225 1.00 . A A .  13 TYR CB   1 1 
        7  3873 1 1 13 TYR CD1  C   -0.981   5.421  -9.519 1.00 . A A .  13 TYR CD1  1 1 
        7  3874 1 1 13 TYR CD2  C   -0.552   7.496  -8.426 1.00 . A A .  13 TYR CD2  1 1 
        7  3875 1 1 13 TYR CE1  C   -0.233   5.833 -10.604 1.00 . A A .  13 TYR CE1  1 1 
        7  3876 1 1 13 TYR CE2  C    0.197   7.917  -9.508 1.00 . A A .  13 TYR CE2  1 1 
        7  3877 1 1 13 TYR CG   C   -1.153   6.243  -8.412 1.00 . A A .  13 TYR CG   1 1 
        7  3878 1 1 13 TYR CZ   C    0.354   7.081 -10.595 1.00 . A A .  13 TYR CZ   1 1 
        7  3879 1 1 13 TYR H    H   -3.819   8.088  -6.706 1.00 . A A .  13 TYR H    1 1 
        7  3880 1 1 13 TYR HA   H   -3.849   5.619  -8.236 1.00 . A A .  13 TYR HA   1 1 
        7  3881 1 1 13 TYR HB2  H   -1.581   6.277  -6.346 1.00 . A A .  13 TYR HB2  1 1 
        7  3882 1 1 13 TYR HB3  H   -1.844   4.720  -7.123 1.00 . A A .  13 TYR HB3  1 1 
        7  3883 1 1 13 TYR HD1  H   -1.442   4.444  -9.523 1.00 . A A .  13 TYR HD1  1 1 
        7  3884 1 1 13 TYR HD2  H   -0.676   8.148  -7.573 1.00 . A A .  13 TYR HD2  1 1 
        7  3885 1 1 13 TYR HE1  H   -0.111   5.180 -11.456 1.00 . A A .  13 TYR HE1  1 1 
        7  3886 1 1 13 TYR HE2  H    0.657   8.894  -9.501 1.00 . A A .  13 TYR HE2  1 1 
        7  3887 1 1 13 TYR HH   H    1.127   6.795 -12.331 1.00 . A A .  13 TYR HH   1 1 
        7  3888 1 1 13 TYR N    N   -3.665   7.540  -7.504 1.00 . A A .  13 TYR N    1 1 
        7  3889 1 1 13 TYR O    O   -4.378   6.278  -5.136 1.00 . A A .  13 TYR O    1 1 
        7  3890 1 1 13 TYR OH   O    1.098   7.496 -11.675 1.00 . A A .  13 TYR OH   1 1 
        7  3891 1 1 14 LYS C    C   -5.489   2.191  -5.329 1.00 . A A .  14 LYS C    1 1 
        7  3892 1 1 14 LYS CA   C   -5.394   3.700  -5.125 1.00 . A A .  14 LYS CA   1 1 
        7  3893 1 1 14 LYS CB   C   -6.797   4.300  -5.011 1.00 . A A .  14 LYS CB   1 1 
        7  3894 1 1 14 LYS CD   C   -8.842   4.569  -3.577 1.00 . A A .  14 LYS CD   1 1 
        7  3895 1 1 14 LYS CE   C   -9.647   3.281  -3.675 1.00 . A A .  14 LYS CE   1 1 
        7  3896 1 1 14 LYS CG   C   -7.348   4.294  -3.595 1.00 . A A .  14 LYS CG   1 1 
        7  3897 1 1 14 LYS H    H   -4.500   3.817  -7.041 1.00 . A A .  14 LYS H    1 1 
        7  3898 1 1 14 LYS HA   H   -4.853   3.894  -4.211 1.00 . A A .  14 LYS HA   1 1 
        7  3899 1 1 14 LYS HB2  H   -6.769   5.322  -5.360 1.00 . A A .  14 LYS HB2  1 1 
        7  3900 1 1 14 LYS HB3  H   -7.470   3.733  -5.639 1.00 . A A .  14 LYS HB3  1 1 
        7  3901 1 1 14 LYS HD2  H   -9.097   5.069  -2.655 1.00 . A A .  14 LYS HD2  1 1 
        7  3902 1 1 14 LYS HD3  H   -9.093   5.204  -4.415 1.00 . A A .  14 LYS HD3  1 1 
        7  3903 1 1 14 LYS HE2  H   -9.732   3.004  -4.715 1.00 . A A .  14 LYS HE2  1 1 
        7  3904 1 1 14 LYS HE3  H   -9.124   2.504  -3.137 1.00 . A A .  14 LYS HE3  1 1 
        7  3905 1 1 14 LYS HG2  H   -7.165   3.327  -3.151 1.00 . A A .  14 LYS HG2  1 1 
        7  3906 1 1 14 LYS HG3  H   -6.844   5.057  -3.020 1.00 . A A .  14 LYS HG3  1 1 
        7  3907 1 1 14 LYS HZ1  H  -11.684   3.712  -3.845 1.00 . A A .  14 LYS HZ1  1 1 
        7  3908 1 1 14 LYS HZ2  H  -11.008   4.168  -2.363 1.00 . A A .  14 LYS HZ2  1 1 
        7  3909 1 1 14 LYS HZ3  H  -11.326   2.538  -2.681 1.00 . A A .  14 LYS HZ3  1 1 
        7  3910 1 1 14 LYS N    N   -4.664   4.328  -6.220 1.00 . A A .  14 LYS N    1 1 
        7  3911 1 1 14 LYS NZ   N  -11.012   3.435  -3.101 1.00 . A A .  14 LYS NZ   1 1 
        7  3912 1 1 14 LYS O    O   -5.533   1.709  -6.461 1.00 . A A .  14 LYS O    1 1 
        7  3913 1 1 15 CYS C    C   -7.069  -0.460  -4.208 1.00 . A A .  15 CYS C    1 1 
        7  3914 1 1 15 CYS CA   C   -5.615  -0.003  -4.283 1.00 . A A .  15 CYS CA   1 1 
        7  3915 1 1 15 CYS CB   C   -4.812  -0.631  -3.142 1.00 . A A .  15 CYS CB   1 1 
        7  3916 1 1 15 CYS H    H   -5.486   1.893  -3.351 1.00 . A A .  15 CYS H    1 1 
        7  3917 1 1 15 CYS HA   H   -5.198  -0.325  -5.225 1.00 . A A .  15 CYS HA   1 1 
        7  3918 1 1 15 CYS HB2  H   -3.813  -0.221  -3.148 1.00 . A A .  15 CYS HB2  1 1 
        7  3919 1 1 15 CYS HB3  H   -5.289  -0.392  -2.203 1.00 . A A .  15 CYS HB3  1 1 
        7  3920 1 1 15 CYS N    N   -5.524   1.451  -4.226 1.00 . A A .  15 CYS N    1 1 
        7  3921 1 1 15 CYS O    O   -7.713  -0.347  -3.165 1.00 . A A .  15 CYS O    1 1 
        7  3922 1 1 15 CYS SG   S   -4.666  -2.444  -3.246 1.00 . A A .  15 CYS SG   1 1 
        7  3923 1 1 16 ASN C    C   -9.073  -2.863  -4.820 1.00 . A A .  16 ASN C    1 1 
        7  3924 1 1 16 ASN CA   C   -8.958  -1.449  -5.382 1.00 . A A .  16 ASN CA   1 1 
        7  3925 1 1 16 ASN CB   C   -9.467  -1.419  -6.825 1.00 . A A .  16 ASN CB   1 1 
        7  3926 1 1 16 ASN CG   C   -9.079  -2.663  -7.601 1.00 . A A .  16 ASN CG   1 1 
        7  3927 1 1 16 ASN H    H   -7.018  -1.039  -6.121 1.00 . A A .  16 ASN H    1 1 
        7  3928 1 1 16 ASN HA   H   -9.563  -0.786  -4.783 1.00 . A A .  16 ASN HA   1 1 
        7  3929 1 1 16 ASN HB2  H  -10.545  -1.344  -6.819 1.00 . A A .  16 ASN HB2  1 1 
        7  3930 1 1 16 ASN HB3  H   -9.053  -0.559  -7.329 1.00 . A A .  16 ASN HB3  1 1 
        7  3931 1 1 16 ASN HD21 H   -7.170  -2.105  -7.589 1.00 . A A .  16 ASN HD21 1 1 
        7  3932 1 1 16 ASN HD22 H   -7.511  -3.597  -8.390 1.00 . A A .  16 ASN HD22 1 1 
        7  3933 1 1 16 ASN N    N   -7.580  -0.975  -5.322 1.00 . A A .  16 ASN N    1 1 
        7  3934 1 1 16 ASN ND2  N   -7.790  -2.802  -7.889 1.00 . A A .  16 ASN ND2  1 1 
        7  3935 1 1 16 ASN O    O   -9.801  -3.697  -5.357 1.00 . A A .  16 ASN O    1 1 
        7  3936 1 1 16 ASN OD1  O   -9.928  -3.489  -7.936 1.00 . A A .  16 ASN OD1  1 1 
        7  3937 1 1 17 GLU C    C   -8.586  -4.309  -1.596 1.00 . A A .  17 GLU C    1 1 
        7  3938 1 1 17 GLU CA   C   -8.370  -4.436  -3.101 1.00 . A A .  17 GLU CA   1 1 
        7  3939 1 1 17 GLU CB   C   -7.063  -5.182  -3.379 1.00 . A A .  17 GLU CB   1 1 
        7  3940 1 1 17 GLU CD   C   -7.471  -6.537  -5.471 1.00 . A A .  17 GLU CD   1 1 
        7  3941 1 1 17 GLU CG   C   -6.759  -5.347  -4.858 1.00 . A A .  17 GLU CG   1 1 
        7  3942 1 1 17 GLU H    H   -7.788  -2.416  -3.354 1.00 . A A .  17 GLU H    1 1 
        7  3943 1 1 17 GLU HA   H   -9.190  -4.996  -3.524 1.00 . A A .  17 GLU HA   1 1 
        7  3944 1 1 17 GLU HB2  H   -6.249  -4.639  -2.923 1.00 . A A .  17 GLU HB2  1 1 
        7  3945 1 1 17 GLU HB3  H   -7.122  -6.164  -2.934 1.00 . A A .  17 GLU HB3  1 1 
        7  3946 1 1 17 GLU HG2  H   -7.071  -4.453  -5.379 1.00 . A A .  17 GLU HG2  1 1 
        7  3947 1 1 17 GLU HG3  H   -5.694  -5.480  -4.981 1.00 . A A .  17 GLU HG3  1 1 
        7  3948 1 1 17 GLU N    N   -8.349  -3.123  -3.736 1.00 . A A .  17 GLU N    1 1 
        7  3949 1 1 17 GLU O    O   -9.335  -5.082  -0.997 1.00 . A A .  17 GLU O    1 1 
        7  3950 1 1 17 GLU OE1  O   -8.570  -6.883  -4.989 1.00 . A A .  17 GLU OE1  1 1 
        7  3951 1 1 17 GLU OE2  O   -6.930  -7.122  -6.432 1.00 . A A .  17 GLU OE2  1 1 
        7  3952 1 1 18 CYS C    C   -8.558  -1.694   0.732 1.00 . A A .  18 CYS C    1 1 
        7  3953 1 1 18 CYS CA   C   -8.041  -3.101   0.446 1.00 . A A .  18 CYS CA   1 1 
        7  3954 1 1 18 CYS CB   C   -6.688  -3.307   1.129 1.00 . A A .  18 CYS CB   1 1 
        7  3955 1 1 18 CYS H    H   -7.341  -2.746  -1.520 1.00 . A A .  18 CYS H    1 1 
        7  3956 1 1 18 CYS HA   H   -8.746  -3.817   0.840 1.00 . A A .  18 CYS HA   1 1 
        7  3957 1 1 18 CYS HB2  H   -6.798  -3.133   2.189 1.00 . A A .  18 CYS HB2  1 1 
        7  3958 1 1 18 CYS HB3  H   -6.364  -4.325   0.968 1.00 . A A .  18 CYS HB3  1 1 
        7  3959 1 1 18 CYS N    N   -7.924  -3.330  -0.989 1.00 . A A .  18 CYS N    1 1 
        7  3960 1 1 18 CYS O    O   -9.444  -1.504   1.564 1.00 . A A .  18 CYS O    1 1 
        7  3961 1 1 18 CYS SG   S   -5.372  -2.203   0.521 1.00 . A A .  18 CYS SG   1 1 
        7  3962 1 1 19 GLY C    C   -7.257   1.579   0.581 1.00 . A A .  19 GLY C    1 1 
        7  3963 1 1 19 GLY CA   C   -8.414   0.667   0.227 1.00 . A A .  19 GLY CA   1 1 
        7  3964 1 1 19 GLY H    H   -7.296  -0.921  -0.616 1.00 . A A .  19 GLY H    1 1 
        7  3965 1 1 19 GLY HA2  H   -8.875   1.023  -0.683 1.00 . A A .  19 GLY HA2  1 1 
        7  3966 1 1 19 GLY HA3  H   -9.142   0.702   1.025 1.00 . A A .  19 GLY HA3  1 1 
        7  3967 1 1 19 GLY N    N   -7.998  -0.710   0.034 1.00 . A A .  19 GLY N    1 1 
        7  3968 1 1 19 GLY O    O   -7.372   2.427   1.465 1.00 . A A .  19 GLY O    1 1 
        7  3969 1 1 20 LYS C    C   -4.786   3.280  -0.947 1.00 . A A .  20 LYS C    1 1 
        7  3970 1 1 20 LYS CA   C   -4.950   2.217   0.135 1.00 . A A .  20 LYS CA   1 1 
        7  3971 1 1 20 LYS CB   C   -3.702   1.333   0.190 1.00 . A A .  20 LYS CB   1 1 
        7  3972 1 1 20 LYS CD   C   -2.726   1.891   2.436 1.00 . A A .  20 LYS CD   1 1 
        7  3973 1 1 20 LYS CE   C   -2.306   1.345   3.792 1.00 . A A .  20 LYS CE   1 1 
        7  3974 1 1 20 LYS CG   C   -3.382   0.818   1.582 1.00 . A A .  20 LYS CG   1 1 
        7  3975 1 1 20 LYS H    H   -6.104   0.711  -0.803 1.00 . A A .  20 LYS H    1 1 
        7  3976 1 1 20 LYS HA   H   -5.076   2.707   1.088 1.00 . A A .  20 LYS HA   1 1 
        7  3977 1 1 20 LYS HB2  H   -3.849   0.483  -0.460 1.00 . A A .  20 LYS HB2  1 1 
        7  3978 1 1 20 LYS HB3  H   -2.855   1.904  -0.164 1.00 . A A .  20 LYS HB3  1 1 
        7  3979 1 1 20 LYS HD2  H   -1.851   2.262   1.923 1.00 . A A .  20 LYS HD2  1 1 
        7  3980 1 1 20 LYS HD3  H   -3.428   2.699   2.585 1.00 . A A .  20 LYS HD3  1 1 
        7  3981 1 1 20 LYS HE2  H   -1.943   2.161   4.398 1.00 . A A .  20 LYS HE2  1 1 
        7  3982 1 1 20 LYS HE3  H   -3.166   0.898   4.268 1.00 . A A .  20 LYS HE3  1 1 
        7  3983 1 1 20 LYS HG2  H   -4.298   0.504   2.060 1.00 . A A .  20 LYS HG2  1 1 
        7  3984 1 1 20 LYS HG3  H   -2.709  -0.024   1.499 1.00 . A A .  20 LYS HG3  1 1 
        7  3985 1 1 20 LYS HZ1  H   -0.398   0.730   3.203 1.00 . A A .  20 LYS HZ1  1 1 
        7  3986 1 1 20 LYS HZ2  H   -1.572  -0.485   3.103 1.00 . A A .  20 LYS HZ2  1 1 
        7  3987 1 1 20 LYS HZ3  H   -0.958  -0.025   4.610 1.00 . A A .  20 LYS HZ3  1 1 
        7  3988 1 1 20 LYS N    N   -6.135   1.404  -0.110 1.00 . A A .  20 LYS N    1 1 
        7  3989 1 1 20 LYS NZ   N   -1.233   0.319   3.668 1.00 . A A .  20 LYS NZ   1 1 
        7  3990 1 1 20 LYS O    O   -4.585   2.960  -2.118 1.00 . A A .  20 LYS O    1 1 
        7  3991 1 1 21 ALA C    C   -3.315   6.222  -1.446 1.00 . A A .  21 ALA C    1 1 
        7  3992 1 1 21 ALA CA   C   -4.730   5.653  -1.481 1.00 . A A .  21 ALA CA   1 1 
        7  3993 1 1 21 ALA CB   C   -5.746   6.741  -1.168 1.00 . A A .  21 ALA CB   1 1 
        7  3994 1 1 21 ALA H    H   -5.034   4.735   0.401 1.00 . A A .  21 ALA H    1 1 
        7  3995 1 1 21 ALA HA   H   -4.933   5.280  -2.475 1.00 . A A .  21 ALA HA   1 1 
        7  3996 1 1 21 ALA HB1  H   -6.587   6.651  -1.839 1.00 . A A .  21 ALA HB1  1 1 
        7  3997 1 1 21 ALA HB2  H   -6.086   6.632  -0.148 1.00 . A A .  21 ALA HB2  1 1 
        7  3998 1 1 21 ALA HB3  H   -5.287   7.710  -1.294 1.00 . A A .  21 ALA HB3  1 1 
        7  3999 1 1 21 ALA N    N   -4.872   4.544  -0.546 1.00 . A A .  21 ALA N    1 1 
        7  4000 1 1 21 ALA O    O   -2.775   6.505  -0.377 1.00 . A A .  21 ALA O    1 1 
        7  4001 1 1 22 PHE C    C   -1.345   8.183  -3.583 1.00 . A A .  22 PHE C    1 1 
        7  4002 1 1 22 PHE CA   C   -1.367   6.921  -2.727 1.00 . A A .  22 PHE CA   1 1 
        7  4003 1 1 22 PHE CB   C   -0.426   5.871  -3.321 1.00 . A A .  22 PHE CB   1 1 
        7  4004 1 1 22 PHE CD1  C   -1.727   3.730  -3.172 1.00 . A A .  22 PHE CD1  1 1 
        7  4005 1 1 22 PHE CD2  C    0.242   3.955  -1.845 1.00 . A A .  22 PHE CD2  1 1 
        7  4006 1 1 22 PHE CE1  C   -1.928   2.461  -2.665 1.00 . A A .  22 PHE CE1  1 1 
        7  4007 1 1 22 PHE CE2  C    0.046   2.685  -1.334 1.00 . A A .  22 PHE CE2  1 1 
        7  4008 1 1 22 PHE CG   C   -0.641   4.491  -2.768 1.00 . A A .  22 PHE CG   1 1 
        7  4009 1 1 22 PHE CZ   C   -1.040   1.937  -1.745 1.00 . A A .  22 PHE CZ   1 1 
        7  4010 1 1 22 PHE H    H   -3.202   6.143  -3.441 1.00 . A A .  22 PHE H    1 1 
        7  4011 1 1 22 PHE HA   H   -1.032   7.169  -1.731 1.00 . A A .  22 PHE HA   1 1 
        7  4012 1 1 22 PHE HB2  H   -0.576   5.827  -4.389 1.00 . A A .  22 PHE HB2  1 1 
        7  4013 1 1 22 PHE HB3  H    0.595   6.156  -3.117 1.00 . A A .  22 PHE HB3  1 1 
        7  4014 1 1 22 PHE HD1  H   -2.421   4.138  -3.892 1.00 . A A .  22 PHE HD1  1 1 
        7  4015 1 1 22 PHE HD2  H    1.092   4.539  -1.523 1.00 . A A .  22 PHE HD2  1 1 
        7  4016 1 1 22 PHE HE1  H   -2.777   1.878  -2.988 1.00 . A A .  22 PHE HE1  1 1 
        7  4017 1 1 22 PHE HE2  H    0.743   2.279  -0.616 1.00 . A A .  22 PHE HE2  1 1 
        7  4018 1 1 22 PHE HZ   H   -1.195   0.946  -1.347 1.00 . A A .  22 PHE HZ   1 1 
        7  4019 1 1 22 PHE N    N   -2.720   6.387  -2.623 1.00 . A A .  22 PHE N    1 1 
        7  4020 1 1 22 PHE O    O   -2.069   8.287  -4.574 1.00 . A A .  22 PHE O    1 1 
        7  4021 1 1 23 ARG C    C    0.623  10.276  -5.056 1.00 . A A .  23 ARG C    1 1 
        7  4022 1 1 23 ARG CA   C   -0.393  10.397  -3.924 1.00 . A A .  23 ARG CA   1 1 
        7  4023 1 1 23 ARG CB   C    0.015  11.527  -2.977 1.00 . A A .  23 ARG CB   1 1 
        7  4024 1 1 23 ARG CD   C   -2.159  12.730  -2.604 1.00 . A A .  23 ARG CD   1 1 
        7  4025 1 1 23 ARG CG   C   -1.060  11.894  -1.967 1.00 . A A .  23 ARG CG   1 1 
        7  4026 1 1 23 ARG CZ   C   -4.206  12.242  -1.334 1.00 . A A .  23 ARG CZ   1 1 
        7  4027 1 1 23 ARG H    H    0.042   8.999  -2.396 1.00 . A A .  23 ARG H    1 1 
        7  4028 1 1 23 ARG HA   H   -1.360  10.626  -4.347 1.00 . A A .  23 ARG HA   1 1 
        7  4029 1 1 23 ARG HB2  H    0.899  11.224  -2.434 1.00 . A A .  23 ARG HB2  1 1 
        7  4030 1 1 23 ARG HB3  H    0.245  12.405  -3.561 1.00 . A A .  23 ARG HB3  1 1 
        7  4031 1 1 23 ARG HD2  H   -1.725  13.644  -2.981 1.00 . A A .  23 ARG HD2  1 1 
        7  4032 1 1 23 ARG HD3  H   -2.590  12.173  -3.422 1.00 . A A .  23 ARG HD3  1 1 
        7  4033 1 1 23 ARG HE   H   -3.179  13.948  -1.227 1.00 . A A .  23 ARG HE   1 1 
        7  4034 1 1 23 ARG HG2  H   -1.496  10.987  -1.574 1.00 . A A .  23 ARG HG2  1 1 
        7  4035 1 1 23 ARG HG3  H   -0.609  12.457  -1.164 1.00 . A A .  23 ARG HG3  1 1 
        7  4036 1 1 23 ARG HH11 H   -3.586  10.754  -2.551 1.00 . A A .  23 ARG HH11 1 1 
        7  4037 1 1 23 ARG HH12 H   -5.028  10.422  -1.650 1.00 . A A .  23 ARG HH12 1 1 
        7  4038 1 1 23 ARG HH21 H   -5.076  13.523  -0.034 1.00 . A A .  23 ARG HH21 1 1 
        7  4039 1 1 23 ARG HH22 H   -5.875  11.998  -0.219 1.00 . A A .  23 ARG HH22 1 1 
        7  4040 1 1 23 ARG N    N   -0.509   9.141  -3.194 1.00 . A A .  23 ARG N    1 1 
        7  4041 1 1 23 ARG NE   N   -3.213  13.065  -1.650 1.00 . A A .  23 ARG NE   1 1 
        7  4042 1 1 23 ARG NH1  N   -4.280  11.041  -1.891 1.00 . A A .  23 ARG NH1  1 1 
        7  4043 1 1 23 ARG NH2  N   -5.128  12.619  -0.457 1.00 . A A .  23 ARG NH2  1 1 
        7  4044 1 1 23 ARG O    O    0.581  11.035  -6.025 1.00 . A A .  23 ARG O    1 1 
        7  4045 1 1 24 ALA C    C    2.411   7.720  -6.579 1.00 . A A .  24 ALA C    1 1 
        7  4046 1 1 24 ALA CA   C    2.559   9.097  -5.939 1.00 . A A .  24 ALA CA   1 1 
        7  4047 1 1 24 ALA CB   C    3.945   9.251  -5.330 1.00 . A A .  24 ALA CB   1 1 
        7  4048 1 1 24 ALA H    H    1.516   8.745  -4.132 1.00 . A A .  24 ALA H    1 1 
        7  4049 1 1 24 ALA HA   H    2.443   9.852  -6.703 1.00 . A A .  24 ALA HA   1 1 
        7  4050 1 1 24 ALA HB1  H    4.331   8.278  -5.063 1.00 . A A .  24 ALA HB1  1 1 
        7  4051 1 1 24 ALA HB2  H    4.604   9.715  -6.049 1.00 . A A .  24 ALA HB2  1 1 
        7  4052 1 1 24 ALA HB3  H    3.883   9.869  -4.447 1.00 . A A .  24 ALA HB3  1 1 
        7  4053 1 1 24 ALA N    N    1.534   9.318  -4.927 1.00 . A A .  24 ALA N    1 1 
        7  4054 1 1 24 ALA O    O    1.811   6.816  -5.998 1.00 . A A .  24 ALA O    1 1 
        7  4055 1 1 25 ARG C    C    3.635   5.206  -7.747 1.00 . A A .  25 ARG C    1 1 
        7  4056 1 1 25 ARG CA   C    2.887   6.303  -8.500 1.00 . A A .  25 ARG CA   1 1 
        7  4057 1 1 25 ARG CB   C    3.467   6.458  -9.907 1.00 . A A .  25 ARG CB   1 1 
        7  4058 1 1 25 ARG CD   C    4.393   5.176 -11.860 1.00 . A A .  25 ARG CD   1 1 
        7  4059 1 1 25 ARG CG   C    3.348   5.203 -10.756 1.00 . A A .  25 ARG CG   1 1 
        7  4060 1 1 25 ARG CZ   C    6.200   3.688 -11.108 1.00 . A A .  25 ARG CZ   1 1 
        7  4061 1 1 25 ARG H    H    3.426   8.327  -8.192 1.00 . A A .  25 ARG H    1 1 
        7  4062 1 1 25 ARG HA   H    1.847   6.025  -8.577 1.00 . A A .  25 ARG HA   1 1 
        7  4063 1 1 25 ARG HB2  H    2.947   7.258 -10.412 1.00 . A A .  25 ARG HB2  1 1 
        7  4064 1 1 25 ARG HB3  H    4.513   6.714  -9.826 1.00 . A A .  25 ARG HB3  1 1 
        7  4065 1 1 25 ARG HD2  H    4.131   4.403 -12.567 1.00 . A A .  25 ARG HD2  1 1 
        7  4066 1 1 25 ARG HD3  H    4.395   6.134 -12.359 1.00 . A A .  25 ARG HD3  1 1 
        7  4067 1 1 25 ARG HE   H    6.309   5.679 -11.156 1.00 . A A .  25 ARG HE   1 1 
        7  4068 1 1 25 ARG HG2  H    3.486   4.337 -10.124 1.00 . A A .  25 ARG HG2  1 1 
        7  4069 1 1 25 ARG HG3  H    2.365   5.173 -11.201 1.00 . A A .  25 ARG HG3  1 1 
        7  4070 1 1 25 ARG HH11 H    4.516   2.746 -11.705 1.00 . A A .  25 ARG HH11 1 1 
        7  4071 1 1 25 ARG HH12 H    5.797   1.709 -11.172 1.00 . A A .  25 ARG HH12 1 1 
        7  4072 1 1 25 ARG HH21 H    8.004   4.324 -10.453 1.00 . A A .  25 ARG HH21 1 1 
        7  4073 1 1 25 ARG HH22 H    7.780   2.608 -10.460 1.00 . A A .  25 ARG HH22 1 1 
        7  4074 1 1 25 ARG N    N    2.960   7.569  -7.780 1.00 . A A .  25 ARG N    1 1 
        7  4075 1 1 25 ARG NE   N    5.732   4.909 -11.341 1.00 . A A .  25 ARG NE   1 1 
        7  4076 1 1 25 ARG NH1  N    5.442   2.627 -11.347 1.00 . A A .  25 ARG NH1  1 1 
        7  4077 1 1 25 ARG NH2  N    7.429   3.527 -10.635 1.00 . A A .  25 ARG NH2  1 1 
        7  4078 1 1 25 ARG O    O    3.070   4.158  -7.434 1.00 . A A .  25 ARG O    1 1 
        7  4079 1 1 26 SER C    C    5.085   4.083  -5.430 1.00 . A A .  26 SER C    1 1 
        7  4080 1 1 26 SER CA   C    5.735   4.487  -6.749 1.00 . A A .  26 SER CA   1 1 
        7  4081 1 1 26 SER CB   C    7.127   5.067  -6.488 1.00 . A A .  26 SER CB   1 1 
        7  4082 1 1 26 SER H    H    5.303   6.309  -7.737 1.00 . A A .  26 SER H    1 1 
        7  4083 1 1 26 SER HA   H    5.831   3.611  -7.373 1.00 . A A .  26 SER HA   1 1 
        7  4084 1 1 26 SER HB2  H    7.444   5.637  -7.348 1.00 . A A .  26 SER HB2  1 1 
        7  4085 1 1 26 SER HB3  H    7.088   5.712  -5.623 1.00 . A A .  26 SER HB3  1 1 
        7  4086 1 1 26 SER HG   H    8.717   4.024  -6.960 1.00 . A A .  26 SER HG   1 1 
        7  4087 1 1 26 SER N    N    4.909   5.455  -7.461 1.00 . A A .  26 SER N    1 1 
        7  4088 1 1 26 SER O    O    5.083   2.909  -5.060 1.00 . A A .  26 SER O    1 1 
        7  4089 1 1 26 SER OG   O    8.072   4.038  -6.250 1.00 . A A .  26 SER OG   1 1 
        7  4090 1 1 27 SER C    C    2.833   3.714  -3.574 1.00 . A A .  27 SER C    1 1 
        7  4091 1 1 27 SER CA   C    3.882   4.814  -3.444 1.00 . A A .  27 SER CA   1 1 
        7  4092 1 1 27 SER CB   C    3.233   6.095  -2.918 1.00 . A A .  27 SER CB   1 1 
        7  4093 1 1 27 SER H    H    4.567   5.981  -5.072 1.00 . A A .  27 SER H    1 1 
        7  4094 1 1 27 SER HA   H    4.640   4.491  -2.744 1.00 . A A .  27 SER HA   1 1 
        7  4095 1 1 27 SER HB2  H    2.613   6.525  -3.690 1.00 . A A .  27 SER HB2  1 1 
        7  4096 1 1 27 SER HB3  H    2.624   5.859  -2.057 1.00 . A A .  27 SER HB3  1 1 
        7  4097 1 1 27 SER HG   H    4.676   7.358  -3.318 1.00 . A A .  27 SER HG   1 1 
        7  4098 1 1 27 SER N    N    4.533   5.065  -4.724 1.00 . A A .  27 SER N    1 1 
        7  4099 1 1 27 SER O    O    2.639   2.913  -2.659 1.00 . A A .  27 SER O    1 1 
        7  4100 1 1 27 SER OG   O    4.213   7.045  -2.538 1.00 . A A .  27 SER OG   1 1 
        7  4101 1 1 28 LEU C    C    1.750   1.335  -5.322 1.00 . A A .  28 LEU C    1 1 
        7  4102 1 1 28 LEU CA   C    1.127   2.682  -4.970 1.00 . A A .  28 LEU CA   1 1 
        7  4103 1 1 28 LEU CB   C    0.207   3.142  -6.102 1.00 . A A .  28 LEU CB   1 1 
        7  4104 1 1 28 LEU CD1  C   -2.039   2.043  -5.940 1.00 . A A .  28 LEU CD1  1 1 
        7  4105 1 1 28 LEU CD2  C   -0.951   2.333  -8.173 1.00 . A A .  28 LEU CD2  1 1 
        7  4106 1 1 28 LEU CG   C   -0.718   2.077  -6.691 1.00 . A A .  28 LEU CG   1 1 
        7  4107 1 1 28 LEU H    H    2.356   4.347  -5.409 1.00 . A A .  28 LEU H    1 1 
        7  4108 1 1 28 LEU HA   H    0.545   2.571  -4.067 1.00 . A A .  28 LEU HA   1 1 
        7  4109 1 1 28 LEU HB2  H   -0.409   3.942  -5.723 1.00 . A A .  28 LEU HB2  1 1 
        7  4110 1 1 28 LEU HB3  H    0.831   3.519  -6.901 1.00 . A A .  28 LEU HB3  1 1 
        7  4111 1 1 28 LEU HD11 H   -1.960   1.367  -5.102 1.00 . A A .  28 LEU HD11 1 1 
        7  4112 1 1 28 LEU HD12 H   -2.822   1.705  -6.602 1.00 . A A .  28 LEU HD12 1 1 
        7  4113 1 1 28 LEU HD13 H   -2.275   3.035  -5.582 1.00 . A A .  28 LEU HD13 1 1 
        7  4114 1 1 28 LEU HD21 H   -0.277   3.104  -8.515 1.00 . A A .  28 LEU HD21 1 1 
        7  4115 1 1 28 LEU HD22 H   -1.972   2.652  -8.326 1.00 . A A .  28 LEU HD22 1 1 
        7  4116 1 1 28 LEU HD23 H   -0.771   1.423  -8.728 1.00 . A A .  28 LEU HD23 1 1 
        7  4117 1 1 28 LEU HG   H   -0.251   1.107  -6.588 1.00 . A A .  28 LEU HG   1 1 
        7  4118 1 1 28 LEU N    N    2.158   3.682  -4.718 1.00 . A A .  28 LEU N    1 1 
        7  4119 1 1 28 LEU O    O    1.328   0.294  -4.818 1.00 . A A .  28 LEU O    1 1 
        7  4120 1 1 29 ALA C    C    3.972  -0.626  -5.398 1.00 . A A .  29 ALA C    1 1 
        7  4121 1 1 29 ALA CA   C    3.443   0.145  -6.603 1.00 . A A .  29 ALA CA   1 1 
        7  4122 1 1 29 ALA CB   C    4.578   0.477  -7.559 1.00 . A A .  29 ALA CB   1 1 
        7  4123 1 1 29 ALA H    H    3.049   2.223  -6.554 1.00 . A A .  29 ALA H    1 1 
        7  4124 1 1 29 ALA HA   H    2.731  -0.475  -7.129 1.00 . A A .  29 ALA HA   1 1 
        7  4125 1 1 29 ALA HB1  H    4.430  -0.049  -8.490 1.00 . A A .  29 ALA HB1  1 1 
        7  4126 1 1 29 ALA HB2  H    4.591   1.542  -7.745 1.00 . A A .  29 ALA HB2  1 1 
        7  4127 1 1 29 ALA HB3  H    5.518   0.177  -7.121 1.00 . A A .  29 ALA HB3  1 1 
        7  4128 1 1 29 ALA N    N    2.758   1.363  -6.187 1.00 . A A .  29 ALA N    1 1 
        7  4129 1 1 29 ALA O    O    3.583  -1.770  -5.161 1.00 . A A .  29 ALA O    1 1 
        7  4130 1 1 30 ILE C    C    4.416  -1.479  -2.732 1.00 . A A .  30 ILE C    1 1 
        7  4131 1 1 30 ILE CA   C    5.443  -0.619  -3.460 1.00 . A A .  30 ILE CA   1 1 
        7  4132 1 1 30 ILE CB   C    6.002   0.432  -2.483 1.00 . A A .  30 ILE CB   1 1 
        7  4133 1 1 30 ILE CD1  C    7.341   2.596  -2.503 1.00 . A A .  30 ILE CD1  1 1 
        7  4134 1 1 30 ILE CG1  C    7.102   1.254  -3.158 1.00 . A A .  30 ILE CG1  1 1 
        7  4135 1 1 30 ILE CG2  C    6.534  -0.243  -1.227 1.00 . A A .  30 ILE CG2  1 1 
        7  4136 1 1 30 ILE H    H    5.132   0.918  -4.881 1.00 . A A .  30 ILE H    1 1 
        7  4137 1 1 30 ILE HA   H    6.258  -1.249  -3.786 1.00 . A A .  30 ILE HA   1 1 
        7  4138 1 1 30 ILE HB   H    5.196   1.089  -2.195 1.00 . A A .  30 ILE HB   1 1 
        7  4139 1 1 30 ILE HD11 H    7.693   2.445  -1.492 1.00 . A A .  30 ILE HD11 1 1 
        7  4140 1 1 30 ILE HD12 H    8.085   3.143  -3.063 1.00 . A A .  30 ILE HD12 1 1 
        7  4141 1 1 30 ILE HD13 H    6.420   3.157  -2.483 1.00 . A A .  30 ILE HD13 1 1 
        7  4142 1 1 30 ILE HG12 H    8.027   0.701  -3.128 1.00 . A A .  30 ILE HG12 1 1 
        7  4143 1 1 30 ILE HG13 H    6.826   1.431  -4.188 1.00 . A A .  30 ILE HG13 1 1 
        7  4144 1 1 30 ILE HG21 H    6.368  -1.308  -1.293 1.00 . A A .  30 ILE HG21 1 1 
        7  4145 1 1 30 ILE HG22 H    7.593  -0.050  -1.136 1.00 . A A .  30 ILE HG22 1 1 
        7  4146 1 1 30 ILE HG23 H    6.021   0.149  -0.362 1.00 . A A .  30 ILE HG23 1 1 
        7  4147 1 1 30 ILE N    N    4.861   0.008  -4.641 1.00 . A A .  30 ILE N    1 1 
        7  4148 1 1 30 ILE O    O    4.720  -2.587  -2.288 1.00 . A A .  30 ILE O    1 1 
        7  4149 1 1 31 HIS C    C    1.602  -2.822  -2.813 1.00 . A A .  31 HIS C    1 1 
        7  4150 1 1 31 HIS CA   C    2.123  -1.684  -1.940 1.00 . A A .  31 HIS CA   1 1 
        7  4151 1 1 31 HIS CB   C    0.980  -0.730  -1.590 1.00 . A A .  31 HIS CB   1 1 
        7  4152 1 1 31 HIS CD2  C   -1.423  -1.691  -1.763 1.00 . A A .  31 HIS CD2  1 1 
        7  4153 1 1 31 HIS CE1  C   -1.593  -2.496   0.270 1.00 . A A .  31 HIS CE1  1 1 
        7  4154 1 1 31 HIS CG   C   -0.260  -1.427  -1.122 1.00 . A A .  31 HIS CG   1 1 
        7  4155 1 1 31 HIS H    H    3.016  -0.075  -2.987 1.00 . A A .  31 HIS H    1 1 
        7  4156 1 1 31 HIS HA   H    2.524  -2.101  -1.029 1.00 . A A .  31 HIS HA   1 1 
        7  4157 1 1 31 HIS HB2  H    1.303  -0.065  -0.803 1.00 . A A .  31 HIS HB2  1 1 
        7  4158 1 1 31 HIS HB3  H    0.725  -0.149  -2.465 1.00 . A A .  31 HIS HB3  1 1 
        7  4159 1 1 31 HIS HD1  H    0.278  -1.910   0.857 1.00 . A A .  31 HIS HD1  1 1 
        7  4160 1 1 31 HIS HD2  H   -1.668  -1.429  -2.782 1.00 . A A .  31 HIS HD2  1 1 
        7  4161 1 1 31 HIS HE1  H   -1.979  -2.979   1.154 1.00 . A A .  31 HIS HE1  1 1 
        7  4162 1 1 31 HIS N    N    3.197  -0.962  -2.613 1.00 . A A .  31 HIS N    1 1 
        7  4163 1 1 31 HIS ND1  N   -0.399  -1.943   0.149 1.00 . A A .  31 HIS ND1  1 1 
        7  4164 1 1 31 HIS NE2  N   -2.234  -2.356  -0.876 1.00 . A A .  31 HIS NE2  1 1 
        7  4165 1 1 31 HIS O    O    1.489  -3.960  -2.361 1.00 . A A .  31 HIS O    1 1 
        7  4166 1 1 32 GLN C    C    1.628  -4.766  -4.964 1.00 . A A .  32 GLN C    1 1 
        7  4167 1 1 32 GLN CA   C    0.778  -3.500  -5.000 1.00 . A A .  32 GLN CA   1 1 
        7  4168 1 1 32 GLN CB   C    0.750  -2.931  -6.419 1.00 . A A .  32 GLN CB   1 1 
        7  4169 1 1 32 GLN CD   C   -1.687  -2.284  -6.575 1.00 . A A .  32 GLN CD   1 1 
        7  4170 1 1 32 GLN CG   C   -0.251  -1.801  -6.602 1.00 . A A .  32 GLN CG   1 1 
        7  4171 1 1 32 GLN H    H    1.401  -1.579  -4.366 1.00 . A A .  32 GLN H    1 1 
        7  4172 1 1 32 GLN HA   H   -0.229  -3.750  -4.702 1.00 . A A .  32 GLN HA   1 1 
        7  4173 1 1 32 GLN HB2  H    1.733  -2.556  -6.664 1.00 . A A .  32 GLN HB2  1 1 
        7  4174 1 1 32 GLN HB3  H    0.495  -3.723  -7.107 1.00 . A A .  32 GLN HB3  1 1 
        7  4175 1 1 32 GLN HE21 H   -2.310  -0.550  -7.321 1.00 . A A .  32 GLN HE21 1 1 
        7  4176 1 1 32 GLN HE22 H   -3.543  -1.717  -7.004 1.00 . A A .  32 GLN HE22 1 1 
        7  4177 1 1 32 GLN HG2  H   -0.114  -1.084  -5.806 1.00 . A A .  32 GLN HG2  1 1 
        7  4178 1 1 32 GLN HG3  H   -0.064  -1.323  -7.552 1.00 . A A .  32 GLN HG3  1 1 
        7  4179 1 1 32 GLN N    N    1.288  -2.504  -4.065 1.00 . A A .  32 GLN N    1 1 
        7  4180 1 1 32 GLN NE2  N   -2.607  -1.431  -7.010 1.00 . A A .  32 GLN NE2  1 1 
        7  4181 1 1 32 GLN O    O    1.184  -5.836  -5.379 1.00 . A A .  32 GLN O    1 1 
        7  4182 1 1 32 GLN OE1  O   -1.968  -3.412  -6.168 1.00 . A A .  32 GLN OE1  1 1 
        7  4183 1 1 33 ALA C    C    3.450  -6.630  -3.155 1.00 . A A .  33 ALA C    1 1 
        7  4184 1 1 33 ALA CA   C    3.765  -5.770  -4.374 1.00 . A A .  33 ALA CA   1 1 
        7  4185 1 1 33 ALA CB   C    5.206  -5.285  -4.322 1.00 . A A .  33 ALA CB   1 1 
        7  4186 1 1 33 ALA H    H    3.151  -3.757  -4.150 1.00 . A A .  33 ALA H    1 1 
        7  4187 1 1 33 ALA HA   H    3.644  -6.368  -5.265 1.00 . A A .  33 ALA HA   1 1 
        7  4188 1 1 33 ALA HB1  H    5.315  -4.564  -3.526 1.00 . A A .  33 ALA HB1  1 1 
        7  4189 1 1 33 ALA HB2  H    5.861  -6.125  -4.140 1.00 . A A .  33 ALA HB2  1 1 
        7  4190 1 1 33 ALA HB3  H    5.465  -4.824  -5.263 1.00 . A A .  33 ALA HB3  1 1 
        7  4191 1 1 33 ALA N    N    2.853  -4.636  -4.465 1.00 . A A .  33 ALA N    1 1 
        7  4192 1 1 33 ALA O    O    4.247  -7.482  -2.760 1.00 . A A .  33 ALA O    1 1 
        7  4193 1 1 34 THR C    C    0.665  -8.043  -1.700 1.00 . A A .  34 THR C    1 1 
        7  4194 1 1 34 THR CA   C    1.864  -7.155  -1.385 1.00 . A A .  34 THR CA   1 1 
        7  4195 1 1 34 THR CB   C    1.502  -6.218  -0.217 1.00 . A A .  34 THR CB   1 1 
        7  4196 1 1 34 THR CG2  C    0.076  -5.707  -0.356 1.00 . A A .  34 THR CG2  1 1 
        7  4197 1 1 34 THR H    H    1.691  -5.710  -2.922 1.00 . A A .  34 THR H    1 1 
        7  4198 1 1 34 THR HA   H    2.690  -7.779  -1.076 1.00 . A A .  34 THR HA   1 1 
        7  4199 1 1 34 THR HB   H    2.175  -5.373  -0.232 1.00 . A A .  34 THR HB   1 1 
        7  4200 1 1 34 THR HG1  H    0.905  -7.505   1.152 1.00 . A A .  34 THR HG1  1 1 
        7  4201 1 1 34 THR HG21 H   -0.015  -5.137  -1.268 1.00 . A A .  34 THR HG21 1 1 
        7  4202 1 1 34 THR HG22 H   -0.164  -5.077   0.488 1.00 . A A .  34 THR HG22 1 1 
        7  4203 1 1 34 THR HG23 H   -0.605  -6.544  -0.385 1.00 . A A .  34 THR HG23 1 1 
        7  4204 1 1 34 THR N    N    2.283  -6.402  -2.561 1.00 . A A .  34 THR N    1 1 
        7  4205 1 1 34 THR O    O    0.492  -9.104  -1.100 1.00 . A A .  34 THR O    1 1 
        7  4206 1 1 34 THR OG1  O    1.648  -6.909   1.028 1.00 . A A .  34 THR OG1  1 1 
        7  4207 1 1 35 HIS C    C   -0.979  -9.449  -4.044 1.00 . A A .  35 HIS C    1 1 
        7  4208 1 1 35 HIS CA   C   -1.342  -8.359  -3.040 1.00 . A A .  35 HIS CA   1 1 
        7  4209 1 1 35 HIS CB   C   -2.394  -7.425  -3.641 1.00 . A A .  35 HIS CB   1 1 
        7  4210 1 1 35 HIS CD2  C   -2.760  -5.322  -2.169 1.00 . A A .  35 HIS CD2  1 1 
        7  4211 1 1 35 HIS CE1  C   -4.580  -5.969  -1.132 1.00 . A A .  35 HIS CE1  1 1 
        7  4212 1 1 35 HIS CG   C   -3.072  -6.557  -2.627 1.00 . A A .  35 HIS CG   1 1 
        7  4213 1 1 35 HIS H    H    0.032  -6.749  -3.087 1.00 . A A .  35 HIS H    1 1 
        7  4214 1 1 35 HIS HA   H   -1.750  -8.824  -2.155 1.00 . A A .  35 HIS HA   1 1 
        7  4215 1 1 35 HIS HB2  H   -1.920  -6.780  -4.366 1.00 . A A .  35 HIS HB2  1 1 
        7  4216 1 1 35 HIS HB3  H   -3.152  -8.017  -4.133 1.00 . A A .  35 HIS HB3  1 1 
        7  4217 1 1 35 HIS HD1  H   -4.692  -7.783  -2.071 1.00 . A A .  35 HIS HD1  1 1 
        7  4218 1 1 35 HIS HD2  H   -1.918  -4.717  -2.476 1.00 . A A .  35 HIS HD2  1 1 
        7  4219 1 1 35 HIS HE1  H   -5.440  -5.986  -0.479 1.00 . A A .  35 HIS HE1  1 1 
        7  4220 1 1 35 HIS N    N   -0.159  -7.603  -2.645 1.00 . A A .  35 HIS N    1 1 
        7  4221 1 1 35 HIS ND1  N   -4.217  -6.935  -1.957 1.00 . A A .  35 HIS ND1  1 1 
        7  4222 1 1 35 HIS NE2  N   -3.713  -4.979  -1.241 1.00 . A A .  35 HIS NE2  1 1 
        7  4223 1 1 35 HIS O    O   -1.683  -9.654  -5.034 1.00 . A A .  35 HIS O    1 1 
        7  4224 1 1 36 SER C    C   -0.558 -12.170  -4.998 1.00 . A A .  36 SER C    1 1 
        7  4225 1 1 36 SER CA   C    0.581 -11.210  -4.667 1.00 . A A .  36 SER CA   1 1 
        7  4226 1 1 36 SER CB   C    1.736 -11.976  -4.019 1.00 . A A .  36 SER CB   1 1 
        7  4227 1 1 36 SER H    H    0.641  -9.934  -2.978 1.00 . A A .  36 SER H    1 1 
        7  4228 1 1 36 SER HA   H    0.930 -10.755  -5.582 1.00 . A A .  36 SER HA   1 1 
        7  4229 1 1 36 SER HB2  H    2.383 -11.281  -3.506 1.00 . A A .  36 SER HB2  1 1 
        7  4230 1 1 36 SER HB3  H    1.340 -12.690  -3.311 1.00 . A A .  36 SER HB3  1 1 
        7  4231 1 1 36 SER HG   H    2.453 -13.616  -4.817 1.00 . A A .  36 SER HG   1 1 
        7  4232 1 1 36 SER N    N    0.123 -10.145  -3.783 1.00 . A A .  36 SER N    1 1 
        7  4233 1 1 36 SER O    O   -1.569 -12.215  -4.299 1.00 . A A .  36 SER O    1 1 
        7  4234 1 1 36 SER OG   O    2.495 -12.673  -4.993 1.00 . A A .  36 SER OG   1 1 
        7  4235 1 1 37 GLY C    C   -1.657 -14.951  -5.429 1.00 . A A .  37 GLY C    1 1 
        7  4236 1 1 37 GLY CA   C   -1.406 -13.884  -6.476 1.00 . A A .  37 GLY CA   1 1 
        7  4237 1 1 37 GLY H    H    0.442 -12.857  -6.590 1.00 . A A .  37 GLY H    1 1 
        7  4238 1 1 37 GLY HA2  H   -2.326 -13.350  -6.659 1.00 . A A .  37 GLY HA2  1 1 
        7  4239 1 1 37 GLY HA3  H   -1.092 -14.363  -7.392 1.00 . A A .  37 GLY HA3  1 1 
        7  4240 1 1 37 GLY N    N   -0.385 -12.936  -6.070 1.00 . A A .  37 GLY N    1 1 
        7  4241 1 1 37 GLY O    O   -0.838 -15.851  -5.243 1.00 . A A .  37 GLY O    1 1 
        7  4242 1 1 38 GLU C    C   -4.658 -15.903  -3.542 1.00 . A A .  38 GLU C    1 1 
        7  4243 1 1 38 GLU CA   C   -3.144 -15.811  -3.705 1.00 . A A .  38 GLU CA   1 1 
        7  4244 1 1 38 GLU CB   C   -2.499 -15.421  -2.374 1.00 . A A .  38 GLU CB   1 1 
        7  4245 1 1 38 GLU CD   C   -3.632 -17.274  -1.085 1.00 . A A .  38 GLU CD   1 1 
        7  4246 1 1 38 GLU CG   C   -2.321 -16.589  -1.418 1.00 . A A .  38 GLU CG   1 1 
        7  4247 1 1 38 GLU H    H   -3.402 -14.108  -4.936 1.00 . A A .  38 GLU H    1 1 
        7  4248 1 1 38 GLU HA   H   -2.767 -16.777  -4.007 1.00 . A A .  38 GLU HA   1 1 
        7  4249 1 1 38 GLU HB2  H   -1.527 -14.992  -2.570 1.00 . A A .  38 GLU HB2  1 1 
        7  4250 1 1 38 GLU HB3  H   -3.118 -14.679  -1.892 1.00 . A A .  38 GLU HB3  1 1 
        7  4251 1 1 38 GLU HG2  H   -1.660 -17.312  -1.871 1.00 . A A .  38 GLU HG2  1 1 
        7  4252 1 1 38 GLU HG3  H   -1.880 -16.224  -0.502 1.00 . A A .  38 GLU HG3  1 1 
        7  4253 1 1 38 GLU N    N   -2.790 -14.849  -4.742 1.00 . A A .  38 GLU N    1 1 
        7  4254 1 1 38 GLU O    O   -5.308 -14.945  -3.122 1.00 . A A .  38 GLU O    1 1 
        7  4255 1 1 38 GLU OE1  O   -4.293 -16.852  -0.113 1.00 . A A .  38 GLU OE1  1 1 
        7  4256 1 1 38 GLU OE2  O   -3.998 -18.233  -1.797 1.00 . A A .  38 GLU OE2  1 1 
        7  4257 1 1 39 LYS C    C   -7.424 -16.013  -4.113 1.00 . A A .  39 LYS C    1 1 
        7  4258 1 1 39 LYS CA   C   -6.652 -17.282  -3.767 1.00 . A A .  39 LYS CA   1 1 
        7  4259 1 1 39 LYS CB   C   -7.012 -17.742  -2.353 1.00 . A A .  39 LYS CB   1 1 
        7  4260 1 1 39 LYS CD   C   -8.168 -19.923  -2.817 1.00 . A A .  39 LYS CD   1 1 
        7  4261 1 1 39 LYS CE   C   -8.512 -21.232  -2.123 1.00 . A A .  39 LYS CE   1 1 
        7  4262 1 1 39 LYS CG   C   -6.968 -19.249  -2.173 1.00 . A A .  39 LYS CG   1 1 
        7  4263 1 1 39 LYS H    H   -4.643 -17.789  -4.205 1.00 . A A .  39 LYS H    1 1 
        7  4264 1 1 39 LYS HA   H   -6.923 -18.057  -4.468 1.00 . A A .  39 LYS HA   1 1 
        7  4265 1 1 39 LYS HB2  H   -6.318 -17.296  -1.655 1.00 . A A .  39 LYS HB2  1 1 
        7  4266 1 1 39 LYS HB3  H   -8.011 -17.401  -2.120 1.00 . A A .  39 LYS HB3  1 1 
        7  4267 1 1 39 LYS HD2  H   -9.019 -19.261  -2.754 1.00 . A A .  39 LYS HD2  1 1 
        7  4268 1 1 39 LYS HD3  H   -7.943 -20.124  -3.855 1.00 . A A .  39 LYS HD3  1 1 
        7  4269 1 1 39 LYS HE2  H   -7.603 -21.794  -1.972 1.00 . A A .  39 LYS HE2  1 1 
        7  4270 1 1 39 LYS HE3  H   -8.960 -21.009  -1.166 1.00 . A A .  39 LYS HE3  1 1 
        7  4271 1 1 39 LYS HG2  H   -6.067 -19.631  -2.629 1.00 . A A .  39 LYS HG2  1 1 
        7  4272 1 1 39 LYS HG3  H   -6.963 -19.477  -1.116 1.00 . A A .  39 LYS HG3  1 1 
        7  4273 1 1 39 LYS HZ1  H   -9.623 -21.608  -3.851 1.00 . A A .  39 LYS HZ1  1 1 
        7  4274 1 1 39 LYS HZ2  H  -10.372 -22.131  -2.426 1.00 . A A .  39 LYS HZ2  1 1 
        7  4275 1 1 39 LYS HZ3  H   -9.075 -23.006  -3.070 1.00 . A A .  39 LYS HZ3  1 1 
        7  4276 1 1 39 LYS N    N   -5.214 -17.062  -3.876 1.00 . A A .  39 LYS N    1 1 
        7  4277 1 1 39 LYS NZ   N   -9.462 -22.052  -2.924 1.00 . A A .  39 LYS NZ   1 1 
        7  4278 1 1 39 LYS O    O   -8.255 -15.533  -3.341 1.00 . A A .  39 LYS O    1 1 
        7  4279 1 1 40 PRO C    C   -9.274 -14.466  -6.117 1.00 . A A .  40 PRO C    1 1 
        7  4280 1 1 40 PRO CA   C   -7.806 -14.236  -5.776 1.00 . A A .  40 PRO CA   1 1 
        7  4281 1 1 40 PRO CB   C   -7.015 -13.872  -7.035 1.00 . A A .  40 PRO CB   1 1 
        7  4282 1 1 40 PRO CD   C   -6.167 -15.973  -6.271 1.00 . A A .  40 PRO CD   1 1 
        7  4283 1 1 40 PRO CG   C   -6.442 -15.164  -7.509 1.00 . A A .  40 PRO CG   1 1 
        7  4284 1 1 40 PRO HA   H   -7.726 -13.435  -5.056 1.00 . A A .  40 PRO HA   1 1 
        7  4285 1 1 40 PRO HB2  H   -7.681 -13.442  -7.770 1.00 . A A .  40 PRO HB2  1 1 
        7  4286 1 1 40 PRO HB3  H   -6.239 -13.165  -6.786 1.00 . A A .  40 PRO HB3  1 1 
        7  4287 1 1 40 PRO HD2  H   -6.332 -17.023  -6.463 1.00 . A A .  40 PRO HD2  1 1 
        7  4288 1 1 40 PRO HD3  H   -5.158 -15.804  -5.927 1.00 . A A .  40 PRO HD3  1 1 
        7  4289 1 1 40 PRO HG2  H   -7.155 -15.673  -8.139 1.00 . A A .  40 PRO HG2  1 1 
        7  4290 1 1 40 PRO HG3  H   -5.525 -14.982  -8.049 1.00 . A A .  40 PRO HG3  1 1 
        7  4291 1 1 40 PRO N    N   -7.146 -15.455  -5.301 1.00 . A A .  40 PRO N    1 1 
        7  4292 1 1 40 PRO O    O   -9.614 -15.408  -6.833 1.00 . A A .  40 PRO O    1 1 
        7  4293 1 1 41 SER C    C  -12.243 -12.343  -5.784 1.00 . A A .  41 SER C    1 1 
        7  4294 1 1 41 SER CA   C  -11.573 -13.711  -5.848 1.00 . A A .  41 SER CA   1 1 
        7  4295 1 1 41 SER CB   C  -12.216 -14.655  -4.829 1.00 . A A .  41 SER CB   1 1 
        7  4296 1 1 41 SER H    H   -9.807 -12.870  -5.037 1.00 . A A .  41 SER H    1 1 
        7  4297 1 1 41 SER HA   H  -11.707 -14.119  -6.839 1.00 . A A .  41 SER HA   1 1 
        7  4298 1 1 41 SER HB2  H  -13.177 -14.978  -5.199 1.00 . A A .  41 SER HB2  1 1 
        7  4299 1 1 41 SER HB3  H  -11.577 -15.515  -4.686 1.00 . A A .  41 SER HB3  1 1 
        7  4300 1 1 41 SER HG   H  -13.176 -14.369  -3.146 1.00 . A A .  41 SER HG   1 1 
        7  4301 1 1 41 SER N    N  -10.140 -13.600  -5.600 1.00 . A A .  41 SER N    1 1 
        7  4302 1 1 41 SER O    O  -12.084 -11.606  -4.812 1.00 . A A .  41 SER O    1 1 
        7  4303 1 1 41 SER OG   O  -12.400 -14.009  -3.581 1.00 . A A .  41 SER OG   1 1 
        7  4304 1 1 42 GLY C    C  -13.628 -10.093  -8.248 1.00 . A A .  42 GLY C    1 1 
        7  4305 1 1 42 GLY CA   C  -13.678 -10.730  -6.874 1.00 . A A .  42 GLY CA   1 1 
        7  4306 1 1 42 GLY H    H  -13.085 -12.637  -7.577 1.00 . A A .  42 GLY H    1 1 
        7  4307 1 1 42 GLY HA2  H  -14.710 -10.876  -6.593 1.00 . A A .  42 GLY HA2  1 1 
        7  4308 1 1 42 GLY HA3  H  -13.213 -10.062  -6.163 1.00 . A A .  42 GLY HA3  1 1 
        7  4309 1 1 42 GLY N    N  -12.994 -12.009  -6.830 1.00 . A A .  42 GLY N    1 1 
        7  4310 1 1 42 GLY O    O  -12.875  -9.150  -8.492 1.00 . A A .  42 GLY O    1 1 
        7  4311 1 1 43 PRO C    C  -15.143  -8.722 -10.627 1.00 . A A .  43 PRO C    1 1 
        7  4312 1 1 43 PRO CA   C  -14.508 -10.106 -10.550 1.00 . A A .  43 PRO CA   1 1 
        7  4313 1 1 43 PRO CB   C  -15.383 -11.136 -11.269 1.00 . A A .  43 PRO CB   1 1 
        7  4314 1 1 43 PRO CD   C  -15.369 -11.738  -8.955 1.00 . A A .  43 PRO CD   1 1 
        7  4315 1 1 43 PRO CG   C  -16.222 -11.737 -10.194 1.00 . A A .  43 PRO CG   1 1 
        7  4316 1 1 43 PRO HA   H  -13.531 -10.079 -11.008 1.00 . A A .  43 PRO HA   1 1 
        7  4317 1 1 43 PRO HB2  H  -15.989 -10.640 -12.014 1.00 . A A .  43 PRO HB2  1 1 
        7  4318 1 1 43 PRO HB3  H  -14.757 -11.878 -11.741 1.00 . A A .  43 PRO HB3  1 1 
        7  4319 1 1 43 PRO HD2  H  -15.977 -11.571  -8.078 1.00 . A A .  43 PRO HD2  1 1 
        7  4320 1 1 43 PRO HD3  H  -14.829 -12.670  -8.870 1.00 . A A .  43 PRO HD3  1 1 
        7  4321 1 1 43 PRO HG2  H  -17.106 -11.137 -10.040 1.00 . A A .  43 PRO HG2  1 1 
        7  4322 1 1 43 PRO HG3  H  -16.494 -12.747 -10.462 1.00 . A A .  43 PRO HG3  1 1 
        7  4323 1 1 43 PRO N    N  -14.445 -10.614  -9.176 1.00 . A A .  43 PRO N    1 1 
        7  4324 1 1 43 PRO O    O  -16.256  -8.511 -10.146 1.00 . A A .  43 PRO O    1 1 
        7  4325 1 1 44 SER C    C  -13.984  -5.586 -12.247 1.00 . A A .  44 SER C    1 1 
        7  4326 1 1 44 SER CA   C  -14.921  -6.416 -11.374 1.00 . A A .  44 SER CA   1 1 
        7  4327 1 1 44 SER CB   C  -15.066  -5.763  -9.998 1.00 . A A .  44 SER CB   1 1 
        7  4328 1 1 44 SER H    H  -13.547  -8.011 -11.600 1.00 . A A .  44 SER H    1 1 
        7  4329 1 1 44 SER HA   H  -15.890  -6.459 -11.847 1.00 . A A .  44 SER HA   1 1 
        7  4330 1 1 44 SER HB2  H  -15.580  -4.819 -10.103 1.00 . A A .  44 SER HB2  1 1 
        7  4331 1 1 44 SER HB3  H  -15.638  -6.414  -9.352 1.00 . A A .  44 SER HB3  1 1 
        7  4332 1 1 44 SER HG   H  -13.712  -6.066  -8.615 1.00 . A A .  44 SER HG   1 1 
        7  4333 1 1 44 SER N    N  -14.428  -7.781 -11.236 1.00 . A A .  44 SER N    1 1 
        7  4334 1 1 44 SER O    O  -12.763  -5.721 -12.170 1.00 . A A .  44 SER O    1 1 
        7  4335 1 1 44 SER OG   O  -13.800  -5.530  -9.407 1.00 . A A .  44 SER OG   1 1 
        7  4336 1 1 45 SER C    C  -12.663  -4.669 -14.631 1.00 . A A .  45 SER C    1 1 
        7  4337 1 1 45 SER CA   C  -13.785  -3.876 -13.967 1.00 . A A .  45 SER CA   1 1 
        7  4338 1 1 45 SER CB   C  -13.199  -2.692 -13.194 1.00 . A A .  45 SER CB   1 1 
        7  4339 1 1 45 SER H    H  -15.544  -4.664 -13.091 1.00 . A A .  45 SER H    1 1 
        7  4340 1 1 45 SER HA   H  -14.447  -3.502 -14.734 1.00 . A A .  45 SER HA   1 1 
        7  4341 1 1 45 SER HB2  H  -12.582  -3.062 -12.389 1.00 . A A .  45 SER HB2  1 1 
        7  4342 1 1 45 SER HB3  H  -12.598  -2.092 -13.862 1.00 . A A .  45 SER HB3  1 1 
        7  4343 1 1 45 SER HG   H  -15.017  -2.410 -12.520 1.00 . A A .  45 SER HG   1 1 
        7  4344 1 1 45 SER N    N  -14.566  -4.726 -13.076 1.00 . A A .  45 SER N    1 1 
        7  4345 1 1 45 SER O    O  -11.538  -4.189 -14.756 1.00 . A A .  45 SER O    1 1 
        7  4346 1 1 45 SER OG   O  -14.225  -1.882 -12.649 1.00 . A A .  45 SER OG   1 1 
        7  4347 1 1 46 GLY C    C  -12.172  -6.791 -17.204 1.00 . A A .  46 GLY C    1 1 
        7  4348 1 1 46 GLY CA   C  -11.990  -6.731 -15.700 1.00 . A A .  46 GLY CA   1 1 
        7  4349 1 1 46 GLY H    H  -13.894  -6.220 -14.928 1.00 . A A .  46 GLY H    1 1 
        7  4350 1 1 46 GLY HA2  H  -11.007  -6.343 -15.482 1.00 . A A .  46 GLY HA2  1 1 
        7  4351 1 1 46 GLY HA3  H  -12.069  -7.731 -15.299 1.00 . A A .  46 GLY HA3  1 1 
        7  4352 1 1 46 GLY N    N  -12.981  -5.889 -15.055 1.00 . A A .  46 GLY N    1 1 
        7  4353 1 1 46 GLY O    O  -12.321  -7.886 -17.745 1.00 . A A .  46 GLY O    1 1 
        7  4354 2 2  1 ZN  ZN   ZN  -4.100  -3.122  -1.116 1.00 . B A . 201 ZN  ZN   1 1 
        8  4355 1 1  1 GLY C    C  -17.820  13.061  12.736 1.00 . A A .   1 GLY C    1 1 
        8  4356 1 1  1 GLY CA   C  -18.940  13.764  11.996 1.00 . A A .   1 GLY CA   1 1 
        8  4357 1 1  1 GLY H1   H  -19.041  15.447  13.278 1.00 . A A .   1 GLY H1   1 1 
        8  4358 1 1  1 GLY HA2  H  -19.678  13.033  11.701 1.00 . A A .   1 GLY HA2  1 1 
        8  4359 1 1  1 GLY HA3  H  -18.533  14.228  11.109 1.00 . A A .   1 GLY HA3  1 1 
        8  4360 1 1  1 GLY N    N  -19.584  14.784  12.803 1.00 . A A .   1 GLY N    1 1 
        8  4361 1 1  1 GLY O    O  -17.016  13.701  13.414 1.00 . A A .   1 GLY O    1 1 
        8  4362 1 1  2 SER C    C  -15.507  10.800  12.391 1.00 . A A .   2 SER C    1 1 
        8  4363 1 1  2 SER CA   C  -16.741  10.947  13.277 1.00 . A A .   2 SER CA   1 1 
        8  4364 1 1  2 SER CB   C  -17.289   9.565  13.640 1.00 . A A .   2 SER CB   1 1 
        8  4365 1 1  2 SER H    H  -18.437  11.285  12.055 1.00 . A A .   2 SER H    1 1 
        8  4366 1 1  2 SER HA   H  -16.461  11.463  14.182 1.00 . A A .   2 SER HA   1 1 
        8  4367 1 1  2 SER HB2  H  -17.745   9.121  12.769 1.00 . A A .   2 SER HB2  1 1 
        8  4368 1 1  2 SER HB3  H  -16.479   8.938  13.983 1.00 . A A .   2 SER HB3  1 1 
        8  4369 1 1  2 SER HG   H  -17.823   9.699  15.521 1.00 . A A .   2 SER HG   1 1 
        8  4370 1 1  2 SER N    N  -17.768  11.739  12.609 1.00 . A A .   2 SER N    1 1 
        8  4371 1 1  2 SER O    O  -14.393  11.122  12.803 1.00 . A A .   2 SER O    1 1 
        8  4372 1 1  2 SER OG   O  -18.261   9.657  14.668 1.00 . A A .   2 SER OG   1 1 
        8  4373 1 1  3 SER C    C  -13.577  11.220  10.375 1.00 . A A .   3 SER C    1 1 
        8  4374 1 1  3 SER CA   C  -14.621  10.117  10.230 1.00 . A A .   3 SER CA   1 1 
        8  4375 1 1  3 SER CB   C  -15.154  10.088   8.796 1.00 . A A .   3 SER CB   1 1 
        8  4376 1 1  3 SER H    H  -16.627  10.072  10.903 1.00 . A A .   3 SER H    1 1 
        8  4377 1 1  3 SER HA   H  -14.157   9.167  10.451 1.00 . A A .   3 SER HA   1 1 
        8  4378 1 1  3 SER HB2  H  -15.880  10.877   8.669 1.00 . A A .   3 SER HB2  1 1 
        8  4379 1 1  3 SER HB3  H  -14.335  10.238   8.108 1.00 . A A .   3 SER HB3  1 1 
        8  4380 1 1  3 SER HG   H  -15.280   8.138   8.926 1.00 . A A .   3 SER HG   1 1 
        8  4381 1 1  3 SER N    N  -15.716  10.311  11.173 1.00 . A A .   3 SER N    1 1 
        8  4382 1 1  3 SER O    O  -12.385  10.948  10.511 1.00 . A A .   3 SER O    1 1 
        8  4383 1 1  3 SER OG   O  -15.773   8.847   8.506 1.00 . A A .   3 SER OG   1 1 
        8  4384 1 1  4 GLY C    C  -12.382  13.887   9.187 1.00 . A A .   4 GLY C    1 1 
        8  4385 1 1  4 GLY CA   C  -13.130  13.594  10.473 1.00 . A A .   4 GLY CA   1 1 
        8  4386 1 1  4 GLY H    H  -14.997  12.624  10.233 1.00 . A A .   4 GLY H    1 1 
        8  4387 1 1  4 GLY HA2  H  -13.698  14.468  10.753 1.00 . A A .   4 GLY HA2  1 1 
        8  4388 1 1  4 GLY HA3  H  -12.413  13.378  11.251 1.00 . A A .   4 GLY HA3  1 1 
        8  4389 1 1  4 GLY N    N  -14.035  12.468  10.344 1.00 . A A .   4 GLY N    1 1 
        8  4390 1 1  4 GLY O    O  -11.194  13.588   9.070 1.00 . A A .   4 GLY O    1 1 
        8  4391 1 1  5 SER C    C  -12.548  16.300   6.665 1.00 . A A .   5 SER C    1 1 
        8  4392 1 1  5 SER CA   C  -12.475  14.799   6.932 1.00 . A A .   5 SER CA   1 1 
        8  4393 1 1  5 SER CB   C  -13.175  14.035   5.807 1.00 . A A .   5 SER CB   1 1 
        8  4394 1 1  5 SER H    H  -14.024  14.685   8.372 1.00 . A A .   5 SER H    1 1 
        8  4395 1 1  5 SER HA   H  -11.438  14.501   6.968 1.00 . A A .   5 SER HA   1 1 
        8  4396 1 1  5 SER HB2  H  -14.213  14.329   5.767 1.00 . A A .   5 SER HB2  1 1 
        8  4397 1 1  5 SER HB3  H  -12.698  14.269   4.866 1.00 . A A .   5 SER HB3  1 1 
        8  4398 1 1  5 SER HG   H  -13.795  12.200   5.515 1.00 . A A .   5 SER HG   1 1 
        8  4399 1 1  5 SER N    N  -13.080  14.471   8.218 1.00 . A A .   5 SER N    1 1 
        8  4400 1 1  5 SER O    O  -13.598  16.826   6.297 1.00 . A A .   5 SER O    1 1 
        8  4401 1 1  5 SER OG   O  -13.104  12.636   6.019 1.00 . A A .   5 SER OG   1 1 
        8  4402 1 1  6 SER C    C  -11.032  18.739   5.180 1.00 . A A .   6 SER C    1 1 
        8  4403 1 1  6 SER CA   C  -11.358  18.423   6.636 1.00 . A A .   6 SER CA   1 1 
        8  4404 1 1  6 SER CB   C  -10.307  19.051   7.554 1.00 . A A .   6 SER CB   1 1 
        8  4405 1 1  6 SER H    H  -10.618  16.506   7.147 1.00 . A A .   6 SER H    1 1 
        8  4406 1 1  6 SER HA   H  -12.326  18.838   6.875 1.00 . A A .   6 SER HA   1 1 
        8  4407 1 1  6 SER HB2  H  -10.425  18.661   8.553 1.00 . A A .   6 SER HB2  1 1 
        8  4408 1 1  6 SER HB3  H   -9.320  18.807   7.186 1.00 . A A .   6 SER HB3  1 1 
        8  4409 1 1  6 SER HG   H   -9.745  20.835   8.138 1.00 . A A .   6 SER HG   1 1 
        8  4410 1 1  6 SER N    N  -11.423  16.983   6.853 1.00 . A A .   6 SER N    1 1 
        8  4411 1 1  6 SER O    O   -9.870  18.904   4.814 1.00 . A A .   6 SER O    1 1 
        8  4412 1 1  6 SER OG   O  -10.443  20.461   7.595 1.00 . A A .   6 SER OG   1 1 
        8  4413 1 1  7 GLY C    C  -11.369  17.920   2.166 1.00 . A A .   7 GLY C    1 1 
        8  4414 1 1  7 GLY CA   C  -11.875  19.118   2.945 1.00 . A A .   7 GLY CA   1 1 
        8  4415 1 1  7 GLY H    H  -12.975  18.681   4.701 1.00 . A A .   7 GLY H    1 1 
        8  4416 1 1  7 GLY HA2  H  -12.815  19.439   2.522 1.00 . A A .   7 GLY HA2  1 1 
        8  4417 1 1  7 GLY HA3  H  -11.158  19.921   2.854 1.00 . A A .   7 GLY HA3  1 1 
        8  4418 1 1  7 GLY N    N  -12.070  18.822   4.353 1.00 . A A .   7 GLY N    1 1 
        8  4419 1 1  7 GLY O    O  -10.263  17.943   1.626 1.00 . A A .   7 GLY O    1 1 
        8  4420 1 1  8 THR C    C  -11.080  15.985   0.092 1.00 . A A .   8 THR C    1 1 
        8  4421 1 1  8 THR CA   C  -11.809  15.656   1.390 1.00 . A A .   8 THR CA   1 1 
        8  4422 1 1  8 THR CB   C  -13.043  14.792   1.068 1.00 . A A .   8 THR CB   1 1 
        8  4423 1 1  8 THR CG2  C  -13.669  14.247   2.343 1.00 . A A .   8 THR CG2  1 1 
        8  4424 1 1  8 THR H    H  -13.050  16.912   2.557 1.00 . A A .   8 THR H    1 1 
        8  4425 1 1  8 THR HA   H  -11.150  15.082   2.026 1.00 . A A .   8 THR HA   1 1 
        8  4426 1 1  8 THR HB   H  -12.731  13.961   0.453 1.00 . A A .   8 THR HB   1 1 
        8  4427 1 1  8 THR HG1  H  -14.623  15.970   0.971 1.00 . A A .   8 THR HG1  1 1 
        8  4428 1 1  8 THR HG21 H  -13.025  13.490   2.764 1.00 . A A .   8 THR HG21 1 1 
        8  4429 1 1  8 THR HG22 H  -14.632  13.813   2.114 1.00 . A A .   8 THR HG22 1 1 
        8  4430 1 1  8 THR HG23 H  -13.795  15.049   3.054 1.00 . A A .   8 THR HG23 1 1 
        8  4431 1 1  8 THR N    N  -12.181  16.869   2.107 1.00 . A A .   8 THR N    1 1 
        8  4432 1 1  8 THR O    O  -11.606  16.697  -0.763 1.00 . A A .   8 THR O    1 1 
        8  4433 1 1  8 THR OG1  O  -14.009  15.568   0.351 1.00 . A A .   8 THR OG1  1 1 
        8  4434 1 1  9 GLY C    C   -9.055  14.516  -2.178 1.00 . A A .   9 GLY C    1 1 
        8  4435 1 1  9 GLY CA   C   -9.086  15.711  -1.247 1.00 . A A .   9 GLY CA   1 1 
        8  4436 1 1  9 GLY H    H   -9.498  14.901   0.666 1.00 . A A .   9 GLY H    1 1 
        8  4437 1 1  9 GLY HA2  H   -9.512  16.553  -1.772 1.00 . A A .   9 GLY HA2  1 1 
        8  4438 1 1  9 GLY HA3  H   -8.074  15.954  -0.959 1.00 . A A .   9 GLY HA3  1 1 
        8  4439 1 1  9 GLY N    N   -9.866  15.461  -0.049 1.00 . A A .   9 GLY N    1 1 
        8  4440 1 1  9 GLY O    O   -9.051  13.371  -1.728 1.00 . A A .   9 GLY O    1 1 
        8  4441 1 1 10 GLU C    C   -7.603  13.132  -4.608 1.00 . A A .  10 GLU C    1 1 
        8  4442 1 1 10 GLU CA   C   -9.006  13.718  -4.477 1.00 . A A .  10 GLU CA   1 1 
        8  4443 1 1 10 GLU CB   C   -9.479  14.246  -5.833 1.00 . A A .  10 GLU CB   1 1 
        8  4444 1 1 10 GLU CD   C  -11.454  14.447  -7.394 1.00 . A A .  10 GLU CD   1 1 
        8  4445 1 1 10 GLU CG   C  -10.990  14.347  -5.954 1.00 . A A .  10 GLU CG   1 1 
        8  4446 1 1 10 GLU H    H   -9.038  15.716  -3.778 1.00 . A A .  10 GLU H    1 1 
        8  4447 1 1 10 GLU HA   H   -9.679  12.940  -4.150 1.00 . A A .  10 GLU HA   1 1 
        8  4448 1 1 10 GLU HB2  H   -9.059  15.229  -5.989 1.00 . A A .  10 GLU HB2  1 1 
        8  4449 1 1 10 GLU HB3  H   -9.120  13.585  -6.608 1.00 . A A .  10 GLU HB3  1 1 
        8  4450 1 1 10 GLU HG2  H  -11.433  13.468  -5.510 1.00 . A A .  10 GLU HG2  1 1 
        8  4451 1 1 10 GLU HG3  H  -11.324  15.225  -5.421 1.00 . A A .  10 GLU HG3  1 1 
        8  4452 1 1 10 GLU N    N   -9.034  14.782  -3.480 1.00 . A A .  10 GLU N    1 1 
        8  4453 1 1 10 GLU O    O   -6.608  13.855  -4.549 1.00 . A A .  10 GLU O    1 1 
        8  4454 1 1 10 GLU OE1  O  -11.154  13.526  -8.181 1.00 . A A .  10 GLU OE1  1 1 
        8  4455 1 1 10 GLU OE2  O  -12.120  15.448  -7.734 1.00 . A A .  10 GLU OE2  1 1 
        8  4456 1 1 11 LYS C    C   -5.979  10.785  -6.386 1.00 . A A .  11 LYS C    1 1 
        8  4457 1 1 11 LYS CA   C   -6.252  11.132  -4.927 1.00 . A A .  11 LYS CA   1 1 
        8  4458 1 1 11 LYS CB   C   -6.236   9.860  -4.077 1.00 . A A .  11 LYS CB   1 1 
        8  4459 1 1 11 LYS CD   C   -8.452   9.655  -2.912 1.00 . A A .  11 LYS CD   1 1 
        8  4460 1 1 11 LYS CE   C   -9.846   9.048  -2.970 1.00 . A A .  11 LYS CE   1 1 
        8  4461 1 1 11 LYS CG   C   -7.572   9.138  -4.037 1.00 . A A .  11 LYS CG   1 1 
        8  4462 1 1 11 LYS H    H   -8.361  11.295  -4.825 1.00 . A A .  11 LYS H    1 1 
        8  4463 1 1 11 LYS HA   H   -5.479  11.799  -4.577 1.00 . A A .  11 LYS HA   1 1 
        8  4464 1 1 11 LYS HB2  H   -5.496   9.183  -4.478 1.00 . A A .  11 LYS HB2  1 1 
        8  4465 1 1 11 LYS HB3  H   -5.962  10.121  -3.065 1.00 . A A .  11 LYS HB3  1 1 
        8  4466 1 1 11 LYS HD2  H   -8.000   9.400  -1.965 1.00 . A A .  11 LYS HD2  1 1 
        8  4467 1 1 11 LYS HD3  H   -8.534  10.730  -2.996 1.00 . A A .  11 LYS HD3  1 1 
        8  4468 1 1 11 LYS HE2  H   -9.754   7.974  -3.016 1.00 . A A .  11 LYS HE2  1 1 
        8  4469 1 1 11 LYS HE3  H  -10.382   9.325  -2.074 1.00 . A A .  11 LYS HE3  1 1 
        8  4470 1 1 11 LYS HG2  H   -8.081   9.290  -4.977 1.00 . A A .  11 LYS HG2  1 1 
        8  4471 1 1 11 LYS HG3  H   -7.396   8.082  -3.887 1.00 . A A .  11 LYS HG3  1 1 
        8  4472 1 1 11 LYS HZ1  H  -10.165  10.377  -4.550 1.00 . A A .  11 LYS HZ1  1 1 
        8  4473 1 1 11 LYS HZ2  H  -11.588   9.744  -3.888 1.00 . A A .  11 LYS HZ2  1 1 
        8  4474 1 1 11 LYS HZ3  H  -10.621   8.784  -4.891 1.00 . A A .  11 LYS HZ3  1 1 
        8  4475 1 1 11 LYS N    N   -7.532  11.817  -4.786 1.00 . A A .  11 LYS N    1 1 
        8  4476 1 1 11 LYS NZ   N  -10.608   9.521  -4.158 1.00 . A A .  11 LYS NZ   1 1 
        8  4477 1 1 11 LYS O    O   -6.884  10.447  -7.149 1.00 . A A .  11 LYS O    1 1 
        8  4478 1 1 12 PRO C    C   -4.386   9.077  -8.480 1.00 . A A .  12 PRO C    1 1 
        8  4479 1 1 12 PRO CA   C   -4.278  10.563  -8.156 1.00 . A A .  12 PRO CA   1 1 
        8  4480 1 1 12 PRO CB   C   -2.815  11.013  -8.184 1.00 . A A .  12 PRO CB   1 1 
        8  4481 1 1 12 PRO CD   C   -3.570  11.264  -5.930 1.00 . A A .  12 PRO CD   1 1 
        8  4482 1 1 12 PRO CG   C   -2.366  10.929  -6.766 1.00 . A A .  12 PRO CG   1 1 
        8  4483 1 1 12 PRO HA   H   -4.845  11.130  -8.881 1.00 . A A .  12 PRO HA   1 1 
        8  4484 1 1 12 PRO HB2  H   -2.245  10.350  -8.820 1.00 . A A .  12 PRO HB2  1 1 
        8  4485 1 1 12 PRO HB3  H   -2.753  12.023  -8.559 1.00 . A A .  12 PRO HB3  1 1 
        8  4486 1 1 12 PRO HD2  H   -3.562  10.694  -5.012 1.00 . A A .  12 PRO HD2  1 1 
        8  4487 1 1 12 PRO HD3  H   -3.600  12.323  -5.719 1.00 . A A .  12 PRO HD3  1 1 
        8  4488 1 1 12 PRO HG2  H   -2.024   9.929  -6.548 1.00 . A A .  12 PRO HG2  1 1 
        8  4489 1 1 12 PRO HG3  H   -1.576  11.644  -6.589 1.00 . A A .  12 PRO HG3  1 1 
        8  4490 1 1 12 PRO N    N   -4.701  10.868  -6.786 1.00 . A A .  12 PRO N    1 1 
        8  4491 1 1 12 PRO O    O   -4.718   8.699  -9.603 1.00 . A A .  12 PRO O    1 1 
        8  4492 1 1 13 TYR C    C   -4.887   6.130  -6.500 1.00 . A A .  13 TYR C    1 1 
        8  4493 1 1 13 TYR CA   C   -4.166   6.794  -7.669 1.00 . A A .  13 TYR CA   1 1 
        8  4494 1 1 13 TYR CB   C   -2.757   6.214  -7.808 1.00 . A A .  13 TYR CB   1 1 
        8  4495 1 1 13 TYR CD1  C   -1.921   7.494  -9.818 1.00 . A A .  13 TYR CD1  1 1 
        8  4496 1 1 13 TYR CD2  C   -1.994   5.116  -9.950 1.00 . A A .  13 TYR CD2  1 1 
        8  4497 1 1 13 TYR CE1  C   -1.426   7.556 -11.106 1.00 . A A .  13 TYR CE1  1 1 
        8  4498 1 1 13 TYR CE2  C   -1.497   5.167 -11.238 1.00 . A A .  13 TYR CE2  1 1 
        8  4499 1 1 13 TYR CG   C   -2.214   6.276  -9.218 1.00 . A A .  13 TYR CG   1 1 
        8  4500 1 1 13 TYR CZ   C   -1.215   6.390 -11.812 1.00 . A A .  13 TYR CZ   1 1 
        8  4501 1 1 13 TYR H    H   -3.844   8.601  -6.615 1.00 . A A .  13 TYR H    1 1 
        8  4502 1 1 13 TYR HA   H   -4.717   6.596  -8.576 1.00 . A A .  13 TYR HA   1 1 
        8  4503 1 1 13 TYR HB2  H   -2.083   6.765  -7.170 1.00 . A A .  13 TYR HB2  1 1 
        8  4504 1 1 13 TYR HB3  H   -2.769   5.178  -7.502 1.00 . A A .  13 TYR HB3  1 1 
        8  4505 1 1 13 TYR HD1  H   -2.088   8.406  -9.263 1.00 . A A .  13 TYR HD1  1 1 
        8  4506 1 1 13 TYR HD2  H   -2.217   4.160  -9.498 1.00 . A A .  13 TYR HD2  1 1 
        8  4507 1 1 13 TYR HE1  H   -1.204   8.512 -11.556 1.00 . A A .  13 TYR HE1  1 1 
        8  4508 1 1 13 TYR HE2  H   -1.333   4.254 -11.791 1.00 . A A .  13 TYR HE2  1 1 
        8  4509 1 1 13 TYR HH   H    0.210   6.675 -13.070 1.00 . A A .  13 TYR HH   1 1 
        8  4510 1 1 13 TYR N    N   -4.103   8.239  -7.489 1.00 . A A .  13 TYR N    1 1 
        8  4511 1 1 13 TYR O    O   -5.034   6.720  -5.429 1.00 . A A .  13 TYR O    1 1 
        8  4512 1 1 13 TYR OH   O   -0.722   6.445 -13.095 1.00 . A A .  13 TYR OH   1 1 
        8  4513 1 1 14 LYS C    C   -5.952   2.649  -5.936 1.00 . A A .  14 LYS C    1 1 
        8  4514 1 1 14 LYS CA   C   -6.040   4.149  -5.678 1.00 . A A .  14 LYS CA   1 1 
        8  4515 1 1 14 LYS CB   C   -7.506   4.582  -5.617 1.00 . A A .  14 LYS CB   1 1 
        8  4516 1 1 14 LYS CD   C   -8.360   4.207  -3.284 1.00 . A A .  14 LYS CD   1 1 
        8  4517 1 1 14 LYS CE   C   -9.335   5.359  -3.095 1.00 . A A .  14 LYS CE   1 1 
        8  4518 1 1 14 LYS CG   C   -8.362   3.706  -4.718 1.00 . A A .  14 LYS CG   1 1 
        8  4519 1 1 14 LYS H    H   -5.187   4.480  -7.587 1.00 . A A .  14 LYS H    1 1 
        8  4520 1 1 14 LYS HA   H   -5.569   4.368  -4.732 1.00 . A A .  14 LYS HA   1 1 
        8  4521 1 1 14 LYS HB2  H   -7.555   5.596  -5.248 1.00 . A A .  14 LYS HB2  1 1 
        8  4522 1 1 14 LYS HB3  H   -7.920   4.551  -6.615 1.00 . A A .  14 LYS HB3  1 1 
        8  4523 1 1 14 LYS HD2  H   -8.645   3.398  -2.628 1.00 . A A .  14 LYS HD2  1 1 
        8  4524 1 1 14 LYS HD3  H   -7.364   4.544  -3.031 1.00 . A A .  14 LYS HD3  1 1 
        8  4525 1 1 14 LYS HE2  H   -9.093   5.871  -2.176 1.00 . A A .  14 LYS HE2  1 1 
        8  4526 1 1 14 LYS HE3  H   -9.231   6.042  -3.926 1.00 . A A .  14 LYS HE3  1 1 
        8  4527 1 1 14 LYS HG2  H   -9.377   3.709  -5.088 1.00 . A A .  14 LYS HG2  1 1 
        8  4528 1 1 14 LYS HG3  H   -7.973   2.697  -4.738 1.00 . A A .  14 LYS HG3  1 1 
        8  4529 1 1 14 LYS HZ1  H  -10.776   3.892  -2.727 1.00 . A A .  14 LYS HZ1  1 1 
        8  4530 1 1 14 LYS HZ2  H  -11.193   4.967  -3.966 1.00 . A A .  14 LYS HZ2  1 1 
        8  4531 1 1 14 LYS HZ3  H  -11.284   5.462  -2.351 1.00 . A A .  14 LYS HZ3  1 1 
        8  4532 1 1 14 LYS N    N   -5.335   4.897  -6.713 1.00 . A A .  14 LYS N    1 1 
        8  4533 1 1 14 LYS NZ   N  -10.746   4.887  -3.030 1.00 . A A .  14 LYS NZ   1 1 
        8  4534 1 1 14 LYS O    O   -6.039   2.199  -7.079 1.00 . A A .  14 LYS O    1 1 
        8  4535 1 1 15 CYS C    C   -7.055  -0.195  -5.205 1.00 . A A .  15 CYS C    1 1 
        8  4536 1 1 15 CYS CA   C   -5.681   0.428  -4.977 1.00 . A A .  15 CYS CA   1 1 
        8  4537 1 1 15 CYS CB   C   -5.046  -0.158  -3.715 1.00 . A A .  15 CYS CB   1 1 
        8  4538 1 1 15 CYS H    H   -5.717   2.295  -3.982 1.00 . A A .  15 CYS H    1 1 
        8  4539 1 1 15 CYS HA   H   -5.052   0.201  -5.825 1.00 . A A .  15 CYS HA   1 1 
        8  4540 1 1 15 CYS HB2  H   -4.191   0.441  -3.440 1.00 . A A .  15 CYS HB2  1 1 
        8  4541 1 1 15 CYS HB3  H   -5.769  -0.134  -2.913 1.00 . A A .  15 CYS HB3  1 1 
        8  4542 1 1 15 CYS N    N   -5.780   1.878  -4.867 1.00 . A A .  15 CYS N    1 1 
        8  4543 1 1 15 CYS O    O   -8.064   0.303  -4.708 1.00 . A A .  15 CYS O    1 1 
        8  4544 1 1 15 CYS SG   S   -4.479  -1.880  -3.898 1.00 . A A .  15 CYS SG   1 1 
        8  4545 1 1 16 ASN C    C   -8.485  -3.226  -5.389 1.00 . A A .  16 ASN C    1 1 
        8  4546 1 1 16 ASN CA   C   -8.335  -1.979  -6.255 1.00 . A A .  16 ASN CA   1 1 
        8  4547 1 1 16 ASN CB   C   -8.394  -2.363  -7.735 1.00 . A A .  16 ASN CB   1 1 
        8  4548 1 1 16 ASN CG   C   -7.161  -3.125  -8.184 1.00 . A A .  16 ASN CG   1 1 
        8  4549 1 1 16 ASN H    H   -6.248  -1.638  -6.330 1.00 . A A .  16 ASN H    1 1 
        8  4550 1 1 16 ASN HA   H   -9.148  -1.303  -6.036 1.00 . A A .  16 ASN HA   1 1 
        8  4551 1 1 16 ASN HB2  H   -9.260  -2.986  -7.905 1.00 . A A .  16 ASN HB2  1 1 
        8  4552 1 1 16 ASN HB3  H   -8.477  -1.467  -8.331 1.00 . A A .  16 ASN HB3  1 1 
        8  4553 1 1 16 ASN HD21 H   -8.294  -4.630  -8.822 1.00 . A A .  16 ASN HD21 1 1 
        8  4554 1 1 16 ASN HD22 H   -6.591  -4.829  -9.034 1.00 . A A .  16 ASN HD22 1 1 
        8  4555 1 1 16 ASN N    N   -7.085  -1.288  -5.961 1.00 . A A .  16 ASN N    1 1 
        8  4556 1 1 16 ASN ND2  N   -7.370  -4.315  -8.736 1.00 . A A .  16 ASN ND2  1 1 
        8  4557 1 1 16 ASN O    O   -9.466  -3.959  -5.503 1.00 . A A .  16 ASN O    1 1 
        8  4558 1 1 16 ASN OD1  O   -6.036  -2.650  -8.036 1.00 . A A .  16 ASN OD1  1 1 
        8  4559 1 1 17 GLU C    C   -8.062  -4.237  -2.258 1.00 . A A .  17 GLU C    1 1 
        8  4560 1 1 17 GLU CA   C   -7.527  -4.616  -3.636 1.00 . A A .  17 GLU CA   1 1 
        8  4561 1 1 17 GLU CB   C   -6.124  -5.213  -3.504 1.00 . A A .  17 GLU CB   1 1 
        8  4562 1 1 17 GLU CD   C   -6.415  -7.270  -4.941 1.00 . A A .  17 GLU CD   1 1 
        8  4563 1 1 17 GLU CG   C   -5.665  -5.968  -4.740 1.00 . A A .  17 GLU CG   1 1 
        8  4564 1 1 17 GLU H    H   -6.748  -2.837  -4.477 1.00 . A A .  17 GLU H    1 1 
        8  4565 1 1 17 GLU HA   H   -8.182  -5.355  -4.072 1.00 . A A .  17 GLU HA   1 1 
        8  4566 1 1 17 GLU HB2  H   -5.423  -4.414  -3.313 1.00 . A A .  17 GLU HB2  1 1 
        8  4567 1 1 17 GLU HB3  H   -6.114  -5.896  -2.667 1.00 . A A .  17 GLU HB3  1 1 
        8  4568 1 1 17 GLU HG2  H   -5.821  -5.343  -5.606 1.00 . A A .  17 GLU HG2  1 1 
        8  4569 1 1 17 GLU HG3  H   -4.612  -6.188  -4.641 1.00 . A A .  17 GLU HG3  1 1 
        8  4570 1 1 17 GLU N    N   -7.504  -3.458  -4.522 1.00 . A A .  17 GLU N    1 1 
        8  4571 1 1 17 GLU O    O   -8.946  -4.903  -1.718 1.00 . A A .  17 GLU O    1 1 
        8  4572 1 1 17 GLU OE1  O   -6.463  -8.080  -3.993 1.00 . A A .  17 GLU OE1  1 1 
        8  4573 1 1 17 GLU OE2  O   -6.955  -7.478  -6.048 1.00 . A A .  17 GLU OE2  1 1 
        8  4574 1 1 18 CYS C    C   -8.569  -1.307  -0.472 1.00 . A A .  18 CYS C    1 1 
        8  4575 1 1 18 CYS CA   C   -7.940  -2.694  -0.380 1.00 . A A .  18 CYS CA   1 1 
        8  4576 1 1 18 CYS CB   C   -6.748  -2.662   0.579 1.00 . A A .  18 CYS CB   1 1 
        8  4577 1 1 18 CYS H    H   -6.818  -2.674  -2.174 1.00 . A A .  18 CYS H    1 1 
        8  4578 1 1 18 CYS HA   H   -8.677  -3.386   0.000 1.00 . A A .  18 CYS HA   1 1 
        8  4579 1 1 18 CYS HB2  H   -7.059  -2.219   1.514 1.00 . A A .  18 CYS HB2  1 1 
        8  4580 1 1 18 CYS HB3  H   -6.413  -3.673   0.760 1.00 . A A .  18 CYS HB3  1 1 
        8  4581 1 1 18 CYS N    N   -7.519  -3.163  -1.694 1.00 . A A .  18 CYS N    1 1 
        8  4582 1 1 18 CYS O    O   -9.651  -1.067   0.063 1.00 . A A .  18 CYS O    1 1 
        8  4583 1 1 18 CYS SG   S   -5.324  -1.708  -0.038 1.00 . A A .  18 CYS SG   1 1 
        8  4584 1 1 19 GLY C    C   -7.402   2.001  -0.834 1.00 . A A .  19 GLY C    1 1 
        8  4585 1 1 19 GLY CA   C   -8.390   0.955  -1.308 1.00 . A A .  19 GLY CA   1 1 
        8  4586 1 1 19 GLY H    H   -7.026  -0.645  -1.563 1.00 . A A .  19 GLY H    1 1 
        8  4587 1 1 19 GLY HA2  H   -8.613   1.130  -2.350 1.00 . A A .  19 GLY HA2  1 1 
        8  4588 1 1 19 GLY HA3  H   -9.301   1.052  -0.735 1.00 . A A .  19 GLY HA3  1 1 
        8  4589 1 1 19 GLY N    N   -7.884  -0.397  -1.157 1.00 . A A .  19 GLY N    1 1 
        8  4590 1 1 19 GLY O    O   -7.788   3.114  -0.474 1.00 . A A .  19 GLY O    1 1 
        8  4591 1 1 20 LYS C    C   -4.844   3.656  -1.436 1.00 . A A .  20 LYS C    1 1 
        8  4592 1 1 20 LYS CA   C   -5.073   2.561  -0.399 1.00 . A A .  20 LYS CA   1 1 
        8  4593 1 1 20 LYS CB   C   -3.770   1.797  -0.152 1.00 . A A .  20 LYS CB   1 1 
        8  4594 1 1 20 LYS CD   C   -3.094   2.199   2.234 1.00 . A A .  20 LYS CD   1 1 
        8  4595 1 1 20 LYS CE   C   -1.586   2.330   2.082 1.00 . A A .  20 LYS CE   1 1 
        8  4596 1 1 20 LYS CG   C   -3.669   1.202   1.242 1.00 . A A .  20 LYS CG   1 1 
        8  4597 1 1 20 LYS H    H   -5.876   0.744  -1.131 1.00 . A A .  20 LYS H    1 1 
        8  4598 1 1 20 LYS HA   H   -5.393   3.019   0.525 1.00 . A A .  20 LYS HA   1 1 
        8  4599 1 1 20 LYS HB2  H   -3.696   0.994  -0.870 1.00 . A A .  20 LYS HB2  1 1 
        8  4600 1 1 20 LYS HB3  H   -2.938   2.473  -0.293 1.00 . A A .  20 LYS HB3  1 1 
        8  4601 1 1 20 LYS HD2  H   -3.546   3.165   2.064 1.00 . A A .  20 LYS HD2  1 1 
        8  4602 1 1 20 LYS HD3  H   -3.318   1.866   3.237 1.00 . A A .  20 LYS HD3  1 1 
        8  4603 1 1 20 LYS HE2  H   -1.355   2.495   1.041 1.00 . A A .  20 LYS HE2  1 1 
        8  4604 1 1 20 LYS HE3  H   -1.251   3.176   2.663 1.00 . A A .  20 LYS HE3  1 1 
        8  4605 1 1 20 LYS HG2  H   -4.655   0.911   1.572 1.00 . A A .  20 LYS HG2  1 1 
        8  4606 1 1 20 LYS HG3  H   -3.028   0.333   1.206 1.00 . A A .  20 LYS HG3  1 1 
        8  4607 1 1 20 LYS HZ1  H    0.027   1.003   2.040 1.00 . A A .  20 LYS HZ1  1 1 
        8  4608 1 1 20 LYS HZ2  H   -1.458   0.266   2.376 1.00 . A A .  20 LYS HZ2  1 1 
        8  4609 1 1 20 LYS HZ3  H   -0.678   1.177   3.568 1.00 . A A .  20 LYS HZ3  1 1 
        8  4610 1 1 20 LYS N    N   -6.121   1.646  -0.833 1.00 . A A .  20 LYS N    1 1 
        8  4611 1 1 20 LYS NZ   N   -0.874   1.109   2.549 1.00 . A A .  20 LYS NZ   1 1 
        8  4612 1 1 20 LYS O    O   -4.570   3.372  -2.602 1.00 . A A .  20 LYS O    1 1 
        8  4613 1 1 21 ALA C    C   -3.307   6.517  -1.866 1.00 . A A .  21 ALA C    1 1 
        8  4614 1 1 21 ALA CA   C   -4.756   6.044  -1.894 1.00 . A A .  21 ALA CA   1 1 
        8  4615 1 1 21 ALA CB   C   -5.692   7.183  -1.513 1.00 . A A .  21 ALA CB   1 1 
        8  4616 1 1 21 ALA H    H   -5.175   5.070  -0.062 1.00 . A A .  21 ALA H    1 1 
        8  4617 1 1 21 ALA HA   H   -5.003   5.729  -2.897 1.00 . A A .  21 ALA HA   1 1 
        8  4618 1 1 21 ALA HB1  H   -6.141   7.593  -2.405 1.00 . A A .  21 ALA HB1  1 1 
        8  4619 1 1 21 ALA HB2  H   -6.466   6.808  -0.859 1.00 . A A .  21 ALA HB2  1 1 
        8  4620 1 1 21 ALA HB3  H   -5.132   7.953  -1.004 1.00 . A A .  21 ALA HB3  1 1 
        8  4621 1 1 21 ALA N    N   -4.955   4.908  -1.003 1.00 . A A .  21 ALA N    1 1 
        8  4622 1 1 21 ALA O    O   -2.802   6.943  -0.827 1.00 . A A .  21 ALA O    1 1 
        8  4623 1 1 22 PHE C    C   -1.127   8.144  -3.928 1.00 . A A .  22 PHE C    1 1 
        8  4624 1 1 22 PHE CA   C   -1.248   6.855  -3.120 1.00 . A A .  22 PHE CA   1 1 
        8  4625 1 1 22 PHE CB   C   -0.411   5.752  -3.771 1.00 . A A .  22 PHE CB   1 1 
        8  4626 1 1 22 PHE CD1  C   -1.571   3.551  -3.439 1.00 . A A .  22 PHE CD1  1 1 
        8  4627 1 1 22 PHE CD2  C    0.351   4.031  -2.111 1.00 . A A .  22 PHE CD2  1 1 
        8  4628 1 1 22 PHE CE1  C   -1.698   2.324  -2.816 1.00 . A A .  22 PHE CE1  1 1 
        8  4629 1 1 22 PHE CE2  C    0.229   2.804  -1.485 1.00 . A A .  22 PHE CE2  1 1 
        8  4630 1 1 22 PHE CG   C   -0.547   4.418  -3.093 1.00 . A A .  22 PHE CG   1 1 
        8  4631 1 1 22 PHE CZ   C   -0.797   1.949  -1.839 1.00 . A A .  22 PHE CZ   1 1 
        8  4632 1 1 22 PHE H    H   -3.098   6.088  -3.808 1.00 . A A .  22 PHE H    1 1 
        8  4633 1 1 22 PHE HA   H   -0.880   7.034  -2.122 1.00 . A A .  22 PHE HA   1 1 
        8  4634 1 1 22 PHE HB2  H   -0.720   5.634  -4.798 1.00 . A A .  22 PHE HB2  1 1 
        8  4635 1 1 22 PHE HB3  H    0.630   6.036  -3.742 1.00 . A A .  22 PHE HB3  1 1 
        8  4636 1 1 22 PHE HD1  H   -2.276   3.842  -4.204 1.00 . A A .  22 PHE HD1  1 1 
        8  4637 1 1 22 PHE HD2  H    1.154   4.699  -1.833 1.00 . A A .  22 PHE HD2  1 1 
        8  4638 1 1 22 PHE HE1  H   -2.500   1.657  -3.095 1.00 . A A .  22 PHE HE1  1 1 
        8  4639 1 1 22 PHE HE2  H    0.935   2.515  -0.722 1.00 . A A .  22 PHE HE2  1 1 
        8  4640 1 1 22 PHE HZ   H   -0.894   0.991  -1.351 1.00 . A A .  22 PHE HZ   1 1 
        8  4641 1 1 22 PHE N    N   -2.641   6.437  -3.013 1.00 . A A .  22 PHE N    1 1 
        8  4642 1 1 22 PHE O    O   -2.079   8.570  -4.583 1.00 . A A .  22 PHE O    1 1 
        8  4643 1 1 23 ARG C    C    1.489   9.855  -5.538 1.00 . A A .  23 ARG C    1 1 
        8  4644 1 1 23 ARG CA   C    0.295  10.001  -4.599 1.00 . A A .  23 ARG CA   1 1 
        8  4645 1 1 23 ARG CB   C    0.540  11.149  -3.618 1.00 . A A .  23 ARG CB   1 1 
        8  4646 1 1 23 ARG CD   C   -0.589  12.976  -2.314 1.00 . A A .  23 ARG CD   1 1 
        8  4647 1 1 23 ARG CG   C   -0.695  11.549  -2.827 1.00 . A A .  23 ARG CG   1 1 
        8  4648 1 1 23 ARG CZ   C    0.680  14.222  -0.617 1.00 . A A .  23 ARG CZ   1 1 
        8  4649 1 1 23 ARG H    H    0.769   8.371  -3.335 1.00 . A A .  23 ARG H    1 1 
        8  4650 1 1 23 ARG HA   H   -0.584  10.222  -5.186 1.00 . A A .  23 ARG HA   1 1 
        8  4651 1 1 23 ARG HB2  H    1.308  10.852  -2.919 1.00 . A A .  23 ARG HB2  1 1 
        8  4652 1 1 23 ARG HB3  H    0.882  12.011  -4.171 1.00 . A A .  23 ARG HB3  1 1 
        8  4653 1 1 23 ARG HD2  H   -0.170  13.595  -3.094 1.00 . A A .  23 ARG HD2  1 1 
        8  4654 1 1 23 ARG HD3  H   -1.580  13.330  -2.068 1.00 . A A .  23 ARG HD3  1 1 
        8  4655 1 1 23 ARG HE   H    0.523  12.235  -0.693 1.00 . A A .  23 ARG HE   1 1 
        8  4656 1 1 23 ARG HG2  H   -1.561  11.471  -3.467 1.00 . A A .  23 ARG HG2  1 1 
        8  4657 1 1 23 ARG HG3  H   -0.804  10.880  -1.987 1.00 . A A .  23 ARG HG3  1 1 
        8  4658 1 1 23 ARG HH11 H   -0.243  15.369  -1.999 1.00 . A A .  23 ARG HH11 1 1 
        8  4659 1 1 23 ARG HH12 H    0.655  16.235  -0.797 1.00 . A A .  23 ARG HH12 1 1 
        8  4660 1 1 23 ARG HH21 H    1.708  13.363   0.897 1.00 . A A .  23 ARG HH21 1 1 
        8  4661 1 1 23 ARG HH22 H    1.765  15.092   0.850 1.00 . A A .  23 ARG HH22 1 1 
        8  4662 1 1 23 ARG N    N    0.049   8.760  -3.875 1.00 . A A .  23 ARG N    1 1 
        8  4663 1 1 23 ARG NE   N    0.257  13.071  -1.128 1.00 . A A .  23 ARG NE   1 1 
        8  4664 1 1 23 ARG NH1  N    0.336  15.369  -1.185 1.00 . A A .  23 ARG NH1  1 1 
        8  4665 1 1 23 ARG NH2  N    1.448  14.226   0.466 1.00 . A A .  23 ARG NH2  1 1 
        8  4666 1 1 23 ARG O    O    2.204  10.821  -5.803 1.00 . A A .  23 ARG O    1 1 
        8  4667 1 1 24 ALA C    C    2.698   6.968  -7.537 1.00 . A A .  24 ALA C    1 1 
        8  4668 1 1 24 ALA CA   C    2.805   8.370  -6.945 1.00 . A A .  24 ALA CA   1 1 
        8  4669 1 1 24 ALA CB   C    4.135   8.541  -6.225 1.00 . A A .  24 ALA CB   1 1 
        8  4670 1 1 24 ALA H    H    1.095   7.912  -5.787 1.00 . A A .  24 ALA H    1 1 
        8  4671 1 1 24 ALA HA   H    2.763   9.092  -7.748 1.00 . A A .  24 ALA HA   1 1 
        8  4672 1 1 24 ALA HB1  H    4.584   9.477  -6.518 1.00 . A A .  24 ALA HB1  1 1 
        8  4673 1 1 24 ALA HB2  H    3.968   8.539  -5.158 1.00 . A A .  24 ALA HB2  1 1 
        8  4674 1 1 24 ALA HB3  H    4.793   7.726  -6.488 1.00 . A A .  24 ALA HB3  1 1 
        8  4675 1 1 24 ALA N    N    1.699   8.641  -6.036 1.00 . A A .  24 ALA N    1 1 
        8  4676 1 1 24 ALA O    O    2.494   5.993  -6.814 1.00 . A A .  24 ALA O    1 1 
        8  4677 1 1 25 ARG C    C    3.514   4.514  -8.778 1.00 . A A .  25 ARG C    1 1 
        8  4678 1 1 25 ARG CA   C    2.754   5.593  -9.544 1.00 . A A .  25 ARG CA   1 1 
        8  4679 1 1 25 ARG CB   C    3.311   5.714 -10.963 1.00 . A A .  25 ARG CB   1 1 
        8  4680 1 1 25 ARG CD   C    3.001   6.856 -13.180 1.00 . A A .  25 ARG CD   1 1 
        8  4681 1 1 25 ARG CG   C    2.307   6.256 -11.967 1.00 . A A .  25 ARG CG   1 1 
        8  4682 1 1 25 ARG CZ   C    4.513   6.093 -14.962 1.00 . A A .  25 ARG CZ   1 1 
        8  4683 1 1 25 ARG H    H    2.998   7.688  -9.378 1.00 . A A .  25 ARG H    1 1 
        8  4684 1 1 25 ARG HA   H    1.712   5.312  -9.598 1.00 . A A .  25 ARG HA   1 1 
        8  4685 1 1 25 ARG HB2  H    4.164   6.377 -10.947 1.00 . A A .  25 ARG HB2  1 1 
        8  4686 1 1 25 ARG HB3  H    3.630   4.738 -11.296 1.00 . A A .  25 ARG HB3  1 1 
        8  4687 1 1 25 ARG HD2  H    2.273   7.402 -13.762 1.00 . A A .  25 ARG HD2  1 1 
        8  4688 1 1 25 ARG HD3  H    3.770   7.533 -12.840 1.00 . A A .  25 ARG HD3  1 1 
        8  4689 1 1 25 ARG HE   H    3.329   4.903 -13.885 1.00 . A A .  25 ARG HE   1 1 
        8  4690 1 1 25 ARG HG2  H    1.667   5.450 -12.294 1.00 . A A .  25 ARG HG2  1 1 
        8  4691 1 1 25 ARG HG3  H    1.711   7.020 -11.490 1.00 . A A .  25 ARG HG3  1 1 
        8  4692 1 1 25 ARG HH11 H    4.532   8.085 -14.626 1.00 . A A .  25 ARG HH11 1 1 
        8  4693 1 1 25 ARG HH12 H    5.594   7.534 -15.879 1.00 . A A .  25 ARG HH12 1 1 
        8  4694 1 1 25 ARG HH21 H    4.723   4.165 -15.533 1.00 . A A .  25 ARG HH21 1 1 
        8  4695 1 1 25 ARG HH22 H    5.701   5.304 -16.395 1.00 . A A .  25 ARG HH22 1 1 
        8  4696 1 1 25 ARG N    N    2.837   6.875  -8.855 1.00 . A A .  25 ARG N    1 1 
        8  4697 1 1 25 ARG NE   N    3.609   5.831 -14.025 1.00 . A A .  25 ARG NE   1 1 
        8  4698 1 1 25 ARG NH1  N    4.912   7.340 -15.173 1.00 . A A .  25 ARG NH1  1 1 
        8  4699 1 1 25 ARG NH2  N    5.021   5.106 -15.690 1.00 . A A .  25 ARG NH2  1 1 
        8  4700 1 1 25 ARG O    O    3.035   3.390  -8.627 1.00 . A A .  25 ARG O    1 1 
        8  4701 1 1 26 SER C    C    4.932   3.644  -6.175 1.00 . A A .  26 SER C    1 1 
        8  4702 1 1 26 SER CA   C    5.532   3.925  -7.550 1.00 . A A .  26 SER CA   1 1 
        8  4703 1 1 26 SER CB   C    6.951   4.475  -7.397 1.00 . A A .  26 SER CB   1 1 
        8  4704 1 1 26 SER H    H    5.031   5.775  -8.449 1.00 . A A .  26 SER H    1 1 
        8  4705 1 1 26 SER HA   H    5.571   3.002  -8.108 1.00 . A A .  26 SER HA   1 1 
        8  4706 1 1 26 SER HB2  H    6.925   5.368  -6.790 1.00 . A A .  26 SER HB2  1 1 
        8  4707 1 1 26 SER HB3  H    7.572   3.733  -6.917 1.00 . A A .  26 SER HB3  1 1 
        8  4708 1 1 26 SER HG   H    7.818   5.706  -8.650 1.00 . A A .  26 SER HG   1 1 
        8  4709 1 1 26 SER N    N    4.703   4.864  -8.296 1.00 . A A .  26 SER N    1 1 
        8  4710 1 1 26 SER O    O    4.988   2.519  -5.680 1.00 . A A .  26 SER O    1 1 
        8  4711 1 1 26 SER OG   O    7.513   4.796  -8.657 1.00 . A A .  26 SER OG   1 1 
        8  4712 1 1 27 SER C    C    2.728   3.411  -4.231 1.00 . A A .  27 SER C    1 1 
        8  4713 1 1 27 SER CA   C    3.750   4.543  -4.246 1.00 . A A .  27 SER CA   1 1 
        8  4714 1 1 27 SER CB   C    3.082   5.856  -3.835 1.00 . A A .  27 SER CB   1 1 
        8  4715 1 1 27 SER H    H    4.345   5.549  -6.012 1.00 . A A .  27 SER H    1 1 
        8  4716 1 1 27 SER HA   H    4.535   4.312  -3.542 1.00 . A A .  27 SER HA   1 1 
        8  4717 1 1 27 SER HB2  H    2.422   6.183  -4.623 1.00 . A A .  27 SER HB2  1 1 
        8  4718 1 1 27 SER HB3  H    2.512   5.698  -2.930 1.00 . A A .  27 SER HB3  1 1 
        8  4719 1 1 27 SER HG   H    3.605   7.665  -3.296 1.00 . A A .  27 SER HG   1 1 
        8  4720 1 1 27 SER N    N    4.358   4.676  -5.565 1.00 . A A .  27 SER N    1 1 
        8  4721 1 1 27 SER O    O    2.576   2.708  -3.231 1.00 . A A .  27 SER O    1 1 
        8  4722 1 1 27 SER OG   O    4.046   6.867  -3.597 1.00 . A A .  27 SER OG   1 1 
        8  4723 1 1 28 LEU C    C    1.669   0.824  -5.620 1.00 . A A .  28 LEU C    1 1 
        8  4724 1 1 28 LEU CA   C    1.017   2.194  -5.464 1.00 . A A .  28 LEU CA   1 1 
        8  4725 1 1 28 LEU CB   C    0.100   2.474  -6.656 1.00 . A A .  28 LEU CB   1 1 
        8  4726 1 1 28 LEU CD1  C   -1.979   1.226  -6.023 1.00 . A A .  28 LEU CD1  1 1 
        8  4727 1 1 28 LEU CD2  C   -1.427   1.588  -8.435 1.00 . A A .  28 LEU CD2  1 1 
        8  4728 1 1 28 LEU CG   C   -0.859   1.348  -7.044 1.00 . A A .  28 LEU CG   1 1 
        8  4729 1 1 28 LEU H    H    2.192   3.832  -6.111 1.00 . A A .  28 LEU H    1 1 
        8  4730 1 1 28 LEU HA   H    0.429   2.199  -4.559 1.00 . A A .  28 LEU HA   1 1 
        8  4731 1 1 28 LEU HB2  H   -0.491   3.346  -6.421 1.00 . A A .  28 LEU HB2  1 1 
        8  4732 1 1 28 LEU HB3  H    0.726   2.687  -7.511 1.00 . A A .  28 LEU HB3  1 1 
        8  4733 1 1 28 LEU HD11 H   -1.731   1.804  -5.146 1.00 . A A .  28 LEU HD11 1 1 
        8  4734 1 1 28 LEU HD12 H   -2.103   0.189  -5.747 1.00 . A A .  28 LEU HD12 1 1 
        8  4735 1 1 28 LEU HD13 H   -2.899   1.596  -6.451 1.00 . A A .  28 LEU HD13 1 1 
        8  4736 1 1 28 LEU HD21 H   -2.037   2.478  -8.427 1.00 . A A .  28 LEU HD21 1 1 
        8  4737 1 1 28 LEU HD22 H   -2.030   0.740  -8.728 1.00 . A A .  28 LEU HD22 1 1 
        8  4738 1 1 28 LEU HD23 H   -0.616   1.712  -9.139 1.00 . A A .  28 LEU HD23 1 1 
        8  4739 1 1 28 LEU HG   H   -0.318   0.412  -7.059 1.00 . A A .  28 LEU HG   1 1 
        8  4740 1 1 28 LEU N    N    2.027   3.241  -5.347 1.00 . A A .  28 LEU N    1 1 
        8  4741 1 1 28 LEU O    O    1.257  -0.146  -4.985 1.00 . A A .  28 LEU O    1 1 
        8  4742 1 1 29 ALA C    C    3.996  -1.043  -5.411 1.00 . A A .  29 ALA C    1 1 
        8  4743 1 1 29 ALA CA   C    3.401  -0.497  -6.704 1.00 . A A .  29 ALA CA   1 1 
        8  4744 1 1 29 ALA CB   C    4.491  -0.296  -7.746 1.00 . A A .  29 ALA CB   1 1 
        8  4745 1 1 29 ALA H    H    2.972   1.561  -6.945 1.00 . A A .  29 ALA H    1 1 
        8  4746 1 1 29 ALA HA   H    2.693  -1.215  -7.094 1.00 . A A .  29 ALA HA   1 1 
        8  4747 1 1 29 ALA HB1  H    5.262   0.342  -7.340 1.00 . A A .  29 ALA HB1  1 1 
        8  4748 1 1 29 ALA HB2  H    4.917  -1.253  -8.010 1.00 . A A .  29 ALA HB2  1 1 
        8  4749 1 1 29 ALA HB3  H    4.068   0.165  -8.625 1.00 . A A .  29 ALA HB3  1 1 
        8  4750 1 1 29 ALA N    N    2.689   0.753  -6.468 1.00 . A A .  29 ALA N    1 1 
        8  4751 1 1 29 ALA O    O    3.658  -2.144  -4.977 1.00 . A A .  29 ALA O    1 1 
        8  4752 1 1 30 ILE C    C    4.546  -1.401  -2.644 1.00 . A A .  30 ILE C    1 1 
        8  4753 1 1 30 ILE CA   C    5.527  -0.672  -3.556 1.00 . A A .  30 ILE CA   1 1 
        8  4754 1 1 30 ILE CB   C    6.109   0.538  -2.802 1.00 . A A .  30 ILE CB   1 1 
        8  4755 1 1 30 ILE CD1  C    7.227   2.747  -3.395 1.00 . A A .  30 ILE CD1  1 1 
        8  4756 1 1 30 ILE CG1  C    7.137   1.263  -3.674 1.00 . A A .  30 ILE CG1  1 1 
        8  4757 1 1 30 ILE CG2  C    6.739   0.092  -1.491 1.00 . A A .  30 ILE CG2  1 1 
        8  4758 1 1 30 ILE H    H    5.113   0.601  -5.195 1.00 . A A .  30 ILE H    1 1 
        8  4759 1 1 30 ILE HA   H    6.338  -1.341  -3.803 1.00 . A A .  30 ILE HA   1 1 
        8  4760 1 1 30 ILE HB   H    5.300   1.215  -2.574 1.00 . A A .  30 ILE HB   1 1 
        8  4761 1 1 30 ILE HD11 H    6.727   2.969  -2.463 1.00 . A A .  30 ILE HD11 1 1 
        8  4762 1 1 30 ILE HD12 H    8.264   3.039  -3.325 1.00 . A A .  30 ILE HD12 1 1 
        8  4763 1 1 30 ILE HD13 H    6.751   3.293  -4.196 1.00 . A A .  30 ILE HD13 1 1 
        8  4764 1 1 30 ILE HG12 H    8.112   0.834  -3.501 1.00 . A A .  30 ILE HG12 1 1 
        8  4765 1 1 30 ILE HG13 H    6.871   1.135  -4.713 1.00 . A A .  30 ILE HG13 1 1 
        8  4766 1 1 30 ILE HG21 H    6.290  -0.838  -1.174 1.00 . A A .  30 ILE HG21 1 1 
        8  4767 1 1 30 ILE HG22 H    7.800  -0.050  -1.631 1.00 . A A .  30 ILE HG22 1 1 
        8  4768 1 1 30 ILE HG23 H    6.573   0.847  -0.737 1.00 . A A .  30 ILE HG23 1 1 
        8  4769 1 1 30 ILE N    N    4.885  -0.266  -4.800 1.00 . A A .  30 ILE N    1 1 
        8  4770 1 1 30 ILE O    O    4.909  -2.362  -1.965 1.00 . A A .  30 ILE O    1 1 
        8  4771 1 1 31 HIS C    C    1.814  -2.882  -2.395 1.00 . A A .  31 HIS C    1 1 
        8  4772 1 1 31 HIS CA   C    2.264  -1.548  -1.807 1.00 . A A .  31 HIS CA   1 1 
        8  4773 1 1 31 HIS CB   C    1.067  -0.606  -1.674 1.00 . A A .  31 HIS CB   1 1 
        8  4774 1 1 31 HIS CD2  C   -1.422  -1.243  -2.028 1.00 . A A .  31 HIS CD2  1 1 
        8  4775 1 1 31 HIS CE1  C   -1.623  -2.677  -0.381 1.00 . A A .  31 HIS CE1  1 1 
        8  4776 1 1 31 HIS CG   C   -0.224  -1.314  -1.401 1.00 . A A .  31 HIS CG   1 1 
        8  4777 1 1 31 HIS H    H    3.071  -0.170  -3.197 1.00 . A A .  31 HIS H    1 1 
        8  4778 1 1 31 HIS HA   H    2.683  -1.724  -0.828 1.00 . A A .  31 HIS HA   1 1 
        8  4779 1 1 31 HIS HB2  H    1.247   0.081  -0.861 1.00 . A A .  31 HIS HB2  1 1 
        8  4780 1 1 31 HIS HB3  H    0.953  -0.048  -2.592 1.00 . A A .  31 HIS HB3  1 1 
        8  4781 1 1 31 HIS HD1  H    0.309  -2.489   0.264 1.00 . A A .  31 HIS HD1  1 1 
        8  4782 1 1 31 HIS HD2  H   -1.664  -0.627  -2.883 1.00 . A A .  31 HIS HD2  1 1 
        8  4783 1 1 31 HIS HE1  H   -2.035  -3.399   0.308 1.00 . A A .  31 HIS HE1  1 1 
        8  4784 1 1 31 HIS N    N    3.300  -0.939  -2.634 1.00 . A A .  31 HIS N    1 1 
        8  4785 1 1 31 HIS ND1  N   -0.384  -2.220  -0.374 1.00 . A A .  31 HIS ND1  1 1 
        8  4786 1 1 31 HIS NE2  N   -2.274  -2.099  -1.375 1.00 . A A .  31 HIS NE2  1 1 
        8  4787 1 1 31 HIS O    O    1.621  -3.857  -1.669 1.00 . A A .  31 HIS O    1 1 
        8  4788 1 1 32 GLN C    C    2.050  -5.330  -3.950 1.00 . A A .  32 GLN C    1 1 
        8  4789 1 1 32 GLN CA   C    1.221  -4.131  -4.398 1.00 . A A .  32 GLN CA   1 1 
        8  4790 1 1 32 GLN CB   C    1.335  -3.955  -5.913 1.00 . A A .  32 GLN CB   1 1 
        8  4791 1 1 32 GLN CD   C   -1.088  -3.458  -6.428 1.00 . A A .  32 GLN CD   1 1 
        8  4792 1 1 32 GLN CG   C    0.342  -2.957  -6.486 1.00 . A A .  32 GLN CG   1 1 
        8  4793 1 1 32 GLN H    H    1.820  -2.107  -4.238 1.00 . A A .  32 GLN H    1 1 
        8  4794 1 1 32 GLN HA   H    0.188  -4.308  -4.142 1.00 . A A .  32 GLN HA   1 1 
        8  4795 1 1 32 GLN HB2  H    2.332  -3.614  -6.150 1.00 . A A .  32 GLN HB2  1 1 
        8  4796 1 1 32 GLN HB3  H    1.167  -4.910  -6.388 1.00 . A A .  32 GLN HB3  1 1 
        8  4797 1 1 32 GLN HE21 H   -1.725  -1.821  -7.360 1.00 . A A .  32 GLN HE21 1 1 
        8  4798 1 1 32 GLN HE22 H   -2.946  -2.969  -6.939 1.00 . A A .  32 GLN HE22 1 1 
        8  4799 1 1 32 GLN HG2  H    0.408  -2.038  -5.922 1.00 . A A .  32 GLN HG2  1 1 
        8  4800 1 1 32 GLN HG3  H    0.599  -2.764  -7.517 1.00 . A A .  32 GLN HG3  1 1 
        8  4801 1 1 32 GLN N    N    1.650  -2.917  -3.714 1.00 . A A .  32 GLN N    1 1 
        8  4802 1 1 32 GLN NE2  N   -2.014  -2.670  -6.962 1.00 . A A .  32 GLN NE2  1 1 
        8  4803 1 1 32 GLN O    O    1.643  -6.478  -4.124 1.00 . A A .  32 GLN O    1 1 
        8  4804 1 1 32 GLN OE1  O   -1.358  -4.541  -5.909 1.00 . A A .  32 GLN OE1  1 1 
        8  4805 1 1 33 ALA C    C    3.628  -6.662  -1.556 1.00 . A A .  33 ALA C    1 1 
        8  4806 1 1 33 ALA CA   C    4.101  -6.111  -2.897 1.00 . A A .  33 ALA CA   1 1 
        8  4807 1 1 33 ALA CB   C    5.527  -5.593  -2.784 1.00 . A A .  33 ALA CB   1 1 
        8  4808 1 1 33 ALA H    H    3.485  -4.119  -3.261 1.00 . A A .  33 ALA H    1 1 
        8  4809 1 1 33 ALA HA   H    4.090  -6.908  -3.627 1.00 . A A .  33 ALA HA   1 1 
        8  4810 1 1 33 ALA HB1  H    5.517  -4.513  -2.777 1.00 . A A .  33 ALA HB1  1 1 
        8  4811 1 1 33 ALA HB2  H    5.969  -5.956  -1.867 1.00 . A A .  33 ALA HB2  1 1 
        8  4812 1 1 33 ALA HB3  H    6.105  -5.943  -3.626 1.00 . A A .  33 ALA HB3  1 1 
        8  4813 1 1 33 ALA N    N    3.215  -5.055  -3.372 1.00 . A A .  33 ALA N    1 1 
        8  4814 1 1 33 ALA O    O    4.335  -7.433  -0.905 1.00 . A A .  33 ALA O    1 1 
        8  4815 1 1 34 THR C    C    0.690  -7.664  -0.113 1.00 . A A .  34 THR C    1 1 
        8  4816 1 1 34 THR CA   C    1.861  -6.715   0.117 1.00 . A A .  34 THR CA   1 1 
        8  4817 1 1 34 THR CB   C    1.385  -5.529   0.976 1.00 . A A .  34 THR CB   1 1 
        8  4818 1 1 34 THR CG2  C    0.007  -5.060   0.534 1.00 . A A .  34 THR CG2  1 1 
        8  4819 1 1 34 THR H    H    1.912  -5.648  -1.710 1.00 . A A .  34 THR H    1 1 
        8  4820 1 1 34 THR HA   H    2.634  -7.239   0.661 1.00 . A A .  34 THR HA   1 1 
        8  4821 1 1 34 THR HB   H    2.083  -4.713   0.854 1.00 . A A .  34 THR HB   1 1 
        8  4822 1 1 34 THR HG1  H    0.704  -5.364   2.820 1.00 . A A .  34 THR HG1  1 1 
        8  4823 1 1 34 THR HG21 H    0.011  -4.884  -0.531 1.00 . A A .  34 THR HG21 1 1 
        8  4824 1 1 34 THR HG22 H   -0.244  -4.144   1.049 1.00 . A A .  34 THR HG22 1 1 
        8  4825 1 1 34 THR HG23 H   -0.724  -5.818   0.772 1.00 . A A .  34 THR HG23 1 1 
        8  4826 1 1 34 THR N    N    2.428  -6.263  -1.147 1.00 . A A .  34 THR N    1 1 
        8  4827 1 1 34 THR O    O    0.442  -8.566   0.688 1.00 . A A .  34 THR O    1 1 
        8  4828 1 1 34 THR OG1  O    1.346  -5.908   2.356 1.00 . A A .  34 THR OG1  1 1 
        8  4829 1 1 35 HIS C    C   -0.717  -9.665  -2.036 1.00 . A A .  35 HIS C    1 1 
        8  4830 1 1 35 HIS CA   C   -1.173  -8.293  -1.549 1.00 . A A .  35 HIS CA   1 1 
        8  4831 1 1 35 HIS CB   C   -2.029  -7.617  -2.620 1.00 . A A .  35 HIS CB   1 1 
        8  4832 1 1 35 HIS CD2  C   -2.882  -5.186  -2.318 1.00 . A A .  35 HIS CD2  1 1 
        8  4833 1 1 35 HIS CE1  C   -4.515  -5.591  -0.912 1.00 . A A .  35 HIS CE1  1 1 
        8  4834 1 1 35 HIS CG   C   -2.898  -6.519  -2.087 1.00 . A A .  35 HIS CG   1 1 
        8  4835 1 1 35 HIS H    H    0.220  -6.720  -1.812 1.00 . A A .  35 HIS H    1 1 
        8  4836 1 1 35 HIS HA   H   -1.764  -8.420  -0.655 1.00 . A A .  35 HIS HA   1 1 
        8  4837 1 1 35 HIS HB2  H   -1.383  -7.191  -3.373 1.00 . A A .  35 HIS HB2  1 1 
        8  4838 1 1 35 HIS HB3  H   -2.670  -8.356  -3.079 1.00 . A A .  35 HIS HB3  1 1 
        8  4839 1 1 35 HIS HD1  H   -4.199  -7.611  -0.839 1.00 . A A .  35 HIS HD1  1 1 
        8  4840 1 1 35 HIS HD2  H   -2.199  -4.655  -2.967 1.00 . A A .  35 HIS HD2  1 1 
        8  4841 1 1 35 HIS HE1  H   -5.353  -5.457  -0.245 1.00 . A A .  35 HIS HE1  1 1 
        8  4842 1 1 35 HIS N    N   -0.027  -7.455  -1.213 1.00 . A A .  35 HIS N    1 1 
        8  4843 1 1 35 HIS ND1  N   -3.932  -6.741  -1.201 1.00 . A A .  35 HIS ND1  1 1 
        8  4844 1 1 35 HIS NE2  N   -3.896  -4.632  -1.577 1.00 . A A .  35 HIS NE2  1 1 
        8  4845 1 1 35 HIS O    O   -0.405  -9.844  -3.214 1.00 . A A .  35 HIS O    1 1 
        8  4846 1 1 36 SER C    C   -0.981 -12.485  -2.708 1.00 . A A .  36 SER C    1 1 
        8  4847 1 1 36 SER CA   C   -0.260 -11.985  -1.460 1.00 . A A .  36 SER CA   1 1 
        8  4848 1 1 36 SER CB   C   -0.529 -12.931  -0.288 1.00 . A A .  36 SER CB   1 1 
        8  4849 1 1 36 SER H    H   -0.943 -10.425  -0.201 1.00 . A A .  36 SER H    1 1 
        8  4850 1 1 36 SER HA   H    0.802 -11.963  -1.656 1.00 . A A .  36 SER HA   1 1 
        8  4851 1 1 36 SER HB2  H   -0.324 -13.946  -0.593 1.00 . A A .  36 SER HB2  1 1 
        8  4852 1 1 36 SER HB3  H    0.114 -12.667   0.539 1.00 . A A .  36 SER HB3  1 1 
        8  4853 1 1 36 SER HG   H   -2.086 -13.597   0.698 1.00 . A A .  36 SER HG   1 1 
        8  4854 1 1 36 SER N    N   -0.682 -10.630  -1.123 1.00 . A A .  36 SER N    1 1 
        8  4855 1 1 36 SER O    O   -0.355 -12.983  -3.642 1.00 . A A .  36 SER O    1 1 
        8  4856 1 1 36 SER OG   O   -1.879 -12.846   0.137 1.00 . A A .  36 SER OG   1 1 
        8  4857 1 1 37 GLY C    C   -4.232 -11.843  -4.169 1.00 . A A .  37 GLY C    1 1 
        8  4858 1 1 37 GLY CA   C   -3.090 -12.788  -3.852 1.00 . A A .  37 GLY CA   1 1 
        8  4859 1 1 37 GLY H    H   -2.749 -11.941  -1.941 1.00 . A A .  37 GLY H    1 1 
        8  4860 1 1 37 GLY HA2  H   -2.445 -12.860  -4.715 1.00 . A A .  37 GLY HA2  1 1 
        8  4861 1 1 37 GLY HA3  H   -3.496 -13.766  -3.636 1.00 . A A .  37 GLY HA3  1 1 
        8  4862 1 1 37 GLY N    N   -2.304 -12.347  -2.715 1.00 . A A .  37 GLY N    1 1 
        8  4863 1 1 37 GLY O    O   -4.017 -10.651  -4.382 1.00 . A A .  37 GLY O    1 1 
        8  4864 1 1 38 GLU C    C   -7.698 -11.762  -3.427 1.00 . A A .  38 GLU C    1 1 
        8  4865 1 1 38 GLU CA   C   -6.628 -11.574  -4.498 1.00 . A A .  38 GLU CA   1 1 
        8  4866 1 1 38 GLU CB   C   -7.194 -11.944  -5.871 1.00 . A A .  38 GLU CB   1 1 
        8  4867 1 1 38 GLU CD   C   -5.211 -12.321  -7.390 1.00 . A A .  38 GLU CD   1 1 
        8  4868 1 1 38 GLU CG   C   -6.371 -11.412  -7.032 1.00 . A A .  38 GLU CG   1 1 
        8  4869 1 1 38 GLU H    H   -5.555 -13.336  -4.023 1.00 . A A .  38 GLU H    1 1 
        8  4870 1 1 38 GLU HA   H   -6.328 -10.537  -4.511 1.00 . A A .  38 GLU HA   1 1 
        8  4871 1 1 38 GLU HB2  H   -7.238 -13.021  -5.950 1.00 . A A .  38 GLU HB2  1 1 
        8  4872 1 1 38 GLU HB3  H   -8.194 -11.546  -5.953 1.00 . A A .  38 GLU HB3  1 1 
        8  4873 1 1 38 GLU HG2  H   -7.012 -11.316  -7.896 1.00 . A A .  38 GLU HG2  1 1 
        8  4874 1 1 38 GLU HG3  H   -5.980 -10.442  -6.765 1.00 . A A .  38 GLU HG3  1 1 
        8  4875 1 1 38 GLU N    N   -5.448 -12.378  -4.202 1.00 . A A .  38 GLU N    1 1 
        8  4876 1 1 38 GLU O    O   -8.033 -12.888  -3.058 1.00 . A A .  38 GLU O    1 1 
        8  4877 1 1 38 GLU OE1  O   -5.266 -13.518  -7.039 1.00 . A A .  38 GLU OE1  1 1 
        8  4878 1 1 38 GLU OE2  O   -4.248 -11.835  -8.019 1.00 . A A .  38 GLU OE2  1 1 
        8  4879 1 1 39 LYS C    C  -10.542 -10.014  -2.387 1.00 . A A .  39 LYS C    1 1 
        8  4880 1 1 39 LYS CA   C   -9.265 -10.691  -1.902 1.00 . A A .  39 LYS CA   1 1 
        8  4881 1 1 39 LYS CB   C   -8.768 -10.011  -0.624 1.00 . A A .  39 LYS CB   1 1 
        8  4882 1 1 39 LYS CD   C   -8.764 -10.161   1.883 1.00 . A A .  39 LYS CD   1 1 
        8  4883 1 1 39 LYS CE   C   -9.536 -10.606   3.116 1.00 . A A .  39 LYS CE   1 1 
        8  4884 1 1 39 LYS CG   C   -9.568 -10.382   0.613 1.00 . A A .  39 LYS CG   1 1 
        8  4885 1 1 39 LYS H    H   -7.924  -9.782  -3.264 1.00 . A A .  39 LYS H    1 1 
        8  4886 1 1 39 LYS HA   H   -9.479 -11.727  -1.688 1.00 . A A .  39 LYS HA   1 1 
        8  4887 1 1 39 LYS HB2  H   -7.738 -10.290  -0.459 1.00 . A A .  39 LYS HB2  1 1 
        8  4888 1 1 39 LYS HB3  H   -8.825  -8.940  -0.756 1.00 . A A .  39 LYS HB3  1 1 
        8  4889 1 1 39 LYS HD2  H   -7.847 -10.728   1.822 1.00 . A A .  39 LYS HD2  1 1 
        8  4890 1 1 39 LYS HD3  H   -8.533  -9.108   1.974 1.00 . A A .  39 LYS HD3  1 1 
        8  4891 1 1 39 LYS HE2  H  -10.161 -11.444   2.849 1.00 . A A .  39 LYS HE2  1 1 
        8  4892 1 1 39 LYS HE3  H   -8.831 -10.910   3.876 1.00 . A A .  39 LYS HE3  1 1 
        8  4893 1 1 39 LYS HG2  H  -10.457  -9.771   0.652 1.00 . A A .  39 LYS HG2  1 1 
        8  4894 1 1 39 LYS HG3  H   -9.846 -11.424   0.551 1.00 . A A .  39 LYS HG3  1 1 
        8  4895 1 1 39 LYS HZ1  H  -10.715  -8.897   2.886 1.00 . A A .  39 LYS HZ1  1 1 
        8  4896 1 1 39 LYS HZ2  H   -9.855  -8.946   4.343 1.00 . A A .  39 LYS HZ2  1 1 
        8  4897 1 1 39 LYS HZ3  H  -11.224  -9.917   4.135 1.00 . A A .  39 LYS HZ3  1 1 
        8  4898 1 1 39 LYS N    N   -8.232 -10.651  -2.930 1.00 . A A .  39 LYS N    1 1 
        8  4899 1 1 39 LYS NZ   N  -10.393  -9.515   3.658 1.00 . A A .  39 LYS NZ   1 1 
        8  4900 1 1 39 LYS O    O  -10.953  -8.971  -1.878 1.00 . A A .  39 LYS O    1 1 
        8  4901 1 1 40 PRO C    C  -13.609 -10.215  -3.010 1.00 . A A .  40 PRO C    1 1 
        8  4902 1 1 40 PRO CA   C  -12.430 -10.094  -3.969 1.00 . A A .  40 PRO CA   1 1 
        8  4903 1 1 40 PRO CB   C  -12.651 -10.974  -5.202 1.00 . A A .  40 PRO CB   1 1 
        8  4904 1 1 40 PRO CD   C  -10.757 -11.866  -4.049 1.00 . A A .  40 PRO CD   1 1 
        8  4905 1 1 40 PRO CG   C  -11.944 -12.247  -4.890 1.00 . A A .  40 PRO CG   1 1 
        8  4906 1 1 40 PRO HA   H  -12.320  -9.064  -4.275 1.00 . A A .  40 PRO HA   1 1 
        8  4907 1 1 40 PRO HB2  H  -13.710 -11.135  -5.347 1.00 . A A .  40 PRO HB2  1 1 
        8  4908 1 1 40 PRO HB3  H  -12.232 -10.492  -6.072 1.00 . A A .  40 PRO HB3  1 1 
        8  4909 1 1 40 PRO HD2  H  -10.550 -12.635  -3.319 1.00 . A A .  40 PRO HD2  1 1 
        8  4910 1 1 40 PRO HD3  H   -9.892 -11.694  -4.674 1.00 . A A .  40 PRO HD3  1 1 
        8  4911 1 1 40 PRO HG2  H  -12.598 -12.906  -4.339 1.00 . A A .  40 PRO HG2  1 1 
        8  4912 1 1 40 PRO HG3  H  -11.618 -12.719  -5.806 1.00 . A A .  40 PRO HG3  1 1 
        8  4913 1 1 40 PRO N    N  -11.188 -10.620  -3.394 1.00 . A A .  40 PRO N    1 1 
        8  4914 1 1 40 PRO O    O  -14.728  -9.817  -3.334 1.00 . A A .  40 PRO O    1 1 
        8  4915 1 1 41 SER C    C  -14.639  -9.642  -0.062 1.00 . A A .  41 SER C    1 1 
        8  4916 1 1 41 SER CA   C  -14.393 -10.942  -0.823 1.00 . A A .  41 SER CA   1 1 
        8  4917 1 1 41 SER CB   C  -14.004 -12.052   0.156 1.00 . A A .  41 SER CB   1 1 
        8  4918 1 1 41 SER H    H  -12.439 -11.063  -1.629 1.00 . A A .  41 SER H    1 1 
        8  4919 1 1 41 SER HA   H  -15.301 -11.225  -1.333 1.00 . A A .  41 SER HA   1 1 
        8  4920 1 1 41 SER HB2  H  -13.656 -12.911  -0.398 1.00 . A A .  41 SER HB2  1 1 
        8  4921 1 1 41 SER HB3  H  -13.215 -11.698   0.803 1.00 . A A .  41 SER HB3  1 1 
        8  4922 1 1 41 SER HG   H  -15.926 -12.244   0.486 1.00 . A A .  41 SER HG   1 1 
        8  4923 1 1 41 SER N    N  -13.351 -10.766  -1.828 1.00 . A A .  41 SER N    1 1 
        8  4924 1 1 41 SER O    O  -13.988  -9.365   0.944 1.00 . A A .  41 SER O    1 1 
        8  4925 1 1 41 SER OG   O  -15.110 -12.440   0.952 1.00 . A A .  41 SER OG   1 1 
        8  4926 1 1 42 GLY C    C  -15.917  -6.425  -0.883 1.00 . A A .  42 GLY C    1 1 
        8  4927 1 1 42 GLY CA   C  -15.903  -7.586   0.092 1.00 . A A .  42 GLY CA   1 1 
        8  4928 1 1 42 GLY H    H  -16.073  -9.120  -1.358 1.00 . A A .  42 GLY H    1 1 
        8  4929 1 1 42 GLY HA2  H  -16.875  -7.666   0.555 1.00 . A A .  42 GLY HA2  1 1 
        8  4930 1 1 42 GLY HA3  H  -15.165  -7.391   0.856 1.00 . A A .  42 GLY HA3  1 1 
        8  4931 1 1 42 GLY N    N  -15.586  -8.848  -0.553 1.00 . A A .  42 GLY N    1 1 
        8  4932 1 1 42 GLY O    O  -15.041  -5.560  -0.863 1.00 . A A .  42 GLY O    1 1 
        8  4933 1 1 43 PRO C    C  -17.451  -3.998  -2.143 1.00 . A A .  43 PRO C    1 1 
        8  4934 1 1 43 PRO CA   C  -17.078  -5.339  -2.765 1.00 . A A .  43 PRO CA   1 1 
        8  4935 1 1 43 PRO CB   C  -18.214  -5.850  -3.654 1.00 . A A .  43 PRO CB   1 1 
        8  4936 1 1 43 PRO CD   C  -18.009  -7.395  -1.842 1.00 . A A .  43 PRO CD   1 1 
        8  4937 1 1 43 PRO CG   C  -19.002  -6.761  -2.777 1.00 . A A .  43 PRO CG   1 1 
        8  4938 1 1 43 PRO HA   H  -16.181  -5.224  -3.355 1.00 . A A .  43 PRO HA   1 1 
        8  4939 1 1 43 PRO HB2  H  -18.811  -5.016  -3.996 1.00 . A A .  43 PRO HB2  1 1 
        8  4940 1 1 43 PRO HB3  H  -17.803  -6.377  -4.502 1.00 . A A .  43 PRO HB3  1 1 
        8  4941 1 1 43 PRO HD2  H  -18.456  -7.560  -0.872 1.00 . A A .  43 PRO HD2  1 1 
        8  4942 1 1 43 PRO HD3  H  -17.644  -8.325  -2.254 1.00 . A A .  43 PRO HD3  1 1 
        8  4943 1 1 43 PRO HG2  H  -19.732  -6.194  -2.220 1.00 . A A .  43 PRO HG2  1 1 
        8  4944 1 1 43 PRO HG3  H  -19.488  -7.517  -3.375 1.00 . A A .  43 PRO HG3  1 1 
        8  4945 1 1 43 PRO N    N  -16.930  -6.397  -1.761 1.00 . A A .  43 PRO N    1 1 
        8  4946 1 1 43 PRO O    O  -18.363  -3.916  -1.320 1.00 . A A .  43 PRO O    1 1 
        8  4947 1 1 44 SER C    C  -17.325  -0.640  -3.150 1.00 . A A .  44 SER C    1 1 
        8  4948 1 1 44 SER CA   C  -16.995  -1.610  -2.019 1.00 . A A .  44 SER CA   1 1 
        8  4949 1 1 44 SER CB   C  -15.781  -1.105  -1.237 1.00 . A A .  44 SER CB   1 1 
        8  4950 1 1 44 SER H    H  -16.025  -3.077  -3.199 1.00 . A A .  44 SER H    1 1 
        8  4951 1 1 44 SER HA   H  -17.842  -1.670  -1.353 1.00 . A A .  44 SER HA   1 1 
        8  4952 1 1 44 SER HB2  H  -15.629  -1.730  -0.370 1.00 . A A .  44 SER HB2  1 1 
        8  4953 1 1 44 SER HB3  H  -14.906  -1.147  -1.869 1.00 . A A .  44 SER HB3  1 1 
        8  4954 1 1 44 SER HG   H  -15.124   0.683  -0.779 1.00 . A A .  44 SER HG   1 1 
        8  4955 1 1 44 SER N    N  -16.740  -2.948  -2.541 1.00 . A A .  44 SER N    1 1 
        8  4956 1 1 44 SER O    O  -18.312   0.092  -3.086 1.00 . A A .  44 SER O    1 1 
        8  4957 1 1 44 SER OG   O  -15.971   0.232  -0.808 1.00 . A A .  44 SER OG   1 1 
        8  4958 1 1 45 SER C    C  -18.176   0.417  -5.626 1.00 . A A .  45 SER C    1 1 
        8  4959 1 1 45 SER CA   C  -16.690   0.241  -5.328 1.00 . A A .  45 SER CA   1 1 
        8  4960 1 1 45 SER CB   C  -15.975  -0.317  -6.560 1.00 . A A .  45 SER CB   1 1 
        8  4961 1 1 45 SER H    H  -15.721  -1.248  -4.177 1.00 . A A .  45 SER H    1 1 
        8  4962 1 1 45 SER HA   H  -16.267   1.204  -5.082 1.00 . A A .  45 SER HA   1 1 
        8  4963 1 1 45 SER HB2  H  -16.229  -1.359  -6.680 1.00 . A A .  45 SER HB2  1 1 
        8  4964 1 1 45 SER HB3  H  -16.289   0.234  -7.435 1.00 . A A .  45 SER HB3  1 1 
        8  4965 1 1 45 SER HG   H  -14.328  -0.256  -5.501 1.00 . A A .  45 SER HG   1 1 
        8  4966 1 1 45 SER N    N  -16.490  -0.641  -4.184 1.00 . A A .  45 SER N    1 1 
        8  4967 1 1 45 SER O    O  -18.974  -0.497  -5.424 1.00 . A A .  45 SER O    1 1 
        8  4968 1 1 45 SER OG   O  -14.568  -0.202  -6.429 1.00 . A A .  45 SER OG   1 1 
        8  4969 1 1 46 GLY C    C  -20.518   0.862  -7.382 1.00 . A A .  46 GLY C    1 1 
        8  4970 1 1 46 GLY CA   C  -19.929   1.878  -6.424 1.00 . A A .  46 GLY CA   1 1 
        8  4971 1 1 46 GLY H    H  -17.861   2.294  -6.248 1.00 . A A .  46 GLY H    1 1 
        8  4972 1 1 46 GLY HA2  H  -20.504   1.872  -5.511 1.00 . A A .  46 GLY HA2  1 1 
        8  4973 1 1 46 GLY HA3  H  -19.996   2.859  -6.873 1.00 . A A .  46 GLY HA3  1 1 
        8  4974 1 1 46 GLY N    N  -18.541   1.602  -6.107 1.00 . A A .  46 GLY N    1 1 
        8  4975 1 1 46 GLY O    O  -21.646   0.419  -7.167 1.00 . A A .  46 GLY O    1 1 
        8  4976 2 2  1 ZN  ZN   ZN  -4.179  -2.625  -1.746 1.00 . B A . 201 ZN  ZN   1 1 
        9  4977 1 1  1 GLY C    C  -18.586  17.873  16.883 1.00 . A A .   1 GLY C    1 1 
        9  4978 1 1  1 GLY CA   C  -17.764  17.991  18.152 1.00 . A A .   1 GLY CA   1 1 
        9  4979 1 1  1 GLY H1   H  -17.303  19.998  17.659 1.00 . A A .   1 GLY H1   1 1 
        9  4980 1 1  1 GLY HA2  H  -16.907  17.339  18.075 1.00 . A A .   1 GLY HA2  1 1 
        9  4981 1 1  1 GLY HA3  H  -18.370  17.676  18.989 1.00 . A A .   1 GLY HA3  1 1 
        9  4982 1 1  1 GLY N    N  -17.304  19.346  18.391 1.00 . A A .   1 GLY N    1 1 
        9  4983 1 1  1 GLY O    O  -19.698  17.347  16.902 1.00 . A A .   1 GLY O    1 1 
        9  4984 1 1  2 SER C    C  -17.903  17.560  13.459 1.00 . A A .   2 SER C    1 1 
        9  4985 1 1  2 SER CA   C  -18.729  18.318  14.494 1.00 . A A .   2 SER CA   1 1 
        9  4986 1 1  2 SER CB   C  -19.018  19.735  13.994 1.00 . A A .   2 SER CB   1 1 
        9  4987 1 1  2 SER H    H  -17.147  18.773  15.826 1.00 . A A .   2 SER H    1 1 
        9  4988 1 1  2 SER HA   H  -19.664  17.799  14.641 1.00 . A A .   2 SER HA   1 1 
        9  4989 1 1  2 SER HB2  H  -19.613  19.682  13.095 1.00 . A A .   2 SER HB2  1 1 
        9  4990 1 1  2 SER HB3  H  -19.562  20.278  14.754 1.00 . A A .   2 SER HB3  1 1 
        9  4991 1 1  2 SER HG   H  -17.287  20.496  14.505 1.00 . A A .   2 SER HG   1 1 
        9  4992 1 1  2 SER N    N  -18.037  18.366  15.777 1.00 . A A .   2 SER N    1 1 
        9  4993 1 1  2 SER O    O  -16.712  17.317  13.656 1.00 . A A .   2 SER O    1 1 
        9  4994 1 1  2 SER OG   O  -17.817  20.430  13.707 1.00 . A A .   2 SER OG   1 1 
        9  4995 1 1  3 SER C    C  -18.778  16.314  10.072 1.00 . A A .   3 SER C    1 1 
        9  4996 1 1  3 SER CA   C  -17.871  16.456  11.290 1.00 . A A .   3 SER CA   1 1 
        9  4997 1 1  3 SER CB   C  -17.443  15.074  11.786 1.00 . A A .   3 SER CB   1 1 
        9  4998 1 1  3 SER H    H  -19.493  17.414  12.257 1.00 . A A .   3 SER H    1 1 
        9  4999 1 1  3 SER HA   H  -16.992  17.016  11.007 1.00 . A A .   3 SER HA   1 1 
        9  5000 1 1  3 SER HB2  H  -16.732  14.650  11.093 1.00 . A A .   3 SER HB2  1 1 
        9  5001 1 1  3 SER HB3  H  -16.984  15.170  12.759 1.00 . A A .   3 SER HB3  1 1 
        9  5002 1 1  3 SER HG   H  -18.961  14.301  12.754 1.00 . A A .   3 SER HG   1 1 
        9  5003 1 1  3 SER N    N  -18.544  17.190  12.355 1.00 . A A .   3 SER N    1 1 
        9  5004 1 1  3 SER O    O  -19.921  15.871  10.182 1.00 . A A .   3 SER O    1 1 
        9  5005 1 1  3 SER OG   O  -18.556  14.202  11.889 1.00 . A A .   3 SER OG   1 1 
        9  5006 1 1  4 GLY C    C  -19.381  15.170   7.324 1.00 . A A .   4 GLY C    1 1 
        9  5007 1 1  4 GLY CA   C  -19.035  16.602   7.684 1.00 . A A .   4 GLY CA   1 1 
        9  5008 1 1  4 GLY H    H  -17.342  17.039   8.880 1.00 . A A .   4 GLY H    1 1 
        9  5009 1 1  4 GLY HA2  H  -19.949  17.162   7.808 1.00 . A A .   4 GLY HA2  1 1 
        9  5010 1 1  4 GLY HA3  H  -18.464  17.036   6.877 1.00 . A A .   4 GLY HA3  1 1 
        9  5011 1 1  4 GLY N    N  -18.259  16.694   8.908 1.00 . A A .   4 GLY N    1 1 
        9  5012 1 1  4 GLY O    O  -18.609  14.251   7.596 1.00 . A A .   4 GLY O    1 1 
        9  5013 1 1  5 SER C    C  -20.211  13.148   5.110 1.00 . A A .   5 SER C    1 1 
        9  5014 1 1  5 SER CA   C  -20.995  13.651   6.319 1.00 . A A .   5 SER CA   1 1 
        9  5015 1 1  5 SER CB   C  -22.491  13.668   5.999 1.00 . A A .   5 SER CB   1 1 
        9  5016 1 1  5 SER H    H  -21.117  15.755   6.522 1.00 . A A .   5 SER H    1 1 
        9  5017 1 1  5 SER HA   H  -20.820  12.983   7.149 1.00 . A A .   5 SER HA   1 1 
        9  5018 1 1  5 SER HB2  H  -22.847  12.655   5.899 1.00 . A A .   5 SER HB2  1 1 
        9  5019 1 1  5 SER HB3  H  -23.022  14.159   6.802 1.00 . A A .   5 SER HB3  1 1 
        9  5020 1 1  5 SER HG   H  -22.191  15.146   4.748 1.00 . A A .   5 SER HG   1 1 
        9  5021 1 1  5 SER N    N  -20.545  14.981   6.712 1.00 . A A .   5 SER N    1 1 
        9  5022 1 1  5 SER O    O  -19.985  11.947   4.959 1.00 . A A .   5 SER O    1 1 
        9  5023 1 1  5 SER OG   O  -22.746  14.364   4.791 1.00 . A A .   5 SER OG   1 1 
        9  5024 1 1  6 SER C    C  -18.026  14.813   2.719 1.00 . A A .   6 SER C    1 1 
        9  5025 1 1  6 SER CA   C  -19.044  13.727   3.054 1.00 . A A .   6 SER CA   1 1 
        9  5026 1 1  6 SER CB   C  -19.992  13.519   1.871 1.00 . A A .   6 SER CB   1 1 
        9  5027 1 1  6 SER H    H  -20.011  15.016   4.427 1.00 . A A .   6 SER H    1 1 
        9  5028 1 1  6 SER HA   H  -18.519  12.805   3.250 1.00 . A A .   6 SER HA   1 1 
        9  5029 1 1  6 SER HB2  H  -19.477  12.978   1.091 1.00 . A A .   6 SER HB2  1 1 
        9  5030 1 1  6 SER HB3  H  -20.851  12.951   2.197 1.00 . A A .   6 SER HB3  1 1 
        9  5031 1 1  6 SER HG   H  -19.680  15.271   1.050 1.00 . A A .   6 SER HG   1 1 
        9  5032 1 1  6 SER N    N  -19.800  14.075   4.252 1.00 . A A .   6 SER N    1 1 
        9  5033 1 1  6 SER O    O  -18.032  15.890   3.313 1.00 . A A .   6 SER O    1 1 
        9  5034 1 1  6 SER OG   O  -20.436  14.759   1.349 1.00 . A A .   6 SER OG   1 1 
        9  5035 1 1  7 GLY C    C  -15.464  15.104   0.059 1.00 . A A .   7 GLY C    1 1 
        9  5036 1 1  7 GLY CA   C  -16.137  15.479   1.365 1.00 . A A .   7 GLY CA   1 1 
        9  5037 1 1  7 GLY H    H  -17.193  13.644   1.324 1.00 . A A .   7 GLY H    1 1 
        9  5038 1 1  7 GLY HA2  H  -16.598  16.449   1.254 1.00 . A A .   7 GLY HA2  1 1 
        9  5039 1 1  7 GLY HA3  H  -15.386  15.535   2.140 1.00 . A A .   7 GLY HA3  1 1 
        9  5040 1 1  7 GLY N    N  -17.150  14.519   1.763 1.00 . A A .   7 GLY N    1 1 
        9  5041 1 1  7 GLY O    O  -15.757  14.058  -0.522 1.00 . A A .   7 GLY O    1 1 
        9  5042 1 1  8 THR C    C  -12.931  14.502  -1.533 1.00 . A A .   8 THR C    1 1 
        9  5043 1 1  8 THR CA   C  -13.846  15.715  -1.653 1.00 . A A .   8 THR CA   1 1 
        9  5044 1 1  8 THR CB   C  -13.006  16.938  -2.069 1.00 . A A .   8 THR CB   1 1 
        9  5045 1 1  8 THR CG2  C  -13.894  18.154  -2.288 1.00 . A A .   8 THR CG2  1 1 
        9  5046 1 1  8 THR H    H  -14.370  16.776   0.102 1.00 . A A .   8 THR H    1 1 
        9  5047 1 1  8 THR HA   H  -14.578  15.527  -2.425 1.00 . A A .   8 THR HA   1 1 
        9  5048 1 1  8 THR HB   H  -12.500  16.709  -2.996 1.00 . A A .   8 THR HB   1 1 
        9  5049 1 1  8 THR HG1  H  -12.343  16.909  -0.212 1.00 . A A .   8 THR HG1  1 1 
        9  5050 1 1  8 THR HG21 H  -13.332  18.922  -2.798 1.00 . A A .   8 THR HG21 1 1 
        9  5051 1 1  8 THR HG22 H  -14.232  18.530  -1.333 1.00 . A A .   8 THR HG22 1 1 
        9  5052 1 1  8 THR HG23 H  -14.747  17.874  -2.888 1.00 . A A .   8 THR HG23 1 1 
        9  5053 1 1  8 THR N    N  -14.560  15.960  -0.406 1.00 . A A .   8 THR N    1 1 
        9  5054 1 1  8 THR O    O  -12.584  14.080  -0.431 1.00 . A A .   8 THR O    1 1 
        9  5055 1 1  8 THR OG1  O  -12.030  17.228  -1.062 1.00 . A A .   8 THR OG1  1 1 
        9  5056 1 1  9 GLY C    C  -11.036  12.536  -4.031 1.00 . A A .   9 GLY C    1 1 
        9  5057 1 1  9 GLY CA   C  -11.669  12.785  -2.676 1.00 . A A .   9 GLY CA   1 1 
        9  5058 1 1  9 GLY H    H  -12.849  14.325  -3.526 1.00 . A A .   9 GLY H    1 1 
        9  5059 1 1  9 GLY HA2  H  -10.886  12.937  -1.948 1.00 . A A .   9 GLY HA2  1 1 
        9  5060 1 1  9 GLY HA3  H  -12.245  11.916  -2.396 1.00 . A A .   9 GLY HA3  1 1 
        9  5061 1 1  9 GLY N    N  -12.541  13.945  -2.676 1.00 . A A .   9 GLY N    1 1 
        9  5062 1 1  9 GLY O    O  -11.163  11.448  -4.591 1.00 . A A .   9 GLY O    1 1 
        9  5063 1 1 10 GLU C    C   -8.277  12.912  -5.708 1.00 . A A .  10 GLU C    1 1 
        9  5064 1 1 10 GLU CA   C   -9.703  13.433  -5.859 1.00 . A A .  10 GLU CA   1 1 
        9  5065 1 1 10 GLU CB   C   -9.690  14.788  -6.570 1.00 . A A .  10 GLU CB   1 1 
        9  5066 1 1 10 GLU CD   C   -8.286  14.423  -8.638 1.00 . A A .  10 GLU CD   1 1 
        9  5067 1 1 10 GLU CG   C   -9.675  14.680  -8.086 1.00 . A A .  10 GLU CG   1 1 
        9  5068 1 1 10 GLU H    H  -10.289  14.391  -4.065 1.00 . A A .  10 GLU H    1 1 
        9  5069 1 1 10 GLU HA   H  -10.269  12.731  -6.453 1.00 . A A .  10 GLU HA   1 1 
        9  5070 1 1 10 GLU HB2  H  -10.570  15.342  -6.278 1.00 . A A .  10 GLU HB2  1 1 
        9  5071 1 1 10 GLU HB3  H   -8.812  15.334  -6.260 1.00 . A A .  10 GLU HB3  1 1 
        9  5072 1 1 10 GLU HG2  H  -10.319  13.866  -8.383 1.00 . A A .  10 GLU HG2  1 1 
        9  5073 1 1 10 GLU HG3  H  -10.048  15.603  -8.503 1.00 . A A .  10 GLU HG3  1 1 
        9  5074 1 1 10 GLU N    N  -10.355  13.548  -4.560 1.00 . A A .  10 GLU N    1 1 
        9  5075 1 1 10 GLU O    O   -7.326  13.688  -5.619 1.00 . A A .  10 GLU O    1 1 
        9  5076 1 1 10 GLU OE1  O   -7.780  13.294  -8.472 1.00 . A A .  10 GLU OE1  1 1 
        9  5077 1 1 10 GLU OE2  O   -7.706  15.353  -9.237 1.00 . A A .  10 GLU OE2  1 1 
        9  5078 1 1 11 LYS C    C   -6.327  10.443  -6.884 1.00 . A A .  11 LYS C    1 1 
        9  5079 1 1 11 LYS CA   C   -6.827  10.964  -5.541 1.00 . A A .  11 LYS CA   1 1 
        9  5080 1 1 11 LYS CB   C   -6.893   9.816  -4.530 1.00 . A A .  11 LYS CB   1 1 
        9  5081 1 1 11 LYS CD   C   -6.135  10.734  -2.318 1.00 . A A .  11 LYS CD   1 1 
        9  5082 1 1 11 LYS CE   C   -6.565  11.721  -1.243 1.00 . A A .  11 LYS CE   1 1 
        9  5083 1 1 11 LYS CG   C   -7.320  10.255  -3.140 1.00 . A A .  11 LYS CG   1 1 
        9  5084 1 1 11 LYS H    H   -8.932  11.023  -5.756 1.00 . A A .  11 LYS H    1 1 
        9  5085 1 1 11 LYS HA   H   -6.137  11.711  -5.179 1.00 . A A .  11 LYS HA   1 1 
        9  5086 1 1 11 LYS HB2  H   -7.599   9.080  -4.885 1.00 . A A .  11 LYS HB2  1 1 
        9  5087 1 1 11 LYS HB3  H   -5.916   9.360  -4.457 1.00 . A A .  11 LYS HB3  1 1 
        9  5088 1 1 11 LYS HD2  H   -5.669   9.883  -1.843 1.00 . A A .  11 LYS HD2  1 1 
        9  5089 1 1 11 LYS HD3  H   -5.425  11.216  -2.974 1.00 . A A .  11 LYS HD3  1 1 
        9  5090 1 1 11 LYS HE2  H   -7.326  11.260  -0.633 1.00 . A A .  11 LYS HE2  1 1 
        9  5091 1 1 11 LYS HE3  H   -5.709  11.961  -0.631 1.00 . A A .  11 LYS HE3  1 1 
        9  5092 1 1 11 LYS HG2  H   -8.032  11.062  -3.229 1.00 . A A .  11 LYS HG2  1 1 
        9  5093 1 1 11 LYS HG3  H   -7.782   9.418  -2.635 1.00 . A A .  11 LYS HG3  1 1 
        9  5094 1 1 11 LYS HZ1  H   -8.112  12.853  -2.073 1.00 . A A .  11 LYS HZ1  1 1 
        9  5095 1 1 11 LYS HZ2  H   -6.582  13.226  -2.691 1.00 . A A .  11 LYS HZ2  1 1 
        9  5096 1 1 11 LYS HZ3  H   -7.023  13.757  -1.147 1.00 . A A .  11 LYS HZ3  1 1 
        9  5097 1 1 11 LYS N    N   -8.136  11.591  -5.680 1.00 . A A .  11 LYS N    1 1 
        9  5098 1 1 11 LYS NZ   N   -7.109  12.977  -1.830 1.00 . A A .  11 LYS NZ   1 1 
        9  5099 1 1 11 LYS O    O   -7.097   9.960  -7.715 1.00 . A A .  11 LYS O    1 1 
        9  5100 1 1 12 PRO C    C   -4.384   8.563  -8.473 1.00 . A A .  12 PRO C    1 1 
        9  5101 1 1 12 PRO CA   C   -4.376  10.083  -8.345 1.00 . A A .  12 PRO CA   1 1 
        9  5102 1 1 12 PRO CB   C   -2.941  10.602  -8.226 1.00 . A A .  12 PRO CB   1 1 
        9  5103 1 1 12 PRO CD   C   -4.031  11.106  -6.159 1.00 . A A .  12 PRO CD   1 1 
        9  5104 1 1 12 PRO CG   C   -2.705  10.729  -6.760 1.00 . A A .  12 PRO CG   1 1 
        9  5105 1 1 12 PRO HA   H   -4.847  10.518  -9.215 1.00 . A A .  12 PRO HA   1 1 
        9  5106 1 1 12 PRO HB2  H   -2.260   9.893  -8.676 1.00 . A A .  12 PRO HB2  1 1 
        9  5107 1 1 12 PRO HB3  H   -2.857  11.556  -8.723 1.00 . A A .  12 PRO HB3  1 1 
        9  5108 1 1 12 PRO HD2  H   -4.141  10.662  -5.180 1.00 . A A .  12 PRO HD2  1 1 
        9  5109 1 1 12 PRO HD3  H   -4.127  12.180  -6.101 1.00 . A A .  12 PRO HD3  1 1 
        9  5110 1 1 12 PRO HG2  H   -2.366   9.785  -6.360 1.00 . A A .  12 PRO HG2  1 1 
        9  5111 1 1 12 PRO HG3  H   -1.975  11.502  -6.572 1.00 . A A .  12 PRO HG3  1 1 
        9  5112 1 1 12 PRO N    N   -5.008  10.541  -7.105 1.00 . A A .  12 PRO N    1 1 
        9  5113 1 1 12 PRO O    O   -4.755   8.020  -9.514 1.00 . A A .  12 PRO O    1 1 
        9  5114 1 1 13 TYR C    C   -4.699   5.863  -6.212 1.00 . A A .  13 TYR C    1 1 
        9  5115 1 1 13 TYR CA   C   -3.931   6.425  -7.404 1.00 . A A .  13 TYR CA   1 1 
        9  5116 1 1 13 TYR CB   C   -2.482   5.936  -7.367 1.00 . A A .  13 TYR CB   1 1 
        9  5117 1 1 13 TYR CD1  C   -1.199   7.124  -9.189 1.00 . A A .  13 TYR CD1  1 1 
        9  5118 1 1 13 TYR CD2  C   -1.756   4.830  -9.519 1.00 . A A .  13 TYR CD2  1 1 
        9  5119 1 1 13 TYR CE1  C   -0.576   7.155 -10.422 1.00 . A A .  13 TYR CE1  1 1 
        9  5120 1 1 13 TYR CE2  C   -1.133   4.851 -10.751 1.00 . A A .  13 TYR CE2  1 1 
        9  5121 1 1 13 TYR CG   C   -1.799   5.964  -8.717 1.00 . A A .  13 TYR CG   1 1 
        9  5122 1 1 13 TYR CZ   C   -0.544   6.016 -11.199 1.00 . A A .  13 TYR CZ   1 1 
        9  5123 1 1 13 TYR H    H   -3.689   8.372  -6.609 1.00 . A A .  13 TYR H    1 1 
        9  5124 1 1 13 TYR HA   H   -4.395   6.076  -8.314 1.00 . A A .  13 TYR HA   1 1 
        9  5125 1 1 13 TYR HB2  H   -1.914   6.562  -6.697 1.00 . A A .  13 TYR HB2  1 1 
        9  5126 1 1 13 TYR HB3  H   -2.461   4.918  -7.006 1.00 . A A .  13 TYR HB3  1 1 
        9  5127 1 1 13 TYR HD1  H   -1.225   8.015  -8.579 1.00 . A A .  13 TYR HD1  1 1 
        9  5128 1 1 13 TYR HD2  H   -2.218   3.920  -9.165 1.00 . A A .  13 TYR HD2  1 1 
        9  5129 1 1 13 TYR HE1  H   -0.114   8.067 -10.772 1.00 . A A .  13 TYR HE1  1 1 
        9  5130 1 1 13 TYR HE2  H   -1.109   3.959 -11.360 1.00 . A A .  13 TYR HE2  1 1 
        9  5131 1 1 13 TYR HH   H   -0.011   6.916 -12.811 1.00 . A A .  13 TYR HH   1 1 
        9  5132 1 1 13 TYR N    N   -3.973   7.883  -7.409 1.00 . A A .  13 TYR N    1 1 
        9  5133 1 1 13 TYR O    O   -4.612   6.383  -5.099 1.00 . A A .  13 TYR O    1 1 
        9  5134 1 1 13 TYR OH   O    0.076   6.041 -12.427 1.00 . A A .  13 TYR OH   1 1 
        9  5135 1 1 14 LYS C    C   -6.309   2.649  -5.615 1.00 . A A .  14 LYS C    1 1 
        9  5136 1 1 14 LYS CA   C   -6.235   4.157  -5.400 1.00 . A A .  14 LYS CA   1 1 
        9  5137 1 1 14 LYS CB   C   -7.647   4.747  -5.359 1.00 . A A .  14 LYS CB   1 1 
        9  5138 1 1 14 LYS CD   C   -9.504   5.259  -3.747 1.00 . A A .  14 LYS CD   1 1 
        9  5139 1 1 14 LYS CE   C  -10.103   4.889  -2.399 1.00 . A A .  14 LYS CE   1 1 
        9  5140 1 1 14 LYS CG   C   -8.490   4.225  -4.209 1.00 . A A .  14 LYS CG   1 1 
        9  5141 1 1 14 LYS H    H   -5.480   4.425  -7.360 1.00 . A A .  14 LYS H    1 1 
        9  5142 1 1 14 LYS HA   H   -5.745   4.351  -4.458 1.00 . A A .  14 LYS HA   1 1 
        9  5143 1 1 14 LYS HB2  H   -7.573   5.820  -5.266 1.00 . A A .  14 LYS HB2  1 1 
        9  5144 1 1 14 LYS HB3  H   -8.151   4.508  -6.285 1.00 . A A .  14 LYS HB3  1 1 
        9  5145 1 1 14 LYS HD2  H   -9.013   6.218  -3.659 1.00 . A A .  14 LYS HD2  1 1 
        9  5146 1 1 14 LYS HD3  H  -10.297   5.325  -4.478 1.00 . A A .  14 LYS HD3  1 1 
        9  5147 1 1 14 LYS HE2  H  -11.049   5.396  -2.289 1.00 . A A .  14 LYS HE2  1 1 
        9  5148 1 1 14 LYS HE3  H  -10.261   3.821  -2.371 1.00 . A A .  14 LYS HE3  1 1 
        9  5149 1 1 14 LYS HG2  H   -9.017   3.341  -4.533 1.00 . A A .  14 LYS HG2  1 1 
        9  5150 1 1 14 LYS HG3  H   -7.840   3.977  -3.382 1.00 . A A .  14 LYS HG3  1 1 
        9  5151 1 1 14 LYS HZ1  H   -8.257   4.890  -1.419 1.00 . A A .  14 LYS HZ1  1 1 
        9  5152 1 1 14 LYS HZ2  H   -9.588   4.907  -0.375 1.00 . A A .  14 LYS HZ2  1 1 
        9  5153 1 1 14 LYS HZ3  H   -9.147   6.313  -1.205 1.00 . A A .  14 LYS HZ3  1 1 
        9  5154 1 1 14 LYS N    N   -5.452   4.794  -6.452 1.00 . A A .  14 LYS N    1 1 
        9  5155 1 1 14 LYS NZ   N   -9.211   5.277  -1.271 1.00 . A A .  14 LYS NZ   1 1 
        9  5156 1 1 14 LYS O    O   -6.797   2.181  -6.644 1.00 . A A .  14 LYS O    1 1 
        9  5157 1 1 15 CYS C    C   -7.260  -0.102  -4.630 1.00 . A A .  15 CYS C    1 1 
        9  5158 1 1 15 CYS CA   C   -5.834   0.437  -4.717 1.00 . A A .  15 CYS CA   1 1 
        9  5159 1 1 15 CYS CB   C   -4.981  -0.164  -3.598 1.00 . A A .  15 CYS CB   1 1 
        9  5160 1 1 15 CYS H    H   -5.446   2.324  -3.840 1.00 . A A .  15 CYS H    1 1 
        9  5161 1 1 15 CYS HA   H   -5.414   0.154  -5.670 1.00 . A A .  15 CYS HA   1 1 
        9  5162 1 1 15 CYS HB2  H   -4.034   0.353  -3.561 1.00 . A A .  15 CYS HB2  1 1 
        9  5163 1 1 15 CYS HB3  H   -5.493  -0.033  -2.656 1.00 . A A .  15 CYS HB3  1 1 
        9  5164 1 1 15 CYS N    N   -5.823   1.892  -4.636 1.00 . A A .  15 CYS N    1 1 
        9  5165 1 1 15 CYS O    O   -7.989   0.193  -3.684 1.00 . A A .  15 CYS O    1 1 
        9  5166 1 1 15 CYS SG   S   -4.634  -1.941  -3.800 1.00 . A A .  15 CYS SG   1 1 
        9  5167 1 1 16 ASN C    C   -9.030  -2.791  -4.893 1.00 . A A .  16 ASN C    1 1 
        9  5168 1 1 16 ASN CA   C   -8.987  -1.473  -5.660 1.00 . A A .  16 ASN CA   1 1 
        9  5169 1 1 16 ASN CB   C   -9.429  -1.697  -7.108 1.00 . A A .  16 ASN CB   1 1 
        9  5170 1 1 16 ASN CG   C   -8.990  -3.046  -7.643 1.00 . A A .  16 ASN CG   1 1 
        9  5171 1 1 16 ASN H    H   -7.023  -1.092  -6.351 1.00 . A A .  16 ASN H    1 1 
        9  5172 1 1 16 ASN HA   H   -9.663  -0.774  -5.191 1.00 . A A .  16 ASN HA   1 1 
        9  5173 1 1 16 ASN HB2  H  -10.507  -1.644  -7.161 1.00 . A A .  16 ASN HB2  1 1 
        9  5174 1 1 16 ASN HB3  H   -9.004  -0.926  -7.732 1.00 . A A .  16 ASN HB3  1 1 
        9  5175 1 1 16 ASN HD21 H   -7.092  -2.454  -7.650 1.00 . A A .  16 ASN HD21 1 1 
        9  5176 1 1 16 ASN HD22 H   -7.377  -4.067  -8.198 1.00 . A A .  16 ASN HD22 1 1 
        9  5177 1 1 16 ASN N    N   -7.649  -0.893  -5.624 1.00 . A A .  16 ASN N    1 1 
        9  5178 1 1 16 ASN ND2  N   -7.688  -3.205  -7.851 1.00 . A A .  16 ASN ND2  1 1 
        9  5179 1 1 16 ASN O    O  -10.014  -3.526  -4.958 1.00 . A A .  16 ASN O    1 1 
        9  5180 1 1 16 ASN OD1  O   -9.812  -3.935  -7.867 1.00 . A A .  16 ASN OD1  1 1 
        9  5181 1 1 17 GLU C    C   -8.211  -4.052  -1.923 1.00 . A A .  17 GLU C    1 1 
        9  5182 1 1 17 GLU CA   C   -7.870  -4.311  -3.388 1.00 . A A .  17 GLU CA   1 1 
        9  5183 1 1 17 GLU CB   C   -6.469  -4.915  -3.497 1.00 . A A .  17 GLU CB   1 1 
        9  5184 1 1 17 GLU CD   C   -6.769  -6.520  -5.425 1.00 . A A .  17 GLU CD   1 1 
        9  5185 1 1 17 GLU CG   C   -6.069  -5.273  -4.919 1.00 . A A .  17 GLU CG   1 1 
        9  5186 1 1 17 GLU H    H   -7.202  -2.455  -4.155 1.00 . A A .  17 GLU H    1 1 
        9  5187 1 1 17 GLU HA   H   -8.586  -5.011  -3.793 1.00 . A A .  17 GLU HA   1 1 
        9  5188 1 1 17 GLU HB2  H   -5.752  -4.204  -3.112 1.00 . A A .  17 GLU HB2  1 1 
        9  5189 1 1 17 GLU HB3  H   -6.429  -5.813  -2.898 1.00 . A A .  17 GLU HB3  1 1 
        9  5190 1 1 17 GLU HG2  H   -6.322  -4.449  -5.568 1.00 . A A .  17 GLU HG2  1 1 
        9  5191 1 1 17 GLU HG3  H   -5.003  -5.440  -4.948 1.00 . A A .  17 GLU HG3  1 1 
        9  5192 1 1 17 GLU N    N   -7.955  -3.082  -4.167 1.00 . A A .  17 GLU N    1 1 
        9  5193 1 1 17 GLU O    O   -9.031  -4.755  -1.331 1.00 . A A .  17 GLU O    1 1 
        9  5194 1 1 17 GLU OE1  O   -6.805  -7.523  -4.683 1.00 . A A .  17 GLU OE1  1 1 
        9  5195 1 1 17 GLU OE2  O   -7.281  -6.491  -6.564 1.00 . A A .  17 GLU OE2  1 1 
        9  5196 1 1 18 CYS C    C   -8.472  -1.314   0.161 1.00 . A A .  18 CYS C    1 1 
        9  5197 1 1 18 CYS CA   C   -7.811  -2.685   0.050 1.00 . A A .  18 CYS CA   1 1 
        9  5198 1 1 18 CYS CB   C   -6.493  -2.692   0.828 1.00 . A A .  18 CYS CB   1 1 
        9  5199 1 1 18 CYS H    H   -6.935  -2.514  -1.869 1.00 . A A .  18 CYS H    1 1 
        9  5200 1 1 18 CYS HA   H   -8.473  -3.425   0.474 1.00 . A A .  18 CYS HA   1 1 
        9  5201 1 1 18 CYS HB2  H   -6.671  -2.317   1.825 1.00 . A A .  18 CYS HB2  1 1 
        9  5202 1 1 18 CYS HB3  H   -6.127  -3.706   0.890 1.00 . A A .  18 CYS HB3  1 1 
        9  5203 1 1 18 CYS N    N   -7.577  -3.038  -1.345 1.00 . A A .  18 CYS N    1 1 
        9  5204 1 1 18 CYS O    O   -9.337  -1.096   1.009 1.00 . A A .  18 CYS O    1 1 
        9  5205 1 1 18 CYS SG   S   -5.183  -1.672   0.079 1.00 . A A .  18 CYS SG   1 1 
        9  5206 1 1 19 GLY C    C   -7.590   2.004  -0.344 1.00 . A A .  19 GLY C    1 1 
        9  5207 1 1 19 GLY CA   C   -8.620   0.946  -0.686 1.00 . A A .  19 GLY CA   1 1 
        9  5208 1 1 19 GLY H    H   -7.365  -0.622  -1.357 1.00 . A A .  19 GLY H    1 1 
        9  5209 1 1 19 GLY HA2  H   -9.034   1.163  -1.660 1.00 . A A .  19 GLY HA2  1 1 
        9  5210 1 1 19 GLY HA3  H   -9.413   0.982   0.047 1.00 . A A .  19 GLY HA3  1 1 
        9  5211 1 1 19 GLY N    N   -8.058  -0.392  -0.703 1.00 . A A .  19 GLY N    1 1 
        9  5212 1 1 19 GLY O    O   -7.935   3.094   0.111 1.00 . A A .  19 GLY O    1 1 
        9  5213 1 1 20 LYS C    C   -5.213   3.754  -1.283 1.00 . A A .  20 LYS C    1 1 
        9  5214 1 1 20 LYS CA   C   -5.234   2.611  -0.273 1.00 . A A .  20 LYS CA   1 1 
        9  5215 1 1 20 LYS CB   C   -3.890   1.879  -0.289 1.00 . A A .  20 LYS CB   1 1 
        9  5216 1 1 20 LYS CD   C   -2.985   2.075   2.047 1.00 . A A .  20 LYS CD   1 1 
        9  5217 1 1 20 LYS CE   C   -2.936   1.419   3.418 1.00 . A A .  20 LYS CE   1 1 
        9  5218 1 1 20 LYS CG   C   -3.582   1.144   1.005 1.00 . A A .  20 LYS CG   1 1 
        9  5219 1 1 20 LYS H    H   -6.106   0.797  -0.926 1.00 . A A .  20 LYS H    1 1 
        9  5220 1 1 20 LYS HA   H   -5.400   3.020   0.712 1.00 . A A .  20 LYS HA   1 1 
        9  5221 1 1 20 LYS HB2  H   -3.895   1.160  -1.095 1.00 . A A .  20 LYS HB2  1 1 
        9  5222 1 1 20 LYS HB3  H   -3.103   2.599  -0.465 1.00 . A A .  20 LYS HB3  1 1 
        9  5223 1 1 20 LYS HD2  H   -1.981   2.338   1.749 1.00 . A A .  20 LYS HD2  1 1 
        9  5224 1 1 20 LYS HD3  H   -3.590   2.969   2.107 1.00 . A A .  20 LYS HD3  1 1 
        9  5225 1 1 20 LYS HE2  H   -3.943   1.193   3.731 1.00 . A A .  20 LYS HE2  1 1 
        9  5226 1 1 20 LYS HE3  H   -2.369   0.502   3.343 1.00 . A A .  20 LYS HE3  1 1 
        9  5227 1 1 20 LYS HG2  H   -4.497   0.724   1.395 1.00 . A A .  20 LYS HG2  1 1 
        9  5228 1 1 20 LYS HG3  H   -2.878   0.351   0.798 1.00 . A A .  20 LYS HG3  1 1 
        9  5229 1 1 20 LYS HZ1  H   -1.766   3.061   3.962 1.00 . A A .  20 LYS HZ1  1 1 
        9  5230 1 1 20 LYS HZ2  H   -1.645   1.751   5.026 1.00 . A A .  20 LYS HZ2  1 1 
        9  5231 1 1 20 LYS HZ3  H   -3.025   2.729   5.042 1.00 . A A .  20 LYS HZ3  1 1 
        9  5232 1 1 20 LYS N    N   -6.319   1.682  -0.562 1.00 . A A .  20 LYS N    1 1 
        9  5233 1 1 20 LYS NZ   N   -2.298   2.302   4.433 1.00 . A A .  20 LYS NZ   1 1 
        9  5234 1 1 20 LYS O    O   -5.803   3.655  -2.359 1.00 . A A .  20 LYS O    1 1 
        9  5235 1 1 21 ALA C    C   -3.046   6.632  -1.723 1.00 . A A .  21 ALA C    1 1 
        9  5236 1 1 21 ALA CA   C   -4.430   5.998  -1.807 1.00 . A A .  21 ALA CA   1 1 
        9  5237 1 1 21 ALA CB   C   -5.503   7.019  -1.456 1.00 . A A .  21 ALA CB   1 1 
        9  5238 1 1 21 ALA H    H   -4.081   4.857  -0.059 1.00 . A A .  21 ALA H    1 1 
        9  5239 1 1 21 ALA HA   H   -4.602   5.666  -2.820 1.00 . A A .  21 ALA HA   1 1 
        9  5240 1 1 21 ALA HB1  H   -6.478   6.576  -1.589 1.00 . A A .  21 ALA HB1  1 1 
        9  5241 1 1 21 ALA HB2  H   -5.384   7.325  -0.426 1.00 . A A .  21 ALA HB2  1 1 
        9  5242 1 1 21 ALA HB3  H   -5.406   7.879  -2.101 1.00 . A A .  21 ALA HB3  1 1 
        9  5243 1 1 21 ALA N    N   -4.530   4.838  -0.930 1.00 . A A .  21 ALA N    1 1 
        9  5244 1 1 21 ALA O    O   -2.618   7.075  -0.656 1.00 . A A .  21 ALA O    1 1 
        9  5245 1 1 22 PHE C    C   -1.005   8.528  -3.743 1.00 . A A .  22 PHE C    1 1 
        9  5246 1 1 22 PHE CA   C   -1.012   7.251  -2.907 1.00 . A A .  22 PHE CA   1 1 
        9  5247 1 1 22 PHE CB   C   -0.019   6.242  -3.489 1.00 . A A .  22 PHE CB   1 1 
        9  5248 1 1 22 PHE CD1  C   -1.299   4.107  -3.174 1.00 . A A .  22 PHE CD1  1 1 
        9  5249 1 1 22 PHE CD2  C    0.833   4.315  -2.126 1.00 . A A .  22 PHE CD2  1 1 
        9  5250 1 1 22 PHE CE1  C   -1.436   2.836  -2.649 1.00 . A A .  22 PHE CE1  1 1 
        9  5251 1 1 22 PHE CE2  C    0.702   3.044  -1.599 1.00 . A A .  22 PHE CE2  1 1 
        9  5252 1 1 22 PHE CG   C   -0.165   4.860  -2.918 1.00 . A A .  22 PHE CG   1 1 
        9  5253 1 1 22 PHE CZ   C   -0.434   2.303  -1.862 1.00 . A A .  22 PHE CZ   1 1 
        9  5254 1 1 22 PHE H    H   -2.744   6.303  -3.672 1.00 . A A .  22 PHE H    1 1 
        9  5255 1 1 22 PHE HA   H   -0.715   7.493  -1.898 1.00 . A A .  22 PHE HA   1 1 
        9  5256 1 1 22 PHE HB2  H   -0.168   6.177  -4.557 1.00 . A A .  22 PHE HB2  1 1 
        9  5257 1 1 22 PHE HB3  H    0.986   6.581  -3.290 1.00 . A A .  22 PHE HB3  1 1 
        9  5258 1 1 22 PHE HD1  H   -2.083   4.521  -3.790 1.00 . A A .  22 PHE HD1  1 1 
        9  5259 1 1 22 PHE HD2  H    1.722   4.894  -1.921 1.00 . A A .  22 PHE HD2  1 1 
        9  5260 1 1 22 PHE HE1  H   -2.325   2.258  -2.856 1.00 . A A .  22 PHE HE1  1 1 
        9  5261 1 1 22 PHE HE2  H    1.487   2.631  -0.984 1.00 . A A .  22 PHE HE2  1 1 
        9  5262 1 1 22 PHE HZ   H   -0.538   1.310  -1.451 1.00 . A A .  22 PHE HZ   1 1 
        9  5263 1 1 22 PHE N    N   -2.349   6.672  -2.854 1.00 . A A .  22 PHE N    1 1 
        9  5264 1 1 22 PHE O    O   -2.051   8.993  -4.194 1.00 . A A .  22 PHE O    1 1 
        9  5265 1 1 23 ARG C    C    1.102  10.050  -6.010 1.00 . A A .  23 ARG C    1 1 
        9  5266 1 1 23 ARG CA   C    0.327  10.314  -4.723 1.00 . A A .  23 ARG CA   1 1 
        9  5267 1 1 23 ARG CB   C    1.038  11.388  -3.897 1.00 . A A .  23 ARG CB   1 1 
        9  5268 1 1 23 ARG CD   C    0.530  10.928  -1.480 1.00 . A A .  23 ARG CD   1 1 
        9  5269 1 1 23 ARG CG   C    0.256  11.831  -2.672 1.00 . A A .  23 ARG CG   1 1 
        9  5270 1 1 23 ARG CZ   C   -0.737  12.075   0.288 1.00 . A A .  23 ARG CZ   1 1 
        9  5271 1 1 23 ARG H    H    0.981   8.672  -3.558 1.00 . A A .  23 ARG H    1 1 
        9  5272 1 1 23 ARG HA   H   -0.662  10.664  -4.977 1.00 . A A .  23 ARG HA   1 1 
        9  5273 1 1 23 ARG HB2  H    1.991  11.001  -3.568 1.00 . A A .  23 ARG HB2  1 1 
        9  5274 1 1 23 ARG HB3  H    1.206  12.252  -4.522 1.00 . A A .  23 ARG HB3  1 1 
        9  5275 1 1 23 ARG HD2  H    0.606   9.909  -1.827 1.00 . A A .  23 ARG HD2  1 1 
        9  5276 1 1 23 ARG HD3  H    1.464  11.225  -1.028 1.00 . A A .  23 ARG HD3  1 1 
        9  5277 1 1 23 ARG HE   H   -1.113  10.230  -0.370 1.00 . A A .  23 ARG HE   1 1 
        9  5278 1 1 23 ARG HG2  H    0.544  12.841  -2.418 1.00 . A A .  23 ARG HG2  1 1 
        9  5279 1 1 23 ARG HG3  H   -0.799  11.803  -2.900 1.00 . A A .  23 ARG HG3  1 1 
        9  5280 1 1 23 ARG HH11 H    0.779  13.149  -0.505 1.00 . A A .  23 ARG HH11 1 1 
        9  5281 1 1 23 ARG HH12 H   -0.122  13.946   0.742 1.00 . A A .  23 ARG HH12 1 1 
        9  5282 1 1 23 ARG HH21 H   -2.307  11.268   1.273 1.00 . A A .  23 ARG HH21 1 1 
        9  5283 1 1 23 ARG HH22 H   -1.877  12.875   1.753 1.00 . A A .  23 ARG HH22 1 1 
        9  5284 1 1 23 ARG N    N    0.183   9.090  -3.944 1.00 . A A .  23 ARG N    1 1 
        9  5285 1 1 23 ARG NE   N   -0.529  11.009  -0.477 1.00 . A A .  23 ARG NE   1 1 
        9  5286 1 1 23 ARG NH1  N    0.037  13.144   0.165 1.00 . A A .  23 ARG NH1  1 1 
        9  5287 1 1 23 ARG NH2  N   -1.722  12.073   1.178 1.00 . A A .  23 ARG NH2  1 1 
        9  5288 1 1 23 ARG O    O    0.934  10.758  -7.003 1.00 . A A .  23 ARG O    1 1 
        9  5289 1 1 24 ALA C    C    2.600   7.191  -7.487 1.00 . A A .  24 ALA C    1 1 
        9  5290 1 1 24 ALA CA   C    2.751   8.671  -7.151 1.00 . A A .  24 ALA CA   1 1 
        9  5291 1 1 24 ALA CB   C    4.214   9.014  -6.912 1.00 . A A .  24 ALA CB   1 1 
        9  5292 1 1 24 ALA H    H    2.041   8.502  -5.164 1.00 . A A .  24 ALA H    1 1 
        9  5293 1 1 24 ALA HA   H    2.401   9.257  -7.988 1.00 . A A .  24 ALA HA   1 1 
        9  5294 1 1 24 ALA HB1  H    4.704   9.176  -7.860 1.00 . A A .  24 ALA HB1  1 1 
        9  5295 1 1 24 ALA HB2  H    4.279   9.912  -6.315 1.00 . A A .  24 ALA HB2  1 1 
        9  5296 1 1 24 ALA HB3  H    4.694   8.199  -6.392 1.00 . A A .  24 ALA HB3  1 1 
        9  5297 1 1 24 ALA N    N    1.951   9.029  -5.985 1.00 . A A .  24 ALA N    1 1 
        9  5298 1 1 24 ALA O    O    1.814   6.480  -6.861 1.00 . A A .  24 ALA O    1 1 
        9  5299 1 1 25 ARG C    C    4.162   4.465  -7.986 1.00 . A A .  25 ARG C    1 1 
        9  5300 1 1 25 ARG CA   C    3.307   5.339  -8.898 1.00 . A A .  25 ARG CA   1 1 
        9  5301 1 1 25 ARG CB   C    3.783   5.203 -10.346 1.00 . A A .  25 ARG CB   1 1 
        9  5302 1 1 25 ARG CD   C    3.238   7.310 -11.601 1.00 . A A .  25 ARG CD   1 1 
        9  5303 1 1 25 ARG CG   C    2.857   5.859 -11.356 1.00 . A A .  25 ARG CG   1 1 
        9  5304 1 1 25 ARG CZ   C    2.140   7.723 -13.762 1.00 . A A .  25 ARG CZ   1 1 
        9  5305 1 1 25 ARG H    H    3.965   7.351  -8.939 1.00 . A A .  25 ARG H    1 1 
        9  5306 1 1 25 ARG HA   H    2.280   5.011  -8.834 1.00 . A A .  25 ARG HA   1 1 
        9  5307 1 1 25 ARG HB2  H    4.758   5.658 -10.436 1.00 . A A .  25 ARG HB2  1 1 
        9  5308 1 1 25 ARG HB3  H    3.861   4.154 -10.589 1.00 . A A .  25 ARG HB3  1 1 
        9  5309 1 1 25 ARG HD2  H    3.277   7.824 -10.652 1.00 . A A .  25 ARG HD2  1 1 
        9  5310 1 1 25 ARG HD3  H    4.212   7.339 -12.066 1.00 . A A .  25 ARG HD3  1 1 
        9  5311 1 1 25 ARG HE   H    1.711   8.678 -12.065 1.00 . A A .  25 ARG HE   1 1 
        9  5312 1 1 25 ARG HG2  H    2.918   5.320 -12.290 1.00 . A A .  25 ARG HG2  1 1 
        9  5313 1 1 25 ARG HG3  H    1.845   5.819 -10.981 1.00 . A A .  25 ARG HG3  1 1 
        9  5314 1 1 25 ARG HH11 H    3.570   6.296 -13.794 1.00 . A A .  25 ARG HH11 1 1 
        9  5315 1 1 25 ARG HH12 H    2.788   6.596 -15.310 1.00 . A A .  25 ARG HH12 1 1 
        9  5316 1 1 25 ARG HH21 H    0.674   9.082 -14.056 1.00 . A A .  25 ARG HH21 1 1 
        9  5317 1 1 25 ARG HH22 H    1.141   8.182 -15.458 1.00 . A A .  25 ARG HH22 1 1 
        9  5318 1 1 25 ARG N    N    3.358   6.735  -8.478 1.00 . A A .  25 ARG N    1 1 
        9  5319 1 1 25 ARG NE   N    2.279   7.989 -12.468 1.00 . A A .  25 ARG NE   1 1 
        9  5320 1 1 25 ARG NH1  N    2.895   6.796 -14.336 1.00 . A A .  25 ARG NH1  1 1 
        9  5321 1 1 25 ARG NH2  N    1.245   8.383 -14.485 1.00 . A A .  25 ARG NH2  1 1 
        9  5322 1 1 25 ARG O    O    3.648   3.589  -7.290 1.00 . A A .  25 ARG O    1 1 
        9  5323 1 1 26 SER C    C    5.837   3.746  -5.764 1.00 . A A .  26 SER C    1 1 
        9  5324 1 1 26 SER CA   C    6.395   3.942  -7.171 1.00 . A A .  26 SER CA   1 1 
        9  5325 1 1 26 SER CB   C    7.751   4.647  -7.100 1.00 . A A .  26 SER CB   1 1 
        9  5326 1 1 26 SER H    H    5.817   5.422  -8.571 1.00 . A A .  26 SER H    1 1 
        9  5327 1 1 26 SER HA   H    6.525   2.975  -7.632 1.00 . A A .  26 SER HA   1 1 
        9  5328 1 1 26 SER HB2  H    8.001   5.040  -8.074 1.00 . A A .  26 SER HB2  1 1 
        9  5329 1 1 26 SER HB3  H    7.696   5.457  -6.387 1.00 . A A .  26 SER HB3  1 1 
        9  5330 1 1 26 SER HG   H    9.082   3.994  -5.820 1.00 . A A .  26 SER HG   1 1 
        9  5331 1 1 26 SER N    N    5.468   4.710  -7.994 1.00 . A A .  26 SER N    1 1 
        9  5332 1 1 26 SER O    O    6.162   2.771  -5.086 1.00 . A A .  26 SER O    1 1 
        9  5333 1 1 26 SER OG   O    8.771   3.750  -6.694 1.00 . A A .  26 SER OG   1 1 
        9  5334 1 1 27 SER C    C    3.348   3.504  -3.939 1.00 . A A .  27 SER C    1 1 
        9  5335 1 1 27 SER CA   C    4.395   4.613  -4.006 1.00 . A A .  27 SER CA   1 1 
        9  5336 1 1 27 SER CB   C    3.757   5.955  -3.643 1.00 . A A .  27 SER CB   1 1 
        9  5337 1 1 27 SER H    H    4.776   5.433  -5.920 1.00 . A A .  27 SER H    1 1 
        9  5338 1 1 27 SER HA   H    5.180   4.394  -3.297 1.00 . A A .  27 SER HA   1 1 
        9  5339 1 1 27 SER HB2  H    4.344   6.756  -4.066 1.00 . A A .  27 SER HB2  1 1 
        9  5340 1 1 27 SER HB3  H    2.754   5.993  -4.043 1.00 . A A .  27 SER HB3  1 1 
        9  5341 1 1 27 SER HG   H    3.686   5.268  -1.810 1.00 . A A .  27 SER HG   1 1 
        9  5342 1 1 27 SER N    N    4.996   4.680  -5.333 1.00 . A A .  27 SER N    1 1 
        9  5343 1 1 27 SER O    O    3.257   2.780  -2.947 1.00 . A A .  27 SER O    1 1 
        9  5344 1 1 27 SER OG   O    3.695   6.127  -2.238 1.00 . A A .  27 SER OG   1 1 
        9  5345 1 1 28 LEU C    C    2.120   0.982  -5.325 1.00 . A A .  28 LEU C    1 1 
        9  5346 1 1 28 LEU CA   C    1.519   2.359  -5.064 1.00 . A A .  28 LEU CA   1 1 
        9  5347 1 1 28 LEU CB   C    0.508   2.703  -6.160 1.00 . A A .  28 LEU CB   1 1 
        9  5348 1 1 28 LEU CD1  C   -1.601   1.434  -5.683 1.00 . A A .  28 LEU CD1  1 1 
        9  5349 1 1 28 LEU CD2  C   -0.862   1.783  -8.047 1.00 . A A .  28 LEU CD2  1 1 
        9  5350 1 1 28 LEU CG   C   -0.405   1.562  -6.612 1.00 . A A .  28 LEU CG   1 1 
        9  5351 1 1 28 LEU H    H    2.681   3.985  -5.760 1.00 . A A .  28 LEU H    1 1 
        9  5352 1 1 28 LEU HA   H    1.013   2.343  -4.111 1.00 . A A .  28 LEU HA   1 1 
        9  5353 1 1 28 LEU HB2  H   -0.119   3.501  -5.792 1.00 . A A .  28 LEU HB2  1 1 
        9  5354 1 1 28 LEU HB3  H    1.060   3.048  -7.022 1.00 . A A .  28 LEU HB3  1 1 
        9  5355 1 1 28 LEU HD11 H   -2.509   1.416  -6.266 1.00 . A A .  28 LEU HD11 1 1 
        9  5356 1 1 28 LEU HD12 H   -1.623   2.277  -5.007 1.00 . A A .  28 LEU HD12 1 1 
        9  5357 1 1 28 LEU HD13 H   -1.519   0.519  -5.114 1.00 . A A .  28 LEU HD13 1 1 
        9  5358 1 1 28 LEU HD21 H   -0.872   0.839  -8.571 1.00 . A A .  28 LEU HD21 1 1 
        9  5359 1 1 28 LEU HD22 H   -0.183   2.462  -8.540 1.00 . A A .  28 LEU HD22 1 1 
        9  5360 1 1 28 LEU HD23 H   -1.857   2.205  -8.046 1.00 . A A .  28 LEU HD23 1 1 
        9  5361 1 1 28 LEU HG   H    0.147   0.632  -6.576 1.00 . A A .  28 LEU HG   1 1 
        9  5362 1 1 28 LEU N    N    2.560   3.379  -5.001 1.00 . A A .  28 LEU N    1 1 
        9  5363 1 1 28 LEU O    O    1.645  -0.024  -4.799 1.00 . A A .  28 LEU O    1 1 
        9  5364 1 1 29 ALA C    C    4.335  -1.011  -5.208 1.00 . A A .  29 ALA C    1 1 
        9  5365 1 1 29 ALA CA   C    3.839  -0.308  -6.467 1.00 . A A .  29 ALA CA   1 1 
        9  5366 1 1 29 ALA CB   C    4.996  -0.054  -7.423 1.00 . A A .  29 ALA CB   1 1 
        9  5367 1 1 29 ALA H    H    3.503   1.781  -6.529 1.00 . A A .  29 ALA H    1 1 
        9  5368 1 1 29 ALA HA   H    3.125  -0.947  -6.967 1.00 . A A .  29 ALA HA   1 1 
        9  5369 1 1 29 ALA HB1  H    5.898  -0.487  -7.017 1.00 . A A .  29 ALA HB1  1 1 
        9  5370 1 1 29 ALA HB2  H    4.778  -0.506  -8.379 1.00 . A A .  29 ALA HB2  1 1 
        9  5371 1 1 29 ALA HB3  H    5.132   1.009  -7.549 1.00 . A A .  29 ALA HB3  1 1 
        9  5372 1 1 29 ALA N    N    3.170   0.945  -6.140 1.00 . A A .  29 ALA N    1 1 
        9  5373 1 1 29 ALA O    O    3.964  -2.154  -4.938 1.00 . A A .  29 ALA O    1 1 
        9  5374 1 1 30 ILE C    C    4.652  -1.643  -2.434 1.00 . A A .  30 ILE C    1 1 
        9  5375 1 1 30 ILE CA   C    5.719  -0.881  -3.212 1.00 . A A .  30 ILE CA   1 1 
        9  5376 1 1 30 ILE CB   C    6.311   0.218  -2.309 1.00 . A A .  30 ILE CB   1 1 
        9  5377 1 1 30 ILE CD1  C    7.619   2.388  -2.551 1.00 . A A .  30 ILE CD1  1 1 
        9  5378 1 1 30 ILE CG1  C    7.419   0.972  -3.045 1.00 . A A .  30 ILE CG1  1 1 
        9  5379 1 1 30 ILE CG2  C    6.842  -0.388  -1.018 1.00 . A A .  30 ILE CG2  1 1 
        9  5380 1 1 30 ILE H    H    5.431   0.585  -4.711 1.00 . A A .  30 ILE H    1 1 
        9  5381 1 1 30 ILE HA   H    6.512  -1.565  -3.480 1.00 . A A .  30 ILE HA   1 1 
        9  5382 1 1 30 ILE HB   H    5.521   0.909  -2.056 1.00 . A A .  30 ILE HB   1 1 
        9  5383 1 1 30 ILE HD11 H    8.622   2.713  -2.786 1.00 . A A .  30 ILE HD11 1 1 
        9  5384 1 1 30 ILE HD12 H    6.907   3.041  -3.034 1.00 . A A .  30 ILE HD12 1 1 
        9  5385 1 1 30 ILE HD13 H    7.471   2.420  -1.482 1.00 . A A .  30 ILE HD13 1 1 
        9  5386 1 1 30 ILE HG12 H    8.351   0.443  -2.919 1.00 . A A .  30 ILE HG12 1 1 
        9  5387 1 1 30 ILE HG13 H    7.176   1.018  -4.097 1.00 . A A .  30 ILE HG13 1 1 
        9  5388 1 1 30 ILE HG21 H    6.737   0.327  -0.215 1.00 . A A .  30 ILE HG21 1 1 
        9  5389 1 1 30 ILE HG22 H    6.280  -1.279  -0.781 1.00 . A A .  30 ILE HG22 1 1 
        9  5390 1 1 30 ILE HG23 H    7.884  -0.641  -1.140 1.00 . A A .  30 ILE HG23 1 1 
        9  5391 1 1 30 ILE N    N    5.174  -0.321  -4.443 1.00 . A A .  30 ILE N    1 1 
        9  5392 1 1 30 ILE O    O    4.931  -2.676  -1.826 1.00 . A A .  30 ILE O    1 1 
        9  5393 1 1 31 HIS C    C    1.764  -2.933  -2.563 1.00 . A A .  31 HIS C    1 1 
        9  5394 1 1 31 HIS CA   C    2.316  -1.760  -1.759 1.00 . A A .  31 HIS CA   1 1 
        9  5395 1 1 31 HIS CB   C    1.206  -0.742  -1.492 1.00 . A A .  31 HIS CB   1 1 
        9  5396 1 1 31 HIS CD2  C   -1.298  -1.159  -2.025 1.00 . A A .  31 HIS CD2  1 1 
        9  5397 1 1 31 HIS CE1  C   -1.706  -2.665  -0.485 1.00 . A A .  31 HIS CE1  1 1 
        9  5398 1 1 31 HIS CG   C   -0.149  -1.360  -1.337 1.00 . A A .  31 HIS CG   1 1 
        9  5399 1 1 31 HIS H    H    3.267  -0.301  -2.962 1.00 . A A .  31 HIS H    1 1 
        9  5400 1 1 31 HIS HA   H    2.687  -2.130  -0.815 1.00 . A A .  31 HIS HA   1 1 
        9  5401 1 1 31 HIS HB2  H    1.431  -0.204  -0.583 1.00 . A A .  31 HIS HB2  1 1 
        9  5402 1 1 31 HIS HB3  H    1.162  -0.044  -2.316 1.00 . A A .  31 HIS HB3  1 1 
        9  5403 1 1 31 HIS HD1  H    0.191  -2.667   0.280 1.00 . A A .  31 HIS HD1  1 1 
        9  5404 1 1 31 HIS HD2  H   -1.439  -0.478  -2.853 1.00 . A A .  31 HIS HD2  1 1 
        9  5405 1 1 31 HIS HE1  H   -2.213  -3.391   0.134 1.00 . A A .  31 HIS HE1  1 1 
        9  5406 1 1 31 HIS N    N    3.427  -1.127  -2.460 1.00 . A A .  31 HIS N    1 1 
        9  5407 1 1 31 HIS ND1  N   -0.439  -2.308  -0.379 1.00 . A A .  31 HIS ND1  1 1 
        9  5408 1 1 31 HIS NE2  N   -2.250  -1.982  -1.476 1.00 . A A .  31 HIS NE2  1 1 
        9  5409 1 1 31 HIS O    O    1.488  -3.999  -2.013 1.00 . A A .  31 HIS O    1 1 
        9  5410 1 1 32 GLN C    C    1.863  -5.068  -4.571 1.00 . A A .  32 GLN C    1 1 
        9  5411 1 1 32 GLN CA   C    1.084  -3.768  -4.745 1.00 . A A .  32 GLN CA   1 1 
        9  5412 1 1 32 GLN CB   C    1.148  -3.312  -6.204 1.00 . A A .  32 GLN CB   1 1 
        9  5413 1 1 32 GLN CD   C   -1.286  -2.689  -6.464 1.00 . A A .  32 GLN CD   1 1 
        9  5414 1 1 32 GLN CG   C    0.152  -2.216  -6.544 1.00 . A A .  32 GLN CG   1 1 
        9  5415 1 1 32 GLN H    H    1.842  -1.856  -4.245 1.00 . A A .  32 GLN H    1 1 
        9  5416 1 1 32 GLN HA   H    0.053  -3.943  -4.478 1.00 . A A .  32 GLN HA   1 1 
        9  5417 1 1 32 GLN HB2  H    2.142  -2.943  -6.410 1.00 . A A .  32 GLN HB2  1 1 
        9  5418 1 1 32 GLN HB3  H    0.949  -4.160  -6.843 1.00 . A A .  32 GLN HB3  1 1 
        9  5419 1 1 32 GLN HE21 H   -1.926  -0.944  -7.171 1.00 . A A .  32 GLN HE21 1 1 
        9  5420 1 1 32 GLN HE22 H   -3.154  -2.106  -6.815 1.00 . A A .  32 GLN HE22 1 1 
        9  5421 1 1 32 GLN HG2  H    0.284  -1.399  -5.850 1.00 . A A .  32 GLN HG2  1 1 
        9  5422 1 1 32 GLN HG3  H    0.346  -1.869  -7.548 1.00 . A A .  32 GLN HG3  1 1 
        9  5423 1 1 32 GLN N    N    1.604  -2.728  -3.866 1.00 . A A .  32 GLN N    1 1 
        9  5424 1 1 32 GLN NE2  N   -2.216  -1.826  -6.856 1.00 . A A .  32 GLN NE2  1 1 
        9  5425 1 1 32 GLN O    O    1.398  -6.138  -4.963 1.00 . A A .  32 GLN O    1 1 
        9  5426 1 1 32 GLN OE1  O   -1.559  -3.818  -6.054 1.00 . A A .  32 GLN OE1  1 1 
        9  5427 1 1 33 ALA C    C    3.468  -6.880  -2.494 1.00 . A A .  33 ALA C    1 1 
        9  5428 1 1 33 ALA CA   C    3.892  -6.133  -3.755 1.00 . A A .  33 ALA CA   1 1 
        9  5429 1 1 33 ALA CB   C    5.353  -5.719  -3.658 1.00 . A A .  33 ALA CB   1 1 
        9  5430 1 1 33 ALA H    H    3.365  -4.085  -3.692 1.00 . A A .  33 ALA H    1 1 
        9  5431 1 1 33 ALA HA   H    3.785  -6.793  -4.604 1.00 . A A .  33 ALA HA   1 1 
        9  5432 1 1 33 ALA HB1  H    5.587  -5.036  -4.461 1.00 . A A .  33 ALA HB1  1 1 
        9  5433 1 1 33 ALA HB2  H    5.527  -5.234  -2.709 1.00 . A A .  33 ALA HB2  1 1 
        9  5434 1 1 33 ALA HB3  H    5.981  -6.594  -3.736 1.00 . A A .  33 ALA HB3  1 1 
        9  5435 1 1 33 ALA N    N    3.049  -4.966  -3.982 1.00 . A A .  33 ALA N    1 1 
        9  5436 1 1 33 ALA O    O    4.174  -7.770  -2.019 1.00 . A A .  33 ALA O    1 1 
        9  5437 1 1 34 THR C    C    0.546  -7.969  -1.052 1.00 . A A .  34 THR C    1 1 
        9  5438 1 1 34 THR CA   C    1.792  -7.144  -0.749 1.00 . A A .  34 THR CA   1 1 
        9  5439 1 1 34 THR CB   C    1.453  -6.101   0.332 1.00 . A A .  34 THR CB   1 1 
        9  5440 1 1 34 THR CG2  C    0.068  -5.515   0.103 1.00 . A A .  34 THR CG2  1 1 
        9  5441 1 1 34 THR H    H    1.792  -5.796  -2.380 1.00 . A A .  34 THR H    1 1 
        9  5442 1 1 34 THR HA   H    2.559  -7.799  -0.360 1.00 . A A .  34 THR HA   1 1 
        9  5443 1 1 34 THR HB   H    2.179  -5.302   0.280 1.00 . A A .  34 THR HB   1 1 
        9  5444 1 1 34 THR HG1  H    2.344  -7.175   1.726 1.00 . A A .  34 THR HG1  1 1 
        9  5445 1 1 34 THR HG21 H   -0.028  -5.211  -0.929 1.00 . A A .  34 THR HG21 1 1 
        9  5446 1 1 34 THR HG22 H   -0.070  -4.657   0.744 1.00 . A A .  34 THR HG22 1 1 
        9  5447 1 1 34 THR HG23 H   -0.680  -6.259   0.330 1.00 . A A .  34 THR HG23 1 1 
        9  5448 1 1 34 THR N    N    2.309  -6.511  -1.955 1.00 . A A .  34 THR N    1 1 
        9  5449 1 1 34 THR O    O    0.304  -9.000  -0.424 1.00 . A A .  34 THR O    1 1 
        9  5450 1 1 34 THR OG1  O    1.513  -6.703   1.630 1.00 . A A .  34 THR OG1  1 1 
        9  5451 1 1 35 HIS C    C   -1.140  -9.493  -3.155 1.00 . A A .  35 HIS C    1 1 
        9  5452 1 1 35 HIS CA   C   -1.464  -8.205  -2.405 1.00 . A A .  35 HIS CA   1 1 
        9  5453 1 1 35 HIS CB   C   -2.338  -7.300  -3.275 1.00 . A A .  35 HIS CB   1 1 
        9  5454 1 1 35 HIS CD2  C   -2.947  -4.966  -2.323 1.00 . A A .  35 HIS CD2  1 1 
        9  5455 1 1 35 HIS CE1  C   -4.730  -5.540  -1.184 1.00 . A A .  35 HIS CE1  1 1 
        9  5456 1 1 35 HIS CG   C   -3.127  -6.297  -2.492 1.00 . A A .  35 HIS CG   1 1 
        9  5457 1 1 35 HIS H    H    0.004  -6.681  -2.482 1.00 . A A .  35 HIS H    1 1 
        9  5458 1 1 35 HIS HA   H   -2.003  -8.453  -1.504 1.00 . A A .  35 HIS HA   1 1 
        9  5459 1 1 35 HIS HB2  H   -1.708  -6.760  -3.967 1.00 . A A .  35 HIS HB2  1 1 
        9  5460 1 1 35 HIS HB3  H   -3.035  -7.911  -3.831 1.00 . A A .  35 HIS HB3  1 1 
        9  5461 1 1 35 HIS HD1  H   -4.641  -7.521  -1.687 1.00 . A A .  35 HIS HD1  1 1 
        9  5462 1 1 35 HIS HD2  H   -2.156  -4.366  -2.752 1.00 . A A .  35 HIS HD2  1 1 
        9  5463 1 1 35 HIS HE1  H   -5.604  -5.493  -0.552 1.00 . A A .  35 HIS HE1  1 1 
        9  5464 1 1 35 HIS N    N   -0.242  -7.508  -2.018 1.00 . A A .  35 HIS N    1 1 
        9  5465 1 1 35 HIS ND1  N   -4.251  -6.625  -1.764 1.00 . A A .  35 HIS ND1  1 1 
        9  5466 1 1 35 HIS NE2  N   -3.956  -4.519  -1.507 1.00 . A A .  35 HIS NE2  1 1 
        9  5467 1 1 35 HIS O    O   -1.661 -10.560  -2.830 1.00 . A A .  35 HIS O    1 1 
        9  5468 1 1 36 SER C    C    0.274 -11.780  -4.083 1.00 . A A .  36 SER C    1 1 
        9  5469 1 1 36 SER CA   C    0.112 -10.542  -4.960 1.00 . A A .  36 SER CA   1 1 
        9  5470 1 1 36 SER CB   C    1.417 -10.257  -5.706 1.00 . A A .  36 SER CB   1 1 
        9  5471 1 1 36 SER H    H    0.104  -8.508  -4.372 1.00 . A A .  36 SER H    1 1 
        9  5472 1 1 36 SER HA   H   -0.672 -10.727  -5.680 1.00 . A A .  36 SER HA   1 1 
        9  5473 1 1 36 SER HB2  H    1.426  -9.227  -6.028 1.00 . A A .  36 SER HB2  1 1 
        9  5474 1 1 36 SER HB3  H    2.252 -10.436  -5.045 1.00 . A A .  36 SER HB3  1 1 
        9  5475 1 1 36 SER HG   H    2.477 -11.260  -7.013 1.00 . A A .  36 SER HG   1 1 
        9  5476 1 1 36 SER N    N   -0.278  -9.386  -4.161 1.00 . A A .  36 SER N    1 1 
        9  5477 1 1 36 SER O    O    1.155 -11.835  -3.225 1.00 . A A .  36 SER O    1 1 
        9  5478 1 1 36 SER OG   O    1.547 -11.092  -6.844 1.00 . A A .  36 SER OG   1 1 
        9  5479 1 1 37 GLY C    C   -1.799 -14.264  -2.762 1.00 . A A .  37 GLY C    1 1 
        9  5480 1 1 37 GLY CA   C   -0.518 -13.995  -3.527 1.00 . A A .  37 GLY CA   1 1 
        9  5481 1 1 37 GLY H    H   -1.264 -12.672  -5.002 1.00 . A A .  37 GLY H    1 1 
        9  5482 1 1 37 GLY HA2  H   -0.329 -14.823  -4.193 1.00 . A A .  37 GLY HA2  1 1 
        9  5483 1 1 37 GLY HA3  H    0.298 -13.919  -2.823 1.00 . A A .  37 GLY HA3  1 1 
        9  5484 1 1 37 GLY N    N   -0.583 -12.772  -4.304 1.00 . A A .  37 GLY N    1 1 
        9  5485 1 1 37 GLY O    O   -1.762 -14.705  -1.613 1.00 . A A .  37 GLY O    1 1 
        9  5486 1 1 38 GLU C    C   -4.270 -13.588  -1.376 1.00 . A A .  38 GLU C    1 1 
        9  5487 1 1 38 GLU CA   C   -4.232 -14.210  -2.769 1.00 . A A .  38 GLU CA   1 1 
        9  5488 1 1 38 GLU CB   C   -4.540 -15.706  -2.679 1.00 . A A .  38 GLU CB   1 1 
        9  5489 1 1 38 GLU CD   C   -4.601 -17.894  -3.941 1.00 . A A .  38 GLU CD   1 1 
        9  5490 1 1 38 GLU CG   C   -4.676 -16.382  -4.033 1.00 . A A .  38 GLU CG   1 1 
        9  5491 1 1 38 GLU H    H   -2.899 -13.647  -4.314 1.00 . A A .  38 GLU H    1 1 
        9  5492 1 1 38 GLU HA   H   -4.981 -13.734  -3.383 1.00 . A A .  38 GLU HA   1 1 
        9  5493 1 1 38 GLU HB2  H   -3.744 -16.194  -2.135 1.00 . A A .  38 GLU HB2  1 1 
        9  5494 1 1 38 GLU HB3  H   -5.466 -15.839  -2.139 1.00 . A A .  38 GLU HB3  1 1 
        9  5495 1 1 38 GLU HG2  H   -5.629 -16.110  -4.462 1.00 . A A .  38 GLU HG2  1 1 
        9  5496 1 1 38 GLU HG3  H   -3.881 -16.035  -4.676 1.00 . A A .  38 GLU HG3  1 1 
        9  5497 1 1 38 GLU N    N   -2.934 -13.997  -3.399 1.00 . A A .  38 GLU N    1 1 
        9  5498 1 1 38 GLU O    O   -4.742 -14.204  -0.420 1.00 . A A .  38 GLU O    1 1 
        9  5499 1 1 38 GLU OE1  O   -5.012 -18.445  -2.898 1.00 . A A .  38 GLU OE1  1 1 
        9  5500 1 1 38 GLU OE2  O   -4.132 -18.525  -4.911 1.00 . A A .  38 GLU OE2  1 1 
        9  5501 1 1 39 LYS C    C   -4.753 -10.510   0.012 1.00 . A A .  39 LYS C    1 1 
        9  5502 1 1 39 LYS CA   C   -3.743 -11.654   0.005 1.00 . A A .  39 LYS CA   1 1 
        9  5503 1 1 39 LYS CB   C   -2.340 -11.110   0.284 1.00 . A A .  39 LYS CB   1 1 
        9  5504 1 1 39 LYS CD   C    0.005 -11.651   1.004 1.00 . A A .  39 LYS CD   1 1 
        9  5505 1 1 39 LYS CE   C    0.311 -10.612   2.072 1.00 . A A .  39 LYS CE   1 1 
        9  5506 1 1 39 LYS CG   C   -1.453 -12.079   1.046 1.00 . A A .  39 LYS CG   1 1 
        9  5507 1 1 39 LYS H    H   -3.405 -11.923  -2.067 1.00 . A A .  39 LYS H    1 1 
        9  5508 1 1 39 LYS HA   H   -4.008 -12.356   0.781 1.00 . A A .  39 LYS HA   1 1 
        9  5509 1 1 39 LYS HB2  H   -1.862 -10.882  -0.658 1.00 . A A .  39 LYS HB2  1 1 
        9  5510 1 1 39 LYS HB3  H   -2.427 -10.202   0.863 1.00 . A A .  39 LYS HB3  1 1 
        9  5511 1 1 39 LYS HD2  H    0.630 -12.516   1.170 1.00 . A A .  39 LYS HD2  1 1 
        9  5512 1 1 39 LYS HD3  H    0.220 -11.231   0.032 1.00 . A A .  39 LYS HD3  1 1 
        9  5513 1 1 39 LYS HE2  H   -0.376  -9.787   1.960 1.00 . A A .  39 LYS HE2  1 1 
        9  5514 1 1 39 LYS HE3  H    0.177 -11.063   3.044 1.00 . A A .  39 LYS HE3  1 1 
        9  5515 1 1 39 LYS HG2  H   -1.777 -12.116   2.076 1.00 . A A .  39 LYS HG2  1 1 
        9  5516 1 1 39 LYS HG3  H   -1.543 -13.061   0.603 1.00 . A A .  39 LYS HG3  1 1 
        9  5517 1 1 39 LYS HZ1  H    2.004 -10.084   0.967 1.00 . A A .  39 LYS HZ1  1 1 
        9  5518 1 1 39 LYS HZ2  H    2.353 -10.711   2.499 1.00 . A A .  39 LYS HZ2  1 1 
        9  5519 1 1 39 LYS HZ3  H    1.762  -9.134   2.345 1.00 . A A .  39 LYS HZ3  1 1 
        9  5520 1 1 39 LYS N    N   -3.768 -12.362  -1.269 1.00 . A A .  39 LYS N    1 1 
        9  5521 1 1 39 LYS NZ   N    1.705 -10.099   1.963 1.00 . A A .  39 LYS NZ   1 1 
        9  5522 1 1 39 LYS O    O   -4.410  -9.346  -0.195 1.00 . A A .  39 LYS O    1 1 
        9  5523 1 1 40 PRO C    C   -7.020  -8.947   1.512 1.00 . A A .  40 PRO C    1 1 
        9  5524 1 1 40 PRO CA   C   -7.113  -9.862   0.296 1.00 . A A .  40 PRO CA   1 1 
        9  5525 1 1 40 PRO CB   C   -8.374 -10.727   0.373 1.00 . A A .  40 PRO CB   1 1 
        9  5526 1 1 40 PRO CD   C   -6.509 -12.215   0.510 1.00 . A A .  40 PRO CD   1 1 
        9  5527 1 1 40 PRO CG   C   -7.920 -12.006   0.987 1.00 . A A .  40 PRO CG   1 1 
        9  5528 1 1 40 PRO HA   H   -7.140  -9.263  -0.602 1.00 . A A .  40 PRO HA   1 1 
        9  5529 1 1 40 PRO HB2  H   -9.115 -10.234   0.988 1.00 . A A .  40 PRO HB2  1 1 
        9  5530 1 1 40 PRO HB3  H   -8.769 -10.883  -0.619 1.00 . A A .  40 PRO HB3  1 1 
        9  5531 1 1 40 PRO HD2  H   -5.919 -12.695   1.277 1.00 . A A .  40 PRO HD2  1 1 
        9  5532 1 1 40 PRO HD3  H   -6.500 -12.802  -0.397 1.00 . A A .  40 PRO HD3  1 1 
        9  5533 1 1 40 PRO HG2  H   -7.944 -11.926   2.063 1.00 . A A .  40 PRO HG2  1 1 
        9  5534 1 1 40 PRO HG3  H   -8.551 -12.817   0.655 1.00 . A A .  40 PRO HG3  1 1 
        9  5535 1 1 40 PRO N    N   -6.028 -10.847   0.255 1.00 . A A .  40 PRO N    1 1 
        9  5536 1 1 40 PRO O    O   -7.881  -8.094   1.727 1.00 . A A .  40 PRO O    1 1 
        9  5537 1 1 41 SER C    C   -6.257  -6.895   3.285 1.00 . A A .  41 SER C    1 1 
        9  5538 1 1 41 SER CA   C   -5.765  -8.322   3.502 1.00 . A A .  41 SER CA   1 1 
        9  5539 1 1 41 SER CB   C   -4.285  -8.311   3.889 1.00 . A A .  41 SER CB   1 1 
        9  5540 1 1 41 SER H    H   -5.316  -9.826   2.081 1.00 . A A .  41 SER H    1 1 
        9  5541 1 1 41 SER HA   H   -6.334  -8.768   4.304 1.00 . A A .  41 SER HA   1 1 
        9  5542 1 1 41 SER HB2  H   -3.850  -9.274   3.670 1.00 . A A .  41 SER HB2  1 1 
        9  5543 1 1 41 SER HB3  H   -3.773  -7.547   3.321 1.00 . A A .  41 SER HB3  1 1 
        9  5544 1 1 41 SER HG   H   -4.251  -7.101   5.430 1.00 . A A .  41 SER HG   1 1 
        9  5545 1 1 41 SER N    N   -5.969  -9.130   2.305 1.00 . A A .  41 SER N    1 1 
        9  5546 1 1 41 SER O    O   -5.764  -6.183   2.410 1.00 . A A .  41 SER O    1 1 
        9  5547 1 1 41 SER OG   O   -4.121  -8.039   5.270 1.00 . A A .  41 SER OG   1 1 
        9  5548 1 1 42 GLY C    C   -8.936  -4.900   4.914 1.00 . A A .  42 GLY C    1 1 
        9  5549 1 1 42 GLY CA   C   -7.776  -5.142   3.969 1.00 . A A .  42 GLY CA   1 1 
        9  5550 1 1 42 GLY H    H   -7.586  -7.094   4.768 1.00 . A A .  42 GLY H    1 1 
        9  5551 1 1 42 GLY HA2  H   -6.995  -4.428   4.184 1.00 . A A .  42 GLY HA2  1 1 
        9  5552 1 1 42 GLY HA3  H   -8.116  -4.993   2.954 1.00 . A A .  42 GLY HA3  1 1 
        9  5553 1 1 42 GLY N    N   -7.232  -6.482   4.088 1.00 . A A .  42 GLY N    1 1 
        9  5554 1 1 42 GLY O    O  -10.103  -4.988   4.533 1.00 . A A .  42 GLY O    1 1 
        9  5555 1 1 43 PRO C    C  -10.375  -3.019   6.970 1.00 . A A .  43 PRO C    1 1 
        9  5556 1 1 43 PRO CA   C   -9.629  -4.328   7.208 1.00 . A A .  43 PRO CA   1 1 
        9  5557 1 1 43 PRO CB   C   -8.810  -4.249   8.499 1.00 . A A .  43 PRO CB   1 1 
        9  5558 1 1 43 PRO CD   C   -7.247  -4.466   6.703 1.00 . A A .  43 PRO CD   1 1 
        9  5559 1 1 43 PRO CG   C   -7.446  -3.844   8.057 1.00 . A A .  43 PRO CG   1 1 
        9  5560 1 1 43 PRO HA   H  -10.340  -5.138   7.280 1.00 . A A .  43 PRO HA   1 1 
        9  5561 1 1 43 PRO HB2  H   -9.246  -3.514   9.161 1.00 . A A .  43 PRO HB2  1 1 
        9  5562 1 1 43 PRO HB3  H   -8.798  -5.215   8.981 1.00 . A A .  43 PRO HB3  1 1 
        9  5563 1 1 43 PRO HD2  H   -6.651  -3.821   6.075 1.00 . A A .  43 PRO HD2  1 1 
        9  5564 1 1 43 PRO HD3  H   -6.783  -5.437   6.798 1.00 . A A .  43 PRO HD3  1 1 
        9  5565 1 1 43 PRO HG2  H   -7.386  -2.768   7.988 1.00 . A A .  43 PRO HG2  1 1 
        9  5566 1 1 43 PRO HG3  H   -6.709  -4.218   8.753 1.00 . A A .  43 PRO HG3  1 1 
        9  5567 1 1 43 PRO N    N   -8.618  -4.589   6.179 1.00 . A A .  43 PRO N    1 1 
        9  5568 1 1 43 PRO O    O  -11.225  -2.624   7.768 1.00 . A A .  43 PRO O    1 1 
        9  5569 1 1 44 SER C    C  -11.026  -1.030   4.038 1.00 . A A .  44 SER C    1 1 
        9  5570 1 1 44 SER CA   C  -10.689  -1.086   5.525 1.00 . A A .  44 SER CA   1 1 
        9  5571 1 1 44 SER CB   C   -9.777   0.085   5.897 1.00 . A A .  44 SER CB   1 1 
        9  5572 1 1 44 SER H    H   -9.366  -2.719   5.270 1.00 . A A .  44 SER H    1 1 
        9  5573 1 1 44 SER HA   H  -11.605  -1.012   6.093 1.00 . A A .  44 SER HA   1 1 
        9  5574 1 1 44 SER HB2  H   -8.779  -0.110   5.536 1.00 . A A .  44 SER HB2  1 1 
        9  5575 1 1 44 SER HB3  H  -10.154   0.990   5.442 1.00 . A A .  44 SER HB3  1 1 
        9  5576 1 1 44 SER HG   H   -9.808   1.201   7.507 1.00 . A A .  44 SER HG   1 1 
        9  5577 1 1 44 SER N    N  -10.052  -2.352   5.867 1.00 . A A .  44 SER N    1 1 
        9  5578 1 1 44 SER O    O  -10.368  -1.670   3.218 1.00 . A A .  44 SER O    1 1 
        9  5579 1 1 44 SER OG   O   -9.728   0.267   7.302 1.00 . A A .  44 SER OG   1 1 
        9  5580 1 1 45 SER C    C  -12.280   1.305   1.819 1.00 . A A .  45 SER C    1 1 
        9  5581 1 1 45 SER CA   C  -12.483  -0.124   2.312 1.00 . A A .  45 SER CA   1 1 
        9  5582 1 1 45 SER CB   C  -13.953  -0.522   2.168 1.00 . A A .  45 SER CB   1 1 
        9  5583 1 1 45 SER H    H  -12.540   0.225   4.399 1.00 . A A .  45 SER H    1 1 
        9  5584 1 1 45 SER HA   H  -11.879  -0.788   1.712 1.00 . A A .  45 SER HA   1 1 
        9  5585 1 1 45 SER HB2  H  -14.058  -1.579   2.359 1.00 . A A .  45 SER HB2  1 1 
        9  5586 1 1 45 SER HB3  H  -14.545   0.034   2.881 1.00 . A A .  45 SER HB3  1 1 
        9  5587 1 1 45 SER HG   H  -15.119   0.424   0.909 1.00 . A A .  45 SER HG   1 1 
        9  5588 1 1 45 SER N    N  -12.055  -0.261   3.699 1.00 . A A .  45 SER N    1 1 
        9  5589 1 1 45 SER O    O  -11.520   1.550   0.883 1.00 . A A .  45 SER O    1 1 
        9  5590 1 1 45 SER OG   O  -14.431  -0.244   0.863 1.00 . A A .  45 SER OG   1 1 
        9  5591 1 1 46 GLY C    C  -13.564   3.945   0.769 1.00 . A A .  46 GLY C    1 1 
        9  5592 1 1 46 GLY CA   C  -12.850   3.642   2.071 1.00 . A A .  46 GLY CA   1 1 
        9  5593 1 1 46 GLY H    H  -13.559   1.995   3.197 1.00 . A A .  46 GLY H    1 1 
        9  5594 1 1 46 GLY HA2  H  -13.271   4.257   2.852 1.00 . A A .  46 GLY HA2  1 1 
        9  5595 1 1 46 GLY HA3  H  -11.803   3.886   1.959 1.00 . A A .  46 GLY HA3  1 1 
        9  5596 1 1 46 GLY N    N  -12.967   2.248   2.457 1.00 . A A .  46 GLY N    1 1 
        9  5597 1 1 46 GLY O    O  -14.465   3.197   0.392 1.00 . A A .  46 GLY O    1 1 
        9  5598 2 2  1 ZN  ZN   ZN  -4.064  -2.571  -1.599 1.00 . B A . 201 ZN  ZN   1 1 
       10  5599 1 1  1 GLY C    C  -21.088  11.623   5.598 1.00 . A A .   1 GLY C    1 1 
       10  5600 1 1  1 GLY CA   C  -22.208  10.777   6.169 1.00 . A A .   1 GLY CA   1 1 
       10  5601 1 1  1 GLY H1   H  -21.657   8.913   7.010 1.00 . A A .   1 GLY H1   1 1 
       10  5602 1 1  1 GLY HA2  H  -22.651  10.199   5.371 1.00 . A A .   1 GLY HA2  1 1 
       10  5603 1 1  1 GLY HA3  H  -22.960  11.430   6.587 1.00 . A A .   1 GLY HA3  1 1 
       10  5604 1 1  1 GLY N    N  -21.747   9.870   7.204 1.00 . A A .   1 GLY N    1 1 
       10  5605 1 1  1 GLY O    O  -20.223  11.120   4.882 1.00 . A A .   1 GLY O    1 1 
       10  5606 1 1  2 SER C    C  -18.687  13.330   5.767 1.00 . A A .   2 SER C    1 1 
       10  5607 1 1  2 SER CA   C  -20.085  13.834   5.423 1.00 . A A .   2 SER CA   1 1 
       10  5608 1 1  2 SER CB   C  -20.297  15.228   6.018 1.00 . A A .   2 SER CB   1 1 
       10  5609 1 1  2 SER H    H  -21.821  13.256   6.489 1.00 . A A .   2 SER H    1 1 
       10  5610 1 1  2 SER HA   H  -20.180  13.892   4.349 1.00 . A A .   2 SER HA   1 1 
       10  5611 1 1  2 SER HB2  H  -20.448  15.143   7.083 1.00 . A A .   2 SER HB2  1 1 
       10  5612 1 1  2 SER HB3  H  -19.424  15.835   5.826 1.00 . A A .   2 SER HB3  1 1 
       10  5613 1 1  2 SER HG   H  -21.465  16.775   5.734 1.00 . A A .   2 SER HG   1 1 
       10  5614 1 1  2 SER N    N  -21.104  12.914   5.914 1.00 . A A .   2 SER N    1 1 
       10  5615 1 1  2 SER O    O  -18.417  12.940   6.903 1.00 . A A .   2 SER O    1 1 
       10  5616 1 1  2 SER OG   O  -21.428  15.860   5.445 1.00 . A A .   2 SER OG   1 1 
       10  5617 1 1  3 SER C    C  -15.507  14.049   5.303 1.00 . A A .   3 SER C    1 1 
       10  5618 1 1  3 SER CA   C  -16.431  12.880   4.971 1.00 . A A .   3 SER CA   1 1 
       10  5619 1 1  3 SER CB   C  -15.929  12.159   3.719 1.00 . A A .   3 SER CB   1 1 
       10  5620 1 1  3 SER H    H  -18.076  13.663   3.893 1.00 . A A .   3 SER H    1 1 
       10  5621 1 1  3 SER HA   H  -16.428  12.188   5.800 1.00 . A A .   3 SER HA   1 1 
       10  5622 1 1  3 SER HB2  H  -16.436  11.211   3.626 1.00 . A A .   3 SER HB2  1 1 
       10  5623 1 1  3 SER HB3  H  -16.138  12.766   2.850 1.00 . A A .   3 SER HB3  1 1 
       10  5624 1 1  3 SER HG   H  -14.075  12.760   3.919 1.00 . A A .   3 SER HG   1 1 
       10  5625 1 1  3 SER N    N  -17.801  13.340   4.777 1.00 . A A .   3 SER N    1 1 
       10  5626 1 1  3 SER O    O  -15.667  15.149   4.778 1.00 . A A .   3 SER O    1 1 
       10  5627 1 1  3 SER OG   O  -14.533  11.926   3.789 1.00 . A A .   3 SER OG   1 1 
       10  5628 1 1  4 GLY C    C  -12.496  15.030   5.554 1.00 . A A .   4 GLY C    1 1 
       10  5629 1 1  4 GLY CA   C  -13.605  14.839   6.569 1.00 . A A .   4 GLY CA   1 1 
       10  5630 1 1  4 GLY H    H  -14.461  12.902   6.568 1.00 . A A .   4 GLY H    1 1 
       10  5631 1 1  4 GLY HA2  H  -14.142  15.769   6.679 1.00 . A A .   4 GLY HA2  1 1 
       10  5632 1 1  4 GLY HA3  H  -13.165  14.575   7.520 1.00 . A A .   4 GLY HA3  1 1 
       10  5633 1 1  4 GLY N    N  -14.540  13.799   6.181 1.00 . A A .   4 GLY N    1 1 
       10  5634 1 1  4 GLY O    O  -11.315  14.970   5.896 1.00 . A A .   4 GLY O    1 1 
       10  5635 1 1  5 SER C    C  -12.167  16.760   2.489 1.00 . A A .   5 SER C    1 1 
       10  5636 1 1  5 SER CA   C  -11.904  15.453   3.231 1.00 . A A .   5 SER CA   1 1 
       10  5637 1 1  5 SER CB   C  -11.951  14.279   2.251 1.00 . A A .   5 SER CB   1 1 
       10  5638 1 1  5 SER H    H  -13.832  15.295   4.090 1.00 . A A .   5 SER H    1 1 
       10  5639 1 1  5 SER HA   H  -10.922  15.498   3.678 1.00 . A A .   5 SER HA   1 1 
       10  5640 1 1  5 SER HB2  H  -11.254  14.457   1.446 1.00 . A A .   5 SER HB2  1 1 
       10  5641 1 1  5 SER HB3  H  -11.679  13.371   2.768 1.00 . A A .   5 SER HB3  1 1 
       10  5642 1 1  5 SER HG   H  -13.539  14.955   1.324 1.00 . A A .   5 SER HG   1 1 
       10  5643 1 1  5 SER N    N  -12.875  15.259   4.301 1.00 . A A .   5 SER N    1 1 
       10  5644 1 1  5 SER O    O  -12.845  16.779   1.462 1.00 . A A .   5 SER O    1 1 
       10  5645 1 1  5 SER OG   O  -13.249  14.123   1.704 1.00 . A A .   5 SER OG   1 1 
       10  5646 1 1  6 SER C    C  -10.562  19.571   1.618 1.00 . A A .   6 SER C    1 1 
       10  5647 1 1  6 SER CA   C  -11.802  19.166   2.410 1.00 . A A .   6 SER CA   1 1 
       10  5648 1 1  6 SER CB   C  -12.100  20.213   3.485 1.00 . A A .   6 SER CB   1 1 
       10  5649 1 1  6 SER H    H  -11.093  17.773   3.838 1.00 . A A .   6 SER H    1 1 
       10  5650 1 1  6 SER HA   H  -12.643  19.107   1.734 1.00 . A A .   6 SER HA   1 1 
       10  5651 1 1  6 SER HB2  H  -12.268  21.170   3.015 1.00 . A A .   6 SER HB2  1 1 
       10  5652 1 1  6 SER HB3  H  -12.984  19.921   4.033 1.00 . A A .   6 SER HB3  1 1 
       10  5653 1 1  6 SER HG   H  -11.081  19.646   5.059 1.00 . A A .   6 SER HG   1 1 
       10  5654 1 1  6 SER N    N  -11.624  17.853   3.018 1.00 . A A .   6 SER N    1 1 
       10  5655 1 1  6 SER O    O   -9.711  20.309   2.112 1.00 . A A .   6 SER O    1 1 
       10  5656 1 1  6 SER OG   O  -11.018  20.334   4.392 1.00 . A A .   6 SER OG   1 1 
       10  5657 1 1  7 GLY C    C   -8.079  18.647  -0.050 1.00 . A A .   7 GLY C    1 1 
       10  5658 1 1  7 GLY CA   C   -9.330  19.401  -0.455 1.00 . A A .   7 GLY CA   1 1 
       10  5659 1 1  7 GLY H    H  -11.178  18.497   0.045 1.00 . A A .   7 GLY H    1 1 
       10  5660 1 1  7 GLY HA2  H   -9.571  19.155  -1.478 1.00 . A A .   7 GLY HA2  1 1 
       10  5661 1 1  7 GLY HA3  H   -9.134  20.462  -0.387 1.00 . A A .   7 GLY HA3  1 1 
       10  5662 1 1  7 GLY N    N  -10.468  19.081   0.386 1.00 . A A .   7 GLY N    1 1 
       10  5663 1 1  7 GLY O    O   -7.182  19.209   0.580 1.00 . A A .   7 GLY O    1 1 
       10  5664 1 1  8 THR C    C   -6.740  15.365  -1.045 1.00 . A A .   8 THR C    1 1 
       10  5665 1 1  8 THR CA   C   -6.869  16.536  -0.077 1.00 . A A .   8 THR CA   1 1 
       10  5666 1 1  8 THR CB   C   -6.968  15.991   1.360 1.00 . A A .   8 THR CB   1 1 
       10  5667 1 1  8 THR CG2  C   -8.120  15.006   1.487 1.00 . A A .   8 THR CG2  1 1 
       10  5668 1 1  8 THR H    H   -8.764  16.978  -0.910 1.00 . A A .   8 THR H    1 1 
       10  5669 1 1  8 THR HA   H   -5.981  17.148  -0.148 1.00 . A A .   8 THR HA   1 1 
       10  5670 1 1  8 THR HB   H   -7.145  16.819   2.032 1.00 . A A .   8 THR HB   1 1 
       10  5671 1 1  8 THR HG1  H   -5.010  15.771   1.270 1.00 . A A .   8 THR HG1  1 1 
       10  5672 1 1  8 THR HG21 H   -8.976  15.383   0.947 1.00 . A A .   8 THR HG21 1 1 
       10  5673 1 1  8 THR HG22 H   -8.378  14.886   2.529 1.00 . A A .   8 THR HG22 1 1 
       10  5674 1 1  8 THR HG23 H   -7.826  14.052   1.077 1.00 . A A .   8 THR HG23 1 1 
       10  5675 1 1  8 THR N    N   -8.017  17.369  -0.410 1.00 . A A .   8 THR N    1 1 
       10  5676 1 1  8 THR O    O   -7.668  14.572  -1.202 1.00 . A A .   8 THR O    1 1 
       10  5677 1 1  8 THR OG1  O   -5.742  15.347   1.725 1.00 . A A .   8 THR OG1  1 1 
       10  5678 1 1  9 GLY C    C   -6.354  14.190  -3.776 1.00 . A A .   9 GLY C    1 1 
       10  5679 1 1  9 GLY CA   C   -5.355  14.184  -2.636 1.00 . A A .   9 GLY CA   1 1 
       10  5680 1 1  9 GLY H    H   -4.879  15.923  -1.526 1.00 . A A .   9 GLY H    1 1 
       10  5681 1 1  9 GLY HA2  H   -4.359  14.281  -3.043 1.00 . A A .   9 GLY HA2  1 1 
       10  5682 1 1  9 GLY HA3  H   -5.428  13.241  -2.113 1.00 . A A .   9 GLY HA3  1 1 
       10  5683 1 1  9 GLY N    N   -5.583  15.262  -1.692 1.00 . A A .   9 GLY N    1 1 
       10  5684 1 1  9 GLY O    O   -7.537  13.920  -3.573 1.00 . A A .   9 GLY O    1 1 
       10  5685 1 1 10 GLU C    C   -6.970  13.140  -6.709 1.00 . A A .  10 GLU C    1 1 
       10  5686 1 1 10 GLU CA   C   -6.740  14.542  -6.153 1.00 . A A .  10 GLU CA   1 1 
       10  5687 1 1 10 GLU CB   C   -6.125  15.436  -7.232 1.00 . A A .  10 GLU CB   1 1 
       10  5688 1 1 10 GLU CD   C   -4.595  17.113  -6.124 1.00 . A A .  10 GLU CD   1 1 
       10  5689 1 1 10 GLU CG   C   -5.936  16.878  -6.792 1.00 . A A .  10 GLU CG   1 1 
       10  5690 1 1 10 GLU H    H   -4.924  14.705  -5.075 1.00 . A A .  10 GLU H    1 1 
       10  5691 1 1 10 GLU HA   H   -7.689  14.958  -5.852 1.00 . A A .  10 GLU HA   1 1 
       10  5692 1 1 10 GLU HB2  H   -5.160  15.035  -7.507 1.00 . A A .  10 GLU HB2  1 1 
       10  5693 1 1 10 GLU HB3  H   -6.769  15.427  -8.099 1.00 . A A .  10 GLU HB3  1 1 
       10  5694 1 1 10 GLU HG2  H   -6.005  17.517  -7.660 1.00 . A A .  10 GLU HG2  1 1 
       10  5695 1 1 10 GLU HG3  H   -6.719  17.134  -6.095 1.00 . A A .  10 GLU HG3  1 1 
       10  5696 1 1 10 GLU N    N   -5.878  14.500  -4.977 1.00 . A A .  10 GLU N    1 1 
       10  5697 1 1 10 GLU O    O   -6.878  12.915  -7.916 1.00 . A A .  10 GLU O    1 1 
       10  5698 1 1 10 GLU OE1  O   -3.562  16.742  -6.719 1.00 . A A .  10 GLU OE1  1 1 
       10  5699 1 1 10 GLU OE2  O   -4.580  17.669  -5.005 1.00 . A A .  10 GLU OE2  1 1 
       10  5700 1 1 11 LYS C    C   -6.603  10.416  -7.373 1.00 . A A .  11 LYS C    1 1 
       10  5701 1 1 11 LYS CA   C   -7.516  10.818  -6.219 1.00 . A A .  11 LYS CA   1 1 
       10  5702 1 1 11 LYS CB   C   -8.980  10.636  -6.625 1.00 . A A .  11 LYS CB   1 1 
       10  5703 1 1 11 LYS CD   C  -10.924  11.462  -7.984 1.00 . A A .  11 LYS CD   1 1 
       10  5704 1 1 11 LYS CE   C  -11.239  10.151  -8.687 1.00 . A A .  11 LYS CE   1 1 
       10  5705 1 1 11 LYS CG   C   -9.437  11.602  -7.704 1.00 . A A .  11 LYS CG   1 1 
       10  5706 1 1 11 LYS H    H   -7.330  12.440  -4.871 1.00 . A A .  11 LYS H    1 1 
       10  5707 1 1 11 LYS HA   H   -7.304  10.185  -5.371 1.00 . A A .  11 LYS HA   1 1 
       10  5708 1 1 11 LYS HB2  H   -9.117   9.629  -6.991 1.00 . A A .  11 LYS HB2  1 1 
       10  5709 1 1 11 LYS HB3  H   -9.603  10.780  -5.754 1.00 . A A .  11 LYS HB3  1 1 
       10  5710 1 1 11 LYS HD2  H  -11.462  11.494  -7.048 1.00 . A A .  11 LYS HD2  1 1 
       10  5711 1 1 11 LYS HD3  H  -11.242  12.283  -8.612 1.00 . A A .  11 LYS HD3  1 1 
       10  5712 1 1 11 LYS HE2  H  -10.852  10.195  -9.693 1.00 . A A .  11 LYS HE2  1 1 
       10  5713 1 1 11 LYS HE3  H  -10.757   9.346  -8.151 1.00 . A A .  11 LYS HE3  1 1 
       10  5714 1 1 11 LYS HG2  H   -9.236  12.612  -7.379 1.00 . A A .  11 LYS HG2  1 1 
       10  5715 1 1 11 LYS HG3  H   -8.889  11.398  -8.613 1.00 . A A .  11 LYS HG3  1 1 
       10  5716 1 1 11 LYS HZ1  H  -12.886   8.972  -9.198 1.00 . A A .  11 LYS HZ1  1 1 
       10  5717 1 1 11 LYS HZ2  H  -13.180  10.635  -9.288 1.00 . A A .  11 LYS HZ2  1 1 
       10  5718 1 1 11 LYS HZ3  H  -13.100   9.871  -7.781 1.00 . A A .  11 LYS HZ3  1 1 
       10  5719 1 1 11 LYS N    N   -7.271  12.199  -5.820 1.00 . A A .  11 LYS N    1 1 
       10  5720 1 1 11 LYS NZ   N  -12.704   9.888  -8.742 1.00 . A A .  11 LYS NZ   1 1 
       10  5721 1 1 11 LYS O    O   -7.051   9.908  -8.402 1.00 . A A .  11 LYS O    1 1 
       10  5722 1 1 12 PRO C    C   -4.106   8.806  -8.376 1.00 . A A .  12 PRO C    1 1 
       10  5723 1 1 12 PRO CA   C   -4.290  10.312  -8.217 1.00 . A A .  12 PRO CA   1 1 
       10  5724 1 1 12 PRO CB   C   -3.010  10.953  -7.675 1.00 . A A .  12 PRO CB   1 1 
       10  5725 1 1 12 PRO CD   C   -4.690  11.247  -6.000 1.00 . A A .  12 PRO CD   1 1 
       10  5726 1 1 12 PRO CG   C   -3.216  11.025  -6.202 1.00 . A A .  12 PRO CG   1 1 
       10  5727 1 1 12 PRO HA   H   -4.536  10.747  -9.174 1.00 . A A .  12 PRO HA   1 1 
       10  5728 1 1 12 PRO HB2  H   -2.160  10.334  -7.927 1.00 . A A .  12 PRO HB2  1 1 
       10  5729 1 1 12 PRO HB3  H   -2.886  11.936  -8.105 1.00 . A A .  12 PRO HB3  1 1 
       10  5730 1 1 12 PRO HD2  H   -5.028  10.746  -5.105 1.00 . A A .  12 PRO HD2  1 1 
       10  5731 1 1 12 PRO HD3  H   -4.908  12.304  -5.948 1.00 . A A .  12 PRO HD3  1 1 
       10  5732 1 1 12 PRO HG2  H   -2.911  10.097  -5.743 1.00 . A A .  12 PRO HG2  1 1 
       10  5733 1 1 12 PRO HG3  H   -2.653  11.851  -5.793 1.00 . A A .  12 PRO HG3  1 1 
       10  5734 1 1 12 PRO N    N   -5.293  10.645  -7.200 1.00 . A A .  12 PRO N    1 1 
       10  5735 1 1 12 PRO O    O   -4.109   8.286  -9.492 1.00 . A A .  12 PRO O    1 1 
       10  5736 1 1 13 TYR C    C   -4.499   6.008  -6.113 1.00 . A A .  13 TYR C    1 1 
       10  5737 1 1 13 TYR CA   C   -3.757   6.667  -7.271 1.00 . A A .  13 TYR CA   1 1 
       10  5738 1 1 13 TYR CB   C   -2.268   6.324  -7.198 1.00 . A A .  13 TYR CB   1 1 
       10  5739 1 1 13 TYR CD1  C   -0.929   7.923  -8.623 1.00 . A A .  13 TYR CD1  1 1 
       10  5740 1 1 13 TYR CD2  C   -1.360   5.741  -9.482 1.00 . A A .  13 TYR CD2  1 1 
       10  5741 1 1 13 TYR CE1  C   -0.232   8.242  -9.772 1.00 . A A .  13 TYR CE1  1 1 
       10  5742 1 1 13 TYR CE2  C   -0.663   6.052 -10.633 1.00 . A A .  13 TYR CE2  1 1 
       10  5743 1 1 13 TYR CG   C   -1.505   6.669  -8.457 1.00 . A A .  13 TYR CG   1 1 
       10  5744 1 1 13 TYR CZ   C   -0.101   7.303 -10.774 1.00 . A A .  13 TYR CZ   1 1 
       10  5745 1 1 13 TYR H    H   -3.951   8.584  -6.396 1.00 . A A .  13 TYR H    1 1 
       10  5746 1 1 13 TYR HA   H   -4.157   6.291  -8.201 1.00 . A A .  13 TYR HA   1 1 
       10  5747 1 1 13 TYR HB2  H   -1.820   6.868  -6.381 1.00 . A A .  13 TYR HB2  1 1 
       10  5748 1 1 13 TYR HB3  H   -2.158   5.264  -7.023 1.00 . A A .  13 TYR HB3  1 1 
       10  5749 1 1 13 TYR HD1  H   -1.033   8.656  -7.837 1.00 . A A .  13 TYR HD1  1 1 
       10  5750 1 1 13 TYR HD2  H   -1.802   4.762  -9.368 1.00 . A A .  13 TYR HD2  1 1 
       10  5751 1 1 13 TYR HE1  H    0.209   9.222  -9.883 1.00 . A A .  13 TYR HE1  1 1 
       10  5752 1 1 13 TYR HE2  H   -0.561   5.317 -11.418 1.00 . A A .  13 TYR HE2  1 1 
       10  5753 1 1 13 TYR HH   H   -0.026   7.872 -12.609 1.00 . A A .  13 TYR HH   1 1 
       10  5754 1 1 13 TYR N    N   -3.945   8.113  -7.255 1.00 . A A .  13 TYR N    1 1 
       10  5755 1 1 13 TYR O    O   -4.483   6.504  -4.986 1.00 . A A .  13 TYR O    1 1 
       10  5756 1 1 13 TYR OH   O    0.593   7.617 -11.920 1.00 . A A .  13 TYR OH   1 1 
       10  5757 1 1 14 LYS C    C   -5.894   2.657  -5.675 1.00 . A A .  14 LYS C    1 1 
       10  5758 1 1 14 LYS CA   C   -5.898   4.154  -5.382 1.00 . A A .  14 LYS CA   1 1 
       10  5759 1 1 14 LYS CB   C   -7.338   4.667  -5.312 1.00 . A A .  14 LYS CB   1 1 
       10  5760 1 1 14 LYS CD   C   -9.419   4.952  -3.934 1.00 . A A .  14 LYS CD   1 1 
       10  5761 1 1 14 LYS CE   C  -10.179   4.492  -2.700 1.00 . A A .  14 LYS CE   1 1 
       10  5762 1 1 14 LYS CG   C   -8.059   4.280  -4.032 1.00 . A A .  14 LYS CG   1 1 
       10  5763 1 1 14 LYS H    H   -5.126   4.539  -7.315 1.00 . A A .  14 LYS H    1 1 
       10  5764 1 1 14 LYS HA   H   -5.417   4.324  -4.430 1.00 . A A .  14 LYS HA   1 1 
       10  5765 1 1 14 LYS HB2  H   -7.327   5.745  -5.382 1.00 . A A .  14 LYS HB2  1 1 
       10  5766 1 1 14 LYS HB3  H   -7.891   4.265  -6.148 1.00 . A A .  14 LYS HB3  1 1 
       10  5767 1 1 14 LYS HD2  H   -9.279   6.021  -3.879 1.00 . A A .  14 LYS HD2  1 1 
       10  5768 1 1 14 LYS HD3  H   -9.996   4.707  -4.814 1.00 . A A .  14 LYS HD3  1 1 
       10  5769 1 1 14 LYS HE2  H  -11.225   4.723  -2.831 1.00 . A A .  14 LYS HE2  1 1 
       10  5770 1 1 14 LYS HE3  H  -10.057   3.424  -2.595 1.00 . A A .  14 LYS HE3  1 1 
       10  5771 1 1 14 LYS HG2  H   -8.198   3.209  -4.018 1.00 . A A .  14 LYS HG2  1 1 
       10  5772 1 1 14 LYS HG3  H   -7.458   4.579  -3.186 1.00 . A A .  14 LYS HG3  1 1 
       10  5773 1 1 14 LYS HZ1  H   -9.114   5.992  -1.711 1.00 . A A .  14 LYS HZ1  1 1 
       10  5774 1 1 14 LYS HZ2  H   -9.102   4.502  -0.910 1.00 . A A .  14 LYS HZ2  1 1 
       10  5775 1 1 14 LYS HZ3  H  -10.490   5.467  -0.879 1.00 . A A .  14 LYS HZ3  1 1 
       10  5776 1 1 14 LYS N    N   -5.150   4.885  -6.398 1.00 . A A .  14 LYS N    1 1 
       10  5777 1 1 14 LYS NZ   N   -9.687   5.160  -1.463 1.00 . A A .  14 LYS NZ   1 1 
       10  5778 1 1 14 LYS O    O   -5.930   2.241  -6.833 1.00 . A A .  14 LYS O    1 1 
       10  5779 1 1 15 CYS C    C   -7.263  -0.157  -4.717 1.00 . A A .  15 CYS C    1 1 
       10  5780 1 1 15 CYS CA   C   -5.844   0.401  -4.762 1.00 . A A .  15 CYS CA   1 1 
       10  5781 1 1 15 CYS CB   C   -4.998  -0.237  -3.658 1.00 . A A .  15 CYS CB   1 1 
       10  5782 1 1 15 CYS H    H   -5.824   2.244  -3.720 1.00 . A A .  15 CYS H    1 1 
       10  5783 1 1 15 CYS HA   H   -5.407   0.165  -5.720 1.00 . A A .  15 CYS HA   1 1 
       10  5784 1 1 15 CYS HB2  H   -4.045   0.269  -3.608 1.00 . A A .  15 CYS HB2  1 1 
       10  5785 1 1 15 CYS HB3  H   -5.509  -0.125  -2.714 1.00 . A A .  15 CYS HB3  1 1 
       10  5786 1 1 15 CYS N    N   -5.851   1.852  -4.619 1.00 . A A .  15 CYS N    1 1 
       10  5787 1 1 15 CYS O    O   -7.958  -0.032  -3.710 1.00 . A A .  15 CYS O    1 1 
       10  5788 1 1 15 CYS SG   S   -4.669  -2.011  -3.906 1.00 . A A .  15 CYS SG   1 1 
       10  5789 1 1 16 ASN C    C   -9.027  -2.790  -5.396 1.00 . A A .  16 ASN C    1 1 
       10  5790 1 1 16 ASN CA   C   -9.022  -1.350  -5.903 1.00 . A A .  16 ASN CA   1 1 
       10  5791 1 1 16 ASN CB   C   -9.528  -1.304  -7.346 1.00 . A A .  16 ASN CB   1 1 
       10  5792 1 1 16 ASN CG   C   -9.094  -2.516  -8.150 1.00 . A A .  16 ASN CG   1 1 
       10  5793 1 1 16 ASN H    H   -7.085  -0.841  -6.588 1.00 . A A .  16 ASN H    1 1 
       10  5794 1 1 16 ASN HA   H   -9.679  -0.760  -5.282 1.00 . A A .  16 ASN HA   1 1 
       10  5795 1 1 16 ASN HB2  H  -10.607  -1.267  -7.342 1.00 . A A .  16 ASN HB2  1 1 
       10  5796 1 1 16 ASN HB3  H   -9.143  -0.419  -7.829 1.00 . A A .  16 ASN HB3  1 1 
       10  5797 1 1 16 ASN HD21 H   -7.215  -1.865  -8.162 1.00 . A A .  16 ASN HD21 1 1 
       10  5798 1 1 16 ASN HD22 H   -7.498  -3.360  -8.982 1.00 . A A .  16 ASN HD22 1 1 
       10  5799 1 1 16 ASN N    N   -7.686  -0.773  -5.816 1.00 . A A .  16 ASN N    1 1 
       10  5800 1 1 16 ASN ND2  N   -7.806  -2.588  -8.462 1.00 . A A .  16 ASN ND2  1 1 
       10  5801 1 1 16 ASN O    O   -9.873  -3.593  -5.788 1.00 . A A .  16 ASN O    1 1 
       10  5802 1 1 16 ASN OD1  O   -9.909  -3.376  -8.484 1.00 . A A .  16 ASN OD1  1 1 
       10  5803 1 1 17 GLU C    C   -8.278  -4.441  -2.468 1.00 . A A .  17 GLU C    1 1 
       10  5804 1 1 17 GLU CA   C   -7.971  -4.449  -3.963 1.00 . A A .  17 GLU CA   1 1 
       10  5805 1 1 17 GLU CB   C   -6.572  -5.019  -4.205 1.00 . A A .  17 GLU CB   1 1 
       10  5806 1 1 17 GLU CD   C   -6.639  -6.396  -6.322 1.00 . A A .  17 GLU CD   1 1 
       10  5807 1 1 17 GLU CG   C   -6.193  -5.099  -5.674 1.00 . A A .  17 GLU CG   1 1 
       10  5808 1 1 17 GLU H    H   -7.431  -2.423  -4.249 1.00 . A A .  17 GLU H    1 1 
       10  5809 1 1 17 GLU HA   H   -8.696  -5.074  -4.463 1.00 . A A .  17 GLU HA   1 1 
       10  5810 1 1 17 GLU HB2  H   -5.850  -4.393  -3.702 1.00 . A A .  17 GLU HB2  1 1 
       10  5811 1 1 17 GLU HB3  H   -6.525  -6.014  -3.788 1.00 . A A .  17 GLU HB3  1 1 
       10  5812 1 1 17 GLU HG2  H   -6.657  -4.276  -6.198 1.00 . A A .  17 GLU HG2  1 1 
       10  5813 1 1 17 GLU HG3  H   -5.120  -5.021  -5.761 1.00 . A A .  17 GLU HG3  1 1 
       10  5814 1 1 17 GLU N    N   -8.076  -3.107  -4.523 1.00 . A A .  17 GLU N    1 1 
       10  5815 1 1 17 GLU O    O   -9.010  -5.295  -1.968 1.00 . A A .  17 GLU O    1 1 
       10  5816 1 1 17 GLU OE1  O   -7.764  -6.850  -6.026 1.00 . A A .  17 GLU OE1  1 1 
       10  5817 1 1 17 GLU OE2  O   -5.863  -6.957  -7.123 1.00 . A A .  17 GLU OE2  1 1 
       10  5818 1 1 18 CYS C    C   -8.611  -2.031   0.018 1.00 . A A .  18 CYS C    1 1 
       10  5819 1 1 18 CYS CA   C   -7.920  -3.349  -0.322 1.00 . A A .  18 CYS CA   1 1 
       10  5820 1 1 18 CYS CB   C   -6.585  -3.444   0.419 1.00 . A A .  18 CYS CB   1 1 
       10  5821 1 1 18 CYS H    H   -7.136  -2.818  -2.215 1.00 . A A .  18 CYS H    1 1 
       10  5822 1 1 18 CYS HA   H   -8.554  -4.164  -0.009 1.00 . A A .  18 CYS HA   1 1 
       10  5823 1 1 18 CYS HB2  H   -6.761  -3.325   1.479 1.00 . A A .  18 CYS HB2  1 1 
       10  5824 1 1 18 CYS HB3  H   -6.150  -4.415   0.239 1.00 . A A .  18 CYS HB3  1 1 
       10  5825 1 1 18 CYS N    N   -7.711  -3.470  -1.760 1.00 . A A .  18 CYS N    1 1 
       10  5826 1 1 18 CYS O    O   -9.565  -2.000   0.795 1.00 . A A .  18 CYS O    1 1 
       10  5827 1 1 18 CYS SG   S   -5.366  -2.187  -0.082 1.00 . A A .  18 CYS SG   1 1 
       10  5828 1 1 19 GLY C    C   -7.665   1.392   0.077 1.00 . A A .  19 GLY C    1 1 
       10  5829 1 1 19 GLY CA   C   -8.704   0.361  -0.318 1.00 . A A .  19 GLY CA   1 1 
       10  5830 1 1 19 GLY H    H   -7.360  -1.029  -1.181 1.00 . A A .  19 GLY H    1 1 
       10  5831 1 1 19 GLY HA2  H   -9.208   0.698  -1.212 1.00 . A A .  19 GLY HA2  1 1 
       10  5832 1 1 19 GLY HA3  H   -9.427   0.272   0.479 1.00 . A A .  19 GLY HA3  1 1 
       10  5833 1 1 19 GLY N    N   -8.122  -0.944  -0.570 1.00 . A A .  19 GLY N    1 1 
       10  5834 1 1 19 GLY O    O   -7.943   2.293   0.869 1.00 . A A .  19 GLY O    1 1 
       10  5835 1 1 20 LYS C    C   -5.360   3.343  -1.169 1.00 . A A .  20 LYS C    1 1 
       10  5836 1 1 20 LYS CA   C   -5.378   2.187  -0.174 1.00 . A A .  20 LYS CA   1 1 
       10  5837 1 1 20 LYS CB   C   -4.034   1.456  -0.201 1.00 . A A .  20 LYS CB   1 1 
       10  5838 1 1 20 LYS CD   C   -2.905   1.823   2.013 1.00 . A A .  20 LYS CD   1 1 
       10  5839 1 1 20 LYS CE   C   -3.861   2.662   2.846 1.00 . A A .  20 LYS CE   1 1 
       10  5840 1 1 20 LYS CG   C   -3.652   0.836   1.132 1.00 . A A .  20 LYS CG   1 1 
       10  5841 1 1 20 LYS H    H   -6.302   0.522  -1.098 1.00 . A A .  20 LYS H    1 1 
       10  5842 1 1 20 LYS HA   H   -5.543   2.583   0.816 1.00 . A A .  20 LYS HA   1 1 
       10  5843 1 1 20 LYS HB2  H   -4.079   0.670  -0.940 1.00 . A A .  20 LYS HB2  1 1 
       10  5844 1 1 20 LYS HB3  H   -3.261   2.158  -0.481 1.00 . A A .  20 LYS HB3  1 1 
       10  5845 1 1 20 LYS HD2  H   -2.251   1.277   2.677 1.00 . A A .  20 LYS HD2  1 1 
       10  5846 1 1 20 LYS HD3  H   -2.317   2.478   1.386 1.00 . A A .  20 LYS HD3  1 1 
       10  5847 1 1 20 LYS HE2  H   -4.125   3.546   2.287 1.00 . A A .  20 LYS HE2  1 1 
       10  5848 1 1 20 LYS HE3  H   -4.750   2.081   3.043 1.00 . A A .  20 LYS HE3  1 1 
       10  5849 1 1 20 LYS HG2  H   -4.550   0.523   1.644 1.00 . A A .  20 LYS HG2  1 1 
       10  5850 1 1 20 LYS HG3  H   -3.021  -0.022   0.952 1.00 . A A .  20 LYS HG3  1 1 
       10  5851 1 1 20 LYS HZ1  H   -3.857   3.776   4.614 1.00 . A A .  20 LYS HZ1  1 1 
       10  5852 1 1 20 LYS HZ2  H   -2.315   3.490   3.981 1.00 . A A .  20 LYS HZ2  1 1 
       10  5853 1 1 20 LYS HZ3  H   -3.150   2.247   4.766 1.00 . A A .  20 LYS HZ3  1 1 
       10  5854 1 1 20 LYS N    N   -6.463   1.260  -0.474 1.00 . A A .  20 LYS N    1 1 
       10  5855 1 1 20 LYS NZ   N   -3.254   3.072   4.143 1.00 . A A .  20 LYS NZ   1 1 
       10  5856 1 1 20 LYS O    O   -5.967   3.265  -2.237 1.00 . A A .  20 LYS O    1 1 
       10  5857 1 1 21 ALA C    C   -3.189   6.244  -1.549 1.00 . A A .  21 ALA C    1 1 
       10  5858 1 1 21 ALA CA   C   -4.558   5.584  -1.676 1.00 . A A .  21 ALA CA   1 1 
       10  5859 1 1 21 ALA CB   C   -5.659   6.580  -1.345 1.00 . A A .  21 ALA CB   1 1 
       10  5860 1 1 21 ALA H    H   -4.196   4.416   0.051 1.00 . A A .  21 ALA H    1 1 
       10  5861 1 1 21 ALA HA   H   -4.696   5.258  -2.697 1.00 . A A .  21 ALA HA   1 1 
       10  5862 1 1 21 ALA HB1  H   -6.499   6.057  -0.911 1.00 . A A .  21 ALA HB1  1 1 
       10  5863 1 1 21 ALA HB2  H   -5.285   7.308  -0.640 1.00 . A A .  21 ALA HB2  1 1 
       10  5864 1 1 21 ALA HB3  H   -5.975   7.081  -2.248 1.00 . A A .  21 ALA HB3  1 1 
       10  5865 1 1 21 ALA N    N   -4.658   4.414  -0.813 1.00 . A A .  21 ALA N    1 1 
       10  5866 1 1 21 ALA O    O   -2.732   6.541  -0.446 1.00 . A A .  21 ALA O    1 1 
       10  5867 1 1 22 PHE C    C   -1.228   8.358  -3.558 1.00 . A A .  22 PHE C    1 1 
       10  5868 1 1 22 PHE CA   C   -1.221   7.095  -2.702 1.00 . A A .  22 PHE CA   1 1 
       10  5869 1 1 22 PHE CB   C   -0.175   6.112  -3.232 1.00 . A A .  22 PHE CB   1 1 
       10  5870 1 1 22 PHE CD1  C   -1.403   3.956  -2.860 1.00 . A A .  22 PHE CD1  1 1 
       10  5871 1 1 22 PHE CD2  C    0.734   4.233  -1.839 1.00 . A A .  22 PHE CD2  1 1 
       10  5872 1 1 22 PHE CE1  C   -1.506   2.693  -2.308 1.00 . A A .  22 PHE CE1  1 1 
       10  5873 1 1 22 PHE CE2  C    0.637   2.971  -1.285 1.00 . A A .  22 PHE CE2  1 1 
       10  5874 1 1 22 PHE CG   C   -0.284   4.740  -2.631 1.00 . A A .  22 PHE CG   1 1 
       10  5875 1 1 22 PHE CZ   C   -0.484   2.199  -1.521 1.00 . A A .  22 PHE CZ   1 1 
       10  5876 1 1 22 PHE H    H   -2.956   6.212  -3.535 1.00 . A A .  22 PHE H    1 1 
       10  5877 1 1 22 PHE HA   H   -0.970   7.363  -1.687 1.00 . A A .  22 PHE HA   1 1 
       10  5878 1 1 22 PHE HB2  H   -0.290   6.016  -4.301 1.00 . A A .  22 PHE HB2  1 1 
       10  5879 1 1 22 PHE HB3  H    0.811   6.495  -3.012 1.00 . A A .  22 PHE HB3  1 1 
       10  5880 1 1 22 PHE HD1  H   -2.202   4.340  -3.477 1.00 . A A .  22 PHE HD1  1 1 
       10  5881 1 1 22 PHE HD2  H    1.612   4.836  -1.654 1.00 . A A .  22 PHE HD2  1 1 
       10  5882 1 1 22 PHE HE1  H   -2.383   2.092  -2.494 1.00 . A A .  22 PHE HE1  1 1 
       10  5883 1 1 22 PHE HE2  H    1.438   2.588  -0.670 1.00 . A A .  22 PHE HE2  1 1 
       10  5884 1 1 22 PHE HZ   H   -0.562   1.213  -1.088 1.00 . A A .  22 PHE HZ   1 1 
       10  5885 1 1 22 PHE N    N   -2.539   6.471  -2.686 1.00 . A A .  22 PHE N    1 1 
       10  5886 1 1 22 PHE O    O   -2.217   8.665  -4.223 1.00 . A A .  22 PHE O    1 1 
       10  5887 1 1 23 ARG C    C    0.445  10.022  -5.736 1.00 . A A .  23 ARG C    1 1 
       10  5888 1 1 23 ARG CA   C    0.005  10.318  -4.306 1.00 . A A .  23 ARG CA   1 1 
       10  5889 1 1 23 ARG CB   C    1.005  11.266  -3.639 1.00 . A A .  23 ARG CB   1 1 
       10  5890 1 1 23 ARG CD   C    2.046  12.735  -5.392 1.00 . A A .  23 ARG CD   1 1 
       10  5891 1 1 23 ARG CG   C    1.035  12.653  -4.259 1.00 . A A .  23 ARG CG   1 1 
       10  5892 1 1 23 ARG CZ   C    4.456  13.177  -5.600 1.00 . A A .  23 ARG CZ   1 1 
       10  5893 1 1 23 ARG H    H    0.638   8.791  -2.984 1.00 . A A .  23 ARG H    1 1 
       10  5894 1 1 23 ARG HA   H   -0.965  10.792  -4.331 1.00 . A A .  23 ARG HA   1 1 
       10  5895 1 1 23 ARG HB2  H    0.746  11.368  -2.596 1.00 . A A .  23 ARG HB2  1 1 
       10  5896 1 1 23 ARG HB3  H    1.993  10.839  -3.717 1.00 . A A .  23 ARG HB3  1 1 
       10  5897 1 1 23 ARG HD2  H    1.902  11.890  -6.048 1.00 . A A .  23 ARG HD2  1 1 
       10  5898 1 1 23 ARG HD3  H    1.877  13.650  -5.941 1.00 . A A .  23 ARG HD3  1 1 
       10  5899 1 1 23 ARG HE   H    3.580  12.360  -4.005 1.00 . A A .  23 ARG HE   1 1 
       10  5900 1 1 23 ARG HG2  H    0.055  12.885  -4.649 1.00 . A A .  23 ARG HG2  1 1 
       10  5901 1 1 23 ARG HG3  H    1.300  13.372  -3.498 1.00 . A A .  23 ARG HG3  1 1 
       10  5902 1 1 23 ARG HH11 H    3.352  13.710  -7.206 1.00 . A A .  23 ARG HH11 1 1 
       10  5903 1 1 23 ARG HH12 H    5.052  14.016  -7.339 1.00 . A A .  23 ARG HH12 1 1 
       10  5904 1 1 23 ARG HH21 H    5.820  12.758  -4.168 1.00 . A A .  23 ARG HH21 1 1 
       10  5905 1 1 23 ARG HH22 H    6.455  13.473  -5.611 1.00 . A A .  23 ARG HH22 1 1 
       10  5906 1 1 23 ARG N    N   -0.117   9.088  -3.534 1.00 . A A .  23 ARG N    1 1 
       10  5907 1 1 23 ARG NE   N    3.421  12.724  -4.900 1.00 . A A .  23 ARG NE   1 1 
       10  5908 1 1 23 ARG NH1  N    4.272  13.675  -6.815 1.00 . A A .  23 ARG NH1  1 1 
       10  5909 1 1 23 ARG NH2  N    5.677  13.132  -5.084 1.00 . A A .  23 ARG NH2  1 1 
       10  5910 1 1 23 ARG O    O   -0.008  10.666  -6.682 1.00 . A A .  23 ARG O    1 1 
       10  5911 1 1 24 ALA C    C    1.868   7.144  -7.354 1.00 . A A .  24 ALA C    1 1 
       10  5912 1 1 24 ALA CA   C    1.832   8.661  -7.201 1.00 . A A .  24 ALA CA   1 1 
       10  5913 1 1 24 ALA CB   C    3.216   9.250  -7.431 1.00 . A A .  24 ALA CB   1 1 
       10  5914 1 1 24 ALA H    H    1.657   8.567  -5.094 1.00 . A A .  24 ALA H    1 1 
       10  5915 1 1 24 ALA HA   H    1.165   9.072  -7.945 1.00 . A A .  24 ALA HA   1 1 
       10  5916 1 1 24 ALA HB1  H    3.160  10.327  -7.393 1.00 . A A .  24 ALA HB1  1 1 
       10  5917 1 1 24 ALA HB2  H    3.889   8.897  -6.662 1.00 . A A .  24 ALA HB2  1 1 
       10  5918 1 1 24 ALA HB3  H    3.582   8.941  -8.399 1.00 . A A .  24 ALA HB3  1 1 
       10  5919 1 1 24 ALA N    N    1.332   9.044  -5.886 1.00 . A A .  24 ALA N    1 1 
       10  5920 1 1 24 ALA O    O    1.698   6.408  -6.382 1.00 . A A .  24 ALA O    1 1 
       10  5921 1 1 25 ARG C    C    3.292   4.595  -8.100 1.00 . A A .  25 ARG C    1 1 
       10  5922 1 1 25 ARG CA   C    2.146   5.254  -8.862 1.00 . A A .  25 ARG CA   1 1 
       10  5923 1 1 25 ARG CB   C    2.312   5.013 -10.363 1.00 . A A .  25 ARG CB   1 1 
       10  5924 1 1 25 ARG CD   C    2.069   3.438 -12.306 1.00 . A A .  25 ARG CD   1 1 
       10  5925 1 1 25 ARG CG   C    1.895   3.620 -10.807 1.00 . A A .  25 ARG CG   1 1 
       10  5926 1 1 25 ARG CZ   C    3.926   3.086 -13.878 1.00 . A A .  25 ARG CZ   1 1 
       10  5927 1 1 25 ARG H    H    2.217   7.320  -9.315 1.00 . A A .  25 ARG H    1 1 
       10  5928 1 1 25 ARG HA   H    1.214   4.815  -8.536 1.00 . A A .  25 ARG HA   1 1 
       10  5929 1 1 25 ARG HB2  H    1.711   5.733 -10.900 1.00 . A A .  25 ARG HB2  1 1 
       10  5930 1 1 25 ARG HB3  H    3.349   5.155 -10.626 1.00 . A A .  25 ARG HB3  1 1 
       10  5931 1 1 25 ARG HD2  H    1.681   2.469 -12.585 1.00 . A A .  25 ARG HD2  1 1 
       10  5932 1 1 25 ARG HD3  H    1.511   4.209 -12.816 1.00 . A A .  25 ARG HD3  1 1 
       10  5933 1 1 25 ARG HE   H    4.101   3.920 -12.075 1.00 . A A .  25 ARG HE   1 1 
       10  5934 1 1 25 ARG HG2  H    2.504   2.891 -10.293 1.00 . A A .  25 ARG HG2  1 1 
       10  5935 1 1 25 ARG HG3  H    0.856   3.468 -10.552 1.00 . A A .  25 ARG HG3  1 1 
       10  5936 1 1 25 ARG HH11 H    2.123   2.456 -14.538 1.00 . A A .  25 ARG HH11 1 1 
       10  5937 1 1 25 ARG HH12 H    3.441   2.214 -15.636 1.00 . A A .  25 ARG HH12 1 1 
       10  5938 1 1 25 ARG HH21 H    5.844   3.607 -13.513 1.00 . A A .  25 ARG HH21 1 1 
       10  5939 1 1 25 ARG HH22 H    5.557   2.868 -15.052 1.00 . A A .  25 ARG HH22 1 1 
       10  5940 1 1 25 ARG N    N    2.090   6.683  -8.581 1.00 . A A .  25 ARG N    1 1 
       10  5941 1 1 25 ARG NE   N    3.470   3.521 -12.709 1.00 . A A .  25 ARG NE   1 1 
       10  5942 1 1 25 ARG NH1  N    3.095   2.540 -14.756 1.00 . A A .  25 ARG NH1  1 1 
       10  5943 1 1 25 ARG NH2  N    5.215   3.196 -14.172 1.00 . A A .  25 ARG NH2  1 1 
       10  5944 1 1 25 ARG O    O    3.082   3.659  -7.329 1.00 . A A .  25 ARG O    1 1 
       10  5945 1 1 26 SER C    C    5.385   4.207  -6.206 1.00 . A A .  26 SER C    1 1 
       10  5946 1 1 26 SER CA   C    5.686   4.546  -7.662 1.00 . A A .  26 SER CA   1 1 
       10  5947 1 1 26 SER CB   C    6.843   5.545  -7.737 1.00 . A A .  26 SER CB   1 1 
       10  5948 1 1 26 SER H    H    4.609   5.836  -8.950 1.00 . A A .  26 SER H    1 1 
       10  5949 1 1 26 SER HA   H    5.969   3.642  -8.180 1.00 . A A .  26 SER HA   1 1 
       10  5950 1 1 26 SER HB2  H    6.465   6.543  -7.576 1.00 . A A .  26 SER HB2  1 1 
       10  5951 1 1 26 SER HB3  H    7.569   5.308  -6.973 1.00 . A A .  26 SER HB3  1 1 
       10  5952 1 1 26 SER HG   H    8.079   4.747  -9.030 1.00 . A A .  26 SER HG   1 1 
       10  5953 1 1 26 SER N    N    4.506   5.090  -8.324 1.00 . A A .  26 SER N    1 1 
       10  5954 1 1 26 SER O    O    5.889   3.220  -5.670 1.00 . A A .  26 SER O    1 1 
       10  5955 1 1 26 SER OG   O    7.479   5.496  -9.002 1.00 . A A .  26 SER OG   1 1 
       10  5956 1 1 27 SER C    C    3.242   3.640  -4.034 1.00 . A A .  27 SER C    1 1 
       10  5957 1 1 27 SER CA   C    4.194   4.824  -4.175 1.00 . A A .  27 SER CA   1 1 
       10  5958 1 1 27 SER CB   C    3.545   6.086  -3.601 1.00 . A A .  27 SER CB   1 1 
       10  5959 1 1 27 SER H    H    4.191   5.803  -6.052 1.00 . A A .  27 SER H    1 1 
       10  5960 1 1 27 SER HA   H    5.098   4.612  -3.623 1.00 . A A .  27 SER HA   1 1 
       10  5961 1 1 27 SER HB2  H    4.121   6.949  -3.896 1.00 . A A .  27 SER HB2  1 1 
       10  5962 1 1 27 SER HB3  H    2.539   6.176  -3.985 1.00 . A A .  27 SER HB3  1 1 
       10  5963 1 1 27 SER HG   H    4.362   6.219  -1.826 1.00 . A A .  27 SER HG   1 1 
       10  5964 1 1 27 SER N    N    4.560   5.033  -5.571 1.00 . A A .  27 SER N    1 1 
       10  5965 1 1 27 SER O    O    3.337   2.862  -3.084 1.00 . A A .  27 SER O    1 1 
       10  5966 1 1 27 SER OG   O    3.492   6.033  -2.186 1.00 . A A .  27 SER OG   1 1 
       10  5967 1 1 28 LEU C    C    2.040   1.078  -5.201 1.00 . A A .  28 LEU C    1 1 
       10  5968 1 1 28 LEU CA   C    1.355   2.421  -4.971 1.00 . A A .  28 LEU CA   1 1 
       10  5969 1 1 28 LEU CB   C    0.284   2.651  -6.039 1.00 . A A .  28 LEU CB   1 1 
       10  5970 1 1 28 LEU CD1  C   -1.730   1.419  -5.196 1.00 . A A .  28 LEU CD1  1 1 
       10  5971 1 1 28 LEU CD2  C   -1.328   1.618  -7.657 1.00 . A A .  28 LEU CD2  1 1 
       10  5972 1 1 28 LEU CG   C   -0.674   1.486  -6.289 1.00 . A A .  28 LEU CG   1 1 
       10  5973 1 1 28 LEU H    H    2.300   4.161  -5.718 1.00 . A A .  28 LEU H    1 1 
       10  5974 1 1 28 LEU HA   H    0.885   2.410  -3.998 1.00 . A A .  28 LEU HA   1 1 
       10  5975 1 1 28 LEU HB2  H   -0.304   3.504  -5.739 1.00 . A A .  28 LEU HB2  1 1 
       10  5976 1 1 28 LEU HB3  H    0.788   2.872  -6.969 1.00 . A A .  28 LEU HB3  1 1 
       10  5977 1 1 28 LEU HD11 H   -1.735   2.346  -4.643 1.00 . A A .  28 LEU HD11 1 1 
       10  5978 1 1 28 LEU HD12 H   -1.504   0.602  -4.528 1.00 . A A .  28 LEU HD12 1 1 
       10  5979 1 1 28 LEU HD13 H   -2.701   1.260  -5.643 1.00 . A A .  28 LEU HD13 1 1 
       10  5980 1 1 28 LEU HD21 H   -0.634   1.298  -8.420 1.00 . A A .  28 LEU HD21 1 1 
       10  5981 1 1 28 LEU HD22 H   -1.601   2.649  -7.827 1.00 . A A .  28 LEU HD22 1 1 
       10  5982 1 1 28 LEU HD23 H   -2.214   1.000  -7.694 1.00 . A A .  28 LEU HD23 1 1 
       10  5983 1 1 28 LEU HG   H   -0.117   0.559  -6.272 1.00 . A A .  28 LEU HG   1 1 
       10  5984 1 1 28 LEU N    N    2.325   3.510  -4.987 1.00 . A A .  28 LEU N    1 1 
       10  5985 1 1 28 LEU O    O    1.674   0.072  -4.595 1.00 . A A .  28 LEU O    1 1 
       10  5986 1 1 29 ALA C    C    4.275  -0.822  -5.115 1.00 . A A .  29 ALA C    1 1 
       10  5987 1 1 29 ALA CA   C    3.776  -0.147  -6.388 1.00 . A A .  29 ALA CA   1 1 
       10  5988 1 1 29 ALA CB   C    4.942   0.163  -7.314 1.00 . A A .  29 ALA CB   1 1 
       10  5989 1 1 29 ALA H    H    3.282   1.906  -6.532 1.00 . A A .  29 ALA H    1 1 
       10  5990 1 1 29 ALA HA   H    3.108  -0.822  -6.903 1.00 . A A .  29 ALA HA   1 1 
       10  5991 1 1 29 ALA HB1  H    4.604   0.131  -8.340 1.00 . A A .  29 ALA HB1  1 1 
       10  5992 1 1 29 ALA HB2  H    5.326   1.148  -7.092 1.00 . A A .  29 ALA HB2  1 1 
       10  5993 1 1 29 ALA HB3  H    5.722  -0.570  -7.169 1.00 . A A .  29 ALA HB3  1 1 
       10  5994 1 1 29 ALA N    N    3.037   1.071  -6.080 1.00 . A A .  29 ALA N    1 1 
       10  5995 1 1 29 ALA O    O    3.967  -1.987  -4.857 1.00 . A A .  29 ALA O    1 1 
       10  5996 1 1 30 ILE C    C    4.540  -1.432  -2.327 1.00 . A A .  30 ILE C    1 1 
       10  5997 1 1 30 ILE CA   C    5.586  -0.614  -3.076 1.00 . A A .  30 ILE CA   1 1 
       10  5998 1 1 30 ILE CB   C    6.093   0.515  -2.159 1.00 . A A .  30 ILE CB   1 1 
       10  5999 1 1 30 ILE CD1  C    7.211   2.785  -2.433 1.00 . A A .  30 ILE CD1  1 1 
       10  6000 1 1 30 ILE CG1  C    7.167   1.338  -2.872 1.00 . A A .  30 ILE CG1  1 1 
       10  6001 1 1 30 ILE CG2  C    6.636  -0.062  -0.860 1.00 . A A .  30 ILE CG2  1 1 
       10  6002 1 1 30 ILE H    H    5.255   0.836  -4.582 1.00 . A A .  30 ILE H    1 1 
       10  6003 1 1 30 ILE HA   H    6.422  -1.254  -3.321 1.00 . A A .  30 ILE HA   1 1 
       10  6004 1 1 30 ILE HB   H    5.259   1.156  -1.919 1.00 . A A .  30 ILE HB   1 1 
       10  6005 1 1 30 ILE HD11 H    7.882   2.885  -1.592 1.00 . A A .  30 ILE HD11 1 1 
       10  6006 1 1 30 ILE HD12 H    7.564   3.399  -3.249 1.00 . A A .  30 ILE HD12 1 1 
       10  6007 1 1 30 ILE HD13 H    6.221   3.103  -2.143 1.00 . A A .  30 ILE HD13 1 1 
       10  6008 1 1 30 ILE HG12 H    8.135   0.903  -2.676 1.00 . A A .  30 ILE HG12 1 1 
       10  6009 1 1 30 ILE HG13 H    6.978   1.319  -3.936 1.00 . A A .  30 ILE HG13 1 1 
       10  6010 1 1 30 ILE HG21 H    6.253  -1.063  -0.723 1.00 . A A .  30 ILE HG21 1 1 
       10  6011 1 1 30 ILE HG22 H    7.714  -0.094  -0.903 1.00 . A A .  30 ILE HG22 1 1 
       10  6012 1 1 30 ILE HG23 H    6.326   0.559  -0.033 1.00 . A A .  30 ILE HG23 1 1 
       10  6013 1 1 30 ILE N    N    5.046  -0.085  -4.322 1.00 . A A .  30 ILE N    1 1 
       10  6014 1 1 30 ILE O    O    4.854  -2.461  -1.727 1.00 . A A .  30 ILE O    1 1 
       10  6015 1 1 31 HIS C    C    1.804  -2.921  -2.454 1.00 . A A .  31 HIS C    1 1 
       10  6016 1 1 31 HIS CA   C    2.201  -1.659  -1.692 1.00 . A A .  31 HIS CA   1 1 
       10  6017 1 1 31 HIS CB   C    0.993  -0.732  -1.553 1.00 . A A .  31 HIS CB   1 1 
       10  6018 1 1 31 HIS CD2  C   -1.376  -1.596  -2.157 1.00 . A A .  31 HIS CD2  1 1 
       10  6019 1 1 31 HIS CE1  C   -1.801  -2.687  -0.303 1.00 . A A .  31 HIS CE1  1 1 
       10  6020 1 1 31 HIS CG   C   -0.300  -1.459  -1.348 1.00 . A A .  31 HIS CG   1 1 
       10  6021 1 1 31 HIS H    H    3.108  -0.144  -2.860 1.00 . A A .  31 HIS H    1 1 
       10  6022 1 1 31 HIS HA   H    2.543  -1.941  -0.708 1.00 . A A .  31 HIS HA   1 1 
       10  6023 1 1 31 HIS HB2  H    1.145  -0.080  -0.706 1.00 . A A .  31 HIS HB2  1 1 
       10  6024 1 1 31 HIS HB3  H    0.901  -0.135  -2.449 1.00 . A A .  31 HIS HB3  1 1 
       10  6025 1 1 31 HIS HD1  H   -0.014  -2.242   0.587 1.00 . A A .  31 HIS HD1  1 1 
       10  6026 1 1 31 HIS HD2  H   -1.492  -1.180  -3.148 1.00 . A A .  31 HIS HD2  1 1 
       10  6027 1 1 31 HIS HE1  H   -2.298  -3.286   0.446 1.00 . A A .  31 HIS HE1  1 1 
       10  6028 1 1 31 HIS N    N    3.295  -0.969  -2.366 1.00 . A A .  31 HIS N    1 1 
       10  6029 1 1 31 HIS ND1  N   -0.598  -2.153  -0.194 1.00 . A A .  31 HIS ND1  1 1 
       10  6030 1 1 31 HIS NE2  N   -2.296  -2.364  -1.485 1.00 . A A .  31 HIS NE2  1 1 
       10  6031 1 1 31 HIS O    O    1.504  -3.951  -1.851 1.00 . A A .  31 HIS O    1 1 
       10  6032 1 1 32 GLN C    C    2.263  -5.196  -4.259 1.00 . A A .  32 GLN C    1 1 
       10  6033 1 1 32 GLN CA   C    1.442  -3.964  -4.622 1.00 . A A .  32 GLN CA   1 1 
       10  6034 1 1 32 GLN CB   C    1.647  -3.616  -6.097 1.00 . A A .  32 GLN CB   1 1 
       10  6035 1 1 32 GLN CD   C   -0.688  -2.779  -6.576 1.00 . A A .  32 GLN CD   1 1 
       10  6036 1 1 32 GLN CG   C    0.793  -2.452  -6.573 1.00 . A A .  32 GLN CG   1 1 
       10  6037 1 1 32 GLN H    H    2.052  -1.982  -4.201 1.00 . A A .  32 GLN H    1 1 
       10  6038 1 1 32 GLN HA   H    0.398  -4.181  -4.455 1.00 . A A .  32 GLN HA   1 1 
       10  6039 1 1 32 GLN HB2  H    2.685  -3.361  -6.254 1.00 . A A .  32 GLN HB2  1 1 
       10  6040 1 1 32 GLN HB3  H    1.403  -4.482  -6.696 1.00 . A A .  32 GLN HB3  1 1 
       10  6041 1 1 32 GLN HE21 H   -1.085  -1.100  -5.587 1.00 . A A .  32 GLN HE21 1 1 
       10  6042 1 1 32 GLN HE22 H   -2.450  -2.085  -5.973 1.00 . A A .  32 GLN HE22 1 1 
       10  6043 1 1 32 GLN HG2  H    0.958  -1.610  -5.918 1.00 . A A .  32 GLN HG2  1 1 
       10  6044 1 1 32 GLN HG3  H    1.091  -2.191  -7.577 1.00 . A A .  32 GLN HG3  1 1 
       10  6045 1 1 32 GLN N    N    1.804  -2.830  -3.780 1.00 . A A .  32 GLN N    1 1 
       10  6046 1 1 32 GLN NE2  N   -1.489  -1.900  -5.985 1.00 . A A .  32 GLN NE2  1 1 
       10  6047 1 1 32 GLN O    O    1.921  -6.316  -4.637 1.00 . A A .  32 GLN O    1 1 
       10  6048 1 1 32 GLN OE1  O   -1.107  -3.809  -7.103 1.00 . A A .  32 GLN OE1  1 1 
       10  6049 1 1 33 ALA C    C    3.654  -6.791  -1.884 1.00 . A A .  33 ALA C    1 1 
       10  6050 1 1 33 ALA CA   C    4.218  -6.076  -3.107 1.00 . A A .  33 ALA CA   1 1 
       10  6051 1 1 33 ALA CB   C    5.618  -5.556  -2.817 1.00 . A A .  33 ALA CB   1 1 
       10  6052 1 1 33 ALA H    H    3.569  -4.066  -3.252 1.00 . A A .  33 ALA H    1 1 
       10  6053 1 1 33 ALA HA   H    4.284  -6.779  -3.924 1.00 . A A .  33 ALA HA   1 1 
       10  6054 1 1 33 ALA HB1  H    5.890  -4.820  -3.559 1.00 . A A .  33 ALA HB1  1 1 
       10  6055 1 1 33 ALA HB2  H    5.637  -5.102  -1.836 1.00 . A A .  33 ALA HB2  1 1 
       10  6056 1 1 33 ALA HB3  H    6.320  -6.376  -2.848 1.00 . A A .  33 ALA HB3  1 1 
       10  6057 1 1 33 ALA N    N    3.349  -4.982  -3.523 1.00 . A A .  33 ALA N    1 1 
       10  6058 1 1 33 ALA O    O    4.316  -7.642  -1.288 1.00 . A A .  33 ALA O    1 1 
       10  6059 1 1 34 THR C    C    0.632  -7.962  -0.793 1.00 . A A .  34 THR C    1 1 
       10  6060 1 1 34 THR CA   C    1.773  -7.048  -0.361 1.00 . A A .  34 THR CA   1 1 
       10  6061 1 1 34 THR CB   C    1.223  -5.978   0.602 1.00 . A A .  34 THR CB   1 1 
       10  6062 1 1 34 THR CG2  C   -0.149  -5.501   0.152 1.00 . A A .  34 THR CG2  1 1 
       10  6063 1 1 34 THR H    H    1.949  -5.757  -2.028 1.00 . A A .  34 THR H    1 1 
       10  6064 1 1 34 THR HA   H    2.510  -7.634   0.169 1.00 . A A .  34 THR HA   1 1 
       10  6065 1 1 34 THR HB   H    1.899  -5.135   0.603 1.00 . A A .  34 THR HB   1 1 
       10  6066 1 1 34 THR HG1  H    1.050  -5.790   2.557 1.00 . A A .  34 THR HG1  1 1 
       10  6067 1 1 34 THR HG21 H   -0.500  -4.731   0.823 1.00 . A A .  34 THR HG21 1 1 
       10  6068 1 1 34 THR HG22 H   -0.841  -6.330   0.163 1.00 . A A .  34 THR HG22 1 1 
       10  6069 1 1 34 THR HG23 H   -0.081  -5.102  -0.849 1.00 . A A .  34 THR HG23 1 1 
       10  6070 1 1 34 THR N    N    2.426  -6.441  -1.513 1.00 . A A .  34 THR N    1 1 
       10  6071 1 1 34 THR O    O    0.275  -8.903  -0.084 1.00 . A A .  34 THR O    1 1 
       10  6072 1 1 34 THR OG1  O    1.137  -6.510   1.928 1.00 . A A .  34 THR OG1  1 1 
       10  6073 1 1 35 HIS C    C   -0.518  -9.753  -3.144 1.00 . A A .  35 HIS C    1 1 
       10  6074 1 1 35 HIS CA   C   -1.038  -8.477  -2.488 1.00 . A A .  35 HIS CA   1 1 
       10  6075 1 1 35 HIS CB   C   -1.847  -7.663  -3.499 1.00 . A A .  35 HIS CB   1 1 
       10  6076 1 1 35 HIS CD2  C   -2.734  -5.348  -2.737 1.00 . A A .  35 HIS CD2  1 1 
       10  6077 1 1 35 HIS CE1  C   -4.600  -6.014  -1.798 1.00 . A A .  35 HIS CE1  1 1 
       10  6078 1 1 35 HIS CG   C   -2.797  -6.694  -2.865 1.00 . A A .  35 HIS CG   1 1 
       10  6079 1 1 35 HIS H    H    0.392  -6.916  -2.480 1.00 . A A .  35 HIS H    1 1 
       10  6080 1 1 35 HIS HA   H   -1.678  -8.746  -1.662 1.00 . A A .  35 HIS HA   1 1 
       10  6081 1 1 35 HIS HB2  H   -1.169  -7.101  -4.124 1.00 . A A .  35 HIS HB2  1 1 
       10  6082 1 1 35 HIS HB3  H   -2.422  -8.338  -4.116 1.00 . A A .  35 HIS HB3  1 1 
       10  6083 1 1 35 HIS HD1  H   -4.309  -7.999  -2.194 1.00 . A A .  35 HIS HD1  1 1 
       10  6084 1 1 35 HIS HD2  H   -1.941  -4.706  -3.094 1.00 . A A .  35 HIS HD2  1 1 
       10  6085 1 1 35 HIS HE1  H   -5.548  -6.011  -1.280 1.00 . A A .  35 HIS HE1  1 1 
       10  6086 1 1 35 HIS N    N    0.063  -7.679  -1.960 1.00 . A A .  35 HIS N    1 1 
       10  6087 1 1 35 HIS ND1  N   -3.977  -7.080  -2.265 1.00 . A A .  35 HIS ND1  1 1 
       10  6088 1 1 35 HIS NE2  N   -3.867  -4.950  -2.071 1.00 . A A .  35 HIS NE2  1 1 
       10  6089 1 1 35 HIS O    O   -0.936 -10.111  -4.245 1.00 . A A .  35 HIS O    1 1 
       10  6090 1 1 36 SER C    C   -0.091 -12.529  -3.649 1.00 . A A .  36 SER C    1 1 
       10  6091 1 1 36 SER CA   C    0.975 -11.668  -2.978 1.00 . A A .  36 SER CA   1 1 
       10  6092 1 1 36 SER CB   C    1.646 -12.454  -1.849 1.00 . A A .  36 SER CB   1 1 
       10  6093 1 1 36 SER H    H    0.688 -10.097  -1.587 1.00 . A A .  36 SER H    1 1 
       10  6094 1 1 36 SER HA   H    1.721 -11.401  -3.712 1.00 . A A .  36 SER HA   1 1 
       10  6095 1 1 36 SER HB2  H    1.003 -12.454  -0.982 1.00 . A A .  36 SER HB2  1 1 
       10  6096 1 1 36 SER HB3  H    1.814 -13.471  -2.173 1.00 . A A .  36 SER HB3  1 1 
       10  6097 1 1 36 SER HG   H    3.306 -11.507  -2.278 1.00 . A A .  36 SER HG   1 1 
       10  6098 1 1 36 SER N    N    0.395 -10.434  -2.460 1.00 . A A .  36 SER N    1 1 
       10  6099 1 1 36 SER O    O   -1.036 -12.981  -3.004 1.00 . A A .  36 SER O    1 1 
       10  6100 1 1 36 SER OG   O    2.891 -11.876  -1.495 1.00 . A A .  36 SER OG   1 1 
       10  6101 1 1 37 GLY C    C   -0.243 -14.308  -6.838 1.00 . A A .  37 GLY C    1 1 
       10  6102 1 1 37 GLY CA   C   -0.884 -13.558  -5.688 1.00 . A A .  37 GLY CA   1 1 
       10  6103 1 1 37 GLY H    H    0.844 -12.366  -5.412 1.00 . A A .  37 GLY H    1 1 
       10  6104 1 1 37 GLY HA2  H   -1.335 -14.271  -5.013 1.00 . A A .  37 GLY HA2  1 1 
       10  6105 1 1 37 GLY HA3  H   -1.656 -12.912  -6.080 1.00 . A A .  37 GLY HA3  1 1 
       10  6106 1 1 37 GLY N    N    0.070 -12.752  -4.950 1.00 . A A .  37 GLY N    1 1 
       10  6107 1 1 37 GLY O    O   -0.658 -14.165  -7.988 1.00 . A A .  37 GLY O    1 1 
       10  6108 1 1 38 GLU C    C    0.984 -17.325  -7.567 1.00 . A A .  38 GLU C    1 1 
       10  6109 1 1 38 GLU CA   C    1.474 -15.880  -7.548 1.00 . A A .  38 GLU CA   1 1 
       10  6110 1 1 38 GLU CB   C    2.983 -15.845  -7.298 1.00 . A A .  38 GLU CB   1 1 
       10  6111 1 1 38 GLU CD   C    5.240 -15.672  -8.420 1.00 . A A .  38 GLU CD   1 1 
       10  6112 1 1 38 GLU CG   C    3.812 -16.170  -8.529 1.00 . A A .  38 GLU CG   1 1 
       10  6113 1 1 38 GLU H    H    1.058 -15.179  -5.594 1.00 . A A .  38 GLU H    1 1 
       10  6114 1 1 38 GLU HA   H    1.266 -15.430  -8.506 1.00 . A A .  38 GLU HA   1 1 
       10  6115 1 1 38 GLU HB2  H    3.256 -14.857  -6.956 1.00 . A A .  38 GLU HB2  1 1 
       10  6116 1 1 38 GLU HB3  H    3.225 -16.562  -6.527 1.00 . A A .  38 GLU HB3  1 1 
       10  6117 1 1 38 GLU HG2  H    3.830 -17.241  -8.662 1.00 . A A .  38 GLU HG2  1 1 
       10  6118 1 1 38 GLU HG3  H    3.350 -15.709  -9.390 1.00 . A A .  38 GLU HG3  1 1 
       10  6119 1 1 38 GLU N    N    0.773 -15.107  -6.529 1.00 . A A .  38 GLU N    1 1 
       10  6120 1 1 38 GLU O    O    1.145 -18.034  -8.561 1.00 . A A .  38 GLU O    1 1 
       10  6121 1 1 38 GLU OE1  O    5.800 -15.720  -7.305 1.00 . A A .  38 GLU OE1  1 1 
       10  6122 1 1 38 GLU OE2  O    5.796 -15.234  -9.448 1.00 . A A .  38 GLU OE2  1 1 
       10  6123 1 1 39 LYS C    C   -1.653 -19.120  -6.321 1.00 . A A .  39 LYS C    1 1 
       10  6124 1 1 39 LYS CA   C   -0.128 -19.116  -6.349 1.00 . A A .  39 LYS CA   1 1 
       10  6125 1 1 39 LYS CB   C    0.418 -19.787  -5.087 1.00 . A A .  39 LYS CB   1 1 
       10  6126 1 1 39 LYS CD   C    2.039 -21.501  -5.949 1.00 . A A .  39 LYS CD   1 1 
       10  6127 1 1 39 LYS CE   C    3.505 -21.840  -6.172 1.00 . A A .  39 LYS CE   1 1 
       10  6128 1 1 39 LYS CG   C    1.878 -20.192  -5.196 1.00 . A A .  39 LYS CG   1 1 
       10  6129 1 1 39 LYS H    H    0.288 -17.144  -5.702 1.00 . A A .  39 LYS H    1 1 
       10  6130 1 1 39 LYS HA   H    0.206 -19.669  -7.214 1.00 . A A .  39 LYS HA   1 1 
       10  6131 1 1 39 LYS HB2  H    0.317 -19.103  -4.257 1.00 . A A .  39 LYS HB2  1 1 
       10  6132 1 1 39 LYS HB3  H   -0.165 -20.674  -4.884 1.00 . A A .  39 LYS HB3  1 1 
       10  6133 1 1 39 LYS HD2  H    1.582 -22.295  -5.376 1.00 . A A .  39 LYS HD2  1 1 
       10  6134 1 1 39 LYS HD3  H    1.547 -21.418  -6.908 1.00 . A A .  39 LYS HD3  1 1 
       10  6135 1 1 39 LYS HE2  H    3.570 -22.653  -6.879 1.00 . A A .  39 LYS HE2  1 1 
       10  6136 1 1 39 LYS HE3  H    4.003 -20.971  -6.577 1.00 . A A .  39 LYS HE3  1 1 
       10  6137 1 1 39 LYS HG2  H    2.418 -19.418  -5.721 1.00 . A A .  39 LYS HG2  1 1 
       10  6138 1 1 39 LYS HG3  H    2.286 -20.306  -4.201 1.00 . A A .  39 LYS HG3  1 1 
       10  6139 1 1 39 LYS HZ1  H    4.224 -23.277  -4.838 1.00 . A A .  39 LYS HZ1  1 1 
       10  6140 1 1 39 LYS HZ2  H    3.656 -21.870  -4.089 1.00 . A A .  39 LYS HZ2  1 1 
       10  6141 1 1 39 LYS HZ3  H    5.149 -21.862  -4.884 1.00 . A A .  39 LYS HZ3  1 1 
       10  6142 1 1 39 LYS N    N    0.387 -17.756  -6.461 1.00 . A A .  39 LYS N    1 1 
       10  6143 1 1 39 LYS NZ   N    4.181 -22.241  -4.907 1.00 . A A .  39 LYS NZ   1 1 
       10  6144 1 1 39 LYS O    O   -2.278 -19.213  -5.264 1.00 . A A .  39 LYS O    1 1 
       10  6145 1 1 40 PRO C    C   -4.347 -20.368  -7.332 1.00 . A A .  40 PRO C    1 1 
       10  6146 1 1 40 PRO CA   C   -3.727 -19.010  -7.646 1.00 . A A .  40 PRO CA   1 1 
       10  6147 1 1 40 PRO CB   C   -3.943 -18.653  -9.119 1.00 . A A .  40 PRO CB   1 1 
       10  6148 1 1 40 PRO CD   C   -1.586 -18.904  -8.809 1.00 . A A .  40 PRO CD   1 1 
       10  6149 1 1 40 PRO CG   C   -2.697 -19.098  -9.803 1.00 . A A .  40 PRO CG   1 1 
       10  6150 1 1 40 PRO HA   H   -4.181 -18.255  -7.021 1.00 . A A .  40 PRO HA   1 1 
       10  6151 1 1 40 PRO HB2  H   -4.810 -19.176  -9.496 1.00 . A A .  40 PRO HB2  1 1 
       10  6152 1 1 40 PRO HB3  H   -4.087 -17.587  -9.217 1.00 . A A .  40 PRO HB3  1 1 
       10  6153 1 1 40 PRO HD2  H   -0.839 -19.675  -8.922 1.00 . A A .  40 PRO HD2  1 1 
       10  6154 1 1 40 PRO HD3  H   -1.142 -17.926  -8.925 1.00 . A A .  40 PRO HD3  1 1 
       10  6155 1 1 40 PRO HG2  H   -2.779 -20.140 -10.074 1.00 . A A .  40 PRO HG2  1 1 
       10  6156 1 1 40 PRO HG3  H   -2.524 -18.493 -10.681 1.00 . A A .  40 PRO HG3  1 1 
       10  6157 1 1 40 PRO N    N   -2.268 -19.018  -7.509 1.00 . A A .  40 PRO N    1 1 
       10  6158 1 1 40 PRO O    O   -5.567 -20.526  -7.364 1.00 . A A .  40 PRO O    1 1 
       10  6159 1 1 41 SER C    C   -4.306 -22.810  -5.229 1.00 . A A .  41 SER C    1 1 
       10  6160 1 1 41 SER CA   C   -3.962 -22.690  -6.710 1.00 . A A .  41 SER CA   1 1 
       10  6161 1 1 41 SER CB   C   -2.896 -23.721  -7.084 1.00 . A A .  41 SER CB   1 1 
       10  6162 1 1 41 SER H    H   -2.536 -21.156  -7.019 1.00 . A A .  41 SER H    1 1 
       10  6163 1 1 41 SER HA   H   -4.853 -22.878  -7.291 1.00 . A A .  41 SER HA   1 1 
       10  6164 1 1 41 SER HB2  H   -2.005 -23.541  -6.503 1.00 . A A .  41 SER HB2  1 1 
       10  6165 1 1 41 SER HB3  H   -3.269 -24.713  -6.873 1.00 . A A .  41 SER HB3  1 1 
       10  6166 1 1 41 SER HG   H   -3.286 -24.007  -8.983 1.00 . A A .  41 SER HG   1 1 
       10  6167 1 1 41 SER N    N   -3.498 -21.344  -7.028 1.00 . A A .  41 SER N    1 1 
       10  6168 1 1 41 SER O    O   -3.472 -23.212  -4.418 1.00 . A A .  41 SER O    1 1 
       10  6169 1 1 41 SER OG   O   -2.569 -23.641  -8.461 1.00 . A A .  41 SER OG   1 1 
       10  6170 1 1 42 GLY C    C   -7.415 -22.101  -3.319 1.00 . A A .  42 GLY C    1 1 
       10  6171 1 1 42 GLY CA   C   -5.974 -22.535  -3.500 1.00 . A A .  42 GLY CA   1 1 
       10  6172 1 1 42 GLY H    H   -6.163 -22.146  -5.573 1.00 . A A .  42 GLY H    1 1 
       10  6173 1 1 42 GLY HA2  H   -5.869 -23.553  -3.156 1.00 . A A .  42 GLY HA2  1 1 
       10  6174 1 1 42 GLY HA3  H   -5.340 -21.896  -2.901 1.00 . A A .  42 GLY HA3  1 1 
       10  6175 1 1 42 GLY N    N   -5.540 -22.459  -4.883 1.00 . A A .  42 GLY N    1 1 
       10  6176 1 1 42 GLY O    O   -7.702 -20.956  -2.971 1.00 . A A .  42 GLY O    1 1 
       10  6177 1 1 43 PRO C    C  -10.210 -22.571  -1.978 1.00 . A A .  43 PRO C    1 1 
       10  6178 1 1 43 PRO CA   C   -9.786 -22.762  -3.430 1.00 . A A .  43 PRO CA   1 1 
       10  6179 1 1 43 PRO CB   C  -10.437 -24.017  -4.016 1.00 . A A .  43 PRO CB   1 1 
       10  6180 1 1 43 PRO CD   C   -8.081 -24.417  -3.979 1.00 . A A .  43 PRO CD   1 1 
       10  6181 1 1 43 PRO CG   C   -9.418 -25.090  -3.840 1.00 . A A .  43 PRO CG   1 1 
       10  6182 1 1 43 PRO HA   H  -10.082 -21.898  -4.007 1.00 . A A .  43 PRO HA   1 1 
       10  6183 1 1 43 PRO HB2  H  -11.345 -24.241  -3.474 1.00 . A A .  43 PRO HB2  1 1 
       10  6184 1 1 43 PRO HB3  H  -10.664 -23.856  -5.059 1.00 . A A .  43 PRO HB3  1 1 
       10  6185 1 1 43 PRO HD2  H   -7.355 -24.882  -3.327 1.00 . A A .  43 PRO HD2  1 1 
       10  6186 1 1 43 PRO HD3  H   -7.746 -24.451  -5.005 1.00 . A A .  43 PRO HD3  1 1 
       10  6187 1 1 43 PRO HG2  H   -9.516 -25.532  -2.861 1.00 . A A .  43 PRO HG2  1 1 
       10  6188 1 1 43 PRO HG3  H   -9.540 -25.841  -4.607 1.00 . A A .  43 PRO HG3  1 1 
       10  6189 1 1 43 PRO N    N   -8.351 -23.031  -3.560 1.00 . A A .  43 PRO N    1 1 
       10  6190 1 1 43 PRO O    O  -10.490 -23.539  -1.270 1.00 . A A .  43 PRO O    1 1 
       10  6191 1 1 44 SER C    C  -12.146 -20.756  -0.073 1.00 . A A .  44 SER C    1 1 
       10  6192 1 1 44 SER CA   C  -10.643 -20.999  -0.170 1.00 . A A .  44 SER CA   1 1 
       10  6193 1 1 44 SER CB   C   -9.883 -19.767   0.325 1.00 . A A .  44 SER CB   1 1 
       10  6194 1 1 44 SER H    H  -10.021 -20.588  -2.152 1.00 . A A .  44 SER H    1 1 
       10  6195 1 1 44 SER HA   H  -10.386 -21.844   0.451 1.00 . A A .  44 SER HA   1 1 
       10  6196 1 1 44 SER HB2  H  -10.115 -18.925  -0.309 1.00 . A A .  44 SER HB2  1 1 
       10  6197 1 1 44 SER HB3  H  -10.181 -19.547   1.340 1.00 . A A .  44 SER HB3  1 1 
       10  6198 1 1 44 SER HG   H   -8.093 -19.672   1.116 1.00 . A A .  44 SER HG   1 1 
       10  6199 1 1 44 SER N    N  -10.256 -21.317  -1.540 1.00 . A A .  44 SER N    1 1 
       10  6200 1 1 44 SER O    O  -12.591 -19.788   0.544 1.00 . A A .  44 SER O    1 1 
       10  6201 1 1 44 SER OG   O   -8.483 -19.987   0.297 1.00 . A A .  44 SER OG   1 1 
       10  6202 1 1 45 SER C    C  -14.894 -21.344   0.751 1.00 . A A .  45 SER C    1 1 
       10  6203 1 1 45 SER CA   C  -14.377 -21.523  -0.673 1.00 . A A .  45 SER CA   1 1 
       10  6204 1 1 45 SER CB   C  -15.017 -22.759  -1.309 1.00 . A A .  45 SER CB   1 1 
       10  6205 1 1 45 SER H    H  -12.509 -22.393  -1.162 1.00 . A A .  45 SER H    1 1 
       10  6206 1 1 45 SER HA   H  -14.643 -20.652  -1.253 1.00 . A A .  45 SER HA   1 1 
       10  6207 1 1 45 SER HB2  H  -14.669 -23.644  -0.798 1.00 . A A .  45 SER HB2  1 1 
       10  6208 1 1 45 SER HB3  H  -16.091 -22.691  -1.219 1.00 . A A .  45 SER HB3  1 1 
       10  6209 1 1 45 SER HG   H  -14.685 -21.987  -3.078 1.00 . A A .  45 SER HG   1 1 
       10  6210 1 1 45 SER N    N  -12.923 -21.643  -0.687 1.00 . A A .  45 SER N    1 1 
       10  6211 1 1 45 SER O    O  -14.174 -21.580   1.719 1.00 . A A .  45 SER O    1 1 
       10  6212 1 1 45 SER OG   O  -14.678 -22.861  -2.681 1.00 . A A .  45 SER OG   1 1 
       10  6213 1 1 46 GLY C    C  -18.258 -20.669   2.125 1.00 . A A .  46 GLY C    1 1 
       10  6214 1 1 46 GLY CA   C  -16.744 -20.719   2.177 1.00 . A A .  46 GLY CA   1 1 
       10  6215 1 1 46 GLY H    H  -16.678 -20.751   0.061 1.00 . A A .  46 GLY H    1 1 
       10  6216 1 1 46 GLY HA2  H  -16.443 -21.527   2.827 1.00 . A A .  46 GLY HA2  1 1 
       10  6217 1 1 46 GLY HA3  H  -16.379 -19.788   2.584 1.00 . A A .  46 GLY HA3  1 1 
       10  6218 1 1 46 GLY N    N  -16.150 -20.924   0.869 1.00 . A A .  46 GLY N    1 1 
       10  6219 1 1 46 GLY O    O  -18.906 -21.207   3.022 1.00 . A A .  46 GLY O    1 1 
       10  6220 2 2  1 ZN  ZN   ZN  -4.159  -3.021  -1.812 1.00 . B A . 201 ZN  ZN   1 1 
       11  6221 1 1  1 GLY C    C  -25.751   3.372  -6.761 1.00 . A A .   1 GLY C    1 1 
       11  6222 1 1  1 GLY CA   C  -25.341   2.988  -5.353 1.00 . A A .   1 GLY CA   1 1 
       11  6223 1 1  1 GLY H1   H  -24.212   4.487  -4.372 1.00 . A A .   1 GLY H1   1 1 
       11  6224 1 1  1 GLY HA2  H  -24.430   2.410  -5.398 1.00 . A A .   1 GLY HA2  1 1 
       11  6225 1 1  1 GLY HA3  H  -26.120   2.380  -4.917 1.00 . A A .   1 GLY HA3  1 1 
       11  6226 1 1  1 GLY N    N  -25.121   4.145  -4.504 1.00 . A A .   1 GLY N    1 1 
       11  6227 1 1  1 GLY O    O  -25.079   3.015  -7.729 1.00 . A A .   1 GLY O    1 1 
       11  6228 1 1  2 SER C    C  -26.767   5.877  -8.570 1.00 . A A .   2 SER C    1 1 
       11  6229 1 1  2 SER CA   C  -27.358   4.526  -8.177 1.00 . A A .   2 SER CA   1 1 
       11  6230 1 1  2 SER CB   C  -28.886   4.612  -8.156 1.00 . A A .   2 SER CB   1 1 
       11  6231 1 1  2 SER H    H  -27.349   4.352  -6.067 1.00 . A A .   2 SER H    1 1 
       11  6232 1 1  2 SER HA   H  -27.058   3.789  -8.907 1.00 . A A .   2 SER HA   1 1 
       11  6233 1 1  2 SER HB2  H  -29.282   3.783  -7.590 1.00 . A A .   2 SER HB2  1 1 
       11  6234 1 1  2 SER HB3  H  -29.185   5.541  -7.692 1.00 . A A .   2 SER HB3  1 1 
       11  6235 1 1  2 SER HG   H  -29.765   5.428  -9.705 1.00 . A A .   2 SER HG   1 1 
       11  6236 1 1  2 SER N    N  -26.857   4.099  -6.876 1.00 . A A .   2 SER N    1 1 
       11  6237 1 1  2 SER O    O  -26.140   6.010  -9.622 1.00 . A A .   2 SER O    1 1 
       11  6238 1 1  2 SER OG   O  -29.418   4.565  -9.468 1.00 . A A .   2 SER OG   1 1 
       11  6239 1 1  3 SER C    C  -25.053   8.162  -8.558 1.00 . A A .   3 SER C    1 1 
       11  6240 1 1  3 SER CA   C  -26.463   8.218  -7.977 1.00 . A A .   3 SER CA   1 1 
       11  6241 1 1  3 SER CB   C  -26.464   9.044  -6.689 1.00 . A A .   3 SER CB   1 1 
       11  6242 1 1  3 SER H    H  -27.479   6.707  -6.897 1.00 . A A .   3 SER H    1 1 
       11  6243 1 1  3 SER HA   H  -27.118   8.687  -8.696 1.00 . A A .   3 SER HA   1 1 
       11  6244 1 1  3 SER HB2  H  -27.481   9.286  -6.421 1.00 . A A .   3 SER HB2  1 1 
       11  6245 1 1  3 SER HB3  H  -26.009   8.468  -5.896 1.00 . A A .   3 SER HB3  1 1 
       11  6246 1 1  3 SER HG   H  -26.065  10.718  -7.624 1.00 . A A .   3 SER HG   1 1 
       11  6247 1 1  3 SER N    N  -26.972   6.876  -7.718 1.00 . A A .   3 SER N    1 1 
       11  6248 1 1  3 SER O    O  -24.284   7.249  -8.261 1.00 . A A .   3 SER O    1 1 
       11  6249 1 1  3 SER OG   O  -25.736  10.248  -6.855 1.00 . A A .   3 SER OG   1 1 
       11  6250 1 1  4 GLY C    C  -22.733  10.538  -9.826 1.00 . A A .   4 GLY C    1 1 
       11  6251 1 1  4 GLY CA   C  -23.406   9.191  -9.998 1.00 . A A .   4 GLY CA   1 1 
       11  6252 1 1  4 GLY H    H  -25.377   9.847  -9.588 1.00 . A A .   4 GLY H    1 1 
       11  6253 1 1  4 GLY HA2  H  -22.787   8.430  -9.548 1.00 . A A .   4 GLY HA2  1 1 
       11  6254 1 1  4 GLY HA3  H  -23.504   8.983 -11.054 1.00 . A A .   4 GLY HA3  1 1 
       11  6255 1 1  4 GLY N    N  -24.722   9.146  -9.388 1.00 . A A .   4 GLY N    1 1 
       11  6256 1 1  4 GLY O    O  -22.118  11.056 -10.758 1.00 . A A .   4 GLY O    1 1 
       11  6257 1 1  5 SER C    C  -20.737  12.289  -8.208 1.00 . A A .   5 SER C    1 1 
       11  6258 1 1  5 SER CA   C  -22.253  12.406  -8.341 1.00 . A A .   5 SER CA   1 1 
       11  6259 1 1  5 SER CB   C  -22.845  12.988  -7.056 1.00 . A A .   5 SER CB   1 1 
       11  6260 1 1  5 SER H    H  -23.354  10.645  -7.928 1.00 . A A .   5 SER H    1 1 
       11  6261 1 1  5 SER HA   H  -22.481  13.067  -9.164 1.00 . A A .   5 SER HA   1 1 
       11  6262 1 1  5 SER HB2  H  -23.894  13.191  -7.205 1.00 . A A .   5 SER HB2  1 1 
       11  6263 1 1  5 SER HB3  H  -22.726  12.275  -6.253 1.00 . A A .   5 SER HB3  1 1 
       11  6264 1 1  5 SER HG   H  -22.705  14.644  -6.018 1.00 . A A .   5 SER HG   1 1 
       11  6265 1 1  5 SER N    N  -22.851  11.108  -8.631 1.00 . A A .   5 SER N    1 1 
       11  6266 1 1  5 SER O    O  -20.231  11.665  -7.276 1.00 . A A .   5 SER O    1 1 
       11  6267 1 1  5 SER OG   O  -22.194  14.194  -6.695 1.00 . A A .   5 SER OG   1 1 
       11  6268 1 1  6 SER C    C  -17.985  14.180  -8.652 1.00 . A A .   6 SER C    1 1 
       11  6269 1 1  6 SER CA   C  -18.561  12.854  -9.141 1.00 . A A .   6 SER CA   1 1 
       11  6270 1 1  6 SER CB   C  -18.031  12.541 -10.541 1.00 . A A .   6 SER CB   1 1 
       11  6271 1 1  6 SER H    H  -20.481  13.375  -9.867 1.00 . A A .   6 SER H    1 1 
       11  6272 1 1  6 SER HA   H  -18.254  12.070  -8.465 1.00 . A A .   6 SER HA   1 1 
       11  6273 1 1  6 SER HB2  H  -18.475  11.623 -10.895 1.00 . A A .   6 SER HB2  1 1 
       11  6274 1 1  6 SER HB3  H  -18.291  13.348 -11.211 1.00 . A A .   6 SER HB3  1 1 
       11  6275 1 1  6 SER HG   H  -16.396  11.471 -10.681 1.00 . A A .   6 SER HG   1 1 
       11  6276 1 1  6 SER N    N  -20.019  12.893  -9.149 1.00 . A A .   6 SER N    1 1 
       11  6277 1 1  6 SER O    O  -17.668  15.063  -9.447 1.00 . A A .   6 SER O    1 1 
       11  6278 1 1  6 SER OG   O  -16.622  12.392 -10.531 1.00 . A A .   6 SER OG   1 1 
       11  6279 1 1  7 GLY C    C  -16.965  15.374  -5.294 1.00 . A A .   7 GLY C    1 1 
       11  6280 1 1  7 GLY CA   C  -17.315  15.530  -6.761 1.00 . A A .   7 GLY CA   1 1 
       11  6281 1 1  7 GLY H    H  -18.122  13.572  -6.749 1.00 . A A .   7 GLY H    1 1 
       11  6282 1 1  7 GLY HA2  H  -16.426  15.809  -7.305 1.00 . A A .   7 GLY HA2  1 1 
       11  6283 1 1  7 GLY HA3  H  -18.050  16.315  -6.862 1.00 . A A .   7 GLY HA3  1 1 
       11  6284 1 1  7 GLY N    N  -17.853  14.310  -7.335 1.00 . A A .   7 GLY N    1 1 
       11  6285 1 1  7 GLY O    O  -17.433  16.140  -4.451 1.00 . A A .   7 GLY O    1 1 
       11  6286 1 1  8 THR C    C  -14.361  13.452  -3.562 1.00 . A A .   8 THR C    1 1 
       11  6287 1 1  8 THR CA   C  -15.728  14.124  -3.612 1.00 . A A .   8 THR CA   1 1 
       11  6288 1 1  8 THR CB   C  -16.750  13.237  -2.876 1.00 . A A .   8 THR CB   1 1 
       11  6289 1 1  8 THR CG2  C  -18.010  14.022  -2.546 1.00 . A A .   8 THR CG2  1 1 
       11  6290 1 1  8 THR H    H  -15.799  13.803  -5.703 1.00 . A A .   8 THR H    1 1 
       11  6291 1 1  8 THR HA   H  -15.672  15.073  -3.099 1.00 . A A .   8 THR HA   1 1 
       11  6292 1 1  8 THR HB   H  -16.306  12.892  -1.953 1.00 . A A .   8 THR HB   1 1 
       11  6293 1 1  8 THR HG1  H  -17.832  12.322  -4.248 1.00 . A A .   8 THR HG1  1 1 
       11  6294 1 1  8 THR HG21 H  -18.616  14.119  -3.434 1.00 . A A .   8 THR HG21 1 1 
       11  6295 1 1  8 THR HG22 H  -17.739  15.004  -2.187 1.00 . A A .   8 THR HG22 1 1 
       11  6296 1 1  8 THR HG23 H  -18.570  13.502  -1.783 1.00 . A A .   8 THR HG23 1 1 
       11  6297 1 1  8 THR N    N  -16.139  14.379  -4.987 1.00 . A A .   8 THR N    1 1 
       11  6298 1 1  8 THR O    O  -14.217  12.287  -3.930 1.00 . A A .   8 THR O    1 1 
       11  6299 1 1  8 THR OG1  O  -17.086  12.103  -3.684 1.00 . A A .   8 THR OG1  1 1 
       11  6300 1 1  9 GLY C    C  -11.378  13.453  -4.376 1.00 . A A .   9 GLY C    1 1 
       11  6301 1 1  9 GLY CA   C  -12.014  13.654  -3.015 1.00 . A A .   9 GLY CA   1 1 
       11  6302 1 1  9 GLY H    H  -13.532  15.119  -2.825 1.00 . A A .   9 GLY H    1 1 
       11  6303 1 1  9 GLY HA2  H  -11.402  14.333  -2.439 1.00 . A A .   9 GLY HA2  1 1 
       11  6304 1 1  9 GLY HA3  H  -12.055  12.703  -2.505 1.00 . A A .   9 GLY HA3  1 1 
       11  6305 1 1  9 GLY N    N  -13.358  14.195  -3.104 1.00 . A A .   9 GLY N    1 1 
       11  6306 1 1  9 GLY O    O  -11.998  12.895  -5.281 1.00 . A A .   9 GLY O    1 1 
       11  6307 1 1 10 GLU C    C   -8.043  13.160  -5.564 1.00 . A A .  10 GLU C    1 1 
       11  6308 1 1 10 GLU CA   C   -9.420  13.780  -5.784 1.00 . A A .  10 GLU CA   1 1 
       11  6309 1 1 10 GLU CB   C   -9.275  15.146  -6.458 1.00 . A A .  10 GLU CB   1 1 
       11  6310 1 1 10 GLU CD   C  -10.866  14.970  -8.412 1.00 . A A .  10 GLU CD   1 1 
       11  6311 1 1 10 GLU CG   C  -10.560  15.651  -7.092 1.00 . A A .  10 GLU CG   1 1 
       11  6312 1 1 10 GLU H    H   -9.697  14.347  -3.763 1.00 . A A .  10 GLU H    1 1 
       11  6313 1 1 10 GLU HA   H   -9.995  13.131  -6.427 1.00 . A A .  10 GLU HA   1 1 
       11  6314 1 1 10 GLU HB2  H   -8.955  15.866  -5.719 1.00 . A A .  10 GLU HB2  1 1 
       11  6315 1 1 10 GLU HB3  H   -8.521  15.075  -7.228 1.00 . A A .  10 GLU HB3  1 1 
       11  6316 1 1 10 GLU HG2  H  -11.378  15.469  -6.412 1.00 . A A .  10 GLU HG2  1 1 
       11  6317 1 1 10 GLU HG3  H  -10.467  16.713  -7.265 1.00 . A A .  10 GLU HG3  1 1 
       11  6318 1 1 10 GLU N    N  -10.139  13.911  -4.521 1.00 . A A .  10 GLU N    1 1 
       11  6319 1 1 10 GLU O    O   -7.101  13.840  -5.158 1.00 . A A .  10 GLU O    1 1 
       11  6320 1 1 10 GLU OE1  O  -10.455  13.804  -8.587 1.00 . A A .  10 GLU OE1  1 1 
       11  6321 1 1 10 GLU OE2  O  -11.517  15.603  -9.269 1.00 . A A .  10 GLU OE2  1 1 
       11  6322 1 1 11 LYS C    C   -6.169  10.618  -7.006 1.00 . A A .  11 LYS C    1 1 
       11  6323 1 1 11 LYS CA   C   -6.674  11.150  -5.668 1.00 . A A .  11 LYS CA   1 1 
       11  6324 1 1 11 LYS CB   C   -6.845   9.995  -4.680 1.00 . A A .  11 LYS CB   1 1 
       11  6325 1 1 11 LYS CD   C   -8.522   8.320  -3.847 1.00 . A A .  11 LYS CD   1 1 
       11  6326 1 1 11 LYS CE   C   -9.612   9.150  -3.189 1.00 . A A .  11 LYS CE   1 1 
       11  6327 1 1 11 LYS CG   C   -7.946   9.022  -5.066 1.00 . A A .  11 LYS CG   1 1 
       11  6328 1 1 11 LYS H    H   -8.722  11.375  -6.156 1.00 . A A .  11 LYS H    1 1 
       11  6329 1 1 11 LYS HA   H   -5.948  11.845  -5.274 1.00 . A A .  11 LYS HA   1 1 
       11  6330 1 1 11 LYS HB2  H   -5.916   9.448  -4.619 1.00 . A A .  11 LYS HB2  1 1 
       11  6331 1 1 11 LYS HB3  H   -7.078  10.401  -3.706 1.00 . A A .  11 LYS HB3  1 1 
       11  6332 1 1 11 LYS HD2  H   -8.941   7.373  -4.153 1.00 . A A .  11 LYS HD2  1 1 
       11  6333 1 1 11 LYS HD3  H   -7.729   8.150  -3.132 1.00 . A A .  11 LYS HD3  1 1 
       11  6334 1 1 11 LYS HE2  H   -9.296  10.182  -3.165 1.00 . A A .  11 LYS HE2  1 1 
       11  6335 1 1 11 LYS HE3  H  -10.516   9.064  -3.774 1.00 . A A .  11 LYS HE3  1 1 
       11  6336 1 1 11 LYS HG2  H   -8.737   9.566  -5.561 1.00 . A A .  11 LYS HG2  1 1 
       11  6337 1 1 11 LYS HG3  H   -7.539   8.281  -5.739 1.00 . A A .  11 LYS HG3  1 1 
       11  6338 1 1 11 LYS HZ1  H  -10.916   8.600  -1.652 1.00 . A A .  11 LYS HZ1  1 1 
       11  6339 1 1 11 LYS HZ2  H   -9.518   9.388  -1.116 1.00 . A A .  11 LYS HZ2  1 1 
       11  6340 1 1 11 LYS HZ3  H   -9.438   7.777  -1.624 1.00 . A A .  11 LYS HZ3  1 1 
       11  6341 1 1 11 LYS N    N   -7.934  11.864  -5.835 1.00 . A A .  11 LYS N    1 1 
       11  6342 1 1 11 LYS NZ   N   -9.891   8.697  -1.798 1.00 . A A .  11 LYS NZ   1 1 
       11  6343 1 1 11 LYS O    O   -6.943  10.194  -7.865 1.00 . A A .  11 LYS O    1 1 
       11  6344 1 1 12 PRO C    C   -4.299   8.645  -8.570 1.00 . A A .  12 PRO C    1 1 
       11  6345 1 1 12 PRO CA   C   -4.203  10.160  -8.419 1.00 . A A .  12 PRO CA   1 1 
       11  6346 1 1 12 PRO CB   C   -2.743  10.589  -8.252 1.00 . A A .  12 PRO CB   1 1 
       11  6347 1 1 12 PRO CD   C   -3.858  11.130  -6.208 1.00 . A A .  12 PRO CD   1 1 
       11  6348 1 1 12 PRO CG   C   -2.541  10.682  -6.779 1.00 . A A .  12 PRO CG   1 1 
       11  6349 1 1 12 PRO HA   H   -4.622  10.635  -9.294 1.00 . A A .  12 PRO HA   1 1 
       11  6350 1 1 12 PRO HB2  H   -2.094   9.847  -8.695 1.00 . A A .  12 PRO HB2  1 1 
       11  6351 1 1 12 PRO HB3  H   -2.588  11.543  -8.732 1.00 . A A .  12 PRO HB3  1 1 
       11  6352 1 1 12 PRO HD2  H   -4.022  10.681  -5.240 1.00 . A A .  12 PRO HD2  1 1 
       11  6353 1 1 12 PRO HD3  H   -3.891  12.208  -6.137 1.00 . A A .  12 PRO HD3  1 1 
       11  6354 1 1 12 PRO HG2  H   -2.271   9.714  -6.384 1.00 . A A .  12 PRO HG2  1 1 
       11  6355 1 1 12 PRO HG3  H   -1.771  11.407  -6.559 1.00 . A A .  12 PRO HG3  1 1 
       11  6356 1 1 12 PRO N    N   -4.840  10.639  -7.189 1.00 . A A .  12 PRO N    1 1 
       11  6357 1 1 12 PRO O    O   -4.704   8.141  -9.617 1.00 . A A .  12 PRO O    1 1 
       11  6358 1 1 13 TYR C    C   -4.893   5.938  -6.445 1.00 . A A .  13 TYR C    1 1 
       11  6359 1 1 13 TYR CA   C   -3.967   6.469  -7.535 1.00 . A A .  13 TYR CA   1 1 
       11  6360 1 1 13 TYR CB   C   -2.561   5.895  -7.349 1.00 . A A .  13 TYR CB   1 1 
       11  6361 1 1 13 TYR CD1  C   -1.671   5.938  -9.712 1.00 . A A .  13 TYR CD1  1 1 
       11  6362 1 1 13 TYR CD2  C   -0.540   7.232  -8.060 1.00 . A A .  13 TYR CD2  1 1 
       11  6363 1 1 13 TYR CE1  C   -0.770   6.363 -10.669 1.00 . A A .  13 TYR CE1  1 1 
       11  6364 1 1 13 TYR CE2  C    0.365   7.663  -9.010 1.00 . A A .  13 TYR CE2  1 1 
       11  6365 1 1 13 TYR CG   C   -1.573   6.363  -8.393 1.00 . A A .  13 TYR CG   1 1 
       11  6366 1 1 13 TYR CZ   C    0.246   7.226 -10.313 1.00 . A A .  13 TYR CZ   1 1 
       11  6367 1 1 13 TYR H    H   -3.611   8.385  -6.711 1.00 . A A .  13 TYR H    1 1 
       11  6368 1 1 13 TYR HA   H   -4.347   6.159  -8.497 1.00 . A A .  13 TYR HA   1 1 
       11  6369 1 1 13 TYR HB2  H   -2.185   6.188  -6.381 1.00 . A A .  13 TYR HB2  1 1 
       11  6370 1 1 13 TYR HB3  H   -2.610   4.817  -7.399 1.00 . A A .  13 TYR HB3  1 1 
       11  6371 1 1 13 TYR HD1  H   -2.468   5.263  -9.987 1.00 . A A .  13 TYR HD1  1 1 
       11  6372 1 1 13 TYR HD2  H   -0.450   7.573  -7.039 1.00 . A A .  13 TYR HD2  1 1 
       11  6373 1 1 13 TYR HE1  H   -0.863   6.021 -11.689 1.00 . A A .  13 TYR HE1  1 1 
       11  6374 1 1 13 TYR HE2  H    1.160   8.339  -8.732 1.00 . A A .  13 TYR HE2  1 1 
       11  6375 1 1 13 TYR HH   H    1.189   7.009 -11.974 1.00 . A A .  13 TYR HH   1 1 
       11  6376 1 1 13 TYR N    N   -3.924   7.926  -7.518 1.00 . A A .  13 TYR N    1 1 
       11  6377 1 1 13 TYR O    O   -5.308   6.676  -5.552 1.00 . A A .  13 TYR O    1 1 
       11  6378 1 1 13 TYR OH   O    1.145   7.653 -11.263 1.00 . A A .  13 TYR OH   1 1 
       11  6379 1 1 14 LYS C    C   -6.055   2.499  -5.689 1.00 . A A .  14 LYS C    1 1 
       11  6380 1 1 14 LYS CA   C   -6.089   4.017  -5.547 1.00 . A A .  14 LYS CA   1 1 
       11  6381 1 1 14 LYS CB   C   -7.524   4.524  -5.712 1.00 . A A .  14 LYS CB   1 1 
       11  6382 1 1 14 LYS CD   C   -9.885   4.489  -4.857 1.00 . A A .  14 LYS CD   1 1 
       11  6383 1 1 14 LYS CE   C  -10.705   4.156  -3.619 1.00 . A A .  14 LYS CE   1 1 
       11  6384 1 1 14 LYS CG   C   -8.528   3.807  -4.826 1.00 . A A .  14 LYS CG   1 1 
       11  6385 1 1 14 LYS H    H   -4.851   4.113  -7.261 1.00 . A A .  14 LYS H    1 1 
       11  6386 1 1 14 LYS HA   H   -5.734   4.283  -4.563 1.00 . A A .  14 LYS HA   1 1 
       11  6387 1 1 14 LYS HB2  H   -7.551   5.577  -5.474 1.00 . A A .  14 LYS HB2  1 1 
       11  6388 1 1 14 LYS HB3  H   -7.824   4.389  -6.742 1.00 . A A .  14 LYS HB3  1 1 
       11  6389 1 1 14 LYS HD2  H   -9.741   5.558  -4.902 1.00 . A A .  14 LYS HD2  1 1 
       11  6390 1 1 14 LYS HD3  H  -10.424   4.159  -5.734 1.00 . A A .  14 LYS HD3  1 1 
       11  6391 1 1 14 LYS HE2  H  -10.723   3.084  -3.493 1.00 . A A .  14 LYS HE2  1 1 
       11  6392 1 1 14 LYS HE3  H  -10.236   4.612  -2.760 1.00 . A A .  14 LYS HE3  1 1 
       11  6393 1 1 14 LYS HG2  H   -8.639   2.791  -5.172 1.00 . A A .  14 LYS HG2  1 1 
       11  6394 1 1 14 LYS HG3  H   -8.159   3.805  -3.809 1.00 . A A .  14 LYS HG3  1 1 
       11  6395 1 1 14 LYS HZ1  H  -12.233   5.493  -3.128 1.00 . A A .  14 LYS HZ1  1 1 
       11  6396 1 1 14 LYS HZ2  H  -12.771   3.917  -3.426 1.00 . A A .  14 LYS HZ2  1 1 
       11  6397 1 1 14 LYS HZ3  H  -12.314   4.912  -4.715 1.00 . A A .  14 LYS HZ3  1 1 
       11  6398 1 1 14 LYS N    N   -5.213   4.651  -6.526 1.00 . A A .  14 LYS N    1 1 
       11  6399 1 1 14 LYS NZ   N  -12.103   4.655  -3.730 1.00 . A A .  14 LYS NZ   1 1 
       11  6400 1 1 14 LYS O    O   -6.301   1.960  -6.768 1.00 . A A .  14 LYS O    1 1 
       11  6401 1 1 15 CYS C    C   -7.079  -0.250  -4.720 1.00 . A A .  15 CYS C    1 1 
       11  6402 1 1 15 CYS CA   C   -5.685   0.357  -4.593 1.00 . A A .  15 CYS CA   1 1 
       11  6403 1 1 15 CYS CB   C   -5.012  -0.146  -3.315 1.00 . A A .  15 CYS CB   1 1 
       11  6404 1 1 15 CYS H    H   -5.564   2.299  -3.761 1.00 . A A .  15 CYS H    1 1 
       11  6405 1 1 15 CYS HA   H   -5.095   0.052  -5.444 1.00 . A A .  15 CYS HA   1 1 
       11  6406 1 1 15 CYS HB2  H   -4.132   0.451  -3.122 1.00 . A A .  15 CYS HB2  1 1 
       11  6407 1 1 15 CYS HB3  H   -5.700  -0.039  -2.489 1.00 . A A .  15 CYS HB3  1 1 
       11  6408 1 1 15 CYS N    N   -5.750   1.813  -4.592 1.00 . A A .  15 CYS N    1 1 
       11  6409 1 1 15 CYS O    O   -8.066   0.340  -4.281 1.00 . A A .  15 CYS O    1 1 
       11  6410 1 1 15 CYS SG   S   -4.493  -1.890  -3.384 1.00 . A A .  15 CYS SG   1 1 
       11  6411 1 1 16 ASN C    C   -8.548  -3.302  -4.550 1.00 . A A .  16 ASN C    1 1 
       11  6412 1 1 16 ASN CA   C   -8.425  -2.120  -5.506 1.00 . A A .  16 ASN CA   1 1 
       11  6413 1 1 16 ASN CB   C   -8.564  -2.601  -6.952 1.00 . A A .  16 ASN CB   1 1 
       11  6414 1 1 16 ASN CG   C   -7.911  -1.656  -7.941 1.00 . A A .  16 ASN CG   1 1 
       11  6415 1 1 16 ASN H    H   -6.330  -1.853  -5.650 1.00 . A A .  16 ASN H    1 1 
       11  6416 1 1 16 ASN HA   H   -9.215  -1.416  -5.293 1.00 . A A .  16 ASN HA   1 1 
       11  6417 1 1 16 ASN HB2  H   -8.096  -3.571  -7.048 1.00 . A A .  16 ASN HB2  1 1 
       11  6418 1 1 16 ASN HB3  H   -9.611  -2.685  -7.198 1.00 . A A .  16 ASN HB3  1 1 
       11  6419 1 1 16 ASN HD21 H   -6.116  -2.384  -7.490 1.00 . A A .  16 ASN HD21 1 1 
       11  6420 1 1 16 ASN HD22 H   -6.141  -1.131  -8.680 1.00 . A A .  16 ASN HD22 1 1 
       11  6421 1 1 16 ASN N    N   -7.152  -1.433  -5.322 1.00 . A A .  16 ASN N    1 1 
       11  6422 1 1 16 ASN ND2  N   -6.589  -1.731  -8.048 1.00 . A A .  16 ASN ND2  1 1 
       11  6423 1 1 16 ASN O    O   -9.612  -3.909  -4.433 1.00 . A A .  16 ASN O    1 1 
       11  6424 1 1 16 ASN OD1  O   -8.587  -0.867  -8.602 1.00 . A A .  16 ASN OD1  1 1 
       11  6425 1 1 17 GLU C    C   -7.912  -4.279  -1.545 1.00 . A A .  17 GLU C    1 1 
       11  6426 1 1 17 GLU CA   C   -7.439  -4.733  -2.924 1.00 . A A .  17 GLU CA   1 1 
       11  6427 1 1 17 GLU CB   C   -6.033  -5.328  -2.822 1.00 . A A .  17 GLU CB   1 1 
       11  6428 1 1 17 GLU CD   C   -5.943  -7.353  -4.329 1.00 . A A .  17 GLU CD   1 1 
       11  6429 1 1 17 GLU CG   C   -5.522  -5.910  -4.129 1.00 . A A .  17 GLU CG   1 1 
       11  6430 1 1 17 GLU H    H   -6.634  -3.101  -4.006 1.00 . A A .  17 GLU H    1 1 
       11  6431 1 1 17 GLU HA   H   -8.114  -5.490  -3.292 1.00 . A A .  17 GLU HA   1 1 
       11  6432 1 1 17 GLU HB2  H   -5.349  -4.554  -2.504 1.00 . A A .  17 GLU HB2  1 1 
       11  6433 1 1 17 GLU HB3  H   -6.041  -6.114  -2.081 1.00 . A A .  17 GLU HB3  1 1 
       11  6434 1 1 17 GLU HG2  H   -5.911  -5.321  -4.947 1.00 . A A .  17 GLU HG2  1 1 
       11  6435 1 1 17 GLU HG3  H   -4.443  -5.861  -4.133 1.00 . A A .  17 GLU HG3  1 1 
       11  6436 1 1 17 GLU N    N   -7.453  -3.623  -3.869 1.00 . A A .  17 GLU N    1 1 
       11  6437 1 1 17 GLU O    O   -8.707  -4.958  -0.895 1.00 . A A .  17 GLU O    1 1 
       11  6438 1 1 17 GLU OE1  O   -5.758  -8.160  -3.395 1.00 . A A .  17 GLU OE1  1 1 
       11  6439 1 1 17 GLU OE2  O   -6.458  -7.674  -5.420 1.00 . A A .  17 GLU OE2  1 1 
       11  6440 1 1 18 CYS C    C   -8.462  -1.221   0.042 1.00 . A A .  18 CYS C    1 1 
       11  6441 1 1 18 CYS CA   C   -7.787  -2.582   0.194 1.00 . A A .  18 CYS CA   1 1 
       11  6442 1 1 18 CYS CB   C   -6.552  -2.453   1.087 1.00 . A A .  18 CYS CB   1 1 
       11  6443 1 1 18 CYS H    H   -6.787  -2.631  -1.670 1.00 . A A .  18 CYS H    1 1 
       11  6444 1 1 18 CYS HA   H   -8.484  -3.265   0.655 1.00 . A A .  18 CYS HA   1 1 
       11  6445 1 1 18 CYS HB2  H   -6.840  -2.001   2.025 1.00 . A A .  18 CYS HB2  1 1 
       11  6446 1 1 18 CYS HB3  H   -6.150  -3.438   1.277 1.00 . A A .  18 CYS HB3  1 1 
       11  6447 1 1 18 CYS N    N   -7.417  -3.127  -1.106 1.00 . A A .  18 CYS N    1 1 
       11  6448 1 1 18 CYS O    O   -9.503  -0.962   0.644 1.00 . A A .  18 CYS O    1 1 
       11  6449 1 1 18 CYS SG   S   -5.219  -1.439   0.371 1.00 . A A .  18 CYS SG   1 1 
       11  6450 1 1 19 GLY C    C   -7.471   2.071  -0.554 1.00 . A A .  19 GLY C    1 1 
       11  6451 1 1 19 GLY CA   C   -8.416   0.967  -0.986 1.00 . A A .  19 GLY CA   1 1 
       11  6452 1 1 19 GLY H    H   -7.032  -0.618  -1.222 1.00 . A A .  19 GLY H    1 1 
       11  6453 1 1 19 GLY HA2  H   -8.635   1.085  -2.036 1.00 . A A .  19 GLY HA2  1 1 
       11  6454 1 1 19 GLY HA3  H   -9.335   1.055  -0.424 1.00 . A A .  19 GLY HA3  1 1 
       11  6455 1 1 19 GLY N    N   -7.860  -0.356  -0.768 1.00 . A A .  19 GLY N    1 1 
       11  6456 1 1 19 GLY O    O   -7.904   3.175  -0.222 1.00 . A A .  19 GLY O    1 1 
       11  6457 1 1 20 LYS C    C   -4.777   3.636  -1.341 1.00 . A A .  20 LYS C    1 1 
       11  6458 1 1 20 LYS CA   C   -5.166   2.749  -0.163 1.00 . A A .  20 LYS CA   1 1 
       11  6459 1 1 20 LYS CB   C   -3.927   2.037   0.385 1.00 . A A .  20 LYS CB   1 1 
       11  6460 1 1 20 LYS CD   C   -2.483   4.067   0.707 1.00 . A A .  20 LYS CD   1 1 
       11  6461 1 1 20 LYS CE   C   -1.856   5.006   1.727 1.00 . A A .  20 LYS CE   1 1 
       11  6462 1 1 20 LYS CG   C   -3.136   2.871   1.378 1.00 . A A .  20 LYS CG   1 1 
       11  6463 1 1 20 LYS H    H   -5.892   0.877  -0.832 1.00 . A A .  20 LYS H    1 1 
       11  6464 1 1 20 LYS HA   H   -5.589   3.368   0.614 1.00 . A A .  20 LYS HA   1 1 
       11  6465 1 1 20 LYS HB2  H   -4.238   1.128   0.877 1.00 . A A .  20 LYS HB2  1 1 
       11  6466 1 1 20 LYS HB3  H   -3.277   1.786  -0.440 1.00 . A A .  20 LYS HB3  1 1 
       11  6467 1 1 20 LYS HD2  H   -1.713   3.717   0.036 1.00 . A A .  20 LYS HD2  1 1 
       11  6468 1 1 20 LYS HD3  H   -3.233   4.608   0.146 1.00 . A A .  20 LYS HD3  1 1 
       11  6469 1 1 20 LYS HE2  H   -1.312   4.418   2.450 1.00 . A A .  20 LYS HE2  1 1 
       11  6470 1 1 20 LYS HE3  H   -1.174   5.668   1.215 1.00 . A A .  20 LYS HE3  1 1 
       11  6471 1 1 20 LYS HG2  H   -3.804   3.225   2.150 1.00 . A A .  20 LYS HG2  1 1 
       11  6472 1 1 20 LYS HG3  H   -2.368   2.254   1.821 1.00 . A A .  20 LYS HG3  1 1 
       11  6473 1 1 20 LYS HZ1  H   -2.919   5.551   3.440 1.00 . A A .  20 LYS HZ1  1 1 
       11  6474 1 1 20 LYS HZ2  H   -3.819   5.662   2.011 1.00 . A A .  20 LYS HZ2  1 1 
       11  6475 1 1 20 LYS HZ3  H   -2.648   6.830   2.366 1.00 . A A .  20 LYS HZ3  1 1 
       11  6476 1 1 20 LYS N    N   -6.176   1.774  -0.557 1.00 . A A .  20 LYS N    1 1 
       11  6477 1 1 20 LYS NZ   N   -2.882   5.819   2.436 1.00 . A A .  20 LYS NZ   1 1 
       11  6478 1 1 20 LYS O    O   -4.268   3.152  -2.352 1.00 . A A .  20 LYS O    1 1 
       11  6479 1 1 21 ALA C    C   -3.342   6.554  -1.991 1.00 . A A .  21 ALA C    1 1 
       11  6480 1 1 21 ALA CA   C   -4.689   5.889  -2.255 1.00 . A A .  21 ALA CA   1 1 
       11  6481 1 1 21 ALA CB   C   -5.784   6.939  -2.377 1.00 . A A .  21 ALA CB   1 1 
       11  6482 1 1 21 ALA H    H   -5.426   5.260  -0.374 1.00 . A A .  21 ALA H    1 1 
       11  6483 1 1 21 ALA HA   H   -4.636   5.350  -3.190 1.00 . A A .  21 ALA HA   1 1 
       11  6484 1 1 21 ALA HB1  H   -6.003   7.344  -1.400 1.00 . A A .  21 ALA HB1  1 1 
       11  6485 1 1 21 ALA HB2  H   -5.449   7.733  -3.029 1.00 . A A .  21 ALA HB2  1 1 
       11  6486 1 1 21 ALA HB3  H   -6.673   6.486  -2.788 1.00 . A A .  21 ALA HB3  1 1 
       11  6487 1 1 21 ALA N    N   -5.018   4.935  -1.203 1.00 . A A .  21 ALA N    1 1 
       11  6488 1 1 21 ALA O    O   -3.100   7.079  -0.904 1.00 . A A .  21 ALA O    1 1 
       11  6489 1 1 22 PHE C    C   -1.054   8.419  -3.675 1.00 . A A .  22 PHE C    1 1 
       11  6490 1 1 22 PHE CA   C   -1.145   7.127  -2.868 1.00 . A A .  22 PHE CA   1 1 
       11  6491 1 1 22 PHE CB   C   -0.070   6.144  -3.336 1.00 . A A .  22 PHE CB   1 1 
       11  6492 1 1 22 PHE CD1  C   -1.140   3.876  -3.221 1.00 . A A .  22 PHE CD1  1 1 
       11  6493 1 1 22 PHE CD2  C    0.602   4.388  -1.674 1.00 . A A .  22 PHE CD2  1 1 
       11  6494 1 1 22 PHE CE1  C   -1.266   2.617  -2.666 1.00 . A A .  22 PHE CE1  1 1 
       11  6495 1 1 22 PHE CE2  C    0.480   3.130  -1.115 1.00 . A A .  22 PHE CE2  1 1 
       11  6496 1 1 22 PHE CG   C   -0.206   4.775  -2.731 1.00 . A A .  22 PHE CG   1 1 
       11  6497 1 1 22 PHE CZ   C   -0.455   2.243  -1.612 1.00 . A A .  22 PHE CZ   1 1 
       11  6498 1 1 22 PHE H    H   -2.720   6.094  -3.835 1.00 . A A .  22 PHE H    1 1 
       11  6499 1 1 22 PHE HA   H   -0.982   7.355  -1.826 1.00 . A A .  22 PHE HA   1 1 
       11  6500 1 1 22 PHE HB2  H   -0.131   6.039  -4.409 1.00 . A A .  22 PHE HB2  1 1 
       11  6501 1 1 22 PHE HB3  H    0.902   6.531  -3.071 1.00 . A A .  22 PHE HB3  1 1 
       11  6502 1 1 22 PHE HD1  H   -1.774   4.167  -4.045 1.00 . A A .  22 PHE HD1  1 1 
       11  6503 1 1 22 PHE HD2  H    1.334   5.081  -1.285 1.00 . A A .  22 PHE HD2  1 1 
       11  6504 1 1 22 PHE HE1  H   -1.998   1.925  -3.056 1.00 . A A .  22 PHE HE1  1 1 
       11  6505 1 1 22 PHE HE2  H    1.116   2.841  -0.292 1.00 . A A .  22 PHE HE2  1 1 
       11  6506 1 1 22 PHE HZ   H   -0.552   1.260  -1.177 1.00 . A A .  22 PHE HZ   1 1 
       11  6507 1 1 22 PHE N    N   -2.469   6.528  -2.992 1.00 . A A .  22 PHE N    1 1 
       11  6508 1 1 22 PHE O    O   -2.042   8.873  -4.253 1.00 . A A .  22 PHE O    1 1 
       11  6509 1 1 23 ARG C    C    1.179   9.994  -5.702 1.00 . A A .  23 ARG C    1 1 
       11  6510 1 1 23 ARG CA   C    0.357  10.247  -4.442 1.00 . A A .  23 ARG CA   1 1 
       11  6511 1 1 23 ARG CB   C    1.067  11.271  -3.554 1.00 . A A .  23 ARG CB   1 1 
       11  6512 1 1 23 ARG CD   C   -0.030  13.504  -3.906 1.00 . A A .  23 ARG CD   1 1 
       11  6513 1 1 23 ARG CG   C    1.192  12.645  -4.190 1.00 . A A .  23 ARG CG   1 1 
       11  6514 1 1 23 ARG CZ   C   -0.732  15.850  -4.123 1.00 . A A .  23 ARG CZ   1 1 
       11  6515 1 1 23 ARG H    H    0.886   8.597  -3.227 1.00 . A A .  23 ARG H    1 1 
       11  6516 1 1 23 ARG HA   H   -0.607  10.639  -4.728 1.00 . A A .  23 ARG HA   1 1 
       11  6517 1 1 23 ARG HB2  H    0.515  11.374  -2.631 1.00 . A A .  23 ARG HB2  1 1 
       11  6518 1 1 23 ARG HB3  H    2.060  10.909  -3.331 1.00 . A A .  23 ARG HB3  1 1 
       11  6519 1 1 23 ARG HD2  H   -0.868  13.108  -4.459 1.00 . A A .  23 ARG HD2  1 1 
       11  6520 1 1 23 ARG HD3  H   -0.245  13.462  -2.848 1.00 . A A .  23 ARG HD3  1 1 
       11  6521 1 1 23 ARG HE   H    1.038  15.132  -4.698 1.00 . A A .  23 ARG HE   1 1 
       11  6522 1 1 23 ARG HG2  H    2.066  13.139  -3.790 1.00 . A A .  23 ARG HG2  1 1 
       11  6523 1 1 23 ARG HG3  H    1.300  12.529  -5.258 1.00 . A A .  23 ARG HG3  1 1 
       11  6524 1 1 23 ARG HH11 H   -2.106  14.626  -3.290 1.00 . A A .  23 ARG HH11 1 1 
       11  6525 1 1 23 ARG HH12 H   -2.588  16.282  -3.449 1.00 . A A .  23 ARG HH12 1 1 
       11  6526 1 1 23 ARG HH21 H    0.415  17.316  -4.913 1.00 . A A .  23 ARG HH21 1 1 
       11  6527 1 1 23 ARG HH22 H   -1.154  17.811  -4.373 1.00 . A A .  23 ARG HH22 1 1 
       11  6528 1 1 23 ARG N    N    0.137   9.007  -3.708 1.00 . A A .  23 ARG N    1 1 
       11  6529 1 1 23 ARG NE   N    0.178  14.897  -4.292 1.00 . A A .  23 ARG NE   1 1 
       11  6530 1 1 23 ARG NH1  N   -1.905  15.562  -3.576 1.00 . A A .  23 ARG NH1  1 1 
       11  6531 1 1 23 ARG NH2  N   -0.469  17.095  -4.501 1.00 . A A .  23 ARG NH2  1 1 
       11  6532 1 1 23 ARG O    O    1.028  10.694  -6.704 1.00 . A A .  23 ARG O    1 1 
       11  6533 1 1 24 ALA C    C    2.764   7.166  -7.131 1.00 . A A .  24 ALA C    1 1 
       11  6534 1 1 24 ALA CA   C    2.893   8.645  -6.781 1.00 . A A .  24 ALA CA   1 1 
       11  6535 1 1 24 ALA CB   C    4.343   8.996  -6.487 1.00 . A A .  24 ALA CB   1 1 
       11  6536 1 1 24 ALA H    H    2.122   8.470  -4.818 1.00 . A A .  24 ALA H    1 1 
       11  6537 1 1 24 ALA HA   H    2.570   9.234  -7.628 1.00 . A A .  24 ALA HA   1 1 
       11  6538 1 1 24 ALA HB1  H    4.394   9.984  -6.054 1.00 . A A .  24 ALA HB1  1 1 
       11  6539 1 1 24 ALA HB2  H    4.753   8.277  -5.793 1.00 . A A .  24 ALA HB2  1 1 
       11  6540 1 1 24 ALA HB3  H    4.912   8.976  -7.405 1.00 . A A .  24 ALA HB3  1 1 
       11  6541 1 1 24 ALA N    N    2.048   8.991  -5.645 1.00 . A A .  24 ALA N    1 1 
       11  6542 1 1 24 ALA O    O    2.327   6.360  -6.309 1.00 . A A .  24 ALA O    1 1 
       11  6543 1 1 25 ARG C    C    3.943   4.527  -7.946 1.00 . A A .  25 ARG C    1 1 
       11  6544 1 1 25 ARG CA   C    3.074   5.435  -8.812 1.00 . A A .  25 ARG CA   1 1 
       11  6545 1 1 25 ARG CB   C    3.515   5.335 -10.274 1.00 . A A .  25 ARG CB   1 1 
       11  6546 1 1 25 ARG CD   C    1.562   4.285 -11.459 1.00 . A A .  25 ARG CD   1 1 
       11  6547 1 1 25 ARG CG   C    2.995   4.096 -10.984 1.00 . A A .  25 ARG CG   1 1 
       11  6548 1 1 25 ARG CZ   C    0.475   4.961 -13.558 1.00 . A A .  25 ARG CZ   1 1 
       11  6549 1 1 25 ARG H    H    3.489   7.505  -8.964 1.00 . A A .  25 ARG H    1 1 
       11  6550 1 1 25 ARG HA   H    2.047   5.113  -8.732 1.00 . A A .  25 ARG HA   1 1 
       11  6551 1 1 25 ARG HB2  H    3.156   6.204 -10.806 1.00 . A A .  25 ARG HB2  1 1 
       11  6552 1 1 25 ARG HB3  H    4.593   5.319 -10.312 1.00 . A A .  25 ARG HB3  1 1 
       11  6553 1 1 25 ARG HD2  H    1.115   3.314 -11.608 1.00 . A A .  25 ARG HD2  1 1 
       11  6554 1 1 25 ARG HD3  H    1.013   4.820 -10.698 1.00 . A A .  25 ARG HD3  1 1 
       11  6555 1 1 25 ARG HE   H    2.248   5.623 -12.928 1.00 . A A .  25 ARG HE   1 1 
       11  6556 1 1 25 ARG HG2  H    3.622   3.892 -11.839 1.00 . A A .  25 ARG HG2  1 1 
       11  6557 1 1 25 ARG HG3  H    3.031   3.260 -10.301 1.00 . A A .  25 ARG HG3  1 1 
       11  6558 1 1 25 ARG HH11 H   -0.570   3.636 -12.447 1.00 . A A .  25 ARG HH11 1 1 
       11  6559 1 1 25 ARG HH12 H   -1.325   4.121 -13.929 1.00 . A A .  25 ARG HH12 1 1 
       11  6560 1 1 25 ARG HH21 H    1.264   6.269 -14.881 1.00 . A A .  25 ARG HH21 1 1 
       11  6561 1 1 25 ARG HH22 H   -0.280   5.618 -15.313 1.00 . A A .  25 ARG HH22 1 1 
       11  6562 1 1 25 ARG N    N    3.148   6.817  -8.354 1.00 . A A .  25 ARG N    1 1 
       11  6563 1 1 25 ARG NE   N    1.495   5.035 -12.710 1.00 . A A .  25 ARG NE   1 1 
       11  6564 1 1 25 ARG NH1  N   -0.558   4.174 -13.289 1.00 . A A .  25 ARG NH1  1 1 
       11  6565 1 1 25 ARG NH2  N    0.487   5.675 -14.676 1.00 . A A .  25 ARG NH2  1 1 
       11  6566 1 1 25 ARG O    O    3.463   3.540  -7.388 1.00 . A A .  25 ARG O    1 1 
       11  6567 1 1 26 SER C    C    5.561   3.738  -5.683 1.00 . A A .  26 SER C    1 1 
       11  6568 1 1 26 SER CA   C    6.159   4.083  -7.043 1.00 . A A .  26 SER CA   1 1 
       11  6569 1 1 26 SER CB   C    7.471   4.848  -6.857 1.00 . A A .  26 SER CB   1 1 
       11  6570 1 1 26 SER H    H    5.545   5.667  -8.307 1.00 . A A .  26 SER H    1 1 
       11  6571 1 1 26 SER HA   H    6.360   3.166  -7.578 1.00 . A A .  26 SER HA   1 1 
       11  6572 1 1 26 SER HB2  H    7.665   5.444  -7.736 1.00 . A A .  26 SER HB2  1 1 
       11  6573 1 1 26 SER HB3  H    7.388   5.494  -5.995 1.00 . A A .  26 SER HB3  1 1 
       11  6574 1 1 26 SER HG   H    8.484   3.553  -5.792 1.00 . A A .  26 SER HG   1 1 
       11  6575 1 1 26 SER N    N    5.223   4.869  -7.838 1.00 . A A .  26 SER N    1 1 
       11  6576 1 1 26 SER O    O    5.760   2.639  -5.165 1.00 . A A .  26 SER O    1 1 
       11  6577 1 1 26 SER OG   O    8.556   3.959  -6.659 1.00 . A A .  26 SER OG   1 1 
       11  6578 1 1 27 SER C    C    3.132   3.400  -3.879 1.00 . A A .  27 SER C    1 1 
       11  6579 1 1 27 SER CA   C    4.202   4.485  -3.807 1.00 . A A .  27 SER CA   1 1 
       11  6580 1 1 27 SER CB   C    3.585   5.793  -3.306 1.00 . A A .  27 SER CB   1 1 
       11  6581 1 1 27 SER H    H    4.705   5.541  -5.571 1.00 . A A .  27 SER H    1 1 
       11  6582 1 1 27 SER HA   H    4.970   4.172  -3.115 1.00 . A A .  27 SER HA   1 1 
       11  6583 1 1 27 SER HB2  H    3.079   6.285  -4.123 1.00 . A A .  27 SER HB2  1 1 
       11  6584 1 1 27 SER HB3  H    2.875   5.575  -2.521 1.00 . A A .  27 SER HB3  1 1 
       11  6585 1 1 27 SER HG   H    4.208   7.192  -2.085 1.00 . A A .  27 SER HG   1 1 
       11  6586 1 1 27 SER N    N    4.827   4.686  -5.109 1.00 . A A .  27 SER N    1 1 
       11  6587 1 1 27 SER O    O    2.963   2.615  -2.945 1.00 . A A .  27 SER O    1 1 
       11  6588 1 1 27 SER OG   O    4.580   6.663  -2.795 1.00 . A A .  27 SER OG   1 1 
       11  6589 1 1 28 LEU C    C    1.947   1.001  -5.496 1.00 . A A .  28 LEU C    1 1 
       11  6590 1 1 28 LEU CA   C    1.357   2.374  -5.190 1.00 . A A .  28 LEU CA   1 1 
       11  6591 1 1 28 LEU CB   C    0.429   2.807  -6.327 1.00 . A A .  28 LEU CB   1 1 
       11  6592 1 1 28 LEU CD1  C   -1.815   1.801  -5.845 1.00 . A A .  28 LEU CD1  1 1 
       11  6593 1 1 28 LEU CD2  C   -1.038   2.042  -8.210 1.00 . A A .  28 LEU CD2  1 1 
       11  6594 1 1 28 LEU CG   C   -0.611   1.779  -6.774 1.00 . A A .  28 LEU CG   1 1 
       11  6595 1 1 28 LEU H    H    2.592   4.014  -5.703 1.00 . A A .  28 LEU H    1 1 
       11  6596 1 1 28 LEU HA   H    0.786   2.312  -4.275 1.00 . A A .  28 LEU HA   1 1 
       11  6597 1 1 28 LEU HB2  H   -0.097   3.692  -6.005 1.00 . A A .  28 LEU HB2  1 1 
       11  6598 1 1 28 LEU HB3  H    1.046   3.048  -7.182 1.00 . A A .  28 LEU HB3  1 1 
       11  6599 1 1 28 LEU HD11 H   -2.680   1.423  -6.369 1.00 . A A .  28 LEU HD11 1 1 
       11  6600 1 1 28 LEU HD12 H   -2.004   2.815  -5.524 1.00 . A A .  28 LEU HD12 1 1 
       11  6601 1 1 28 LEU HD13 H   -1.616   1.182  -4.983 1.00 . A A .  28 LEU HD13 1 1 
       11  6602 1 1 28 LEU HD21 H   -2.045   2.431  -8.221 1.00 . A A .  28 LEU HD21 1 1 
       11  6603 1 1 28 LEU HD22 H   -1.003   1.119  -8.770 1.00 . A A .  28 LEU HD22 1 1 
       11  6604 1 1 28 LEU HD23 H   -0.368   2.761  -8.659 1.00 . A A .  28 LEU HD23 1 1 
       11  6605 1 1 28 LEU HG   H   -0.174   0.791  -6.729 1.00 . A A .  28 LEU HG   1 1 
       11  6606 1 1 28 LEU N    N    2.411   3.362  -4.994 1.00 . A A .  28 LEU N    1 1 
       11  6607 1 1 28 LEU O    O    1.445  -0.020  -5.026 1.00 . A A .  28 LEU O    1 1 
       11  6608 1 1 29 ALA C    C    4.178  -1.001  -5.411 1.00 . A A .  29 ALA C    1 1 
       11  6609 1 1 29 ALA CA   C    3.678  -0.262  -6.648 1.00 . A A .  29 ALA CA   1 1 
       11  6610 1 1 29 ALA CB   C    4.831   0.011  -7.603 1.00 . A A .  29 ALA CB   1 1 
       11  6611 1 1 29 ALA H    H    3.371   1.831  -6.627 1.00 . A A .  29 ALA H    1 1 
       11  6612 1 1 29 ALA HA   H    2.959  -0.885  -7.160 1.00 . A A .  29 ALA HA   1 1 
       11  6613 1 1 29 ALA HB1  H    5.724  -0.473  -7.237 1.00 . A A .  29 ALA HB1  1 1 
       11  6614 1 1 29 ALA HB2  H    4.586  -0.376  -8.581 1.00 . A A .  29 ALA HB2  1 1 
       11  6615 1 1 29 ALA HB3  H    4.999   1.076  -7.668 1.00 . A A .  29 ALA HB3  1 1 
       11  6616 1 1 29 ALA N    N    3.017   0.984  -6.284 1.00 . A A .  29 ALA N    1 1 
       11  6617 1 1 29 ALA O    O    3.713  -2.098  -5.101 1.00 . A A .  29 ALA O    1 1 
       11  6618 1 1 30 ILE C    C    4.610  -1.689  -2.682 1.00 . A A .  30 ILE C    1 1 
       11  6619 1 1 30 ILE CA   C    5.689  -0.993  -3.504 1.00 . A A .  30 ILE CA   1 1 
       11  6620 1 1 30 ILE CB   C    6.390   0.059  -2.625 1.00 . A A .  30 ILE CB   1 1 
       11  6621 1 1 30 ILE CD1  C    7.831   2.136  -2.927 1.00 . A A .  30 ILE CD1  1 1 
       11  6622 1 1 30 ILE CG1  C    7.523   0.733  -3.403 1.00 . A A .  30 ILE CG1  1 1 
       11  6623 1 1 30 ILE CG2  C    6.923  -0.584  -1.353 1.00 . A A .  30 ILE CG2  1 1 
       11  6624 1 1 30 ILE H    H    5.458   0.480  -5.005 1.00 . A A .  30 ILE H    1 1 
       11  6625 1 1 30 ILE HA   H    6.423  -1.725  -3.809 1.00 . A A .  30 ILE HA   1 1 
       11  6626 1 1 30 ILE HB   H    5.662   0.805  -2.345 1.00 . A A .  30 ILE HB   1 1 
       11  6627 1 1 30 ILE HD11 H    8.176   2.730  -3.761 1.00 . A A .  30 ILE HD11 1 1 
       11  6628 1 1 30 ILE HD12 H    6.937   2.581  -2.516 1.00 . A A .  30 ILE HD12 1 1 
       11  6629 1 1 30 ILE HD13 H    8.598   2.099  -2.169 1.00 . A A .  30 ILE HD13 1 1 
       11  6630 1 1 30 ILE HG12 H    8.421   0.144  -3.301 1.00 . A A .  30 ILE HG12 1 1 
       11  6631 1 1 30 ILE HG13 H    7.249   0.788  -4.446 1.00 . A A .  30 ILE HG13 1 1 
       11  6632 1 1 30 ILE HG21 H    6.411  -1.519  -1.181 1.00 . A A .  30 ILE HG21 1 1 
       11  6633 1 1 30 ILE HG22 H    7.982  -0.768  -1.460 1.00 . A A .  30 ILE HG22 1 1 
       11  6634 1 1 30 ILE HG23 H    6.755   0.078  -0.517 1.00 . A A .  30 ILE HG23 1 1 
       11  6635 1 1 30 ILE N    N    5.128  -0.393  -4.708 1.00 . A A .  30 ILE N    1 1 
       11  6636 1 1 30 ILE O    O    4.835  -2.765  -2.127 1.00 . A A .  30 ILE O    1 1 
       11  6637 1 1 31 HIS C    C    1.693  -2.801  -2.607 1.00 . A A .  31 HIS C    1 1 
       11  6638 1 1 31 HIS CA   C    2.320  -1.630  -1.857 1.00 . A A .  31 HIS CA   1 1 
       11  6639 1 1 31 HIS CB   C    1.266  -0.555  -1.591 1.00 . A A .  31 HIS CB   1 1 
       11  6640 1 1 31 HIS CD2  C   -1.284  -1.020  -1.683 1.00 . A A .  31 HIS CD2  1 1 
       11  6641 1 1 31 HIS CE1  C   -1.462  -2.196   0.160 1.00 . A A .  31 HIS CE1  1 1 
       11  6642 1 1 31 HIS CG   C   -0.050  -1.107  -1.134 1.00 . A A .  31 HIS CG   1 1 
       11  6643 1 1 31 HIS H    H    3.319  -0.214  -3.073 1.00 . A A .  31 HIS H    1 1 
       11  6644 1 1 31 HIS HA   H    2.703  -1.987  -0.913 1.00 . A A .  31 HIS HA   1 1 
       11  6645 1 1 31 HIS HB2  H    1.628   0.114  -0.824 1.00 . A A .  31 HIS HB2  1 1 
       11  6646 1 1 31 HIS HB3  H    1.094   0.005  -2.499 1.00 . A A .  31 HIS HB3  1 1 
       11  6647 1 1 31 HIS HD1  H    0.523  -2.086   0.641 1.00 . A A .  31 HIS HD1  1 1 
       11  6648 1 1 31 HIS HD2  H   -1.545  -0.508  -2.598 1.00 . A A .  31 HIS HD2  1 1 
       11  6649 1 1 31 HIS HE1  H   -1.872  -2.780   0.970 1.00 . A A .  31 HIS HE1  1 1 
       11  6650 1 1 31 HIS N    N    3.437  -1.069  -2.609 1.00 . A A .  31 HIS N    1 1 
       11  6651 1 1 31 HIS ND1  N   -0.195  -1.848   0.019 1.00 . A A .  31 HIS ND1  1 1 
       11  6652 1 1 31 HIS NE2  N   -2.144  -1.705  -0.860 1.00 . A A .  31 HIS NE2  1 1 
       11  6653 1 1 31 HIS O    O    1.488  -3.874  -2.041 1.00 . A A .  31 HIS O    1 1 
       11  6654 1 1 32 GLN C    C    1.545  -4.938  -4.576 1.00 . A A .  32 GLN C    1 1 
       11  6655 1 1 32 GLN CA   C    0.785  -3.622  -4.710 1.00 . A A .  32 GLN CA   1 1 
       11  6656 1 1 32 GLN CB   C    0.755  -3.184  -6.175 1.00 . A A .  32 GLN CB   1 1 
       11  6657 1 1 32 GLN CD   C   -1.650  -2.555  -6.626 1.00 . A A .  32 GLN CD   1 1 
       11  6658 1 1 32 GLN CG   C   -0.228  -2.059  -6.454 1.00 . A A .  32 GLN CG   1 1 
       11  6659 1 1 32 GLN H    H    1.578  -1.708  -4.278 1.00 . A A .  32 GLN H    1 1 
       11  6660 1 1 32 GLN HA   H   -0.228  -3.770  -4.367 1.00 . A A .  32 GLN HA   1 1 
       11  6661 1 1 32 GLN HB2  H    1.742  -2.850  -6.459 1.00 . A A .  32 GLN HB2  1 1 
       11  6662 1 1 32 GLN HB3  H    0.481  -4.031  -6.786 1.00 . A A .  32 GLN HB3  1 1 
       11  6663 1 1 32 GLN HE21 H   -2.324  -0.685  -6.668 1.00 . A A .  32 GLN HE21 1 1 
       11  6664 1 1 32 GLN HE22 H   -3.523  -1.919  -6.828 1.00 . A A .  32 GLN HE22 1 1 
       11  6665 1 1 32 GLN HG2  H   -0.204  -1.364  -5.627 1.00 . A A .  32 GLN HG2  1 1 
       11  6666 1 1 32 GLN HG3  H    0.073  -1.551  -7.358 1.00 . A A .  32 GLN HG3  1 1 
       11  6667 1 1 32 GLN N    N    1.390  -2.585  -3.883 1.00 . A A .  32 GLN N    1 1 
       11  6668 1 1 32 GLN NE2  N   -2.595  -1.626  -6.716 1.00 . A A .  32 GLN NE2  1 1 
       11  6669 1 1 32 GLN O    O    1.020  -6.004  -4.896 1.00 . A A .  32 GLN O    1 1 
       11  6670 1 1 32 GLN OE1  O   -1.897  -3.760  -6.677 1.00 . A A .  32 GLN OE1  1 1 
       11  6671 1 1 33 ALA C    C    3.262  -6.768  -2.632 1.00 . A A .  33 ALA C    1 1 
       11  6672 1 1 33 ALA CA   C    3.615  -6.038  -3.923 1.00 . A A .  33 ALA CA   1 1 
       11  6673 1 1 33 ALA CB   C    5.087  -5.655  -3.930 1.00 . A A .  33 ALA CB   1 1 
       11  6674 1 1 33 ALA H    H    3.146  -3.976  -3.864 1.00 . A A .  33 ALA H    1 1 
       11  6675 1 1 33 ALA HA   H    3.436  -6.700  -4.759 1.00 . A A .  33 ALA HA   1 1 
       11  6676 1 1 33 ALA HB1  H    5.679  -6.496  -3.602 1.00 . A A .  33 ALA HB1  1 1 
       11  6677 1 1 33 ALA HB2  H    5.381  -5.376  -4.932 1.00 . A A .  33 ALA HB2  1 1 
       11  6678 1 1 33 ALA HB3  H    5.245  -4.821  -3.263 1.00 . A A .  33 ALA HB3  1 1 
       11  6679 1 1 33 ALA N    N    2.783  -4.854  -4.101 1.00 . A A .  33 ALA N    1 1 
       11  6680 1 1 33 ALA O    O    4.007  -7.633  -2.171 1.00 . A A .  33 ALA O    1 1 
       11  6681 1 1 34 THR C    C    0.384  -7.823  -1.026 1.00 . A A .  34 THR C    1 1 
       11  6682 1 1 34 THR CA   C    1.670  -7.033  -0.810 1.00 . A A .  34 THR CA   1 1 
       11  6683 1 1 34 THR CB   C    1.434  -5.981   0.291 1.00 . A A .  34 THR CB   1 1 
       11  6684 1 1 34 THR CG2  C    2.704  -5.189   0.563 1.00 . A A .  34 THR CG2  1 1 
       11  6685 1 1 34 THR H    H    1.569  -5.717  -2.465 1.00 . A A .  34 THR H    1 1 
       11  6686 1 1 34 THR HA   H    2.444  -7.708  -0.474 1.00 . A A .  34 THR HA   1 1 
       11  6687 1 1 34 THR HB   H    1.143  -6.490   1.198 1.00 . A A .  34 THR HB   1 1 
       11  6688 1 1 34 THR HG1  H    0.164  -4.512   0.634 1.00 . A A .  34 THR HG1  1 1 
       11  6689 1 1 34 THR HG21 H    3.562  -5.835   0.450 1.00 . A A .  34 THR HG21 1 1 
       11  6690 1 1 34 THR HG22 H    2.677  -4.801   1.571 1.00 . A A .  34 THR HG22 1 1 
       11  6691 1 1 34 THR HG23 H    2.775  -4.370  -0.136 1.00 . A A .  34 THR HG23 1 1 
       11  6692 1 1 34 THR N    N    2.120  -6.413  -2.050 1.00 . A A .  34 THR N    1 1 
       11  6693 1 1 34 THR O    O    0.098  -8.774  -0.297 1.00 . A A .  34 THR O    1 1 
       11  6694 1 1 34 THR OG1  O    0.385  -5.089  -0.101 1.00 . A A .  34 THR OG1  1 1 
       11  6695 1 1 35 HIS C    C   -1.416  -9.252  -3.312 1.00 . A A .  35 HIS C    1 1 
       11  6696 1 1 35 HIS CA   C   -1.645  -8.096  -2.343 1.00 . A A .  35 HIS CA   1 1 
       11  6697 1 1 35 HIS CB   C   -2.644  -7.105  -2.941 1.00 . A A .  35 HIS CB   1 1 
       11  6698 1 1 35 HIS CD2  C   -2.919  -4.777  -1.830 1.00 . A A .  35 HIS CD2  1 1 
       11  6699 1 1 35 HIS CE1  C   -4.303  -5.347  -0.229 1.00 . A A .  35 HIS CE1  1 1 
       11  6700 1 1 35 HIS CG   C   -3.158  -6.104  -1.953 1.00 . A A .  35 HIS CG   1 1 
       11  6701 1 1 35 HIS H    H   -0.107  -6.659  -2.576 1.00 . A A .  35 HIS H    1 1 
       11  6702 1 1 35 HIS HA   H   -2.048  -8.489  -1.423 1.00 . A A .  35 HIS HA   1 1 
       11  6703 1 1 35 HIS HB2  H   -2.166  -6.563  -3.744 1.00 . A A .  35 HIS HB2  1 1 
       11  6704 1 1 35 HIS HB3  H   -3.490  -7.649  -3.334 1.00 . A A .  35 HIS HB3  1 1 
       11  6705 1 1 35 HIS HD1  H   -4.391  -7.322  -0.756 1.00 . A A .  35 HIS HD1  1 1 
       11  6706 1 1 35 HIS HD2  H   -2.278  -4.179  -2.464 1.00 . A A .  35 HIS HD2  1 1 
       11  6707 1 1 35 HIS HE1  H   -4.956  -5.301   0.629 1.00 . A A .  35 HIS HE1  1 1 
       11  6708 1 1 35 HIS N    N   -0.389  -7.424  -2.031 1.00 . A A .  35 HIS N    1 1 
       11  6709 1 1 35 HIS ND1  N   -4.028  -6.430  -0.934 1.00 . A A .  35 HIS ND1  1 1 
       11  6710 1 1 35 HIS NE2  N   -3.642  -4.330  -0.752 1.00 . A A .  35 HIS NE2  1 1 
       11  6711 1 1 35 HIS O    O   -1.597 -10.417  -2.958 1.00 . A A .  35 HIS O    1 1 
       11  6712 1 1 36 SER C    C    0.632 -10.522  -5.409 1.00 . A A .  36 SER C    1 1 
       11  6713 1 1 36 SER CA   C   -0.768  -9.932  -5.558 1.00 . A A .  36 SER CA   1 1 
       11  6714 1 1 36 SER CB   C   -0.933  -9.328  -6.954 1.00 . A A .  36 SER CB   1 1 
       11  6715 1 1 36 SER H    H   -0.890  -7.976  -4.758 1.00 . A A .  36 SER H    1 1 
       11  6716 1 1 36 SER HA   H   -1.493 -10.721  -5.428 1.00 . A A .  36 SER HA   1 1 
       11  6717 1 1 36 SER HB2  H   -0.848 -10.110  -7.694 1.00 . A A .  36 SER HB2  1 1 
       11  6718 1 1 36 SER HB3  H   -1.907  -8.866  -7.030 1.00 . A A .  36 SER HB3  1 1 
       11  6719 1 1 36 SER HG   H    0.360  -7.975  -6.375 1.00 . A A .  36 SER HG   1 1 
       11  6720 1 1 36 SER N    N   -1.017  -8.922  -4.537 1.00 . A A .  36 SER N    1 1 
       11  6721 1 1 36 SER O    O    1.511  -9.916  -4.798 1.00 . A A .  36 SER O    1 1 
       11  6722 1 1 36 SER OG   O    0.059  -8.349  -7.207 1.00 . A A .  36 SER OG   1 1 
       11  6723 1 1 37 GLY C    C    2.044 -13.728  -5.241 1.00 . A A .  37 GLY C    1 1 
       11  6724 1 1 37 GLY CA   C    2.124 -12.362  -5.893 1.00 . A A .  37 GLY CA   1 1 
       11  6725 1 1 37 GLY H    H    0.092 -12.145  -6.448 1.00 . A A .  37 GLY H    1 1 
       11  6726 1 1 37 GLY HA2  H    2.522 -12.473  -6.890 1.00 . A A .  37 GLY HA2  1 1 
       11  6727 1 1 37 GLY HA3  H    2.793 -11.739  -5.317 1.00 . A A .  37 GLY HA3  1 1 
       11  6728 1 1 37 GLY N    N    0.830 -11.709  -5.973 1.00 . A A .  37 GLY N    1 1 
       11  6729 1 1 37 GLY O    O    0.966 -14.174  -4.850 1.00 . A A .  37 GLY O    1 1 
       11  6730 1 1 38 GLU C    C    2.674 -15.692  -3.102 1.00 . A A .  38 GLU C    1 1 
       11  6731 1 1 38 GLU CA   C    3.243 -15.719  -4.518 1.00 . A A .  38 GLU CA   1 1 
       11  6732 1 1 38 GLU CB   C    4.683 -16.234  -4.490 1.00 . A A .  38 GLU CB   1 1 
       11  6733 1 1 38 GLU CD   C    6.070 -18.239  -3.830 1.00 . A A .  38 GLU CD   1 1 
       11  6734 1 1 38 GLU CG   C    4.788 -17.749  -4.475 1.00 . A A .  38 GLU CG   1 1 
       11  6735 1 1 38 GLU H    H    4.016 -13.985  -5.455 1.00 . A A .  38 GLU H    1 1 
       11  6736 1 1 38 GLU HA   H    2.644 -16.385  -5.121 1.00 . A A .  38 GLU HA   1 1 
       11  6737 1 1 38 GLU HB2  H    5.201 -15.866  -5.364 1.00 . A A .  38 GLU HB2  1 1 
       11  6738 1 1 38 GLU HB3  H    5.172 -15.852  -3.606 1.00 . A A .  38 GLU HB3  1 1 
       11  6739 1 1 38 GLU HG2  H    3.950 -18.150  -3.925 1.00 . A A .  38 GLU HG2  1 1 
       11  6740 1 1 38 GLU HG3  H    4.754 -18.110  -5.493 1.00 . A A .  38 GLU HG3  1 1 
       11  6741 1 1 38 GLU N    N    3.189 -14.394  -5.125 1.00 . A A .  38 GLU N    1 1 
       11  6742 1 1 38 GLU O    O    3.188 -14.997  -2.226 1.00 . A A .  38 GLU O    1 1 
       11  6743 1 1 38 GLU OE1  O    7.143 -17.685  -4.145 1.00 . A A .  38 GLU OE1  1 1 
       11  6744 1 1 38 GLU OE2  O    5.998 -19.178  -3.009 1.00 . A A .  38 GLU OE2  1 1 
       11  6745 1 1 39 LYS C    C    1.065 -17.926  -0.993 1.00 . A A .  39 LYS C    1 1 
       11  6746 1 1 39 LYS CA   C    0.966 -16.520  -1.577 1.00 . A A .  39 LYS CA   1 1 
       11  6747 1 1 39 LYS CB   C   -0.502 -16.102  -1.684 1.00 . A A .  39 LYS CB   1 1 
       11  6748 1 1 39 LYS CD   C   -2.673 -15.644  -0.506 1.00 . A A .  39 LYS CD   1 1 
       11  6749 1 1 39 LYS CE   C   -2.861 -14.135  -0.495 1.00 . A A .  39 LYS CE   1 1 
       11  6750 1 1 39 LYS CG   C   -1.211 -16.024  -0.342 1.00 . A A .  39 LYS CG   1 1 
       11  6751 1 1 39 LYS H    H    1.242 -16.987  -3.623 1.00 . A A .  39 LYS H    1 1 
       11  6752 1 1 39 LYS HA   H    1.480 -15.834  -0.921 1.00 . A A .  39 LYS HA   1 1 
       11  6753 1 1 39 LYS HB2  H   -0.554 -15.131  -2.152 1.00 . A A .  39 LYS HB2  1 1 
       11  6754 1 1 39 LYS HB3  H   -1.024 -16.819  -2.301 1.00 . A A .  39 LYS HB3  1 1 
       11  6755 1 1 39 LYS HD2  H   -3.034 -16.033  -1.446 1.00 . A A .  39 LYS HD2  1 1 
       11  6756 1 1 39 LYS HD3  H   -3.241 -16.075   0.306 1.00 . A A .  39 LYS HD3  1 1 
       11  6757 1 1 39 LYS HE2  H   -3.858 -13.912  -0.147 1.00 . A A .  39 LYS HE2  1 1 
       11  6758 1 1 39 LYS HE3  H   -2.139 -13.700   0.180 1.00 . A A .  39 LYS HE3  1 1 
       11  6759 1 1 39 LYS HG2  H   -1.153 -16.987   0.142 1.00 . A A .  39 LYS HG2  1 1 
       11  6760 1 1 39 LYS HG3  H   -0.721 -15.280   0.270 1.00 . A A .  39 LYS HG3  1 1 
       11  6761 1 1 39 LYS HZ1  H   -3.580 -13.167  -2.202 1.00 . A A .  39 LYS HZ1  1 1 
       11  6762 1 1 39 LYS HZ2  H   -2.333 -14.267  -2.512 1.00 . A A .  39 LYS HZ2  1 1 
       11  6763 1 1 39 LYS HZ3  H   -1.984 -12.769  -1.810 1.00 . A A .  39 LYS HZ3  1 1 
       11  6764 1 1 39 LYS N    N    1.607 -16.454  -2.885 1.00 . A A .  39 LYS N    1 1 
       11  6765 1 1 39 LYS NZ   N   -2.677 -13.543  -1.849 1.00 . A A .  39 LYS NZ   1 1 
       11  6766 1 1 39 LYS O    O    0.069 -18.637  -0.854 1.00 . A A .  39 LYS O    1 1 
       11  6767 1 1 40 PRO C    C    1.992 -19.795   1.348 1.00 . A A .  40 PRO C    1 1 
       11  6768 1 1 40 PRO CA   C    2.548 -19.661  -0.065 1.00 . A A .  40 PRO CA   1 1 
       11  6769 1 1 40 PRO CB   C    4.076 -19.751  -0.049 1.00 . A A .  40 PRO CB   1 1 
       11  6770 1 1 40 PRO CD   C    3.524 -17.543  -0.779 1.00 . A A .  40 PRO CD   1 1 
       11  6771 1 1 40 PRO CG   C    4.538 -18.335  -0.003 1.00 . A A .  40 PRO CG   1 1 
       11  6772 1 1 40 PRO HA   H    2.146 -20.449  -0.686 1.00 . A A .  40 PRO HA   1 1 
       11  6773 1 1 40 PRO HB2  H    4.398 -20.301   0.824 1.00 . A A .  40 PRO HB2  1 1 
       11  6774 1 1 40 PRO HB3  H    4.421 -20.249  -0.943 1.00 . A A .  40 PRO HB3  1 1 
       11  6775 1 1 40 PRO HD2  H    3.399 -16.561  -0.346 1.00 . A A .  40 PRO HD2  1 1 
       11  6776 1 1 40 PRO HD3  H    3.818 -17.465  -1.816 1.00 . A A .  40 PRO HD3  1 1 
       11  6777 1 1 40 PRO HG2  H    4.577 -17.995   1.021 1.00 . A A .  40 PRO HG2  1 1 
       11  6778 1 1 40 PRO HG3  H    5.511 -18.252  -0.464 1.00 . A A .  40 PRO HG3  1 1 
       11  6779 1 1 40 PRO N    N    2.292 -18.338  -0.642 1.00 . A A .  40 PRO N    1 1 
       11  6780 1 1 40 PRO O    O    2.241 -18.950   2.207 1.00 . A A .  40 PRO O    1 1 
       11  6781 1 1 41 SER C    C    1.646 -20.827   4.005 1.00 . A A .  41 SER C    1 1 
       11  6782 1 1 41 SER CA   C    0.642 -21.107   2.891 1.00 . A A .  41 SER CA   1 1 
       11  6783 1 1 41 SER CB   C    0.145 -22.551   2.989 1.00 . A A .  41 SER CB   1 1 
       11  6784 1 1 41 SER H    H    1.074 -21.502   0.857 1.00 . A A .  41 SER H    1 1 
       11  6785 1 1 41 SER HA   H   -0.198 -20.438   3.003 1.00 . A A .  41 SER HA   1 1 
       11  6786 1 1 41 SER HB2  H   -0.717 -22.676   2.351 1.00 . A A .  41 SER HB2  1 1 
       11  6787 1 1 41 SER HB3  H    0.930 -23.221   2.670 1.00 . A A .  41 SER HB3  1 1 
       11  6788 1 1 41 SER HG   H   -1.177 -22.858   4.402 1.00 . A A .  41 SER HG   1 1 
       11  6789 1 1 41 SER N    N    1.237 -20.864   1.582 1.00 . A A .  41 SER N    1 1 
       11  6790 1 1 41 SER O    O    2.703 -21.453   4.075 1.00 . A A .  41 SER O    1 1 
       11  6791 1 1 41 SER OG   O   -0.221 -22.876   4.319 1.00 . A A .  41 SER OG   1 1 
       11  6792 1 1 42 GLY C    C    1.526 -18.614   6.981 1.00 . A A .  42 GLY C    1 1 
       11  6793 1 1 42 GLY CA   C    2.189 -19.532   5.974 1.00 . A A .  42 GLY CA   1 1 
       11  6794 1 1 42 GLY H    H    0.452 -19.414   4.769 1.00 . A A .  42 GLY H    1 1 
       11  6795 1 1 42 GLY HA2  H    2.496 -20.438   6.475 1.00 . A A .  42 GLY HA2  1 1 
       11  6796 1 1 42 GLY HA3  H    3.064 -19.039   5.576 1.00 . A A .  42 GLY HA3  1 1 
       11  6797 1 1 42 GLY N    N    1.307 -19.880   4.875 1.00 . A A .  42 GLY N    1 1 
       11  6798 1 1 42 GLY O    O    1.698 -17.396   6.950 1.00 . A A .  42 GLY O    1 1 
       11  6799 1 1 43 PRO C    C    0.985 -17.860   9.977 1.00 . A A .  43 PRO C    1 1 
       11  6800 1 1 43 PRO CA   C    0.037 -18.447   8.937 1.00 . A A .  43 PRO CA   1 1 
       11  6801 1 1 43 PRO CB   C   -0.876 -19.495   9.578 1.00 . A A .  43 PRO CB   1 1 
       11  6802 1 1 43 PRO CD   C    0.494 -20.650   7.996 1.00 . A A .  43 PRO CD   1 1 
       11  6803 1 1 43 PRO CG   C   -0.196 -20.796   9.324 1.00 . A A .  43 PRO CG   1 1 
       11  6804 1 1 43 PRO HA   H   -0.563 -17.656   8.512 1.00 . A A .  43 PRO HA   1 1 
       11  6805 1 1 43 PRO HB2  H   -0.969 -19.297  10.637 1.00 . A A .  43 PRO HB2  1 1 
       11  6806 1 1 43 PRO HB3  H   -1.850 -19.462   9.113 1.00 . A A .  43 PRO HB3  1 1 
       11  6807 1 1 43 PRO HD2  H    1.422 -21.203   7.991 1.00 . A A .  43 PRO HD2  1 1 
       11  6808 1 1 43 PRO HD3  H   -0.151 -20.983   7.197 1.00 . A A .  43 PRO HD3  1 1 
       11  6809 1 1 43 PRO HG2  H    0.525 -20.991  10.103 1.00 . A A .  43 PRO HG2  1 1 
       11  6810 1 1 43 PRO HG3  H   -0.928 -21.590   9.281 1.00 . A A .  43 PRO HG3  1 1 
       11  6811 1 1 43 PRO N    N    0.745 -19.202   7.900 1.00 . A A .  43 PRO N    1 1 
       11  6812 1 1 43 PRO O    O    0.552 -17.229  10.941 1.00 . A A .  43 PRO O    1 1 
       11  6813 1 1 44 SER C    C    2.876 -16.216  11.272 1.00 . A A .  44 SER C    1 1 
       11  6814 1 1 44 SER CA   C    3.292 -17.566  10.696 1.00 . A A .  44 SER CA   1 1 
       11  6815 1 1 44 SER CB   C    4.642 -17.437   9.987 1.00 . A A .  44 SER CB   1 1 
       11  6816 1 1 44 SER H    H    2.565 -18.583   8.987 1.00 . A A .  44 SER H    1 1 
       11  6817 1 1 44 SER HA   H    3.387 -18.275  11.505 1.00 . A A .  44 SER HA   1 1 
       11  6818 1 1 44 SER HB2  H    5.428 -17.374  10.724 1.00 . A A .  44 SER HB2  1 1 
       11  6819 1 1 44 SER HB3  H    4.801 -18.304   9.363 1.00 . A A .  44 SER HB3  1 1 
       11  6820 1 1 44 SER HG   H    5.250 -15.619   9.584 1.00 . A A .  44 SER HG   1 1 
       11  6821 1 1 44 SER N    N    2.282 -18.072   9.774 1.00 . A A .  44 SER N    1 1 
       11  6822 1 1 44 SER O    O    2.218 -15.420  10.602 1.00 . A A .  44 SER O    1 1 
       11  6823 1 1 44 SER OG   O    4.682 -16.276   9.176 1.00 . A A .  44 SER OG   1 1 
       11  6824 1 1 45 SER C    C    3.950 -14.386  14.270 1.00 . A A .  45 SER C    1 1 
       11  6825 1 1 45 SER CA   C    2.928 -14.714  13.186 1.00 . A A .  45 SER CA   1 1 
       11  6826 1 1 45 SER CB   C    1.528 -14.797  13.798 1.00 . A A .  45 SER CB   1 1 
       11  6827 1 1 45 SER H    H    3.786 -16.641  13.000 1.00 . A A .  45 SER H    1 1 
       11  6828 1 1 45 SER HA   H    2.941 -13.929  12.445 1.00 . A A .  45 SER HA   1 1 
       11  6829 1 1 45 SER HB2  H    1.496 -15.609  14.509 1.00 . A A .  45 SER HB2  1 1 
       11  6830 1 1 45 SER HB3  H    1.303 -13.869  14.303 1.00 . A A .  45 SER HB3  1 1 
       11  6831 1 1 45 SER HG   H    0.852 -14.663  11.965 1.00 . A A .  45 SER HG   1 1 
       11  6832 1 1 45 SER N    N    3.264 -15.966  12.518 1.00 . A A .  45 SER N    1 1 
       11  6833 1 1 45 SER O    O    4.009 -15.048  15.305 1.00 . A A .  45 SER O    1 1 
       11  6834 1 1 45 SER OG   O    0.548 -15.025  12.800 1.00 . A A .  45 SER OG   1 1 
       11  6835 1 1 46 GLY C    C    7.110 -12.692  14.339 1.00 . A A .  46 GLY C    1 1 
       11  6836 1 1 46 GLY CA   C    5.765 -12.957  14.986 1.00 . A A .  46 GLY CA   1 1 
       11  6837 1 1 46 GLY H    H    4.662 -12.864  13.181 1.00 . A A .  46 GLY H    1 1 
       11  6838 1 1 46 GLY HA2  H    5.434 -12.059  15.487 1.00 . A A .  46 GLY HA2  1 1 
       11  6839 1 1 46 GLY HA3  H    5.879 -13.743  15.718 1.00 . A A .  46 GLY HA3  1 1 
       11  6840 1 1 46 GLY N    N    4.755 -13.356  14.024 1.00 . A A .  46 GLY N    1 1 
       11  6841 1 1 46 GLY O    O    7.851 -13.641  14.087 1.00 . A A .  46 GLY O    1 1 
       11  6842 2 2  1 ZN  ZN   ZN  -3.998  -2.478  -1.140 1.00 . B A . 201 ZN  ZN   1 1 
       12  6843 1 1  1 GLY C    C  -27.296  18.515  -4.716 1.00 . A A .   1 GLY C    1 1 
       12  6844 1 1  1 GLY CA   C  -28.720  18.826  -4.299 1.00 . A A .   1 GLY CA   1 1 
       12  6845 1 1  1 GLY H1   H  -30.396  18.016  -5.308 1.00 . A A .   1 GLY H1   1 1 
       12  6846 1 1  1 GLY HA2  H  -28.766  19.845  -3.945 1.00 . A A .   1 GLY HA2  1 1 
       12  6847 1 1  1 GLY HA3  H  -28.999  18.162  -3.494 1.00 . A A .   1 GLY HA3  1 1 
       12  6848 1 1  1 GLY N    N  -29.665  18.664  -5.388 1.00 . A A .   1 GLY N    1 1 
       12  6849 1 1  1 GLY O    O  -26.866  17.362  -4.670 1.00 . A A .   1 GLY O    1 1 
       12  6850 1 1  2 SER C    C  -24.248  20.284  -4.766 1.00 . A A .   2 SER C    1 1 
       12  6851 1 1  2 SER CA   C  -25.181  19.375  -5.559 1.00 . A A .   2 SER CA   1 1 
       12  6852 1 1  2 SER CB   C  -25.052  19.672  -7.055 1.00 . A A .   2 SER CB   1 1 
       12  6853 1 1  2 SER H    H  -26.962  20.440  -5.141 1.00 . A A .   2 SER H    1 1 
       12  6854 1 1  2 SER HA   H  -24.901  18.347  -5.380 1.00 . A A .   2 SER HA   1 1 
       12  6855 1 1  2 SER HB2  H  -25.352  20.692  -7.243 1.00 . A A .   2 SER HB2  1 1 
       12  6856 1 1  2 SER HB3  H  -24.024  19.537  -7.358 1.00 . A A .   2 SER HB3  1 1 
       12  6857 1 1  2 SER HG   H  -25.969  19.158  -8.707 1.00 . A A .   2 SER HG   1 1 
       12  6858 1 1  2 SER N    N  -26.563  19.545  -5.127 1.00 . A A .   2 SER N    1 1 
       12  6859 1 1  2 SER O    O  -24.282  21.506  -4.911 1.00 . A A .   2 SER O    1 1 
       12  6860 1 1  2 SER OG   O  -25.872  18.806  -7.819 1.00 . A A .   2 SER OG   1 1 
       12  6861 1 1  3 SER C    C  -21.747  21.484  -3.940 1.00 . A A .   3 SER C    1 1 
       12  6862 1 1  3 SER CA   C  -22.473  20.433  -3.106 1.00 . A A .   3 SER CA   1 1 
       12  6863 1 1  3 SER CB   C  -21.458  19.489  -2.458 1.00 . A A .   3 SER CB   1 1 
       12  6864 1 1  3 SER H    H  -23.434  18.701  -3.855 1.00 . A A .   3 SER H    1 1 
       12  6865 1 1  3 SER HA   H  -23.035  20.931  -2.331 1.00 . A A .   3 SER HA   1 1 
       12  6866 1 1  3 SER HB2  H  -21.922  18.530  -2.285 1.00 . A A .   3 SER HB2  1 1 
       12  6867 1 1  3 SER HB3  H  -20.612  19.366  -3.119 1.00 . A A .   3 SER HB3  1 1 
       12  6868 1 1  3 SER HG   H  -21.666  20.590  -0.851 1.00 . A A .   3 SER HG   1 1 
       12  6869 1 1  3 SER N    N  -23.414  19.679  -3.926 1.00 . A A .   3 SER N    1 1 
       12  6870 1 1  3 SER O    O  -21.794  22.675  -3.637 1.00 . A A .   3 SER O    1 1 
       12  6871 1 1  3 SER OG   O  -21.000  20.005  -1.220 1.00 . A A .   3 SER OG   1 1 
       12  6872 1 1  4 GLY C    C  -19.020  21.374  -6.319 1.00 . A A .   4 GLY C    1 1 
       12  6873 1 1  4 GLY CA   C  -20.346  21.945  -5.857 1.00 . A A .   4 GLY CA   1 1 
       12  6874 1 1  4 GLY H    H  -21.071  20.071  -5.188 1.00 . A A .   4 GLY H    1 1 
       12  6875 1 1  4 GLY HA2  H  -20.952  22.165  -6.723 1.00 . A A .   4 GLY HA2  1 1 
       12  6876 1 1  4 GLY HA3  H  -20.161  22.862  -5.317 1.00 . A A .   4 GLY HA3  1 1 
       12  6877 1 1  4 GLY N    N  -21.074  21.032  -4.995 1.00 . A A .   4 GLY N    1 1 
       12  6878 1 1  4 GLY O    O  -17.971  21.990  -6.129 1.00 . A A .   4 GLY O    1 1 
       12  6879 1 1  5 SER C    C  -16.721  19.673  -6.401 1.00 . A A .   5 SER C    1 1 
       12  6880 1 1  5 SER CA   C  -17.858  19.534  -7.410 1.00 . A A .   5 SER CA   1 1 
       12  6881 1 1  5 SER CB   C  -17.435  20.126  -8.756 1.00 . A A .   5 SER CB   1 1 
       12  6882 1 1  5 SER H    H  -19.932  19.750  -7.046 1.00 . A A .   5 SER H    1 1 
       12  6883 1 1  5 SER HA   H  -18.081  18.486  -7.541 1.00 . A A .   5 SER HA   1 1 
       12  6884 1 1  5 SER HB2  H  -17.593  21.194  -8.742 1.00 . A A .   5 SER HB2  1 1 
       12  6885 1 1  5 SER HB3  H  -16.388  19.919  -8.924 1.00 . A A .   5 SER HB3  1 1 
       12  6886 1 1  5 SER HG   H  -18.338  18.634  -9.647 1.00 . A A .   5 SER HG   1 1 
       12  6887 1 1  5 SER N    N  -19.066  20.192  -6.925 1.00 . A A .   5 SER N    1 1 
       12  6888 1 1  5 SER O    O  -15.576  19.930  -6.771 1.00 . A A .   5 SER O    1 1 
       12  6889 1 1  5 SER OG   O  -18.188  19.567  -9.818 1.00 . A A .   5 SER OG   1 1 
       12  6890 1 1  6 SER C    C  -14.782  18.855  -4.426 1.00 . A A .   6 SER C    1 1 
       12  6891 1 1  6 SER CA   C  -16.057  19.610  -4.060 1.00 . A A .   6 SER CA   1 1 
       12  6892 1 1  6 SER CB   C  -16.625  19.068  -2.747 1.00 . A A .   6 SER CB   1 1 
       12  6893 1 1  6 SER H    H  -17.979  19.298  -4.892 1.00 . A A .   6 SER H    1 1 
       12  6894 1 1  6 SER HA   H  -15.818  20.656  -3.935 1.00 . A A .   6 SER HA   1 1 
       12  6895 1 1  6 SER HB2  H  -15.859  19.096  -1.987 1.00 . A A .   6 SER HB2  1 1 
       12  6896 1 1  6 SER HB3  H  -17.460  19.681  -2.439 1.00 . A A .   6 SER HB3  1 1 
       12  6897 1 1  6 SER HG   H  -16.340  17.130  -2.735 1.00 . A A .   6 SER HG   1 1 
       12  6898 1 1  6 SER N    N  -17.048  19.501  -5.124 1.00 . A A .   6 SER N    1 1 
       12  6899 1 1  6 SER O    O  -14.774  18.036  -5.343 1.00 . A A .   6 SER O    1 1 
       12  6900 1 1  6 SER OG   O  -17.071  17.731  -2.897 1.00 . A A .   6 SER OG   1 1 
       12  6901 1 1  7 GLY C    C  -11.663  18.189  -2.692 1.00 . A A .   7 GLY C    1 1 
       12  6902 1 1  7 GLY CA   C  -12.439  18.478  -3.961 1.00 . A A .   7 GLY CA   1 1 
       12  6903 1 1  7 GLY H    H  -13.771  19.800  -2.979 1.00 . A A .   7 GLY H    1 1 
       12  6904 1 1  7 GLY HA2  H  -12.630  17.548  -4.474 1.00 . A A .   7 GLY HA2  1 1 
       12  6905 1 1  7 GLY HA3  H  -11.841  19.113  -4.598 1.00 . A A .   7 GLY HA3  1 1 
       12  6906 1 1  7 GLY N    N  -13.705  19.138  -3.699 1.00 . A A .   7 GLY N    1 1 
       12  6907 1 1  7 GLY O    O  -11.839  17.140  -2.071 1.00 . A A .   7 GLY O    1 1 
       12  6908 1 1  8 THR C    C   -9.544  17.513  -0.928 1.00 . A A .   8 THR C    1 1 
       12  6909 1 1  8 THR CA   C   -9.988  18.961  -1.102 1.00 . A A .   8 THR CA   1 1 
       12  6910 1 1  8 THR CB   C  -10.758  19.404   0.156 1.00 . A A .   8 THR CB   1 1 
       12  6911 1 1  8 THR CG2  C  -10.881  20.920   0.210 1.00 . A A .   8 THR CG2  1 1 
       12  6912 1 1  8 THR H    H  -10.701  19.936  -2.840 1.00 . A A .   8 THR H    1 1 
       12  6913 1 1  8 THR HA   H   -9.113  19.586  -1.203 1.00 . A A .   8 THR HA   1 1 
       12  6914 1 1  8 THR HB   H  -10.213  19.071   1.028 1.00 . A A .   8 THR HB   1 1 
       12  6915 1 1  8 THR HG1  H  -12.210  18.378   1.009 1.00 . A A .   8 THR HG1  1 1 
       12  6916 1 1  8 THR HG21 H  -11.909  21.203   0.042 1.00 . A A .   8 THR HG21 1 1 
       12  6917 1 1  8 THR HG22 H  -10.258  21.359  -0.556 1.00 . A A .   8 THR HG22 1 1 
       12  6918 1 1  8 THR HG23 H  -10.562  21.273   1.179 1.00 . A A .   8 THR HG23 1 1 
       12  6919 1 1  8 THR N    N  -10.797  19.121  -2.304 1.00 . A A .   8 THR N    1 1 
       12  6920 1 1  8 THR O    O   -9.589  16.968   0.173 1.00 . A A .   8 THR O    1 1 
       12  6921 1 1  8 THR OG1  O  -12.062  18.814   0.166 1.00 . A A .   8 THR OG1  1 1 
       12  6922 1 1  9 GLY C    C   -8.244  14.990  -3.328 1.00 . A A .   9 GLY C    1 1 
       12  6923 1 1  9 GLY CA   C   -8.666  15.516  -1.971 1.00 . A A .   9 GLY CA   1 1 
       12  6924 1 1  9 GLY H    H   -9.100  17.380  -2.876 1.00 . A A .   9 GLY H    1 1 
       12  6925 1 1  9 GLY HA2  H   -7.829  15.446  -1.293 1.00 . A A .   9 GLY HA2  1 1 
       12  6926 1 1  9 GLY HA3  H   -9.472  14.902  -1.595 1.00 . A A .   9 GLY HA3  1 1 
       12  6927 1 1  9 GLY N    N   -9.114  16.895  -2.024 1.00 . A A .   9 GLY N    1 1 
       12  6928 1 1  9 GLY O    O   -9.084  14.731  -4.189 1.00 . A A .   9 GLY O    1 1 
       12  6929 1 1 10 GLU C    C   -6.021  12.866  -4.673 1.00 . A A .  10 GLU C    1 1 
       12  6930 1 1 10 GLU CA   C   -6.406  14.338  -4.785 1.00 . A A .  10 GLU CA   1 1 
       12  6931 1 1 10 GLU CB   C   -5.190  15.164  -5.211 1.00 . A A .  10 GLU CB   1 1 
       12  6932 1 1 10 GLU CD   C   -6.213  17.343  -4.447 1.00 . A A .  10 GLU CD   1 1 
       12  6933 1 1 10 GLU CG   C   -5.527  16.600  -5.576 1.00 . A A .  10 GLU CG   1 1 
       12  6934 1 1 10 GLU H    H   -6.317  15.058  -2.796 1.00 . A A .  10 GLU H    1 1 
       12  6935 1 1 10 GLU HA   H   -7.178  14.440  -5.532 1.00 . A A .  10 GLU HA   1 1 
       12  6936 1 1 10 GLU HB2  H   -4.477  15.178  -4.399 1.00 . A A .  10 GLU HB2  1 1 
       12  6937 1 1 10 GLU HB3  H   -4.734  14.693  -6.070 1.00 . A A .  10 GLU HB3  1 1 
       12  6938 1 1 10 GLU HG2  H   -4.613  17.118  -5.825 1.00 . A A .  10 GLU HG2  1 1 
       12  6939 1 1 10 GLU HG3  H   -6.182  16.595  -6.435 1.00 . A A .  10 GLU HG3  1 1 
       12  6940 1 1 10 GLU N    N   -6.937  14.834  -3.521 1.00 . A A .  10 GLU N    1 1 
       12  6941 1 1 10 GLU O    O   -5.180  12.492  -3.855 1.00 . A A .  10 GLU O    1 1 
       12  6942 1 1 10 GLU OE1  O   -5.540  17.643  -3.438 1.00 . A A .  10 GLU OE1  1 1 
       12  6943 1 1 10 GLU OE2  O   -7.423  17.626  -4.573 1.00 . A A .  10 GLU OE2  1 1 
       12  6944 1 1 11 LYS C    C   -6.166  10.083  -6.919 1.00 . A A .  11 LYS C    1 1 
       12  6945 1 1 11 LYS CA   C   -6.367  10.602  -5.498 1.00 . A A .  11 LYS CA   1 1 
       12  6946 1 1 11 LYS CB   C   -7.512   9.843  -4.824 1.00 . A A .  11 LYS CB   1 1 
       12  6947 1 1 11 LYS CD   C   -9.994   9.459  -4.854 1.00 . A A .  11 LYS CD   1 1 
       12  6948 1 1 11 LYS CE   C  -11.344  10.035  -5.253 1.00 . A A .  11 LYS CE   1 1 
       12  6949 1 1 11 LYS CG   C   -8.876  10.468  -5.055 1.00 . A A .  11 LYS CG   1 1 
       12  6950 1 1 11 LYS H    H   -7.304  12.392  -6.131 1.00 . A A .  11 LYS H    1 1 
       12  6951 1 1 11 LYS HA   H   -5.459  10.440  -4.937 1.00 . A A .  11 LYS HA   1 1 
       12  6952 1 1 11 LYS HB2  H   -7.532   8.833  -5.206 1.00 . A A .  11 LYS HB2  1 1 
       12  6953 1 1 11 LYS HB3  H   -7.329   9.812  -3.759 1.00 . A A .  11 LYS HB3  1 1 
       12  6954 1 1 11 LYS HD2  H   -9.794   8.587  -5.460 1.00 . A A .  11 LYS HD2  1 1 
       12  6955 1 1 11 LYS HD3  H  -10.028   9.175  -3.811 1.00 . A A .  11 LYS HD3  1 1 
       12  6956 1 1 11 LYS HE2  H  -12.118   9.513  -4.711 1.00 . A A .  11 LYS HE2  1 1 
       12  6957 1 1 11 LYS HE3  H  -11.365  11.082  -4.992 1.00 . A A .  11 LYS HE3  1 1 
       12  6958 1 1 11 LYS HG2  H   -9.012  11.282  -4.358 1.00 . A A .  11 LYS HG2  1 1 
       12  6959 1 1 11 LYS HG3  H   -8.922  10.846  -6.066 1.00 . A A .  11 LYS HG3  1 1 
       12  6960 1 1 11 LYS HZ1  H  -12.616   9.796  -6.893 1.00 . A A .  11 LYS HZ1  1 1 
       12  6961 1 1 11 LYS HZ2  H  -11.109   9.051  -7.081 1.00 . A A .  11 LYS HZ2  1 1 
       12  6962 1 1 11 LYS HZ3  H  -11.245  10.731  -7.220 1.00 . A A .  11 LYS HZ3  1 1 
       12  6963 1 1 11 LYS N    N   -6.643  12.034  -5.501 1.00 . A A .  11 LYS N    1 1 
       12  6964 1 1 11 LYS NZ   N  -11.597   9.894  -6.714 1.00 . A A .  11 LYS NZ   1 1 
       12  6965 1 1 11 LYS O    O   -7.070   9.512  -7.530 1.00 . A A .  11 LYS O    1 1 
       12  6966 1 1 12 PRO C    C   -4.511   8.324  -8.919 1.00 . A A .  12 PRO C    1 1 
       12  6967 1 1 12 PRO CA   C   -4.607   9.842  -8.811 1.00 . A A .  12 PRO CA   1 1 
       12  6968 1 1 12 PRO CB   C   -3.238  10.483  -9.052 1.00 . A A .  12 PRO CB   1 1 
       12  6969 1 1 12 PRO CD   C   -3.830  10.957  -6.786 1.00 . A A .  12 PRO CD   1 1 
       12  6970 1 1 12 PRO CG   C   -2.663  10.674  -7.691 1.00 . A A .  12 PRO CG   1 1 
       12  6971 1 1 12 PRO HA   H   -5.312  10.210  -9.542 1.00 . A A .  12 PRO HA   1 1 
       12  6972 1 1 12 PRO HB2  H   -2.628   9.820  -9.650 1.00 . A A .  12 PRO HB2  1 1 
       12  6973 1 1 12 PRO HB3  H   -3.362  11.425  -9.564 1.00 . A A .  12 PRO HB3  1 1 
       12  6974 1 1 12 PRO HD2  H   -3.658  10.537  -5.806 1.00 . A A .  12 PRO HD2  1 1 
       12  6975 1 1 12 PRO HD3  H   -4.004  12.021  -6.717 1.00 . A A .  12 PRO HD3  1 1 
       12  6976 1 1 12 PRO HG2  H   -2.155   9.775  -7.377 1.00 . A A .  12 PRO HG2  1 1 
       12  6977 1 1 12 PRO HG3  H   -1.981  11.511  -7.695 1.00 . A A .  12 PRO HG3  1 1 
       12  6978 1 1 12 PRO N    N   -4.954  10.284  -7.457 1.00 . A A .  12 PRO N    1 1 
       12  6979 1 1 12 PRO O    O   -4.837   7.744  -9.954 1.00 . A A .  12 PRO O    1 1 
       12  6980 1 1 13 TYR C    C   -4.645   5.639  -6.613 1.00 . A A .  13 TYR C    1 1 
       12  6981 1 1 13 TYR CA   C   -3.923   6.235  -7.817 1.00 . A A .  13 TYR CA   1 1 
       12  6982 1 1 13 TYR CB   C   -2.444   5.845  -7.784 1.00 . A A .  13 TYR CB   1 1 
       12  6983 1 1 13 TYR CD1  C   -1.898   5.497 -10.224 1.00 . A A .  13 TYR CD1  1 1 
       12  6984 1 1 13 TYR CD2  C   -0.783   7.254  -9.062 1.00 . A A .  13 TYR CD2  1 1 
       12  6985 1 1 13 TYR CE1  C   -1.214   5.821 -11.380 1.00 . A A .  13 TYR CE1  1 1 
       12  6986 1 1 13 TYR CE2  C   -0.096   7.587 -10.213 1.00 . A A .  13 TYR CE2  1 1 
       12  6987 1 1 13 TYR CG   C   -1.695   6.205  -9.046 1.00 . A A .  13 TYR CG   1 1 
       12  6988 1 1 13 TYR CZ   C   -0.315   6.867 -11.370 1.00 . A A .  13 TYR CZ   1 1 
       12  6989 1 1 13 TYR H    H   -3.819   8.204  -7.047 1.00 . A A .  13 TYR H    1 1 
       12  6990 1 1 13 TYR HA   H   -4.368   5.843  -8.720 1.00 . A A .  13 TYR HA   1 1 
       12  6991 1 1 13 TYR HB2  H   -1.965   6.349  -6.959 1.00 . A A .  13 TYR HB2  1 1 
       12  6992 1 1 13 TYR HB3  H   -2.364   4.777  -7.643 1.00 . A A .  13 TYR HB3  1 1 
       12  6993 1 1 13 TYR HD1  H   -2.603   4.678 -10.229 1.00 . A A .  13 TYR HD1  1 1 
       12  6994 1 1 13 TYR HD2  H   -0.614   7.816  -8.154 1.00 . A A .  13 TYR HD2  1 1 
       12  6995 1 1 13 TYR HE1  H   -1.385   5.258 -12.286 1.00 . A A .  13 TYR HE1  1 1 
       12  6996 1 1 13 TYR HE2  H    0.608   8.405 -10.205 1.00 . A A .  13 TYR HE2  1 1 
       12  6997 1 1 13 TYR HH   H    1.170   6.671 -12.574 1.00 . A A .  13 TYR HH   1 1 
       12  6998 1 1 13 TYR N    N   -4.063   7.687  -7.843 1.00 . A A .  13 TYR N    1 1 
       12  6999 1 1 13 TYR O    O   -4.726   6.260  -5.552 1.00 . A A .  13 TYR O    1 1 
       12  7000 1 1 13 TYR OH   O    0.367   7.194 -12.519 1.00 . A A .  13 TYR OH   1 1 
       12  7001 1 1 14 LYS C    C   -5.775   2.233  -5.866 1.00 . A A .  14 LYS C    1 1 
       12  7002 1 1 14 LYS CA   C   -5.884   3.747  -5.713 1.00 . A A .  14 LYS CA   1 1 
       12  7003 1 1 14 LYS CB   C   -7.356   4.164  -5.706 1.00 . A A .  14 LYS CB   1 1 
       12  7004 1 1 14 LYS CD   C   -9.487   4.268  -4.380 1.00 . A A .  14 LYS CD   1 1 
       12  7005 1 1 14 LYS CE   C   -9.969   4.182  -2.940 1.00 . A A .  14 LYS CE   1 1 
       12  7006 1 1 14 LYS CG   C   -8.154   3.561  -4.564 1.00 . A A .  14 LYS CG   1 1 
       12  7007 1 1 14 LYS H    H   -5.072   3.986  -7.653 1.00 . A A .  14 LYS H    1 1 
       12  7008 1 1 14 LYS HA   H   -5.432   4.035  -4.776 1.00 . A A .  14 LYS HA   1 1 
       12  7009 1 1 14 LYS HB2  H   -7.412   5.240  -5.628 1.00 . A A .  14 LYS HB2  1 1 
       12  7010 1 1 14 LYS HB3  H   -7.810   3.855  -6.637 1.00 . A A .  14 LYS HB3  1 1 
       12  7011 1 1 14 LYS HD2  H   -9.373   5.307  -4.648 1.00 . A A .  14 LYS HD2  1 1 
       12  7012 1 1 14 LYS HD3  H  -10.221   3.806  -5.025 1.00 . A A .  14 LYS HD3  1 1 
       12  7013 1 1 14 LYS HE2  H   -9.116   4.258  -2.283 1.00 . A A .  14 LYS HE2  1 1 
       12  7014 1 1 14 LYS HE3  H  -10.643   5.004  -2.751 1.00 . A A .  14 LYS HE3  1 1 
       12  7015 1 1 14 LYS HG2  H   -8.338   2.518  -4.776 1.00 . A A .  14 LYS HG2  1 1 
       12  7016 1 1 14 LYS HG3  H   -7.582   3.648  -3.651 1.00 . A A .  14 LYS HG3  1 1 
       12  7017 1 1 14 LYS HZ1  H  -10.597   2.655  -1.661 1.00 . A A .  14 LYS HZ1  1 1 
       12  7018 1 1 14 LYS HZ2  H  -10.263   2.136  -3.236 1.00 . A A .  14 LYS HZ2  1 1 
       12  7019 1 1 14 LYS HZ3  H  -11.685   2.992  -2.911 1.00 . A A .  14 LYS HZ3  1 1 
       12  7020 1 1 14 LYS N    N   -5.169   4.430  -6.784 1.00 . A A .  14 LYS N    1 1 
       12  7021 1 1 14 LYS NZ   N  -10.678   2.901  -2.668 1.00 . A A .  14 LYS NZ   1 1 
       12  7022 1 1 14 LYS O    O   -5.606   1.721  -6.973 1.00 . A A .  14 LYS O    1 1 
       12  7023 1 1 15 CYS C    C   -7.174  -0.561  -4.855 1.00 . A A .  15 CYS C    1 1 
       12  7024 1 1 15 CYS CA   C   -5.786   0.066  -4.757 1.00 . A A .  15 CYS CA   1 1 
       12  7025 1 1 15 CYS CB   C   -5.077  -0.431  -3.495 1.00 . A A .  15 CYS CB   1 1 
       12  7026 1 1 15 CYS H    H   -6.007   1.987  -3.895 1.00 . A A .  15 CYS H    1 1 
       12  7027 1 1 15 CYS HA   H   -5.211  -0.227  -5.622 1.00 . A A .  15 CYS HA   1 1 
       12  7028 1 1 15 CYS HB2  H   -4.181   0.152  -3.341 1.00 . A A .  15 CYS HB2  1 1 
       12  7029 1 1 15 CYS HB3  H   -5.735  -0.303  -2.648 1.00 . A A .  15 CYS HB3  1 1 
       12  7030 1 1 15 CYS N    N   -5.873   1.521  -4.748 1.00 . A A .  15 CYS N    1 1 
       12  7031 1 1 15 CYS O    O   -8.115  -0.114  -4.201 1.00 . A A .  15 CYS O    1 1 
       12  7032 1 1 15 CYS SG   S   -4.590  -2.185  -3.559 1.00 . A A .  15 CYS SG   1 1 
       12  7033 1 1 16 ASN C    C   -8.679  -3.480  -4.914 1.00 . A A .  16 ASN C    1 1 
       12  7034 1 1 16 ASN CA   C   -8.564  -2.288  -5.860 1.00 . A A .  16 ASN CA   1 1 
       12  7035 1 1 16 ASN CB   C   -8.709  -2.757  -7.309 1.00 . A A .  16 ASN CB   1 1 
       12  7036 1 1 16 ASN CG   C   -7.390  -3.208  -7.905 1.00 . A A .  16 ASN CG   1 1 
       12  7037 1 1 16 ASN H    H   -6.504  -1.910  -6.170 1.00 . A A .  16 ASN H    1 1 
       12  7038 1 1 16 ASN HA   H   -9.355  -1.588  -5.636 1.00 . A A .  16 ASN HA   1 1 
       12  7039 1 1 16 ASN HB2  H   -9.400  -3.586  -7.345 1.00 . A A .  16 ASN HB2  1 1 
       12  7040 1 1 16 ASN HB3  H   -9.095  -1.945  -7.907 1.00 . A A .  16 ASN HB3  1 1 
       12  7041 1 1 16 ASN HD21 H   -8.127  -5.027  -8.224 1.00 . A A .  16 ASN HD21 1 1 
       12  7042 1 1 16 ASN HD22 H   -6.488  -4.785  -8.712 1.00 . A A .  16 ASN HD22 1 1 
       12  7043 1 1 16 ASN N    N   -7.291  -1.599  -5.676 1.00 . A A .  16 ASN N    1 1 
       12  7044 1 1 16 ASN ND2  N   -7.329  -4.467  -8.323 1.00 . A A .  16 ASN ND2  1 1 
       12  7045 1 1 16 ASN O    O   -9.679  -4.196  -4.922 1.00 . A A .  16 ASN O    1 1 
       12  7046 1 1 16 ASN OD1  O   -6.437  -2.433  -7.990 1.00 . A A .  16 ASN OD1  1 1 
       12  7047 1 1 17 GLU C    C   -8.198  -4.353  -1.800 1.00 . A A .  17 GLU C    1 1 
       12  7048 1 1 17 GLU CA   C   -7.634  -4.790  -3.149 1.00 . A A .  17 GLU CA   1 1 
       12  7049 1 1 17 GLU CB   C   -6.210  -5.321  -2.971 1.00 . A A .  17 GLU CB   1 1 
       12  7050 1 1 17 GLU CD   C   -5.745  -5.318  -5.454 1.00 . A A .  17 GLU CD   1 1 
       12  7051 1 1 17 GLU CG   C   -5.703  -6.114  -4.164 1.00 . A A .  17 GLU CG   1 1 
       12  7052 1 1 17 GLU H    H   -6.879  -3.079  -4.141 1.00 . A A .  17 GLU H    1 1 
       12  7053 1 1 17 GLU HA   H   -8.255  -5.578  -3.547 1.00 . A A .  17 GLU HA   1 1 
       12  7054 1 1 17 GLU HB2  H   -5.544  -4.485  -2.810 1.00 . A A .  17 GLU HB2  1 1 
       12  7055 1 1 17 GLU HB3  H   -6.184  -5.962  -2.102 1.00 . A A .  17 GLU HB3  1 1 
       12  7056 1 1 17 GLU HG2  H   -4.682  -6.410  -3.975 1.00 . A A .  17 GLU HG2  1 1 
       12  7057 1 1 17 GLU HG3  H   -6.316  -6.995  -4.281 1.00 . A A .  17 GLU HG3  1 1 
       12  7058 1 1 17 GLU N    N   -7.648  -3.685  -4.100 1.00 . A A .  17 GLU N    1 1 
       12  7059 1 1 17 GLU O    O   -9.181  -4.914  -1.314 1.00 . A A .  17 GLU O    1 1 
       12  7060 1 1 17 GLU OE1  O   -5.482  -4.097  -5.406 1.00 . A A .  17 GLU OE1  1 1 
       12  7061 1 1 17 GLU OE2  O   -6.040  -5.914  -6.510 1.00 . A A .  17 GLU OE2  1 1 
       12  7062 1 1 18 CYS C    C   -8.692  -1.483  -0.061 1.00 . A A .  18 CYS C    1 1 
       12  7063 1 1 18 CYS CA   C   -8.005  -2.837   0.094 1.00 . A A .  18 CYS CA   1 1 
       12  7064 1 1 18 CYS CB   C   -6.814  -2.711   1.045 1.00 . A A .  18 CYS CB   1 1 
       12  7065 1 1 18 CYS H    H   -6.791  -2.942  -1.636 1.00 . A A .  18 CYS H    1 1 
       12  7066 1 1 18 CYS HA   H   -8.712  -3.540   0.508 1.00 . A A .  18 CYS HA   1 1 
       12  7067 1 1 18 CYS HB2  H   -7.113  -2.138   1.911 1.00 . A A .  18 CYS HB2  1 1 
       12  7068 1 1 18 CYS HB3  H   -6.508  -3.698   1.360 1.00 . A A .  18 CYS HB3  1 1 
       12  7069 1 1 18 CYS N    N   -7.569  -3.349  -1.199 1.00 . A A .  18 CYS N    1 1 
       12  7070 1 1 18 CYS O    O   -9.780  -1.262   0.469 1.00 . A A .  18 CYS O    1 1 
       12  7071 1 1 18 CYS SG   S   -5.362  -1.888   0.313 1.00 . A A .  18 CYS SG   1 1 
       12  7072 1 1 19 GLY C    C   -7.707   1.846  -0.492 1.00 . A A .  19 GLY C    1 1 
       12  7073 1 1 19 GLY CA   C   -8.610   0.742  -1.004 1.00 . A A .  19 GLY CA   1 1 
       12  7074 1 1 19 GLY H    H   -7.182  -0.811  -1.191 1.00 . A A .  19 GLY H    1 1 
       12  7075 1 1 19 GLY HA2  H   -8.773   0.886  -2.062 1.00 . A A .  19 GLY HA2  1 1 
       12  7076 1 1 19 GLY HA3  H   -9.559   0.803  -0.492 1.00 . A A .  19 GLY HA3  1 1 
       12  7077 1 1 19 GLY N    N   -8.047  -0.579  -0.792 1.00 . A A .  19 GLY N    1 1 
       12  7078 1 1 19 GLY O    O   -8.172   2.802   0.129 1.00 . A A .  19 GLY O    1 1 
       12  7079 1 1 20 LYS C    C   -5.151   3.717  -1.420 1.00 . A A .  20 LYS C    1 1 
       12  7080 1 1 20 LYS CA   C   -5.438   2.710  -0.311 1.00 . A A .  20 LYS CA   1 1 
       12  7081 1 1 20 LYS CB   C   -4.138   2.026   0.120 1.00 . A A .  20 LYS CB   1 1 
       12  7082 1 1 20 LYS CD   C   -3.566   3.559   2.026 1.00 . A A .  20 LYS CD   1 1 
       12  7083 1 1 20 LYS CE   C   -2.388   4.047   2.856 1.00 . A A .  20 LYS CE   1 1 
       12  7084 1 1 20 LYS CG   C   -3.109   2.984   0.696 1.00 . A A .  20 LYS CG   1 1 
       12  7085 1 1 20 LYS H    H   -6.099   0.931  -1.250 1.00 . A A .  20 LYS H    1 1 
       12  7086 1 1 20 LYS HA   H   -5.858   3.233   0.535 1.00 . A A .  20 LYS HA   1 1 
       12  7087 1 1 20 LYS HB2  H   -4.368   1.284   0.871 1.00 . A A .  20 LYS HB2  1 1 
       12  7088 1 1 20 LYS HB3  H   -3.702   1.535  -0.737 1.00 . A A .  20 LYS HB3  1 1 
       12  7089 1 1 20 LYS HD2  H   -4.229   4.391   1.840 1.00 . A A .  20 LYS HD2  1 1 
       12  7090 1 1 20 LYS HD3  H   -4.092   2.794   2.578 1.00 . A A .  20 LYS HD3  1 1 
       12  7091 1 1 20 LYS HE2  H   -1.663   3.251   2.930 1.00 . A A .  20 LYS HE2  1 1 
       12  7092 1 1 20 LYS HE3  H   -1.942   4.896   2.360 1.00 . A A .  20 LYS HE3  1 1 
       12  7093 1 1 20 LYS HG2  H   -2.181   2.453   0.846 1.00 . A A .  20 LYS HG2  1 1 
       12  7094 1 1 20 LYS HG3  H   -2.955   3.794  -0.003 1.00 . A A .  20 LYS HG3  1 1 
       12  7095 1 1 20 LYS HZ1  H   -3.719   4.948   4.191 1.00 . A A .  20 LYS HZ1  1 1 
       12  7096 1 1 20 LYS HZ2  H   -2.094   5.084   4.645 1.00 . A A .  20 LYS HZ2  1 1 
       12  7097 1 1 20 LYS HZ3  H   -2.903   3.611   4.833 1.00 . A A .  20 LYS HZ3  1 1 
       12  7098 1 1 20 LYS N    N   -6.410   1.716  -0.750 1.00 . A A .  20 LYS N    1 1 
       12  7099 1 1 20 LYS NZ   N   -2.806   4.451   4.227 1.00 . A A .  20 LYS NZ   1 1 
       12  7100 1 1 20 LYS O    O   -4.640   3.358  -2.481 1.00 . A A .  20 LYS O    1 1 
       12  7101 1 1 21 ALA C    C   -3.868   6.651  -1.975 1.00 . A A .  21 ALA C    1 1 
       12  7102 1 1 21 ALA CA   C   -5.255   6.039  -2.142 1.00 . A A .  21 ALA CA   1 1 
       12  7103 1 1 21 ALA CB   C   -6.327   7.111  -2.014 1.00 . A A .  21 ALA CB   1 1 
       12  7104 1 1 21 ALA H    H   -5.884   5.203  -0.302 1.00 . A A .  21 ALA H    1 1 
       12  7105 1 1 21 ALA HA   H   -5.330   5.605  -3.129 1.00 . A A .  21 ALA HA   1 1 
       12  7106 1 1 21 ALA HB1  H   -7.003   7.045  -2.853 1.00 . A A .  21 ALA HB1  1 1 
       12  7107 1 1 21 ALA HB2  H   -6.876   6.961  -1.096 1.00 . A A .  21 ALA HB2  1 1 
       12  7108 1 1 21 ALA HB3  H   -5.861   8.085  -2.001 1.00 . A A .  21 ALA HB3  1 1 
       12  7109 1 1 21 ALA N    N   -5.481   4.979  -1.166 1.00 . A A .  21 ALA N    1 1 
       12  7110 1 1 21 ALA O    O   -3.540   7.192  -0.919 1.00 . A A .  21 ALA O    1 1 
       12  7111 1 1 22 PHE C    C   -1.627   8.415  -3.777 1.00 . A A .  22 PHE C    1 1 
       12  7112 1 1 22 PHE CA   C   -1.705   7.108  -2.994 1.00 . A A .  22 PHE CA   1 1 
       12  7113 1 1 22 PHE CB   C   -0.712   6.096  -3.568 1.00 . A A .  22 PHE CB   1 1 
       12  7114 1 1 22 PHE CD1  C   -1.968   3.932  -3.377 1.00 . A A .  22 PHE CD1  1 1 
       12  7115 1 1 22 PHE CD2  C    0.049   4.185  -2.131 1.00 . A A .  22 PHE CD2  1 1 
       12  7116 1 1 22 PHE CE1  C   -2.126   2.657  -2.868 1.00 . A A .  22 PHE CE1  1 1 
       12  7117 1 1 22 PHE CE2  C   -0.103   2.910  -1.619 1.00 . A A .  22 PHE CE2  1 1 
       12  7118 1 1 22 PHE CG   C   -0.880   4.710  -3.014 1.00 . A A .  22 PHE CG   1 1 
       12  7119 1 1 22 PHE CZ   C   -1.192   2.145  -1.989 1.00 . A A .  22 PHE CZ   1 1 
       12  7120 1 1 22 PHE H    H   -3.377   6.121  -3.839 1.00 . A A .  22 PHE H    1 1 
       12  7121 1 1 22 PHE HA   H   -1.451   7.304  -1.964 1.00 . A A .  22 PHE HA   1 1 
       12  7122 1 1 22 PHE HB2  H   -0.841   6.043  -4.639 1.00 . A A .  22 PHE HB2  1 1 
       12  7123 1 1 22 PHE HB3  H    0.293   6.424  -3.347 1.00 . A A .  22 PHE HB3  1 1 
       12  7124 1 1 22 PHE HD1  H   -2.699   4.331  -4.066 1.00 . A A .  22 PHE HD1  1 1 
       12  7125 1 1 22 PHE HD2  H    0.901   4.783  -1.841 1.00 . A A .  22 PHE HD2  1 1 
       12  7126 1 1 22 PHE HE1  H   -2.978   2.061  -3.160 1.00 . A A .  22 PHE HE1  1 1 
       12  7127 1 1 22 PHE HE2  H    0.629   2.513  -0.932 1.00 . A A .  22 PHE HE2  1 1 
       12  7128 1 1 22 PHE HZ   H   -1.313   1.149  -1.590 1.00 . A A .  22 PHE HZ   1 1 
       12  7129 1 1 22 PHE N    N   -3.058   6.563  -3.025 1.00 . A A .  22 PHE N    1 1 
       12  7130 1 1 22 PHE O    O   -2.614   8.859  -4.365 1.00 . A A .  22 PHE O    1 1 
       12  7131 1 1 23 ARG C    C    0.959  10.187  -5.429 1.00 . A A .  23 ARG C    1 1 
       12  7132 1 1 23 ARG CA   C   -0.240  10.284  -4.490 1.00 . A A .  23 ARG CA   1 1 
       12  7133 1 1 23 ARG CB   C   -0.031  11.427  -3.495 1.00 . A A .  23 ARG CB   1 1 
       12  7134 1 1 23 ARG CD   C   -0.956  13.680  -2.874 1.00 . A A .  23 ARG CD   1 1 
       12  7135 1 1 23 ARG CG   C   -0.503  12.776  -4.010 1.00 . A A .  23 ARG CG   1 1 
       12  7136 1 1 23 ARG CZ   C   -1.867  15.941  -2.560 1.00 . A A .  23 ARG CZ   1 1 
       12  7137 1 1 23 ARG H    H    0.302   8.624  -3.294 1.00 . A A .  23 ARG H    1 1 
       12  7138 1 1 23 ARG HA   H   -1.125  10.484  -5.075 1.00 . A A .  23 ARG HA   1 1 
       12  7139 1 1 23 ARG HB2  H   -0.573  11.203  -2.588 1.00 . A A .  23 ARG HB2  1 1 
       12  7140 1 1 23 ARG HB3  H    1.021  11.501  -3.267 1.00 . A A .  23 ARG HB3  1 1 
       12  7141 1 1 23 ARG HD2  H   -1.771  13.200  -2.353 1.00 . A A .  23 ARG HD2  1 1 
       12  7142 1 1 23 ARG HD3  H   -0.129  13.821  -2.194 1.00 . A A .  23 ARG HD3  1 1 
       12  7143 1 1 23 ARG HE   H   -1.355  15.152  -4.319 1.00 . A A .  23 ARG HE   1 1 
       12  7144 1 1 23 ARG HG2  H    0.311  13.256  -4.534 1.00 . A A .  23 ARG HG2  1 1 
       12  7145 1 1 23 ARG HG3  H   -1.330  12.623  -4.688 1.00 . A A .  23 ARG HG3  1 1 
       12  7146 1 1 23 ARG HH11 H   -1.650  14.869  -0.862 1.00 . A A .  23 ARG HH11 1 1 
       12  7147 1 1 23 ARG HH12 H   -2.291  16.466  -0.655 1.00 . A A .  23 ARG HH12 1 1 
       12  7148 1 1 23 ARG HH21 H   -2.198  17.256  -4.060 1.00 . A A .  23 ARG HH21 1 1 
       12  7149 1 1 23 ARG HH22 H   -2.603  17.822  -2.475 1.00 . A A .  23 ARG HH22 1 1 
       12  7150 1 1 23 ARG N    N   -0.447   9.027  -3.781 1.00 . A A .  23 ARG N    1 1 
       12  7151 1 1 23 ARG NE   N   -1.403  14.984  -3.355 1.00 . A A .  23 ARG NE   1 1 
       12  7152 1 1 23 ARG NH1  N   -1.943  15.742  -1.252 1.00 . A A .  23 ARG NH1  1 1 
       12  7153 1 1 23 ARG NH2  N   -2.254  17.102  -3.074 1.00 . A A .  23 ARG NH2  1 1 
       12  7154 1 1 23 ARG O    O    1.319  11.158  -6.094 1.00 . A A .  23 ARG O    1 1 
       12  7155 1 1 24 ALA C    C    2.603   7.467  -7.093 1.00 . A A .  24 ALA C    1 1 
       12  7156 1 1 24 ALA CA   C    2.729   8.785  -6.335 1.00 . A A .  24 ALA CA   1 1 
       12  7157 1 1 24 ALA CB   C    4.008   8.802  -5.512 1.00 . A A .  24 ALA CB   1 1 
       12  7158 1 1 24 ALA H    H    1.238   8.273  -4.924 1.00 . A A .  24 ALA H    1 1 
       12  7159 1 1 24 ALA HA   H    2.778   9.595  -7.048 1.00 . A A .  24 ALA HA   1 1 
       12  7160 1 1 24 ALA HB1  H    3.759   8.826  -4.462 1.00 . A A .  24 ALA HB1  1 1 
       12  7161 1 1 24 ALA HB2  H    4.585   7.914  -5.725 1.00 . A A .  24 ALA HB2  1 1 
       12  7162 1 1 24 ALA HB3  H    4.587   9.677  -5.766 1.00 . A A .  24 ALA HB3  1 1 
       12  7163 1 1 24 ALA N    N    1.572   9.009  -5.477 1.00 . A A .  24 ALA N    1 1 
       12  7164 1 1 24 ALA O    O    2.175   6.457  -6.534 1.00 . A A .  24 ALA O    1 1 
       12  7165 1 1 25 ARG C    C    3.708   5.149  -8.588 1.00 . A A .  25 ARG C    1 1 
       12  7166 1 1 25 ARG CA   C    2.906   6.292  -9.202 1.00 . A A .  25 ARG CA   1 1 
       12  7167 1 1 25 ARG CB   C    3.425   6.595 -10.609 1.00 . A A .  25 ARG CB   1 1 
       12  7168 1 1 25 ARG CD   C    5.156   7.811 -11.966 1.00 . A A .  25 ARG CD   1 1 
       12  7169 1 1 25 ARG CG   C    4.835   7.162 -10.629 1.00 . A A .  25 ARG CG   1 1 
       12  7170 1 1 25 ARG CZ   C    6.907   9.218 -12.964 1.00 . A A .  25 ARG CZ   1 1 
       12  7171 1 1 25 ARG H    H    3.311   8.321  -8.757 1.00 . A A .  25 ARG H    1 1 
       12  7172 1 1 25 ARG HA   H    1.870   5.994  -9.267 1.00 . A A .  25 ARG HA   1 1 
       12  7173 1 1 25 ARG HB2  H    3.419   5.682 -11.187 1.00 . A A .  25 ARG HB2  1 1 
       12  7174 1 1 25 ARG HB3  H    2.766   7.311 -11.076 1.00 . A A .  25 ARG HB3  1 1 
       12  7175 1 1 25 ARG HD2  H    5.268   7.035 -12.710 1.00 . A A .  25 ARG HD2  1 1 
       12  7176 1 1 25 ARG HD3  H    4.337   8.458 -12.243 1.00 . A A .  25 ARG HD3  1 1 
       12  7177 1 1 25 ARG HE   H    6.844   8.662 -11.050 1.00 . A A .  25 ARG HE   1 1 
       12  7178 1 1 25 ARG HG2  H    4.925   7.905  -9.850 1.00 . A A .  25 ARG HG2  1 1 
       12  7179 1 1 25 ARG HG3  H    5.537   6.362 -10.449 1.00 . A A .  25 ARG HG3  1 1 
       12  7180 1 1 25 ARG HH11 H    5.462   8.624 -14.244 1.00 . A A .  25 ARG HH11 1 1 
       12  7181 1 1 25 ARG HH12 H    6.702   9.617 -14.935 1.00 . A A .  25 ARG HH12 1 1 
       12  7182 1 1 25 ARG HH21 H    8.483   9.971 -11.947 1.00 . A A .  25 ARG HH21 1 1 
       12  7183 1 1 25 ARG HH22 H    8.421  10.382 -13.628 1.00 . A A .  25 ARG HH22 1 1 
       12  7184 1 1 25 ARG N    N    2.978   7.485  -8.368 1.00 . A A .  25 ARG N    1 1 
       12  7185 1 1 25 ARG NE   N    6.386   8.596 -11.913 1.00 . A A .  25 ARG NE   1 1 
       12  7186 1 1 25 ARG NH1  N    6.308   9.147 -14.145 1.00 . A A .  25 ARG NH1  1 1 
       12  7187 1 1 25 ARG NH2  N    8.029   9.914 -12.836 1.00 . A A .  25 ARG NH2  1 1 
       12  7188 1 1 25 ARG O    O    3.256   4.004  -8.561 1.00 . A A .  25 ARG O    1 1 
       12  7189 1 1 26 SER C    C    5.330   4.167  -6.056 1.00 . A A .  26 SER C    1 1 
       12  7190 1 1 26 SER CA   C    5.769   4.467  -7.486 1.00 . A A .  26 SER CA   1 1 
       12  7191 1 1 26 SER CB   C    7.222   4.947  -7.496 1.00 . A A .  26 SER CB   1 1 
       12  7192 1 1 26 SER H    H    5.206   6.398  -8.148 1.00 . A A .  26 SER H    1 1 
       12  7193 1 1 26 SER HA   H    5.694   3.562  -8.070 1.00 . A A .  26 SER HA   1 1 
       12  7194 1 1 26 SER HB2  H    7.621   4.856  -8.494 1.00 . A A .  26 SER HB2  1 1 
       12  7195 1 1 26 SER HB3  H    7.258   5.981  -7.185 1.00 . A A .  26 SER HB3  1 1 
       12  7196 1 1 26 SER HG   H    8.260   3.350  -7.038 1.00 . A A .  26 SER HG   1 1 
       12  7197 1 1 26 SER N    N    4.901   5.468  -8.096 1.00 . A A .  26 SER N    1 1 
       12  7198 1 1 26 SER O    O    5.908   3.313  -5.384 1.00 . A A .  26 SER O    1 1 
       12  7199 1 1 26 SER OG   O    8.019   4.176  -6.613 1.00 . A A .  26 SER OG   1 1 
       12  7200 1 1 27 SER C    C    2.835   3.501  -4.188 1.00 . A A .  27 SER C    1 1 
       12  7201 1 1 27 SER CA   C    3.789   4.690  -4.246 1.00 . A A .  27 SER CA   1 1 
       12  7202 1 1 27 SER CB   C    3.073   5.956  -3.771 1.00 . A A .  27 SER CB   1 1 
       12  7203 1 1 27 SER H    H    3.885   5.543  -6.181 1.00 . A A .  27 SER H    1 1 
       12  7204 1 1 27 SER HA   H    4.628   4.495  -3.595 1.00 . A A .  27 SER HA   1 1 
       12  7205 1 1 27 SER HB2  H    3.655   6.821  -4.049 1.00 . A A .  27 SER HB2  1 1 
       12  7206 1 1 27 SER HB3  H    2.099   6.012  -4.236 1.00 . A A .  27 SER HB3  1 1 
       12  7207 1 1 27 SER HG   H    2.432   6.740  -2.094 1.00 . A A .  27 SER HG   1 1 
       12  7208 1 1 27 SER N    N    4.304   4.876  -5.597 1.00 . A A .  27 SER N    1 1 
       12  7209 1 1 27 SER O    O    2.778   2.783  -3.188 1.00 . A A .  27 SER O    1 1 
       12  7210 1 1 27 SER OG   O    2.907   5.950  -2.364 1.00 . A A .  27 SER OG   1 1 
       12  7211 1 1 28 LEU C    C    1.851   0.870  -5.576 1.00 . A A .  28 LEU C    1 1 
       12  7212 1 1 28 LEU CA   C    1.133   2.195  -5.339 1.00 . A A .  28 LEU CA   1 1 
       12  7213 1 1 28 LEU CB   C    0.119   2.445  -6.457 1.00 . A A .  28 LEU CB   1 1 
       12  7214 1 1 28 LEU CD1  C   -1.998   1.185  -5.996 1.00 . A A .  28 LEU CD1  1 1 
       12  7215 1 1 28 LEU CD2  C   -1.116   1.330  -8.332 1.00 . A A .  28 LEU CD2  1 1 
       12  7216 1 1 28 LEU CG   C   -0.747   1.250  -6.858 1.00 . A A .  28 LEU CG   1 1 
       12  7217 1 1 28 LEU H    H    2.175   3.902  -6.031 1.00 . A A .  28 LEU H    1 1 
       12  7218 1 1 28 LEU HA   H    0.611   2.145  -4.395 1.00 . A A .  28 LEU HA   1 1 
       12  7219 1 1 28 LEU HB2  H   -0.540   3.237  -6.134 1.00 . A A .  28 LEU HB2  1 1 
       12  7220 1 1 28 LEU HB3  H    0.665   2.768  -7.332 1.00 . A A .  28 LEU HB3  1 1 
       12  7221 1 1 28 LEU HD11 H   -2.196   0.159  -5.726 1.00 . A A .  28 LEU HD11 1 1 
       12  7222 1 1 28 LEU HD12 H   -2.837   1.580  -6.549 1.00 . A A .  28 LEU HD12 1 1 
       12  7223 1 1 28 LEU HD13 H   -1.850   1.771  -5.100 1.00 . A A .  28 LEU HD13 1 1 
       12  7224 1 1 28 LEU HD21 H   -0.981   0.361  -8.789 1.00 . A A .  28 LEU HD21 1 1 
       12  7225 1 1 28 LEU HD22 H   -0.481   2.052  -8.823 1.00 . A A .  28 LEU HD22 1 1 
       12  7226 1 1 28 LEU HD23 H   -2.148   1.634  -8.428 1.00 . A A .  28 LEU HD23 1 1 
       12  7227 1 1 28 LEU HG   H   -0.186   0.339  -6.701 1.00 . A A .  28 LEU HG   1 1 
       12  7228 1 1 28 LEU N    N    2.086   3.297  -5.266 1.00 . A A .  28 LEU N    1 1 
       12  7229 1 1 28 LEU O    O    1.421  -0.175  -5.089 1.00 . A A .  28 LEU O    1 1 
       12  7230 1 1 29 ALA C    C    4.227  -0.935  -5.342 1.00 . A A .  29 ALA C    1 1 
       12  7231 1 1 29 ALA CA   C    3.727  -0.273  -6.622 1.00 . A A .  29 ALA CA   1 1 
       12  7232 1 1 29 ALA CB   C    4.897   0.073  -7.532 1.00 . A A .  29 ALA CB   1 1 
       12  7233 1 1 29 ALA H    H    3.240   1.785  -6.685 1.00 . A A .  29 ALA H    1 1 
       12  7234 1 1 29 ALA HA   H    3.087  -0.967  -7.148 1.00 . A A .  29 ALA HA   1 1 
       12  7235 1 1 29 ALA HB1  H    4.789  -0.450  -8.470 1.00 . A A .  29 ALA HB1  1 1 
       12  7236 1 1 29 ALA HB2  H    4.909   1.138  -7.712 1.00 . A A .  29 ALA HB2  1 1 
       12  7237 1 1 29 ALA HB3  H    5.821  -0.223  -7.058 1.00 . A A .  29 ALA HB3  1 1 
       12  7238 1 1 29 ALA N    N    2.947   0.922  -6.325 1.00 . A A .  29 ALA N    1 1 
       12  7239 1 1 29 ALA O    O    3.906  -2.091  -5.064 1.00 . A A .  29 ALA O    1 1 
       12  7240 1 1 30 ILE C    C    4.481  -1.422  -2.503 1.00 . A A .  30 ILE C    1 1 
       12  7241 1 1 30 ILE CA   C    5.557  -0.711  -3.318 1.00 . A A .  30 ILE CA   1 1 
       12  7242 1 1 30 ILE CB   C    6.172   0.414  -2.464 1.00 . A A .  30 ILE CB   1 1 
       12  7243 1 1 30 ILE CD1  C    7.723   2.426  -2.617 1.00 . A A .  30 ILE CD1  1 1 
       12  7244 1 1 30 ILE CG1  C    7.291   1.116  -3.236 1.00 . A A .  30 ILE CG1  1 1 
       12  7245 1 1 30 ILE CG2  C    6.697  -0.145  -1.150 1.00 . A A .  30 ILE CG2  1 1 
       12  7246 1 1 30 ILE H    H    5.233   0.719  -4.843 1.00 . A A .  30 ILE H    1 1 
       12  7247 1 1 30 ILE HA   H    6.336  -1.419  -3.560 1.00 . A A .  30 ILE HA   1 1 
       12  7248 1 1 30 ILE HB   H    5.396   1.130  -2.239 1.00 . A A .  30 ILE HB   1 1 
       12  7249 1 1 30 ILE HD11 H    6.953   3.168  -2.771 1.00 . A A .  30 ILE HD11 1 1 
       12  7250 1 1 30 ILE HD12 H    7.882   2.289  -1.557 1.00 . A A .  30 ILE HD12 1 1 
       12  7251 1 1 30 ILE HD13 H    8.640   2.758  -3.079 1.00 . A A .  30 ILE HD13 1 1 
       12  7252 1 1 30 ILE HG12 H    8.153   0.468  -3.277 1.00 . A A .  30 ILE HG12 1 1 
       12  7253 1 1 30 ILE HG13 H    6.951   1.319  -4.242 1.00 . A A .  30 ILE HG13 1 1 
       12  7254 1 1 30 ILE HG21 H    6.534  -1.212  -1.122 1.00 . A A .  30 ILE HG21 1 1 
       12  7255 1 1 30 ILE HG22 H    7.754   0.059  -1.070 1.00 . A A .  30 ILE HG22 1 1 
       12  7256 1 1 30 ILE HG23 H    6.176   0.321  -0.327 1.00 . A A .  30 ILE HG23 1 1 
       12  7257 1 1 30 ILE N    N    5.013  -0.195  -4.568 1.00 . A A .  30 ILE N    1 1 
       12  7258 1 1 30 ILE O    O    4.764  -2.381  -1.784 1.00 . A A .  30 ILE O    1 1 
       12  7259 1 1 31 HIS C    C    1.669  -2.831  -2.566 1.00 . A A .  31 HIS C    1 1 
       12  7260 1 1 31 HIS CA   C    2.126  -1.538  -1.897 1.00 . A A .  31 HIS CA   1 1 
       12  7261 1 1 31 HIS CB   C    0.962  -0.550  -1.821 1.00 . A A .  31 HIS CB   1 1 
       12  7262 1 1 31 HIS CD2  C   -1.523  -1.278  -1.972 1.00 . A A .  31 HIS CD2  1 1 
       12  7263 1 1 31 HIS CE1  C   -1.699  -2.226  -0.003 1.00 . A A .  31 HIS CE1  1 1 
       12  7264 1 1 31 HIS CG   C   -0.321  -1.171  -1.359 1.00 . A A .  31 HIS CG   1 1 
       12  7265 1 1 31 HIS H    H    3.083  -0.180  -3.210 1.00 . A A .  31 HIS H    1 1 
       12  7266 1 1 31 HIS HA   H    2.461  -1.764  -0.896 1.00 . A A .  31 HIS HA   1 1 
       12  7267 1 1 31 HIS HB2  H    1.214   0.241  -1.130 1.00 . A A .  31 HIS HB2  1 1 
       12  7268 1 1 31 HIS HB3  H    0.793  -0.126  -2.800 1.00 . A A .  31 HIS HB3  1 1 
       12  7269 1 1 31 HIS HD1  H    0.235  -1.858   0.553 1.00 . A A .  31 HIS HD1  1 1 
       12  7270 1 1 31 HIS HD2  H   -1.776  -0.913  -2.957 1.00 . A A .  31 HIS HD2  1 1 
       12  7271 1 1 31 HIS HE1  H   -2.099  -2.744   0.856 1.00 . A A .  31 HIS HE1  1 1 
       12  7272 1 1 31 HIS N    N    3.246  -0.946  -2.621 1.00 . A A .  31 HIS N    1 1 
       12  7273 1 1 31 HIS ND1  N   -0.465  -1.774  -0.127 1.00 . A A .  31 HIS ND1  1 1 
       12  7274 1 1 31 HIS NE2  N   -2.362  -1.938  -1.108 1.00 . A A .  31 HIS NE2  1 1 
       12  7275 1 1 31 HIS O    O    1.535  -3.864  -1.912 1.00 . A A .  31 HIS O    1 1 
       12  7276 1 1 32 GLN C    C    1.842  -5.149  -4.298 1.00 . A A .  32 GLN C    1 1 
       12  7277 1 1 32 GLN CA   C    0.988  -3.929  -4.628 1.00 . A A .  32 GLN CA   1 1 
       12  7278 1 1 32 GLN CB   C    1.046  -3.642  -6.129 1.00 . A A .  32 GLN CB   1 1 
       12  7279 1 1 32 GLN CD   C   -1.330  -3.052  -6.753 1.00 . A A .  32 GLN CD   1 1 
       12  7280 1 1 32 GLN CG   C    0.090  -2.549  -6.577 1.00 . A A .  32 GLN CG   1 1 
       12  7281 1 1 32 GLN H    H    1.557  -1.912  -4.337 1.00 . A A .  32 GLN H    1 1 
       12  7282 1 1 32 GLN HA   H   -0.034  -4.135  -4.349 1.00 . A A .  32 GLN HA   1 1 
       12  7283 1 1 32 GLN HB2  H    2.051  -3.340  -6.387 1.00 . A A .  32 GLN HB2  1 1 
       12  7284 1 1 32 GLN HB3  H    0.802  -4.547  -6.666 1.00 . A A .  32 GLN HB3  1 1 
       12  7285 1 1 32 GLN HE21 H   -1.850  -1.348  -7.634 1.00 . A A .  32 GLN HE21 1 1 
       12  7286 1 1 32 GLN HE22 H   -3.105  -2.524  -7.474 1.00 . A A .  32 GLN HE22 1 1 
       12  7287 1 1 32 GLN HG2  H    0.087  -1.764  -5.835 1.00 . A A .  32 GLN HG2  1 1 
       12  7288 1 1 32 GLN HG3  H    0.435  -2.151  -7.520 1.00 . A A .  32 GLN HG3  1 1 
       12  7289 1 1 32 GLN N    N    1.432  -2.764  -3.872 1.00 . A A .  32 GLN N    1 1 
       12  7290 1 1 32 GLN NE2  N   -2.182  -2.225  -7.346 1.00 . A A .  32 GLN NE2  1 1 
       12  7291 1 1 32 GLN O    O    1.427  -6.287  -4.517 1.00 . A A .  32 GLN O    1 1 
       12  7292 1 1 32 GLN OE1  O   -1.657  -4.172  -6.360 1.00 . A A .  32 GLN OE1  1 1 
       12  7293 1 1 33 ALA C    C    3.550  -6.615  -2.079 1.00 . A A .  33 ALA C    1 1 
       12  7294 1 1 33 ALA CA   C    3.948  -5.983  -3.408 1.00 . A A .  33 ALA CA   1 1 
       12  7295 1 1 33 ALA CB   C    5.377  -5.466  -3.342 1.00 . A A .  33 ALA CB   1 1 
       12  7296 1 1 33 ALA H    H    3.311  -3.976  -3.618 1.00 . A A .  33 ALA H    1 1 
       12  7297 1 1 33 ALA HA   H    3.898  -6.735  -4.182 1.00 . A A .  33 ALA HA   1 1 
       12  7298 1 1 33 ALA HB1  H    5.639  -5.010  -4.285 1.00 . A A .  33 ALA HB1  1 1 
       12  7299 1 1 33 ALA HB2  H    5.458  -4.733  -2.552 1.00 . A A .  33 ALA HB2  1 1 
       12  7300 1 1 33 ALA HB3  H    6.048  -6.288  -3.141 1.00 . A A .  33 ALA HB3  1 1 
       12  7301 1 1 33 ALA N    N    3.036  -4.904  -3.770 1.00 . A A .  33 ALA N    1 1 
       12  7302 1 1 33 ALA O    O    4.303  -7.402  -1.503 1.00 . A A .  33 ALA O    1 1 
       12  7303 1 1 34 THR C    C    0.636  -7.672  -0.549 1.00 . A A .  34 THR C    1 1 
       12  7304 1 1 34 THR CA   C    1.865  -6.798  -0.332 1.00 . A A .  34 THR CA   1 1 
       12  7305 1 1 34 THR CB   C    1.510  -5.668   0.653 1.00 . A A .  34 THR CB   1 1 
       12  7306 1 1 34 THR CG2  C    0.231  -4.962   0.228 1.00 . A A .  34 THR CG2  1 1 
       12  7307 1 1 34 THR H    H    1.808  -5.635  -2.099 1.00 . A A .  34 THR H    1 1 
       12  7308 1 1 34 THR HA   H    2.648  -7.398   0.109 1.00 . A A .  34 THR HA   1 1 
       12  7309 1 1 34 THR HB   H    2.316  -4.948   0.657 1.00 . A A .  34 THR HB   1 1 
       12  7310 1 1 34 THR HG1  H    2.147  -6.677   2.223 1.00 . A A .  34 THR HG1  1 1 
       12  7311 1 1 34 THR HG21 H   -0.573  -5.247   0.890 1.00 . A A .  34 THR HG21 1 1 
       12  7312 1 1 34 THR HG22 H   -0.018  -5.246  -0.784 1.00 . A A .  34 THR HG22 1 1 
       12  7313 1 1 34 THR HG23 H    0.376  -3.893   0.277 1.00 . A A .  34 THR HG23 1 1 
       12  7314 1 1 34 THR N    N    2.362  -6.266  -1.594 1.00 . A A .  34 THR N    1 1 
       12  7315 1 1 34 THR O    O    0.324  -8.537   0.269 1.00 . A A .  34 THR O    1 1 
       12  7316 1 1 34 THR OG1  O    1.352  -6.200   1.973 1.00 . A A .  34 THR OG1  1 1 
       12  7317 1 1 35 HIS C    C   -0.899  -9.456  -2.789 1.00 . A A .  35 HIS C    1 1 
       12  7318 1 1 35 HIS CA   C   -1.256  -8.210  -1.984 1.00 . A A .  35 HIS CA   1 1 
       12  7319 1 1 35 HIS CB   C   -2.244  -7.347  -2.770 1.00 . A A .  35 HIS CB   1 1 
       12  7320 1 1 35 HIS CD2  C   -2.917  -5.034  -1.810 1.00 . A A .  35 HIS CD2  1 1 
       12  7321 1 1 35 HIS CE1  C   -4.483  -5.703  -0.429 1.00 . A A .  35 HIS CE1  1 1 
       12  7322 1 1 35 HIS CG   C   -3.006  -6.380  -1.917 1.00 . A A .  35 HIS CG   1 1 
       12  7323 1 1 35 HIS H    H    0.238  -6.738  -2.272 1.00 . A A .  35 HIS H    1 1 
       12  7324 1 1 35 HIS HA   H   -1.717  -8.515  -1.057 1.00 . A A .  35 HIS HA   1 1 
       12  7325 1 1 35 HIS HB2  H   -1.704  -6.779  -3.513 1.00 . A A .  35 HIS HB2  1 1 
       12  7326 1 1 35 HIS HB3  H   -2.959  -7.989  -3.264 1.00 . A A .  35 HIS HB3  1 1 
       12  7327 1 1 35 HIS HD1  H   -4.296  -7.688  -0.886 1.00 . A A .  35 HIS HD1  1 1 
       12  7328 1 1 35 HIS HD2  H   -2.241  -4.390  -2.355 1.00 . A A .  35 HIS HD2  1 1 
       12  7329 1 1 35 HIS HE1  H   -5.269  -5.702   0.311 1.00 . A A .  35 HIS HE1  1 1 
       12  7330 1 1 35 HIS N    N   -0.060  -7.441  -1.658 1.00 . A A .  35 HIS N    1 1 
       12  7331 1 1 35 HIS ND1  N   -3.995  -6.768  -1.039 1.00 . A A .  35 HIS ND1  1 1 
       12  7332 1 1 35 HIS NE2  N   -3.845  -4.637  -0.879 1.00 . A A .  35 HIS NE2  1 1 
       12  7333 1 1 35 HIS O    O   -1.637  -9.859  -3.688 1.00 . A A .  35 HIS O    1 1 
       12  7334 1 1 36 SER C    C   -0.359 -12.360  -3.090 1.00 . A A .  36 SER C    1 1 
       12  7335 1 1 36 SER CA   C    0.695 -11.259  -3.154 1.00 . A A .  36 SER CA   1 1 
       12  7336 1 1 36 SER CB   C    2.007 -11.758  -2.545 1.00 . A A .  36 SER CB   1 1 
       12  7337 1 1 36 SER H    H    0.782  -9.692  -1.733 1.00 . A A .  36 SER H    1 1 
       12  7338 1 1 36 SER HA   H    0.864 -10.998  -4.188 1.00 . A A .  36 SER HA   1 1 
       12  7339 1 1 36 SER HB2  H    2.668 -10.919  -2.385 1.00 . A A .  36 SER HB2  1 1 
       12  7340 1 1 36 SER HB3  H    1.802 -12.241  -1.601 1.00 . A A .  36 SER HB3  1 1 
       12  7341 1 1 36 SER HG   H    3.035 -13.391  -2.881 1.00 . A A .  36 SER HG   1 1 
       12  7342 1 1 36 SER N    N    0.237 -10.062  -2.459 1.00 . A A .  36 SER N    1 1 
       12  7343 1 1 36 SER O    O   -0.809 -12.743  -2.011 1.00 . A A .  36 SER O    1 1 
       12  7344 1 1 36 SER OG   O    2.647 -12.686  -3.404 1.00 . A A .  36 SER OG   1 1 
       12  7345 1 1 37 GLY C    C   -1.457 -14.936  -5.396 1.00 . A A .  37 GLY C    1 1 
       12  7346 1 1 37 GLY CA   C   -1.748 -13.918  -4.312 1.00 . A A .  37 GLY CA   1 1 
       12  7347 1 1 37 GLY H    H   -0.356 -12.522  -5.085 1.00 . A A .  37 GLY H    1 1 
       12  7348 1 1 37 GLY HA2  H   -1.777 -14.422  -3.357 1.00 . A A .  37 GLY HA2  1 1 
       12  7349 1 1 37 GLY HA3  H   -2.713 -13.473  -4.502 1.00 . A A .  37 GLY HA3  1 1 
       12  7350 1 1 37 GLY N    N   -0.750 -12.866  -4.256 1.00 . A A .  37 GLY N    1 1 
       12  7351 1 1 37 GLY O    O   -0.300 -15.273  -5.645 1.00 . A A .  37 GLY O    1 1 
       12  7352 1 1 38 GLU C    C   -3.525 -16.339  -8.087 1.00 . A A .  38 GLU C    1 1 
       12  7353 1 1 38 GLU CA   C   -2.361 -16.417  -7.103 1.00 . A A .  38 GLU CA   1 1 
       12  7354 1 1 38 GLU CB   C   -2.273 -17.825  -6.511 1.00 . A A .  38 GLU CB   1 1 
       12  7355 1 1 38 GLU CD   C   -0.048 -18.830  -7.160 1.00 . A A .  38 GLU CD   1 1 
       12  7356 1 1 38 GLU CG   C   -1.544 -18.816  -7.404 1.00 . A A .  38 GLU CG   1 1 
       12  7357 1 1 38 GLU H    H   -3.408 -15.121  -5.797 1.00 . A A .  38 GLU H    1 1 
       12  7358 1 1 38 GLU HA   H   -1.444 -16.201  -7.631 1.00 . A A .  38 GLU HA   1 1 
       12  7359 1 1 38 GLU HB2  H   -1.753 -17.773  -5.566 1.00 . A A .  38 GLU HB2  1 1 
       12  7360 1 1 38 GLU HB3  H   -3.273 -18.194  -6.342 1.00 . A A .  38 GLU HB3  1 1 
       12  7361 1 1 38 GLU HG2  H   -1.933 -19.805  -7.214 1.00 . A A .  38 GLU HG2  1 1 
       12  7362 1 1 38 GLU HG3  H   -1.723 -18.551  -8.435 1.00 . A A .  38 GLU HG3  1 1 
       12  7363 1 1 38 GLU N    N   -2.510 -15.429  -6.041 1.00 . A A .  38 GLU N    1 1 
       12  7364 1 1 38 GLU O    O   -4.664 -16.658  -7.745 1.00 . A A .  38 GLU O    1 1 
       12  7365 1 1 38 GLU OE1  O    0.590 -17.768  -7.319 1.00 . A A .  38 GLU OE1  1 1 
       12  7366 1 1 38 GLU OE2  O    0.486 -19.904  -6.809 1.00 . A A .  38 GLU OE2  1 1 
       12  7367 1 1 39 LYS C    C   -4.091 -16.883 -11.397 1.00 . A A .  39 LYS C    1 1 
       12  7368 1 1 39 LYS CA   C   -4.251 -15.790 -10.344 1.00 . A A .  39 LYS CA   1 1 
       12  7369 1 1 39 LYS CB   C   -4.174 -14.413 -11.008 1.00 . A A .  39 LYS CB   1 1 
       12  7370 1 1 39 LYS CD   C   -5.617 -12.574 -11.928 1.00 . A A .  39 LYS CD   1 1 
       12  7371 1 1 39 LYS CE   C   -6.502 -12.085 -10.792 1.00 . A A .  39 LYS CE   1 1 
       12  7372 1 1 39 LYS CG   C   -5.391 -14.075 -11.851 1.00 . A A .  39 LYS CG   1 1 
       12  7373 1 1 39 LYS H    H   -2.304 -15.670  -9.522 1.00 . A A .  39 LYS H    1 1 
       12  7374 1 1 39 LYS HA   H   -5.216 -15.900  -9.873 1.00 . A A .  39 LYS HA   1 1 
       12  7375 1 1 39 LYS HB2  H   -4.075 -13.661 -10.238 1.00 . A A .  39 LYS HB2  1 1 
       12  7376 1 1 39 LYS HB3  H   -3.302 -14.382 -11.644 1.00 . A A .  39 LYS HB3  1 1 
       12  7377 1 1 39 LYS HD2  H   -4.663 -12.072 -11.868 1.00 . A A .  39 LYS HD2  1 1 
       12  7378 1 1 39 LYS HD3  H   -6.092 -12.339 -12.870 1.00 . A A .  39 LYS HD3  1 1 
       12  7379 1 1 39 LYS HE2  H   -7.535 -12.184 -11.089 1.00 . A A .  39 LYS HE2  1 1 
       12  7380 1 1 39 LYS HE3  H   -6.317 -12.695  -9.921 1.00 . A A .  39 LYS HE3  1 1 
       12  7381 1 1 39 LYS HG2  H   -5.244 -14.458 -12.850 1.00 . A A .  39 LYS HG2  1 1 
       12  7382 1 1 39 LYS HG3  H   -6.263 -14.539 -11.411 1.00 . A A .  39 LYS HG3  1 1 
       12  7383 1 1 39 LYS HZ1  H   -6.508 -10.045 -11.243 1.00 . A A .  39 LYS HZ1  1 1 
       12  7384 1 1 39 LYS HZ2  H   -5.217 -10.526 -10.260 1.00 . A A .  39 LYS HZ2  1 1 
       12  7385 1 1 39 LYS HZ3  H   -6.771 -10.386  -9.607 1.00 . A A .  39 LYS HZ3  1 1 
       12  7386 1 1 39 LYS N    N   -3.231 -15.911  -9.310 1.00 . A A .  39 LYS N    1 1 
       12  7387 1 1 39 LYS NZ   N   -6.231 -10.660 -10.452 1.00 . A A .  39 LYS NZ   1 1 
       12  7388 1 1 39 LYS O    O   -3.660 -16.634 -12.523 1.00 . A A .  39 LYS O    1 1 
       12  7389 1 1 40 PRO C    C   -5.374 -19.217 -13.051 1.00 . A A .  40 PRO C    1 1 
       12  7390 1 1 40 PRO CA   C   -4.351 -19.276 -11.922 1.00 . A A .  40 PRO CA   1 1 
       12  7391 1 1 40 PRO CB   C   -4.638 -20.465 -11.003 1.00 . A A .  40 PRO CB   1 1 
       12  7392 1 1 40 PRO CD   C   -4.967 -18.490  -9.697 1.00 . A A .  40 PRO CD   1 1 
       12  7393 1 1 40 PRO CG   C   -5.456 -19.898  -9.894 1.00 . A A .  40 PRO CG   1 1 
       12  7394 1 1 40 PRO HA   H   -3.360 -19.373 -12.341 1.00 . A A .  40 PRO HA   1 1 
       12  7395 1 1 40 PRO HB2  H   -5.182 -21.223 -11.549 1.00 . A A .  40 PRO HB2  1 1 
       12  7396 1 1 40 PRO HB3  H   -3.708 -20.875 -10.637 1.00 . A A .  40 PRO HB3  1 1 
       12  7397 1 1 40 PRO HD2  H   -5.783 -17.844  -9.410 1.00 . A A .  40 PRO HD2  1 1 
       12  7398 1 1 40 PRO HD3  H   -4.183 -18.463  -8.955 1.00 . A A .  40 PRO HD3  1 1 
       12  7399 1 1 40 PRO HG2  H   -6.499 -19.898 -10.170 1.00 . A A .  40 PRO HG2  1 1 
       12  7400 1 1 40 PRO HG3  H   -5.304 -20.476  -8.994 1.00 . A A .  40 PRO HG3  1 1 
       12  7401 1 1 40 PRO N    N   -4.446 -18.121 -11.024 1.00 . A A .  40 PRO N    1 1 
       12  7402 1 1 40 PRO O    O   -5.248 -19.921 -14.053 1.00 . A A .  40 PRO O    1 1 
       12  7403 1 1 41 SER C    C   -6.835 -17.898 -15.252 1.00 . A A .  41 SER C    1 1 
       12  7404 1 1 41 SER CA   C   -7.434 -18.224 -13.887 1.00 . A A .  41 SER CA   1 1 
       12  7405 1 1 41 SER CB   C   -8.416 -17.127 -13.472 1.00 . A A .  41 SER CB   1 1 
       12  7406 1 1 41 SER H    H   -6.432 -17.838 -12.062 1.00 . A A .  41 SER H    1 1 
       12  7407 1 1 41 SER HA   H   -7.964 -19.163 -13.955 1.00 . A A .  41 SER HA   1 1 
       12  7408 1 1 41 SER HB2  H   -9.346 -17.261 -14.002 1.00 . A A .  41 SER HB2  1 1 
       12  7409 1 1 41 SER HB3  H   -8.594 -17.190 -12.409 1.00 . A A .  41 SER HB3  1 1 
       12  7410 1 1 41 SER HG   H   -7.605 -15.417 -12.964 1.00 . A A .  41 SER HG   1 1 
       12  7411 1 1 41 SER N    N   -6.387 -18.372 -12.883 1.00 . A A .  41 SER N    1 1 
       12  7412 1 1 41 SER O    O   -7.253 -18.444 -16.272 1.00 . A A .  41 SER O    1 1 
       12  7413 1 1 41 SER OG   O   -7.900 -15.841 -13.773 1.00 . A A .  41 SER OG   1 1 
       12  7414 1 1 42 GLY C    C   -3.749 -16.265 -16.319 1.00 . A A .  42 GLY C    1 1 
       12  7415 1 1 42 GLY CA   C   -5.212 -16.617 -16.505 1.00 . A A .  42 GLY CA   1 1 
       12  7416 1 1 42 GLY H    H   -5.561 -16.599 -14.417 1.00 . A A .  42 GLY H    1 1 
       12  7417 1 1 42 GLY HA2  H   -5.288 -17.435 -17.205 1.00 . A A .  42 GLY HA2  1 1 
       12  7418 1 1 42 GLY HA3  H   -5.727 -15.759 -16.912 1.00 . A A .  42 GLY HA3  1 1 
       12  7419 1 1 42 GLY N    N   -5.853 -17.002 -15.261 1.00 . A A .  42 GLY N    1 1 
       12  7420 1 1 42 GLY O    O   -3.376 -15.095 -16.230 1.00 . A A .  42 GLY O    1 1 
       12  7421 1 1 43 PRO C    C   -0.783 -16.510 -17.308 1.00 . A A .  43 PRO C    1 1 
       12  7422 1 1 43 PRO CA   C   -1.449 -17.114 -16.077 1.00 . A A .  43 PRO CA   1 1 
       12  7423 1 1 43 PRO CB   C   -0.939 -18.538 -15.838 1.00 . A A .  43 PRO CB   1 1 
       12  7424 1 1 43 PRO CD   C   -3.267 -18.716 -16.354 1.00 . A A .  43 PRO CD   1 1 
       12  7425 1 1 43 PRO CG   C   -1.944 -19.415 -16.502 1.00 . A A .  43 PRO CG   1 1 
       12  7426 1 1 43 PRO HA   H   -1.229 -16.502 -15.214 1.00 . A A .  43 PRO HA   1 1 
       12  7427 1 1 43 PRO HB2  H    0.040 -18.651 -16.282 1.00 . A A .  43 PRO HB2  1 1 
       12  7428 1 1 43 PRO HB3  H   -0.885 -18.732 -14.778 1.00 . A A .  43 PRO HB3  1 1 
       12  7429 1 1 43 PRO HD2  H   -3.886 -18.892 -17.221 1.00 . A A .  43 PRO HD2  1 1 
       12  7430 1 1 43 PRO HD3  H   -3.769 -19.044 -15.456 1.00 . A A .  43 PRO HD3  1 1 
       12  7431 1 1 43 PRO HG2  H   -1.697 -19.533 -17.546 1.00 . A A .  43 PRO HG2  1 1 
       12  7432 1 1 43 PRO HG3  H   -1.972 -20.377 -16.010 1.00 . A A .  43 PRO HG3  1 1 
       12  7433 1 1 43 PRO N    N   -2.892 -17.295 -16.256 1.00 . A A .  43 PRO N    1 1 
       12  7434 1 1 43 PRO O    O    0.313 -15.957 -17.225 1.00 . A A .  43 PRO O    1 1 
       12  7435 1 1 44 SER C    C   -0.374 -14.676 -19.501 1.00 . A A .  44 SER C    1 1 
       12  7436 1 1 44 SER CA   C   -0.926 -16.084 -19.701 1.00 . A A .  44 SER CA   1 1 
       12  7437 1 1 44 SER CB   C   -2.016 -16.070 -20.775 1.00 . A A .  44 SER CB   1 1 
       12  7438 1 1 44 SER H    H   -2.324 -17.070 -18.453 1.00 . A A .  44 SER H    1 1 
       12  7439 1 1 44 SER HA   H   -0.123 -16.730 -20.024 1.00 . A A .  44 SER HA   1 1 
       12  7440 1 1 44 SER HB2  H   -2.944 -15.736 -20.337 1.00 . A A .  44 SER HB2  1 1 
       12  7441 1 1 44 SER HB3  H   -1.727 -15.394 -21.567 1.00 . A A .  44 SER HB3  1 1 
       12  7442 1 1 44 SER HG   H   -1.399 -17.871 -21.235 1.00 . A A .  44 SER HG   1 1 
       12  7443 1 1 44 SER N    N   -1.454 -16.618 -18.451 1.00 . A A .  44 SER N    1 1 
       12  7444 1 1 44 SER O    O   -0.818 -13.944 -18.616 1.00 . A A .  44 SER O    1 1 
       12  7445 1 1 44 SER OG   O   -2.208 -17.362 -21.324 1.00 . A A .  44 SER OG   1 1 
       12  7446 1 1 45 SER C    C    1.109 -12.248 -21.574 1.00 . A A .  45 SER C    1 1 
       12  7447 1 1 45 SER CA   C    1.212 -12.985 -20.242 1.00 . A A .  45 SER CA   1 1 
       12  7448 1 1 45 SER CB   C    2.680 -13.111 -19.828 1.00 . A A .  45 SER CB   1 1 
       12  7449 1 1 45 SER H    H    0.907 -14.933 -21.014 1.00 . A A .  45 SER H    1 1 
       12  7450 1 1 45 SER HA   H    0.682 -12.421 -19.489 1.00 . A A .  45 SER HA   1 1 
       12  7451 1 1 45 SER HB2  H    3.159 -13.864 -20.435 1.00 . A A .  45 SER HB2  1 1 
       12  7452 1 1 45 SER HB3  H    3.175 -12.162 -19.974 1.00 . A A .  45 SER HB3  1 1 
       12  7453 1 1 45 SER HG   H    2.054 -13.123 -17.971 1.00 . A A .  45 SER HG   1 1 
       12  7454 1 1 45 SER N    N    0.596 -14.304 -20.329 1.00 . A A .  45 SER N    1 1 
       12  7455 1 1 45 SER O    O    1.399 -12.808 -22.630 1.00 . A A .  45 SER O    1 1 
       12  7456 1 1 45 SER OG   O    2.795 -13.482 -18.465 1.00 . A A .  45 SER OG   1 1 
       12  7457 1 1 46 GLY C    C   -0.619  -9.241 -22.661 1.00 . A A .  46 GLY C    1 1 
       12  7458 1 1 46 GLY CA   C    0.559 -10.192 -22.721 1.00 . A A .  46 GLY CA   1 1 
       12  7459 1 1 46 GLY H    H    0.477 -10.592 -20.643 1.00 . A A .  46 GLY H    1 1 
       12  7460 1 1 46 GLY HA2  H    1.463  -9.620 -22.865 1.00 . A A .  46 GLY HA2  1 1 
       12  7461 1 1 46 GLY HA3  H    0.427 -10.856 -23.563 1.00 . A A .  46 GLY HA3  1 1 
       12  7462 1 1 46 GLY N    N    0.694 -10.986 -21.514 1.00 . A A .  46 GLY N    1 1 
       12  7463 1 1 46 GLY O    O   -1.297  -9.191 -21.635 1.00 . A A .  46 GLY O    1 1 
       12  7464 2 2  1 ZN  ZN   ZN  -4.230  -2.800  -1.329 1.00 . B A . 201 ZN  ZN   1 1 
       13  7465 1 1  1 GLY C    C  -27.868  13.409  -7.908 1.00 . A A .   1 GLY C    1 1 
       13  7466 1 1  1 GLY CA   C  -27.954  14.715  -8.672 1.00 . A A .   1 GLY CA   1 1 
       13  7467 1 1  1 GLY H1   H  -26.981  15.675  -7.056 1.00 . A A .   1 GLY H1   1 1 
       13  7468 1 1  1 GLY HA2  H  -28.991  14.925  -8.890 1.00 . A A .   1 GLY HA2  1 1 
       13  7469 1 1  1 GLY HA3  H  -27.416  14.610  -9.603 1.00 . A A .   1 GLY HA3  1 1 
       13  7470 1 1  1 GLY N    N  -27.395  15.830  -7.931 1.00 . A A .   1 GLY N    1 1 
       13  7471 1 1  1 GLY O    O  -26.837  13.098  -7.311 1.00 . A A .   1 GLY O    1 1 
       13  7472 1 1  2 SER C    C  -27.676  10.617  -7.371 1.00 . A A .   2 SER C    1 1 
       13  7473 1 1  2 SER CA   C  -28.998  11.364  -7.224 1.00 . A A .   2 SER CA   1 1 
       13  7474 1 1  2 SER CB   C  -30.145  10.504  -7.759 1.00 . A A .   2 SER CB   1 1 
       13  7475 1 1  2 SER H    H  -29.744  12.944  -8.419 1.00 . A A .   2 SER H    1 1 
       13  7476 1 1  2 SER HA   H  -29.169  11.567  -6.177 1.00 . A A .   2 SER HA   1 1 
       13  7477 1 1  2 SER HB2  H  -30.078   9.515  -7.334 1.00 . A A .   2 SER HB2  1 1 
       13  7478 1 1  2 SER HB3  H  -31.087  10.953  -7.481 1.00 . A A .   2 SER HB3  1 1 
       13  7479 1 1  2 SER HG   H  -30.573   9.621  -9.455 1.00 . A A .   2 SER HG   1 1 
       13  7480 1 1  2 SER N    N  -28.954  12.642  -7.925 1.00 . A A .   2 SER N    1 1 
       13  7481 1 1  2 SER O    O  -27.115  10.126  -6.391 1.00 . A A .   2 SER O    1 1 
       13  7482 1 1  2 SER OG   O  -30.087  10.399  -9.171 1.00 . A A .   2 SER OG   1 1 
       13  7483 1 1  3 SER C    C  -24.868  10.211  -7.846 1.00 . A A .   3 SER C    1 1 
       13  7484 1 1  3 SER CA   C  -25.928   9.846  -8.880 1.00 . A A .   3 SER CA   1 1 
       13  7485 1 1  3 SER CB   C  -25.430  10.195 -10.284 1.00 . A A .   3 SER CB   1 1 
       13  7486 1 1  3 SER H    H  -27.676  10.948  -9.342 1.00 . A A .   3 SER H    1 1 
       13  7487 1 1  3 SER HA   H  -26.116   8.784  -8.827 1.00 . A A .   3 SER HA   1 1 
       13  7488 1 1  3 SER HB2  H  -24.566   9.591 -10.517 1.00 . A A .   3 SER HB2  1 1 
       13  7489 1 1  3 SER HB3  H  -26.213   9.996 -11.001 1.00 . A A .   3 SER HB3  1 1 
       13  7490 1 1  3 SER HG   H  -25.290  11.898 -11.242 1.00 . A A .   3 SER HG   1 1 
       13  7491 1 1  3 SER N    N  -27.183  10.536  -8.602 1.00 . A A .   3 SER N    1 1 
       13  7492 1 1  3 SER O    O  -24.757  11.365  -7.434 1.00 . A A .   3 SER O    1 1 
       13  7493 1 1  3 SER OG   O  -25.067  11.562 -10.371 1.00 . A A .   3 SER OG   1 1 
       13  7494 1 1  4 GLY C    C  -23.363   8.823  -5.105 1.00 . A A .   4 GLY C    1 1 
       13  7495 1 1  4 GLY CA   C  -23.047   9.452  -6.448 1.00 . A A .   4 GLY CA   1 1 
       13  7496 1 1  4 GLY H    H  -24.223   8.317  -7.793 1.00 . A A .   4 GLY H    1 1 
       13  7497 1 1  4 GLY HA2  H  -22.119   9.041  -6.817 1.00 . A A .   4 GLY HA2  1 1 
       13  7498 1 1  4 GLY HA3  H  -22.928  10.517  -6.313 1.00 . A A .   4 GLY HA3  1 1 
       13  7499 1 1  4 GLY N    N  -24.089   9.217  -7.430 1.00 . A A .   4 GLY N    1 1 
       13  7500 1 1  4 GLY O    O  -24.436   9.045  -4.545 1.00 . A A .   4 GLY O    1 1 
       13  7501 1 1  5 SER C    C  -21.870   8.102  -2.196 1.00 . A A .   5 SER C    1 1 
       13  7502 1 1  5 SER CA   C  -22.612   7.365  -3.306 1.00 . A A .   5 SER CA   1 1 
       13  7503 1 1  5 SER CB   C  -22.125   5.917  -3.386 1.00 . A A .   5 SER CB   1 1 
       13  7504 1 1  5 SER H    H  -21.591   7.896  -5.084 1.00 . A A .   5 SER H    1 1 
       13  7505 1 1  5 SER HA   H  -23.668   7.368  -3.081 1.00 . A A .   5 SER HA   1 1 
       13  7506 1 1  5 SER HB2  H  -22.602   5.425  -4.220 1.00 . A A .   5 SER HB2  1 1 
       13  7507 1 1  5 SER HB3  H  -21.054   5.908  -3.528 1.00 . A A .   5 SER HB3  1 1 
       13  7508 1 1  5 SER HG   H  -21.929   5.570  -1.469 1.00 . A A .   5 SER HG   1 1 
       13  7509 1 1  5 SER N    N  -22.426   8.033  -4.589 1.00 . A A .   5 SER N    1 1 
       13  7510 1 1  5 SER O    O  -22.406   8.311  -1.108 1.00 . A A .   5 SER O    1 1 
       13  7511 1 1  5 SER OG   O  -22.435   5.208  -2.199 1.00 . A A .   5 SER OG   1 1 
       13  7512 1 1  6 SER C    C  -18.626   9.883  -2.185 1.00 . A A .   6 SER C    1 1 
       13  7513 1 1  6 SER CA   C  -19.813   9.206  -1.506 1.00 . A A .   6 SER CA   1 1 
       13  7514 1 1  6 SER CB   C  -19.316   8.243  -0.426 1.00 . A A .   6 SER CB   1 1 
       13  7515 1 1  6 SER H    H  -20.260   8.299  -3.366 1.00 . A A .   6 SER H    1 1 
       13  7516 1 1  6 SER HA   H  -20.429   9.963  -1.045 1.00 . A A .   6 SER HA   1 1 
       13  7517 1 1  6 SER HB2  H  -20.135   7.623  -0.095 1.00 . A A .   6 SER HB2  1 1 
       13  7518 1 1  6 SER HB3  H  -18.535   7.619  -0.837 1.00 . A A .   6 SER HB3  1 1 
       13  7519 1 1  6 SER HG   H  -19.505   9.442   1.111 1.00 . A A .   6 SER HG   1 1 
       13  7520 1 1  6 SER N    N  -20.632   8.495  -2.480 1.00 . A A .   6 SER N    1 1 
       13  7521 1 1  6 SER O    O  -18.146   9.427  -3.221 1.00 . A A .   6 SER O    1 1 
       13  7522 1 1  6 SER OG   O  -18.798   8.949   0.688 1.00 . A A .   6 SER OG   1 1 
       13  7523 1 1  7 GLY C    C  -15.727  10.942  -2.012 1.00 . A A .   7 GLY C    1 1 
       13  7524 1 1  7 GLY CA   C  -17.032  11.701  -2.152 1.00 . A A .   7 GLY CA   1 1 
       13  7525 1 1  7 GLY H    H  -18.581  11.295  -0.766 1.00 . A A .   7 GLY H    1 1 
       13  7526 1 1  7 GLY HA2  H  -17.220  11.883  -3.199 1.00 . A A .   7 GLY HA2  1 1 
       13  7527 1 1  7 GLY HA3  H  -16.939  12.649  -1.643 1.00 . A A .   7 GLY HA3  1 1 
       13  7528 1 1  7 GLY N    N  -18.158  10.977  -1.591 1.00 . A A .   7 GLY N    1 1 
       13  7529 1 1  7 GLY O    O  -15.055  11.031  -0.983 1.00 . A A .   7 GLY O    1 1 
       13  7530 1 1  8 THR C    C  -13.353   9.599  -4.329 1.00 . A A .   8 THR C    1 1 
       13  7531 1 1  8 THR CA   C  -14.136   9.411  -3.035 1.00 . A A .   8 THR CA   1 1 
       13  7532 1 1  8 THR CB   C  -14.424   7.911  -2.836 1.00 . A A .   8 THR CB   1 1 
       13  7533 1 1  8 THR CG2  C  -15.127   7.666  -1.509 1.00 . A A .   8 THR CG2  1 1 
       13  7534 1 1  8 THR H    H  -15.945  10.161  -3.839 1.00 . A A .   8 THR H    1 1 
       13  7535 1 1  8 THR HA   H  -13.533   9.753  -2.207 1.00 . A A .   8 THR HA   1 1 
       13  7536 1 1  8 THR HB   H  -13.484   7.377  -2.833 1.00 . A A .   8 THR HB   1 1 
       13  7537 1 1  8 THR HG1  H  -15.980   8.013  -4.043 1.00 . A A .   8 THR HG1  1 1 
       13  7538 1 1  8 THR HG21 H  -15.738   6.779  -1.585 1.00 . A A .   8 THR HG21 1 1 
       13  7539 1 1  8 THR HG22 H  -15.751   8.514  -1.271 1.00 . A A .   8 THR HG22 1 1 
       13  7540 1 1  8 THR HG23 H  -14.390   7.531  -0.731 1.00 . A A .   8 THR HG23 1 1 
       13  7541 1 1  8 THR N    N  -15.367  10.191  -3.048 1.00 . A A .   8 THR N    1 1 
       13  7542 1 1  8 THR O    O  -13.899  10.043  -5.338 1.00 . A A .   8 THR O    1 1 
       13  7543 1 1  8 THR OG1  O  -15.236   7.421  -3.909 1.00 . A A .   8 THR OG1  1 1 
       13  7544 1 1  9 GLY C    C  -10.536  10.741  -5.532 1.00 . A A .   9 GLY C    1 1 
       13  7545 1 1  9 GLY CA   C  -11.230   9.395  -5.470 1.00 . A A .   9 GLY CA   1 1 
       13  7546 1 1  9 GLY H    H  -11.686   8.908  -3.460 1.00 . A A .   9 GLY H    1 1 
       13  7547 1 1  9 GLY HA2  H  -10.483   8.616  -5.460 1.00 . A A .   9 GLY HA2  1 1 
       13  7548 1 1  9 GLY HA3  H  -11.845   9.279  -6.351 1.00 . A A .   9 GLY HA3  1 1 
       13  7549 1 1  9 GLY N    N  -12.068   9.257  -4.293 1.00 . A A .   9 GLY N    1 1 
       13  7550 1 1  9 GLY O    O  -10.519  11.389  -6.578 1.00 . A A .   9 GLY O    1 1 
       13  7551 1 1 10 GLU C    C   -7.764  12.254  -4.514 1.00 . A A .  10 GLU C    1 1 
       13  7552 1 1 10 GLU CA   C   -9.268  12.443  -4.341 1.00 . A A .  10 GLU CA   1 1 
       13  7553 1 1 10 GLU CB   C   -9.556  13.135  -3.007 1.00 . A A .  10 GLU CB   1 1 
       13  7554 1 1 10 GLU CD   C  -12.076  13.036  -3.151 1.00 . A A .  10 GLU CD   1 1 
       13  7555 1 1 10 GLU CG   C  -10.856  13.923  -2.998 1.00 . A A .  10 GLU CG   1 1 
       13  7556 1 1 10 GLU H    H  -10.013  10.602  -3.607 1.00 . A A .  10 GLU H    1 1 
       13  7557 1 1 10 GLU HA   H   -9.636  13.064  -5.144 1.00 . A A .  10 GLU HA   1 1 
       13  7558 1 1 10 GLU HB2  H   -9.607  12.387  -2.230 1.00 . A A .  10 GLU HB2  1 1 
       13  7559 1 1 10 GLU HB3  H   -8.747  13.815  -2.787 1.00 . A A .  10 GLU HB3  1 1 
       13  7560 1 1 10 GLU HG2  H  -10.932  14.456  -2.062 1.00 . A A .  10 GLU HG2  1 1 
       13  7561 1 1 10 GLU HG3  H  -10.839  14.630  -3.814 1.00 . A A .  10 GLU HG3  1 1 
       13  7562 1 1 10 GLU N    N   -9.965  11.164  -4.409 1.00 . A A .  10 GLU N    1 1 
       13  7563 1 1 10 GLU O    O   -6.964  12.989  -3.935 1.00 . A A .  10 GLU O    1 1 
       13  7564 1 1 10 GLU OE1  O  -12.048  11.895  -2.645 1.00 . A A .  10 GLU OE1  1 1 
       13  7565 1 1 10 GLU OE2  O  -13.060  13.485  -3.776 1.00 . A A .  10 GLU OE2  1 1 
       13  7566 1 1 11 LYS C    C   -5.783  10.409  -6.969 1.00 . A A .  11 LYS C    1 1 
       13  7567 1 1 11 LYS CA   C   -5.980  10.975  -5.566 1.00 . A A .  11 LYS CA   1 1 
       13  7568 1 1 11 LYS CB   C   -5.446   9.988  -4.526 1.00 . A A .  11 LYS CB   1 1 
       13  7569 1 1 11 LYS CD   C   -3.765  11.464  -3.382 1.00 . A A .  11 LYS CD   1 1 
       13  7570 1 1 11 LYS CE   C   -3.614  12.485  -2.265 1.00 . A A .  11 LYS CE   1 1 
       13  7571 1 1 11 LYS CG   C   -5.035  10.645  -3.219 1.00 . A A .  11 LYS CG   1 1 
       13  7572 1 1 11 LYS H    H   -8.072  10.711  -5.748 1.00 . A A .  11 LYS H    1 1 
       13  7573 1 1 11 LYS HA   H   -5.432  11.902  -5.485 1.00 . A A .  11 LYS HA   1 1 
       13  7574 1 1 11 LYS HB2  H   -6.213   9.259  -4.313 1.00 . A A .  11 LYS HB2  1 1 
       13  7575 1 1 11 LYS HB3  H   -4.584   9.482  -4.937 1.00 . A A .  11 LYS HB3  1 1 
       13  7576 1 1 11 LYS HD2  H   -2.914  10.800  -3.365 1.00 . A A .  11 LYS HD2  1 1 
       13  7577 1 1 11 LYS HD3  H   -3.801  11.982  -4.330 1.00 . A A .  11 LYS HD3  1 1 
       13  7578 1 1 11 LYS HE2  H   -4.596  12.812  -1.958 1.00 . A A .  11 LYS HE2  1 1 
       13  7579 1 1 11 LYS HE3  H   -3.115  12.015  -1.431 1.00 . A A .  11 LYS HE3  1 1 
       13  7580 1 1 11 LYS HG2  H   -5.830  11.295  -2.888 1.00 . A A .  11 LYS HG2  1 1 
       13  7581 1 1 11 LYS HG3  H   -4.864   9.876  -2.479 1.00 . A A .  11 LYS HG3  1 1 
       13  7582 1 1 11 LYS HZ1  H   -2.502  14.209  -1.870 1.00 . A A .  11 LYS HZ1  1 1 
       13  7583 1 1 11 LYS HZ2  H   -3.405  14.288  -3.299 1.00 . A A .  11 LYS HZ2  1 1 
       13  7584 1 1 11 LYS HZ3  H   -1.990  13.363  -3.242 1.00 . A A .  11 LYS HZ3  1 1 
       13  7585 1 1 11 LYS N    N   -7.387  11.263  -5.315 1.00 . A A .  11 LYS N    1 1 
       13  7586 1 1 11 LYS NZ   N   -2.822  13.669  -2.699 1.00 . A A .  11 LYS NZ   1 1 
       13  7587 1 1 11 LYS O    O   -6.708   9.884  -7.588 1.00 . A A .  11 LYS O    1 1 
       13  7588 1 1 12 PRO C    C   -4.205   8.492  -8.885 1.00 . A A .  12 PRO C    1 1 
       13  7589 1 1 12 PRO CA   C   -4.200  10.016  -8.816 1.00 . A A .  12 PRO CA   1 1 
       13  7590 1 1 12 PRO CB   C   -2.786  10.556  -9.039 1.00 . A A .  12 PRO CB   1 1 
       13  7591 1 1 12 PRO CD   C   -3.396  11.127  -6.800 1.00 . A A .  12 PRO CD   1 1 
       13  7592 1 1 12 PRO CG   C   -2.231  10.743  -7.669 1.00 . A A .  12 PRO CG   1 1 
       13  7593 1 1 12 PRO HA   H   -4.862  10.411  -9.573 1.00 . A A .  12 PRO HA   1 1 
       13  7594 1 1 12 PRO HB2  H   -2.209   9.839  -9.606 1.00 . A A .  12 PRO HB2  1 1 
       13  7595 1 1 12 PRO HB3  H   -2.835  11.492  -9.576 1.00 . A A .  12 PRO HB3  1 1 
       13  7596 1 1 12 PRO HD2  H   -3.275  10.721  -5.806 1.00 . A A .  12 PRO HD2  1 1 
       13  7597 1 1 12 PRO HD3  H   -3.499  12.202  -6.760 1.00 . A A .  12 PRO HD3  1 1 
       13  7598 1 1 12 PRO HG2  H   -1.792   9.820  -7.322 1.00 . A A .  12 PRO HG2  1 1 
       13  7599 1 1 12 PRO HG3  H   -1.493  11.532  -7.677 1.00 . A A .  12 PRO HG3  1 1 
       13  7600 1 1 12 PRO N    N   -4.548  10.514  -7.482 1.00 . A A .  12 PRO N    1 1 
       13  7601 1 1 12 PRO O    O   -4.737   7.906  -9.828 1.00 . A A .  12 PRO O    1 1 
       13  7602 1 1 13 TYR C    C   -4.252   5.868  -6.589 1.00 . A A .  13 TYR C    1 1 
       13  7603 1 1 13 TYR CA   C   -3.544   6.402  -7.830 1.00 . A A .  13 TYR CA   1 1 
       13  7604 1 1 13 TYR CB   C   -2.087   5.935  -7.840 1.00 . A A .  13 TYR CB   1 1 
       13  7605 1 1 13 TYR CD1  C   -1.675   6.198 -10.318 1.00 . A A .  13 TYR CD1  1 1 
       13  7606 1 1 13 TYR CD2  C   -0.151   7.236  -8.807 1.00 . A A .  13 TYR CD2  1 1 
       13  7607 1 1 13 TYR CE1  C   -0.948   6.681 -11.389 1.00 . A A .  13 TYR CE1  1 1 
       13  7608 1 1 13 TYR CE2  C    0.581   7.724  -9.872 1.00 . A A .  13 TYR CE2  1 1 
       13  7609 1 1 13 TYR CG   C   -1.290   6.466  -9.010 1.00 . A A .  13 TYR CG   1 1 
       13  7610 1 1 13 TYR CZ   C    0.178   7.443 -11.161 1.00 . A A .  13 TYR CZ   1 1 
       13  7611 1 1 13 TYR H    H   -3.203   8.380  -7.159 1.00 . A A .  13 TYR H    1 1 
       13  7612 1 1 13 TYR HA   H   -4.041   6.016  -8.708 1.00 . A A .  13 TYR HA   1 1 
       13  7613 1 1 13 TYR HB2  H   -1.605   6.265  -6.933 1.00 . A A .  13 TYR HB2  1 1 
       13  7614 1 1 13 TYR HB3  H   -2.062   4.856  -7.884 1.00 . A A .  13 TYR HB3  1 1 
       13  7615 1 1 13 TYR HD1  H   -2.558   5.601 -10.492 1.00 . A A .  13 TYR HD1  1 1 
       13  7616 1 1 13 TYR HD2  H    0.162   7.455  -7.796 1.00 . A A .  13 TYR HD2  1 1 
       13  7617 1 1 13 TYR HE1  H   -1.263   6.461 -12.398 1.00 . A A .  13 TYR HE1  1 1 
       13  7618 1 1 13 TYR HE2  H    1.463   8.321  -9.694 1.00 . A A .  13 TYR HE2  1 1 
       13  7619 1 1 13 TYR HH   H    0.418   7.774 -13.040 1.00 . A A .  13 TYR HH   1 1 
       13  7620 1 1 13 TYR N    N   -3.610   7.857  -7.882 1.00 . A A .  13 TYR N    1 1 
       13  7621 1 1 13 TYR O    O   -4.283   6.523  -5.547 1.00 . A A .  13 TYR O    1 1 
       13  7622 1 1 13 TYR OH   O    0.904   7.927 -12.226 1.00 . A A .  13 TYR OH   1 1 
       13  7623 1 1 14 LYS C    C   -5.584   2.533  -5.771 1.00 . A A .  14 LYS C    1 1 
       13  7624 1 1 14 LYS CA   C   -5.527   4.047  -5.596 1.00 . A A .  14 LYS CA   1 1 
       13  7625 1 1 14 LYS CB   C   -6.945   4.612  -5.484 1.00 . A A .  14 LYS CB   1 1 
       13  7626 1 1 14 LYS CD   C   -9.122   4.645  -4.231 1.00 . A A .  14 LYS CD   1 1 
       13  7627 1 1 14 LYS CE   C   -9.016   5.897  -3.374 1.00 . A A .  14 LYS CE   1 1 
       13  7628 1 1 14 LYS CG   C   -7.774   3.963  -4.389 1.00 . A A .  14 LYS CG   1 1 
       13  7629 1 1 14 LYS H    H   -4.762   4.199  -7.564 1.00 . A A .  14 LYS H    1 1 
       13  7630 1 1 14 LYS HA   H   -4.986   4.273  -4.690 1.00 . A A .  14 LYS HA   1 1 
       13  7631 1 1 14 LYS HB2  H   -6.883   5.671  -5.280 1.00 . A A .  14 LYS HB2  1 1 
       13  7632 1 1 14 LYS HB3  H   -7.454   4.465  -6.426 1.00 . A A .  14 LYS HB3  1 1 
       13  7633 1 1 14 LYS HD2  H   -9.493   4.922  -5.207 1.00 . A A .  14 LYS HD2  1 1 
       13  7634 1 1 14 LYS HD3  H   -9.812   3.957  -3.764 1.00 . A A .  14 LYS HD3  1 1 
       13  7635 1 1 14 LYS HE2  H   -8.686   5.614  -2.386 1.00 . A A .  14 LYS HE2  1 1 
       13  7636 1 1 14 LYS HE3  H   -8.291   6.562  -3.819 1.00 . A A .  14 LYS HE3  1 1 
       13  7637 1 1 14 LYS HG2  H   -7.935   2.925  -4.640 1.00 . A A .  14 LYS HG2  1 1 
       13  7638 1 1 14 LYS HG3  H   -7.235   4.030  -3.455 1.00 . A A .  14 LYS HG3  1 1 
       13  7639 1 1 14 LYS HZ1  H  -10.164   7.618  -3.078 1.00 . A A .  14 LYS HZ1  1 1 
       13  7640 1 1 14 LYS HZ2  H  -10.881   6.205  -2.486 1.00 . A A .  14 LYS HZ2  1 1 
       13  7641 1 1 14 LYS HZ3  H  -10.857   6.507  -4.150 1.00 . A A .  14 LYS HZ3  1 1 
       13  7642 1 1 14 LYS N    N   -4.821   4.673  -6.707 1.00 . A A .  14 LYS N    1 1 
       13  7643 1 1 14 LYS NZ   N  -10.321   6.607  -3.264 1.00 . A A .  14 LYS NZ   1 1 
       13  7644 1 1 14 LYS O    O   -5.746   2.032  -6.884 1.00 . A A .  14 LYS O    1 1 
       13  7645 1 1 15 CYS C    C   -6.909  -0.151  -4.938 1.00 . A A .  15 CYS C    1 1 
       13  7646 1 1 15 CYS CA   C   -5.489   0.352  -4.694 1.00 . A A .  15 CYS CA   1 1 
       13  7647 1 1 15 CYS CB   C   -4.952  -0.220  -3.381 1.00 . A A .  15 CYS CB   1 1 
       13  7648 1 1 15 CYS H    H   -5.325   2.266  -3.806 1.00 . A A .  15 CYS H    1 1 
       13  7649 1 1 15 CYS HA   H   -4.859   0.021  -5.506 1.00 . A A .  15 CYS HA   1 1 
       13  7650 1 1 15 CYS HB2  H   -4.082   0.345  -3.080 1.00 . A A .  15 CYS HB2  1 1 
       13  7651 1 1 15 CYS HB3  H   -5.713  -0.130  -2.620 1.00 . A A .  15 CYS HB3  1 1 
       13  7652 1 1 15 CYS N    N   -5.452   1.809  -4.665 1.00 . A A .  15 CYS N    1 1 
       13  7653 1 1 15 CYS O    O   -7.881   0.560  -4.689 1.00 . A A .  15 CYS O    1 1 
       13  7654 1 1 15 CYS SG   S   -4.466  -1.973  -3.477 1.00 . A A .  15 CYS SG   1 1 
       13  7655 1 1 16 ASN C    C   -8.603  -3.134  -4.747 1.00 . A A .  16 ASN C    1 1 
       13  7656 1 1 16 ASN CA   C   -8.319  -1.981  -5.705 1.00 . A A .  16 ASN CA   1 1 
       13  7657 1 1 16 ASN CB   C   -8.377  -2.477  -7.151 1.00 . A A .  16 ASN CB   1 1 
       13  7658 1 1 16 ASN CG   C   -7.695  -3.820  -7.328 1.00 . A A .  16 ASN CG   1 1 
       13  7659 1 1 16 ASN H    H   -6.207  -1.900  -5.605 1.00 . A A .  16 ASN H    1 1 
       13  7660 1 1 16 ASN HA   H   -9.071  -1.219  -5.565 1.00 . A A .  16 ASN HA   1 1 
       13  7661 1 1 16 ASN HB2  H   -9.410  -2.578  -7.449 1.00 . A A .  16 ASN HB2  1 1 
       13  7662 1 1 16 ASN HB3  H   -7.890  -1.758  -7.792 1.00 . A A .  16 ASN HB3  1 1 
       13  7663 1 1 16 ASN HD21 H   -6.460  -3.041  -8.679 1.00 . A A .  16 ASN HD21 1 1 
       13  7664 1 1 16 ASN HD22 H   -6.239  -4.720  -8.339 1.00 . A A .  16 ASN HD22 1 1 
       13  7665 1 1 16 ASN N    N   -7.019  -1.382  -5.427 1.00 . A A .  16 ASN N    1 1 
       13  7666 1 1 16 ASN ND2  N   -6.697  -3.865  -8.204 1.00 . A A .  16 ASN ND2  1 1 
       13  7667 1 1 16 ASN O    O   -9.699  -3.693  -4.742 1.00 . A A .  16 ASN O    1 1 
       13  7668 1 1 16 ASN OD1  O   -8.060  -4.804  -6.686 1.00 . A A .  16 ASN OD1  1 1 
       13  7669 1 1 17 GLU C    C   -8.241  -4.046  -1.631 1.00 . A A .  17 GLU C    1 1 
       13  7670 1 1 17 GLU CA   C   -7.750  -4.571  -2.978 1.00 . A A .  17 GLU CA   1 1 
       13  7671 1 1 17 GLU CB   C   -6.418  -5.301  -2.798 1.00 . A A .  17 GLU CB   1 1 
       13  7672 1 1 17 GLU CD   C   -6.525  -7.460  -4.105 1.00 . A A .  17 GLU CD   1 1 
       13  7673 1 1 17 GLU CG   C   -5.963  -6.053  -4.038 1.00 . A A .  17 GLU CG   1 1 
       13  7674 1 1 17 GLU H    H   -6.757  -3.000  -3.991 1.00 . A A .  17 GLU H    1 1 
       13  7675 1 1 17 GLU HA   H   -8.480  -5.264  -3.367 1.00 . A A .  17 GLU HA   1 1 
       13  7676 1 1 17 GLU HB2  H   -5.657  -4.579  -2.541 1.00 . A A .  17 GLU HB2  1 1 
       13  7677 1 1 17 GLU HB3  H   -6.516  -6.010  -1.989 1.00 . A A .  17 GLU HB3  1 1 
       13  7678 1 1 17 GLU HG2  H   -6.289  -5.510  -4.912 1.00 . A A .  17 GLU HG2  1 1 
       13  7679 1 1 17 GLU HG3  H   -4.885  -6.111  -4.033 1.00 . A A .  17 GLU HG3  1 1 
       13  7680 1 1 17 GLU N    N   -7.607  -3.484  -3.939 1.00 . A A .  17 GLU N    1 1 
       13  7681 1 1 17 GLU O    O   -9.152  -4.611  -1.026 1.00 . A A .  17 GLU O    1 1 
       13  7682 1 1 17 GLU OE1  O   -6.205  -8.270  -3.210 1.00 . A A .  17 GLU OE1  1 1 
       13  7683 1 1 17 GLU OE2  O   -7.284  -7.750  -5.054 1.00 . A A .  17 GLU OE2  1 1 
       13  7684 1 1 18 CYS C    C   -8.562  -0.954  -0.099 1.00 . A A .  18 CYS C    1 1 
       13  7685 1 1 18 CYS CA   C   -8.001  -2.358   0.106 1.00 . A A .  18 CYS CA   1 1 
       13  7686 1 1 18 CYS CB   C   -6.791  -2.305   1.041 1.00 . A A .  18 CYS CB   1 1 
       13  7687 1 1 18 CYS H    H   -6.909  -2.555  -1.696 1.00 . A A .  18 CYS H    1 1 
       13  7688 1 1 18 CYS HA   H   -8.764  -2.975   0.555 1.00 . A A .  18 CYS HA   1 1 
       13  7689 1 1 18 CYS HB2  H   -7.060  -1.761   1.935 1.00 . A A .  18 CYS HB2  1 1 
       13  7690 1 1 18 CYS HB3  H   -6.509  -3.312   1.310 1.00 . A A .  18 CYS HB3  1 1 
       13  7691 1 1 18 CYS N    N   -7.629  -2.961  -1.168 1.00 . A A .  18 CYS N    1 1 
       13  7692 1 1 18 CYS O    O   -9.627  -0.618   0.416 1.00 . A A .  18 CYS O    1 1 
       13  7693 1 1 18 CYS SG   S   -5.329  -1.492   0.320 1.00 . A A .  18 CYS SG   1 1 
       13  7694 1 1 19 GLY C    C   -7.229   2.252  -0.741 1.00 . A A .  19 GLY C    1 1 
       13  7695 1 1 19 GLY CA   C   -8.275   1.221  -1.116 1.00 . A A .  19 GLY CA   1 1 
       13  7696 1 1 19 GLY H    H   -6.993  -0.459  -1.240 1.00 . A A .  19 GLY H    1 1 
       13  7697 1 1 19 GLY HA2  H   -8.502   1.319  -2.167 1.00 . A A .  19 GLY HA2  1 1 
       13  7698 1 1 19 GLY HA3  H   -9.172   1.412  -0.545 1.00 . A A .  19 GLY HA3  1 1 
       13  7699 1 1 19 GLY N    N   -7.835  -0.137  -0.856 1.00 . A A .  19 GLY N    1 1 
       13  7700 1 1 19 GLY O    O   -7.546   3.424  -0.537 1.00 . A A .  19 GLY O    1 1 
       13  7701 1 1 20 LYS C    C   -4.588   3.686  -1.426 1.00 . A A .  20 LYS C    1 1 
       13  7702 1 1 20 LYS CA   C   -4.880   2.707  -0.293 1.00 . A A .  20 LYS CA   1 1 
       13  7703 1 1 20 LYS CB   C   -3.622   1.898   0.032 1.00 . A A .  20 LYS CB   1 1 
       13  7704 1 1 20 LYS CD   C   -3.189   2.704   2.371 1.00 . A A .  20 LYS CD   1 1 
       13  7705 1 1 20 LYS CE   C   -3.744   2.534   3.777 1.00 . A A .  20 LYS CE   1 1 
       13  7706 1 1 20 LYS CG   C   -3.513   1.506   1.495 1.00 . A A .  20 LYS CG   1 1 
       13  7707 1 1 20 LYS H    H   -5.787   0.869  -0.821 1.00 . A A .  20 LYS H    1 1 
       13  7708 1 1 20 LYS HA   H   -5.175   3.265   0.582 1.00 . A A .  20 LYS HA   1 1 
       13  7709 1 1 20 LYS HB2  H   -3.626   0.995  -0.562 1.00 . A A .  20 LYS HB2  1 1 
       13  7710 1 1 20 LYS HB3  H   -2.753   2.485  -0.227 1.00 . A A .  20 LYS HB3  1 1 
       13  7711 1 1 20 LYS HD2  H   -2.116   2.816   2.431 1.00 . A A .  20 LYS HD2  1 1 
       13  7712 1 1 20 LYS HD3  H   -3.620   3.590   1.928 1.00 . A A .  20 LYS HD3  1 1 
       13  7713 1 1 20 LYS HE2  H   -3.581   1.515   4.093 1.00 . A A .  20 LYS HE2  1 1 
       13  7714 1 1 20 LYS HE3  H   -3.219   3.205   4.440 1.00 . A A .  20 LYS HE3  1 1 
       13  7715 1 1 20 LYS HG2  H   -4.453   1.082   1.817 1.00 . A A .  20 LYS HG2  1 1 
       13  7716 1 1 20 LYS HG3  H   -2.729   0.769   1.603 1.00 . A A .  20 LYS HG3  1 1 
       13  7717 1 1 20 LYS HZ1  H   -5.618   2.409   4.690 1.00 . A A .  20 LYS HZ1  1 1 
       13  7718 1 1 20 LYS HZ2  H   -5.681   2.445   3.000 1.00 . A A .  20 LYS HZ2  1 1 
       13  7719 1 1 20 LYS HZ3  H   -5.354   3.861   3.865 1.00 . A A .  20 LYS HZ3  1 1 
       13  7720 1 1 20 LYS N    N   -5.977   1.815  -0.647 1.00 . A A .  20 LYS N    1 1 
       13  7721 1 1 20 LYS NZ   N   -5.201   2.833   3.837 1.00 . A A .  20 LYS NZ   1 1 
       13  7722 1 1 20 LYS O    O   -4.109   3.295  -2.490 1.00 . A A .  20 LYS O    1 1 
       13  7723 1 1 21 ALA C    C   -3.301   6.684  -1.961 1.00 . A A .  21 ALA C    1 1 
       13  7724 1 1 21 ALA CA   C   -4.644   5.997  -2.188 1.00 . A A .  21 ALA CA   1 1 
       13  7725 1 1 21 ALA CB   C   -5.772   7.018  -2.164 1.00 . A A .  21 ALA CB   1 1 
       13  7726 1 1 21 ALA H    H   -5.258   5.212  -0.321 1.00 . A A .  21 ALA H    1 1 
       13  7727 1 1 21 ALA HA   H   -4.637   5.526  -3.160 1.00 . A A .  21 ALA HA   1 1 
       13  7728 1 1 21 ALA HB1  H   -5.423   7.948  -2.587 1.00 . A A .  21 ALA HB1  1 1 
       13  7729 1 1 21 ALA HB2  H   -6.604   6.647  -2.745 1.00 . A A .  21 ALA HB2  1 1 
       13  7730 1 1 21 ALA HB3  H   -6.088   7.181  -1.145 1.00 . A A .  21 ALA HB3  1 1 
       13  7731 1 1 21 ALA N    N   -4.878   4.961  -1.189 1.00 . A A .  21 ALA N    1 1 
       13  7732 1 1 21 ALA O    O   -2.989   7.107  -0.848 1.00 . A A .  21 ALA O    1 1 
       13  7733 1 1 22 PHE C    C   -1.135   8.659  -3.834 1.00 . A A .  22 PHE C    1 1 
       13  7734 1 1 22 PHE CA   C   -1.199   7.424  -2.940 1.00 . A A .  22 PHE CA   1 1 
       13  7735 1 1 22 PHE CB   C   -0.104   6.433  -3.339 1.00 . A A .  22 PHE CB   1 1 
       13  7736 1 1 22 PHE CD1  C   -1.180   4.181  -3.083 1.00 . A A .  22 PHE CD1  1 1 
       13  7737 1 1 22 PHE CD2  C    0.606   4.758  -1.611 1.00 . A A .  22 PHE CD2  1 1 
       13  7738 1 1 22 PHE CE1  C   -1.297   2.951  -2.463 1.00 . A A .  22 PHE CE1  1 1 
       13  7739 1 1 22 PHE CE2  C    0.494   3.529  -0.988 1.00 . A A .  22 PHE CE2  1 1 
       13  7740 1 1 22 PHE CG   C   -0.228   5.097  -2.664 1.00 . A A .  22 PHE CG   1 1 
       13  7741 1 1 22 PHE CZ   C   -0.459   2.625  -1.415 1.00 . A A .  22 PHE CZ   1 1 
       13  7742 1 1 22 PHE H    H   -2.814   6.432  -3.884 1.00 . A A .  22 PHE H    1 1 
       13  7743 1 1 22 PHE HA   H   -1.043   7.727  -1.916 1.00 . A A .  22 PHE HA   1 1 
       13  7744 1 1 22 PHE HB2  H   -0.146   6.271  -4.406 1.00 . A A .  22 PHE HB2  1 1 
       13  7745 1 1 22 PHE HB3  H    0.859   6.849  -3.081 1.00 . A A .  22 PHE HB3  1 1 
       13  7746 1 1 22 PHE HD1  H   -1.835   4.434  -3.903 1.00 . A A .  22 PHE HD1  1 1 
       13  7747 1 1 22 PHE HD2  H    1.352   5.465  -1.276 1.00 . A A .  22 PHE HD2  1 1 
       13  7748 1 1 22 PHE HE1  H   -2.042   2.246  -2.799 1.00 . A A .  22 PHE HE1  1 1 
       13  7749 1 1 22 PHE HE2  H    1.151   3.278  -0.168 1.00 . A A .  22 PHE HE2  1 1 
       13  7750 1 1 22 PHE HZ   H   -0.548   1.665  -0.928 1.00 . A A .  22 PHE HZ   1 1 
       13  7751 1 1 22 PHE N    N   -2.510   6.790  -3.024 1.00 . A A .  22 PHE N    1 1 
       13  7752 1 1 22 PHE O    O   -2.094   8.982  -4.535 1.00 . A A .  22 PHE O    1 1 
       13  7753 1 1 23 ARG C    C    1.088  10.257  -5.811 1.00 . A A .  23 ARG C    1 1 
       13  7754 1 1 23 ARG CA   C    0.193  10.545  -4.610 1.00 . A A .  23 ARG CA   1 1 
       13  7755 1 1 23 ARG CB   C    0.804  11.663  -3.762 1.00 . A A .  23 ARG CB   1 1 
       13  7756 1 1 23 ARG CD   C    3.192  12.024  -4.457 1.00 . A A .  23 ARG CD   1 1 
       13  7757 1 1 23 ARG CG   C    2.264  11.431  -3.409 1.00 . A A .  23 ARG CG   1 1 
       13  7758 1 1 23 ARG CZ   C    4.292  13.957  -3.409 1.00 . A A .  23 ARG CZ   1 1 
       13  7759 1 1 23 ARG H    H    0.732   9.038  -3.225 1.00 . A A .  23 ARG H    1 1 
       13  7760 1 1 23 ARG HA   H   -0.776  10.863  -4.965 1.00 . A A .  23 ARG HA   1 1 
       13  7761 1 1 23 ARG HB2  H    0.732  12.592  -4.307 1.00 . A A .  23 ARG HB2  1 1 
       13  7762 1 1 23 ARG HB3  H    0.243  11.749  -2.844 1.00 . A A .  23 ARG HB3  1 1 
       13  7763 1 1 23 ARG HD2  H    4.145  11.521  -4.401 1.00 . A A .  23 ARG HD2  1 1 
       13  7764 1 1 23 ARG HD3  H    2.758  11.867  -5.433 1.00 . A A .  23 ARG HD3  1 1 
       13  7765 1 1 23 ARG HE   H    2.847  14.073  -4.778 1.00 . A A .  23 ARG HE   1 1 
       13  7766 1 1 23 ARG HG2  H    2.472  11.894  -2.456 1.00 . A A .  23 ARG HG2  1 1 
       13  7767 1 1 23 ARG HG3  H    2.443  10.368  -3.341 1.00 . A A .  23 ARG HG3  1 1 
       13  7768 1 1 23 ARG HH11 H    4.960  12.156  -2.783 1.00 . A A .  23 ARG HH11 1 1 
       13  7769 1 1 23 ARG HH12 H    5.727  13.526  -2.052 1.00 . A A .  23 ARG HH12 1 1 
       13  7770 1 1 23 ARG HH21 H    3.850  15.885  -3.823 1.00 . A A .  23 ARG HH21 1 1 
       13  7771 1 1 23 ARG HH22 H    5.095  15.647  -2.644 1.00 . A A .  23 ARG HH22 1 1 
       13  7772 1 1 23 ARG N    N    0.003   9.345  -3.804 1.00 . A A .  23 ARG N    1 1 
       13  7773 1 1 23 ARG NE   N    3.400  13.456  -4.256 1.00 . A A .  23 ARG NE   1 1 
       13  7774 1 1 23 ARG NH1  N    5.055  13.146  -2.688 1.00 . A A .  23 ARG NH1  1 1 
       13  7775 1 1 23 ARG NH2  N    4.423  15.271  -3.281 1.00 . A A .  23 ARG NH2  1 1 
       13  7776 1 1 23 ARG O    O    1.136  11.036  -6.763 1.00 . A A .  23 ARG O    1 1 
       13  7777 1 1 24 ALA C    C    2.512   7.267  -7.194 1.00 . A A .  24 ALA C    1 1 
       13  7778 1 1 24 ALA CA   C    2.687   8.741  -6.845 1.00 . A A .  24 ALA CA   1 1 
       13  7779 1 1 24 ALA CB   C    4.133   9.029  -6.469 1.00 . A A .  24 ALA CB   1 1 
       13  7780 1 1 24 ALA H    H    1.714   8.553  -4.975 1.00 . A A .  24 ALA H    1 1 
       13  7781 1 1 24 ALA HA   H    2.440   9.338  -7.711 1.00 . A A .  24 ALA HA   1 1 
       13  7782 1 1 24 ALA HB1  H    4.586   9.646  -7.230 1.00 . A A .  24 ALA HB1  1 1 
       13  7783 1 1 24 ALA HB2  H    4.161   9.547  -5.521 1.00 . A A .  24 ALA HB2  1 1 
       13  7784 1 1 24 ALA HB3  H    4.675   8.099  -6.388 1.00 . A A .  24 ALA HB3  1 1 
       13  7785 1 1 24 ALA N    N    1.795   9.133  -5.760 1.00 . A A .  24 ALA N    1 1 
       13  7786 1 1 24 ALA O    O    2.102   6.465  -6.354 1.00 . A A .  24 ALA O    1 1 
       13  7787 1 1 25 ARG C    C    3.572   4.606  -8.061 1.00 . A A .  25 ARG C    1 1 
       13  7788 1 1 25 ARG CA   C    2.701   5.539  -8.897 1.00 . A A .  25 ARG CA   1 1 
       13  7789 1 1 25 ARG CB   C    3.091   5.434 -10.372 1.00 . A A .  25 ARG CB   1 1 
       13  7790 1 1 25 ARG CD   C    1.249   4.155 -11.505 1.00 . A A .  25 ARG CD   1 1 
       13  7791 1 1 25 ARG CG   C    2.689   4.118 -11.017 1.00 . A A .  25 ARG CG   1 1 
       13  7792 1 1 25 ARG CZ   C    0.068   4.784 -13.568 1.00 . A A .  25 ARG CZ   1 1 
       13  7793 1 1 25 ARG H    H    3.146   7.602  -9.060 1.00 . A A .  25 ARG H    1 1 
       13  7794 1 1 25 ARG HA   H    1.668   5.244  -8.785 1.00 . A A .  25 ARG HA   1 1 
       13  7795 1 1 25 ARG HB2  H    2.615   6.237 -10.917 1.00 . A A .  25 ARG HB2  1 1 
       13  7796 1 1 25 ARG HB3  H    4.163   5.539 -10.457 1.00 . A A .  25 ARG HB3  1 1 
       13  7797 1 1 25 ARG HD2  H    0.910   3.141 -11.660 1.00 . A A .  25 ARG HD2  1 1 
       13  7798 1 1 25 ARG HD3  H    0.639   4.626 -10.750 1.00 . A A .  25 ARG HD3  1 1 
       13  7799 1 1 25 ARG HE   H    1.839   5.507 -13.002 1.00 . A A .  25 ARG HE   1 1 
       13  7800 1 1 25 ARG HG2  H    3.338   3.927 -11.859 1.00 . A A .  25 ARG HG2  1 1 
       13  7801 1 1 25 ARG HG3  H    2.794   3.326 -10.291 1.00 . A A .  25 ARG HG3  1 1 
       13  7802 1 1 25 ARG HH11 H   -0.894   3.431 -12.416 1.00 . A A .  25 ARG HH11 1 1 
       13  7803 1 1 25 ARG HH12 H   -1.716   3.884 -13.873 1.00 . A A .  25 ARG HH12 1 1 
       13  7804 1 1 25 ARG HH21 H    0.767   6.111 -14.923 1.00 . A A .  25 ARG HH21 1 1 
       13  7805 1 1 25 ARG HH22 H   -0.770   5.408 -15.298 1.00 . A A .  25 ARG HH22 1 1 
       13  7806 1 1 25 ARG N    N    2.825   6.917  -8.437 1.00 . A A .  25 ARG N    1 1 
       13  7807 1 1 25 ARG NE   N    1.114   4.896 -12.756 1.00 . A A .  25 ARG NE   1 1 
       13  7808 1 1 25 ARG NH1  N   -0.929   3.965 -13.261 1.00 . A A .  25 ARG NH1  1 1 
       13  7809 1 1 25 ARG NH2  N    0.017   5.493 -14.688 1.00 . A A .  25 ARG NH2  1 1 
       13  7810 1 1 25 ARG O    O    3.089   3.618  -7.509 1.00 . A A .  25 ARG O    1 1 
       13  7811 1 1 26 SER C    C    5.256   3.824  -5.814 1.00 . A A .  26 SER C    1 1 
       13  7812 1 1 26 SER CA   C    5.799   4.116  -7.210 1.00 . A A .  26 SER CA   1 1 
       13  7813 1 1 26 SER CB   C    7.150   4.825  -7.105 1.00 . A A .  26 SER CB   1 1 
       13  7814 1 1 26 SER H    H    5.184   5.728  -8.437 1.00 . A A .  26 SER H    1 1 
       13  7815 1 1 26 SER HA   H    5.933   3.181  -7.734 1.00 . A A .  26 SER HA   1 1 
       13  7816 1 1 26 SER HB2  H    7.048   5.699  -6.480 1.00 . A A .  26 SER HB2  1 1 
       13  7817 1 1 26 SER HB3  H    7.874   4.153  -6.668 1.00 . A A .  26 SER HB3  1 1 
       13  7818 1 1 26 SER HG   H    8.404   4.730  -8.608 1.00 . A A .  26 SER HG   1 1 
       13  7819 1 1 26 SER N    N    4.859   4.927  -7.974 1.00 . A A .  26 SER N    1 1 
       13  7820 1 1 26 SER O    O    5.454   2.736  -5.274 1.00 . A A .  26 SER O    1 1 
       13  7821 1 1 26 SER OG   O    7.615   5.228  -8.382 1.00 . A A .  26 SER OG   1 1 
       13  7822 1 1 27 SER C    C    2.911   3.587  -3.892 1.00 . A A .  27 SER C    1 1 
       13  7823 1 1 27 SER CA   C    3.999   4.656  -3.903 1.00 . A A .  27 SER CA   1 1 
       13  7824 1 1 27 SER CB   C    3.425   5.989  -3.419 1.00 . A A .  27 SER CB   1 1 
       13  7825 1 1 27 SER H    H    4.445   5.649  -5.719 1.00 . A A .  27 SER H    1 1 
       13  7826 1 1 27 SER HA   H    4.792   4.353  -3.236 1.00 . A A .  27 SER HA   1 1 
       13  7827 1 1 27 SER HB2  H    2.646   6.309  -4.094 1.00 . A A .  27 SER HB2  1 1 
       13  7828 1 1 27 SER HB3  H    3.014   5.863  -2.428 1.00 . A A .  27 SER HB3  1 1 
       13  7829 1 1 27 SER HG   H    5.287   6.578  -3.259 1.00 . A A .  27 SER HG   1 1 
       13  7830 1 1 27 SER N    N    4.569   4.805  -5.237 1.00 . A A .  27 SER N    1 1 
       13  7831 1 1 27 SER O    O    2.709   2.899  -2.891 1.00 . A A .  27 SER O    1 1 
       13  7832 1 1 27 SER OG   O    4.428   6.990  -3.373 1.00 . A A .  27 SER OG   1 1 
       13  7833 1 1 28 LEU C    C    1.713   1.073  -5.371 1.00 . A A .  28 LEU C    1 1 
       13  7834 1 1 28 LEU CA   C    1.143   2.468  -5.136 1.00 . A A .  28 LEU CA   1 1 
       13  7835 1 1 28 LEU CB   C    0.202   2.846  -6.282 1.00 . A A .  28 LEU CB   1 1 
       13  7836 1 1 28 LEU CD1  C   -2.075   1.855  -5.948 1.00 . A A .  28 LEU CD1  1 1 
       13  7837 1 1 28 LEU CD2  C   -1.044   1.873  -8.227 1.00 . A A .  28 LEU CD2  1 1 
       13  7838 1 1 28 LEU CG   C   -0.776   1.761  -6.733 1.00 . A A .  28 LEU CG   1 1 
       13  7839 1 1 28 LEU H    H    2.418   4.030  -5.779 1.00 . A A .  28 LEU H    1 1 
       13  7840 1 1 28 LEU HA   H    0.587   2.466  -4.210 1.00 . A A .  28 LEU HA   1 1 
       13  7841 1 1 28 LEU HB2  H   -0.375   3.702  -5.966 1.00 . A A .  28 LEU HB2  1 1 
       13  7842 1 1 28 LEU HB3  H    0.811   3.119  -7.132 1.00 . A A .  28 LEU HB3  1 1 
       13  7843 1 1 28 LEU HD11 H   -2.878   2.134  -6.613 1.00 . A A .  28 LEU HD11 1 1 
       13  7844 1 1 28 LEU HD12 H   -1.974   2.599  -5.172 1.00 . A A .  28 LEU HD12 1 1 
       13  7845 1 1 28 LEU HD13 H   -2.295   0.896  -5.500 1.00 . A A .  28 LEU HD13 1 1 
       13  7846 1 1 28 LEU HD21 H   -0.145   1.628  -8.773 1.00 . A A .  28 LEU HD21 1 1 
       13  7847 1 1 28 LEU HD22 H   -1.347   2.882  -8.463 1.00 . A A .  28 LEU HD22 1 1 
       13  7848 1 1 28 LEU HD23 H   -1.832   1.187  -8.503 1.00 . A A .  28 LEU HD23 1 1 
       13  7849 1 1 28 LEU HG   H   -0.340   0.790  -6.542 1.00 . A A .  28 LEU HG   1 1 
       13  7850 1 1 28 LEU N    N    2.212   3.453  -5.014 1.00 . A A .  28 LEU N    1 1 
       13  7851 1 1 28 LEU O    O    1.295   0.106  -4.734 1.00 . A A .  28 LEU O    1 1 
       13  7852 1 1 29 ALA C    C    3.883  -0.948  -5.351 1.00 . A A .  29 ALA C    1 1 
       13  7853 1 1 29 ALA CA   C    3.301  -0.299  -6.602 1.00 . A A .  29 ALA CA   1 1 
       13  7854 1 1 29 ALA CB   C    4.385  -0.107  -7.653 1.00 . A A .  29 ALA CB   1 1 
       13  7855 1 1 29 ALA H    H    2.961   1.783  -6.761 1.00 . A A .  29 ALA H    1 1 
       13  7856 1 1 29 ALA HA   H    2.545  -0.952  -7.016 1.00 . A A .  29 ALA HA   1 1 
       13  7857 1 1 29 ALA HB1  H    5.350  -0.063  -7.170 1.00 . A A .  29 ALA HB1  1 1 
       13  7858 1 1 29 ALA HB2  H    4.366  -0.937  -8.344 1.00 . A A .  29 ALA HB2  1 1 
       13  7859 1 1 29 ALA HB3  H    4.207   0.813  -8.189 1.00 . A A .  29 ALA HB3  1 1 
       13  7860 1 1 29 ALA N    N    2.671   0.977  -6.287 1.00 . A A .  29 ALA N    1 1 
       13  7861 1 1 29 ALA O    O    3.451  -2.025  -4.941 1.00 . A A .  29 ALA O    1 1 
       13  7862 1 1 30 ILE C    C    4.499  -1.507  -2.646 1.00 . A A .  30 ILE C    1 1 
       13  7863 1 1 30 ILE CA   C    5.507  -0.799  -3.546 1.00 . A A .  30 ILE CA   1 1 
       13  7864 1 1 30 ILE CB   C    6.188   0.328  -2.747 1.00 . A A .  30 ILE CB   1 1 
       13  7865 1 1 30 ILE CD1  C    7.519   2.447  -3.211 1.00 . A A .  30 ILE CD1  1 1 
       13  7866 1 1 30 ILE CG1  C    7.263   1.007  -3.598 1.00 . A A .  30 ILE CG1  1 1 
       13  7867 1 1 30 ILE CG2  C    6.791  -0.223  -1.463 1.00 . A A .  30 ILE CG2  1 1 
       13  7868 1 1 30 ILE H    H    5.167   0.568  -5.125 1.00 . A A .  30 ILE H    1 1 
       13  7869 1 1 30 ILE HA   H    6.264  -1.508  -3.847 1.00 . A A .  30 ILE HA   1 1 
       13  7870 1 1 30 ILE HB   H    5.437   1.055  -2.480 1.00 . A A .  30 ILE HB   1 1 
       13  7871 1 1 30 ILE HD11 H    6.586   2.914  -2.927 1.00 . A A .  30 ILE HD11 1 1 
       13  7872 1 1 30 ILE HD12 H    8.205   2.480  -2.378 1.00 . A A .  30 ILE HD12 1 1 
       13  7873 1 1 30 ILE HD13 H    7.944   2.976  -4.050 1.00 . A A .  30 ILE HD13 1 1 
       13  7874 1 1 30 ILE HG12 H    8.191   0.467  -3.494 1.00 . A A .  30 ILE HG12 1 1 
       13  7875 1 1 30 ILE HG13 H    6.955   0.991  -4.633 1.00 . A A .  30 ILE HG13 1 1 
       13  7876 1 1 30 ILE HG21 H    6.494  -1.254  -1.339 1.00 . A A .  30 ILE HG21 1 1 
       13  7877 1 1 30 ILE HG22 H    7.867  -0.163  -1.517 1.00 . A A .  30 ILE HG22 1 1 
       13  7878 1 1 30 ILE HG23 H    6.439   0.357  -0.623 1.00 . A A .  30 ILE HG23 1 1 
       13  7879 1 1 30 ILE N    N    4.866  -0.286  -4.750 1.00 . A A .  30 ILE N    1 1 
       13  7880 1 1 30 ILE O    O    4.817  -2.513  -2.011 1.00 . A A .  30 ILE O    1 1 
       13  7881 1 1 31 HIS C    C    1.590  -2.754  -2.478 1.00 . A A .  31 HIS C    1 1 
       13  7882 1 1 31 HIS CA   C    2.226  -1.558  -1.777 1.00 . A A .  31 HIS CA   1 1 
       13  7883 1 1 31 HIS CB   C    1.158  -0.510  -1.464 1.00 . A A .  31 HIS CB   1 1 
       13  7884 1 1 31 HIS CD2  C   -1.357  -1.104  -1.685 1.00 . A A .  31 HIS CD2  1 1 
       13  7885 1 1 31 HIS CE1  C   -1.601  -2.178   0.210 1.00 . A A .  31 HIS CE1  1 1 
       13  7886 1 1 31 HIS CG   C   -0.158  -1.098  -1.057 1.00 . A A .  31 HIS CG   1 1 
       13  7887 1 1 31 HIS H    H    3.089  -0.173  -3.125 1.00 . A A .  31 HIS H    1 1 
       13  7888 1 1 31 HIS HA   H    2.671  -1.893  -0.852 1.00 . A A .  31 HIS HA   1 1 
       13  7889 1 1 31 HIS HB2  H    1.504   0.117  -0.655 1.00 . A A .  31 HIS HB2  1 1 
       13  7890 1 1 31 HIS HB3  H    0.993   0.100  -2.340 1.00 . A A .  31 HIS HB3  1 1 
       13  7891 1 1 31 HIS HD1  H    0.342  -1.944   0.806 1.00 . A A .  31 HIS HD1  1 1 
       13  7892 1 1 31 HIS HD2  H   -1.581  -0.659  -2.645 1.00 . A A .  31 HIS HD2  1 1 
       13  7893 1 1 31 HIS HE1  H   -2.035  -2.735   1.027 1.00 . A A .  31 HIS HE1  1 1 
       13  7894 1 1 31 HIS N    N    3.282  -0.975  -2.597 1.00 . A A .  31 HIS N    1 1 
       13  7895 1 1 31 HIS ND1  N   -0.345  -1.778   0.128 1.00 . A A .  31 HIS ND1  1 1 
       13  7896 1 1 31 HIS NE2  N   -2.237  -1.782  -0.878 1.00 . A A .  31 HIS NE2  1 1 
       13  7897 1 1 31 HIS O    O    1.352  -3.792  -1.861 1.00 . A A .  31 HIS O    1 1 
       13  7898 1 1 32 GLN C    C    1.501  -4.966  -4.414 1.00 . A A .  32 GLN C    1 1 
       13  7899 1 1 32 GLN CA   C    0.710  -3.669  -4.555 1.00 . A A .  32 GLN CA   1 1 
       13  7900 1 1 32 GLN CB   C    0.627  -3.266  -6.028 1.00 . A A .  32 GLN CB   1 1 
       13  7901 1 1 32 GLN CD   C   -0.909  -2.179  -7.714 1.00 . A A .  32 GLN CD   1 1 
       13  7902 1 1 32 GLN CG   C   -0.370  -2.150  -6.297 1.00 . A A .  32 GLN CG   1 1 
       13  7903 1 1 32 GLN H    H    1.533  -1.751  -4.206 1.00 . A A .  32 GLN H    1 1 
       13  7904 1 1 32 GLN HA   H   -0.288  -3.829  -4.178 1.00 . A A .  32 GLN HA   1 1 
       13  7905 1 1 32 GLN HB2  H    1.602  -2.935  -6.354 1.00 . A A .  32 GLN HB2  1 1 
       13  7906 1 1 32 GLN HB3  H    0.335  -4.128  -6.609 1.00 . A A .  32 GLN HB3  1 1 
       13  7907 1 1 32 GLN HE21 H   -1.886  -0.476  -7.403 1.00 . A A .  32 GLN HE21 1 1 
       13  7908 1 1 32 GLN HE22 H   -2.060  -1.165  -8.977 1.00 . A A .  32 GLN HE22 1 1 
       13  7909 1 1 32 GLN HG2  H   -1.199  -2.252  -5.612 1.00 . A A .  32 GLN HG2  1 1 
       13  7910 1 1 32 GLN HG3  H    0.118  -1.201  -6.132 1.00 . A A .  32 GLN HG3  1 1 
       13  7911 1 1 32 GLN N    N    1.319  -2.601  -3.771 1.00 . A A .  32 GLN N    1 1 
       13  7912 1 1 32 GLN NE2  N   -1.699  -1.172  -8.068 1.00 . A A .  32 GLN NE2  1 1 
       13  7913 1 1 32 GLN O    O    0.992  -6.049  -4.702 1.00 . A A .  32 GLN O    1 1 
       13  7914 1 1 32 GLN OE1  O   -0.618  -3.096  -8.483 1.00 . A A .  32 GLN OE1  1 1 
       13  7915 1 1 33 ALA C    C    3.287  -6.736  -2.489 1.00 . A A .  33 ALA C    1 1 
       13  7916 1 1 33 ALA CA   C    3.609  -6.011  -3.791 1.00 . A A .  33 ALA CA   1 1 
       13  7917 1 1 33 ALA CB   C    5.072  -5.594  -3.818 1.00 . A A .  33 ALA CB   1 1 
       13  7918 1 1 33 ALA H    H    3.098  -3.958  -3.758 1.00 . A A .  33 ALA H    1 1 
       13  7919 1 1 33 ALA HA   H    3.436  -6.684  -4.619 1.00 . A A .  33 ALA HA   1 1 
       13  7920 1 1 33 ALA HB1  H    5.258  -4.991  -4.694 1.00 . A A .  33 ALA HB1  1 1 
       13  7921 1 1 33 ALA HB2  H    5.298  -5.020  -2.931 1.00 . A A .  33 ALA HB2  1 1 
       13  7922 1 1 33 ALA HB3  H    5.696  -6.475  -3.847 1.00 . A A .  33 ALA HB3  1 1 
       13  7923 1 1 33 ALA N    N    2.748  -4.848  -3.971 1.00 . A A .  33 ALA N    1 1 
       13  7924 1 1 33 ALA O    O    4.028  -7.620  -2.058 1.00 . A A .  33 ALA O    1 1 
       13  7925 1 1 34 THR C    C    0.486  -7.788  -0.796 1.00 . A A .  34 THR C    1 1 
       13  7926 1 1 34 THR CA   C    1.758  -6.968  -0.610 1.00 . A A .  34 THR CA   1 1 
       13  7927 1 1 34 THR CB   C    1.516  -5.907   0.480 1.00 . A A .  34 THR CB   1 1 
       13  7928 1 1 34 THR CG2  C    2.785  -5.115   0.756 1.00 . A A .  34 THR CG2  1 1 
       13  7929 1 1 34 THR H    H    1.628  -5.646  -2.257 1.00 . A A .  34 THR H    1 1 
       13  7930 1 1 34 THR HA   H    2.551  -7.622  -0.277 1.00 . A A .  34 THR HA   1 1 
       13  7931 1 1 34 THR HB   H    1.218  -6.409   1.390 1.00 . A A .  34 THR HB   1 1 
       13  7932 1 1 34 THR HG1  H    0.516  -4.211   0.595 1.00 . A A .  34 THR HG1  1 1 
       13  7933 1 1 34 THR HG21 H    2.703  -4.137   0.306 1.00 . A A .  34 THR HG21 1 1 
       13  7934 1 1 34 THR HG22 H    3.633  -5.635   0.334 1.00 . A A .  34 THR HG22 1 1 
       13  7935 1 1 34 THR HG23 H    2.921  -5.012   1.822 1.00 . A A .  34 THR HG23 1 1 
       13  7936 1 1 34 THR N    N    2.177  -6.356  -1.864 1.00 . A A .  34 THR N    1 1 
       13  7937 1 1 34 THR O    O    0.221  -8.722  -0.038 1.00 . A A .  34 THR O    1 1 
       13  7938 1 1 34 THR OG1  O    0.471  -5.017   0.074 1.00 . A A .  34 THR OG1  1 1 
       13  7939 1 1 35 HIS C    C   -1.287  -9.352  -2.985 1.00 . A A .  35 HIS C    1 1 
       13  7940 1 1 35 HIS CA   C   -1.542  -8.139  -2.096 1.00 . A A .  35 HIS CA   1 1 
       13  7941 1 1 35 HIS CB   C   -2.542  -7.199  -2.770 1.00 . A A .  35 HIS CB   1 1 
       13  7942 1 1 35 HIS CD2  C   -2.976  -4.837  -1.790 1.00 . A A .  35 HIS CD2  1 1 
       13  7943 1 1 35 HIS CE1  C   -4.335  -5.409  -0.166 1.00 . A A .  35 HIS CE1  1 1 
       13  7944 1 1 35 HIS CG   C   -3.128  -6.181  -1.841 1.00 . A A .  35 HIS CG   1 1 
       13  7945 1 1 35 HIS H    H   -0.033  -6.681  -2.378 1.00 . A A .  35 HIS H    1 1 
       13  7946 1 1 35 HIS HA   H   -1.956  -8.476  -1.157 1.00 . A A .  35 HIS HA   1 1 
       13  7947 1 1 35 HIS HB2  H   -2.045  -6.670  -3.570 1.00 . A A .  35 HIS HB2  1 1 
       13  7948 1 1 35 HIS HB3  H   -3.354  -7.782  -3.181 1.00 . A A .  35 HIS HB3  1 1 
       13  7949 1 1 35 HIS HD1  H   -4.290  -7.411  -0.585 1.00 . A A .  35 HIS HD1  1 1 
       13  7950 1 1 35 HIS HD2  H   -2.370  -4.234  -2.451 1.00 . A A .  35 HIS HD2  1 1 
       13  7951 1 1 35 HIS HE1  H   -4.997  -5.359   0.685 1.00 . A A .  35 HIS HE1  1 1 
       13  7952 1 1 35 HIS N    N   -0.298  -7.434  -1.809 1.00 . A A .  35 HIS N    1 1 
       13  7953 1 1 35 HIS ND1  N   -3.984  -6.508  -0.810 1.00 . A A .  35 HIS ND1  1 1 
       13  7954 1 1 35 HIS NE2  N   -3.736  -4.381  -0.741 1.00 . A A .  35 HIS NE2  1 1 
       13  7955 1 1 35 HIS O    O   -2.073  -9.652  -3.883 1.00 . A A .  35 HIS O    1 1 
       13  7956 1 1 36 SER C    C    1.388 -11.928  -2.901 1.00 . A A .  36 SER C    1 1 
       13  7957 1 1 36 SER CA   C    0.178 -11.224  -3.508 1.00 . A A .  36 SER CA   1 1 
       13  7958 1 1 36 SER CB   C    0.475 -10.832  -4.956 1.00 . A A .  36 SER CB   1 1 
       13  7959 1 1 36 SER H    H    0.404  -9.757  -1.998 1.00 . A A .  36 SER H    1 1 
       13  7960 1 1 36 SER HA   H   -0.662 -11.902  -3.493 1.00 . A A .  36 SER HA   1 1 
       13  7961 1 1 36 SER HB2  H   -0.154 -10.002  -5.238 1.00 . A A .  36 SER HB2  1 1 
       13  7962 1 1 36 SER HB3  H    1.513 -10.542  -5.042 1.00 . A A .  36 SER HB3  1 1 
       13  7963 1 1 36 SER HG   H   -0.691 -11.897  -6.115 1.00 . A A .  36 SER HG   1 1 
       13  7964 1 1 36 SER N    N   -0.183 -10.046  -2.728 1.00 . A A .  36 SER N    1 1 
       13  7965 1 1 36 SER O    O    1.940 -11.482  -1.895 1.00 . A A .  36 SER O    1 1 
       13  7966 1 1 36 SER OG   O    0.228 -11.913  -5.839 1.00 . A A .  36 SER OG   1 1 
       13  7967 1 1 37 GLY C    C    3.362 -14.881  -3.979 1.00 . A A .  37 GLY C    1 1 
       13  7968 1 1 37 GLY CA   C    2.938 -13.779  -3.029 1.00 . A A .  37 GLY CA   1 1 
       13  7969 1 1 37 GLY H    H    1.318 -13.339  -4.319 1.00 . A A .  37 GLY H    1 1 
       13  7970 1 1 37 GLY HA2  H    3.766 -13.101  -2.888 1.00 . A A .  37 GLY HA2  1 1 
       13  7971 1 1 37 GLY HA3  H    2.682 -14.220  -2.077 1.00 . A A .  37 GLY HA3  1 1 
       13  7972 1 1 37 GLY N    N    1.796 -13.031  -3.521 1.00 . A A .  37 GLY N    1 1 
       13  7973 1 1 37 GLY O    O    2.602 -15.273  -4.864 1.00 . A A .  37 GLY O    1 1 
       13  7974 1 1 38 GLU C    C    4.068 -17.546  -4.843 1.00 . A A .  38 GLU C    1 1 
       13  7975 1 1 38 GLU CA   C    5.105 -16.443  -4.648 1.00 . A A .  38 GLU CA   1 1 
       13  7976 1 1 38 GLU CB   C    6.381 -17.030  -4.041 1.00 . A A .  38 GLU CB   1 1 
       13  7977 1 1 38 GLU CD   C    7.917 -15.075  -3.594 1.00 . A A .  38 GLU CD   1 1 
       13  7978 1 1 38 GLU CG   C    7.645 -16.294  -4.454 1.00 . A A .  38 GLU CG   1 1 
       13  7979 1 1 38 GLU H    H    5.140 -15.027  -3.075 1.00 . A A .  38 GLU H    1 1 
       13  7980 1 1 38 GLU HA   H    5.340 -16.012  -5.609 1.00 . A A .  38 GLU HA   1 1 
       13  7981 1 1 38 GLU HB2  H    6.303 -16.994  -2.965 1.00 . A A .  38 GLU HB2  1 1 
       13  7982 1 1 38 GLU HB3  H    6.472 -18.060  -4.353 1.00 . A A .  38 GLU HB3  1 1 
       13  7983 1 1 38 GLU HG2  H    8.483 -16.969  -4.369 1.00 . A A .  38 GLU HG2  1 1 
       13  7984 1 1 38 GLU HG3  H    7.543 -15.977  -5.481 1.00 . A A .  38 GLU HG3  1 1 
       13  7985 1 1 38 GLU N    N    4.581 -15.381  -3.797 1.00 . A A .  38 GLU N    1 1 
       13  7986 1 1 38 GLU O    O    4.134 -18.313  -5.804 1.00 . A A .  38 GLU O    1 1 
       13  7987 1 1 38 GLU OE1  O    7.235 -14.047  -3.789 1.00 . A A .  38 GLU OE1  1 1 
       13  7988 1 1 38 GLU OE2  O    8.813 -15.149  -2.727 1.00 . A A .  38 GLU OE2  1 1 
       13  7989 1 1 39 LYS C    C    0.682 -17.970  -4.052 1.00 . A A .  39 LYS C    1 1 
       13  7990 1 1 39 LYS CA   C    2.058 -18.625  -3.995 1.00 . A A .  39 LYS CA   1 1 
       13  7991 1 1 39 LYS CB   C    2.139 -19.561  -2.786 1.00 . A A .  39 LYS CB   1 1 
       13  7992 1 1 39 LYS CD   C    2.841 -19.581  -0.375 1.00 . A A .  39 LYS CD   1 1 
       13  7993 1 1 39 LYS CE   C    2.908 -18.779   0.916 1.00 . A A .  39 LYS CE   1 1 
       13  7994 1 1 39 LYS CG   C    2.068 -18.839  -1.452 1.00 . A A .  39 LYS CG   1 1 
       13  7995 1 1 39 LYS H    H    3.111 -16.978  -3.183 1.00 . A A .  39 LYS H    1 1 
       13  7996 1 1 39 LYS HA   H    2.208 -19.200  -4.896 1.00 . A A .  39 LYS HA   1 1 
       13  7997 1 1 39 LYS HB2  H    1.321 -20.265  -2.836 1.00 . A A .  39 LYS HB2  1 1 
       13  7998 1 1 39 LYS HB3  H    3.072 -20.104  -2.829 1.00 . A A .  39 LYS HB3  1 1 
       13  7999 1 1 39 LYS HD2  H    2.351 -20.522  -0.175 1.00 . A A .  39 LYS HD2  1 1 
       13  8000 1 1 39 LYS HD3  H    3.846 -19.765  -0.727 1.00 . A A .  39 LYS HD3  1 1 
       13  8001 1 1 39 LYS HE2  H    1.905 -18.510   1.210 1.00 . A A .  39 LYS HE2  1 1 
       13  8002 1 1 39 LYS HE3  H    3.355 -19.394   1.683 1.00 . A A .  39 LYS HE3  1 1 
       13  8003 1 1 39 LYS HG2  H    2.487 -17.851  -1.565 1.00 . A A .  39 LYS HG2  1 1 
       13  8004 1 1 39 LYS HG3  H    1.033 -18.761  -1.150 1.00 . A A .  39 LYS HG3  1 1 
       13  8005 1 1 39 LYS HZ1  H    4.103 -17.485  -0.207 1.00 . A A .  39 LYS HZ1  1 1 
       13  8006 1 1 39 LYS HZ2  H    4.504 -17.536   1.436 1.00 . A A .  39 LYS HZ2  1 1 
       13  8007 1 1 39 LYS HZ3  H    3.123 -16.701   0.927 1.00 . A A .  39 LYS HZ3  1 1 
       13  8008 1 1 39 LYS N    N    3.110 -17.618  -3.925 1.00 . A A .  39 LYS N    1 1 
       13  8009 1 1 39 LYS NZ   N    3.716 -17.538   0.756 1.00 . A A .  39 LYS NZ   1 1 
       13  8010 1 1 39 LYS O    O   -0.045 -17.908  -3.060 1.00 . A A .  39 LYS O    1 1 
       13  8011 1 1 40 PRO C    C   -2.147 -17.795  -5.396 1.00 . A A .  40 PRO C    1 1 
       13  8012 1 1 40 PRO CA   C   -0.981 -16.815  -5.457 1.00 . A A .  40 PRO CA   1 1 
       13  8013 1 1 40 PRO CB   C   -0.850 -16.227  -6.864 1.00 . A A .  40 PRO CB   1 1 
       13  8014 1 1 40 PRO CD   C    1.127 -17.511  -6.467 1.00 . A A .  40 PRO CD   1 1 
       13  8015 1 1 40 PRO CG   C    0.164 -17.084  -7.540 1.00 . A A .  40 PRO CG   1 1 
       13  8016 1 1 40 PRO HA   H   -1.144 -16.018  -4.746 1.00 . A A .  40 PRO HA   1 1 
       13  8017 1 1 40 PRO HB2  H   -1.806 -16.273  -7.367 1.00 . A A .  40 PRO HB2  1 1 
       13  8018 1 1 40 PRO HB3  H   -0.519 -15.201  -6.800 1.00 . A A .  40 PRO HB3  1 1 
       13  8019 1 1 40 PRO HD2  H    1.487 -18.511  -6.659 1.00 . A A .  40 PRO HD2  1 1 
       13  8020 1 1 40 PRO HD3  H    1.952 -16.816  -6.403 1.00 . A A .  40 PRO HD3  1 1 
       13  8021 1 1 40 PRO HG2  H   -0.317 -17.946  -7.976 1.00 . A A .  40 PRO HG2  1 1 
       13  8022 1 1 40 PRO HG3  H    0.678 -16.514  -8.300 1.00 . A A .  40 PRO HG3  1 1 
       13  8023 1 1 40 PRO N    N    0.312 -17.471  -5.241 1.00 . A A .  40 PRO N    1 1 
       13  8024 1 1 40 PRO O    O   -3.128 -17.565  -4.688 1.00 . A A .  40 PRO O    1 1 
       13  8025 1 1 41 SER C    C   -4.424 -19.286  -6.544 1.00 . A A .  41 SER C    1 1 
       13  8026 1 1 41 SER CA   C   -3.080 -19.905  -6.174 1.00 . A A .  41 SER CA   1 1 
       13  8027 1 1 41 SER CB   C   -3.184 -20.604  -4.818 1.00 . A A .  41 SER CB   1 1 
       13  8028 1 1 41 SER H    H   -1.226 -19.017  -6.684 1.00 . A A .  41 SER H    1 1 
       13  8029 1 1 41 SER HA   H   -2.812 -20.632  -6.926 1.00 . A A .  41 SER HA   1 1 
       13  8030 1 1 41 SER HB2  H   -2.195 -20.725  -4.401 1.00 . A A .  41 SER HB2  1 1 
       13  8031 1 1 41 SER HB3  H   -3.785 -20.004  -4.151 1.00 . A A .  41 SER HB3  1 1 
       13  8032 1 1 41 SER HG   H   -4.344 -21.895  -5.727 1.00 . A A .  41 SER HG   1 1 
       13  8033 1 1 41 SER N    N   -2.033 -18.890  -6.141 1.00 . A A .  41 SER N    1 1 
       13  8034 1 1 41 SER O    O   -5.456 -19.620  -5.962 1.00 . A A .  41 SER O    1 1 
       13  8035 1 1 41 SER OG   O   -3.783 -21.882  -4.947 1.00 . A A .  41 SER OG   1 1 
       13  8036 1 1 42 GLY C    C   -5.362 -16.432  -8.689 1.00 . A A .  42 GLY C    1 1 
       13  8037 1 1 42 GLY CA   C   -5.627 -17.729  -7.950 1.00 . A A .  42 GLY CA   1 1 
       13  8038 1 1 42 GLY H    H   -3.552 -18.153  -7.946 1.00 . A A .  42 GLY H    1 1 
       13  8039 1 1 42 GLY HA2  H   -6.168 -18.398  -8.601 1.00 . A A .  42 GLY HA2  1 1 
       13  8040 1 1 42 GLY HA3  H   -6.234 -17.517  -7.082 1.00 . A A .  42 GLY HA3  1 1 
       13  8041 1 1 42 GLY N    N   -4.404 -18.380  -7.518 1.00 . A A .  42 GLY N    1 1 
       13  8042 1 1 42 GLY O    O   -5.425 -15.343  -8.118 1.00 . A A .  42 GLY O    1 1 
       13  8043 1 1 43 PRO C    C   -6.019 -14.534 -11.097 1.00 . A A .  43 PRO C    1 1 
       13  8044 1 1 43 PRO CA   C   -4.775 -15.376 -10.837 1.00 . A A .  43 PRO CA   1 1 
       13  8045 1 1 43 PRO CB   C   -4.269 -16.000 -12.139 1.00 . A A .  43 PRO CB   1 1 
       13  8046 1 1 43 PRO CD   C   -4.965 -17.806 -10.737 1.00 . A A .  43 PRO CD   1 1 
       13  8047 1 1 43 PRO CG   C   -4.876 -17.360 -12.170 1.00 . A A .  43 PRO CG   1 1 
       13  8048 1 1 43 PRO HA   H   -4.003 -14.753 -10.409 1.00 . A A .  43 PRO HA   1 1 
       13  8049 1 1 43 PRO HB2  H   -4.595 -15.401 -12.979 1.00 . A A .  43 PRO HB2  1 1 
       13  8050 1 1 43 PRO HB3  H   -3.190 -16.050 -12.124 1.00 . A A .  43 PRO HB3  1 1 
       13  8051 1 1 43 PRO HD2  H   -5.847 -18.409 -10.584 1.00 . A A .  43 PRO HD2  1 1 
       13  8052 1 1 43 PRO HD3  H   -4.077 -18.354 -10.457 1.00 . A A .  43 PRO HD3  1 1 
       13  8053 1 1 43 PRO HG2  H   -5.861 -17.312 -12.610 1.00 . A A .  43 PRO HG2  1 1 
       13  8054 1 1 43 PRO HG3  H   -4.244 -18.031 -12.733 1.00 . A A .  43 PRO HG3  1 1 
       13  8055 1 1 43 PRO N    N   -5.057 -16.540  -9.991 1.00 . A A .  43 PRO N    1 1 
       13  8056 1 1 43 PRO O    O   -5.964 -13.304 -11.070 1.00 . A A .  43 PRO O    1 1 
       13  8057 1 1 44 SER C    C   -9.496 -15.007 -10.682 1.00 . A A .  44 SER C    1 1 
       13  8058 1 1 44 SER CA   C   -8.396 -14.515 -11.619 1.00 . A A .  44 SER CA   1 1 
       13  8059 1 1 44 SER CB   C   -8.818 -14.728 -13.074 1.00 . A A .  44 SER CB   1 1 
       13  8060 1 1 44 SER H    H   -7.119 -16.183 -11.357 1.00 . A A .  44 SER H    1 1 
       13  8061 1 1 44 SER HA   H   -8.240 -13.460 -11.449 1.00 . A A .  44 SER HA   1 1 
       13  8062 1 1 44 SER HB2  H   -8.869 -15.786 -13.280 1.00 . A A .  44 SER HB2  1 1 
       13  8063 1 1 44 SER HB3  H   -9.789 -14.283 -13.233 1.00 . A A .  44 SER HB3  1 1 
       13  8064 1 1 44 SER HG   H   -7.483 -13.374 -13.544 1.00 . A A .  44 SER HG   1 1 
       13  8065 1 1 44 SER N    N   -7.139 -15.203 -11.350 1.00 . A A .  44 SER N    1 1 
       13  8066 1 1 44 SER O    O  -10.307 -15.856 -11.050 1.00 . A A .  44 SER O    1 1 
       13  8067 1 1 44 SER OG   O   -7.891 -14.134 -13.965 1.00 . A A .  44 SER OG   1 1 
       13  8068 1 1 45 SER C    C  -11.143 -13.619  -7.832 1.00 . A A .  45 SER C    1 1 
       13  8069 1 1 45 SER CA   C  -10.512 -14.851  -8.476 1.00 . A A .  45 SER CA   1 1 
       13  8070 1 1 45 SER CB   C   -9.877 -15.734  -7.400 1.00 . A A .  45 SER CB   1 1 
       13  8071 1 1 45 SER H    H   -8.842 -13.793  -9.233 1.00 . A A .  45 SER H    1 1 
       13  8072 1 1 45 SER HA   H  -11.284 -15.413  -8.981 1.00 . A A .  45 SER HA   1 1 
       13  8073 1 1 45 SER HB2  H  -10.633 -16.029  -6.688 1.00 . A A .  45 SER HB2  1 1 
       13  8074 1 1 45 SER HB3  H   -9.455 -16.614  -7.863 1.00 . A A .  45 SER HB3  1 1 
       13  8075 1 1 45 SER HG   H   -9.095 -14.934  -5.791 1.00 . A A .  45 SER HG   1 1 
       13  8076 1 1 45 SER N    N   -9.516 -14.466  -9.468 1.00 . A A .  45 SER N    1 1 
       13  8077 1 1 45 SER O    O  -10.687 -13.147  -6.791 1.00 . A A .  45 SER O    1 1 
       13  8078 1 1 45 SER OG   O   -8.849 -15.041  -6.713 1.00 . A A .  45 SER OG   1 1 
       13  8079 1 1 46 GLY C    C  -12.078 -10.658  -8.154 1.00 . A A .  46 GLY C    1 1 
       13  8080 1 1 46 GLY CA   C  -12.871 -11.932  -7.936 1.00 . A A .  46 GLY CA   1 1 
       13  8081 1 1 46 GLY H    H  -12.514 -13.522  -9.287 1.00 . A A .  46 GLY H    1 1 
       13  8082 1 1 46 GLY HA2  H  -13.829 -11.834  -8.424 1.00 . A A .  46 GLY HA2  1 1 
       13  8083 1 1 46 GLY HA3  H  -13.030 -12.066  -6.876 1.00 . A A .  46 GLY HA3  1 1 
       13  8084 1 1 46 GLY N    N  -12.194 -13.104  -8.461 1.00 . A A .  46 GLY N    1 1 
       13  8085 1 1 46 GLY O    O  -12.161 -10.078  -9.235 1.00 . A A .  46 GLY O    1 1 
       13  8086 2 2  1 ZN  ZN   ZN  -4.146  -2.572  -1.199 1.00 . B A . 201 ZN  ZN   1 1 
       14  8087 1 1  1 GLY C    C  -17.432  17.865  14.971 1.00 . A A .   1 GLY C    1 1 
       14  8088 1 1  1 GLY CA   C  -18.349  18.542  15.971 1.00 . A A .   1 GLY CA   1 1 
       14  8089 1 1  1 GLY H1   H  -18.148  20.595  16.448 1.00 . A A .   1 GLY H1   1 1 
       14  8090 1 1  1 GLY HA2  H  -17.970  18.366  16.967 1.00 . A A .   1 GLY HA2  1 1 
       14  8091 1 1  1 GLY HA3  H  -19.334  18.107  15.890 1.00 . A A .   1 GLY HA3  1 1 
       14  8092 1 1  1 GLY N    N  -18.449  19.973  15.752 1.00 . A A .   1 GLY N    1 1 
       14  8093 1 1  1 GLY O    O  -17.809  16.874  14.346 1.00 . A A .   1 GLY O    1 1 
       14  8094 1 1  2 SER C    C  -14.061  17.256  14.625 1.00 . A A .   2 SER C    1 1 
       14  8095 1 1  2 SER CA   C  -15.255  17.847  13.882 1.00 . A A .   2 SER CA   1 1 
       14  8096 1 1  2 SER CB   C  -14.780  18.926  12.907 1.00 . A A .   2 SER CB   1 1 
       14  8097 1 1  2 SER H    H  -15.985  19.193  15.345 1.00 . A A .   2 SER H    1 1 
       14  8098 1 1  2 SER HA   H  -15.743  17.061  13.326 1.00 . A A .   2 SER HA   1 1 
       14  8099 1 1  2 SER HB2  H  -15.574  19.155  12.213 1.00 . A A .   2 SER HB2  1 1 
       14  8100 1 1  2 SER HB3  H  -14.518  19.817  13.460 1.00 . A A .   2 SER HB3  1 1 
       14  8101 1 1  2 SER HG   H  -12.863  18.564  12.728 1.00 . A A .   2 SER HG   1 1 
       14  8102 1 1  2 SER N    N  -16.226  18.402  14.818 1.00 . A A .   2 SER N    1 1 
       14  8103 1 1  2 SER O    O  -13.564  17.840  15.588 1.00 . A A .   2 SER O    1 1 
       14  8104 1 1  2 SER OG   O  -13.646  18.491  12.177 1.00 . A A .   2 SER OG   1 1 
       14  8105 1 1  3 SER C    C  -11.271  15.396  13.855 1.00 . A A .   3 SER C    1 1 
       14  8106 1 1  3 SER CA   C  -12.473  15.419  14.794 1.00 . A A .   3 SER CA   1 1 
       14  8107 1 1  3 SER CB   C  -12.855  13.990  15.186 1.00 . A A .   3 SER CB   1 1 
       14  8108 1 1  3 SER H    H  -14.046  15.676  13.399 1.00 . A A .   3 SER H    1 1 
       14  8109 1 1  3 SER HA   H  -12.209  15.969  15.685 1.00 . A A .   3 SER HA   1 1 
       14  8110 1 1  3 SER HB2  H  -13.808  14.001  15.694 1.00 . A A .   3 SER HB2  1 1 
       14  8111 1 1  3 SER HB3  H  -12.929  13.383  14.295 1.00 . A A .   3 SER HB3  1 1 
       14  8112 1 1  3 SER HG   H  -11.625  14.067  16.708 1.00 . A A .   3 SER HG   1 1 
       14  8113 1 1  3 SER N    N  -13.607  16.092  14.171 1.00 . A A .   3 SER N    1 1 
       14  8114 1 1  3 SER O    O  -11.098  14.463  13.072 1.00 . A A .   3 SER O    1 1 
       14  8115 1 1  3 SER OG   O  -11.885  13.421  16.048 1.00 . A A .   3 SER OG   1 1 
       14  8116 1 1  4 GLY C    C   -9.537  17.247  11.795 1.00 . A A .   4 GLY C    1 1 
       14  8117 1 1  4 GLY CA   C   -9.266  16.513  13.093 1.00 . A A .   4 GLY CA   1 1 
       14  8118 1 1  4 GLY H    H  -10.630  17.147  14.583 1.00 . A A .   4 GLY H    1 1 
       14  8119 1 1  4 GLY HA2  H   -8.484  17.028  13.630 1.00 . A A .   4 GLY HA2  1 1 
       14  8120 1 1  4 GLY HA3  H   -8.933  15.512  12.864 1.00 . A A .   4 GLY HA3  1 1 
       14  8121 1 1  4 GLY N    N  -10.442  16.432  13.940 1.00 . A A .   4 GLY N    1 1 
       14  8122 1 1  4 GLY O    O  -10.560  17.917  11.654 1.00 . A A .   4 GLY O    1 1 
       14  8123 1 1  5 SER C    C   -8.730  16.767   8.414 1.00 . A A .   5 SER C    1 1 
       14  8124 1 1  5 SER CA   C   -8.758  17.784   9.552 1.00 . A A .   5 SER CA   1 1 
       14  8125 1 1  5 SER CB   C   -7.644  18.814   9.358 1.00 . A A .   5 SER CB   1 1 
       14  8126 1 1  5 SER H    H   -7.823  16.574  11.016 1.00 . A A .   5 SER H    1 1 
       14  8127 1 1  5 SER HA   H   -9.711  18.291   9.542 1.00 . A A .   5 SER HA   1 1 
       14  8128 1 1  5 SER HB2  H   -7.739  19.264   8.382 1.00 . A A .   5 SER HB2  1 1 
       14  8129 1 1  5 SER HB3  H   -7.728  19.579  10.117 1.00 . A A .   5 SER HB3  1 1 
       14  8130 1 1  5 SER HG   H   -6.429  17.416   9.997 1.00 . A A .   5 SER HG   1 1 
       14  8131 1 1  5 SER N    N   -8.617  17.122  10.843 1.00 . A A .   5 SER N    1 1 
       14  8132 1 1  5 SER O    O   -7.688  16.183   8.115 1.00 . A A .   5 SER O    1 1 
       14  8133 1 1  5 SER OG   O   -6.366  18.209   9.459 1.00 . A A .   5 SER OG   1 1 
       14  8134 1 1  6 SER C    C  -10.751  16.227   5.510 1.00 . A A .   6 SER C    1 1 
       14  8135 1 1  6 SER CA   C   -9.991  15.613   6.682 1.00 . A A .   6 SER CA   1 1 
       14  8136 1 1  6 SER CB   C  -10.694  14.336   7.148 1.00 . A A .   6 SER CB   1 1 
       14  8137 1 1  6 SER H    H  -10.677  17.058   8.070 1.00 . A A .   6 SER H    1 1 
       14  8138 1 1  6 SER HA   H   -8.992  15.365   6.358 1.00 . A A .   6 SER HA   1 1 
       14  8139 1 1  6 SER HB2  H  -10.754  13.641   6.325 1.00 . A A .   6 SER HB2  1 1 
       14  8140 1 1  6 SER HB3  H  -10.130  13.892   7.955 1.00 . A A .   6 SER HB3  1 1 
       14  8141 1 1  6 SER HG   H  -12.052  14.469   8.555 1.00 . A A .   6 SER HG   1 1 
       14  8142 1 1  6 SER N    N   -9.882  16.561   7.784 1.00 . A A .   6 SER N    1 1 
       14  8143 1 1  6 SER O    O  -11.752  16.917   5.698 1.00 . A A .   6 SER O    1 1 
       14  8144 1 1  6 SER OG   O  -12.006  14.615   7.607 1.00 . A A .   6 SER OG   1 1 
       14  8145 1 1  7 GLY C    C  -11.653  15.441   2.328 1.00 . A A .   7 GLY C    1 1 
       14  8146 1 1  7 GLY CA   C  -10.911  16.504   3.114 1.00 . A A .   7 GLY CA   1 1 
       14  8147 1 1  7 GLY H    H   -9.465  15.413   4.210 1.00 . A A .   7 GLY H    1 1 
       14  8148 1 1  7 GLY HA2  H  -11.611  17.270   3.412 1.00 . A A .   7 GLY HA2  1 1 
       14  8149 1 1  7 GLY HA3  H  -10.159  16.946   2.477 1.00 . A A .   7 GLY HA3  1 1 
       14  8150 1 1  7 GLY N    N  -10.267  15.970   4.299 1.00 . A A .   7 GLY N    1 1 
       14  8151 1 1  7 GLY O    O  -11.674  14.272   2.716 1.00 . A A .   7 GLY O    1 1 
       14  8152 1 1  8 THR C    C  -12.225  13.639   0.133 1.00 . A A .   8 THR C    1 1 
       14  8153 1 1  8 THR CA   C  -13.014  14.920   0.378 1.00 . A A .   8 THR CA   1 1 
       14  8154 1 1  8 THR CB   C  -13.371  15.556  -0.978 1.00 . A A .   8 THR CB   1 1 
       14  8155 1 1  8 THR CG2  C  -14.163  14.585  -1.840 1.00 . A A .   8 THR CG2  1 1 
       14  8156 1 1  8 THR H    H  -12.212  16.789   0.963 1.00 . A A .   8 THR H    1 1 
       14  8157 1 1  8 THR HA   H  -13.933  14.673   0.890 1.00 . A A .   8 THR HA   1 1 
       14  8158 1 1  8 THR HB   H  -12.455  15.807  -1.493 1.00 . A A .   8 THR HB   1 1 
       14  8159 1 1  8 THR HG1  H  -13.699  17.299  -0.114 1.00 . A A .   8 THR HG1  1 1 
       14  8160 1 1  8 THR HG21 H  -14.870  14.051  -1.223 1.00 . A A .   8 THR HG21 1 1 
       14  8161 1 1  8 THR HG22 H  -13.487  13.882  -2.304 1.00 . A A .   8 THR HG22 1 1 
       14  8162 1 1  8 THR HG23 H  -14.694  15.133  -2.604 1.00 . A A .   8 THR HG23 1 1 
       14  8163 1 1  8 THR N    N  -12.265  15.845   1.219 1.00 . A A .   8 THR N    1 1 
       14  8164 1 1  8 THR O    O  -12.654  12.551   0.517 1.00 . A A .   8 THR O    1 1 
       14  8165 1 1  8 THR OG1  O  -14.133  16.751  -0.773 1.00 . A A .   8 THR OG1  1 1 
       14  8166 1 1  9 GLY C    C  -10.210  12.274  -2.268 1.00 . A A .   9 GLY C    1 1 
       14  8167 1 1  9 GLY CA   C  -10.237  12.619  -0.792 1.00 . A A .   9 GLY CA   1 1 
       14  8168 1 1  9 GLY H    H  -10.776  14.667  -0.790 1.00 . A A .   9 GLY H    1 1 
       14  8169 1 1  9 GLY HA2  H   -9.230  12.824  -0.462 1.00 . A A .   9 GLY HA2  1 1 
       14  8170 1 1  9 GLY HA3  H  -10.620  11.771  -0.243 1.00 . A A .   9 GLY HA3  1 1 
       14  8171 1 1  9 GLY N    N  -11.068  13.775  -0.508 1.00 . A A .   9 GLY N    1 1 
       14  8172 1 1  9 GLY O    O  -11.139  11.654  -2.783 1.00 . A A .   9 GLY O    1 1 
       14  8173 1 1 10 GLU C    C   -7.529  12.272  -4.759 1.00 . A A .  10 GLU C    1 1 
       14  8174 1 1 10 GLU CA   C   -8.999  12.409  -4.375 1.00 . A A .  10 GLU CA   1 1 
       14  8175 1 1 10 GLU CB   C   -9.650  13.526  -5.194 1.00 . A A .  10 GLU CB   1 1 
       14  8176 1 1 10 GLU CD   C  -10.786  14.037  -7.392 1.00 . A A .  10 GLU CD   1 1 
       14  8177 1 1 10 GLU CG   C   -9.717  13.228  -6.683 1.00 . A A .  10 GLU CG   1 1 
       14  8178 1 1 10 GLU H    H   -8.434  13.168  -2.481 1.00 . A A .  10 GLU H    1 1 
       14  8179 1 1 10 GLU HA   H   -9.503  11.478  -4.589 1.00 . A A .  10 GLU HA   1 1 
       14  8180 1 1 10 GLU HB2  H  -10.655  13.682  -4.833 1.00 . A A .  10 GLU HB2  1 1 
       14  8181 1 1 10 GLU HB3  H   -9.082  14.434  -5.056 1.00 . A A .  10 GLU HB3  1 1 
       14  8182 1 1 10 GLU HG2  H   -8.760  13.458  -7.127 1.00 . A A .  10 GLU HG2  1 1 
       14  8183 1 1 10 GLU HG3  H   -9.933  12.178  -6.818 1.00 . A A .  10 GLU HG3  1 1 
       14  8184 1 1 10 GLU N    N   -9.142  12.678  -2.949 1.00 . A A .  10 GLU N    1 1 
       14  8185 1 1 10 GLU O    O   -6.755  13.224  -4.649 1.00 . A A .  10 GLU O    1 1 
       14  8186 1 1 10 GLU OE1  O  -11.976  13.875  -7.050 1.00 . A A .  10 GLU OE1  1 1 
       14  8187 1 1 10 GLU OE2  O  -10.433  14.832  -8.287 1.00 . A A .  10 GLU OE2  1 1 
       14  8188 1 1 11 LYS C    C   -5.722  10.190  -6.999 1.00 . A A .  11 LYS C    1 1 
       14  8189 1 1 11 LYS CA   C   -5.773  10.816  -5.609 1.00 . A A .  11 LYS CA   1 1 
       14  8190 1 1 11 LYS CB   C   -5.093   9.892  -4.596 1.00 . A A .  11 LYS CB   1 1 
       14  8191 1 1 11 LYS CD   C   -4.056   9.703  -2.316 1.00 . A A .  11 LYS CD   1 1 
       14  8192 1 1 11 LYS CE   C   -3.135  10.375  -1.310 1.00 . A A .  11 LYS CE   1 1 
       14  8193 1 1 11 LYS CG   C   -4.398  10.634  -3.467 1.00 . A A .  11 LYS CG   1 1 
       14  8194 1 1 11 LYS H    H   -7.813  10.361  -5.273 1.00 . A A .  11 LYS H    1 1 
       14  8195 1 1 11 LYS HA   H   -5.247  11.759  -5.633 1.00 . A A .  11 LYS HA   1 1 
       14  8196 1 1 11 LYS HB2  H   -5.838   9.240  -4.166 1.00 . A A .  11 LYS HB2  1 1 
       14  8197 1 1 11 LYS HB3  H   -4.357   9.293  -5.112 1.00 . A A .  11 LYS HB3  1 1 
       14  8198 1 1 11 LYS HD2  H   -4.968   9.413  -1.815 1.00 . A A .  11 LYS HD2  1 1 
       14  8199 1 1 11 LYS HD3  H   -3.565   8.824  -2.710 1.00 . A A .  11 LYS HD3  1 1 
       14  8200 1 1 11 LYS HE2  H   -2.276  10.767  -1.834 1.00 . A A .  11 LYS HE2  1 1 
       14  8201 1 1 11 LYS HE3  H   -3.669  11.187  -0.839 1.00 . A A .  11 LYS HE3  1 1 
       14  8202 1 1 11 LYS HG2  H   -3.487  11.073  -3.844 1.00 . A A .  11 LYS HG2  1 1 
       14  8203 1 1 11 LYS HG3  H   -5.053  11.414  -3.105 1.00 . A A .  11 LYS HG3  1 1 
       14  8204 1 1 11 LYS HZ1  H   -3.488   8.987   0.210 1.00 . A A .  11 LYS HZ1  1 1 
       14  8205 1 1 11 LYS HZ2  H   -2.103   9.929   0.450 1.00 . A A .  11 LYS HZ2  1 1 
       14  8206 1 1 11 LYS HZ3  H   -2.088   8.678  -0.688 1.00 . A A .  11 LYS HZ3  1 1 
       14  8207 1 1 11 LYS N    N   -7.150  11.081  -5.208 1.00 . A A .  11 LYS N    1 1 
       14  8208 1 1 11 LYS NZ   N   -2.671   9.425  -0.261 1.00 . A A .  11 LYS NZ   1 1 
       14  8209 1 1 11 LYS O    O   -6.706   9.643  -7.496 1.00 . A A .  11 LYS O    1 1 
       14  8210 1 1 12 PRO C    C   -4.350   8.188  -8.985 1.00 . A A .  12 PRO C    1 1 
       14  8211 1 1 12 PRO CA   C   -4.339   9.713  -8.982 1.00 . A A .  12 PRO CA   1 1 
       14  8212 1 1 12 PRO CB   C   -2.956  10.238  -9.374 1.00 . A A .  12 PRO CB   1 1 
       14  8213 1 1 12 PRO CD   C   -3.331  10.906  -7.109 1.00 . A A .  12 PRO CD   1 1 
       14  8214 1 1 12 PRO CG   C   -2.262  10.481  -8.078 1.00 . A A .  12 PRO CG   1 1 
       14  8215 1 1 12 PRO HA   H   -5.077  10.078  -9.682 1.00 . A A .  12 PRO HA   1 1 
       14  8216 1 1 12 PRO HB2  H   -2.440   9.495  -9.966 1.00 . A A .  12 PRO HB2  1 1 
       14  8217 1 1 12 PRO HB3  H   -3.061  11.150  -9.942 1.00 . A A .  12 PRO HB3  1 1 
       14  8218 1 1 12 PRO HD2  H   -3.108  10.542  -6.117 1.00 . A A .  12 PRO HD2  1 1 
       14  8219 1 1 12 PRO HD3  H   -3.431  11.981  -7.105 1.00 . A A .  12 PRO HD3  1 1 
       14  8220 1 1 12 PRO HG2  H   -1.789   9.572  -7.739 1.00 . A A .  12 PRO HG2  1 1 
       14  8221 1 1 12 PRO HG3  H   -1.530  11.266  -8.196 1.00 . A A .  12 PRO HG3  1 1 
       14  8222 1 1 12 PRO N    N   -4.547  10.269  -7.642 1.00 . A A .  12 PRO N    1 1 
       14  8223 1 1 12 PRO O    O   -4.940   7.563  -9.868 1.00 . A A .  12 PRO O    1 1 
       14  8224 1 1 13 TYR C    C   -4.413   5.651  -6.670 1.00 . A A .  13 TYR C    1 1 
       14  8225 1 1 13 TYR CA   C   -3.629   6.142  -7.883 1.00 . A A .  13 TYR CA   1 1 
       14  8226 1 1 13 TYR CB   C   -2.173   5.683  -7.784 1.00 . A A .  13 TYR CB   1 1 
       14  8227 1 1 13 TYR CD1  C   -1.571   5.573 -10.234 1.00 . A A .  13 TYR CD1  1 1 
       14  8228 1 1 13 TYR CD2  C   -0.285   6.999  -8.822 1.00 . A A .  13 TYR CD2  1 1 
       14  8229 1 1 13 TYR CE1  C   -0.800   5.944 -11.318 1.00 . A A .  13 TYR CE1  1 1 
       14  8230 1 1 13 TYR CE2  C    0.490   7.377  -9.901 1.00 . A A .  13 TYR CE2  1 1 
       14  8231 1 1 13 TYR CG   C   -1.327   6.093  -8.968 1.00 . A A .  13 TYR CG   1 1 
       14  8232 1 1 13 TYR CZ   C    0.229   6.846 -11.147 1.00 . A A .  13 TYR CZ   1 1 
       14  8233 1 1 13 TYR H    H   -3.246   8.145  -7.320 1.00 . A A .  13 TYR H    1 1 
       14  8234 1 1 13 TYR HA   H   -4.069   5.721  -8.776 1.00 . A A .  13 TYR HA   1 1 
       14  8235 1 1 13 TYR HB2  H   -1.729   6.109  -6.897 1.00 . A A .  13 TYR HB2  1 1 
       14  8236 1 1 13 TYR HB3  H   -2.147   4.606  -7.713 1.00 . A A .  13 TYR HB3  1 1 
       14  8237 1 1 13 TYR HD1  H   -2.378   4.867 -10.364 1.00 . A A .  13 TYR HD1  1 1 
       14  8238 1 1 13 TYR HD2  H   -0.083   7.414  -7.845 1.00 . A A .  13 TYR HD2  1 1 
       14  8239 1 1 13 TYR HE1  H   -1.005   5.529 -12.294 1.00 . A A .  13 TYR HE1  1 1 
       14  8240 1 1 13 TYR HE2  H    1.297   8.083  -9.768 1.00 . A A .  13 TYR HE2  1 1 
       14  8241 1 1 13 TYR HH   H    1.734   7.757 -11.923 1.00 . A A .  13 TYR HH   1 1 
       14  8242 1 1 13 TYR N    N   -3.696   7.594  -7.993 1.00 . A A .  13 TYR N    1 1 
       14  8243 1 1 13 TYR O    O   -4.402   6.280  -5.612 1.00 . A A .  13 TYR O    1 1 
       14  8244 1 1 13 TYR OH   O    0.999   7.219 -12.226 1.00 . A A .  13 TYR OH   1 1 
       14  8245 1 1 14 LYS C    C   -5.917   2.420  -5.857 1.00 . A A .  14 LYS C    1 1 
       14  8246 1 1 14 LYS CA   C   -5.882   3.941  -5.750 1.00 . A A .  14 LYS CA   1 1 
       14  8247 1 1 14 LYS CB   C   -7.307   4.498  -5.775 1.00 . A A .  14 LYS CB   1 1 
       14  8248 1 1 14 LYS CD   C   -9.241   4.985  -4.249 1.00 . A A .  14 LYS CD   1 1 
       14  8249 1 1 14 LYS CE   C  -10.476   4.890  -5.132 1.00 . A A .  14 LYS CE   1 1 
       14  8250 1 1 14 LYS CG   C   -8.187   3.969  -4.656 1.00 . A A .  14 LYS CG   1 1 
       14  8251 1 1 14 LYS H    H   -5.063   4.064  -7.698 1.00 . A A .  14 LYS H    1 1 
       14  8252 1 1 14 LYS HA   H   -5.414   4.213  -4.816 1.00 . A A .  14 LYS HA   1 1 
       14  8253 1 1 14 LYS HB2  H   -7.261   5.574  -5.692 1.00 . A A .  14 LYS HB2  1 1 
       14  8254 1 1 14 LYS HB3  H   -7.765   4.238  -6.719 1.00 . A A .  14 LYS HB3  1 1 
       14  8255 1 1 14 LYS HD2  H   -9.530   4.800  -3.225 1.00 . A A .  14 LYS HD2  1 1 
       14  8256 1 1 14 LYS HD3  H   -8.824   5.978  -4.334 1.00 . A A .  14 LYS HD3  1 1 
       14  8257 1 1 14 LYS HE2  H  -10.672   3.850  -5.344 1.00 . A A .  14 LYS HE2  1 1 
       14  8258 1 1 14 LYS HE3  H  -11.316   5.313  -4.600 1.00 . A A .  14 LYS HE3  1 1 
       14  8259 1 1 14 LYS HG2  H   -8.680   3.069  -4.992 1.00 . A A .  14 LYS HG2  1 1 
       14  8260 1 1 14 LYS HG3  H   -7.567   3.744  -3.800 1.00 . A A .  14 LYS HG3  1 1 
       14  8261 1 1 14 LYS HZ1  H  -10.146   4.948  -7.194 1.00 . A A .  14 LYS HZ1  1 1 
       14  8262 1 1 14 LYS HZ2  H   -9.474   6.255  -6.354 1.00 . A A .  14 LYS HZ2  1 1 
       14  8263 1 1 14 LYS HZ3  H  -11.143   6.191  -6.623 1.00 . A A .  14 LYS HZ3  1 1 
       14  8264 1 1 14 LYS N    N   -5.093   4.521  -6.831 1.00 . A A .  14 LYS N    1 1 
       14  8265 1 1 14 LYS NZ   N  -10.298   5.622  -6.416 1.00 . A A .  14 LYS NZ   1 1 
       14  8266 1 1 14 LYS O    O   -6.137   1.869  -6.936 1.00 . A A .  14 LYS O    1 1 
       14  8267 1 1 15 CYS C    C   -7.137  -0.245  -4.627 1.00 . A A .  15 CYS C    1 1 
       14  8268 1 1 15 CYS CA   C   -5.709   0.289  -4.699 1.00 . A A .  15 CYS CA   1 1 
       14  8269 1 1 15 CYS CB   C   -4.901  -0.219  -3.504 1.00 . A A .  15 CYS CB   1 1 
       14  8270 1 1 15 CYS H    H   -5.531   2.242  -3.903 1.00 . A A .  15 CYS H    1 1 
       14  8271 1 1 15 CYS HA   H   -5.251  -0.066  -5.610 1.00 . A A .  15 CYS HA   1 1 
       14  8272 1 1 15 CYS HB2  H   -4.004   0.375  -3.407 1.00 . A A .  15 CYS HB2  1 1 
       14  8273 1 1 15 CYS HB3  H   -5.494  -0.115  -2.608 1.00 . A A .  15 CYS HB3  1 1 
       14  8274 1 1 15 CYS N    N   -5.701   1.747  -4.733 1.00 . A A .  15 CYS N    1 1 
       14  8275 1 1 15 CYS O    O   -7.856   0.006  -3.661 1.00 . A A .  15 CYS O    1 1 
       14  8276 1 1 15 CYS SG   S   -4.396  -1.965  -3.636 1.00 . A A .  15 CYS SG   1 1 
       14  8277 1 1 16 ASN C    C   -8.971  -2.813  -4.853 1.00 . A A .  16 ASN C    1 1 
       14  8278 1 1 16 ASN CA   C   -8.881  -1.554  -5.709 1.00 . A A .  16 ASN CA   1 1 
       14  8279 1 1 16 ASN CB   C   -9.263  -1.878  -7.155 1.00 . A A .  16 ASN CB   1 1 
       14  8280 1 1 16 ASN CG   C   -8.838  -3.274  -7.566 1.00 . A A .  16 ASN CG   1 1 
       14  8281 1 1 16 ASN H    H   -6.920  -1.150  -6.397 1.00 . A A .  16 ASN H    1 1 
       14  8282 1 1 16 ASN HA   H   -9.569  -0.818  -5.320 1.00 . A A .  16 ASN HA   1 1 
       14  8283 1 1 16 ASN HB2  H  -10.335  -1.803  -7.263 1.00 . A A .  16 ASN HB2  1 1 
       14  8284 1 1 16 ASN HB3  H   -8.788  -1.168  -7.814 1.00 . A A .  16 ASN HB3  1 1 
       14  8285 1 1 16 ASN HD21 H   -6.964  -2.657  -7.815 1.00 . A A .  16 ASN HD21 1 1 
       14  8286 1 1 16 ASN HD22 H   -7.254  -4.329  -8.141 1.00 . A A .  16 ASN HD22 1 1 
       14  8287 1 1 16 ASN N    N   -7.539  -0.984  -5.656 1.00 . A A .  16 ASN N    1 1 
       14  8288 1 1 16 ASN ND2  N   -7.556  -3.437  -7.871 1.00 . A A .  16 ASN ND2  1 1 
       14  8289 1 1 16 ASN O    O  -10.024  -3.445  -4.770 1.00 . A A .  16 ASN O    1 1 
       14  8290 1 1 16 ASN OD1  O   -9.653  -4.196  -7.608 1.00 . A A .  16 ASN OD1  1 1 
       14  8291 1 1 17 GLU C    C   -8.236  -4.018  -1.941 1.00 . A A .  17 GLU C    1 1 
       14  8292 1 1 17 GLU CA   C   -7.814  -4.356  -3.368 1.00 . A A .  17 GLU CA   1 1 
       14  8293 1 1 17 GLU CB   C   -6.406  -4.956  -3.366 1.00 . A A .  17 GLU CB   1 1 
       14  8294 1 1 17 GLU CD   C   -6.213  -6.629  -5.249 1.00 . A A .  17 GLU CD   1 1 
       14  8295 1 1 17 GLU CG   C   -5.863  -5.238  -4.757 1.00 . A A .  17 GLU CG   1 1 
       14  8296 1 1 17 GLU H    H   -7.051  -2.628  -4.324 1.00 . A A .  17 GLU H    1 1 
       14  8297 1 1 17 GLU HA   H   -8.503  -5.081  -3.773 1.00 . A A .  17 GLU HA   1 1 
       14  8298 1 1 17 GLU HB2  H   -5.735  -4.268  -2.872 1.00 . A A .  17 GLU HB2  1 1 
       14  8299 1 1 17 GLU HB3  H   -6.425  -5.884  -2.815 1.00 . A A .  17 GLU HB3  1 1 
       14  8300 1 1 17 GLU HG2  H   -6.276  -4.515  -5.445 1.00 . A A .  17 GLU HG2  1 1 
       14  8301 1 1 17 GLU HG3  H   -4.788  -5.139  -4.737 1.00 . A A .  17 GLU HG3  1 1 
       14  8302 1 1 17 GLU N    N   -7.859  -3.172  -4.218 1.00 . A A .  17 GLU N    1 1 
       14  8303 1 1 17 GLU O    O   -9.152  -4.631  -1.391 1.00 . A A .  17 GLU O    1 1 
       14  8304 1 1 17 GLU OE1  O   -7.361  -6.827  -5.697 1.00 . A A .  17 GLU OE1  1 1 
       14  8305 1 1 17 GLU OE2  O   -5.339  -7.518  -5.186 1.00 . A A .  17 GLU OE2  1 1 
       14  8306 1 1 18 CYS C    C   -8.559  -1.262   0.026 1.00 . A A .  18 CYS C    1 1 
       14  8307 1 1 18 CYS CA   C   -7.865  -2.621   0.016 1.00 . A A .  18 CYS CA   1 1 
       14  8308 1 1 18 CYS CB   C   -6.583  -2.556   0.850 1.00 . A A .  18 CYS CB   1 1 
       14  8309 1 1 18 CYS H    H   -6.841  -2.589  -1.836 1.00 . A A .  18 CYS H    1 1 
       14  8310 1 1 18 CYS HA   H   -8.528  -3.353   0.450 1.00 . A A .  18 CYS HA   1 1 
       14  8311 1 1 18 CYS HB2  H   -6.827  -2.216   1.845 1.00 . A A .  18 CYS HB2  1 1 
       14  8312 1 1 18 CYS HB3  H   -6.151  -3.544   0.908 1.00 . A A .  18 CYS HB3  1 1 
       14  8313 1 1 18 CYS N    N   -7.562  -3.040  -1.346 1.00 . A A .  18 CYS N    1 1 
       14  8314 1 1 18 CYS O    O   -9.574  -1.076   0.695 1.00 . A A .  18 CYS O    1 1 
       14  8315 1 1 18 CYS SG   S   -5.315  -1.434   0.177 1.00 . A A .  18 CYS SG   1 1 
       14  8316 1 1 19 GLY C    C   -7.594   2.097  -0.402 1.00 . A A .  19 GLY C    1 1 
       14  8317 1 1 19 GLY CA   C   -8.582   1.015  -0.788 1.00 . A A .  19 GLY CA   1 1 
       14  8318 1 1 19 GLY H    H   -7.194  -0.520  -1.237 1.00 . A A .  19 GLY H    1 1 
       14  8319 1 1 19 GLY HA2  H   -8.925   1.198  -1.796 1.00 . A A .  19 GLY HA2  1 1 
       14  8320 1 1 19 GLY HA3  H   -9.428   1.060  -0.118 1.00 . A A .  19 GLY HA3  1 1 
       14  8321 1 1 19 GLY N    N   -8.003  -0.314  -0.724 1.00 . A A .  19 GLY N    1 1 
       14  8322 1 1 19 GLY O    O   -7.986   3.185   0.022 1.00 . A A .  19 GLY O    1 1 
       14  8323 1 1 20 LYS C    C   -4.867   3.586  -1.425 1.00 . A A .  20 LYS C    1 1 
       14  8324 1 1 20 LYS CA   C   -5.258   2.754  -0.208 1.00 . A A .  20 LYS CA   1 1 
       14  8325 1 1 20 LYS CB   C   -4.029   2.022   0.337 1.00 . A A .  20 LYS CB   1 1 
       14  8326 1 1 20 LYS CD   C   -2.505   3.991   0.666 1.00 . A A .  20 LYS CD   1 1 
       14  8327 1 1 20 LYS CE   C   -2.068   5.040   1.678 1.00 . A A .  20 LYS CE   1 1 
       14  8328 1 1 20 LYS CG   C   -3.230   2.838   1.339 1.00 . A A .  20 LYS CG   1 1 
       14  8329 1 1 20 LYS H    H   -6.056   0.915  -0.888 1.00 . A A .  20 LYS H    1 1 
       14  8330 1 1 20 LYS HA   H   -5.642   3.413   0.555 1.00 . A A .  20 LYS HA   1 1 
       14  8331 1 1 20 LYS HB2  H   -4.353   1.113   0.822 1.00 . A A .  20 LYS HB2  1 1 
       14  8332 1 1 20 LYS HB3  H   -3.380   1.769  -0.488 1.00 . A A .  20 LYS HB3  1 1 
       14  8333 1 1 20 LYS HD2  H   -1.631   3.610   0.160 1.00 . A A .  20 LYS HD2  1 1 
       14  8334 1 1 20 LYS HD3  H   -3.167   4.451  -0.053 1.00 . A A .  20 LYS HD3  1 1 
       14  8335 1 1 20 LYS HE2  H   -2.944   5.546   2.054 1.00 . A A .  20 LYS HE2  1 1 
       14  8336 1 1 20 LYS HE3  H   -1.560   4.546   2.492 1.00 . A A .  20 LYS HE3  1 1 
       14  8337 1 1 20 LYS HG2  H   -3.903   3.235   2.084 1.00 . A A .  20 LYS HG2  1 1 
       14  8338 1 1 20 LYS HG3  H   -2.503   2.195   1.814 1.00 . A A .  20 LYS HG3  1 1 
       14  8339 1 1 20 LYS HZ1  H   -0.733   6.641   1.816 1.00 . A A .  20 LYS HZ1  1 1 
       14  8340 1 1 20 LYS HZ2  H   -1.674   6.652   0.409 1.00 . A A .  20 LYS HZ2  1 1 
       14  8341 1 1 20 LYS HZ3  H   -0.386   5.566   0.557 1.00 . A A .  20 LYS HZ3  1 1 
       14  8342 1 1 20 LYS N    N   -6.307   1.799  -0.545 1.00 . A A .  20 LYS N    1 1 
       14  8343 1 1 20 LYS NZ   N   -1.151   6.045   1.073 1.00 . A A .  20 LYS NZ   1 1 
       14  8344 1 1 20 LYS O    O   -4.438   3.048  -2.445 1.00 . A A .  20 LYS O    1 1 
       14  8345 1 1 21 ALA C    C   -3.358   6.521  -2.130 1.00 . A A .  21 ALA C    1 1 
       14  8346 1 1 21 ALA CA   C   -4.678   5.808  -2.400 1.00 . A A .  21 ALA CA   1 1 
       14  8347 1 1 21 ALA CB   C   -5.793   6.821  -2.611 1.00 . A A .  21 ALA CB   1 1 
       14  8348 1 1 21 ALA H    H   -5.365   5.272  -0.472 1.00 . A A .  21 ALA H    1 1 
       14  8349 1 1 21 ALA HA   H   -4.582   5.222  -3.303 1.00 . A A .  21 ALA HA   1 1 
       14  8350 1 1 21 ALA HB1  H   -6.356   6.933  -1.697 1.00 . A A .  21 ALA HB1  1 1 
       14  8351 1 1 21 ALA HB2  H   -5.365   7.774  -2.890 1.00 . A A .  21 ALA HB2  1 1 
       14  8352 1 1 21 ALA HB3  H   -6.448   6.477  -3.398 1.00 . A A .  21 ALA HB3  1 1 
       14  8353 1 1 21 ALA N    N   -5.018   4.902  -1.310 1.00 . A A .  21 ALA N    1 1 
       14  8354 1 1 21 ALA O    O   -3.106   6.982  -1.016 1.00 . A A .  21 ALA O    1 1 
       14  8355 1 1 22 PHE C    C   -1.154   8.513  -3.899 1.00 . A A .  22 PHE C    1 1 
       14  8356 1 1 22 PHE CA   C   -1.220   7.262  -3.027 1.00 . A A .  22 PHE CA   1 1 
       14  8357 1 1 22 PHE CB   C   -0.097   6.298  -3.414 1.00 . A A .  22 PHE CB   1 1 
       14  8358 1 1 22 PHE CD1  C   -1.199   4.069  -3.073 1.00 . A A .  22 PHE CD1  1 1 
       14  8359 1 1 22 PHE CD2  C    0.719   4.597  -1.759 1.00 . A A .  22 PHE CD2  1 1 
       14  8360 1 1 22 PHE CE1  C   -1.291   2.839  -2.449 1.00 . A A .  22 PHE CE1  1 1 
       14  8361 1 1 22 PHE CE2  C    0.633   3.369  -1.132 1.00 . A A .  22 PHE CE2  1 1 
       14  8362 1 1 22 PHE CG   C   -0.194   4.961  -2.735 1.00 . A A .  22 PHE CG   1 1 
       14  8363 1 1 22 PHE CZ   C   -0.373   2.488  -1.478 1.00 . A A .  22 PHE CZ   1 1 
       14  8364 1 1 22 PHE H    H   -2.774   6.220  -4.018 1.00 . A A .  22 PHE H    1 1 
       14  8365 1 1 22 PHE HA   H   -1.096   7.551  -1.995 1.00 . A A .  22 PHE HA   1 1 
       14  8366 1 1 22 PHE HB2  H   -0.127   6.130  -4.480 1.00 . A A .  22 PHE HB2  1 1 
       14  8367 1 1 22 PHE HB3  H    0.853   6.738  -3.149 1.00 . A A .  22 PHE HB3  1 1 
       14  8368 1 1 22 PHE HD1  H   -1.916   4.342  -3.833 1.00 . A A .  22 PHE HD1  1 1 
       14  8369 1 1 22 PHE HD2  H    1.507   5.286  -1.487 1.00 . A A .  22 PHE HD2  1 1 
       14  8370 1 1 22 PHE HE1  H   -2.078   2.153  -2.722 1.00 . A A .  22 PHE HE1  1 1 
       14  8371 1 1 22 PHE HE2  H    1.352   3.097  -0.373 1.00 . A A .  22 PHE HE2  1 1 
       14  8372 1 1 22 PHE HZ   H   -0.443   1.528  -0.989 1.00 . A A .  22 PHE HZ   1 1 
       14  8373 1 1 22 PHE N    N   -2.517   6.607  -3.155 1.00 . A A .  22 PHE N    1 1 
       14  8374 1 1 22 PHE O    O   -2.094   8.822  -4.632 1.00 . A A .  22 PHE O    1 1 
       14  8375 1 1 23 ARG C    C    1.115  10.207  -5.750 1.00 . A A .  23 ARG C    1 1 
       14  8376 1 1 23 ARG CA   C    0.151  10.446  -4.592 1.00 . A A .  23 ARG CA   1 1 
       14  8377 1 1 23 ARG CB   C    0.677  11.572  -3.700 1.00 . A A .  23 ARG CB   1 1 
       14  8378 1 1 23 ARG CD   C    1.491  13.949  -3.659 1.00 . A A .  23 ARG CD   1 1 
       14  8379 1 1 23 ARG CG   C    0.557  12.952  -4.325 1.00 . A A .  23 ARG CG   1 1 
       14  8380 1 1 23 ARG CZ   C    1.962  16.360  -3.755 1.00 . A A .  23 ARG CZ   1 1 
       14  8381 1 1 23 ARG H    H    0.676   8.931  -3.211 1.00 . A A .  23 ARG H    1 1 
       14  8382 1 1 23 ARG HA   H   -0.809  10.736  -4.993 1.00 . A A .  23 ARG HA   1 1 
       14  8383 1 1 23 ARG HB2  H    0.121  11.571  -2.774 1.00 . A A .  23 ARG HB2  1 1 
       14  8384 1 1 23 ARG HB3  H    1.719  11.387  -3.486 1.00 . A A .  23 ARG HB3  1 1 
       14  8385 1 1 23 ARG HD2  H    1.407  13.841  -2.588 1.00 . A A .  23 ARG HD2  1 1 
       14  8386 1 1 23 ARG HD3  H    2.504  13.732  -3.963 1.00 . A A .  23 ARG HD3  1 1 
       14  8387 1 1 23 ARG HE   H    0.325  15.488  -4.488 1.00 . A A .  23 ARG HE   1 1 
       14  8388 1 1 23 ARG HG2  H    0.809  12.885  -5.374 1.00 . A A .  23 ARG HG2  1 1 
       14  8389 1 1 23 ARG HG3  H   -0.461  13.298  -4.219 1.00 . A A .  23 ARG HG3  1 1 
       14  8390 1 1 23 ARG HH11 H    3.388  15.251  -2.852 1.00 . A A .  23 ARG HH11 1 1 
       14  8391 1 1 23 ARG HH12 H    3.708  16.952  -2.926 1.00 . A A .  23 ARG HH12 1 1 
       14  8392 1 1 23 ARG HH21 H    0.734  17.730  -4.592 1.00 . A A .  23 ARG HH21 1 1 
       14  8393 1 1 23 ARG HH22 H    2.197  18.361  -3.916 1.00 . A A .  23 ARG HH22 1 1 
       14  8394 1 1 23 ARG N    N   -0.038   9.229  -3.813 1.00 . A A .  23 ARG N    1 1 
       14  8395 1 1 23 ARG NE   N    1.171  15.327  -4.022 1.00 . A A .  23 ARG NE   1 1 
       14  8396 1 1 23 ARG NH1  N    3.114  16.172  -3.125 1.00 . A A .  23 ARG NH1  1 1 
       14  8397 1 1 23 ARG NH2  N    1.602  17.584  -4.118 1.00 . A A .  23 ARG NH2  1 1 
       14  8398 1 1 23 ARG O    O    1.165  10.987  -6.701 1.00 . A A .  23 ARG O    1 1 
       14  8399 1 1 24 ALA C    C    2.656   7.342  -7.170 1.00 . A A .  24 ALA C    1 1 
       14  8400 1 1 24 ALA CA   C    2.842   8.781  -6.703 1.00 . A A .  24 ALA CA   1 1 
       14  8401 1 1 24 ALA CB   C    4.262   8.995  -6.200 1.00 . A A .  24 ALA CB   1 1 
       14  8402 1 1 24 ALA H    H    1.794   8.541  -4.880 1.00 . A A .  24 ALA H    1 1 
       14  8403 1 1 24 ALA HA   H    2.679   9.445  -7.540 1.00 . A A .  24 ALA HA   1 1 
       14  8404 1 1 24 ALA HB1  H    4.262   9.014  -5.120 1.00 . A A .  24 ALA HB1  1 1 
       14  8405 1 1 24 ALA HB2  H    4.891   8.189  -6.547 1.00 . A A .  24 ALA HB2  1 1 
       14  8406 1 1 24 ALA HB3  H    4.639   9.934  -6.576 1.00 . A A .  24 ALA HB3  1 1 
       14  8407 1 1 24 ALA N    N    1.880   9.124  -5.662 1.00 . A A .  24 ALA N    1 1 
       14  8408 1 1 24 ALA O    O    2.233   6.479  -6.400 1.00 . A A .  24 ALA O    1 1 
       14  8409 1 1 25 ARG C    C    3.653   4.740  -8.211 1.00 . A A .  25 ARG C    1 1 
       14  8410 1 1 25 ARG CA   C    2.838   5.755  -9.006 1.00 . A A .  25 ARG CA   1 1 
       14  8411 1 1 25 ARG CB   C    3.289   5.754 -10.468 1.00 . A A .  25 ARG CB   1 1 
       14  8412 1 1 25 ARG CD   C    3.192   3.348 -11.187 1.00 . A A .  25 ARG CD   1 1 
       14  8413 1 1 25 ARG CG   C    2.568   4.727 -11.326 1.00 . A A .  25 ARG CG   1 1 
       14  8414 1 1 25 ARG CZ   C    2.669   1.301  -9.929 1.00 . A A .  25 ARG CZ   1 1 
       14  8415 1 1 25 ARG H    H    3.304   7.820  -9.000 1.00 . A A .  25 ARG H    1 1 
       14  8416 1 1 25 ARG HA   H    1.796   5.478  -8.960 1.00 . A A .  25 ARG HA   1 1 
       14  8417 1 1 25 ARG HB2  H    3.109   6.732 -10.889 1.00 . A A .  25 ARG HB2  1 1 
       14  8418 1 1 25 ARG HB3  H    4.347   5.544 -10.506 1.00 . A A .  25 ARG HB3  1 1 
       14  8419 1 1 25 ARG HD2  H    2.980   2.779 -12.080 1.00 . A A .  25 ARG HD2  1 1 
       14  8420 1 1 25 ARG HD3  H    4.260   3.460 -11.077 1.00 . A A .  25 ARG HD3  1 1 
       14  8421 1 1 25 ARG HE   H    2.302   3.155  -9.292 1.00 . A A .  25 ARG HE   1 1 
       14  8422 1 1 25 ARG HG2  H    1.534   4.675 -11.018 1.00 . A A .  25 ARG HG2  1 1 
       14  8423 1 1 25 ARG HG3  H    2.622   5.035 -12.360 1.00 . A A .  25 ARG HG3  1 1 
       14  8424 1 1 25 ARG HH11 H    3.534   0.995 -11.730 1.00 . A A .  25 ARG HH11 1 1 
       14  8425 1 1 25 ARG HH12 H    3.160  -0.439 -10.833 1.00 . A A .  25 ARG HH12 1 1 
       14  8426 1 1 25 ARG HH21 H    1.805   1.273  -8.102 1.00 . A A .  25 ARG HH21 1 1 
       14  8427 1 1 25 ARG HH22 H    2.176  -0.280  -8.770 1.00 . A A .  25 ARG HH22 1 1 
       14  8428 1 1 25 ARG N    N    2.973   7.090  -8.436 1.00 . A A .  25 ARG N    1 1 
       14  8429 1 1 25 ARG NE   N    2.670   2.625 -10.030 1.00 . A A .  25 ARG NE   1 1 
       14  8430 1 1 25 ARG NH1  N    3.161   0.558 -10.911 1.00 . A A .  25 ARG NH1  1 1 
       14  8431 1 1 25 ARG NH2  N    2.176   0.717  -8.845 1.00 . A A .  25 ARG NH2  1 1 
       14  8432 1 1 25 ARG O    O    3.114   3.755  -7.706 1.00 . A A .  25 ARG O    1 1 
       14  8433 1 1 26 SER C    C    5.316   3.826  -5.969 1.00 . A A .  26 SER C    1 1 
       14  8434 1 1 26 SER CA   C    5.846   4.091  -7.375 1.00 . A A .  26 SER CA   1 1 
       14  8435 1 1 26 SER CB   C    7.252   4.688  -7.298 1.00 . A A .  26 SER CB   1 1 
       14  8436 1 1 26 SER H    H    5.326   5.788  -8.530 1.00 . A A .  26 SER H    1 1 
       14  8437 1 1 26 SER HA   H    5.890   3.156  -7.913 1.00 . A A .  26 SER HA   1 1 
       14  8438 1 1 26 SER HB2  H    7.489   5.167  -8.236 1.00 . A A .  26 SER HB2  1 1 
       14  8439 1 1 26 SER HB3  H    7.287   5.419  -6.502 1.00 . A A .  26 SER HB3  1 1 
       14  8440 1 1 26 SER HG   H    8.256   3.511  -6.096 1.00 . A A .  26 SER HG   1 1 
       14  8441 1 1 26 SER N    N    4.955   4.986  -8.104 1.00 . A A .  26 SER N    1 1 
       14  8442 1 1 26 SER O    O    5.452   2.722  -5.440 1.00 . A A .  26 SER O    1 1 
       14  8443 1 1 26 SER OG   O    8.219   3.685  -7.039 1.00 . A A .  26 SER OG   1 1 
       14  8444 1 1 27 SER C    C    3.053   3.681  -3.979 1.00 . A A .  27 SER C    1 1 
       14  8445 1 1 27 SER CA   C    4.164   4.725  -4.022 1.00 . A A .  27 SER CA   1 1 
       14  8446 1 1 27 SER CB   C    3.628   6.076  -3.544 1.00 . A A .  27 SER CB   1 1 
       14  8447 1 1 27 SER H    H    4.634   5.701  -5.842 1.00 . A A .  27 SER H    1 1 
       14  8448 1 1 27 SER HA   H    4.963   4.411  -3.367 1.00 . A A .  27 SER HA   1 1 
       14  8449 1 1 27 SER HB2  H    3.036   6.524  -4.327 1.00 . A A .  27 SER HB2  1 1 
       14  8450 1 1 27 SER HB3  H    3.013   5.926  -2.668 1.00 . A A .  27 SER HB3  1 1 
       14  8451 1 1 27 SER HG   H    4.903   7.500  -3.973 1.00 . A A .  27 SER HG   1 1 
       14  8452 1 1 27 SER N    N    4.711   4.846  -5.368 1.00 . A A .  27 SER N    1 1 
       14  8453 1 1 27 SER O    O    2.821   3.045  -2.950 1.00 . A A .  27 SER O    1 1 
       14  8454 1 1 27 SER OG   O    4.688   6.956  -3.212 1.00 . A A .  27 SER OG   1 1 
       14  8455 1 1 28 LEU C    C    1.821   1.132  -5.423 1.00 . A A .  28 LEU C    1 1 
       14  8456 1 1 28 LEU CA   C    1.280   2.540  -5.197 1.00 . A A .  28 LEU CA   1 1 
       14  8457 1 1 28 LEU CB   C    0.328   2.921  -6.332 1.00 . A A .  28 LEU CB   1 1 
       14  8458 1 1 28 LEU CD1  C   -1.946   1.986  -5.844 1.00 . A A .  28 LEU CD1  1 1 
       14  8459 1 1 28 LEU CD2  C   -1.080   2.000  -8.191 1.00 . A A .  28 LEU CD2  1 1 
       14  8460 1 1 28 LEU CG   C   -0.709   1.867  -6.721 1.00 . A A .  28 LEU CG   1 1 
       14  8461 1 1 28 LEU H    H    2.598   4.043  -5.892 1.00 . A A .  28 LEU H    1 1 
       14  8462 1 1 28 LEU HA   H    0.739   2.560  -4.263 1.00 . A A .  28 LEU HA   1 1 
       14  8463 1 1 28 LEU HB2  H   -0.203   3.812  -6.034 1.00 . A A .  28 LEU HB2  1 1 
       14  8464 1 1 28 LEU HB3  H    0.926   3.136  -7.206 1.00 . A A .  28 LEU HB3  1 1 
       14  8465 1 1 28 LEU HD11 H   -2.240   3.022  -5.775 1.00 . A A .  28 LEU HD11 1 1 
       14  8466 1 1 28 LEU HD12 H   -1.725   1.608  -4.857 1.00 . A A .  28 LEU HD12 1 1 
       14  8467 1 1 28 LEU HD13 H   -2.751   1.410  -6.277 1.00 . A A .  28 LEU HD13 1 1 
       14  8468 1 1 28 LEU HD21 H   -0.276   2.488  -8.722 1.00 . A A .  28 LEU HD21 1 1 
       14  8469 1 1 28 LEU HD22 H   -1.981   2.588  -8.282 1.00 . A A .  28 LEU HD22 1 1 
       14  8470 1 1 28 LEU HD23 H   -1.247   1.018  -8.610 1.00 . A A .  28 LEU HD23 1 1 
       14  8471 1 1 28 LEU HG   H   -0.287   0.883  -6.569 1.00 . A A .  28 LEU HG   1 1 
       14  8472 1 1 28 LEU N    N    2.368   3.508  -5.104 1.00 . A A .  28 LEU N    1 1 
       14  8473 1 1 28 LEU O    O    1.375   0.176  -4.790 1.00 . A A .  28 LEU O    1 1 
       14  8474 1 1 29 ALA C    C    3.971  -0.923  -5.380 1.00 . A A .  29 ALA C    1 1 
       14  8475 1 1 29 ALA CA   C    3.393  -0.276  -6.634 1.00 . A A .  29 ALA CA   1 1 
       14  8476 1 1 29 ALA CB   C    4.473  -0.114  -7.693 1.00 . A A .  29 ALA CB   1 1 
       14  8477 1 1 29 ALA H    H    3.101   1.813  -6.800 1.00 . A A .  29 ALA H    1 1 
       14  8478 1 1 29 ALA HA   H    2.623  -0.919  -7.036 1.00 . A A .  29 ALA HA   1 1 
       14  8479 1 1 29 ALA HB1  H    4.703   0.934  -7.815 1.00 . A A .  29 ALA HB1  1 1 
       14  8480 1 1 29 ALA HB2  H    5.362  -0.645  -7.383 1.00 . A A .  29 ALA HB2  1 1 
       14  8481 1 1 29 ALA HB3  H    4.122  -0.518  -8.631 1.00 . A A .  29 ALA HB3  1 1 
       14  8482 1 1 29 ALA N    N    2.787   1.014  -6.328 1.00 . A A .  29 ALA N    1 1 
       14  8483 1 1 29 ALA O    O    3.563  -2.018  -4.990 1.00 . A A .  29 ALA O    1 1 
       14  8484 1 1 30 ILE C    C    4.540  -1.437  -2.638 1.00 . A A .  30 ILE C    1 1 
       14  8485 1 1 30 ILE CA   C    5.556  -0.748  -3.543 1.00 . A A .  30 ILE CA   1 1 
       14  8486 1 1 30 ILE CB   C    6.248   0.379  -2.753 1.00 . A A .  30 ILE CB   1 1 
       14  8487 1 1 30 ILE CD1  C    7.722   2.420  -3.128 1.00 . A A .  30 ILE CD1  1 1 
       14  8488 1 1 30 ILE CG1  C    7.330   1.040  -3.609 1.00 . A A .  30 ILE CG1  1 1 
       14  8489 1 1 30 ILE CG2  C    6.845  -0.166  -1.464 1.00 . A A .  30 ILE CG2  1 1 
       14  8490 1 1 30 ILE H    H    5.205   0.627  -5.112 1.00 . A A .  30 ILE H    1 1 
       14  8491 1 1 30 ILE HA   H    6.307  -1.468  -3.837 1.00 . A A .  30 ILE HA   1 1 
       14  8492 1 1 30 ILE HB   H    5.504   1.116  -2.494 1.00 . A A .  30 ILE HB   1 1 
       14  8493 1 1 30 ILE HD11 H    8.780   2.571  -3.291 1.00 . A A .  30 ILE HD11 1 1 
       14  8494 1 1 30 ILE HD12 H    7.165   3.165  -3.677 1.00 . A A .  30 ILE HD12 1 1 
       14  8495 1 1 30 ILE HD13 H    7.504   2.509  -2.074 1.00 . A A .  30 ILE HD13 1 1 
       14  8496 1 1 30 ILE HG12 H    8.215   0.423  -3.601 1.00 . A A .  30 ILE HG12 1 1 
       14  8497 1 1 30 ILE HG13 H    6.970   1.132  -4.624 1.00 . A A .  30 ILE HG13 1 1 
       14  8498 1 1 30 ILE HG21 H    6.637   0.517  -0.654 1.00 . A A .  30 ILE HG21 1 1 
       14  8499 1 1 30 ILE HG22 H    6.406  -1.128  -1.244 1.00 . A A .  30 ILE HG22 1 1 
       14  8500 1 1 30 ILE HG23 H    7.913  -0.275  -1.579 1.00 . A A .  30 ILE HG23 1 1 
       14  8501 1 1 30 ILE N    N    4.923  -0.240  -4.753 1.00 . A A .  30 ILE N    1 1 
       14  8502 1 1 30 ILE O    O    4.836  -2.461  -2.021 1.00 . A A .  30 ILE O    1 1 
       14  8503 1 1 31 HIS C    C    1.675  -2.669  -2.394 1.00 . A A .  31 HIS C    1 1 
       14  8504 1 1 31 HIS CA   C    2.278  -1.431  -1.738 1.00 . A A .  31 HIS CA   1 1 
       14  8505 1 1 31 HIS CB   C    1.188  -0.387  -1.494 1.00 . A A .  31 HIS CB   1 1 
       14  8506 1 1 31 HIS CD2  C   -1.271  -1.202  -1.619 1.00 . A A .  31 HIS CD2  1 1 
       14  8507 1 1 31 HIS CE1  C   -1.501  -1.851   0.462 1.00 . A A .  31 HIS CE1  1 1 
       14  8508 1 1 31 HIS CG   C   -0.096  -0.969  -0.989 1.00 . A A .  31 HIS CG   1 1 
       14  8509 1 1 31 HIS H    H    3.165  -0.055  -3.081 1.00 . A A .  31 HIS H    1 1 
       14  8510 1 1 31 HIS HA   H    2.711  -1.715  -0.791 1.00 . A A .  31 HIS HA   1 1 
       14  8511 1 1 31 HIS HB2  H    1.539   0.326  -0.762 1.00 . A A .  31 HIS HB2  1 1 
       14  8512 1 1 31 HIS HB3  H    0.978   0.129  -2.420 1.00 . A A .  31 HIS HB3  1 1 
       14  8513 1 1 31 HIS HD1  H    0.401  -1.348   1.023 1.00 . A A .  31 HIS HD1  1 1 
       14  8514 1 1 31 HIS HD2  H   -1.495  -0.995  -2.656 1.00 . A A .  31 HIS HD2  1 1 
       14  8515 1 1 31 HIS HE1  H   -1.921  -2.246   1.375 1.00 . A A .  31 HIS HE1  1 1 
       14  8516 1 1 31 HIS N    N    3.340  -0.870  -2.565 1.00 . A A .  31 HIS N    1 1 
       14  8517 1 1 31 HIS ND1  N   -0.273  -1.386   0.314 1.00 . A A .  31 HIS ND1  1 1 
       14  8518 1 1 31 HIS NE2  N   -2.127  -1.750  -0.696 1.00 . A A .  31 HIS NE2  1 1 
       14  8519 1 1 31 HIS O    O    1.441  -3.681  -1.733 1.00 . A A .  31 HIS O    1 1 
       14  8520 1 1 32 GLN C    C    1.685  -4.958  -4.265 1.00 . A A .  32 GLN C    1 1 
       14  8521 1 1 32 GLN CA   C    0.849  -3.694  -4.440 1.00 . A A .  32 GLN CA   1 1 
       14  8522 1 1 32 GLN CB   C    0.741  -3.342  -5.925 1.00 . A A .  32 GLN CB   1 1 
       14  8523 1 1 32 GLN CD   C   -0.497  -2.044  -7.704 1.00 . A A .  32 GLN CD   1 1 
       14  8524 1 1 32 GLN CG   C   -0.274  -2.249  -6.219 1.00 . A A .  32 GLN CG   1 1 
       14  8525 1 1 32 GLN H    H    1.634  -1.748  -4.168 1.00 . A A .  32 GLN H    1 1 
       14  8526 1 1 32 GLN HA   H   -0.141  -3.876  -4.050 1.00 . A A .  32 GLN HA   1 1 
       14  8527 1 1 32 GLN HB2  H    1.707  -3.011  -6.275 1.00 . A A .  32 GLN HB2  1 1 
       14  8528 1 1 32 GLN HB3  H    0.453  -4.227  -6.473 1.00 . A A .  32 GLN HB3  1 1 
       14  8529 1 1 32 GLN HE21 H   -1.899  -0.685  -7.331 1.00 . A A .  32 GLN HE21 1 1 
       14  8530 1 1 32 GLN HE22 H   -1.585  -1.000  -9.000 1.00 . A A .  32 GLN HE22 1 1 
       14  8531 1 1 32 GLN HG2  H   -1.216  -2.518  -5.763 1.00 . A A .  32 GLN HG2  1 1 
       14  8532 1 1 32 GLN HG3  H    0.080  -1.323  -5.791 1.00 . A A .  32 GLN HG3  1 1 
       14  8533 1 1 32 GLN N    N    1.426  -2.581  -3.697 1.00 . A A .  32 GLN N    1 1 
       14  8534 1 1 32 GLN NE2  N   -1.421  -1.154  -8.047 1.00 . A A .  32 GLN NE2  1 1 
       14  8535 1 1 32 GLN O    O    1.228  -6.062  -4.561 1.00 . A A .  32 GLN O    1 1 
       14  8536 1 1 32 GLN OE1  O    0.153  -2.678  -8.535 1.00 . A A .  32 GLN OE1  1 1 
       14  8537 1 1 33 ALA C    C    3.447  -6.669  -2.291 1.00 . A A .  33 ALA C    1 1 
       14  8538 1 1 33 ALA CA   C    3.810  -5.915  -3.565 1.00 . A A .  33 ALA CA   1 1 
       14  8539 1 1 33 ALA CB   C    5.252  -5.435  -3.505 1.00 . A A .  33 ALA CB   1 1 
       14  8540 1 1 33 ALA H    H    3.218  -3.883  -3.565 1.00 . A A .  33 ALA H    1 1 
       14  8541 1 1 33 ALA HA   H    3.714  -6.585  -4.408 1.00 . A A .  33 ALA HA   1 1 
       14  8542 1 1 33 ALA HB1  H    5.636  -5.322  -4.508 1.00 . A A .  33 ALA HB1  1 1 
       14  8543 1 1 33 ALA HB2  H    5.293  -4.484  -2.994 1.00 . A A .  33 ALA HB2  1 1 
       14  8544 1 1 33 ALA HB3  H    5.850  -6.158  -2.970 1.00 . A A .  33 ALA HB3  1 1 
       14  8545 1 1 33 ALA N    N    2.911  -4.788  -3.782 1.00 . A A .  33 ALA N    1 1 
       14  8546 1 1 33 ALA O    O    4.180  -7.556  -1.852 1.00 . A A .  33 ALA O    1 1 
       14  8547 1 1 34 THR C    C    0.613  -7.802  -0.728 1.00 . A A .  34 THR C    1 1 
       14  8548 1 1 34 THR CA   C    1.853  -6.953  -0.473 1.00 . A A .  34 THR CA   1 1 
       14  8549 1 1 34 THR CB   C    1.535  -5.915   0.619 1.00 . A A .  34 THR CB   1 1 
       14  8550 1 1 34 THR CG2  C    2.675  -4.918   0.767 1.00 . A A .  34 THR CG2  1 1 
       14  8551 1 1 34 THR H    H    1.771  -5.597  -2.097 1.00 . A A .  34 THR H    1 1 
       14  8552 1 1 34 THR HA   H    2.647  -7.591  -0.114 1.00 . A A .  34 THR HA   1 1 
       14  8553 1 1 34 THR HB   H    1.405  -6.432   1.559 1.00 . A A .  34 THR HB   1 1 
       14  8554 1 1 34 THR HG1  H    0.299  -5.042  -0.646 1.00 . A A .  34 THR HG1  1 1 
       14  8555 1 1 34 THR HG21 H    2.866  -4.447  -0.185 1.00 . A A .  34 THR HG21 1 1 
       14  8556 1 1 34 THR HG22 H    3.564  -5.434   1.098 1.00 . A A .  34 THR HG22 1 1 
       14  8557 1 1 34 THR HG23 H    2.403  -4.166   1.493 1.00 . A A .  34 THR HG23 1 1 
       14  8558 1 1 34 THR N    N    2.312  -6.311  -1.699 1.00 . A A .  34 THR N    1 1 
       14  8559 1 1 34 THR O    O    0.400  -8.821  -0.071 1.00 . A A .  34 THR O    1 1 
       14  8560 1 1 34 THR OG1  O    0.325  -5.219   0.297 1.00 . A A .  34 THR OG1  1 1 
       14  8561 1 1 35 HIS C    C   -1.098  -9.380  -2.794 1.00 . A A .  35 HIS C    1 1 
       14  8562 1 1 35 HIS CA   C   -1.422  -8.099  -2.030 1.00 . A A .  35 HIS CA   1 1 
       14  8563 1 1 35 HIS CB   C   -2.348  -7.214  -2.866 1.00 . A A .  35 HIS CB   1 1 
       14  8564 1 1 35 HIS CD2  C   -2.799  -4.837  -1.929 1.00 . A A .  35 HIS CD2  1 1 
       14  8565 1 1 35 HIS CE1  C   -4.556  -5.304  -0.704 1.00 . A A .  35 HIS CE1  1 1 
       14  8566 1 1 35 HIS CG   C   -3.051  -6.160  -2.067 1.00 . A A .  35 HIS CG   1 1 
       14  8567 1 1 35 HIS H    H    0.021  -6.557  -2.176 1.00 . A A .  35 HIS H    1 1 
       14  8568 1 1 35 HIS HA   H   -1.923  -8.360  -1.110 1.00 . A A .  35 HIS HA   1 1 
       14  8569 1 1 35 HIS HB2  H   -1.767  -6.717  -3.629 1.00 . A A .  35 HIS HB2  1 1 
       14  8570 1 1 35 HIS HB3  H   -3.099  -7.832  -3.336 1.00 . A A .  35 HIS HB3  1 1 
       14  8571 1 1 35 HIS HD1  H   -4.587  -7.294  -1.176 1.00 . A A .  35 HIS HD1  1 1 
       14  8572 1 1 35 HIS HD2  H   -1.999  -4.284  -2.402 1.00 . A A .  35 HIS HD2  1 1 
       14  8573 1 1 35 HIS HE1  H   -5.399  -5.205  -0.036 1.00 . A A .  35 HIS HE1  1 1 
       14  8574 1 1 35 HIS N    N   -0.203  -7.376  -1.688 1.00 . A A .  35 HIS N    1 1 
       14  8575 1 1 35 HIS ND1  N   -4.157  -6.421  -1.286 1.00 . A A .  35 HIS ND1  1 1 
       14  8576 1 1 35 HIS NE2  N   -3.748  -4.328  -1.078 1.00 . A A .  35 HIS NE2  1 1 
       14  8577 1 1 35 HIS O    O   -1.021  -9.379  -4.022 1.00 . A A .  35 HIS O    1 1 
       14  8578 1 1 36 SER C    C   -1.748 -12.737  -2.503 1.00 . A A .  36 SER C    1 1 
       14  8579 1 1 36 SER CA   C   -0.590 -11.757  -2.664 1.00 . A A .  36 SER CA   1 1 
       14  8580 1 1 36 SER CB   C    0.678 -12.339  -2.037 1.00 . A A .  36 SER CB   1 1 
       14  8581 1 1 36 SER H    H   -0.985 -10.407  -1.082 1.00 . A A .  36 SER H    1 1 
       14  8582 1 1 36 SER HA   H   -0.417 -11.592  -3.718 1.00 . A A .  36 SER HA   1 1 
       14  8583 1 1 36 SER HB2  H    0.688 -12.118  -0.980 1.00 . A A .  36 SER HB2  1 1 
       14  8584 1 1 36 SER HB3  H    0.688 -13.410  -2.180 1.00 . A A .  36 SER HB3  1 1 
       14  8585 1 1 36 SER HG   H    2.150 -12.369  -3.329 1.00 . A A .  36 SER HG   1 1 
       14  8586 1 1 36 SER N    N   -0.910 -10.470  -2.057 1.00 . A A .  36 SER N    1 1 
       14  8587 1 1 36 SER O    O   -1.774 -13.535  -1.568 1.00 . A A .  36 SER O    1 1 
       14  8588 1 1 36 SER OG   O    1.841 -11.788  -2.630 1.00 . A A .  36 SER OG   1 1 
       14  8589 1 1 37 GLY C    C   -3.559 -14.923  -3.950 1.00 . A A .  37 GLY C    1 1 
       14  8590 1 1 37 GLY CA   C   -3.853 -13.555  -3.367 1.00 . A A .  37 GLY CA   1 1 
       14  8591 1 1 37 GLY H    H   -2.631 -12.012  -4.147 1.00 . A A .  37 GLY H    1 1 
       14  8592 1 1 37 GLY HA2  H   -4.153 -13.671  -2.336 1.00 . A A .  37 GLY HA2  1 1 
       14  8593 1 1 37 GLY HA3  H   -4.666 -13.107  -3.920 1.00 . A A .  37 GLY HA3  1 1 
       14  8594 1 1 37 GLY N    N   -2.705 -12.669  -3.424 1.00 . A A .  37 GLY N    1 1 
       14  8595 1 1 37 GLY O    O   -3.989 -15.236  -5.059 1.00 . A A .  37 GLY O    1 1 
       14  8596 1 1 38 GLU C    C   -3.460 -18.111  -3.117 1.00 . A A .  38 GLU C    1 1 
       14  8597 1 1 38 GLU CA   C   -2.472 -17.079  -3.653 1.00 . A A .  38 GLU CA   1 1 
       14  8598 1 1 38 GLU CB   C   -1.053 -17.436  -3.205 1.00 . A A .  38 GLU CB   1 1 
       14  8599 1 1 38 GLU CD   C    0.357 -18.223  -1.262 1.00 . A A .  38 GLU CD   1 1 
       14  8600 1 1 38 GLU CG   C   -0.878 -17.457  -1.696 1.00 . A A .  38 GLU CG   1 1 
       14  8601 1 1 38 GLU H    H   -2.511 -15.431  -2.325 1.00 . A A .  38 GLU H    1 1 
       14  8602 1 1 38 GLU HA   H   -2.511 -17.087  -4.731 1.00 . A A .  38 GLU HA   1 1 
       14  8603 1 1 38 GLU HB2  H   -0.801 -18.413  -3.590 1.00 . A A .  38 GLU HB2  1 1 
       14  8604 1 1 38 GLU HB3  H   -0.366 -16.710  -3.615 1.00 . A A .  38 GLU HB3  1 1 
       14  8605 1 1 38 GLU HG2  H   -0.794 -16.441  -1.341 1.00 . A A .  38 GLU HG2  1 1 
       14  8606 1 1 38 GLU HG3  H   -1.746 -17.921  -1.252 1.00 . A A .  38 GLU HG3  1 1 
       14  8607 1 1 38 GLU N    N   -2.824 -15.738  -3.201 1.00 . A A .  38 GLU N    1 1 
       14  8608 1 1 38 GLU O    O   -3.527 -19.238  -3.608 1.00 . A A .  38 GLU O    1 1 
       14  8609 1 1 38 GLU OE1  O    1.442 -17.966  -1.824 1.00 . A A .  38 GLU OE1  1 1 
       14  8610 1 1 38 GLU OE2  O    0.238 -19.080  -0.361 1.00 . A A .  38 GLU OE2  1 1 
       14  8611 1 1 39 LYS C    C   -6.584 -17.941  -1.449 1.00 . A A .  39 LYS C    1 1 
       14  8612 1 1 39 LYS CA   C   -5.213 -18.606  -1.501 1.00 . A A .  39 LYS CA   1 1 
       14  8613 1 1 39 LYS CB   C   -4.773 -19.005  -0.091 1.00 . A A .  39 LYS CB   1 1 
       14  8614 1 1 39 LYS CD   C   -5.124 -17.002   1.383 1.00 . A A .  39 LYS CD   1 1 
       14  8615 1 1 39 LYS CE   C   -4.479 -16.166   2.479 1.00 . A A .  39 LYS CE   1 1 
       14  8616 1 1 39 LYS CG   C   -4.103 -17.880   0.679 1.00 . A A .  39 LYS CG   1 1 
       14  8617 1 1 39 LYS H    H   -4.127 -16.807  -1.756 1.00 . A A .  39 LYS H    1 1 
       14  8618 1 1 39 LYS HA   H   -5.279 -19.493  -2.113 1.00 . A A .  39 LYS HA   1 1 
       14  8619 1 1 39 LYS HB2  H   -5.641 -19.327   0.466 1.00 . A A .  39 LYS HB2  1 1 
       14  8620 1 1 39 LYS HB3  H   -4.077 -19.828  -0.163 1.00 . A A .  39 LYS HB3  1 1 
       14  8621 1 1 39 LYS HD2  H   -5.576 -16.339   0.660 1.00 . A A .  39 LYS HD2  1 1 
       14  8622 1 1 39 LYS HD3  H   -5.885 -17.630   1.823 1.00 . A A .  39 LYS HD3  1 1 
       14  8623 1 1 39 LYS HE2  H   -5.224 -15.936   3.224 1.00 . A A .  39 LYS HE2  1 1 
       14  8624 1 1 39 LYS HE3  H   -3.684 -16.741   2.930 1.00 . A A .  39 LYS HE3  1 1 
       14  8625 1 1 39 LYS HG2  H   -3.441 -18.306   1.418 1.00 . A A .  39 LYS HG2  1 1 
       14  8626 1 1 39 LYS HG3  H   -3.534 -17.274  -0.011 1.00 . A A .  39 LYS HG3  1 1 
       14  8627 1 1 39 LYS HZ1  H   -4.624 -14.135   2.011 1.00 . A A .  39 LYS HZ1  1 1 
       14  8628 1 1 39 LYS HZ2  H   -3.641 -15.014   0.951 1.00 . A A .  39 LYS HZ2  1 1 
       14  8629 1 1 39 LYS HZ3  H   -3.076 -14.618   2.496 1.00 . A A .  39 LYS HZ3  1 1 
       14  8630 1 1 39 LYS N    N   -4.226 -17.718  -2.105 1.00 . A A .  39 LYS N    1 1 
       14  8631 1 1 39 LYS NZ   N   -3.916 -14.894   1.947 1.00 . A A .  39 LYS NZ   1 1 
       14  8632 1 1 39 LYS O    O   -7.188 -17.792  -0.387 1.00 . A A .  39 LYS O    1 1 
       14  8633 1 1 40 PRO C    C   -9.550 -17.836  -2.461 1.00 . A A .  40 PRO C    1 1 
       14  8634 1 1 40 PRO CA   C   -8.397 -16.878  -2.736 1.00 . A A .  40 PRO CA   1 1 
       14  8635 1 1 40 PRO CB   C   -8.430 -16.404  -4.191 1.00 . A A .  40 PRO CB   1 1 
       14  8636 1 1 40 PRO CD   C   -6.425 -17.677  -3.928 1.00 . A A .  40 PRO CD   1 1 
       14  8637 1 1 40 PRO CG   C   -7.506 -17.324  -4.911 1.00 . A A .  40 PRO CG   1 1 
       14  8638 1 1 40 PRO HA   H   -8.473 -16.026  -2.076 1.00 . A A .  40 PRO HA   1 1 
       14  8639 1 1 40 PRO HB2  H   -9.439 -16.477  -4.573 1.00 . A A .  40 PRO HB2  1 1 
       14  8640 1 1 40 PRO HB3  H   -8.091 -15.380  -4.248 1.00 . A A .  40 PRO HB3  1 1 
       14  8641 1 1 40 PRO HD2  H   -6.093 -18.693  -4.081 1.00 . A A .  40 PRO HD2  1 1 
       14  8642 1 1 40 PRO HD3  H   -5.596 -16.990  -4.016 1.00 . A A .  40 PRO HD3  1 1 
       14  8643 1 1 40 PRO HG2  H   -8.038 -18.212  -5.219 1.00 . A A .  40 PRO HG2  1 1 
       14  8644 1 1 40 PRO HG3  H   -7.083 -16.822  -5.769 1.00 . A A .  40 PRO HG3  1 1 
       14  8645 1 1 40 PRO N    N   -7.090 -17.532  -2.622 1.00 . A A .  40 PRO N    1 1 
       14  8646 1 1 40 PRO O    O  -10.076 -18.469  -3.377 1.00 . A A .  40 PRO O    1 1 
       14  8647 1 1 41 SER C    C  -12.065 -18.071   0.032 1.00 . A A .  41 SER C    1 1 
       14  8648 1 1 41 SER CA   C  -11.030 -18.823  -0.799 1.00 . A A .  41 SER CA   1 1 
       14  8649 1 1 41 SER CB   C  -10.487 -20.012  -0.004 1.00 . A A .  41 SER CB   1 1 
       14  8650 1 1 41 SER H    H   -9.481 -17.408  -0.510 1.00 . A A .  41 SER H    1 1 
       14  8651 1 1 41 SER HA   H  -11.504 -19.188  -1.698 1.00 . A A .  41 SER HA   1 1 
       14  8652 1 1 41 SER HB2  H   -9.654 -19.688   0.600 1.00 . A A .  41 SER HB2  1 1 
       14  8653 1 1 41 SER HB3  H  -11.267 -20.400   0.635 1.00 . A A .  41 SER HB3  1 1 
       14  8654 1 1 41 SER HG   H   -9.113 -21.208  -0.726 1.00 . A A .  41 SER HG   1 1 
       14  8655 1 1 41 SER N    N   -9.940 -17.938  -1.195 1.00 . A A .  41 SER N    1 1 
       14  8656 1 1 41 SER O    O  -13.248 -18.045  -0.304 1.00 . A A .  41 SER O    1 1 
       14  8657 1 1 41 SER OG   O  -10.049 -21.046  -0.869 1.00 . A A .  41 SER OG   1 1 
       14  8658 1 1 42 GLY C    C  -11.803 -15.601   2.732 1.00 . A A .  42 GLY C    1 1 
       14  8659 1 1 42 GLY CA   C  -12.507 -16.716   1.985 1.00 . A A .  42 GLY CA   1 1 
       14  8660 1 1 42 GLY H    H  -10.656 -17.515   1.341 1.00 . A A .  42 GLY H    1 1 
       14  8661 1 1 42 GLY HA2  H  -13.297 -16.290   1.384 1.00 . A A .  42 GLY HA2  1 1 
       14  8662 1 1 42 GLY HA3  H  -12.942 -17.395   2.704 1.00 . A A .  42 GLY HA3  1 1 
       14  8663 1 1 42 GLY N    N  -11.609 -17.460   1.122 1.00 . A A .  42 GLY N    1 1 
       14  8664 1 1 42 GLY O    O  -11.551 -15.691   3.934 1.00 . A A .  42 GLY O    1 1 
       14  8665 1 1 43 PRO C    C  -11.680 -12.574   3.543 1.00 . A A .  43 PRO C    1 1 
       14  8666 1 1 43 PRO CA   C  -10.784 -13.361   2.592 1.00 . A A .  43 PRO CA   1 1 
       14  8667 1 1 43 PRO CB   C  -10.424 -12.512   1.371 1.00 . A A .  43 PRO CB   1 1 
       14  8668 1 1 43 PRO CD   C  -11.739 -14.343   0.574 1.00 . A A .  43 PRO CD   1 1 
       14  8669 1 1 43 PRO CG   C  -11.428 -12.891   0.337 1.00 . A A .  43 PRO CG   1 1 
       14  8670 1 1 43 PRO HA   H   -9.881 -13.653   3.109 1.00 . A A .  43 PRO HA   1 1 
       14  8671 1 1 43 PRO HB2  H  -10.494 -11.464   1.624 1.00 . A A .  43 PRO HB2  1 1 
       14  8672 1 1 43 PRO HB3  H   -9.420 -12.744   1.049 1.00 . A A .  43 PRO HB3  1 1 
       14  8673 1 1 43 PRO HD2  H  -12.775 -14.549   0.348 1.00 . A A .  43 PRO HD2  1 1 
       14  8674 1 1 43 PRO HD3  H  -11.089 -14.970  -0.018 1.00 . A A .  43 PRO HD3  1 1 
       14  8675 1 1 43 PRO HG2  H  -12.319 -12.293   0.454 1.00 . A A .  43 PRO HG2  1 1 
       14  8676 1 1 43 PRO HG3  H  -11.009 -12.754  -0.649 1.00 . A A .  43 PRO HG3  1 1 
       14  8677 1 1 43 PRO N    N  -11.470 -14.519   2.011 1.00 . A A .  43 PRO N    1 1 
       14  8678 1 1 43 PRO O    O  -12.871 -12.400   3.288 1.00 . A A .  43 PRO O    1 1 
       14  8679 1 1 44 SER C    C  -11.527  -9.845   5.518 1.00 . A A .  44 SER C    1 1 
       14  8680 1 1 44 SER CA   C  -11.844 -11.333   5.631 1.00 . A A .  44 SER CA   1 1 
       14  8681 1 1 44 SER CB   C  -11.520 -11.830   7.041 1.00 . A A .  44 SER CB   1 1 
       14  8682 1 1 44 SER H    H  -10.144 -12.271   4.787 1.00 . A A .  44 SER H    1 1 
       14  8683 1 1 44 SER HA   H  -12.897 -11.480   5.439 1.00 . A A .  44 SER HA   1 1 
       14  8684 1 1 44 SER HB2  H  -11.666 -12.898   7.086 1.00 . A A .  44 SER HB2  1 1 
       14  8685 1 1 44 SER HB3  H  -10.491 -11.596   7.274 1.00 . A A .  44 SER HB3  1 1 
       14  8686 1 1 44 SER HG   H  -13.173 -11.715   8.087 1.00 . A A .  44 SER HG   1 1 
       14  8687 1 1 44 SER N    N  -11.098 -12.099   4.640 1.00 . A A .  44 SER N    1 1 
       14  8688 1 1 44 SER O    O  -12.424  -9.002   5.563 1.00 . A A .  44 SER O    1 1 
       14  8689 1 1 44 SER OG   O  -12.358 -11.214   8.004 1.00 . A A .  44 SER OG   1 1 
       14  8690 1 1 45 SER C    C   -9.973  -7.638   3.826 1.00 . A A .  45 SER C    1 1 
       14  8691 1 1 45 SER CA   C   -9.807  -8.143   5.256 1.00 . A A .  45 SER CA   1 1 
       14  8692 1 1 45 SER CB   C   -8.345  -8.009   5.689 1.00 . A A .  45 SER CB   1 1 
       14  8693 1 1 45 SER H    H   -9.576 -10.246   5.342 1.00 . A A .  45 SER H    1 1 
       14  8694 1 1 45 SER HA   H  -10.423  -7.545   5.910 1.00 . A A .  45 SER HA   1 1 
       14  8695 1 1 45 SER HB2  H   -7.723  -8.597   5.032 1.00 . A A .  45 SER HB2  1 1 
       14  8696 1 1 45 SER HB3  H   -8.050  -6.972   5.633 1.00 . A A .  45 SER HB3  1 1 
       14  8697 1 1 45 SER HG   H   -7.744  -7.776   7.539 1.00 . A A .  45 SER HG   1 1 
       14  8698 1 1 45 SER N    N  -10.244  -9.529   5.371 1.00 . A A .  45 SER N    1 1 
       14  8699 1 1 45 SER O    O  -10.641  -6.633   3.584 1.00 . A A .  45 SER O    1 1 
       14  8700 1 1 45 SER OG   O   -8.164  -8.465   7.019 1.00 . A A .  45 SER OG   1 1 
       14  8701 1 1 46 GLY C    C   -8.138  -8.128   0.748 1.00 . A A .  46 GLY C    1 1 
       14  8702 1 1 46 GLY CA   C   -9.450  -7.952   1.486 1.00 . A A .  46 GLY CA   1 1 
       14  8703 1 1 46 GLY H    H   -8.840  -9.136   3.132 1.00 . A A .  46 GLY H    1 1 
       14  8704 1 1 46 GLY HA2  H  -10.207  -8.553   1.004 1.00 . A A .  46 GLY HA2  1 1 
       14  8705 1 1 46 GLY HA3  H   -9.743  -6.913   1.434 1.00 . A A .  46 GLY HA3  1 1 
       14  8706 1 1 46 GLY N    N   -9.359  -8.343   2.881 1.00 . A A .  46 GLY N    1 1 
       14  8707 1 1 46 GLY O    O   -7.726  -9.264   0.521 1.00 . A A .  46 GLY O    1 1 
       14  8708 2 2  1 ZN  ZN   ZN  -3.935  -2.458  -1.350 1.00 . B A . 201 ZN  ZN   1 1 
       15  8709 1 1  1 GLY C    C  -24.782  22.726 -11.321 1.00 . A A .   1 GLY C    1 1 
       15  8710 1 1  1 GLY CA   C  -24.572  23.206 -12.744 1.00 . A A .   1 GLY CA   1 1 
       15  8711 1 1  1 GLY H1   H  -26.356  24.342 -12.626 1.00 . A A .   1 GLY H1   1 1 
       15  8712 1 1  1 GLY HA2  H  -24.680  22.368 -13.415 1.00 . A A .   1 GLY HA2  1 1 
       15  8713 1 1  1 GLY HA3  H  -23.571  23.601 -12.834 1.00 . A A .   1 GLY HA3  1 1 
       15  8714 1 1  1 GLY N    N  -25.519  24.238 -13.126 1.00 . A A .   1 GLY N    1 1 
       15  8715 1 1  1 GLY O    O  -25.246  23.480 -10.466 1.00 . A A .   1 GLY O    1 1 
       15  8716 1 1  2 SER C    C  -23.250  20.764  -9.035 1.00 . A A .   2 SER C    1 1 
       15  8717 1 1  2 SER CA   C  -24.598  20.884  -9.740 1.00 . A A .   2 SER CA   1 1 
       15  8718 1 1  2 SER CB   C  -25.259  19.508  -9.839 1.00 . A A .   2 SER CB   1 1 
       15  8719 1 1  2 SER H    H  -24.076  20.915 -11.791 1.00 . A A .   2 SER H    1 1 
       15  8720 1 1  2 SER HA   H  -25.235  21.539  -9.164 1.00 . A A .   2 SER HA   1 1 
       15  8721 1 1  2 SER HB2  H  -25.978  19.514 -10.644 1.00 . A A .   2 SER HB2  1 1 
       15  8722 1 1  2 SER HB3  H  -24.503  18.762 -10.036 1.00 . A A .   2 SER HB3  1 1 
       15  8723 1 1  2 SER HG   H  -26.175  18.248  -8.651 1.00 . A A .   2 SER HG   1 1 
       15  8724 1 1  2 SER N    N  -24.440  21.466 -11.068 1.00 . A A .   2 SER N    1 1 
       15  8725 1 1  2 SER O    O  -22.505  19.810  -9.255 1.00 . A A .   2 SER O    1 1 
       15  8726 1 1  2 SER OG   O  -25.926  19.175  -8.634 1.00 . A A .   2 SER OG   1 1 
       15  8727 1 1  3 SER C    C  -21.910  21.395  -5.984 1.00 . A A .   3 SER C    1 1 
       15  8728 1 1  3 SER CA   C  -21.685  21.748  -7.452 1.00 . A A .   3 SER CA   1 1 
       15  8729 1 1  3 SER CB   C  -21.014  23.118  -7.562 1.00 . A A .   3 SER CB   1 1 
       15  8730 1 1  3 SER H    H  -23.580  22.475  -8.054 1.00 . A A .   3 SER H    1 1 
       15  8731 1 1  3 SER HA   H  -21.039  21.004  -7.893 1.00 . A A .   3 SER HA   1 1 
       15  8732 1 1  3 SER HB2  H  -20.963  23.409  -8.600 1.00 . A A .   3 SER HB2  1 1 
       15  8733 1 1  3 SER HB3  H  -21.594  23.845  -7.012 1.00 . A A .   3 SER HB3  1 1 
       15  8734 1 1  3 SER HG   H  -19.258  22.285  -7.319 1.00 . A A .   3 SER HG   1 1 
       15  8735 1 1  3 SER N    N  -22.945  21.741  -8.187 1.00 . A A .   3 SER N    1 1 
       15  8736 1 1  3 SER O    O  -22.479  22.180  -5.226 1.00 . A A .   3 SER O    1 1 
       15  8737 1 1  3 SER OG   O  -19.700  23.087  -7.031 1.00 . A A .   3 SER OG   1 1 
       15  8738 1 1  4 GLY C    C  -20.338  19.215  -3.631 1.00 . A A .   4 GLY C    1 1 
       15  8739 1 1  4 GLY CA   C  -21.620  19.771  -4.217 1.00 . A A .   4 GLY CA   1 1 
       15  8740 1 1  4 GLY H    H  -21.013  19.624  -6.240 1.00 . A A .   4 GLY H    1 1 
       15  8741 1 1  4 GLY HA2  H  -21.943  20.611  -3.619 1.00 . A A .   4 GLY HA2  1 1 
       15  8742 1 1  4 GLY HA3  H  -22.380  19.005  -4.182 1.00 . A A .   4 GLY HA3  1 1 
       15  8743 1 1  4 GLY N    N  -21.459  20.208  -5.591 1.00 . A A .   4 GLY N    1 1 
       15  8744 1 1  4 GLY O    O  -19.675  18.383  -4.249 1.00 . A A .   4 GLY O    1 1 
       15  8745 1 1  5 SER C    C  -19.035  17.959  -0.958 1.00 . A A .   5 SER C    1 1 
       15  8746 1 1  5 SER CA   C  -18.771  19.225  -1.768 1.00 . A A .   5 SER CA   1 1 
       15  8747 1 1  5 SER CB   C  -18.226  20.324  -0.854 1.00 . A A .   5 SER CB   1 1 
       15  8748 1 1  5 SER H    H  -20.556  20.341  -1.993 1.00 . A A .   5 SER H    1 1 
       15  8749 1 1  5 SER HA   H  -18.037  19.005  -2.529 1.00 . A A .   5 SER HA   1 1 
       15  8750 1 1  5 SER HB2  H  -19.034  20.733  -0.266 1.00 . A A .   5 SER HB2  1 1 
       15  8751 1 1  5 SER HB3  H  -17.479  19.904  -0.196 1.00 . A A .   5 SER HB3  1 1 
       15  8752 1 1  5 SER HG   H  -18.177  21.552  -2.379 1.00 . A A .   5 SER HG   1 1 
       15  8753 1 1  5 SER N    N  -19.986  19.678  -2.435 1.00 . A A .   5 SER N    1 1 
       15  8754 1 1  5 SER O    O  -18.682  17.876   0.218 1.00 . A A .   5 SER O    1 1 
       15  8755 1 1  5 SER OG   O  -17.636  21.369  -1.608 1.00 . A A .   5 SER OG   1 1 
       15  8756 1 1  6 SER C    C  -18.703  15.018  -0.459 1.00 . A A .   6 SER C    1 1 
       15  8757 1 1  6 SER CA   C  -19.974  15.713  -0.938 1.00 . A A .   6 SER CA   1 1 
       15  8758 1 1  6 SER CB   C  -20.745  14.795  -1.888 1.00 . A A .   6 SER CB   1 1 
       15  8759 1 1  6 SER H    H  -19.914  17.101  -2.536 1.00 . A A .   6 SER H    1 1 
       15  8760 1 1  6 SER HA   H  -20.594  15.934  -0.081 1.00 . A A .   6 SER HA   1 1 
       15  8761 1 1  6 SER HB2  H  -20.397  14.951  -2.897 1.00 . A A .   6 SER HB2  1 1 
       15  8762 1 1  6 SER HB3  H  -20.578  13.766  -1.604 1.00 . A A .   6 SER HB3  1 1 
       15  8763 1 1  6 SER HG   H  -22.519  14.928  -2.708 1.00 . A A .   6 SER HG   1 1 
       15  8764 1 1  6 SER N    N  -19.658  16.975  -1.598 1.00 . A A .   6 SER N    1 1 
       15  8765 1 1  6 SER O    O  -18.613  14.585   0.689 1.00 . A A .   6 SER O    1 1 
       15  8766 1 1  6 SER OG   O  -22.136  15.062  -1.838 1.00 . A A .   6 SER OG   1 1 
       15  8767 1 1  7 GLY C    C  -15.262  15.061  -1.466 1.00 . A A .   7 GLY C    1 1 
       15  8768 1 1  7 GLY CA   C  -16.469  14.270  -1.002 1.00 . A A .   7 GLY CA   1 1 
       15  8769 1 1  7 GLY H    H  -17.849  15.277  -2.252 1.00 . A A .   7 GLY H    1 1 
       15  8770 1 1  7 GLY HA2  H  -16.421  14.156   0.071 1.00 . A A .   7 GLY HA2  1 1 
       15  8771 1 1  7 GLY HA3  H  -16.441  13.292  -1.459 1.00 . A A .   7 GLY HA3  1 1 
       15  8772 1 1  7 GLY N    N  -17.722  14.914  -1.350 1.00 . A A .   7 GLY N    1 1 
       15  8773 1 1  7 GLY O    O  -14.880  14.998  -2.635 1.00 . A A .   7 GLY O    1 1 
       15  8774 1 1  8 THR C    C  -12.212  15.790  -0.807 1.00 . A A .   8 THR C    1 1 
       15  8775 1 1  8 THR CA   C  -13.490  16.619  -0.870 1.00 . A A .   8 THR CA   1 1 
       15  8776 1 1  8 THR CB   C  -13.357  17.819   0.086 1.00 . A A .   8 THR CB   1 1 
       15  8777 1 1  8 THR CG2  C  -12.222  18.735  -0.348 1.00 . A A .   8 THR CG2  1 1 
       15  8778 1 1  8 THR H    H  -15.010  15.819   0.366 1.00 . A A .   8 THR H    1 1 
       15  8779 1 1  8 THR HA   H  -13.612  16.998  -1.874 1.00 . A A .   8 THR HA   1 1 
       15  8780 1 1  8 THR HB   H  -13.141  17.448   1.078 1.00 . A A .   8 THR HB   1 1 
       15  8781 1 1  8 THR HG1  H  -14.859  18.678   1.033 1.00 . A A .   8 THR HG1  1 1 
       15  8782 1 1  8 THR HG21 H  -11.981  18.541  -1.383 1.00 . A A .   8 THR HG21 1 1 
       15  8783 1 1  8 THR HG22 H  -11.353  18.547   0.265 1.00 . A A .   8 THR HG22 1 1 
       15  8784 1 1  8 THR HG23 H  -12.527  19.764  -0.236 1.00 . A A .   8 THR HG23 1 1 
       15  8785 1 1  8 THR N    N  -14.658  15.810  -0.548 1.00 . A A .   8 THR N    1 1 
       15  8786 1 1  8 THR O    O  -12.109  14.850  -0.019 1.00 . A A .   8 THR O    1 1 
       15  8787 1 1  8 THR OG1  O  -14.584  18.556   0.121 1.00 . A A .   8 THR OG1  1 1 
       15  8788 1 1  9 GLY C    C  -10.013  14.229  -2.598 1.00 . A A .   9 GLY C    1 1 
       15  8789 1 1  9 GLY CA   C   -9.981  15.422  -1.663 1.00 . A A .   9 GLY CA   1 1 
       15  8790 1 1  9 GLY H    H  -11.378  16.902  -2.247 1.00 . A A .   9 GLY H    1 1 
       15  8791 1 1  9 GLY HA2  H   -9.198  16.094  -1.980 1.00 . A A .   9 GLY HA2  1 1 
       15  8792 1 1  9 GLY HA3  H   -9.761  15.075  -0.664 1.00 . A A .   9 GLY HA3  1 1 
       15  8793 1 1  9 GLY N    N  -11.240  16.144  -1.641 1.00 . A A .   9 GLY N    1 1 
       15  8794 1 1  9 GLY O    O  -10.760  13.278  -2.375 1.00 . A A .   9 GLY O    1 1 
       15  8795 1 1 10 GLU C    C   -7.700  12.760  -4.863 1.00 . A A .  10 GLU C    1 1 
       15  8796 1 1 10 GLU CA   C   -9.142  13.198  -4.623 1.00 . A A .  10 GLU CA   1 1 
       15  8797 1 1 10 GLU CB   C   -9.780  13.634  -5.943 1.00 . A A .  10 GLU CB   1 1 
       15  8798 1 1 10 GLU CD   C  -11.493  15.315  -5.154 1.00 . A A .  10 GLU CD   1 1 
       15  8799 1 1 10 GLU CG   C  -11.256  13.974  -5.822 1.00 . A A .  10 GLU CG   1 1 
       15  8800 1 1 10 GLU H    H   -8.629  15.068  -3.773 1.00 . A A .  10 GLU H    1 1 
       15  8801 1 1 10 GLU HA   H   -9.697  12.363  -4.223 1.00 . A A .  10 GLU HA   1 1 
       15  8802 1 1 10 GLU HB2  H   -9.259  14.505  -6.311 1.00 . A A .  10 GLU HB2  1 1 
       15  8803 1 1 10 GLU HB3  H   -9.675  12.833  -6.661 1.00 . A A .  10 GLU HB3  1 1 
       15  8804 1 1 10 GLU HG2  H  -11.689  14.001  -6.811 1.00 . A A .  10 GLU HG2  1 1 
       15  8805 1 1 10 GLU HG3  H  -11.743  13.207  -5.239 1.00 . A A .  10 GLU HG3  1 1 
       15  8806 1 1 10 GLU N    N   -9.201  14.282  -3.649 1.00 . A A .  10 GLU N    1 1 
       15  8807 1 1 10 GLU O    O   -6.784  13.584  -4.888 1.00 . A A .  10 GLU O    1 1 
       15  8808 1 1 10 GLU OE1  O  -11.055  16.342  -5.713 1.00 . A A .  10 GLU OE1  1 1 
       15  8809 1 1 10 GLU OE2  O  -12.117  15.336  -4.073 1.00 . A A .  10 GLU OE2  1 1 
       15  8810 1 1 11 LYS C    C   -6.058  10.364  -6.697 1.00 . A A .  11 LYS C    1 1 
       15  8811 1 1 11 LYS CA   C   -6.175  10.908  -5.276 1.00 . A A .  11 LYS CA   1 1 
       15  8812 1 1 11 LYS CB   C   -5.871   9.798  -4.267 1.00 . A A .  11 LYS CB   1 1 
       15  8813 1 1 11 LYS CD   C   -6.299  10.805  -2.006 1.00 . A A .  11 LYS CD   1 1 
       15  8814 1 1 11 LYS CE   C   -6.871   9.672  -1.169 1.00 . A A .  11 LYS CE   1 1 
       15  8815 1 1 11 LYS CG   C   -5.245  10.303  -2.978 1.00 . A A .  11 LYS CG   1 1 
       15  8816 1 1 11 LYS H    H   -8.274  10.851  -5.006 1.00 . A A .  11 LYS H    1 1 
       15  8817 1 1 11 LYS HA   H   -5.459  11.705  -5.149 1.00 . A A .  11 LYS HA   1 1 
       15  8818 1 1 11 LYS HB2  H   -6.791   9.290  -4.021 1.00 . A A .  11 LYS HB2  1 1 
       15  8819 1 1 11 LYS HB3  H   -5.190   9.093  -4.721 1.00 . A A .  11 LYS HB3  1 1 
       15  8820 1 1 11 LYS HD2  H   -5.851  11.534  -1.347 1.00 . A A .  11 LYS HD2  1 1 
       15  8821 1 1 11 LYS HD3  H   -7.101  11.268  -2.565 1.00 . A A .  11 LYS HD3  1 1 
       15  8822 1 1 11 LYS HE2  H   -7.159   8.866  -1.826 1.00 . A A .  11 LYS HE2  1 1 
       15  8823 1 1 11 LYS HE3  H   -6.107   9.325  -0.488 1.00 . A A .  11 LYS HE3  1 1 
       15  8824 1 1 11 LYS HG2  H   -4.698   9.496  -2.514 1.00 . A A .  11 LYS HG2  1 1 
       15  8825 1 1 11 LYS HG3  H   -4.568  11.113  -3.211 1.00 . A A .  11 LYS HG3  1 1 
       15  8826 1 1 11 LYS HZ1  H   -8.361  11.053  -0.687 1.00 . A A .  11 LYS HZ1  1 1 
       15  8827 1 1 11 LYS HZ2  H   -7.825  10.137   0.630 1.00 . A A .  11 LYS HZ2  1 1 
       15  8828 1 1 11 LYS HZ3  H   -8.845   9.440  -0.526 1.00 . A A .  11 LYS HZ3  1 1 
       15  8829 1 1 11 LYS N    N   -7.504  11.458  -5.038 1.00 . A A .  11 LYS N    1 1 
       15  8830 1 1 11 LYS NZ   N   -8.059  10.106  -0.383 1.00 . A A .  11 LYS NZ   1 1 
       15  8831 1 1 11 LYS O    O   -7.004   9.806  -7.253 1.00 . A A .  11 LYS O    1 1 
       15  8832 1 1 12 PRO C    C   -4.547   8.537  -8.749 1.00 . A A .  12 PRO C    1 1 
       15  8833 1 1 12 PRO CA   C   -4.602  10.058  -8.660 1.00 . A A .  12 PRO CA   1 1 
       15  8834 1 1 12 PRO CB   C   -3.232  10.663  -8.980 1.00 . A A .  12 PRO CB   1 1 
       15  8835 1 1 12 PRO CD   C   -3.699  11.184  -6.695 1.00 . A A .  12 PRO CD   1 1 
       15  8836 1 1 12 PRO CG   C   -2.586  10.860  -7.653 1.00 . A A .  12 PRO CG   1 1 
       15  8837 1 1 12 PRO HA   H   -5.335  10.432  -9.361 1.00 . A A .  12 PRO HA   1 1 
       15  8838 1 1 12 PRO HB2  H   -2.669   9.977  -9.597 1.00 . A A .  12 PRO HB2  1 1 
       15  8839 1 1 12 PRO HB3  H   -3.361  11.600  -9.500 1.00 . A A .  12 PRO HB3  1 1 
       15  8840 1 1 12 PRO HD2  H   -3.488  10.775  -5.718 1.00 . A A .  12 PRO HD2  1 1 
       15  8841 1 1 12 PRO HD3  H   -3.845  12.253  -6.634 1.00 . A A .  12 PRO HD3  1 1 
       15  8842 1 1 12 PRO HG2  H   -2.083   9.954  -7.351 1.00 . A A .  12 PRO HG2  1 1 
       15  8843 1 1 12 PRO HG3  H   -1.886  11.680  -7.704 1.00 . A A .  12 PRO HG3  1 1 
       15  8844 1 1 12 PRO N    N   -4.871  10.528  -7.298 1.00 . A A .  12 PRO N    1 1 
       15  8845 1 1 12 PRO O    O   -5.068   7.941  -9.691 1.00 . A A .  12 PRO O    1 1 
       15  8846 1 1 13 TYR C    C   -4.515   5.880  -6.521 1.00 . A A .  13 TYR C    1 1 
       15  8847 1 1 13 TYR CA   C   -3.788   6.462  -7.729 1.00 . A A .  13 TYR CA   1 1 
       15  8848 1 1 13 TYR CB   C   -2.313   6.057  -7.695 1.00 . A A .  13 TYR CB   1 1 
       15  8849 1 1 13 TYR CD1  C   -1.546   5.690 -10.073 1.00 . A A .  13 TYR CD1  1 1 
       15  8850 1 1 13 TYR CD2  C   -0.809   7.655  -8.943 1.00 . A A .  13 TYR CD2  1 1 
       15  8851 1 1 13 TYR CE1  C   -0.842   6.068 -11.200 1.00 . A A .  13 TYR CE1  1 1 
       15  8852 1 1 13 TYR CE2  C   -0.103   8.042 -10.066 1.00 . A A .  13 TYR CE2  1 1 
       15  8853 1 1 13 TYR CG   C   -1.542   6.475  -8.926 1.00 . A A .  13 TYR CG   1 1 
       15  8854 1 1 13 TYR CZ   C   -0.123   7.245 -11.192 1.00 . A A .  13 TYR CZ   1 1 
       15  8855 1 1 13 TYR H    H   -3.517   8.444  -7.038 1.00 . A A .  13 TYR H    1 1 
       15  8856 1 1 13 TYR HA   H   -4.238   6.070  -8.629 1.00 . A A .  13 TYR HA   1 1 
       15  8857 1 1 13 TYR HB2  H   -1.841   6.512  -6.838 1.00 . A A .  13 TYR HB2  1 1 
       15  8858 1 1 13 TYR HB3  H   -2.244   4.982  -7.609 1.00 . A A .  13 TYR HB3  1 1 
       15  8859 1 1 13 TYR HD1  H   -2.112   4.770 -10.076 1.00 . A A .  13 TYR HD1  1 1 
       15  8860 1 1 13 TYR HD2  H   -0.795   8.277  -8.060 1.00 . A A .  13 TYR HD2  1 1 
       15  8861 1 1 13 TYR HE1  H   -0.858   5.445 -12.082 1.00 . A A .  13 TYR HE1  1 1 
       15  8862 1 1 13 TYR HE2  H    0.461   8.963 -10.060 1.00 . A A .  13 TYR HE2  1 1 
       15  8863 1 1 13 TYR HH   H    1.508   7.722 -12.091 1.00 . A A .  13 TYR HH   1 1 
       15  8864 1 1 13 TYR N    N   -3.913   7.915  -7.761 1.00 . A A .  13 TYR N    1 1 
       15  8865 1 1 13 TYR O    O   -4.329   6.333  -5.391 1.00 . A A .  13 TYR O    1 1 
       15  8866 1 1 13 TYR OH   O    0.579   7.626 -12.313 1.00 . A A .  13 TYR OH   1 1 
       15  8867 1 1 14 LYS C    C   -6.157   2.713  -5.916 1.00 . A A .  14 LYS C    1 1 
       15  8868 1 1 14 LYS CA   C   -6.098   4.222  -5.701 1.00 . A A .  14 LYS CA   1 1 
       15  8869 1 1 14 LYS CB   C   -7.516   4.794  -5.632 1.00 . A A .  14 LYS CB   1 1 
       15  8870 1 1 14 LYS CD   C   -7.738   5.845  -3.361 1.00 . A A .  14 LYS CD   1 1 
       15  8871 1 1 14 LYS CE   C   -8.789   6.129  -2.299 1.00 . A A .  14 LYS CE   1 1 
       15  8872 1 1 14 LYS CG   C   -8.149   4.687  -4.256 1.00 . A A .  14 LYS CG   1 1 
       15  8873 1 1 14 LYS H    H   -5.449   4.553  -7.689 1.00 . A A .  14 LYS H    1 1 
       15  8874 1 1 14 LYS HA   H   -5.593   4.422  -4.768 1.00 . A A .  14 LYS HA   1 1 
       15  8875 1 1 14 LYS HB2  H   -7.485   5.837  -5.911 1.00 . A A .  14 LYS HB2  1 1 
       15  8876 1 1 14 LYS HB3  H   -8.141   4.261  -6.335 1.00 . A A .  14 LYS HB3  1 1 
       15  8877 1 1 14 LYS HD2  H   -6.807   5.599  -2.873 1.00 . A A .  14 LYS HD2  1 1 
       15  8878 1 1 14 LYS HD3  H   -7.605   6.728  -3.970 1.00 . A A .  14 LYS HD3  1 1 
       15  8879 1 1 14 LYS HE2  H   -8.573   7.083  -1.844 1.00 . A A .  14 LYS HE2  1 1 
       15  8880 1 1 14 LYS HE3  H   -9.759   6.168  -2.773 1.00 . A A .  14 LYS HE3  1 1 
       15  8881 1 1 14 LYS HG2  H   -9.224   4.692  -4.362 1.00 . A A .  14 LYS HG2  1 1 
       15  8882 1 1 14 LYS HG3  H   -7.835   3.760  -3.796 1.00 . A A .  14 LYS HG3  1 1 
       15  8883 1 1 14 LYS HZ1  H   -9.393   4.276  -1.546 1.00 . A A .  14 LYS HZ1  1 1 
       15  8884 1 1 14 LYS HZ2  H   -9.200   5.468  -0.361 1.00 . A A .  14 LYS HZ2  1 1 
       15  8885 1 1 14 LYS HZ3  H   -7.841   4.741  -1.059 1.00 . A A .  14 LYS HZ3  1 1 
       15  8886 1 1 14 LYS N    N   -5.343   4.871  -6.767 1.00 . A A .  14 LYS N    1 1 
       15  8887 1 1 14 LYS NZ   N   -8.807   5.080  -1.242 1.00 . A A .  14 LYS NZ   1 1 
       15  8888 1 1 14 LYS O    O   -6.364   2.243  -7.035 1.00 . A A .  14 LYS O    1 1 
       15  8889 1 1 15 CYS C    C   -7.435  -0.016  -4.768 1.00 . A A .  15 CYS C    1 1 
       15  8890 1 1 15 CYS CA   C   -6.007   0.503  -4.907 1.00 . A A .  15 CYS CA   1 1 
       15  8891 1 1 15 CYS CB   C   -5.125  -0.101  -3.813 1.00 . A A .  15 CYS CB   1 1 
       15  8892 1 1 15 CYS H    H   -5.812   2.392  -3.972 1.00 . A A .  15 CYS H    1 1 
       15  8893 1 1 15 CYS HA   H   -5.622   0.208  -5.871 1.00 . A A .  15 CYS HA   1 1 
       15  8894 1 1 15 CYS HB2  H   -4.121   0.284  -3.918 1.00 . A A .  15 CYS HB2  1 1 
       15  8895 1 1 15 CYS HB3  H   -5.515   0.185  -2.848 1.00 . A A .  15 CYS HB3  1 1 
       15  8896 1 1 15 CYS N    N   -5.974   1.959  -4.837 1.00 . A A .  15 CYS N    1 1 
       15  8897 1 1 15 CYS O    O   -8.107   0.246  -3.772 1.00 . A A .  15 CYS O    1 1 
       15  8898 1 1 15 CYS SG   S   -5.026  -1.919  -3.856 1.00 . A A .  15 CYS SG   1 1 
       15  8899 1 1 16 ASN C    C   -9.252  -2.697  -5.133 1.00 . A A .  16 ASN C    1 1 
       15  8900 1 1 16 ASN CA   C   -9.240  -1.309  -5.766 1.00 . A A .  16 ASN CA   1 1 
       15  8901 1 1 16 ASN CB   C   -9.794  -1.381  -7.190 1.00 . A A .  16 ASN CB   1 1 
       15  8902 1 1 16 ASN CG   C   -8.807  -1.996  -8.164 1.00 . A A .  16 ASN CG   1 1 
       15  8903 1 1 16 ASN H    H   -7.308  -0.928  -6.543 1.00 . A A .  16 ASN H    1 1 
       15  8904 1 1 16 ASN HA   H   -9.865  -0.653  -5.179 1.00 . A A .  16 ASN HA   1 1 
       15  8905 1 1 16 ASN HB2  H  -10.692  -1.982  -7.191 1.00 . A A .  16 ASN HB2  1 1 
       15  8906 1 1 16 ASN HB3  H  -10.033  -0.384  -7.529 1.00 . A A .  16 ASN HB3  1 1 
       15  8907 1 1 16 ASN HD21 H   -9.555  -3.806  -7.817 1.00 . A A .  16 ASN HD21 1 1 
       15  8908 1 1 16 ASN HD22 H   -8.253  -3.736  -8.950 1.00 . A A .  16 ASN HD22 1 1 
       15  8909 1 1 16 ASN N    N   -7.892  -0.753  -5.775 1.00 . A A .  16 ASN N    1 1 
       15  8910 1 1 16 ASN ND2  N   -8.879  -3.312  -8.327 1.00 . A A .  16 ASN ND2  1 1 
       15  8911 1 1 16 ASN O    O  -10.188  -3.471  -5.328 1.00 . A A .  16 ASN O    1 1 
       15  8912 1 1 16 ASN OD1  O   -7.991  -1.296  -8.763 1.00 . A A .  16 ASN OD1  1 1 
       15  8913 1 1 17 GLU C    C   -8.313  -4.161  -2.207 1.00 . A A .  17 GLU C    1 1 
       15  8914 1 1 17 GLU CA   C   -8.096  -4.298  -3.711 1.00 . A A .  17 GLU CA   1 1 
       15  8915 1 1 17 GLU CB   C   -6.725  -4.922  -3.985 1.00 . A A .  17 GLU CB   1 1 
       15  8916 1 1 17 GLU CD   C   -5.984  -3.705  -6.071 1.00 . A A .  17 GLU CD   1 1 
       15  8917 1 1 17 GLU CG   C   -6.392  -5.033  -5.463 1.00 . A A .  17 GLU CG   1 1 
       15  8918 1 1 17 GLU H    H   -7.490  -2.344  -4.255 1.00 . A A .  17 GLU H    1 1 
       15  8919 1 1 17 GLU HA   H   -8.861  -4.943  -4.115 1.00 . A A .  17 GLU HA   1 1 
       15  8920 1 1 17 GLU HB2  H   -5.967  -4.317  -3.510 1.00 . A A .  17 GLU HB2  1 1 
       15  8921 1 1 17 GLU HB3  H   -6.703  -5.913  -3.557 1.00 . A A .  17 GLU HB3  1 1 
       15  8922 1 1 17 GLU HG2  H   -5.577  -5.732  -5.583 1.00 . A A .  17 GLU HG2  1 1 
       15  8923 1 1 17 GLU HG3  H   -7.261  -5.401  -5.988 1.00 . A A .  17 GLU HG3  1 1 
       15  8924 1 1 17 GLU N    N   -8.205  -3.004  -4.373 1.00 . A A .  17 GLU N    1 1 
       15  8925 1 1 17 GLU O    O   -9.098  -4.899  -1.611 1.00 . A A .  17 GLU O    1 1 
       15  8926 1 1 17 GLU OE1  O   -6.882  -2.917  -6.433 1.00 . A A .  17 GLU OE1  1 1 
       15  8927 1 1 17 GLU OE2  O   -4.765  -3.454  -6.183 1.00 . A A .  17 GLU OE2  1 1 
       15  8928 1 1 18 CYS C    C   -8.415  -1.643   0.116 1.00 . A A .  18 CYS C    1 1 
       15  8929 1 1 18 CYS CA   C   -7.725  -2.975  -0.164 1.00 . A A .  18 CYS CA   1 1 
       15  8930 1 1 18 CYS CB   C   -6.341  -2.992   0.488 1.00 . A A .  18 CYS CB   1 1 
       15  8931 1 1 18 CYS H    H   -7.001  -2.654  -2.127 1.00 . A A .  18 CYS H    1 1 
       15  8932 1 1 18 CYS HA   H   -8.321  -3.771   0.257 1.00 . A A .  18 CYS HA   1 1 
       15  8933 1 1 18 CYS HB2  H   -6.455  -2.912   1.559 1.00 . A A .  18 CYS HB2  1 1 
       15  8934 1 1 18 CYS HB3  H   -5.851  -3.925   0.252 1.00 . A A .  18 CYS HB3  1 1 
       15  8935 1 1 18 CYS N    N   -7.611  -3.211  -1.598 1.00 . A A .  18 CYS N    1 1 
       15  8936 1 1 18 CYS O    O   -9.283  -1.552   0.982 1.00 . A A .  18 CYS O    1 1 
       15  8937 1 1 18 CYS SG   S   -5.248  -1.638  -0.053 1.00 . A A .  18 CYS SG   1 1 
       15  8938 1 1 19 GLY C    C   -7.595   1.740  -0.016 1.00 . A A .  19 GLY C    1 1 
       15  8939 1 1 19 GLY CA   C   -8.612   0.701  -0.443 1.00 . A A .  19 GLY CA   1 1 
       15  8940 1 1 19 GLY H    H   -7.325  -0.744  -1.303 1.00 . A A .  19 GLY H    1 1 
       15  8941 1 1 19 GLY HA2  H   -9.062   1.014  -1.374 1.00 . A A .  19 GLY HA2  1 1 
       15  8942 1 1 19 GLY HA3  H   -9.381   0.635   0.312 1.00 . A A .  19 GLY HA3  1 1 
       15  8943 1 1 19 GLY N    N   -8.022  -0.612  -0.626 1.00 . A A .  19 GLY N    1 1 
       15  8944 1 1 19 GLY O    O   -7.873   2.576   0.844 1.00 . A A .  19 GLY O    1 1 
       15  8945 1 1 20 LYS C    C   -5.228   3.706  -1.369 1.00 . A A .  20 LYS C    1 1 
       15  8946 1 1 20 LYS CA   C   -5.347   2.631  -0.293 1.00 . A A .  20 LYS CA   1 1 
       15  8947 1 1 20 LYS CB   C   -4.013   1.896  -0.143 1.00 . A A .  20 LYS CB   1 1 
       15  8948 1 1 20 LYS CD   C   -3.092   3.084   1.869 1.00 . A A .  20 LYS CD   1 1 
       15  8949 1 1 20 LYS CE   C   -2.747   1.889   2.745 1.00 . A A .  20 LYS CE   1 1 
       15  8950 1 1 20 LYS CG   C   -2.894   2.769   0.396 1.00 . A A .  20 LYS CG   1 1 
       15  8951 1 1 20 LYS H    H   -6.248   0.998  -1.294 1.00 . A A .  20 LYS H    1 1 
       15  8952 1 1 20 LYS HA   H   -5.595   3.103   0.645 1.00 . A A .  20 LYS HA   1 1 
       15  8953 1 1 20 LYS HB2  H   -4.149   1.063   0.532 1.00 . A A .  20 LYS HB2  1 1 
       15  8954 1 1 20 LYS HB3  H   -3.713   1.518  -1.110 1.00 . A A .  20 LYS HB3  1 1 
       15  8955 1 1 20 LYS HD2  H   -2.453   3.911   2.141 1.00 . A A .  20 LYS HD2  1 1 
       15  8956 1 1 20 LYS HD3  H   -4.125   3.355   2.034 1.00 . A A .  20 LYS HD3  1 1 
       15  8957 1 1 20 LYS HE2  H   -3.570   1.192   2.720 1.00 . A A .  20 LYS HE2  1 1 
       15  8958 1 1 20 LYS HE3  H   -1.861   1.415   2.351 1.00 . A A .  20 LYS HE3  1 1 
       15  8959 1 1 20 LYS HG2  H   -1.954   2.252   0.273 1.00 . A A .  20 LYS HG2  1 1 
       15  8960 1 1 20 LYS HG3  H   -2.872   3.695  -0.161 1.00 . A A .  20 LYS HG3  1 1 
       15  8961 1 1 20 LYS HZ1  H   -2.615   3.319   4.263 1.00 . A A .  20 LYS HZ1  1 1 
       15  8962 1 1 20 LYS HZ2  H   -1.526   2.035   4.434 1.00 . A A .  20 LYS HZ2  1 1 
       15  8963 1 1 20 LYS HZ3  H   -3.164   1.808   4.791 1.00 . A A .  20 LYS HZ3  1 1 
       15  8964 1 1 20 LYS N    N   -6.410   1.688  -0.616 1.00 . A A .  20 LYS N    1 1 
       15  8965 1 1 20 LYS NZ   N   -2.496   2.291   4.157 1.00 . A A .  20 LYS NZ   1 1 
       15  8966 1 1 20 LYS O    O   -5.661   3.512  -2.504 1.00 . A A .  20 LYS O    1 1 
       15  8967 1 1 21 ALA C    C   -3.015   6.439  -1.933 1.00 . A A .  21 ALA C    1 1 
       15  8968 1 1 21 ALA CA   C   -4.457   5.943  -1.939 1.00 . A A .  21 ALA CA   1 1 
       15  8969 1 1 21 ALA CB   C   -5.410   7.080  -1.601 1.00 . A A .  21 ALA CB   1 1 
       15  8970 1 1 21 ALA H    H   -4.311   4.934  -0.084 1.00 . A A .  21 ALA H    1 1 
       15  8971 1 1 21 ALA HA   H   -4.700   5.585  -2.929 1.00 . A A .  21 ALA HA   1 1 
       15  8972 1 1 21 ALA HB1  H   -4.900   7.807  -0.986 1.00 . A A .  21 ALA HB1  1 1 
       15  8973 1 1 21 ALA HB2  H   -5.744   7.552  -2.514 1.00 . A A .  21 ALA HB2  1 1 
       15  8974 1 1 21 ALA HB3  H   -6.262   6.689  -1.065 1.00 . A A .  21 ALA HB3  1 1 
       15  8975 1 1 21 ALA N    N   -4.636   4.839  -1.004 1.00 . A A .  21 ALA N    1 1 
       15  8976 1 1 21 ALA O    O   -2.437   6.686  -0.874 1.00 . A A .  21 ALA O    1 1 
       15  8977 1 1 22 PHE C    C   -0.993   8.301  -4.121 1.00 . A A .  22 PHE C    1 1 
       15  8978 1 1 22 PHE CA   C   -1.063   7.048  -3.253 1.00 . A A .  22 PHE CA   1 1 
       15  8979 1 1 22 PHE CB   C   -0.186   5.948  -3.854 1.00 . A A .  22 PHE CB   1 1 
       15  8980 1 1 22 PHE CD1  C   -1.704   3.957  -3.699 1.00 . A A .  22 PHE CD1  1 1 
       15  8981 1 1 22 PHE CD2  C    0.365   3.899  -2.514 1.00 . A A .  22 PHE CD2  1 1 
       15  8982 1 1 22 PHE CE1  C   -2.010   2.692  -3.231 1.00 . A A .  22 PHE CE1  1 1 
       15  8983 1 1 22 PHE CE2  C    0.065   2.634  -2.044 1.00 . A A .  22 PHE CE2  1 1 
       15  8984 1 1 22 PHE CG   C   -0.515   4.574  -3.345 1.00 . A A .  22 PHE CG   1 1 
       15  8985 1 1 22 PHE CZ   C   -1.124   2.030  -2.404 1.00 . A A .  22 PHE CZ   1 1 
       15  8986 1 1 22 PHE H    H   -2.951   6.370  -3.930 1.00 . A A .  22 PHE H    1 1 
       15  8987 1 1 22 PHE HA   H   -0.700   7.288  -2.266 1.00 . A A .  22 PHE HA   1 1 
       15  8988 1 1 22 PHE HB2  H   -0.311   5.943  -4.926 1.00 . A A .  22 PHE HB2  1 1 
       15  8989 1 1 22 PHE HB3  H    0.847   6.153  -3.617 1.00 . A A .  22 PHE HB3  1 1 
       15  8990 1 1 22 PHE HD1  H   -2.397   4.473  -4.346 1.00 . A A .  22 PHE HD1  1 1 
       15  8991 1 1 22 PHE HD2  H    1.295   4.371  -2.232 1.00 . A A .  22 PHE HD2  1 1 
       15  8992 1 1 22 PHE HE1  H   -2.939   2.222  -3.514 1.00 . A A .  22 PHE HE1  1 1 
       15  8993 1 1 22 PHE HE2  H    0.760   2.120  -1.398 1.00 . A A .  22 PHE HE2  1 1 
       15  8994 1 1 22 PHE HZ   H   -1.360   1.042  -2.038 1.00 . A A .  22 PHE HZ   1 1 
       15  8995 1 1 22 PHE N    N   -2.439   6.583  -3.121 1.00 . A A .  22 PHE N    1 1 
       15  8996 1 1 22 PHE O    O   -1.951   8.643  -4.815 1.00 . A A .  22 PHE O    1 1 
       15  8997 1 1 23 ARG C    C    0.925   9.876  -6.228 1.00 . A A .  23 ARG C    1 1 
       15  8998 1 1 23 ARG CA   C    0.342  10.199  -4.855 1.00 . A A .  23 ARG CA   1 1 
       15  8999 1 1 23 ARG CB   C    1.266  11.165  -4.111 1.00 . A A .  23 ARG CB   1 1 
       15  9000 1 1 23 ARG CD   C    2.016  13.535  -3.746 1.00 . A A .  23 ARG CD   1 1 
       15  9001 1 1 23 ARG CG   C    1.117  12.611  -4.553 1.00 . A A .  23 ARG CG   1 1 
       15  9002 1 1 23 ARG CZ   C    2.095  12.663  -1.449 1.00 . A A .  23 ARG CZ   1 1 
       15  9003 1 1 23 ARG H    H    0.874   8.660  -3.503 1.00 . A A .  23 ARG H    1 1 
       15  9004 1 1 23 ARG HA   H   -0.622  10.667  -4.988 1.00 . A A .  23 ARG HA   1 1 
       15  9005 1 1 23 ARG HB2  H    1.049  11.110  -3.055 1.00 . A A .  23 ARG HB2  1 1 
       15  9006 1 1 23 ARG HB3  H    2.289  10.864  -4.277 1.00 . A A .  23 ARG HB3  1 1 
       15  9007 1 1 23 ARG HD2  H    3.037  13.197  -3.842 1.00 . A A .  23 ARG HD2  1 1 
       15  9008 1 1 23 ARG HD3  H    1.930  14.536  -4.143 1.00 . A A .  23 ARG HD3  1 1 
       15  9009 1 1 23 ARG HE   H    1.053  14.263  -2.025 1.00 . A A .  23 ARG HE   1 1 
       15  9010 1 1 23 ARG HG2  H    1.385  12.689  -5.597 1.00 . A A .  23 ARG HG2  1 1 
       15  9011 1 1 23 ARG HG3  H    0.090  12.915  -4.419 1.00 . A A .  23 ARG HG3  1 1 
       15  9012 1 1 23 ARG HH11 H    3.194  11.627  -2.791 1.00 . A A .  23 ARG HH11 1 1 
       15  9013 1 1 23 ARG HH12 H    3.241  11.022  -1.168 1.00 . A A .  23 ARG HH12 1 1 
       15  9014 1 1 23 ARG HH21 H    1.106  13.476   0.115 1.00 . A A .  23 ARG HH21 1 1 
       15  9015 1 1 23 ARG HH22 H    2.053  12.074   0.484 1.00 . A A .  23 ARG HH22 1 1 
       15  9016 1 1 23 ARG N    N    0.147   8.983  -4.075 1.00 . A A .  23 ARG N    1 1 
       15  9017 1 1 23 ARG NE   N    1.654  13.552  -2.331 1.00 . A A .  23 ARG NE   1 1 
       15  9018 1 1 23 ARG NH1  N    2.910  11.690  -1.834 1.00 . A A .  23 ARG NH1  1 1 
       15  9019 1 1 23 ARG NH2  N    1.721  12.744  -0.179 1.00 . A A .  23 ARG NH2  1 1 
       15  9020 1 1 23 ARG O    O    0.671  10.584  -7.203 1.00 . A A .  23 ARG O    1 1 
       15  9021 1 1 24 ALA C    C    2.367   6.867  -7.661 1.00 . A A .  24 ALA C    1 1 
       15  9022 1 1 24 ALA CA   C    2.324   8.387  -7.549 1.00 . A A .  24 ALA CA   1 1 
       15  9023 1 1 24 ALA CB   C    3.727   8.966  -7.665 1.00 . A A .  24 ALA CB   1 1 
       15  9024 1 1 24 ALA H    H    1.871   8.280  -5.485 1.00 . A A .  24 ALA H    1 1 
       15  9025 1 1 24 ALA HA   H    1.730   8.782  -8.361 1.00 . A A .  24 ALA HA   1 1 
       15  9026 1 1 24 ALA HB1  H    4.062   8.893  -8.688 1.00 . A A .  24 ALA HB1  1 1 
       15  9027 1 1 24 ALA HB2  H    3.713  10.003  -7.363 1.00 . A A .  24 ALA HB2  1 1 
       15  9028 1 1 24 ALA HB3  H    4.398   8.413  -7.025 1.00 . A A .  24 ALA HB3  1 1 
       15  9029 1 1 24 ALA N    N    1.707   8.804  -6.296 1.00 . A A .  24 ALA N    1 1 
       15  9030 1 1 24 ALA O    O    1.921   6.156  -6.760 1.00 . A A .  24 ALA O    1 1 
       15  9031 1 1 25 ARG C    C    3.972   4.295  -8.016 1.00 . A A .  25 ARG C    1 1 
       15  9032 1 1 25 ARG CA   C    3.002   4.939  -9.003 1.00 . A A .  25 ARG CA   1 1 
       15  9033 1 1 25 ARG CB   C    3.458   4.660 -10.436 1.00 . A A .  25 ARG CB   1 1 
       15  9034 1 1 25 ARG CD   C    3.063   5.398 -12.806 1.00 . A A .  25 ARG CD   1 1 
       15  9035 1 1 25 ARG CG   C    2.415   5.011 -11.486 1.00 . A A .  25 ARG CG   1 1 
       15  9036 1 1 25 ARG CZ   C    4.484   7.195 -13.697 1.00 . A A .  25 ARG CZ   1 1 
       15  9037 1 1 25 ARG H    H    3.242   6.992  -9.455 1.00 . A A .  25 ARG H    1 1 
       15  9038 1 1 25 ARG HA   H    2.022   4.511  -8.857 1.00 . A A .  25 ARG HA   1 1 
       15  9039 1 1 25 ARG HB2  H    4.348   5.238 -10.638 1.00 . A A .  25 ARG HB2  1 1 
       15  9040 1 1 25 ARG HB3  H    3.692   3.610 -10.529 1.00 . A A .  25 ARG HB3  1 1 
       15  9041 1 1 25 ARG HD2  H    3.807   4.657 -13.058 1.00 . A A .  25 ARG HD2  1 1 
       15  9042 1 1 25 ARG HD3  H    2.302   5.418 -13.572 1.00 . A A .  25 ARG HD3  1 1 
       15  9043 1 1 25 ARG HE   H    3.542   7.252 -11.940 1.00 . A A .  25 ARG HE   1 1 
       15  9044 1 1 25 ARG HG2  H    1.778   4.154 -11.647 1.00 . A A .  25 ARG HG2  1 1 
       15  9045 1 1 25 ARG HG3  H    1.823   5.840 -11.128 1.00 . A A .  25 ARG HG3  1 1 
       15  9046 1 1 25 ARG HH11 H    4.309   5.578 -14.894 1.00 . A A .  25 ARG HH11 1 1 
       15  9047 1 1 25 ARG HH12 H    5.308   6.852 -15.510 1.00 . A A .  25 ARG HH12 1 1 
       15  9048 1 1 25 ARG HH21 H    4.855   8.937 -12.740 1.00 . A A .  25 ARG HH21 1 1 
       15  9049 1 1 25 ARG HH22 H    5.619   8.762 -14.283 1.00 . A A .  25 ARG HH22 1 1 
       15  9050 1 1 25 ARG N    N    2.904   6.375  -8.773 1.00 . A A .  25 ARG N    1 1 
       15  9051 1 1 25 ARG NE   N    3.703   6.709 -12.739 1.00 . A A .  25 ARG NE   1 1 
       15  9052 1 1 25 ARG NH1  N    4.720   6.483 -14.790 1.00 . A A .  25 ARG NH1  1 1 
       15  9053 1 1 25 ARG NH2  N    5.031   8.397 -13.562 1.00 . A A .  25 ARG NH2  1 1 
       15  9054 1 1 25 ARG O    O    3.613   3.362  -7.297 1.00 . A A .  25 ARG O    1 1 
       15  9055 1 1 26 SER C    C    5.639   3.976  -5.713 1.00 . A A .  26 SER C    1 1 
       15  9056 1 1 26 SER CA   C    6.223   4.271  -7.091 1.00 . A A .  26 SER CA   1 1 
       15  9057 1 1 26 SER CB   C    7.382   5.262  -6.965 1.00 . A A .  26 SER CB   1 1 
       15  9058 1 1 26 SER H    H    5.426   5.544  -8.584 1.00 . A A .  26 SER H    1 1 
       15  9059 1 1 26 SER HA   H    6.593   3.351  -7.517 1.00 . A A .  26 SER HA   1 1 
       15  9060 1 1 26 SER HB2  H    7.689   5.581  -7.949 1.00 . A A .  26 SER HB2  1 1 
       15  9061 1 1 26 SER HB3  H    7.058   6.120  -6.393 1.00 . A A .  26 SER HB3  1 1 
       15  9062 1 1 26 SER HG   H    8.629   5.098  -5.463 1.00 . A A .  26 SER HG   1 1 
       15  9063 1 1 26 SER N    N    5.201   4.800  -7.987 1.00 . A A .  26 SER N    1 1 
       15  9064 1 1 26 SER O    O    5.967   2.966  -5.091 1.00 . A A .  26 SER O    1 1 
       15  9065 1 1 26 SER OG   O    8.491   4.670  -6.311 1.00 . A A .  26 SER OG   1 1 
       15  9066 1 1 27 SER C    C    3.105   3.587  -3.967 1.00 . A A .  27 SER C    1 1 
       15  9067 1 1 27 SER CA   C    4.143   4.705  -3.937 1.00 . A A .  27 SER CA   1 1 
       15  9068 1 1 27 SER CB   C    3.485   6.015  -3.498 1.00 . A A .  27 SER CB   1 1 
       15  9069 1 1 27 SER H    H    4.550   5.652  -5.786 1.00 . A A .  27 SER H    1 1 
       15  9070 1 1 27 SER HA   H    4.914   4.445  -3.228 1.00 . A A .  27 SER HA   1 1 
       15  9071 1 1 27 SER HB2  H    2.869   6.391  -4.301 1.00 . A A .  27 SER HB2  1 1 
       15  9072 1 1 27 SER HB3  H    2.871   5.832  -2.628 1.00 . A A .  27 SER HB3  1 1 
       15  9073 1 1 27 SER HG   H    4.796   7.388  -3.980 1.00 . A A .  27 SER HG   1 1 
       15  9074 1 1 27 SER N    N    4.771   4.866  -5.243 1.00 . A A .  27 SER N    1 1 
       15  9075 1 1 27 SER O    O    2.887   2.899  -2.969 1.00 . A A .  27 SER O    1 1 
       15  9076 1 1 27 SER OG   O    4.459   6.991  -3.174 1.00 . A A .  27 SER OG   1 1 
       15  9077 1 1 28 LEU C    C    2.094   0.996  -5.389 1.00 . A A .  28 LEU C    1 1 
       15  9078 1 1 28 LEU CA   C    1.453   2.376  -5.283 1.00 . A A .  28 LEU CA   1 1 
       15  9079 1 1 28 LEU CB   C    0.607   2.655  -6.526 1.00 . A A .  28 LEU CB   1 1 
       15  9080 1 1 28 LEU CD1  C   -1.612   1.574  -6.095 1.00 . A A .  28 LEU CD1  1 1 
       15  9081 1 1 28 LEU CD2  C   -0.704   1.672  -8.423 1.00 . A A .  28 LEU CD2  1 1 
       15  9082 1 1 28 LEU CG   C   -0.354   1.543  -6.948 1.00 . A A .  28 LEU CG   1 1 
       15  9083 1 1 28 LEU H    H    2.685   3.990  -5.880 1.00 . A A .  28 LEU H    1 1 
       15  9084 1 1 28 LEU HA   H    0.816   2.398  -4.412 1.00 . A A .  28 LEU HA   1 1 
       15  9085 1 1 28 LEU HB2  H    0.023   3.543  -6.336 1.00 . A A .  28 LEU HB2  1 1 
       15  9086 1 1 28 LEU HB3  H    1.282   2.841  -7.350 1.00 . A A .  28 LEU HB3  1 1 
       15  9087 1 1 28 LEU HD11 H   -2.406   1.050  -6.606 1.00 . A A .  28 LEU HD11 1 1 
       15  9088 1 1 28 LEU HD12 H   -1.908   2.599  -5.926 1.00 . A A .  28 LEU HD12 1 1 
       15  9089 1 1 28 LEU HD13 H   -1.416   1.095  -5.147 1.00 . A A .  28 LEU HD13 1 1 
       15  9090 1 1 28 LEU HD21 H    0.118   1.309  -9.022 1.00 . A A .  28 LEU HD21 1 1 
       15  9091 1 1 28 LEU HD22 H   -0.890   2.709  -8.659 1.00 . A A .  28 LEU HD22 1 1 
       15  9092 1 1 28 LEU HD23 H   -1.589   1.090  -8.635 1.00 . A A .  28 LEU HD23 1 1 
       15  9093 1 1 28 LEU HG   H    0.126   0.586  -6.800 1.00 . A A .  28 LEU HG   1 1 
       15  9094 1 1 28 LEU N    N    2.469   3.411  -5.120 1.00 . A A .  28 LEU N    1 1 
       15  9095 1 1 28 LEU O    O    1.595   0.024  -4.824 1.00 . A A .  28 LEU O    1 1 
       15  9096 1 1 29 ALA C    C    4.322  -0.935  -4.949 1.00 . A A .  29 ALA C    1 1 
       15  9097 1 1 29 ALA CA   C    3.916  -0.340  -6.293 1.00 . A A .  29 ALA CA   1 1 
       15  9098 1 1 29 ALA CB   C    5.140  -0.135  -7.173 1.00 . A A .  29 ALA CB   1 1 
       15  9099 1 1 29 ALA H    H    3.553   1.730  -6.543 1.00 . A A .  29 ALA H    1 1 
       15  9100 1 1 29 ALA HA   H    3.253  -1.030  -6.795 1.00 . A A .  29 ALA HA   1 1 
       15  9101 1 1 29 ALA HB1  H    5.176   0.891  -7.507 1.00 . A A .  29 ALA HB1  1 1 
       15  9102 1 1 29 ALA HB2  H    6.032  -0.361  -6.606 1.00 . A A .  29 ALA HB2  1 1 
       15  9103 1 1 29 ALA HB3  H    5.082  -0.791  -8.029 1.00 . A A .  29 ALA HB3  1 1 
       15  9104 1 1 29 ALA N    N    3.204   0.920  -6.116 1.00 . A A .  29 ALA N    1 1 
       15  9105 1 1 29 ALA O    O    3.931  -2.053  -4.611 1.00 . A A .  29 ALA O    1 1 
       15  9106 1 1 30 ILE C    C    4.471  -1.408  -2.151 1.00 . A A .  30 ILE C    1 1 
       15  9107 1 1 30 ILE CA   C    5.565  -0.635  -2.879 1.00 . A A .  30 ILE CA   1 1 
       15  9108 1 1 30 ILE CB   C    6.016   0.546  -2.000 1.00 . A A .  30 ILE CB   1 1 
       15  9109 1 1 30 ILE CD1  C    7.292   2.738  -2.220 1.00 . A A .  30 ILE CD1  1 1 
       15  9110 1 1 30 ILE CG1  C    7.168   1.298  -2.669 1.00 . A A .  30 ILE CG1  1 1 
       15  9111 1 1 30 ILE CG2  C    6.428   0.053  -0.621 1.00 . A A .  30 ILE CG2  1 1 
       15  9112 1 1 30 ILE H    H    5.385   0.700  -4.511 1.00 . A A .  30 ILE H    1 1 
       15  9113 1 1 30 ILE HA   H    6.412  -1.288  -3.031 1.00 . A A .  30 ILE HA   1 1 
       15  9114 1 1 30 ILE HB   H    5.179   1.217  -1.880 1.00 . A A .  30 ILE HB   1 1 
       15  9115 1 1 30 ILE HD11 H    7.212   3.390  -3.078 1.00 . A A .  30 ILE HD11 1 1 
       15  9116 1 1 30 ILE HD12 H    6.501   2.966  -1.521 1.00 . A A .  30 ILE HD12 1 1 
       15  9117 1 1 30 ILE HD13 H    8.249   2.886  -1.743 1.00 . A A .  30 ILE HD13 1 1 
       15  9118 1 1 30 ILE HG12 H    8.096   0.799  -2.441 1.00 . A A .  30 ILE HG12 1 1 
       15  9119 1 1 30 ILE HG13 H    7.016   1.296  -3.739 1.00 . A A .  30 ILE HG13 1 1 
       15  9120 1 1 30 ILE HG21 H    6.112  -0.972  -0.496 1.00 . A A .  30 ILE HG21 1 1 
       15  9121 1 1 30 ILE HG22 H    7.502   0.112  -0.524 1.00 . A A .  30 ILE HG22 1 1 
       15  9122 1 1 30 ILE HG23 H    5.964   0.667   0.135 1.00 . A A .  30 ILE HG23 1 1 
       15  9123 1 1 30 ILE N    N    5.107  -0.181  -4.187 1.00 . A A .  30 ILE N    1 1 
       15  9124 1 1 30 ILE O    O    4.743  -2.395  -1.468 1.00 . A A .  30 ILE O    1 1 
       15  9125 1 1 31 HIS C    C    1.638  -2.818  -2.467 1.00 . A A .  31 HIS C    1 1 
       15  9126 1 1 31 HIS CA   C    2.093  -1.603  -1.663 1.00 . A A .  31 HIS CA   1 1 
       15  9127 1 1 31 HIS CB   C    0.936  -0.617  -1.508 1.00 . A A .  31 HIS CB   1 1 
       15  9128 1 1 31 HIS CD2  C   -1.432  -1.288  -2.326 1.00 . A A .  31 HIS CD2  1 1 
       15  9129 1 1 31 HIS CE1  C   -2.045  -2.479  -0.590 1.00 . A A .  31 HIS CE1  1 1 
       15  9130 1 1 31 HIS CG   C   -0.408  -1.275  -1.441 1.00 . A A .  31 HIS CG   1 1 
       15  9131 1 1 31 HIS H    H    3.078  -0.162  -2.861 1.00 . A A .  31 HIS H    1 1 
       15  9132 1 1 31 HIS HA   H    2.408  -1.933  -0.685 1.00 . A A .  31 HIS HA   1 1 
       15  9133 1 1 31 HIS HB2  H    1.073  -0.052  -0.597 1.00 . A A .  31 HIS HB2  1 1 
       15  9134 1 1 31 HIS HB3  H    0.933   0.061  -2.349 1.00 . A A .  31 HIS HB3  1 1 
       15  9135 1 1 31 HIS HD1  H   -0.301  -2.209   0.445 1.00 . A A .  31 HIS HD1  1 1 
       15  9136 1 1 31 HIS HD2  H   -1.455  -0.797  -3.288 1.00 . A A .  31 HIS HD2  1 1 
       15  9137 1 1 31 HIS HE1  H   -2.625  -3.097   0.079 1.00 . A A .  31 HIS HE1  1 1 
       15  9138 1 1 31 HIS N    N    3.231  -0.953  -2.304 1.00 . A A .  31 HIS N    1 1 
       15  9139 1 1 31 HIS ND1  N   -0.824  -2.029  -0.364 1.00 . A A .  31 HIS ND1  1 1 
       15  9140 1 1 31 HIS NE2  N   -2.437  -2.043  -1.773 1.00 . A A .  31 HIS NE2  1 1 
       15  9141 1 1 31 HIS O    O    1.335  -3.868  -1.902 1.00 . A A .  31 HIS O    1 1 
       15  9142 1 1 32 GLN C    C    2.019  -4.996  -4.436 1.00 . A A .  32 GLN C    1 1 
       15  9143 1 1 32 GLN CA   C    1.172  -3.748  -4.667 1.00 . A A .  32 GLN CA   1 1 
       15  9144 1 1 32 GLN CB   C    1.272  -3.313  -6.130 1.00 . A A .  32 GLN CB   1 1 
       15  9145 1 1 32 GLN CD   C   -1.196  -2.807  -6.320 1.00 . A A .  32 GLN CD   1 1 
       15  9146 1 1 32 GLN CG   C    0.215  -2.298  -6.535 1.00 . A A .  32 GLN CG   1 1 
       15  9147 1 1 32 GLN H    H    1.847  -1.803  -4.177 1.00 . A A .  32 GLN H    1 1 
       15  9148 1 1 32 GLN HA   H    0.143  -3.980  -4.439 1.00 . A A .  32 GLN HA   1 1 
       15  9149 1 1 32 GLN HB2  H    2.244  -2.876  -6.298 1.00 . A A .  32 GLN HB2  1 1 
       15  9150 1 1 32 GLN HB3  H    1.164  -4.184  -6.760 1.00 . A A .  32 GLN HB3  1 1 
       15  9151 1 1 32 GLN HE21 H   -1.774  -1.012  -5.688 1.00 . A A .  32 GLN HE21 1 1 
       15  9152 1 1 32 GLN HE22 H   -2.999  -2.230  -5.712 1.00 . A A .  32 GLN HE22 1 1 
       15  9153 1 1 32 GLN HG2  H    0.351  -1.402  -5.948 1.00 . A A .  32 GLN HG2  1 1 
       15  9154 1 1 32 GLN HG3  H    0.343  -2.064  -7.582 1.00 . A A .  32 GLN HG3  1 1 
       15  9155 1 1 32 GLN N    N    1.593  -2.665  -3.786 1.00 . A A .  32 GLN N    1 1 
       15  9156 1 1 32 GLN NE2  N   -2.079  -1.928  -5.860 1.00 . A A .  32 GLN NE2  1 1 
       15  9157 1 1 32 GLN O    O    1.627  -6.102  -4.807 1.00 . A A .  32 GLN O    1 1 
       15  9158 1 1 32 GLN OE1  O   -1.491  -3.977  -6.565 1.00 . A A .  32 GLN OE1  1 1 
       15  9159 1 1 33 ALA C    C    3.662  -6.664  -2.279 1.00 . A A .  33 ALA C    1 1 
       15  9160 1 1 33 ALA CA   C    4.085  -5.920  -3.541 1.00 . A A .  33 ALA CA   1 1 
       15  9161 1 1 33 ALA CB   C    5.515  -5.418  -3.407 1.00 . A A .  33 ALA CB   1 1 
       15  9162 1 1 33 ALA H    H    3.441  -3.904  -3.551 1.00 . A A .  33 ALA H    1 1 
       15  9163 1 1 33 ALA HA   H    4.046  -6.602  -4.379 1.00 . A A .  33 ALA HA   1 1 
       15  9164 1 1 33 ALA HB1  H    5.766  -4.815  -4.266 1.00 . A A .  33 ALA HB1  1 1 
       15  9165 1 1 33 ALA HB2  H    5.603  -4.822  -2.510 1.00 . A A .  33 ALA HB2  1 1 
       15  9166 1 1 33 ALA HB3  H    6.188  -6.260  -3.348 1.00 . A A .  33 ALA HB3  1 1 
       15  9167 1 1 33 ALA N    N    3.183  -4.810  -3.822 1.00 . A A .  33 ALA N    1 1 
       15  9168 1 1 33 ALA O    O    4.380  -7.538  -1.791 1.00 . A A .  33 ALA O    1 1 
       15  9169 1 1 34 THR C    C    0.769  -7.823  -0.860 1.00 . A A .  34 THR C    1 1 
       15  9170 1 1 34 THR CA   C    1.976  -6.946  -0.547 1.00 . A A .  34 THR CA   1 1 
       15  9171 1 1 34 THR CB   C    1.574  -5.899   0.509 1.00 . A A .  34 THR CB   1 1 
       15  9172 1 1 34 THR CG2  C    2.748  -4.991   0.845 1.00 . A A .  34 THR CG2  1 1 
       15  9173 1 1 34 THR H    H    1.966  -5.610  -2.189 1.00 . A A .  34 THR H    1 1 
       15  9174 1 1 34 THR HA   H    2.759  -7.563  -0.132 1.00 . A A .  34 THR HA   1 1 
       15  9175 1 1 34 THR HB   H    1.269  -6.415   1.408 1.00 . A A .  34 THR HB   1 1 
       15  9176 1 1 34 THR HG1  H    0.364  -4.343   0.591 1.00 . A A .  34 THR HG1  1 1 
       15  9177 1 1 34 THR HG21 H    3.142  -4.562  -0.064 1.00 . A A .  34 THR HG21 1 1 
       15  9178 1 1 34 THR HG22 H    3.520  -5.566   1.334 1.00 . A A .  34 THR HG22 1 1 
       15  9179 1 1 34 THR HG23 H    2.416  -4.201   1.502 1.00 . A A .  34 THR HG23 1 1 
       15  9180 1 1 34 THR N    N    2.493  -6.313  -1.754 1.00 . A A .  34 THR N    1 1 
       15  9181 1 1 34 THR O    O    0.555  -8.853  -0.220 1.00 . A A .  34 THR O    1 1 
       15  9182 1 1 34 THR OG1  O    0.479  -5.112   0.027 1.00 . A A .  34 THR OG1  1 1 
       15  9183 1 1 35 HIS C    C   -0.815  -9.517  -2.832 1.00 . A A .  35 HIS C    1 1 
       15  9184 1 1 35 HIS CA   C   -1.202  -8.161  -2.249 1.00 . A A .  35 HIS CA   1 1 
       15  9185 1 1 35 HIS CB   C   -2.014  -7.366  -3.272 1.00 . A A .  35 HIS CB   1 1 
       15  9186 1 1 35 HIS CD2  C   -2.941  -5.016  -2.685 1.00 . A A .  35 HIS CD2  1 1 
       15  9187 1 1 35 HIS CE1  C   -4.666  -5.643  -1.486 1.00 . A A .  35 HIS CE1  1 1 
       15  9188 1 1 35 HIS CG   C   -2.945  -6.369  -2.654 1.00 . A A .  35 HIS CG   1 1 
       15  9189 1 1 35 HIS H    H    0.207  -6.582  -2.323 1.00 . A A .  35 HIS H    1 1 
       15  9190 1 1 35 HIS HA   H   -1.805  -8.320  -1.369 1.00 . A A .  35 HIS HA   1 1 
       15  9191 1 1 35 HIS HB2  H   -1.337  -6.829  -3.921 1.00 . A A .  35 HIS HB2  1 1 
       15  9192 1 1 35 HIS HB3  H   -2.604  -8.050  -3.864 1.00 . A A .  35 HIS HB3  1 1 
       15  9193 1 1 35 HIS HD1  H   -4.311  -7.648  -1.686 1.00 . A A .  35 HIS HD1  1 1 
       15  9194 1 1 35 HIS HD2  H   -2.223  -4.388  -3.193 1.00 . A A .  35 HIS HD2  1 1 
       15  9195 1 1 35 HIS HE1  H   -5.556  -5.619  -0.874 1.00 . A A .  35 HIS HE1  1 1 
       15  9196 1 1 35 HIS N    N   -0.016  -7.410  -1.850 1.00 . A A .  35 HIS N    1 1 
       15  9197 1 1 35 HIS ND1  N   -4.037  -6.731  -1.894 1.00 . A A .  35 HIS ND1  1 1 
       15  9198 1 1 35 HIS NE2  N   -4.021  -4.589  -1.952 1.00 . A A .  35 HIS NE2  1 1 
       15  9199 1 1 35 HIS O    O   -0.856  -9.716  -4.046 1.00 . A A .  35 HIS O    1 1 
       15  9200 1 1 36 SER C    C   -1.254 -12.591  -2.838 1.00 . A A .  36 SER C    1 1 
       15  9201 1 1 36 SER CA   C   -0.042 -11.782  -2.386 1.00 . A A .  36 SER CA   1 1 
       15  9202 1 1 36 SER CB   C    0.677 -12.511  -1.250 1.00 . A A .  36 SER CB   1 1 
       15  9203 1 1 36 SER H    H   -0.429 -10.226  -1.003 1.00 . A A .  36 SER H    1 1 
       15  9204 1 1 36 SER HA   H    0.636 -11.675  -3.220 1.00 . A A .  36 SER HA   1 1 
       15  9205 1 1 36 SER HB2  H    0.109 -12.402  -0.339 1.00 . A A .  36 SER HB2  1 1 
       15  9206 1 1 36 SER HB3  H    0.764 -13.559  -1.497 1.00 . A A .  36 SER HB3  1 1 
       15  9207 1 1 36 SER HG   H    2.370 -12.389  -0.270 1.00 . A A .  36 SER HG   1 1 
       15  9208 1 1 36 SER N    N   -0.440 -10.446  -1.958 1.00 . A A .  36 SER N    1 1 
       15  9209 1 1 36 SER O    O   -1.966 -13.173  -2.021 1.00 . A A .  36 SER O    1 1 
       15  9210 1 1 36 SER OG   O    1.976 -11.981  -1.045 1.00 . A A .  36 SER OG   1 1 
       15  9211 1 1 37 GLY C    C   -2.583 -14.825  -4.292 1.00 . A A .  37 GLY C    1 1 
       15  9212 1 1 37 GLY CA   C   -2.608 -13.362  -4.687 1.00 . A A .  37 GLY CA   1 1 
       15  9213 1 1 37 GLY H    H   -0.881 -12.139  -4.752 1.00 . A A .  37 GLY H    1 1 
       15  9214 1 1 37 GLY HA2  H   -3.523 -12.918  -4.325 1.00 . A A .  37 GLY HA2  1 1 
       15  9215 1 1 37 GLY HA3  H   -2.587 -13.292  -5.765 1.00 . A A .  37 GLY HA3  1 1 
       15  9216 1 1 37 GLY N    N   -1.482 -12.622  -4.147 1.00 . A A .  37 GLY N    1 1 
       15  9217 1 1 37 GLY O    O   -3.549 -15.338  -3.728 1.00 . A A .  37 GLY O    1 1 
       15  9218 1 1 38 GLU C    C   -1.358 -17.128  -2.755 1.00 . A A .  38 GLU C    1 1 
       15  9219 1 1 38 GLU CA   C   -1.332 -16.912  -4.265 1.00 . A A .  38 GLU CA   1 1 
       15  9220 1 1 38 GLU CB   C   -0.028 -17.462  -4.848 1.00 . A A .  38 GLU CB   1 1 
       15  9221 1 1 38 GLU CD   C    1.338 -19.528  -5.344 1.00 . A A .  38 GLU CD   1 1 
       15  9222 1 1 38 GLU CG   C   -0.041 -18.967  -5.056 1.00 . A A .  38 GLU CG   1 1 
       15  9223 1 1 38 GLU H    H   -0.741 -15.034  -5.041 1.00 . A A .  38 GLU H    1 1 
       15  9224 1 1 38 GLU HA   H   -2.163 -17.441  -4.707 1.00 . A A .  38 GLU HA   1 1 
       15  9225 1 1 38 GLU HB2  H    0.155 -16.988  -5.801 1.00 . A A .  38 GLU HB2  1 1 
       15  9226 1 1 38 GLU HB3  H    0.782 -17.221  -4.175 1.00 . A A .  38 GLU HB3  1 1 
       15  9227 1 1 38 GLU HG2  H   -0.426 -19.438  -4.164 1.00 . A A .  38 GLU HG2  1 1 
       15  9228 1 1 38 GLU HG3  H   -0.688 -19.196  -5.891 1.00 . A A .  38 GLU HG3  1 1 
       15  9229 1 1 38 GLU N    N   -1.477 -15.498  -4.591 1.00 . A A .  38 GLU N    1 1 
       15  9230 1 1 38 GLU O    O   -0.428 -16.746  -2.045 1.00 . A A .  38 GLU O    1 1 
       15  9231 1 1 38 GLU OE1  O    2.321 -19.002  -4.782 1.00 . A A .  38 GLU OE1  1 1 
       15  9232 1 1 38 GLU OE2  O    1.434 -20.493  -6.130 1.00 . A A .  38 GLU OE2  1 1 
       15  9233 1 1 39 LYS C    C   -2.611 -19.513  -0.574 1.00 . A A .  39 LYS C    1 1 
       15  9234 1 1 39 LYS CA   C   -2.581 -18.012  -0.845 1.00 . A A .  39 LYS CA   1 1 
       15  9235 1 1 39 LYS CB   C   -3.861 -17.362  -0.314 1.00 . A A .  39 LYS CB   1 1 
       15  9236 1 1 39 LYS CD   C   -6.279 -16.835  -0.743 1.00 . A A .  39 LYS CD   1 1 
       15  9237 1 1 39 LYS CE   C   -7.596 -17.429  -1.219 1.00 . A A .  39 LYS CE   1 1 
       15  9238 1 1 39 LYS CG   C   -5.102 -17.723  -1.111 1.00 . A A .  39 LYS CG   1 1 
       15  9239 1 1 39 LYS H    H   -3.140 -18.025  -2.886 1.00 . A A .  39 LYS H    1 1 
       15  9240 1 1 39 LYS HA   H   -1.732 -17.583  -0.335 1.00 . A A .  39 LYS HA   1 1 
       15  9241 1 1 39 LYS HB2  H   -4.012 -17.675   0.709 1.00 . A A .  39 LYS HB2  1 1 
       15  9242 1 1 39 LYS HB3  H   -3.742 -16.289  -0.339 1.00 . A A .  39 LYS HB3  1 1 
       15  9243 1 1 39 LYS HD2  H   -6.314 -16.726   0.331 1.00 . A A .  39 LYS HD2  1 1 
       15  9244 1 1 39 LYS HD3  H   -6.145 -15.866  -1.202 1.00 . A A .  39 LYS HD3  1 1 
       15  9245 1 1 39 LYS HE2  H   -7.788 -17.086  -2.224 1.00 . A A .  39 LYS HE2  1 1 
       15  9246 1 1 39 LYS HE3  H   -7.512 -18.506  -1.217 1.00 . A A .  39 LYS HE3  1 1 
       15  9247 1 1 39 LYS HG2  H   -4.891 -17.604  -2.163 1.00 . A A .  39 LYS HG2  1 1 
       15  9248 1 1 39 LYS HG3  H   -5.362 -18.753  -0.909 1.00 . A A .  39 LYS HG3  1 1 
       15  9249 1 1 39 LYS HZ1  H   -8.585 -17.387   0.620 1.00 . A A .  39 LYS HZ1  1 1 
       15  9250 1 1 39 LYS HZ2  H   -9.623 -17.421  -0.715 1.00 . A A .  39 LYS HZ2  1 1 
       15  9251 1 1 39 LYS HZ3  H   -8.811 -15.993  -0.312 1.00 . A A .  39 LYS HZ3  1 1 
       15  9252 1 1 39 LYS N    N   -2.431 -17.744  -2.270 1.00 . A A .  39 LYS N    1 1 
       15  9253 1 1 39 LYS NZ   N   -8.733 -17.030  -0.345 1.00 . A A .  39 LYS NZ   1 1 
       15  9254 1 1 39 LYS O    O   -3.645 -20.086  -0.231 1.00 . A A .  39 LYS O    1 1 
       15  9255 1 1 40 PRO C    C   -1.440 -21.980   0.969 1.00 . A A .  40 PRO C    1 1 
       15  9256 1 1 40 PRO CA   C   -1.316 -21.609  -0.504 1.00 . A A .  40 PRO CA   1 1 
       15  9257 1 1 40 PRO CB   C    0.092 -21.919  -1.017 1.00 . A A .  40 PRO CB   1 1 
       15  9258 1 1 40 PRO CD   C   -0.177 -19.547  -1.136 1.00 . A A .  40 PRO CD   1 1 
       15  9259 1 1 40 PRO CG   C    0.833 -20.633  -0.891 1.00 . A A .  40 PRO CG   1 1 
       15  9260 1 1 40 PRO HA   H   -2.041 -22.168  -1.077 1.00 . A A .  40 PRO HA   1 1 
       15  9261 1 1 40 PRO HB2  H    0.537 -22.694  -0.409 1.00 . A A .  40 PRO HB2  1 1 
       15  9262 1 1 40 PRO HB3  H    0.041 -22.246  -2.045 1.00 . A A .  40 PRO HB3  1 1 
       15  9263 1 1 40 PRO HD2  H    0.043 -18.682  -0.527 1.00 . A A .  40 PRO HD2  1 1 
       15  9264 1 1 40 PRO HD3  H   -0.196 -19.279  -2.182 1.00 . A A .  40 PRO HD3  1 1 
       15  9265 1 1 40 PRO HG2  H    1.246 -20.544   0.103 1.00 . A A .  40 PRO HG2  1 1 
       15  9266 1 1 40 PRO HG3  H    1.619 -20.588  -1.631 1.00 . A A .  40 PRO HG3  1 1 
       15  9267 1 1 40 PRO N    N   -1.449 -20.166  -0.729 1.00 . A A .  40 PRO N    1 1 
       15  9268 1 1 40 PRO O    O   -1.585 -21.110   1.828 1.00 . A A .  40 PRO O    1 1 
       15  9269 1 1 41 SER C    C   -0.152 -23.654   3.349 1.00 . A A .  41 SER C    1 1 
       15  9270 1 1 41 SER CA   C   -1.491 -23.762   2.626 1.00 . A A .  41 SER CA   1 1 
       15  9271 1 1 41 SER CB   C   -1.974 -25.214   2.638 1.00 . A A .  41 SER CB   1 1 
       15  9272 1 1 41 SER H    H   -1.265 -23.922   0.527 1.00 . A A .  41 SER H    1 1 
       15  9273 1 1 41 SER HA   H   -2.215 -23.147   3.139 1.00 . A A .  41 SER HA   1 1 
       15  9274 1 1 41 SER HB2  H   -2.860 -25.301   2.029 1.00 . A A .  41 SER HB2  1 1 
       15  9275 1 1 41 SER HB3  H   -1.198 -25.851   2.238 1.00 . A A .  41 SER HB3  1 1 
       15  9276 1 1 41 SER HG   H   -2.956 -26.320   3.922 1.00 . A A .  41 SER HG   1 1 
       15  9277 1 1 41 SER N    N   -1.382 -23.276   1.256 1.00 . A A .  41 SER N    1 1 
       15  9278 1 1 41 SER O    O    0.908 -23.725   2.730 1.00 . A A .  41 SER O    1 1 
       15  9279 1 1 41 SER OG   O   -2.280 -25.639   3.954 1.00 . A A .  41 SER OG   1 1 
       15  9280 1 1 42 GLY C    C    0.938 -22.228   6.455 1.00 . A A .  42 GLY C    1 1 
       15  9281 1 1 42 GLY CA   C    1.004 -23.364   5.453 1.00 . A A .  42 GLY CA   1 1 
       15  9282 1 1 42 GLY H    H   -1.084 -23.430   5.107 1.00 . A A .  42 GLY H    1 1 
       15  9283 1 1 42 GLY HA2  H    1.165 -24.290   5.984 1.00 . A A .  42 GLY HA2  1 1 
       15  9284 1 1 42 GLY HA3  H    1.836 -23.193   4.787 1.00 . A A .  42 GLY HA3  1 1 
       15  9285 1 1 42 GLY N    N   -0.210 -23.480   4.666 1.00 . A A .  42 GLY N    1 1 
       15  9286 1 1 42 GLY O    O    1.432 -21.127   6.211 1.00 . A A .  42 GLY O    1 1 
       15  9287 1 1 43 PRO C    C    1.500 -21.172   9.354 1.00 . A A .  43 PRO C    1 1 
       15  9288 1 1 43 PRO CA   C    0.171 -21.495   8.679 1.00 . A A .  43 PRO CA   1 1 
       15  9289 1 1 43 PRO CB   C   -0.782 -22.169   9.669 1.00 . A A .  43 PRO CB   1 1 
       15  9290 1 1 43 PRO CD   C   -0.297 -23.782   7.973 1.00 . A A .  43 PRO CD   1 1 
       15  9291 1 1 43 PRO CG   C   -0.597 -23.629   9.438 1.00 . A A .  43 PRO CG   1 1 
       15  9292 1 1 43 PRO HA   H   -0.276 -20.582   8.311 1.00 . A A .  43 PRO HA   1 1 
       15  9293 1 1 43 PRO HB2  H   -0.513 -21.890  10.678 1.00 . A A .  43 PRO HB2  1 1 
       15  9294 1 1 43 PRO HB3  H   -1.797 -21.862   9.464 1.00 . A A .  43 PRO HB3  1 1 
       15  9295 1 1 43 PRO HD2  H    0.396 -24.595   7.812 1.00 . A A .  43 PRO HD2  1 1 
       15  9296 1 1 43 PRO HD3  H   -1.208 -23.944   7.416 1.00 . A A .  43 PRO HD3  1 1 
       15  9297 1 1 43 PRO HG2  H    0.229 -23.993  10.030 1.00 . A A .  43 PRO HG2  1 1 
       15  9298 1 1 43 PRO HG3  H   -1.504 -24.158   9.691 1.00 . A A .  43 PRO HG3  1 1 
       15  9299 1 1 43 PRO N    N    0.315 -22.491   7.614 1.00 . A A .  43 PRO N    1 1 
       15  9300 1 1 43 PRO O    O    2.424 -21.984   9.346 1.00 . A A .  43 PRO O    1 1 
       15  9301 1 1 44 SER C    C    2.834 -20.055  12.055 1.00 . A A .  44 SER C    1 1 
       15  9302 1 1 44 SER CA   C    2.804 -19.549  10.616 1.00 . A A .  44 SER CA   1 1 
       15  9303 1 1 44 SER CB   C    2.910 -18.023  10.598 1.00 . A A .  44 SER CB   1 1 
       15  9304 1 1 44 SER H    H    0.815 -19.377   9.911 1.00 . A A .  44 SER H    1 1 
       15  9305 1 1 44 SER HA   H    3.646 -19.966  10.083 1.00 . A A .  44 SER HA   1 1 
       15  9306 1 1 44 SER HB2  H    3.849 -17.725  11.038 1.00 . A A .  44 SER HB2  1 1 
       15  9307 1 1 44 SER HB3  H    2.863 -17.674   9.576 1.00 . A A .  44 SER HB3  1 1 
       15  9308 1 1 44 SER HG   H    2.160 -16.617  11.737 1.00 . A A .  44 SER HG   1 1 
       15  9309 1 1 44 SER N    N    1.587 -19.981   9.939 1.00 . A A .  44 SER N    1 1 
       15  9310 1 1 44 SER O    O    1.794 -20.360  12.639 1.00 . A A .  44 SER O    1 1 
       15  9311 1 1 44 SER OG   O    1.852 -17.430  11.331 1.00 . A A .  44 SER OG   1 1 
       15  9312 1 1 45 SER C    C    3.803 -19.535  14.990 1.00 . A A .  45 SER C    1 1 
       15  9313 1 1 45 SER CA   C    4.201 -20.616  13.989 1.00 . A A .  45 SER CA   1 1 
       15  9314 1 1 45 SER CB   C    5.650 -21.042  14.231 1.00 . A A .  45 SER CB   1 1 
       15  9315 1 1 45 SER H    H    4.825 -19.886  12.102 1.00 . A A .  45 SER H    1 1 
       15  9316 1 1 45 SER HA   H    3.556 -21.471  14.126 1.00 . A A .  45 SER HA   1 1 
       15  9317 1 1 45 SER HB2  H    5.793 -21.245  15.281 1.00 . A A .  45 SER HB2  1 1 
       15  9318 1 1 45 SER HB3  H    5.860 -21.934  13.659 1.00 . A A .  45 SER HB3  1 1 
       15  9319 1 1 45 SER HG   H    7.272 -20.410  13.331 1.00 . A A .  45 SER HG   1 1 
       15  9320 1 1 45 SER N    N    4.034 -20.143  12.620 1.00 . A A .  45 SER N    1 1 
       15  9321 1 1 45 SER O    O    2.946 -19.750  15.845 1.00 . A A .  45 SER O    1 1 
       15  9322 1 1 45 SER OG   O    6.553 -20.023  13.837 1.00 . A A .  45 SER OG   1 1 
       15  9323 1 1 46 GLY C    C    2.647 -16.988  15.868 1.00 . A A .  46 GLY C    1 1 
       15  9324 1 1 46 GLY CA   C    4.133 -17.272  15.775 1.00 . A A .  46 GLY CA   1 1 
       15  9325 1 1 46 GLY H    H    5.109 -18.255  14.173 1.00 . A A .  46 GLY H    1 1 
       15  9326 1 1 46 GLY HA2  H    4.505 -17.515  16.759 1.00 . A A .  46 GLY HA2  1 1 
       15  9327 1 1 46 GLY HA3  H    4.636 -16.383  15.421 1.00 . A A .  46 GLY HA3  1 1 
       15  9328 1 1 46 GLY N    N    4.434 -18.370  14.875 1.00 . A A .  46 GLY N    1 1 
       15  9329 1 1 46 GLY O    O    2.234 -15.861  15.598 1.00 . A A .  46 GLY O    1 1 
       15  9330 2 2  1 ZN  ZN   ZN  -4.227  -2.657  -1.956 1.00 . B A . 201 ZN  ZN   1 1 
       16  9331 1 1  1 GLY C    C  -29.893  17.164   2.921 1.00 . A A .   1 GLY C    1 1 
       16  9332 1 1  1 GLY CA   C  -31.175  16.796   3.640 1.00 . A A .   1 GLY CA   1 1 
       16  9333 1 1  1 GLY H1   H  -32.078  16.014   1.892 1.00 . A A .   1 GLY H1   1 1 
       16  9334 1 1  1 GLY HA2  H  -31.469  17.618   4.275 1.00 . A A .   1 GLY HA2  1 1 
       16  9335 1 1  1 GLY HA3  H  -30.993  15.927   4.255 1.00 . A A .   1 GLY HA3  1 1 
       16  9336 1 1  1 GLY N    N  -32.261  16.500   2.723 1.00 . A A .   1 GLY N    1 1 
       16  9337 1 1  1 GLY O    O  -29.230  16.305   2.340 1.00 . A A .   1 GLY O    1 1 
       16  9338 1 1  2 SER C    C  -27.208  19.130   3.312 1.00 . A A .   2 SER C    1 1 
       16  9339 1 1  2 SER CA   C  -28.333  18.927   2.301 1.00 . A A .   2 SER CA   1 1 
       16  9340 1 1  2 SER CB   C  -28.615  20.238   1.564 1.00 . A A .   2 SER CB   1 1 
       16  9341 1 1  2 SER H    H  -30.112  19.083   3.438 1.00 . A A .   2 SER H    1 1 
       16  9342 1 1  2 SER HA   H  -28.026  18.180   1.584 1.00 . A A .   2 SER HA   1 1 
       16  9343 1 1  2 SER HB2  H  -29.003  20.964   2.262 1.00 . A A .   2 SER HB2  1 1 
       16  9344 1 1  2 SER HB3  H  -27.697  20.609   1.131 1.00 . A A .   2 SER HB3  1 1 
       16  9345 1 1  2 SER HG   H  -30.319  19.565   0.872 1.00 . A A .   2 SER HG   1 1 
       16  9346 1 1  2 SER N    N  -29.542  18.445   2.958 1.00 . A A .   2 SER N    1 1 
       16  9347 1 1  2 SER O    O  -27.376  19.830   4.310 1.00 . A A .   2 SER O    1 1 
       16  9348 1 1  2 SER OG   O  -29.563  20.047   0.529 1.00 . A A .   2 SER OG   1 1 
       16  9349 1 1  3 SER C    C  -23.670  19.059   3.161 1.00 . A A .   3 SER C    1 1 
       16  9350 1 1  3 SER CA   C  -24.910  18.621   3.932 1.00 . A A .   3 SER CA   1 1 
       16  9351 1 1  3 SER CB   C  -24.647  17.283   4.626 1.00 . A A .   3 SER CB   1 1 
       16  9352 1 1  3 SER H    H  -25.991  17.967   2.233 1.00 . A A .   3 SER H    1 1 
       16  9353 1 1  3 SER HA   H  -25.137  19.366   4.680 1.00 . A A .   3 SER HA   1 1 
       16  9354 1 1  3 SER HB2  H  -23.778  17.374   5.260 1.00 . A A .   3 SER HB2  1 1 
       16  9355 1 1  3 SER HB3  H  -25.504  17.017   5.227 1.00 . A A .   3 SER HB3  1 1 
       16  9356 1 1  3 SER HG   H  -24.535  15.399   4.100 1.00 . A A .   3 SER HG   1 1 
       16  9357 1 1  3 SER N    N  -26.062  18.512   3.045 1.00 . A A .   3 SER N    1 1 
       16  9358 1 1  3 SER O    O  -22.941  19.952   3.591 1.00 . A A .   3 SER O    1 1 
       16  9359 1 1  3 SER OG   O  -24.415  16.254   3.680 1.00 . A A .   3 SER OG   1 1 
       16  9360 1 1  4 GLY C    C  -21.433  17.551   0.872 1.00 . A A .   4 GLY C    1 1 
       16  9361 1 1  4 GLY CA   C  -22.284  18.762   1.202 1.00 . A A .   4 GLY CA   1 1 
       16  9362 1 1  4 GLY H    H  -24.052  17.720   1.722 1.00 . A A .   4 GLY H    1 1 
       16  9363 1 1  4 GLY HA2  H  -22.626  19.210   0.281 1.00 . A A .   4 GLY HA2  1 1 
       16  9364 1 1  4 GLY HA3  H  -21.678  19.478   1.736 1.00 . A A .   4 GLY HA3  1 1 
       16  9365 1 1  4 GLY N    N  -23.437  18.424   2.016 1.00 . A A .   4 GLY N    1 1 
       16  9366 1 1  4 GLY O    O  -21.309  16.632   1.681 1.00 . A A .   4 GLY O    1 1 
       16  9367 1 1  5 SER C    C  -18.791  16.287   0.152 1.00 . A A .   5 SER C    1 1 
       16  9368 1 1  5 SER CA   C  -20.006  16.441  -0.758 1.00 . A A .   5 SER CA   1 1 
       16  9369 1 1  5 SER CB   C  -19.551  16.657  -2.203 1.00 . A A .   5 SER CB   1 1 
       16  9370 1 1  5 SER H    H  -20.983  18.312  -0.922 1.00 . A A .   5 SER H    1 1 
       16  9371 1 1  5 SER HA   H  -20.597  15.538  -0.707 1.00 . A A .   5 SER HA   1 1 
       16  9372 1 1  5 SER HB2  H  -19.046  15.770  -2.555 1.00 . A A .   5 SER HB2  1 1 
       16  9373 1 1  5 SER HB3  H  -20.414  16.850  -2.824 1.00 . A A .   5 SER HB3  1 1 
       16  9374 1 1  5 SER HG   H  -18.253  17.763  -3.167 1.00 . A A .   5 SER HG   1 1 
       16  9375 1 1  5 SER N    N  -20.846  17.550  -0.321 1.00 . A A .   5 SER N    1 1 
       16  9376 1 1  5 SER O    O  -17.869  17.102   0.117 1.00 . A A .   5 SER O    1 1 
       16  9377 1 1  5 SER OG   O  -18.663  17.757  -2.299 1.00 . A A .   5 SER OG   1 1 
       16  9378 1 1  6 SER C    C  -16.457  14.512   1.136 1.00 . A A .   6 SER C    1 1 
       16  9379 1 1  6 SER CA   C  -17.700  14.976   1.889 1.00 . A A .   6 SER CA   1 1 
       16  9380 1 1  6 SER CB   C  -18.110  13.922   2.919 1.00 . A A .   6 SER CB   1 1 
       16  9381 1 1  6 SER H    H  -19.563  14.623   0.947 1.00 . A A .   6 SER H    1 1 
       16  9382 1 1  6 SER HA   H  -17.473  15.899   2.401 1.00 . A A .   6 SER HA   1 1 
       16  9383 1 1  6 SER HB2  H  -18.718  13.170   2.439 1.00 . A A .   6 SER HB2  1 1 
       16  9384 1 1  6 SER HB3  H  -17.224  13.461   3.330 1.00 . A A .   6 SER HB3  1 1 
       16  9385 1 1  6 SER HG   H  -18.852  13.913   4.732 1.00 . A A .   6 SER HG   1 1 
       16  9386 1 1  6 SER N    N  -18.799  15.236   0.966 1.00 . A A .   6 SER N    1 1 
       16  9387 1 1  6 SER O    O  -15.390  15.113   1.247 1.00 . A A .   6 SER O    1 1 
       16  9388 1 1  6 SER OG   O  -18.854  14.504   3.976 1.00 . A A .   6 SER OG   1 1 
       16  9389 1 1  7 GLY C    C  -15.164  13.750  -1.608 1.00 . A A .   7 GLY C    1 1 
       16  9390 1 1  7 GLY CA   C  -15.487  12.908  -0.391 1.00 . A A .   7 GLY CA   1 1 
       16  9391 1 1  7 GLY H    H  -17.480  12.997   0.319 1.00 . A A .   7 GLY H    1 1 
       16  9392 1 1  7 GLY HA2  H  -14.617  12.869   0.248 1.00 . A A .   7 GLY HA2  1 1 
       16  9393 1 1  7 GLY HA3  H  -15.728  11.906  -0.715 1.00 . A A .   7 GLY HA3  1 1 
       16  9394 1 1  7 GLY N    N  -16.605  13.436   0.369 1.00 . A A .   7 GLY N    1 1 
       16  9395 1 1  7 GLY O    O  -15.607  14.894  -1.718 1.00 . A A .   7 GLY O    1 1 
       16  9396 1 1  8 THR C    C  -13.652  12.919  -4.860 1.00 . A A .   8 THR C    1 1 
       16  9397 1 1  8 THR CA   C  -14.001  13.894  -3.742 1.00 . A A .   8 THR CA   1 1 
       16  9398 1 1  8 THR CB   C  -12.798  14.824  -3.493 1.00 . A A .   8 THR CB   1 1 
       16  9399 1 1  8 THR CG2  C  -11.569  14.022  -3.092 1.00 . A A .   8 THR CG2  1 1 
       16  9400 1 1  8 THR H    H  -14.064  12.272  -2.384 1.00 . A A .   8 THR H    1 1 
       16  9401 1 1  8 THR HA   H  -14.839  14.500  -4.055 1.00 . A A .   8 THR HA   1 1 
       16  9402 1 1  8 THR HB   H  -13.047  15.501  -2.689 1.00 . A A .   8 THR HB   1 1 
       16  9403 1 1  8 THR HG1  H  -11.912  15.090  -5.235 1.00 . A A .   8 THR HG1  1 1 
       16  9404 1 1  8 THR HG21 H  -11.066  14.521  -2.277 1.00 . A A .   8 THR HG21 1 1 
       16  9405 1 1  8 THR HG22 H  -10.899  13.944  -3.935 1.00 . A A .   8 THR HG22 1 1 
       16  9406 1 1  8 THR HG23 H  -11.871  13.034  -2.778 1.00 . A A .   8 THR HG23 1 1 
       16  9407 1 1  8 THR N    N  -14.386  13.186  -2.528 1.00 . A A .   8 THR N    1 1 
       16  9408 1 1  8 THR O    O  -13.156  11.822  -4.607 1.00 . A A .   8 THR O    1 1 
       16  9409 1 1  8 THR OG1  O  -12.514  15.584  -4.673 1.00 . A A .   8 THR OG1  1 1 
       16  9410 1 1  9 GLY C    C  -12.305  12.830  -7.901 1.00 . A A .   9 GLY C    1 1 
       16  9411 1 1  9 GLY CA   C  -13.620  12.475  -7.237 1.00 . A A .   9 GLY CA   1 1 
       16  9412 1 1  9 GLY H    H  -14.310  14.211  -6.240 1.00 . A A .   9 GLY H    1 1 
       16  9413 1 1  9 GLY HA2  H  -13.579  11.449  -6.904 1.00 . A A .   9 GLY HA2  1 1 
       16  9414 1 1  9 GLY HA3  H  -14.415  12.576  -7.962 1.00 . A A .   9 GLY HA3  1 1 
       16  9415 1 1  9 GLY N    N  -13.914  13.326  -6.098 1.00 . A A .   9 GLY N    1 1 
       16  9416 1 1  9 GLY O    O  -12.237  12.969  -9.122 1.00 . A A .   9 GLY O    1 1 
       16  9417 1 1 10 GLU C    C   -8.839  12.676  -6.773 1.00 . A A .  10 GLU C    1 1 
       16  9418 1 1 10 GLU CA   C   -9.938  13.320  -7.613 1.00 . A A .  10 GLU CA   1 1 
       16  9419 1 1 10 GLU CB   C   -9.754  14.839  -7.636 1.00 . A A .  10 GLU CB   1 1 
       16  9420 1 1 10 GLU CD   C   -9.469  15.262 -10.110 1.00 . A A .  10 GLU CD   1 1 
       16  9421 1 1 10 GLU CG   C  -10.322  15.502  -8.880 1.00 . A A .  10 GLU CG   1 1 
       16  9422 1 1 10 GLU H    H  -11.375  12.853  -6.130 1.00 . A A .  10 GLU H    1 1 
       16  9423 1 1 10 GLU HA   H   -9.870  12.944  -8.623 1.00 . A A .  10 GLU HA   1 1 
       16  9424 1 1 10 GLU HB2  H  -10.244  15.262  -6.772 1.00 . A A .  10 GLU HB2  1 1 
       16  9425 1 1 10 GLU HB3  H   -8.699  15.062  -7.585 1.00 . A A .  10 GLU HB3  1 1 
       16  9426 1 1 10 GLU HG2  H  -11.310  15.108  -9.064 1.00 . A A .  10 GLU HG2  1 1 
       16  9427 1 1 10 GLU HG3  H  -10.386  16.567  -8.707 1.00 . A A .  10 GLU HG3  1 1 
       16  9428 1 1 10 GLU N    N  -11.257  12.977  -7.095 1.00 . A A .  10 GLU N    1 1 
       16  9429 1 1 10 GLU O    O   -8.708  12.956  -5.581 1.00 . A A .  10 GLU O    1 1 
       16  9430 1 1 10 GLU OE1  O   -8.259  15.569 -10.062 1.00 . A A .  10 GLU OE1  1 1 
       16  9431 1 1 10 GLU OE2  O  -10.010  14.767 -11.121 1.00 . A A .  10 GLU OE2  1 1 
       16  9432 1 1 11 LYS C    C   -5.916  10.634  -7.710 1.00 . A A .  11 LYS C    1 1 
       16  9433 1 1 11 LYS CA   C   -6.963  11.127  -6.715 1.00 . A A .  11 LYS CA   1 1 
       16  9434 1 1 11 LYS CB   C   -7.506   9.948  -5.904 1.00 . A A .  11 LYS CB   1 1 
       16  9435 1 1 11 LYS CD   C   -7.493   8.825  -3.657 1.00 . A A .  11 LYS CD   1 1 
       16  9436 1 1 11 LYS CE   C   -8.492   9.689  -2.904 1.00 . A A .  11 LYS CE   1 1 
       16  9437 1 1 11 LYS CG   C   -6.693   9.642  -4.658 1.00 . A A .  11 LYS CG   1 1 
       16  9438 1 1 11 LYS H    H   -8.206  11.629  -8.354 1.00 . A A .  11 LYS H    1 1 
       16  9439 1 1 11 LYS HA   H   -6.499  11.832  -6.043 1.00 . A A .  11 LYS HA   1 1 
       16  9440 1 1 11 LYS HB2  H   -8.519  10.170  -5.603 1.00 . A A .  11 LYS HB2  1 1 
       16  9441 1 1 11 LYS HB3  H   -7.511   9.067  -6.530 1.00 . A A .  11 LYS HB3  1 1 
       16  9442 1 1 11 LYS HD2  H   -8.031   8.051  -4.185 1.00 . A A .  11 LYS HD2  1 1 
       16  9443 1 1 11 LYS HD3  H   -6.813   8.374  -2.948 1.00 . A A .  11 LYS HD3  1 1 
       16  9444 1 1 11 LYS HE2  H   -8.945  10.381  -3.597 1.00 . A A .  11 LYS HE2  1 1 
       16  9445 1 1 11 LYS HE3  H   -9.255   9.051  -2.483 1.00 . A A .  11 LYS HE3  1 1 
       16  9446 1 1 11 LYS HG2  H   -5.813   9.083  -4.941 1.00 . A A .  11 LYS HG2  1 1 
       16  9447 1 1 11 LYS HG3  H   -6.397  10.572  -4.194 1.00 . A A .  11 LYS HG3  1 1 
       16  9448 1 1 11 LYS HZ1  H   -8.516  10.608  -1.028 1.00 . A A .  11 LYS HZ1  1 1 
       16  9449 1 1 11 LYS HZ2  H   -7.524  11.383  -2.158 1.00 . A A .  11 LYS HZ2  1 1 
       16  9450 1 1 11 LYS HZ3  H   -7.020   9.936  -1.442 1.00 . A A .  11 LYS HZ3  1 1 
       16  9451 1 1 11 LYS N    N   -8.052  11.811  -7.402 1.00 . A A .  11 LYS N    1 1 
       16  9452 1 1 11 LYS NZ   N   -7.843  10.458  -1.806 1.00 . A A .  11 LYS NZ   1 1 
       16  9453 1 1 11 LYS O    O   -6.236  10.157  -8.799 1.00 . A A .  11 LYS O    1 1 
       16  9454 1 1 12 PRO C    C   -3.441   8.803  -8.306 1.00 . A A .  12 PRO C    1 1 
       16  9455 1 1 12 PRO CA   C   -3.517  10.320  -8.172 1.00 . A A .  12 PRO CA   1 1 
       16  9456 1 1 12 PRO CB   C   -2.288  10.853  -7.430 1.00 . A A .  12 PRO CB   1 1 
       16  9457 1 1 12 PRO CD   C   -4.182  11.310  -6.044 1.00 . A A .  12 PRO CD   1 1 
       16  9458 1 1 12 PRO CG   C   -2.720  10.957  -6.008 1.00 . A A .  12 PRO CG   1 1 
       16  9459 1 1 12 PRO HA   H   -3.567  10.765  -9.155 1.00 . A A .  12 PRO HA   1 1 
       16  9460 1 1 12 PRO HB2  H   -1.467  10.159  -7.544 1.00 . A A .  12 PRO HB2  1 1 
       16  9461 1 1 12 PRO HB3  H   -2.011  11.816  -7.830 1.00 . A A .  12 PRO HB3  1 1 
       16  9462 1 1 12 PRO HD2  H   -4.701  10.849  -5.217 1.00 . A A .  12 PRO HD2  1 1 
       16  9463 1 1 12 PRO HD3  H   -4.312  12.382  -6.024 1.00 . A A .  12 PRO HD3  1 1 
       16  9464 1 1 12 PRO HG2  H   -2.575  10.011  -5.509 1.00 . A A .  12 PRO HG2  1 1 
       16  9465 1 1 12 PRO HG3  H   -2.160  11.735  -5.511 1.00 . A A .  12 PRO HG3  1 1 
       16  9466 1 1 12 PRO N    N   -4.636  10.750  -7.328 1.00 . A A .  12 PRO N    1 1 
       16  9467 1 1 12 PRO O    O   -3.355   8.271  -9.413 1.00 . A A .  12 PRO O    1 1 
       16  9468 1 1 13 TYR C    C   -4.200   6.080  -5.992 1.00 . A A .  13 TYR C    1 1 
       16  9469 1 1 13 TYR CA   C   -3.409   6.655  -7.163 1.00 . A A .  13 TYR CA   1 1 
       16  9470 1 1 13 TYR CB   C   -1.953   6.190  -7.087 1.00 . A A .  13 TYR CB   1 1 
       16  9471 1 1 13 TYR CD1  C   -1.029   5.859  -9.414 1.00 . A A .  13 TYR CD1  1 1 
       16  9472 1 1 13 TYR CD2  C   -0.405   7.828  -8.225 1.00 . A A .  13 TYR CD2  1 1 
       16  9473 1 1 13 TYR CE1  C   -0.263   6.260 -10.491 1.00 . A A .  13 TYR CE1  1 1 
       16  9474 1 1 13 TYR CE2  C    0.363   8.238  -9.298 1.00 . A A .  13 TYR CE2  1 1 
       16  9475 1 1 13 TYR CG   C   -1.114   6.634  -8.264 1.00 . A A .  13 TYR CG   1 1 
       16  9476 1 1 13 TYR CZ   C    0.431   7.451 -10.428 1.00 . A A .  13 TYR CZ   1 1 
       16  9477 1 1 13 TYR H    H   -3.545   8.591  -6.321 1.00 . A A .  13 TYR H    1 1 
       16  9478 1 1 13 TYR HA   H   -3.843   6.297  -8.086 1.00 . A A .  13 TYR HA   1 1 
       16  9479 1 1 13 TYR HB2  H   -1.503   6.586  -6.191 1.00 . A A .  13 TYR HB2  1 1 
       16  9480 1 1 13 TYR HB3  H   -1.929   5.111  -7.050 1.00 . A A .  13 TYR HB3  1 1 
       16  9481 1 1 13 TYR HD1  H   -1.575   4.927  -9.460 1.00 . A A .  13 TYR HD1  1 1 
       16  9482 1 1 13 TYR HD2  H   -0.461   8.443  -7.338 1.00 . A A .  13 TYR HD2  1 1 
       16  9483 1 1 13 TYR HE1  H   -0.209   5.644 -11.376 1.00 . A A .  13 TYR HE1  1 1 
       16  9484 1 1 13 TYR HE2  H    0.907   9.170  -9.249 1.00 . A A .  13 TYR HE2  1 1 
       16  9485 1 1 13 TYR HH   H    2.107   7.959 -11.220 1.00 . A A .  13 TYR HH   1 1 
       16  9486 1 1 13 TYR N    N   -3.475   8.111  -7.172 1.00 . A A .  13 TYR N    1 1 
       16  9487 1 1 13 TYR O    O   -4.230   6.657  -4.905 1.00 . A A .  13 TYR O    1 1 
       16  9488 1 1 13 TYR OH   O    1.195   7.854 -11.499 1.00 . A A .  13 TYR OH   1 1 
       16  9489 1 1 14 LYS C    C   -5.728   2.782  -5.447 1.00 . A A .  14 LYS C    1 1 
       16  9490 1 1 14 LYS CA   C   -5.630   4.282  -5.187 1.00 . A A .  14 LYS CA   1 1 
       16  9491 1 1 14 LYS CB   C   -7.032   4.892  -5.124 1.00 . A A .  14 LYS CB   1 1 
       16  9492 1 1 14 LYS CD   C   -9.028   5.078  -3.610 1.00 . A A .  14 LYS CD   1 1 
       16  9493 1 1 14 LYS CE   C  -10.059   5.482  -4.652 1.00 . A A .  14 LYS CE   1 1 
       16  9494 1 1 14 LYS CG   C   -7.978   4.149  -4.196 1.00 . A A .  14 LYS CG   1 1 
       16  9495 1 1 14 LYS H    H   -4.778   4.527  -7.110 1.00 . A A .  14 LYS H    1 1 
       16  9496 1 1 14 LYS HA   H   -5.135   4.440  -4.241 1.00 . A A .  14 LYS HA   1 1 
       16  9497 1 1 14 LYS HB2  H   -6.952   5.913  -4.780 1.00 . A A .  14 LYS HB2  1 1 
       16  9498 1 1 14 LYS HB3  H   -7.459   4.888  -6.117 1.00 . A A .  14 LYS HB3  1 1 
       16  9499 1 1 14 LYS HD2  H   -9.531   4.572  -2.799 1.00 . A A .  14 LYS HD2  1 1 
       16  9500 1 1 14 LYS HD3  H   -8.540   5.966  -3.234 1.00 . A A .  14 LYS HD3  1 1 
       16  9501 1 1 14 LYS HE2  H   -9.607   6.189  -5.331 1.00 . A A .  14 LYS HE2  1 1 
       16  9502 1 1 14 LYS HE3  H  -10.363   4.602  -5.199 1.00 . A A .  14 LYS HE3  1 1 
       16  9503 1 1 14 LYS HG2  H   -8.474   3.368  -4.753 1.00 . A A .  14 LYS HG2  1 1 
       16  9504 1 1 14 LYS HG3  H   -7.406   3.712  -3.390 1.00 . A A .  14 LYS HG3  1 1 
       16  9505 1 1 14 LYS HZ1  H  -11.042   6.415  -3.062 1.00 . A A .  14 LYS HZ1  1 1 
       16  9506 1 1 14 LYS HZ2  H  -12.041   5.422  -3.998 1.00 . A A .  14 LYS HZ2  1 1 
       16  9507 1 1 14 LYS HZ3  H  -11.561   6.932  -4.587 1.00 . A A .  14 LYS HZ3  1 1 
       16  9508 1 1 14 LYS N    N   -4.839   4.939  -6.222 1.00 . A A .  14 LYS N    1 1 
       16  9509 1 1 14 LYS NZ   N  -11.260   6.107  -4.031 1.00 . A A .  14 LYS NZ   1 1 
       16  9510 1 1 14 LYS O    O   -5.903   2.349  -6.586 1.00 . A A .  14 LYS O    1 1 
       16  9511 1 1 15 CYS C    C   -7.141   0.067  -4.422 1.00 . A A .  15 CYS C    1 1 
       16  9512 1 1 15 CYS CA   C   -5.693   0.542  -4.495 1.00 . A A .  15 CYS CA   1 1 
       16  9513 1 1 15 CYS CB   C   -4.871  -0.120  -3.388 1.00 . A A .  15 CYS CB   1 1 
       16  9514 1 1 15 CYS H    H   -5.478   2.398  -3.500 1.00 . A A .  15 CYS H    1 1 
       16  9515 1 1 15 CYS HA   H   -5.283   0.261  -5.453 1.00 . A A .  15 CYS HA   1 1 
       16  9516 1 1 15 CYS HB2  H   -3.851   0.232  -3.448 1.00 . A A .  15 CYS HB2  1 1 
       16  9517 1 1 15 CYS HB3  H   -5.286   0.155  -2.429 1.00 . A A .  15 CYS HB3  1 1 
       16  9518 1 1 15 CYS N    N   -5.616   1.994  -4.383 1.00 . A A .  15 CYS N    1 1 
       16  9519 1 1 15 CYS O    O   -7.808   0.230  -3.401 1.00 . A A .  15 CYS O    1 1 
       16  9520 1 1 15 CYS SG   S   -4.834  -1.939  -3.476 1.00 . A A .  15 CYS SG   1 1 
       16  9521 1 1 16 ASN C    C   -9.064  -2.466  -5.093 1.00 . A A .  16 ASN C    1 1 
       16  9522 1 1 16 ASN CA   C   -8.990  -1.020  -5.574 1.00 . A A .  16 ASN CA   1 1 
       16  9523 1 1 16 ASN CB   C   -9.530  -0.917  -7.001 1.00 . A A .  16 ASN CB   1 1 
       16  9524 1 1 16 ASN CG   C   -8.536  -1.414  -8.033 1.00 . A A .  16 ASN CG   1 1 
       16  9525 1 1 16 ASN H    H   -7.041  -0.622  -6.297 1.00 . A A .  16 ASN H    1 1 
       16  9526 1 1 16 ASN HA   H   -9.595  -0.406  -4.924 1.00 . A A .  16 ASN HA   1 1 
       16  9527 1 1 16 ASN HB2  H  -10.430  -1.509  -7.083 1.00 . A A .  16 ASN HB2  1 1 
       16  9528 1 1 16 ASN HB3  H   -9.762   0.115  -7.219 1.00 . A A .  16 ASN HB3  1 1 
       16  9529 1 1 16 ASN HD21 H   -8.532  -3.218  -7.195 1.00 . A A .  16 ASN HD21 1 1 
       16  9530 1 1 16 ASN HD22 H   -7.513  -3.029  -8.578 1.00 . A A .  16 ASN HD22 1 1 
       16  9531 1 1 16 ASN N    N   -7.621  -0.521  -5.513 1.00 . A A .  16 ASN N    1 1 
       16  9532 1 1 16 ASN ND2  N   -8.155  -2.682  -7.924 1.00 . A A .  16 ASN ND2  1 1 
       16  9533 1 1 16 ASN O    O   -9.815  -3.274  -5.639 1.00 . A A .  16 ASN O    1 1 
       16  9534 1 1 16 ASN OD1  O   -8.115  -0.667  -8.917 1.00 . A A .  16 ASN OD1  1 1 
       16  9535 1 1 17 GLU C    C   -8.426  -4.102  -1.998 1.00 . A A .  17 GLU C    1 1 
       16  9536 1 1 17 GLU CA   C   -8.256  -4.133  -3.514 1.00 . A A .  17 GLU CA   1 1 
       16  9537 1 1 17 GLU CB   C   -6.946  -4.835  -3.878 1.00 . A A .  17 GLU CB   1 1 
       16  9538 1 1 17 GLU CD   C   -7.490  -6.131  -5.977 1.00 . A A .  17 GLU CD   1 1 
       16  9539 1 1 17 GLU CG   C   -6.723  -4.970  -5.375 1.00 . A A .  17 GLU CG   1 1 
       16  9540 1 1 17 GLU H    H   -7.703  -2.096  -3.675 1.00 . A A .  17 GLU H    1 1 
       16  9541 1 1 17 GLU HA   H   -9.080  -4.682  -3.945 1.00 . A A .  17 GLU HA   1 1 
       16  9542 1 1 17 GLU HB2  H   -6.123  -4.274  -3.461 1.00 . A A .  17 GLU HB2  1 1 
       16  9543 1 1 17 GLU HB3  H   -6.951  -5.825  -3.446 1.00 . A A .  17 GLU HB3  1 1 
       16  9544 1 1 17 GLU HG2  H   -7.044  -4.059  -5.857 1.00 . A A .  17 GLU HG2  1 1 
       16  9545 1 1 17 GLU HG3  H   -5.669  -5.120  -5.557 1.00 . A A .  17 GLU HG3  1 1 
       16  9546 1 1 17 GLU N    N   -8.280  -2.784  -4.068 1.00 . A A .  17 GLU N    1 1 
       16  9547 1 1 17 GLU O    O   -9.125  -4.936  -1.423 1.00 . A A .  17 GLU O    1 1 
       16  9548 1 1 17 GLU OE1  O   -6.950  -7.257  -5.988 1.00 . A A .  17 GLU OE1  1 1 
       16  9549 1 1 17 GLU OE2  O   -8.631  -5.914  -6.437 1.00 . A A .  17 GLU OE2  1 1 
       16  9550 1 1 18 CYS C    C   -8.398  -1.619   0.477 1.00 . A A .  18 CYS C    1 1 
       16  9551 1 1 18 CYS CA   C   -7.857  -2.993   0.093 1.00 . A A .  18 CYS CA   1 1 
       16  9552 1 1 18 CYS CB   C   -6.477  -3.204   0.720 1.00 . A A .  18 CYS CB   1 1 
       16  9553 1 1 18 CYS H    H   -7.238  -2.498  -1.870 1.00 . A A .  18 CYS H    1 1 
       16  9554 1 1 18 CYS HA   H   -8.531  -3.749   0.465 1.00 . A A .  18 CYS HA   1 1 
       16  9555 1 1 18 CYS HB2  H   -6.572  -3.175   1.796 1.00 . A A .  18 CYS HB2  1 1 
       16  9556 1 1 18 CYS HB3  H   -6.099  -4.171   0.423 1.00 . A A .  18 CYS HB3  1 1 
       16  9557 1 1 18 CYS N    N   -7.780  -3.134  -1.356 1.00 . A A .  18 CYS N    1 1 
       16  9558 1 1 18 CYS O    O   -9.283  -1.503   1.325 1.00 . A A .  18 CYS O    1 1 
       16  9559 1 1 18 CYS SG   S   -5.243  -1.953   0.240 1.00 . A A .  18 CYS SG   1 1 
       16  9560 1 1 19 GLY C    C   -7.153   1.689   0.512 1.00 . A A .  19 GLY C    1 1 
       16  9561 1 1 19 GLY CA   C   -8.300   0.773   0.137 1.00 . A A .  19 GLY CA   1 1 
       16  9562 1 1 19 GLY H    H   -7.157  -0.731  -0.819 1.00 . A A .  19 GLY H    1 1 
       16  9563 1 1 19 GLY HA2  H   -8.796   1.173  -0.735 1.00 . A A .  19 GLY HA2  1 1 
       16  9564 1 1 19 GLY HA3  H   -9.004   0.742   0.956 1.00 . A A .  19 GLY HA3  1 1 
       16  9565 1 1 19 GLY N    N   -7.859  -0.579  -0.152 1.00 . A A .  19 GLY N    1 1 
       16  9566 1 1 19 GLY O    O   -7.318   2.606   1.318 1.00 . A A .  19 GLY O    1 1 
       16  9567 1 1 20 LYS C    C   -4.582   3.284  -0.894 1.00 . A A .  20 LYS C    1 1 
       16  9568 1 1 20 LYS CA   C   -4.804   2.251   0.206 1.00 . A A .  20 LYS CA   1 1 
       16  9569 1 1 20 LYS CB   C   -3.568   1.358   0.339 1.00 . A A .  20 LYS CB   1 1 
       16  9570 1 1 20 LYS CD   C   -2.891   2.013   2.667 1.00 . A A .  20 LYS CD   1 1 
       16  9571 1 1 20 LYS CE   C   -1.381   2.188   2.672 1.00 . A A .  20 LYS CE   1 1 
       16  9572 1 1 20 LYS CG   C   -3.317   0.874   1.756 1.00 . A A .  20 LYS CG   1 1 
       16  9573 1 1 20 LYS H    H   -5.916   0.697  -0.705 1.00 . A A .  20 LYS H    1 1 
       16  9574 1 1 20 LYS HA   H   -4.967   2.766   1.140 1.00 . A A .  20 LYS HA   1 1 
       16  9575 1 1 20 LYS HB2  H   -3.693   0.494  -0.297 1.00 . A A .  20 LYS HB2  1 1 
       16  9576 1 1 20 LYS HB3  H   -2.701   1.913   0.011 1.00 . A A .  20 LYS HB3  1 1 
       16  9577 1 1 20 LYS HD2  H   -3.347   2.929   2.321 1.00 . A A .  20 LYS HD2  1 1 
       16  9578 1 1 20 LYS HD3  H   -3.224   1.801   3.674 1.00 . A A .  20 LYS HD3  1 1 
       16  9579 1 1 20 LYS HE2  H   -1.079   2.568   3.637 1.00 . A A .  20 LYS HE2  1 1 
       16  9580 1 1 20 LYS HE3  H   -0.919   1.227   2.504 1.00 . A A .  20 LYS HE3  1 1 
       16  9581 1 1 20 LYS HG2  H   -4.225   0.437   2.145 1.00 . A A .  20 LYS HG2  1 1 
       16  9582 1 1 20 LYS HG3  H   -2.535   0.128   1.739 1.00 . A A .  20 LYS HG3  1 1 
       16  9583 1 1 20 LYS HZ1  H    0.092   3.312   1.707 1.00 . A A .  20 LYS HZ1  1 1 
       16  9584 1 1 20 LYS HZ2  H   -1.436   4.039   1.705 1.00 . A A .  20 LYS HZ2  1 1 
       16  9585 1 1 20 LYS HZ3  H   -1.117   2.736   0.674 1.00 . A A .  20 LYS HZ3  1 1 
       16  9586 1 1 20 LYS N    N   -5.985   1.442  -0.071 1.00 . A A .  20 LYS N    1 1 
       16  9587 1 1 20 LYS NZ   N   -0.928   3.135   1.616 1.00 . A A .  20 LYS NZ   1 1 
       16  9588 1 1 20 LYS O    O   -4.425   2.935  -2.063 1.00 . A A .  20 LYS O    1 1 
       16  9589 1 1 21 ALA C    C   -2.969   6.245  -1.313 1.00 . A A .  21 ALA C    1 1 
       16  9590 1 1 21 ALA CA   C   -4.361   5.640  -1.463 1.00 . A A .  21 ALA CA   1 1 
       16  9591 1 1 21 ALA CB   C   -5.427   6.711  -1.284 1.00 . A A .  21 ALA CB   1 1 
       16  9592 1 1 21 ALA H    H   -4.698   4.771   0.437 1.00 . A A .  21 ALA H    1 1 
       16  9593 1 1 21 ALA HA   H   -4.459   5.231  -2.459 1.00 . A A .  21 ALA HA   1 1 
       16  9594 1 1 21 ALA HB1  H   -6.099   6.694  -2.129 1.00 . A A .  21 ALA HB1  1 1 
       16  9595 1 1 21 ALA HB2  H   -5.982   6.516  -0.378 1.00 . A A .  21 ALA HB2  1 1 
       16  9596 1 1 21 ALA HB3  H   -4.955   7.680  -1.217 1.00 . A A .  21 ALA HB3  1 1 
       16  9597 1 1 21 ALA N    N   -4.568   4.556  -0.510 1.00 . A A .  21 ALA N    1 1 
       16  9598 1 1 21 ALA O    O   -2.489   6.453  -0.198 1.00 . A A .  21 ALA O    1 1 
       16  9599 1 1 22 PHE C    C   -0.958   8.411  -3.224 1.00 . A A .  22 PHE C    1 1 
       16  9600 1 1 22 PHE CA   C   -0.988   7.106  -2.434 1.00 . A A .  22 PHE CA   1 1 
       16  9601 1 1 22 PHE CB   C    0.022   6.118  -3.021 1.00 . A A .  22 PHE CB   1 1 
       16  9602 1 1 22 PHE CD1  C   -1.093   3.881  -2.799 1.00 . A A .  22 PHE CD1  1 1 
       16  9603 1 1 22 PHE CD2  C    0.862   4.307  -1.501 1.00 . A A .  22 PHE CD2  1 1 
       16  9604 1 1 22 PHE CE1  C   -1.182   2.614  -2.254 1.00 . A A .  22 PHE CE1  1 1 
       16  9605 1 1 22 PHE CE2  C    0.778   3.040  -0.953 1.00 . A A .  22 PHE CE2  1 1 
       16  9606 1 1 22 PHE CG   C   -0.072   4.741  -2.428 1.00 . A A .  22 PHE CG   1 1 
       16  9607 1 1 22 PHE CZ   C   -0.244   2.193  -1.331 1.00 . A A .  22 PHE CZ   1 1 
       16  9608 1 1 22 PHE H    H   -2.761   6.336  -3.299 1.00 . A A .  22 PHE H    1 1 
       16  9609 1 1 22 PHE HA   H   -0.723   7.312  -1.409 1.00 . A A .  22 PHE HA   1 1 
       16  9610 1 1 22 PHE HB2  H   -0.145   6.032  -4.084 1.00 . A A .  22 PHE HB2  1 1 
       16  9611 1 1 22 PHE HB3  H    1.021   6.489  -2.846 1.00 . A A .  22 PHE HB3  1 1 
       16  9612 1 1 22 PHE HD1  H   -1.826   4.208  -3.521 1.00 . A A .  22 PHE HD1  1 1 
       16  9613 1 1 22 PHE HD2  H    1.663   4.969  -1.205 1.00 . A A .  22 PHE HD2  1 1 
       16  9614 1 1 22 PHE HE1  H   -1.982   1.953  -2.551 1.00 . A A .  22 PHE HE1  1 1 
       16  9615 1 1 22 PHE HE2  H    1.513   2.715  -0.232 1.00 . A A .  22 PHE HE2  1 1 
       16  9616 1 1 22 PHE HZ   H   -0.312   1.203  -0.903 1.00 . A A .  22 PHE HZ   1 1 
       16  9617 1 1 22 PHE N    N   -2.326   6.525  -2.441 1.00 . A A .  22 PHE N    1 1 
       16  9618 1 1 22 PHE O    O   -1.985   8.871  -3.723 1.00 . A A .  22 PHE O    1 1 
       16  9619 1 1 23 ARG C    C    1.000  10.009  -5.436 1.00 . A A .  23 ARG C    1 1 
       16  9620 1 1 23 ARG CA   C    0.393  10.256  -4.058 1.00 . A A .  23 ARG CA   1 1 
       16  9621 1 1 23 ARG CB   C    1.278  11.218  -3.264 1.00 . A A .  23 ARG CB   1 1 
       16  9622 1 1 23 ARG CD   C    2.256  13.524  -3.063 1.00 . A A .  23 ARG CD   1 1 
       16  9623 1 1 23 ARG CG   C    1.245  12.645  -3.784 1.00 . A A .  23 ARG CG   1 1 
       16  9624 1 1 23 ARG CZ   C    3.751  12.039  -1.797 1.00 . A A .  23 ARG CZ   1 1 
       16  9625 1 1 23 ARG H    H    1.010   8.587  -2.912 1.00 . A A .  23 ARG H    1 1 
       16  9626 1 1 23 ARG HA   H   -0.584  10.698  -4.182 1.00 . A A .  23 ARG HA   1 1 
       16  9627 1 1 23 ARG HB2  H    0.948  11.226  -2.235 1.00 . A A .  23 ARG HB2  1 1 
       16  9628 1 1 23 ARG HB3  H    2.297  10.866  -3.304 1.00 . A A .  23 ARG HB3  1 1 
       16  9629 1 1 23 ARG HD2  H    2.440  14.404  -3.662 1.00 . A A .  23 ARG HD2  1 1 
       16  9630 1 1 23 ARG HD3  H    1.842  13.818  -2.110 1.00 . A A .  23 ARG HD3  1 1 
       16  9631 1 1 23 ARG HE   H    4.235  12.964  -3.496 1.00 . A A .  23 ARG HE   1 1 
       16  9632 1 1 23 ARG HG2  H    1.478  12.640  -4.839 1.00 . A A .  23 ARG HG2  1 1 
       16  9633 1 1 23 ARG HG3  H    0.256  13.051  -3.634 1.00 . A A .  23 ARG HG3  1 1 
       16  9634 1 1 23 ARG HH11 H    1.915  12.286  -0.991 1.00 . A A .  23 ARG HH11 1 1 
       16  9635 1 1 23 ARG HH12 H    2.979  11.241  -0.108 1.00 . A A .  23 ARG HH12 1 1 
       16  9636 1 1 23 ARG HH21 H    5.645  11.590  -2.344 1.00 . A A .  23 ARG HH21 1 1 
       16  9637 1 1 23 ARG HH22 H    5.100  10.847  -0.878 1.00 . A A .  23 ARG HH22 1 1 
       16  9638 1 1 23 ARG N    N    0.228   9.003  -3.332 1.00 . A A .  23 ARG N    1 1 
       16  9639 1 1 23 ARG NE   N    3.522  12.831  -2.839 1.00 . A A .  23 ARG NE   1 1 
       16  9640 1 1 23 ARG NH1  N    2.804  11.839  -0.891 1.00 . A A .  23 ARG NH1  1 1 
       16  9641 1 1 23 ARG NH2  N    4.929  11.443  -1.662 1.00 . A A .  23 ARG NH2  1 1 
       16  9642 1 1 23 ARG O    O    0.689  10.712  -6.397 1.00 . A A .  23 ARG O    1 1 
       16  9643 1 1 24 ALA C    C    2.432   7.169  -7.058 1.00 . A A .  24 ALA C    1 1 
       16  9644 1 1 24 ALA CA   C    2.517   8.666  -6.784 1.00 . A A .  24 ALA CA   1 1 
       16  9645 1 1 24 ALA CB   C    3.969   9.121  -6.769 1.00 . A A .  24 ALA CB   1 1 
       16  9646 1 1 24 ALA H    H    2.075   8.482  -4.723 1.00 . A A .  24 ALA H    1 1 
       16  9647 1 1 24 ALA HA   H    2.007   9.197  -7.576 1.00 . A A .  24 ALA HA   1 1 
       16  9648 1 1 24 ALA HB1  H    4.386   9.024  -7.760 1.00 . A A .  24 ALA HB1  1 1 
       16  9649 1 1 24 ALA HB2  H    4.018  10.154  -6.456 1.00 . A A .  24 ALA HB2  1 1 
       16  9650 1 1 24 ALA HB3  H    4.530   8.509  -6.080 1.00 . A A .  24 ALA HB3  1 1 
       16  9651 1 1 24 ALA N    N    1.867   9.007  -5.524 1.00 . A A .  24 ALA N    1 1 
       16  9652 1 1 24 ALA O    O    2.132   6.380  -6.162 1.00 . A A .  24 ALA O    1 1 
       16  9653 1 1 25 ARG C    C    3.649   4.556  -7.887 1.00 . A A .  25 ARG C    1 1 
       16  9654 1 1 25 ARG CA   C    2.650   5.381  -8.695 1.00 . A A .  25 ARG CA   1 1 
       16  9655 1 1 25 ARG CB   C    2.944   5.236 -10.189 1.00 . A A .  25 ARG CB   1 1 
       16  9656 1 1 25 ARG CD   C    3.174   3.575 -12.060 1.00 . A A .  25 ARG CD   1 1 
       16  9657 1 1 25 ARG CG   C    2.422   3.942 -10.790 1.00 . A A .  25 ARG CG   1 1 
       16  9658 1 1 25 ARG CZ   C    4.967   1.999 -12.649 1.00 . A A .  25 ARG CZ   1 1 
       16  9659 1 1 25 ARG H    H    2.932   7.460  -8.973 1.00 . A A .  25 ARG H    1 1 
       16  9660 1 1 25 ARG HA   H    1.655   5.014  -8.496 1.00 . A A .  25 ARG HA   1 1 
       16  9661 1 1 25 ARG HB2  H    2.487   6.062 -10.715 1.00 . A A .  25 ARG HB2  1 1 
       16  9662 1 1 25 ARG HB3  H    4.013   5.272 -10.339 1.00 . A A .  25 ARG HB3  1 1 
       16  9663 1 1 25 ARG HD2  H    2.527   2.976 -12.685 1.00 . A A .  25 ARG HD2  1 1 
       16  9664 1 1 25 ARG HD3  H    3.437   4.482 -12.582 1.00 . A A .  25 ARG HD3  1 1 
       16  9665 1 1 25 ARG HE   H    4.798   2.930 -10.893 1.00 . A A .  25 ARG HE   1 1 
       16  9666 1 1 25 ARG HG2  H    2.544   3.146 -10.070 1.00 . A A .  25 ARG HG2  1 1 
       16  9667 1 1 25 ARG HG3  H    1.375   4.061 -11.024 1.00 . A A .  25 ARG HG3  1 1 
       16  9668 1 1 25 ARG HH11 H    3.605   2.321 -14.106 1.00 . A A .  25 ARG HH11 1 1 
       16  9669 1 1 25 ARG HH12 H    4.875   1.212 -14.508 1.00 . A A .  25 ARG HH12 1 1 
       16  9670 1 1 25 ARG HH21 H    6.475   1.473 -11.410 1.00 . A A .  25 ARG HH21 1 1 
       16  9671 1 1 25 ARG HH22 H    6.506   0.730 -12.974 1.00 . A A .  25 ARG HH22 1 1 
       16  9672 1 1 25 ARG N    N    2.699   6.784  -8.302 1.00 . A A .  25 ARG N    1 1 
       16  9673 1 1 25 ARG NE   N    4.391   2.819 -11.777 1.00 . A A .  25 ARG NE   1 1 
       16  9674 1 1 25 ARG NH1  N    4.439   1.830 -13.853 1.00 . A A .  25 ARG NH1  1 1 
       16  9675 1 1 25 ARG NH2  N    6.074   1.347 -12.317 1.00 . A A .  25 ARG NH2  1 1 
       16  9676 1 1 25 ARG O    O    3.274   3.602  -7.206 1.00 . A A .  25 ARG O    1 1 
       16  9677 1 1 26 SER C    C    5.519   3.859  -5.841 1.00 . A A .  26 SER C    1 1 
       16  9678 1 1 26 SER CA   C    5.974   4.223  -7.251 1.00 . A A .  26 SER CA   1 1 
       16  9679 1 1 26 SER CB   C    7.241   5.079  -7.185 1.00 . A A .  26 SER CB   1 1 
       16  9680 1 1 26 SER H    H    5.158   5.699  -8.530 1.00 . A A .  26 SER H    1 1 
       16  9681 1 1 26 SER HA   H    6.192   3.314  -7.792 1.00 . A A .  26 SER HA   1 1 
       16  9682 1 1 26 SER HB2  H    7.021   6.003  -6.673 1.00 . A A .  26 SER HB2  1 1 
       16  9683 1 1 26 SER HB3  H    8.008   4.542  -6.647 1.00 . A A .  26 SER HB3  1 1 
       16  9684 1 1 26 SER HG   H    6.979   5.571  -9.063 1.00 . A A .  26 SER HG   1 1 
       16  9685 1 1 26 SER N    N    4.922   4.930  -7.970 1.00 . A A .  26 SER N    1 1 
       16  9686 1 1 26 SER O    O    5.749   2.745  -5.371 1.00 . A A .  26 SER O    1 1 
       16  9687 1 1 26 SER OG   O    7.720   5.380  -8.484 1.00 . A A .  26 SER OG   1 1 
       16  9688 1 1 27 SER C    C    3.359   3.464  -3.778 1.00 . A A .  27 SER C    1 1 
       16  9689 1 1 27 SER CA   C    4.388   4.590  -3.813 1.00 . A A .  27 SER CA   1 1 
       16  9690 1 1 27 SER CB   C    3.773   5.875  -3.257 1.00 . A A .  27 SER CB   1 1 
       16  9691 1 1 27 SER H    H    4.720   5.676  -5.601 1.00 . A A .  27 SER H    1 1 
       16  9692 1 1 27 SER HA   H    5.232   4.310  -3.201 1.00 . A A .  27 SER HA   1 1 
       16  9693 1 1 27 SER HB2  H    3.328   6.438  -4.063 1.00 . A A .  27 SER HB2  1 1 
       16  9694 1 1 27 SER HB3  H    3.013   5.623  -2.531 1.00 . A A .  27 SER HB3  1 1 
       16  9695 1 1 27 SER HG   H    4.427   7.578  -2.541 1.00 . A A .  27 SER HG   1 1 
       16  9696 1 1 27 SER N    N    4.873   4.808  -5.171 1.00 . A A .  27 SER N    1 1 
       16  9697 1 1 27 SER O    O    3.410   2.587  -2.914 1.00 . A A .  27 SER O    1 1 
       16  9698 1 1 27 SER OG   O    4.756   6.680  -2.627 1.00 . A A .  27 SER OG   1 1 
       16  9699 1 1 28 LEU C    C    1.978   1.113  -5.137 1.00 . A A .  28 LEU C    1 1 
       16  9700 1 1 28 LEU CA   C    1.383   2.477  -4.801 1.00 . A A .  28 LEU CA   1 1 
       16  9701 1 1 28 LEU CB   C    0.342   2.865  -5.852 1.00 . A A .  28 LEU CB   1 1 
       16  9702 1 1 28 LEU CD1  C   -1.754   1.597  -5.319 1.00 . A A .  28 LEU CD1  1 1 
       16  9703 1 1 28 LEU CD2  C   -1.132   2.033  -7.702 1.00 . A A .  28 LEU CD2  1 1 
       16  9704 1 1 28 LEU CG   C   -0.605   1.752  -6.302 1.00 . A A .  28 LEU CG   1 1 
       16  9705 1 1 28 LEU H    H    2.436   4.218  -5.383 1.00 . A A .  28 LEU H    1 1 
       16  9706 1 1 28 LEU HA   H    0.903   2.419  -3.835 1.00 . A A .  28 LEU HA   1 1 
       16  9707 1 1 28 LEU HB2  H   -0.259   3.663  -5.443 1.00 . A A .  28 LEU HB2  1 1 
       16  9708 1 1 28 LEU HB3  H    0.871   3.224  -6.723 1.00 . A A .  28 LEU HB3  1 1 
       16  9709 1 1 28 LEU HD11 H   -1.878   2.515  -4.764 1.00 . A A .  28 LEU HD11 1 1 
       16  9710 1 1 28 LEU HD12 H   -1.538   0.790  -4.636 1.00 . A A .  28 LEU HD12 1 1 
       16  9711 1 1 28 LEU HD13 H   -2.663   1.377  -5.860 1.00 . A A .  28 LEU HD13 1 1 
       16  9712 1 1 28 LEU HD21 H   -1.318   3.091  -7.810 1.00 . A A .  28 LEU HD21 1 1 
       16  9713 1 1 28 LEU HD22 H   -2.050   1.487  -7.857 1.00 . A A .  28 LEU HD22 1 1 
       16  9714 1 1 28 LEU HD23 H   -0.399   1.720  -8.432 1.00 . A A .  28 LEU HD23 1 1 
       16  9715 1 1 28 LEU HG   H   -0.062   0.816  -6.330 1.00 . A A .  28 LEU HG   1 1 
       16  9716 1 1 28 LEU N    N    2.425   3.494  -4.722 1.00 . A A .  28 LEU N    1 1 
       16  9717 1 1 28 LEU O    O    1.631   0.105  -4.522 1.00 . A A .  28 LEU O    1 1 
       16  9718 1 1 29 ALA C    C    4.083  -0.904  -5.331 1.00 . A A .  29 ALA C    1 1 
       16  9719 1 1 29 ALA CA   C    3.522  -0.149  -6.531 1.00 . A A .  29 ALA CA   1 1 
       16  9720 1 1 29 ALA CB   C    4.626   0.143  -7.537 1.00 . A A .  29 ALA CB   1 1 
       16  9721 1 1 29 ALA H    H    3.111   1.927  -6.569 1.00 . A A .  29 ALA H    1 1 
       16  9722 1 1 29 ALA HA   H    2.780  -0.766  -7.017 1.00 . A A .  29 ALA HA   1 1 
       16  9723 1 1 29 ALA HB1  H    4.364  -0.284  -8.493 1.00 . A A .  29 ALA HB1  1 1 
       16  9724 1 1 29 ALA HB2  H    4.744   1.212  -7.640 1.00 . A A .  29 ALA HB2  1 1 
       16  9725 1 1 29 ALA HB3  H    5.552  -0.290  -7.190 1.00 . A A .  29 ALA HB3  1 1 
       16  9726 1 1 29 ALA N    N    2.876   1.090  -6.116 1.00 . A A .  29 ALA N    1 1 
       16  9727 1 1 29 ALA O    O    3.746  -2.067  -5.104 1.00 . A A .  29 ALA O    1 1 
       16  9728 1 1 30 ILE C    C    4.534  -1.684  -2.619 1.00 . A A .  30 ILE C    1 1 
       16  9729 1 1 30 ILE CA   C    5.548  -0.846  -3.389 1.00 . A A .  30 ILE CA   1 1 
       16  9730 1 1 30 ILE CB   C    6.139   0.219  -2.446 1.00 . A A .  30 ILE CB   1 1 
       16  9731 1 1 30 ILE CD1  C    7.431   2.408  -2.570 1.00 . A A .  30 ILE CD1  1 1 
       16  9732 1 1 30 ILE CG1  C    7.207   1.039  -3.172 1.00 . A A .  30 ILE CG1  1 1 
       16  9733 1 1 30 ILE CG2  C    6.722  -0.439  -1.204 1.00 . A A .  30 ILE CG2  1 1 
       16  9734 1 1 30 ILE H    H    5.170   0.687  -4.798 1.00 . A A .  30 ILE H    1 1 
       16  9735 1 1 30 ILE HA   H    6.351  -1.488  -3.723 1.00 . A A .  30 ILE HA   1 1 
       16  9736 1 1 30 ILE HB   H    5.341   0.875  -2.135 1.00 . A A .  30 ILE HB   1 1 
       16  9737 1 1 30 ILE HD11 H    8.222   2.353  -1.836 1.00 . A A .  30 ILE HD11 1 1 
       16  9738 1 1 30 ILE HD12 H    7.711   3.103  -3.348 1.00 . A A .  30 ILE HD12 1 1 
       16  9739 1 1 30 ILE HD13 H    6.523   2.746  -2.094 1.00 . A A .  30 ILE HD13 1 1 
       16  9740 1 1 30 ILE HG12 H    8.144   0.506  -3.142 1.00 . A A .  30 ILE HG12 1 1 
       16  9741 1 1 30 ILE HG13 H    6.908   1.174  -4.202 1.00 . A A .  30 ILE HG13 1 1 
       16  9742 1 1 30 ILE HG21 H    6.745   0.276  -0.395 1.00 . A A .  30 ILE HG21 1 1 
       16  9743 1 1 30 ILE HG22 H    6.109  -1.282  -0.922 1.00 . A A .  30 ILE HG22 1 1 
       16  9744 1 1 30 ILE HG23 H    7.726  -0.777  -1.413 1.00 . A A .  30 ILE HG23 1 1 
       16  9745 1 1 30 ILE N    N    4.941  -0.237  -4.566 1.00 . A A .  30 ILE N    1 1 
       16  9746 1 1 30 ILE O    O    4.845  -2.781  -2.153 1.00 . A A .  30 ILE O    1 1 
       16  9747 1 1 31 HIS C    C    1.703  -3.010  -2.620 1.00 . A A .  31 HIS C    1 1 
       16  9748 1 1 31 HIS CA   C    2.256  -1.864  -1.778 1.00 . A A .  31 HIS CA   1 1 
       16  9749 1 1 31 HIS CB   C    1.131  -0.895  -1.413 1.00 . A A .  31 HIS CB   1 1 
       16  9750 1 1 31 HIS CD2  C   -1.290  -1.763  -1.748 1.00 . A A .  31 HIS CD2  1 1 
       16  9751 1 1 31 HIS CE1  C   -1.577  -2.679   0.223 1.00 . A A .  31 HIS CE1  1 1 
       16  9752 1 1 31 HIS CG   C   -0.150  -1.576  -1.043 1.00 . A A .  31 HIS CG   1 1 
       16  9753 1 1 31 HIS H    H    3.131  -0.284  -2.883 1.00 . A A .  31 HIS H    1 1 
       16  9754 1 1 31 HIS HA   H    2.677  -2.271  -0.871 1.00 . A A .  31 HIS HA   1 1 
       16  9755 1 1 31 HIS HB2  H    1.442  -0.293  -0.572 1.00 . A A .  31 HIS HB2  1 1 
       16  9756 1 1 31 HIS HB3  H    0.932  -0.250  -2.257 1.00 . A A .  31 HIS HB3  1 1 
       16  9757 1 1 31 HIS HD1  H    0.281  -2.192   0.925 1.00 . A A .  31 HIS HD1  1 1 
       16  9758 1 1 31 HIS HD2  H   -1.480  -1.433  -2.760 1.00 . A A .  31 HIS HD2  1 1 
       16  9759 1 1 31 HIS HE1  H   -2.019  -3.201   1.059 1.00 . A A .  31 HIS HE1  1 1 
       16  9760 1 1 31 HIS N    N    3.318  -1.162  -2.490 1.00 . A A .  31 HIS N    1 1 
       16  9761 1 1 31 HIS ND1  N   -0.363  -2.161   0.188 1.00 . A A .  31 HIS ND1  1 1 
       16  9762 1 1 31 HIS NE2  N   -2.161  -2.452  -0.940 1.00 . A A .  31 HIS NE2  1 1 
       16  9763 1 1 31 HIS O    O    1.546  -4.129  -2.133 1.00 . A A .  31 HIS O    1 1 
       16  9764 1 1 32 GLN C    C    1.690  -5.014  -4.723 1.00 . A A .  32 GLN C    1 1 
       16  9765 1 1 32 GLN CA   C    0.873  -3.728  -4.792 1.00 . A A .  32 GLN CA   1 1 
       16  9766 1 1 32 GLN CB   C    0.857  -3.196  -6.226 1.00 . A A .  32 GLN CB   1 1 
       16  9767 1 1 32 GLN CD   C   -0.371  -1.693  -7.843 1.00 . A A .  32 GLN CD   1 1 
       16  9768 1 1 32 GLN CG   C    0.019  -1.939  -6.399 1.00 . A A .  32 GLN CG   1 1 
       16  9769 1 1 32 GLN H    H    1.557  -1.811  -4.213 1.00 . A A .  32 GLN H    1 1 
       16  9770 1 1 32 GLN HA   H   -0.140  -3.944  -4.486 1.00 . A A .  32 GLN HA   1 1 
       16  9771 1 1 32 GLN HB2  H    1.870  -2.972  -6.525 1.00 . A A .  32 GLN HB2  1 1 
       16  9772 1 1 32 GLN HB3  H    0.459  -3.960  -6.876 1.00 . A A .  32 GLN HB3  1 1 
       16  9773 1 1 32 GLN HE21 H   -2.123  -0.950  -7.268 1.00 . A A .  32 GLN HE21 1 1 
       16  9774 1 1 32 GLN HE22 H   -1.846  -0.985  -8.973 1.00 . A A .  32 GLN HE22 1 1 
       16  9775 1 1 32 GLN HG2  H   -0.881  -2.038  -5.811 1.00 . A A .  32 GLN HG2  1 1 
       16  9776 1 1 32 GLN HG3  H    0.588  -1.092  -6.045 1.00 . A A .  32 GLN HG3  1 1 
       16  9777 1 1 32 GLN N    N    1.409  -2.722  -3.884 1.00 . A A .  32 GLN N    1 1 
       16  9778 1 1 32 GLN NE2  N   -1.568  -1.156  -8.049 1.00 . A A .  32 GLN NE2  1 1 
       16  9779 1 1 32 GLN O    O    1.218  -6.082  -5.112 1.00 . A A .  32 GLN O    1 1 
       16  9780 1 1 32 GLN OE1  O    0.394  -1.983  -8.763 1.00 . A A .  32 GLN OE1  1 1 
       16  9781 1 1 33 ALA C    C    3.456  -6.885  -2.871 1.00 . A A .  33 ALA C    1 1 
       16  9782 1 1 33 ALA CA   C    3.800  -6.058  -4.105 1.00 . A A .  33 ALA CA   1 1 
       16  9783 1 1 33 ALA CB   C    5.252  -5.609  -4.054 1.00 . A A .  33 ALA CB   1 1 
       16  9784 1 1 33 ALA H    H    3.237  -4.025  -3.933 1.00 . A A .  33 ALA H    1 1 
       16  9785 1 1 33 ALA HA   H    3.669  -6.671  -4.985 1.00 . A A .  33 ALA HA   1 1 
       16  9786 1 1 33 ALA HB1  H    5.519  -5.145  -4.992 1.00 . A A .  33 ALA HB1  1 1 
       16  9787 1 1 33 ALA HB2  H    5.380  -4.897  -3.251 1.00 . A A .  33 ALA HB2  1 1 
       16  9788 1 1 33 ALA HB3  H    5.888  -6.464  -3.882 1.00 . A A .  33 ALA HB3  1 1 
       16  9789 1 1 33 ALA N    N    2.918  -4.904  -4.226 1.00 . A A .  33 ALA N    1 1 
       16  9790 1 1 33 ALA O    O    4.212  -7.772  -2.474 1.00 . A A .  33 ALA O    1 1 
       16  9791 1 1 34 THR C    C    0.610  -8.118  -1.360 1.00 . A A .  34 THR C    1 1 
       16  9792 1 1 34 THR CA   C    1.866  -7.302  -1.076 1.00 . A A .  34 THR CA   1 1 
       16  9793 1 1 34 THR CB   C    1.584  -6.334   0.088 1.00 . A A .  34 THR CB   1 1 
       16  9794 1 1 34 THR CG2  C    0.273  -5.593  -0.130 1.00 . A A .  34 THR CG2  1 1 
       16  9795 1 1 34 THR H    H    1.750  -5.870  -2.630 1.00 . A A .  34 THR H    1 1 
       16  9796 1 1 34 THR HA   H    2.658  -7.972  -0.774 1.00 . A A .  34 THR HA   1 1 
       16  9797 1 1 34 THR HB   H    2.385  -5.610   0.138 1.00 . A A .  34 THR HB   1 1 
       16  9798 1 1 34 THR HG1  H    2.395  -7.046   1.739 1.00 . A A .  34 THR HG1  1 1 
       16  9799 1 1 34 THR HG21 H    0.464  -4.531  -0.177 1.00 . A A .  34 THR HG21 1 1 
       16  9800 1 1 34 THR HG22 H   -0.400  -5.802   0.688 1.00 . A A .  34 THR HG22 1 1 
       16  9801 1 1 34 THR HG23 H   -0.175  -5.919  -1.057 1.00 . A A .  34 THR HG23 1 1 
       16  9802 1 1 34 THR N    N    2.309  -6.588  -2.266 1.00 . A A .  34 THR N    1 1 
       16  9803 1 1 34 THR O    O    0.307  -9.078  -0.650 1.00 . A A .  34 THR O    1 1 
       16  9804 1 1 34 THR OG1  O    1.529  -7.055   1.324 1.00 . A A .  34 THR OG1  1 1 
       16  9805 1 1 35 HIS C    C   -1.029  -9.642  -3.649 1.00 . A A .  35 HIS C    1 1 
       16  9806 1 1 35 HIS CA   C   -1.342  -8.427  -2.781 1.00 . A A .  35 HIS CA   1 1 
       16  9807 1 1 35 HIS CB   C   -2.283  -7.481  -3.528 1.00 . A A .  35 HIS CB   1 1 
       16  9808 1 1 35 HIS CD2  C   -2.960  -5.220  -2.451 1.00 . A A .  35 HIS CD2  1 1 
       16  9809 1 1 35 HIS CE1  C   -4.523  -5.961  -1.105 1.00 . A A .  35 HIS CE1  1 1 
       16  9810 1 1 35 HIS CG   C   -3.046  -6.560  -2.626 1.00 . A A .  35 HIS CG   1 1 
       16  9811 1 1 35 HIS H    H    0.175  -6.958  -2.929 1.00 . A A .  35 HIS H    1 1 
       16  9812 1 1 35 HIS HA   H   -1.827  -8.762  -1.876 1.00 . A A .  35 HIS HA   1 1 
       16  9813 1 1 35 HIS HB2  H   -1.706  -6.874  -4.209 1.00 . A A .  35 HIS HB2  1 1 
       16  9814 1 1 35 HIS HB3  H   -2.998  -8.064  -4.090 1.00 . A A .  35 HIS HB3  1 1 
       16  9815 1 1 35 HIS HD1  H   -4.332  -7.921  -1.661 1.00 . A A .  35 HIS HD1  1 1 
       16  9816 1 1 35 HIS HD2  H   -2.286  -4.548  -2.964 1.00 . A A .  35 HIS HD2  1 1 
       16  9817 1 1 35 HIS HE1  H   -5.308  -6.000  -0.365 1.00 . A A .  35 HIS HE1  1 1 
       16  9818 1 1 35 HIS N    N   -0.118  -7.730  -2.402 1.00 . A A .  35 HIS N    1 1 
       16  9819 1 1 35 HIS ND1  N   -4.033  -6.994  -1.767 1.00 . A A .  35 HIS ND1  1 1 
       16  9820 1 1 35 HIS NE2  N   -3.888  -4.873  -1.501 1.00 . A A .  35 HIS NE2  1 1 
       16  9821 1 1 35 HIS O    O   -1.148  -9.590  -4.873 1.00 . A A .  35 HIS O    1 1 
       16  9822 1 1 36 SER C    C   -1.504 -12.886  -3.808 1.00 . A A .  36 SER C    1 1 
       16  9823 1 1 36 SER CA   C   -0.294 -11.961  -3.721 1.00 . A A .  36 SER CA   1 1 
       16  9824 1 1 36 SER CB   C    0.864 -12.681  -3.026 1.00 . A A .  36 SER CB   1 1 
       16  9825 1 1 36 SER H    H   -0.553 -10.714  -2.029 1.00 . A A .  36 SER H    1 1 
       16  9826 1 1 36 SER HA   H    0.010 -11.691  -4.721 1.00 . A A .  36 SER HA   1 1 
       16  9827 1 1 36 SER HB2  H    0.619 -12.830  -1.985 1.00 . A A .  36 SER HB2  1 1 
       16  9828 1 1 36 SER HB3  H    1.024 -13.640  -3.499 1.00 . A A .  36 SER HB3  1 1 
       16  9829 1 1 36 SER HG   H    1.843 -10.995  -3.211 1.00 . A A .  36 SER HG   1 1 
       16  9830 1 1 36 SER N    N   -0.628 -10.735  -3.007 1.00 . A A .  36 SER N    1 1 
       16  9831 1 1 36 SER O    O   -1.720 -13.728  -2.937 1.00 . A A .  36 SER O    1 1 
       16  9832 1 1 36 SER OG   O    2.059 -11.925  -3.110 1.00 . A A .  36 SER OG   1 1 
       16  9833 1 1 37 GLY C    C   -4.138 -13.904  -3.736 1.00 . A A .  37 GLY C    1 1 
       16  9834 1 1 37 GLY CA   C   -3.470 -13.549  -5.050 1.00 . A A .  37 GLY CA   1 1 
       16  9835 1 1 37 GLY H    H   -2.069 -12.035  -5.530 1.00 . A A .  37 GLY H    1 1 
       16  9836 1 1 37 GLY HA2  H   -4.176 -13.017  -5.669 1.00 . A A .  37 GLY HA2  1 1 
       16  9837 1 1 37 GLY HA3  H   -3.182 -14.461  -5.552 1.00 . A A .  37 GLY HA3  1 1 
       16  9838 1 1 37 GLY N    N   -2.291 -12.723  -4.867 1.00 . A A .  37 GLY N    1 1 
       16  9839 1 1 37 GLY O    O   -4.521 -13.021  -2.970 1.00 . A A .  37 GLY O    1 1 
       16  9840 1 1 38 GLU C    C   -4.225 -16.931  -1.734 1.00 . A A .  38 GLU C    1 1 
       16  9841 1 1 38 GLU CA   C   -4.910 -15.669  -2.249 1.00 . A A .  38 GLU CA   1 1 
       16  9842 1 1 38 GLU CB   C   -6.397 -15.942  -2.484 1.00 . A A .  38 GLU CB   1 1 
       16  9843 1 1 38 GLU CD   C   -8.161 -16.938  -3.993 1.00 . A A .  38 GLU CD   1 1 
       16  9844 1 1 38 GLU CG   C   -6.678 -16.738  -3.747 1.00 . A A .  38 GLU CG   1 1 
       16  9845 1 1 38 GLU H    H   -3.955 -15.856  -4.129 1.00 . A A .  38 GLU H    1 1 
       16  9846 1 1 38 GLU HA   H   -4.809 -14.891  -1.507 1.00 . A A .  38 GLU HA   1 1 
       16  9847 1 1 38 GLU HB2  H   -6.787 -16.493  -1.641 1.00 . A A .  38 GLU HB2  1 1 
       16  9848 1 1 38 GLU HB3  H   -6.917 -14.998  -2.556 1.00 . A A .  38 GLU HB3  1 1 
       16  9849 1 1 38 GLU HG2  H   -6.257 -16.211  -4.590 1.00 . A A .  38 GLU HG2  1 1 
       16  9850 1 1 38 GLU HG3  H   -6.208 -17.707  -3.659 1.00 . A A .  38 GLU HG3  1 1 
       16  9851 1 1 38 GLU N    N   -4.280 -15.200  -3.478 1.00 . A A .  38 GLU N    1 1 
       16  9852 1 1 38 GLU O    O   -4.205 -17.960  -2.409 1.00 . A A .  38 GLU O    1 1 
       16  9853 1 1 38 GLU OE1  O   -8.849 -17.453  -3.087 1.00 . A A .  38 GLU OE1  1 1 
       16  9854 1 1 38 GLU OE2  O   -8.633 -16.580  -5.092 1.00 . A A .  38 GLU OE2  1 1 
       16  9855 1 1 39 LYS C    C   -3.686 -18.421   1.352 1.00 . A A .  39 LYS C    1 1 
       16  9856 1 1 39 LYS CA   C   -2.978 -17.978   0.076 1.00 . A A .  39 LYS CA   1 1 
       16  9857 1 1 39 LYS CB   C   -1.524 -17.614   0.387 1.00 . A A .  39 LYS CB   1 1 
       16  9858 1 1 39 LYS CD   C    0.833 -18.441   0.121 1.00 . A A .  39 LYS CD   1 1 
       16  9859 1 1 39 LYS CE   C    1.079 -18.490  -1.379 1.00 . A A .  39 LYS CE   1 1 
       16  9860 1 1 39 LYS CG   C   -0.599 -18.816   0.463 1.00 . A A .  39 LYS CG   1 1 
       16  9861 1 1 39 LYS H    H   -3.713 -15.996  -0.042 1.00 . A A .  39 LYS H    1 1 
       16  9862 1 1 39 LYS HA   H   -2.993 -18.793  -0.631 1.00 . A A .  39 LYS HA   1 1 
       16  9863 1 1 39 LYS HB2  H   -1.159 -16.953  -0.385 1.00 . A A .  39 LYS HB2  1 1 
       16  9864 1 1 39 LYS HB3  H   -1.490 -17.099   1.336 1.00 . A A .  39 LYS HB3  1 1 
       16  9865 1 1 39 LYS HD2  H    1.027 -17.438   0.473 1.00 . A A .  39 LYS HD2  1 1 
       16  9866 1 1 39 LYS HD3  H    1.504 -19.132   0.611 1.00 . A A .  39 LYS HD3  1 1 
       16  9867 1 1 39 LYS HE2  H    2.116 -18.734  -1.552 1.00 . A A .  39 LYS HE2  1 1 
       16  9868 1 1 39 LYS HE3  H    0.452 -19.258  -1.808 1.00 . A A .  39 LYS HE3  1 1 
       16  9869 1 1 39 LYS HG2  H   -0.625 -19.216   1.466 1.00 . A A .  39 LYS HG2  1 1 
       16  9870 1 1 39 LYS HG3  H   -0.942 -19.567  -0.235 1.00 . A A .  39 LYS HG3  1 1 
       16  9871 1 1 39 LYS HZ1  H    0.833 -16.416  -1.343 1.00 . A A .  39 LYS HZ1  1 1 
       16  9872 1 1 39 LYS HZ2  H   -0.192 -17.210  -2.431 1.00 . A A .  39 LYS HZ2  1 1 
       16  9873 1 1 39 LYS HZ3  H    1.445 -17.009  -2.805 1.00 . A A .  39 LYS HZ3  1 1 
       16  9874 1 1 39 LYS N    N   -3.664 -16.844  -0.532 1.00 . A A .  39 LYS N    1 1 
       16  9875 1 1 39 LYS NZ   N    0.770 -17.190  -2.035 1.00 . A A .  39 LYS NZ   1 1 
       16  9876 1 1 39 LYS O    O   -3.190 -18.233   2.463 1.00 . A A .  39 LYS O    1 1 
       16  9877 1 1 40 PRO C    C   -5.039 -20.718   3.005 1.00 . A A .  40 PRO C    1 1 
       16  9878 1 1 40 PRO CA   C   -5.673 -19.511   2.321 1.00 . A A .  40 PRO CA   1 1 
       16  9879 1 1 40 PRO CB   C   -7.003 -19.901   1.671 1.00 . A A .  40 PRO CB   1 1 
       16  9880 1 1 40 PRO CD   C   -5.524 -19.284  -0.103 1.00 . A A .  40 PRO CD   1 1 
       16  9881 1 1 40 PRO CG   C   -6.657 -20.206   0.255 1.00 . A A .  40 PRO CG   1 1 
       16  9882 1 1 40 PRO HA   H   -5.841 -18.732   3.051 1.00 . A A .  40 PRO HA   1 1 
       16  9883 1 1 40 PRO HB2  H   -7.411 -20.766   2.174 1.00 . A A .  40 PRO HB2  1 1 
       16  9884 1 1 40 PRO HB3  H   -7.696 -19.077   1.739 1.00 . A A .  40 PRO HB3  1 1 
       16  9885 1 1 40 PRO HD2  H   -4.844 -19.770  -0.787 1.00 . A A .  40 PRO HD2  1 1 
       16  9886 1 1 40 PRO HD3  H   -5.904 -18.369  -0.532 1.00 . A A .  40 PRO HD3  1 1 
       16  9887 1 1 40 PRO HG2  H   -6.345 -21.236   0.166 1.00 . A A .  40 PRO HG2  1 1 
       16  9888 1 1 40 PRO HG3  H   -7.510 -20.015  -0.380 1.00 . A A .  40 PRO HG3  1 1 
       16  9889 1 1 40 PRO N    N   -4.873 -19.026   1.192 1.00 . A A .  40 PRO N    1 1 
       16  9890 1 1 40 PRO O    O   -4.010 -21.226   2.560 1.00 . A A .  40 PRO O    1 1 
       16  9891 1 1 41 SER C    C   -5.909 -23.589   4.456 1.00 . A A .  41 SER C    1 1 
       16  9892 1 1 41 SER CA   C   -5.155 -22.318   4.836 1.00 . A A .  41 SER CA   1 1 
       16  9893 1 1 41 SER CB   C   -5.280 -22.068   6.340 1.00 . A A .  41 SER CB   1 1 
       16  9894 1 1 41 SER H    H   -6.477 -20.724   4.394 1.00 . A A .  41 SER H    1 1 
       16  9895 1 1 41 SER HA   H   -4.113 -22.443   4.585 1.00 . A A .  41 SER HA   1 1 
       16  9896 1 1 41 SER HB2  H   -4.977 -21.055   6.560 1.00 . A A .  41 SER HB2  1 1 
       16  9897 1 1 41 SER HB3  H   -6.308 -22.209   6.641 1.00 . A A .  41 SER HB3  1 1 
       16  9898 1 1 41 SER HG   H   -4.019 -22.482   7.780 1.00 . A A .  41 SER HG   1 1 
       16  9899 1 1 41 SER N    N   -5.661 -21.172   4.088 1.00 . A A .  41 SER N    1 1 
       16  9900 1 1 41 SER O    O   -7.120 -23.686   4.646 1.00 . A A .  41 SER O    1 1 
       16  9901 1 1 41 SER OG   O   -4.461 -22.960   7.075 1.00 . A A .  41 SER OG   1 1 
       16  9902 1 1 42 GLY C    C   -4.819 -26.975   3.547 1.00 . A A .  42 GLY C    1 1 
       16  9903 1 1 42 GLY CA   C   -5.795 -25.815   3.518 1.00 . A A .  42 GLY CA   1 1 
       16  9904 1 1 42 GLY H    H   -4.218 -24.429   3.789 1.00 . A A .  42 GLY H    1 1 
       16  9905 1 1 42 GLY HA2  H   -6.614 -26.031   4.188 1.00 . A A .  42 GLY HA2  1 1 
       16  9906 1 1 42 GLY HA3  H   -6.182 -25.710   2.515 1.00 . A A .  42 GLY HA3  1 1 
       16  9907 1 1 42 GLY N    N   -5.180 -24.562   3.917 1.00 . A A .  42 GLY N    1 1 
       16  9908 1 1 42 GLY O    O   -4.236 -27.348   2.529 1.00 . A A .  42 GLY O    1 1 
       16  9909 1 1 43 PRO C    C   -4.232 -29.970   4.265 1.00 . A A .  43 PRO C    1 1 
       16  9910 1 1 43 PRO CA   C   -3.716 -28.695   4.923 1.00 . A A .  43 PRO CA   1 1 
       16  9911 1 1 43 PRO CB   C   -3.664 -28.863   6.444 1.00 . A A .  43 PRO CB   1 1 
       16  9912 1 1 43 PRO CD   C   -5.291 -27.170   5.992 1.00 . A A .  43 PRO CD   1 1 
       16  9913 1 1 43 PRO CG   C   -4.952 -28.294   6.932 1.00 . A A .  43 PRO CG   1 1 
       16  9914 1 1 43 PRO HA   H   -2.727 -28.473   4.549 1.00 . A A .  43 PRO HA   1 1 
       16  9915 1 1 43 PRO HB2  H   -3.575 -29.911   6.690 1.00 . A A .  43 PRO HB2  1 1 
       16  9916 1 1 43 PRO HB3  H   -2.818 -28.321   6.840 1.00 . A A .  43 PRO HB3  1 1 
       16  9917 1 1 43 PRO HD2  H   -6.360 -27.100   5.859 1.00 . A A .  43 PRO HD2  1 1 
       16  9918 1 1 43 PRO HD3  H   -4.892 -26.237   6.361 1.00 . A A .  43 PRO HD3  1 1 
       16  9919 1 1 43 PRO HG2  H   -5.721 -29.051   6.905 1.00 . A A .  43 PRO HG2  1 1 
       16  9920 1 1 43 PRO HG3  H   -4.829 -27.918   7.937 1.00 . A A .  43 PRO HG3  1 1 
       16  9921 1 1 43 PRO N    N   -4.629 -27.564   4.737 1.00 . A A .  43 PRO N    1 1 
       16  9922 1 1 43 PRO O    O   -3.576 -31.011   4.306 1.00 . A A .  43 PRO O    1 1 
       16  9923 1 1 44 SER C    C   -4.961 -31.850   2.256 1.00 . A A .  44 SER C    1 1 
       16  9924 1 1 44 SER CA   C   -6.016 -31.030   2.992 1.00 . A A .  44 SER CA   1 1 
       16  9925 1 1 44 SER CB   C   -7.095 -30.568   2.011 1.00 . A A .  44 SER CB   1 1 
       16  9926 1 1 44 SER H    H   -5.886 -29.025   3.658 1.00 . A A .  44 SER H    1 1 
       16  9927 1 1 44 SER HA   H   -6.472 -31.650   3.750 1.00 . A A .  44 SER HA   1 1 
       16  9928 1 1 44 SER HB2  H   -6.633 -30.024   1.202 1.00 . A A .  44 SER HB2  1 1 
       16  9929 1 1 44 SER HB3  H   -7.613 -31.430   1.617 1.00 . A A .  44 SER HB3  1 1 
       16  9930 1 1 44 SER HG   H   -8.874 -29.765   2.182 1.00 . A A .  44 SER HG   1 1 
       16  9931 1 1 44 SER N    N   -5.411 -29.882   3.657 1.00 . A A .  44 SER N    1 1 
       16  9932 1 1 44 SER O    O   -4.754 -33.026   2.553 1.00 . A A .  44 SER O    1 1 
       16  9933 1 1 44 SER OG   O   -8.037 -29.723   2.650 1.00 . A A .  44 SER OG   1 1 
       16  9934 1 1 45 SER C    C   -1.960 -31.099   0.540 1.00 . A A .  45 SER C    1 1 
       16  9935 1 1 45 SER CA   C   -3.265 -31.889   0.510 1.00 . A A .  45 SER CA   1 1 
       16  9936 1 1 45 SER CB   C   -3.730 -32.072  -0.936 1.00 . A A .  45 SER CB   1 1 
       16  9937 1 1 45 SER H    H   -4.507 -30.281   1.103 1.00 . A A .  45 SER H    1 1 
       16  9938 1 1 45 SER HA   H   -3.094 -32.861   0.949 1.00 . A A .  45 SER HA   1 1 
       16  9939 1 1 45 SER HB2  H   -3.937 -31.105  -1.370 1.00 . A A .  45 SER HB2  1 1 
       16  9940 1 1 45 SER HB3  H   -2.952 -32.562  -1.503 1.00 . A A .  45 SER HB3  1 1 
       16  9941 1 1 45 SER HG   H   -5.238 -32.871  -1.899 1.00 . A A .  45 SER HG   1 1 
       16  9942 1 1 45 SER N    N   -4.296 -31.219   1.293 1.00 . A A .  45 SER N    1 1 
       16  9943 1 1 45 SER O    O   -1.930 -29.945   0.965 1.00 . A A .  45 SER O    1 1 
       16  9944 1 1 45 SER OG   O   -4.906 -32.861  -0.998 1.00 . A A .  45 SER OG   1 1 
       16  9945 1 1 46 GLY C    C    0.952 -30.893  -1.334 1.00 . A A .  46 GLY C    1 1 
       16  9946 1 1 46 GLY CA   C    0.412 -31.074   0.070 1.00 . A A .  46 GLY CA   1 1 
       16  9947 1 1 46 GLY H    H   -0.966 -32.652  -0.240 1.00 . A A .  46 GLY H    1 1 
       16  9948 1 1 46 GLY HA2  H    0.316 -30.104   0.536 1.00 . A A .  46 GLY HA2  1 1 
       16  9949 1 1 46 GLY HA3  H    1.112 -31.668   0.639 1.00 . A A .  46 GLY HA3  1 1 
       16  9950 1 1 46 GLY N    N   -0.882 -31.732   0.087 1.00 . A A .  46 GLY N    1 1 
       16  9951 1 1 46 GLY O    O    0.193 -30.512  -2.224 1.00 . A A .  46 GLY O    1 1 
       16  9952 2 2  1 ZN  ZN   ZN  -4.022  -2.797  -1.503 1.00 . B A . 201 ZN  ZN   1 1 
       17  9953 1 1  1 GLY C    C  -28.893   7.861   5.077 1.00 . A A .   1 GLY C    1 1 
       17  9954 1 1  1 GLY CA   C  -28.838   6.347   5.015 1.00 . A A .   1 GLY CA   1 1 
       17  9955 1 1  1 GLY H1   H  -27.430   6.210   6.591 1.00 . A A .   1 GLY H1   1 1 
       17  9956 1 1  1 GLY HA2  H  -28.285   6.053   4.136 1.00 . A A .   1 GLY HA2  1 1 
       17  9957 1 1  1 GLY HA3  H  -29.846   5.965   4.939 1.00 . A A .   1 GLY HA3  1 1 
       17  9958 1 1  1 GLY N    N  -28.204   5.767   6.185 1.00 . A A .   1 GLY N    1 1 
       17  9959 1 1  1 GLY O    O  -28.069   8.544   4.469 1.00 . A A .   1 GLY O    1 1 
       17  9960 1 1  2 SER C    C  -28.788  10.461   6.568 1.00 . A A .   2 SER C    1 1 
       17  9961 1 1  2 SER CA   C  -30.030   9.830   5.946 1.00 . A A .   2 SER CA   1 1 
       17  9962 1 1  2 SER CB   C  -31.260  10.149   6.798 1.00 . A A .   2 SER CB   1 1 
       17  9963 1 1  2 SER H    H  -30.494   7.790   6.273 1.00 . A A .   2 SER H    1 1 
       17  9964 1 1  2 SER HA   H  -30.171  10.241   4.957 1.00 . A A .   2 SER HA   1 1 
       17  9965 1 1  2 SER HB2  H  -31.301  11.212   6.983 1.00 . A A .   2 SER HB2  1 1 
       17  9966 1 1  2 SER HB3  H  -32.150   9.840   6.270 1.00 . A A .   2 SER HB3  1 1 
       17  9967 1 1  2 SER HG   H  -31.807   8.721   8.023 1.00 . A A .   2 SER HG   1 1 
       17  9968 1 1  2 SER N    N  -29.867   8.387   5.812 1.00 . A A .   2 SER N    1 1 
       17  9969 1 1  2 SER O    O  -28.702  10.618   7.786 1.00 . A A .   2 SER O    1 1 
       17  9970 1 1  2 SER OG   O  -31.208   9.471   8.042 1.00 . A A .   2 SER OG   1 1 
       17  9971 1 1  3 SER C    C  -25.825  12.063   5.028 1.00 . A A .   3 SER C    1 1 
       17  9972 1 1  3 SER CA   C  -26.588  11.431   6.188 1.00 . A A .   3 SER CA   1 1 
       17  9973 1 1  3 SER CB   C  -25.711  10.388   6.882 1.00 . A A .   3 SER CB   1 1 
       17  9974 1 1  3 SER H    H  -27.956  10.669   4.762 1.00 . A A .   3 SER H    1 1 
       17  9975 1 1  3 SER HA   H  -26.845  12.203   6.898 1.00 . A A .   3 SER HA   1 1 
       17  9976 1 1  3 SER HB2  H  -25.732   9.469   6.316 1.00 . A A .   3 SER HB2  1 1 
       17  9977 1 1  3 SER HB3  H  -24.696  10.754   6.937 1.00 . A A .   3 SER HB3  1 1 
       17  9978 1 1  3 SER HG   H  -26.641  10.894   8.530 1.00 . A A .   3 SER HG   1 1 
       17  9979 1 1  3 SER N    N  -27.828  10.820   5.722 1.00 . A A .   3 SER N    1 1 
       17  9980 1 1  3 SER O    O  -26.164  11.861   3.863 1.00 . A A .   3 SER O    1 1 
       17  9981 1 1  3 SER OG   O  -26.173  10.126   8.196 1.00 . A A .   3 SER OG   1 1 
       17  9982 1 1  4 GLY C    C  -22.843  12.619   3.858 1.00 . A A .   4 GLY C    1 1 
       17  9983 1 1  4 GLY CA   C  -23.994  13.482   4.333 1.00 . A A .   4 GLY CA   1 1 
       17  9984 1 1  4 GLY H    H  -24.566  12.957   6.303 1.00 . A A .   4 GLY H    1 1 
       17  9985 1 1  4 GLY HA2  H  -24.630  13.712   3.491 1.00 . A A .   4 GLY HA2  1 1 
       17  9986 1 1  4 GLY HA3  H  -23.597  14.403   4.733 1.00 . A A .   4 GLY HA3  1 1 
       17  9987 1 1  4 GLY N    N  -24.790  12.831   5.357 1.00 . A A .   4 GLY N    1 1 
       17  9988 1 1  4 GLY O    O  -22.142  12.008   4.665 1.00 . A A .   4 GLY O    1 1 
       17  9989 1 1  5 SER C    C  -21.152  12.329   0.609 1.00 . A A .   5 SER C    1 1 
       17  9990 1 1  5 SER CA   C  -21.575  11.767   1.962 1.00 . A A .   5 SER CA   1 1 
       17  9991 1 1  5 SER CB   C  -22.023  10.312   1.806 1.00 . A A .   5 SER CB   1 1 
       17  9992 1 1  5 SER H    H  -23.239  13.076   1.952 1.00 . A A .   5 SER H    1 1 
       17  9993 1 1  5 SER HA   H  -20.731  11.804   2.634 1.00 . A A .   5 SER HA   1 1 
       17  9994 1 1  5 SER HB2  H  -21.232   9.743   1.342 1.00 . A A .   5 SER HB2  1 1 
       17  9995 1 1  5 SER HB3  H  -22.241   9.899   2.780 1.00 . A A .   5 SER HB3  1 1 
       17  9996 1 1  5 SER HG   H  -23.035  10.675   0.168 1.00 . A A .   5 SER HG   1 1 
       17  9997 1 1  5 SER N    N  -22.647  12.566   2.544 1.00 . A A .   5 SER N    1 1 
       17  9998 1 1  5 SER O    O  -21.967  12.883  -0.129 1.00 . A A .   5 SER O    1 1 
       17  9999 1 1  5 SER OG   O  -23.185  10.220   1.000 1.00 . A A .   5 SER OG   1 1 
       17 10000 1 1  6 SER C    C  -18.958  11.521  -1.896 1.00 . A A .   6 SER C    1 1 
       17 10001 1 1  6 SER CA   C  -19.336  12.677  -0.975 1.00 . A A .   6 SER CA   1 1 
       17 10002 1 1  6 SER CB   C  -18.114  13.563  -0.723 1.00 . A A .   6 SER CB   1 1 
       17 10003 1 1  6 SER H    H  -19.269  11.730   0.918 1.00 . A A .   6 SER H    1 1 
       17 10004 1 1  6 SER HA   H  -20.105  13.266  -1.452 1.00 . A A .   6 SER HA   1 1 
       17 10005 1 1  6 SER HB2  H  -17.546  13.163   0.103 1.00 . A A .   6 SER HB2  1 1 
       17 10006 1 1  6 SER HB3  H  -17.497  13.581  -1.610 1.00 . A A .   6 SER HB3  1 1 
       17 10007 1 1  6 SER HG   H  -18.958  15.276  -1.160 1.00 . A A .   6 SER HG   1 1 
       17 10008 1 1  6 SER N    N  -19.870  12.181   0.288 1.00 . A A .   6 SER N    1 1 
       17 10009 1 1  6 SER O    O  -18.563  10.450  -1.437 1.00 . A A .   6 SER O    1 1 
       17 10010 1 1  6 SER OG   O  -18.502  14.890  -0.409 1.00 . A A .   6 SER OG   1 1 
       17 10011 1 1  7 GLY C    C  -17.637  11.135  -5.102 1.00 . A A .   7 GLY C    1 1 
       17 10012 1 1  7 GLY CA   C  -18.753  10.716  -4.167 1.00 . A A .   7 GLY CA   1 1 
       17 10013 1 1  7 GLY H    H  -19.405  12.620  -3.509 1.00 . A A .   7 GLY H    1 1 
       17 10014 1 1  7 GLY HA2  H  -18.450   9.825  -3.637 1.00 . A A .   7 GLY HA2  1 1 
       17 10015 1 1  7 GLY HA3  H  -19.633  10.492  -4.753 1.00 . A A .   7 GLY HA3  1 1 
       17 10016 1 1  7 GLY N    N  -19.084  11.747  -3.200 1.00 . A A .   7 GLY N    1 1 
       17 10017 1 1  7 GLY O    O  -16.757  10.338  -5.429 1.00 . A A .   7 GLY O    1 1 
       17 10018 1 1  8 THR C    C  -15.412  13.353  -5.680 1.00 . A A .   8 THR C    1 1 
       17 10019 1 1  8 THR CA   C  -16.657  12.915  -6.443 1.00 . A A .   8 THR CA   1 1 
       17 10020 1 1  8 THR CB   C  -17.193  14.107  -7.258 1.00 . A A .   8 THR CB   1 1 
       17 10021 1 1  8 THR CG2  C  -18.347  13.678  -8.151 1.00 . A A .   8 THR CG2  1 1 
       17 10022 1 1  8 THR H    H  -18.398  12.978  -5.242 1.00 . A A .   8 THR H    1 1 
       17 10023 1 1  8 THR HA   H  -16.387  12.127  -7.132 1.00 . A A .   8 THR HA   1 1 
       17 10024 1 1  8 THR HB   H  -16.395  14.485  -7.882 1.00 . A A .   8 THR HB   1 1 
       17 10025 1 1  8 THR HG1  H  -18.215  15.743  -6.847 1.00 . A A .   8 THR HG1  1 1 
       17 10026 1 1  8 THR HG21 H  -17.961  13.362  -9.109 1.00 . A A .   8 THR HG21 1 1 
       17 10027 1 1  8 THR HG22 H  -19.022  14.508  -8.292 1.00 . A A .   8 THR HG22 1 1 
       17 10028 1 1  8 THR HG23 H  -18.875  12.858  -7.688 1.00 . A A .   8 THR HG23 1 1 
       17 10029 1 1  8 THR N    N  -17.672  12.391  -5.537 1.00 . A A .   8 THR N    1 1 
       17 10030 1 1  8 THR O    O  -15.221  14.539  -5.415 1.00 . A A .   8 THR O    1 1 
       17 10031 1 1  8 THR OG1  O  -17.628  15.147  -6.375 1.00 . A A .   8 THR OG1  1 1 
       17 10032 1 1  9 GLY C    C  -12.211  13.093  -5.519 1.00 . A A .   9 GLY C    1 1 
       17 10033 1 1  9 GLY CA   C  -13.350  12.695  -4.602 1.00 . A A .   9 GLY CA   1 1 
       17 10034 1 1  9 GLY H    H  -14.772  11.460  -5.570 1.00 . A A .   9 GLY H    1 1 
       17 10035 1 1  9 GLY HA2  H  -13.549  13.507  -3.918 1.00 . A A .   9 GLY HA2  1 1 
       17 10036 1 1  9 GLY HA3  H  -13.054  11.825  -4.036 1.00 . A A .   9 GLY HA3  1 1 
       17 10037 1 1  9 GLY N    N  -14.567  12.388  -5.331 1.00 . A A .   9 GLY N    1 1 
       17 10038 1 1  9 GLY O    O  -12.425  13.386  -6.694 1.00 . A A .   9 GLY O    1 1 
       17 10039 1 1 10 GLU C    C   -8.577  12.755  -5.236 1.00 . A A .  10 GLU C    1 1 
       17 10040 1 1 10 GLU CA   C   -9.819  13.473  -5.757 1.00 . A A .  10 GLU CA   1 1 
       17 10041 1 1 10 GLU CB   C   -9.602  14.987  -5.711 1.00 . A A .  10 GLU CB   1 1 
       17 10042 1 1 10 GLU CD   C   -9.104  17.014  -4.289 1.00 . A A .  10 GLU CD   1 1 
       17 10043 1 1 10 GLU CG   C   -9.451  15.538  -4.303 1.00 . A A .  10 GLU CG   1 1 
       17 10044 1 1 10 GLU H    H  -10.889  12.861  -4.036 1.00 . A A .  10 GLU H    1 1 
       17 10045 1 1 10 GLU HA   H   -9.990  13.174  -6.780 1.00 . A A .  10 GLU HA   1 1 
       17 10046 1 1 10 GLU HB2  H   -8.709  15.228  -6.269 1.00 . A A .  10 GLU HB2  1 1 
       17 10047 1 1 10 GLU HB3  H  -10.448  15.473  -6.176 1.00 . A A .  10 GLU HB3  1 1 
       17 10048 1 1 10 GLU HG2  H  -10.381  15.398  -3.773 1.00 . A A .  10 GLU HG2  1 1 
       17 10049 1 1 10 GLU HG3  H   -8.665  14.994  -3.800 1.00 . A A .  10 GLU HG3  1 1 
       17 10050 1 1 10 GLU N    N  -10.996  13.105  -4.979 1.00 . A A .  10 GLU N    1 1 
       17 10051 1 1 10 GLU O    O   -8.289  12.776  -4.039 1.00 . A A .  10 GLU O    1 1 
       17 10052 1 1 10 GLU OE1  O   -8.442  17.477  -5.242 1.00 . A A .  10 GLU OE1  1 1 
       17 10053 1 1 10 GLU OE2  O   -9.493  17.707  -3.326 1.00 . A A .  10 GLU OE2  1 1 
       17 10054 1 1 11 LYS C    C   -5.857  10.970  -7.024 1.00 . A A .  11 LYS C    1 1 
       17 10055 1 1 11 LYS CA   C   -6.632  11.395  -5.780 1.00 . A A .  11 LYS CA   1 1 
       17 10056 1 1 11 LYS CB   C   -6.982  10.165  -4.939 1.00 . A A .  11 LYS CB   1 1 
       17 10057 1 1 11 LYS CD   C   -8.753   8.424  -4.563 1.00 . A A .  11 LYS CD   1 1 
       17 10058 1 1 11 LYS CE   C   -9.922   9.197  -3.973 1.00 . A A .  11 LYS CE   1 1 
       17 10059 1 1 11 LYS CG   C   -8.002   9.251  -5.594 1.00 . A A .  11 LYS CG   1 1 
       17 10060 1 1 11 LYS H    H   -8.125  12.139  -7.084 1.00 . A A .  11 LYS H    1 1 
       17 10061 1 1 11 LYS HA   H   -6.013  12.057  -5.194 1.00 . A A .  11 LYS HA   1 1 
       17 10062 1 1 11 LYS HB2  H   -6.081   9.597  -4.762 1.00 . A A .  11 LYS HB2  1 1 
       17 10063 1 1 11 LYS HB3  H   -7.381  10.495  -3.991 1.00 . A A .  11 LYS HB3  1 1 
       17 10064 1 1 11 LYS HD2  H   -9.130   7.530  -5.037 1.00 . A A .  11 LYS HD2  1 1 
       17 10065 1 1 11 LYS HD3  H   -8.073   8.153  -3.768 1.00 . A A .  11 LYS HD3  1 1 
       17 10066 1 1 11 LYS HE2  H  -10.334   9.839  -4.736 1.00 . A A .  11 LYS HE2  1 1 
       17 10067 1 1 11 LYS HE3  H  -10.675   8.493  -3.649 1.00 . A A .  11 LYS HE3  1 1 
       17 10068 1 1 11 LYS HG2  H   -8.712   9.852  -6.143 1.00 . A A .  11 LYS HG2  1 1 
       17 10069 1 1 11 LYS HG3  H   -7.491   8.584  -6.274 1.00 . A A .  11 LYS HG3  1 1 
       17 10070 1 1 11 LYS HZ1  H   -8.662   9.621  -2.361 1.00 . A A .  11 LYS HZ1  1 1 
       17 10071 1 1 11 LYS HZ2  H  -10.273  10.072  -2.109 1.00 . A A .  11 LYS HZ2  1 1 
       17 10072 1 1 11 LYS HZ3  H   -9.285  10.996  -3.124 1.00 . A A .  11 LYS HZ3  1 1 
       17 10073 1 1 11 LYS N    N   -7.844  12.120  -6.145 1.00 . A A .  11 LYS N    1 1 
       17 10074 1 1 11 LYS NZ   N   -9.506  10.030  -2.810 1.00 . A A .  11 LYS NZ   1 1 
       17 10075 1 1 11 LYS O    O   -6.434  10.617  -8.053 1.00 . A A .  11 LYS O    1 1 
       17 10076 1 1 12 PRO C    C   -3.680   9.124  -8.321 1.00 . A A .  12 PRO C    1 1 
       17 10077 1 1 12 PRO CA   C   -3.638  10.621  -8.036 1.00 . A A .  12 PRO CA   1 1 
       17 10078 1 1 12 PRO CB   C   -2.249  11.033  -7.541 1.00 . A A .  12 PRO CB   1 1 
       17 10079 1 1 12 PRO CD   C   -3.765  11.412  -5.732 1.00 . A A .  12 PRO CD   1 1 
       17 10080 1 1 12 PRO CG   C   -2.354  11.007  -6.055 1.00 . A A .  12 PRO CG   1 1 
       17 10081 1 1 12 PRO HA   H   -3.877  11.165  -8.938 1.00 . A A .  12 PRO HA   1 1 
       17 10082 1 1 12 PRO HB2  H   -1.513  10.326  -7.898 1.00 . A A .  12 PRO HB2  1 1 
       17 10083 1 1 12 PRO HB3  H   -2.013  12.022  -7.903 1.00 . A A .  12 PRO HB3  1 1 
       17 10084 1 1 12 PRO HD2  H   -4.117  10.888  -4.856 1.00 . A A .  12 PRO HD2  1 1 
       17 10085 1 1 12 PRO HD3  H   -3.827  12.480  -5.585 1.00 . A A .  12 PRO HD3  1 1 
       17 10086 1 1 12 PRO HG2  H   -2.156  10.011  -5.690 1.00 . A A .  12 PRO HG2  1 1 
       17 10087 1 1 12 PRO HG3  H   -1.655  11.710  -5.626 1.00 . A A .  12 PRO HG3  1 1 
       17 10088 1 1 12 PRO N    N   -4.520  11.002  -6.928 1.00 . A A .  12 PRO N    1 1 
       17 10089 1 1 12 PRO O    O   -3.805   8.705  -9.472 1.00 . A A .  12 PRO O    1 1 
       17 10090 1 1 13 TYR C    C   -4.399   6.229  -6.276 1.00 . A A .  13 TYR C    1 1 
       17 10091 1 1 13 TYR CA   C   -3.599   6.871  -7.406 1.00 . A A .  13 TYR CA   1 1 
       17 10092 1 1 13 TYR CB   C   -2.174   6.315  -7.416 1.00 . A A .  13 TYR CB   1 1 
       17 10093 1 1 13 TYR CD1  C   -0.778   7.714  -8.988 1.00 . A A .  13 TYR CD1  1 1 
       17 10094 1 1 13 TYR CD2  C   -1.441   5.539  -9.705 1.00 . A A .  13 TYR CD2  1 1 
       17 10095 1 1 13 TYR CE1  C   -0.117   7.911 -10.185 1.00 . A A .  13 TYR CE1  1 1 
       17 10096 1 1 13 TYR CE2  C   -0.781   5.727 -10.903 1.00 . A A .  13 TYR CE2  1 1 
       17 10097 1 1 13 TYR CG   C   -1.451   6.526  -8.727 1.00 . A A .  13 TYR CG   1 1 
       17 10098 1 1 13 TYR CZ   C   -0.121   6.915 -11.139 1.00 . A A .  13 TYR CZ   1 1 
       17 10099 1 1 13 TYR H    H   -3.477   8.715  -6.375 1.00 . A A .  13 TYR H    1 1 
       17 10100 1 1 13 TYR HA   H   -4.073   6.635  -8.347 1.00 . A A .  13 TYR HA   1 1 
       17 10101 1 1 13 TYR HB2  H   -1.600   6.799  -6.640 1.00 . A A .  13 TYR HB2  1 1 
       17 10102 1 1 13 TYR HB3  H   -2.207   5.253  -7.223 1.00 . A A .  13 TYR HB3  1 1 
       17 10103 1 1 13 TYR HD1  H   -0.777   8.492  -8.239 1.00 . A A .  13 TYR HD1  1 1 
       17 10104 1 1 13 TYR HD2  H   -1.960   4.610  -9.517 1.00 . A A .  13 TYR HD2  1 1 
       17 10105 1 1 13 TYR HE1  H    0.401   8.841 -10.370 1.00 . A A .  13 TYR HE1  1 1 
       17 10106 1 1 13 TYR HE2  H   -0.784   4.948 -11.651 1.00 . A A .  13 TYR HE2  1 1 
       17 10107 1 1 13 TYR HH   H    0.000   7.657 -12.909 1.00 . A A .  13 TYR HH   1 1 
       17 10108 1 1 13 TYR N    N   -3.575   8.322  -7.268 1.00 . A A .  13 TYR N    1 1 
       17 10109 1 1 13 TYR O    O   -4.589   6.826  -5.217 1.00 . A A .  13 TYR O    1 1 
       17 10110 1 1 13 TYR OH   O    0.537   7.108 -12.333 1.00 . A A .  13 TYR OH   1 1 
       17 10111 1 1 14 LYS C    C   -5.545   2.775  -5.740 1.00 . A A .  14 LYS C    1 1 
       17 10112 1 1 14 LYS CA   C   -5.643   4.281  -5.515 1.00 . A A .  14 LYS CA   1 1 
       17 10113 1 1 14 LYS CB   C   -7.108   4.720  -5.563 1.00 . A A .  14 LYS CB   1 1 
       17 10114 1 1 14 LYS CD   C   -9.281   4.777  -4.303 1.00 . A A .  14 LYS CD   1 1 
       17 10115 1 1 14 LYS CE   C  -10.092   4.156  -3.176 1.00 . A A .  14 LYS CE   1 1 
       17 10116 1 1 14 LYS CG   C   -7.988   4.016  -4.543 1.00 . A A .  14 LYS CG   1 1 
       17 10117 1 1 14 LYS H    H   -4.680   4.583  -7.376 1.00 . A A .  14 LYS H    1 1 
       17 10118 1 1 14 LYS HA   H   -5.238   4.514  -4.542 1.00 . A A .  14 LYS HA   1 1 
       17 10119 1 1 14 LYS HB2  H   -7.159   5.783  -5.379 1.00 . A A .  14 LYS HB2  1 1 
       17 10120 1 1 14 LYS HB3  H   -7.501   4.515  -6.548 1.00 . A A .  14 LYS HB3  1 1 
       17 10121 1 1 14 LYS HD2  H   -9.045   5.798  -4.040 1.00 . A A .  14 LYS HD2  1 1 
       17 10122 1 1 14 LYS HD3  H   -9.870   4.764  -5.209 1.00 . A A .  14 LYS HD3  1 1 
       17 10123 1 1 14 LYS HE2  H  -10.709   3.370  -3.585 1.00 . A A .  14 LYS HE2  1 1 
       17 10124 1 1 14 LYS HE3  H   -9.412   3.737  -2.449 1.00 . A A .  14 LYS HE3  1 1 
       17 10125 1 1 14 LYS HG2  H   -8.227   3.028  -4.908 1.00 . A A .  14 LYS HG2  1 1 
       17 10126 1 1 14 LYS HG3  H   -7.449   3.937  -3.610 1.00 . A A .  14 LYS HG3  1 1 
       17 10127 1 1 14 LYS HZ1  H  -11.870   4.720  -2.235 1.00 . A A .  14 LYS HZ1  1 1 
       17 10128 1 1 14 LYS HZ2  H  -11.154   5.954  -3.145 1.00 . A A .  14 LYS HZ2  1 1 
       17 10129 1 1 14 LYS HZ3  H  -10.500   5.519  -1.647 1.00 . A A .  14 LYS HZ3  1 1 
       17 10130 1 1 14 LYS N    N   -4.865   5.007  -6.511 1.00 . A A .  14 LYS N    1 1 
       17 10131 1 1 14 LYS NZ   N  -10.965   5.157  -2.504 1.00 . A A .  14 LYS NZ   1 1 
       17 10132 1 1 14 LYS O    O   -5.421   2.314  -6.875 1.00 . A A .  14 LYS O    1 1 
       17 10133 1 1 15 CYS C    C   -6.899  -0.049  -4.969 1.00 . A A .  15 CYS C    1 1 
       17 10134 1 1 15 CYS CA   C   -5.521   0.560  -4.730 1.00 . A A .  15 CYS CA   1 1 
       17 10135 1 1 15 CYS CB   C   -4.915  -0.007  -3.445 1.00 . A A .  15 CYS CB   1 1 
       17 10136 1 1 15 CYS H    H   -5.702   2.440  -3.774 1.00 . A A .  15 CYS H    1 1 
       17 10137 1 1 15 CYS HA   H   -4.881   0.308  -5.562 1.00 . A A .  15 CYS HA   1 1 
       17 10138 1 1 15 CYS HB2  H   -4.098   0.626  -3.131 1.00 . A A .  15 CYS HB2  1 1 
       17 10139 1 1 15 CYS HB3  H   -5.671  -0.018  -2.674 1.00 . A A .  15 CYS HB3  1 1 
       17 10140 1 1 15 CYS N    N   -5.602   2.014  -4.652 1.00 . A A .  15 CYS N    1 1 
       17 10141 1 1 15 CYS O    O   -7.922   0.593  -4.734 1.00 . A A .  15 CYS O    1 1 
       17 10142 1 1 15 CYS SG   S   -4.269  -1.702  -3.613 1.00 . A A .  15 CYS SG   1 1 
       17 10143 1 1 16 ASN C    C   -8.383  -3.130  -4.714 1.00 . A A .  16 ASN C    1 1 
       17 10144 1 1 16 ASN CA   C   -8.169  -1.991  -5.706 1.00 . A A .  16 ASN CA   1 1 
       17 10145 1 1 16 ASN CB   C   -8.175  -2.536  -7.135 1.00 . A A .  16 ASN CB   1 1 
       17 10146 1 1 16 ASN CG   C   -8.999  -3.803  -7.268 1.00 . A A .  16 ASN CG   1 1 
       17 10147 1 1 16 ASN H    H   -6.068  -1.754  -5.603 1.00 . A A .  16 ASN H    1 1 
       17 10148 1 1 16 ASN HA   H   -8.974  -1.280  -5.598 1.00 . A A .  16 ASN HA   1 1 
       17 10149 1 1 16 ASN HB2  H   -8.590  -1.790  -7.797 1.00 . A A .  16 ASN HB2  1 1 
       17 10150 1 1 16 ASN HB3  H   -7.162  -2.754  -7.436 1.00 . A A .  16 ASN HB3  1 1 
       17 10151 1 1 16 ASN HD21 H  -10.566  -2.899  -6.443 1.00 . A A .  16 ASN HD21 1 1 
       17 10152 1 1 16 ASN HD22 H  -10.804  -4.549  -6.897 1.00 . A A .  16 ASN HD22 1 1 
       17 10153 1 1 16 ASN N    N   -6.917  -1.294  -5.435 1.00 . A A .  16 ASN N    1 1 
       17 10154 1 1 16 ASN ND2  N  -10.250  -3.744  -6.825 1.00 . A A .  16 ASN ND2  1 1 
       17 10155 1 1 16 ASN O    O   -9.510  -3.573  -4.496 1.00 . A A .  16 ASN O    1 1 
       17 10156 1 1 16 ASN OD1  O   -8.516  -4.821  -7.762 1.00 . A A .  16 ASN OD1  1 1 
       17 10157 1 1 17 GLU C    C   -7.908  -4.192  -1.811 1.00 . A A .  17 GLU C    1 1 
       17 10158 1 1 17 GLU CA   C   -7.361  -4.687  -3.147 1.00 . A A .  17 GLU CA   1 1 
       17 10159 1 1 17 GLU CB   C   -5.977  -5.308  -2.945 1.00 . A A .  17 GLU CB   1 1 
       17 10160 1 1 17 GLU CD   C   -5.905  -7.355  -4.424 1.00 . A A .  17 GLU CD   1 1 
       17 10161 1 1 17 GLU CG   C   -5.404  -5.941  -4.203 1.00 . A A .  17 GLU CG   1 1 
       17 10162 1 1 17 GLU H    H   -6.421  -3.204  -4.331 1.00 . A A .  17 GLU H    1 1 
       17 10163 1 1 17 GLU HA   H   -8.028  -5.439  -3.540 1.00 . A A .  17 GLU HA   1 1 
       17 10164 1 1 17 GLU HB2  H   -5.296  -4.539  -2.612 1.00 . A A .  17 GLU HB2  1 1 
       17 10165 1 1 17 GLU HB3  H   -6.046  -6.070  -2.183 1.00 . A A .  17 GLU HB3  1 1 
       17 10166 1 1 17 GLU HG2  H   -5.686  -5.339  -5.054 1.00 . A A .  17 GLU HG2  1 1 
       17 10167 1 1 17 GLU HG3  H   -4.328  -5.965  -4.120 1.00 . A A .  17 GLU HG3  1 1 
       17 10168 1 1 17 GLU N    N   -7.292  -3.599  -4.116 1.00 . A A .  17 GLU N    1 1 
       17 10169 1 1 17 GLU O    O   -8.795  -4.812  -1.223 1.00 . A A .  17 GLU O    1 1 
       17 10170 1 1 17 GLU OE1  O   -5.803  -8.174  -3.487 1.00 . A A .  17 GLU OE1  1 1 
       17 10171 1 1 17 GLU OE2  O   -6.400  -7.642  -5.534 1.00 . A A .  17 GLU OE2  1 1 
       17 10172 1 1 18 CYS C    C   -8.472  -1.138  -0.292 1.00 . A A .  18 CYS C    1 1 
       17 10173 1 1 18 CYS CA   C   -7.805  -2.493  -0.071 1.00 . A A .  18 CYS CA   1 1 
       17 10174 1 1 18 CYS CB   C   -6.614  -2.340   0.876 1.00 . A A .  18 CYS CB   1 1 
       17 10175 1 1 18 CYS H    H   -6.669  -2.623  -1.853 1.00 . A A .  18 CYS H    1 1 
       17 10176 1 1 18 CYS HA   H   -8.523  -3.166   0.373 1.00 . A A .  18 CYS HA   1 1 
       17 10177 1 1 18 CYS HB2  H   -6.947  -1.864   1.787 1.00 . A A .  18 CYS HB2  1 1 
       17 10178 1 1 18 CYS HB3  H   -6.221  -3.318   1.110 1.00 . A A .  18 CYS HB3  1 1 
       17 10179 1 1 18 CYS N    N   -7.373  -3.072  -1.338 1.00 . A A .  18 CYS N    1 1 
       17 10180 1 1 18 CYS O    O   -9.427  -0.785   0.398 1.00 . A A .  18 CYS O    1 1 
       17 10181 1 1 18 CYS SG   S   -5.249  -1.341   0.199 1.00 . A A .  18 CYS SG   1 1 
       17 10182 1 1 19 GLY C    C   -7.677   2.052  -0.992 1.00 . A A .  19 GLY C    1 1 
       17 10183 1 1 19 GLY CA   C   -8.518   0.923  -1.555 1.00 . A A .  19 GLY CA   1 1 
       17 10184 1 1 19 GLY H    H   -7.198  -0.717  -1.778 1.00 . A A .  19 GLY H    1 1 
       17 10185 1 1 19 GLY HA2  H   -8.588   1.039  -2.626 1.00 . A A .  19 GLY HA2  1 1 
       17 10186 1 1 19 GLY HA3  H   -9.509   0.983  -1.131 1.00 . A A .  19 GLY HA3  1 1 
       17 10187 1 1 19 GLY N    N   -7.960  -0.384  -1.260 1.00 . A A .  19 GLY N    1 1 
       17 10188 1 1 19 GLY O    O   -8.187   3.139  -0.717 1.00 . A A .  19 GLY O    1 1 
       17 10189 1 1 20 LYS C    C   -5.228   3.910  -1.302 1.00 . A A .  20 LYS C    1 1 
       17 10190 1 1 20 LYS CA   C   -5.470   2.799  -0.286 1.00 . A A .  20 LYS CA   1 1 
       17 10191 1 1 20 LYS CB   C   -4.140   2.150   0.102 1.00 . A A .  20 LYS CB   1 1 
       17 10192 1 1 20 LYS CD   C   -3.194   3.511   1.990 1.00 . A A .  20 LYS CD   1 1 
       17 10193 1 1 20 LYS CE   C   -4.087   4.726   2.195 1.00 . A A .  20 LYS CE   1 1 
       17 10194 1 1 20 LYS CG   C   -3.075   3.149   0.519 1.00 . A A .  20 LYS CG   1 1 
       17 10195 1 1 20 LYS H    H   -6.037   0.911  -1.058 1.00 . A A .  20 LYS H    1 1 
       17 10196 1 1 20 LYS HA   H   -5.924   3.226   0.595 1.00 . A A .  20 LYS HA   1 1 
       17 10197 1 1 20 LYS HB2  H   -4.310   1.473   0.926 1.00 . A A .  20 LYS HB2  1 1 
       17 10198 1 1 20 LYS HB3  H   -3.766   1.589  -0.742 1.00 . A A .  20 LYS HB3  1 1 
       17 10199 1 1 20 LYS HD2  H   -3.618   2.674   2.525 1.00 . A A .  20 LYS HD2  1 1 
       17 10200 1 1 20 LYS HD3  H   -2.210   3.728   2.380 1.00 . A A .  20 LYS HD3  1 1 
       17 10201 1 1 20 LYS HE2  H   -3.744   5.521   1.550 1.00 . A A .  20 LYS HE2  1 1 
       17 10202 1 1 20 LYS HE3  H   -5.100   4.460   1.931 1.00 . A A .  20 LYS HE3  1 1 
       17 10203 1 1 20 LYS HG2  H   -2.100   2.718   0.344 1.00 . A A .  20 LYS HG2  1 1 
       17 10204 1 1 20 LYS HG3  H   -3.185   4.047  -0.073 1.00 . A A .  20 LYS HG3  1 1 
       17 10205 1 1 20 LYS HZ1  H   -3.216   4.839   4.090 1.00 . A A .  20 LYS HZ1  1 1 
       17 10206 1 1 20 LYS HZ2  H   -4.907   4.865   4.111 1.00 . A A .  20 LYS HZ2  1 1 
       17 10207 1 1 20 LYS HZ3  H   -4.047   6.240   3.633 1.00 . A A .  20 LYS HZ3  1 1 
       17 10208 1 1 20 LYS N    N   -6.385   1.796  -0.820 1.00 . A A .  20 LYS N    1 1 
       17 10209 1 1 20 LYS NZ   N   -4.062   5.201   3.606 1.00 . A A .  20 LYS NZ   1 1 
       17 10210 1 1 20 LYS O    O   -5.238   3.673  -2.510 1.00 . A A .  20 LYS O    1 1 
       17 10211 1 1 21 ALA C    C   -3.333   6.779  -1.510 1.00 . A A .  21 ALA C    1 1 
       17 10212 1 1 21 ALA CA   C   -4.762   6.270  -1.670 1.00 . A A .  21 ALA CA   1 1 
       17 10213 1 1 21 ALA CB   C   -5.757   7.382  -1.371 1.00 . A A .  21 ALA CB   1 1 
       17 10214 1 1 21 ALA H    H   -5.015   5.250   0.167 1.00 . A A .  21 ALA H    1 1 
       17 10215 1 1 21 ALA HA   H   -4.909   5.955  -2.693 1.00 . A A .  21 ALA HA   1 1 
       17 10216 1 1 21 ALA HB1  H   -6.757   6.975  -1.356 1.00 . A A .  21 ALA HB1  1 1 
       17 10217 1 1 21 ALA HB2  H   -5.531   7.817  -0.408 1.00 . A A .  21 ALA HB2  1 1 
       17 10218 1 1 21 ALA HB3  H   -5.688   8.142  -2.135 1.00 . A A .  21 ALA HB3  1 1 
       17 10219 1 1 21 ALA N    N   -5.010   5.123  -0.805 1.00 . A A .  21 ALA N    1 1 
       17 10220 1 1 21 ALA O    O   -2.944   7.238  -0.436 1.00 . A A .  21 ALA O    1 1 
       17 10221 1 1 22 PHE C    C   -1.023   8.486  -3.276 1.00 . A A .  22 PHE C    1 1 
       17 10222 1 1 22 PHE CA   C   -1.170   7.145  -2.563 1.00 . A A .  22 PHE CA   1 1 
       17 10223 1 1 22 PHE CB   C   -0.262   6.103  -3.220 1.00 . A A .  22 PHE CB   1 1 
       17 10224 1 1 22 PHE CD1  C   -1.456   3.909  -2.981 1.00 . A A .  22 PHE CD1  1 1 
       17 10225 1 1 22 PHE CD2  C    0.533   4.261  -1.713 1.00 . A A .  22 PHE CD2  1 1 
       17 10226 1 1 22 PHE CE1  C   -1.583   2.645  -2.436 1.00 . A A .  22 PHE CE1  1 1 
       17 10227 1 1 22 PHE CE2  C    0.411   2.998  -1.165 1.00 . A A .  22 PHE CE2  1 1 
       17 10228 1 1 22 PHE CG   C   -0.398   4.730  -2.626 1.00 . A A .  22 PHE CG   1 1 
       17 10229 1 1 22 PHE CZ   C   -0.648   2.189  -1.527 1.00 . A A .  22 PHE CZ   1 1 
       17 10230 1 1 22 PHE H    H   -2.925   6.319  -3.412 1.00 . A A .  22 PHE H    1 1 
       17 10231 1 1 22 PHE HA   H   -0.877   7.265  -1.532 1.00 . A A .  22 PHE HA   1 1 
       17 10232 1 1 22 PHE HB2  H   -0.505   6.035  -4.270 1.00 . A A .  22 PHE HB2  1 1 
       17 10233 1 1 22 PHE HB3  H    0.766   6.413  -3.112 1.00 . A A .  22 PHE HB3  1 1 
       17 10234 1 1 22 PHE HD1  H   -2.187   4.264  -3.692 1.00 . A A .  22 PHE HD1  1 1 
       17 10235 1 1 22 PHE HD2  H    1.362   4.894  -1.429 1.00 . A A .  22 PHE HD2  1 1 
       17 10236 1 1 22 PHE HE1  H   -2.412   2.015  -2.721 1.00 . A A .  22 PHE HE1  1 1 
       17 10237 1 1 22 PHE HE2  H    1.144   2.645  -0.455 1.00 . A A .  22 PHE HE2  1 1 
       17 10238 1 1 22 PHE HZ   H   -0.746   1.203  -1.099 1.00 . A A .  22 PHE HZ   1 1 
       17 10239 1 1 22 PHE N    N   -2.557   6.694  -2.585 1.00 . A A .  22 PHE N    1 1 
       17 10240 1 1 22 PHE O    O   -2.010   9.090  -3.695 1.00 . A A .  22 PHE O    1 1 
       17 10241 1 1 23 ARG C    C    1.116   9.990  -5.444 1.00 . A A .  23 ARG C    1 1 
       17 10242 1 1 23 ARG CA   C    0.494  10.216  -4.069 1.00 . A A .  23 ARG CA   1 1 
       17 10243 1 1 23 ARG CB   C    1.429  11.069  -3.209 1.00 . A A .  23 ARG CB   1 1 
       17 10244 1 1 23 ARG CD   C   -0.258  12.226  -1.750 1.00 . A A .  23 ARG CD   1 1 
       17 10245 1 1 23 ARG CG   C    0.930  11.277  -1.789 1.00 . A A .  23 ARG CG   1 1 
       17 10246 1 1 23 ARG CZ   C   -0.619  14.650  -1.549 1.00 . A A .  23 ARG CZ   1 1 
       17 10247 1 1 23 ARG H    H    0.963   8.419  -3.054 1.00 . A A .  23 ARG H    1 1 
       17 10248 1 1 23 ARG HA   H   -0.443  10.738  -4.192 1.00 . A A .  23 ARG HA   1 1 
       17 10249 1 1 23 ARG HB2  H    2.395  10.586  -3.160 1.00 . A A .  23 ARG HB2  1 1 
       17 10250 1 1 23 ARG HB3  H    1.543  12.036  -3.673 1.00 . A A .  23 ARG HB3  1 1 
       17 10251 1 1 23 ARG HD2  H   -0.927  11.978  -2.560 1.00 . A A .  23 ARG HD2  1 1 
       17 10252 1 1 23 ARG HD3  H   -0.770  12.101  -0.808 1.00 . A A .  23 ARG HD3  1 1 
       17 10253 1 1 23 ARG HE   H    1.046  13.799  -2.245 1.00 . A A .  23 ARG HE   1 1 
       17 10254 1 1 23 ARG HG2  H    0.628  10.324  -1.380 1.00 . A A .  23 ARG HG2  1 1 
       17 10255 1 1 23 ARG HG3  H    1.730  11.690  -1.193 1.00 . A A .  23 ARG HG3  1 1 
       17 10256 1 1 23 ARG HH11 H   -2.170  13.506  -0.943 1.00 . A A .  23 ARG HH11 1 1 
       17 10257 1 1 23 ARG HH12 H   -2.411  15.216  -0.807 1.00 . A A .  23 ARG HH12 1 1 
       17 10258 1 1 23 ARG HH21 H    0.740  16.053  -2.070 1.00 . A A .  23 ARG HH21 1 1 
       17 10259 1 1 23 ARG HH22 H   -0.756  16.664  -1.449 1.00 . A A .  23 ARG HH22 1 1 
       17 10260 1 1 23 ARG N    N    0.217   8.946  -3.409 1.00 . A A .  23 ARG N    1 1 
       17 10261 1 1 23 ARG NE   N    0.152  13.621  -1.885 1.00 . A A .  23 ARG NE   1 1 
       17 10262 1 1 23 ARG NH1  N   -1.833  14.440  -1.060 1.00 . A A .  23 ARG NH1  1 1 
       17 10263 1 1 23 ARG NH2  N   -0.175  15.891  -1.702 1.00 . A A .  23 ARG NH2  1 1 
       17 10264 1 1 23 ARG O    O    0.974  10.817  -6.344 1.00 . A A .  23 ARG O    1 1 
       17 10265 1 1 24 ALA C    C    2.324   7.037  -7.162 1.00 . A A .  24 ALA C    1 1 
       17 10266 1 1 24 ALA CA   C    2.446   8.528  -6.864 1.00 . A A .  24 ALA CA   1 1 
       17 10267 1 1 24 ALA CB   C    3.909   8.946  -6.841 1.00 . A A .  24 ALA CB   1 1 
       17 10268 1 1 24 ALA H    H    1.882   8.243  -4.844 1.00 . A A .  24 ALA H    1 1 
       17 10269 1 1 24 ALA HA   H    1.950   9.083  -7.647 1.00 . A A .  24 ALA HA   1 1 
       17 10270 1 1 24 ALA HB1  H    4.081   9.605  -6.003 1.00 . A A .  24 ALA HB1  1 1 
       17 10271 1 1 24 ALA HB2  H    4.531   8.068  -6.744 1.00 . A A .  24 ALA HB2  1 1 
       17 10272 1 1 24 ALA HB3  H    4.150   9.460  -7.759 1.00 . A A .  24 ALA HB3  1 1 
       17 10273 1 1 24 ALA N    N    1.804   8.864  -5.599 1.00 . A A .  24 ALA N    1 1 
       17 10274 1 1 24 ALA O    O    1.944   6.250  -6.296 1.00 . A A .  24 ALA O    1 1 
       17 10275 1 1 25 ARG C    C    3.581   4.411  -8.037 1.00 . A A .  25 ARG C    1 1 
       17 10276 1 1 25 ARG CA   C    2.574   5.261  -8.807 1.00 . A A .  25 ARG CA   1 1 
       17 10277 1 1 25 ARG CB   C    2.829   5.137 -10.310 1.00 . A A .  25 ARG CB   1 1 
       17 10278 1 1 25 ARG CD   C    4.023   6.298 -12.192 1.00 . A A .  25 ARG CD   1 1 
       17 10279 1 1 25 ARG CG   C    4.126   5.788 -10.763 1.00 . A A .  25 ARG CG   1 1 
       17 10280 1 1 25 ARG CZ   C    4.107   8.746 -11.993 1.00 . A A .  25 ARG CZ   1 1 
       17 10281 1 1 25 ARG H    H    2.945   7.331  -9.040 1.00 . A A .  25 ARG H    1 1 
       17 10282 1 1 25 ARG HA   H    1.578   4.903  -8.589 1.00 . A A .  25 ARG HA   1 1 
       17 10283 1 1 25 ARG HB2  H    2.867   4.090 -10.572 1.00 . A A .  25 ARG HB2  1 1 
       17 10284 1 1 25 ARG HB3  H    2.013   5.603 -10.841 1.00 . A A .  25 ARG HB3  1 1 
       17 10285 1 1 25 ARG HD2  H    5.014   6.331 -12.620 1.00 . A A .  25 ARG HD2  1 1 
       17 10286 1 1 25 ARG HD3  H    3.409   5.615 -12.760 1.00 . A A .  25 ARG HD3  1 1 
       17 10287 1 1 25 ARG HE   H    2.490   7.700 -12.509 1.00 . A A .  25 ARG HE   1 1 
       17 10288 1 1 25 ARG HG2  H    4.347   6.620 -10.111 1.00 . A A .  25 ARG HG2  1 1 
       17 10289 1 1 25 ARG HG3  H    4.922   5.061 -10.705 1.00 . A A .  25 ARG HG3  1 1 
       17 10290 1 1 25 ARG HH11 H    5.846   7.801 -11.589 1.00 . A A .  25 ARG HH11 1 1 
       17 10291 1 1 25 ARG HH12 H    5.891   9.527 -11.452 1.00 . A A .  25 ARG HH12 1 1 
       17 10292 1 1 25 ARG HH21 H    2.537   9.973 -12.332 1.00 . A A .  25 ARG HH21 1 1 
       17 10293 1 1 25 ARG HH22 H    4.008  10.762 -11.875 1.00 . A A .  25 ARG HH22 1 1 
       17 10294 1 1 25 ARG N    N    2.649   6.657  -8.394 1.00 . A A .  25 ARG N    1 1 
       17 10295 1 1 25 ARG NE   N    3.434   7.632 -12.257 1.00 . A A .  25 ARG NE   1 1 
       17 10296 1 1 25 ARG NH1  N    5.386   8.686 -11.649 1.00 . A A .  25 ARG NH1  1 1 
       17 10297 1 1 25 ARG NH2  N    3.501   9.924 -12.073 1.00 . A A .  25 ARG NH2  1 1 
       17 10298 1 1 25 ARG O    O    3.211   3.446  -7.369 1.00 . A A .  25 ARG O    1 1 
       17 10299 1 1 26 SER C    C    5.489   3.664  -6.040 1.00 . A A .  26 SER C    1 1 
       17 10300 1 1 26 SER CA   C    5.916   4.047  -7.454 1.00 . A A .  26 SER CA   1 1 
       17 10301 1 1 26 SER CB   C    7.192   4.888  -7.403 1.00 . A A .  26 SER CB   1 1 
       17 10302 1 1 26 SER H    H    5.086   5.557  -8.685 1.00 . A A .  26 SER H    1 1 
       17 10303 1 1 26 SER HA   H    6.111   3.145  -8.015 1.00 . A A .  26 SER HA   1 1 
       17 10304 1 1 26 SER HB2  H    7.286   5.452  -8.319 1.00 . A A .  26 SER HB2  1 1 
       17 10305 1 1 26 SER HB3  H    7.138   5.569  -6.565 1.00 . A A .  26 SER HB3  1 1 
       17 10306 1 1 26 SER HG   H    9.129   4.594  -7.392 1.00 . A A .  26 SER HG   1 1 
       17 10307 1 1 26 SER N    N    4.855   4.778  -8.137 1.00 . A A .  26 SER N    1 1 
       17 10308 1 1 26 SER O    O    5.941   2.658  -5.494 1.00 . A A .  26 SER O    1 1 
       17 10309 1 1 26 SER OG   O    8.338   4.068  -7.252 1.00 . A A .  26 SER OG   1 1 
       17 10310 1 1 27 SER C    C    3.070   3.125  -4.099 1.00 . A A .  27 SER C    1 1 
       17 10311 1 1 27 SER CA   C    4.128   4.224  -4.101 1.00 . A A .  27 SER CA   1 1 
       17 10312 1 1 27 SER CB   C    3.549   5.506  -3.499 1.00 . A A .  27 SER CB   1 1 
       17 10313 1 1 27 SER H    H    4.290   5.261  -5.940 1.00 . A A .  27 SER H    1 1 
       17 10314 1 1 27 SER HA   H    4.966   3.902  -3.502 1.00 . A A .  27 SER HA   1 1 
       17 10315 1 1 27 SER HB2  H    2.979   6.029  -4.251 1.00 . A A .  27 SER HB2  1 1 
       17 10316 1 1 27 SER HB3  H    2.905   5.252  -2.670 1.00 . A A .  27 SER HB3  1 1 
       17 10317 1 1 27 SER HG   H    5.331   5.833  -2.754 1.00 . A A .  27 SER HG   1 1 
       17 10318 1 1 27 SER N    N    4.614   4.475  -5.453 1.00 . A A .  27 SER N    1 1 
       17 10319 1 1 27 SER O    O    3.043   2.275  -3.209 1.00 . A A .  27 SER O    1 1 
       17 10320 1 1 27 SER OG   O    4.579   6.360  -3.032 1.00 . A A .  27 SER OG   1 1 
       17 10321 1 1 28 LEU C    C    1.705   0.798  -5.620 1.00 . A A .  28 LEU C    1 1 
       17 10322 1 1 28 LEU CA   C    1.138   2.156  -5.218 1.00 . A A .  28 LEU CA   1 1 
       17 10323 1 1 28 LEU CB   C    0.097   2.610  -6.243 1.00 . A A .  28 LEU CB   1 1 
       17 10324 1 1 28 LEU CD1  C   -2.139   1.776  -5.474 1.00 . A A .  28 LEU CD1  1 1 
       17 10325 1 1 28 LEU CD2  C   -1.607   1.847  -7.917 1.00 . A A .  28 LEU CD2  1 1 
       17 10326 1 1 28 LEU CG   C   -1.044   1.630  -6.520 1.00 . A A .  28 LEU CG   1 1 
       17 10327 1 1 28 LEU H    H    2.271   3.852  -5.781 1.00 . A A .  28 LEU H    1 1 
       17 10328 1 1 28 LEU HA   H    0.664   2.063  -4.252 1.00 . A A .  28 LEU HA   1 1 
       17 10329 1 1 28 LEU HB2  H   -0.338   3.531  -5.886 1.00 . A A .  28 LEU HB2  1 1 
       17 10330 1 1 28 LEU HB3  H    0.610   2.793  -7.176 1.00 . A A .  28 LEU HB3  1 1 
       17 10331 1 1 28 LEU HD11 H   -1.926   1.129  -4.637 1.00 . A A .  28 LEU HD11 1 1 
       17 10332 1 1 28 LEU HD12 H   -3.090   1.504  -5.907 1.00 . A A .  28 LEU HD12 1 1 
       17 10333 1 1 28 LEU HD13 H   -2.179   2.802  -5.136 1.00 . A A .  28 LEU HD13 1 1 
       17 10334 1 1 28 LEU HD21 H   -0.794   1.943  -8.621 1.00 . A A .  28 LEU HD21 1 1 
       17 10335 1 1 28 LEU HD22 H   -2.202   2.748  -7.928 1.00 . A A .  28 LEU HD22 1 1 
       17 10336 1 1 28 LEU HD23 H   -2.224   1.004  -8.191 1.00 . A A .  28 LEU HD23 1 1 
       17 10337 1 1 28 LEU HG   H   -0.664   0.619  -6.465 1.00 . A A .  28 LEU HG   1 1 
       17 10338 1 1 28 LEU N    N    2.199   3.149  -5.102 1.00 . A A .  28 LEU N    1 1 
       17 10339 1 1 28 LEU O    O    1.220  -0.244  -5.177 1.00 . A A .  28 LEU O    1 1 
       17 10340 1 1 29 ALA C    C    3.985  -1.180  -5.751 1.00 . A A .  29 ALA C    1 1 
       17 10341 1 1 29 ALA CA   C    3.371  -0.412  -6.916 1.00 . A A .  29 ALA CA   1 1 
       17 10342 1 1 29 ALA CB   C    4.431  -0.100  -7.962 1.00 . A A .  29 ALA CB   1 1 
       17 10343 1 1 29 ALA H    H    3.076   1.679  -6.777 1.00 . A A .  29 ALA H    1 1 
       17 10344 1 1 29 ALA HA   H    2.613  -1.027  -7.380 1.00 . A A .  29 ALA HA   1 1 
       17 10345 1 1 29 ALA HB1  H    5.395  -0.431  -7.606 1.00 . A A .  29 ALA HB1  1 1 
       17 10346 1 1 29 ALA HB2  H    4.190  -0.614  -8.882 1.00 . A A .  29 ALA HB2  1 1 
       17 10347 1 1 29 ALA HB3  H    4.458   0.964  -8.141 1.00 . A A .  29 ALA HB3  1 1 
       17 10348 1 1 29 ALA N    N    2.735   0.817  -6.459 1.00 . A A .  29 ALA N    1 1 
       17 10349 1 1 29 ALA O    O    3.619  -2.326  -5.489 1.00 . A A .  29 ALA O    1 1 
       17 10350 1 1 30 ILE C    C    4.572  -1.824  -2.984 1.00 . A A .  30 ILE C    1 1 
       17 10351 1 1 30 ILE CA   C    5.583  -1.164  -3.917 1.00 . A A .  30 ILE CA   1 1 
       17 10352 1 1 30 ILE CB   C    6.410  -0.140  -3.117 1.00 . A A .  30 ILE CB   1 1 
       17 10353 1 1 30 ILE CD1  C    8.009   1.806  -3.480 1.00 . A A .  30 ILE CD1  1 1 
       17 10354 1 1 30 ILE CG1  C    7.480   0.492  -4.010 1.00 . A A .  30 ILE CG1  1 1 
       17 10355 1 1 30 ILE CG2  C    7.048  -0.805  -1.906 1.00 . A A .  30 ILE CG2  1 1 
       17 10356 1 1 30 ILE H    H    5.167   0.371  -5.312 1.00 . A A .  30 ILE H    1 1 
       17 10357 1 1 30 ILE HA   H    6.254  -1.922  -4.296 1.00 . A A .  30 ILE HA   1 1 
       17 10358 1 1 30 ILE HB   H    5.743   0.631  -2.765 1.00 . A A .  30 ILE HB   1 1 
       17 10359 1 1 30 ILE HD11 H    7.725   2.605  -4.151 1.00 . A A .  30 ILE HD11 1 1 
       17 10360 1 1 30 ILE HD12 H    7.592   1.995  -2.502 1.00 . A A .  30 ILE HD12 1 1 
       17 10361 1 1 30 ILE HD13 H    9.085   1.760  -3.412 1.00 . A A .  30 ILE HD13 1 1 
       17 10362 1 1 30 ILE HG12 H    8.312  -0.188  -4.100 1.00 . A A .  30 ILE HG12 1 1 
       17 10363 1 1 30 ILE HG13 H    7.060   0.672  -4.989 1.00 . A A .  30 ILE HG13 1 1 
       17 10364 1 1 30 ILE HG21 H    6.980  -0.143  -1.055 1.00 . A A .  30 ILE HG21 1 1 
       17 10365 1 1 30 ILE HG22 H    6.530  -1.726  -1.687 1.00 . A A .  30 ILE HG22 1 1 
       17 10366 1 1 30 ILE HG23 H    8.086  -1.016  -2.116 1.00 . A A .  30 ILE HG23 1 1 
       17 10367 1 1 30 ILE N    N    4.919  -0.541  -5.055 1.00 . A A .  30 ILE N    1 1 
       17 10368 1 1 30 ILE O    O    4.824  -2.899  -2.439 1.00 . A A .  30 ILE O    1 1 
       17 10369 1 1 31 HIS C    C    1.723  -2.928  -2.564 1.00 . A A .  31 HIS C    1 1 
       17 10370 1 1 31 HIS CA   C    2.376  -1.697  -1.941 1.00 . A A .  31 HIS CA   1 1 
       17 10371 1 1 31 HIS CB   C    1.320  -0.623  -1.678 1.00 . A A .  31 HIS CB   1 1 
       17 10372 1 1 31 HIS CD2  C   -1.246  -0.980  -1.810 1.00 . A A .  31 HIS CD2  1 1 
       17 10373 1 1 31 HIS CE1  C   -1.463  -2.366  -0.125 1.00 . A A .  31 HIS CE1  1 1 
       17 10374 1 1 31 HIS CG   C   -0.014  -1.179  -1.285 1.00 . A A .  31 HIS CG   1 1 
       17 10375 1 1 31 HIS H    H    3.285  -0.321  -3.268 1.00 . A A .  31 HIS H    1 1 
       17 10376 1 1 31 HIS HA   H    2.829  -1.981  -1.004 1.00 . A A .  31 HIS HA   1 1 
       17 10377 1 1 31 HIS HB2  H    1.660   0.019  -0.879 1.00 . A A .  31 HIS HB2  1 1 
       17 10378 1 1 31 HIS HB3  H    1.184  -0.034  -2.574 1.00 . A A .  31 HIS HB3  1 1 
       17 10379 1 1 31 HIS HD1  H    0.526  -2.390   0.353 1.00 . A A .  31 HIS HD1  1 1 
       17 10380 1 1 31 HIS HD2  H   -1.490  -0.350  -2.654 1.00 . A A .  31 HIS HD2  1 1 
       17 10381 1 1 31 HIS HE1  H   -1.892  -3.031   0.610 1.00 . A A .  31 HIS HE1  1 1 
       17 10382 1 1 31 HIS N    N    3.427  -1.173  -2.807 1.00 . A A .  31 HIS N    1 1 
       17 10383 1 1 31 HIS ND1  N   -0.185  -2.051  -0.230 1.00 . A A .  31 HIS ND1  1 1 
       17 10384 1 1 31 HIS NE2  N   -2.129  -1.729  -1.072 1.00 . A A .  31 HIS NE2  1 1 
       17 10385 1 1 31 HIS O    O    1.640  -3.982  -1.935 1.00 . A A .  31 HIS O    1 1 
       17 10386 1 1 32 GLN C    C    1.449  -5.158  -4.411 1.00 . A A .  32 GLN C    1 1 
       17 10387 1 1 32 GLN CA   C    0.616  -3.884  -4.508 1.00 . A A .  32 GLN CA   1 1 
       17 10388 1 1 32 GLN CB   C    0.394  -3.516  -5.976 1.00 . A A .  32 GLN CB   1 1 
       17 10389 1 1 32 GLN CD   C   -1.415  -2.676  -7.528 1.00 . A A .  32 GLN CD   1 1 
       17 10390 1 1 32 GLN CG   C   -0.723  -2.507  -6.189 1.00 . A A .  32 GLN CG   1 1 
       17 10391 1 1 32 GLN H    H    1.358  -1.919  -4.251 1.00 . A A .  32 GLN H    1 1 
       17 10392 1 1 32 GLN HA   H   -0.342  -4.059  -4.043 1.00 . A A .  32 GLN HA   1 1 
       17 10393 1 1 32 GLN HB2  H    1.308  -3.097  -6.372 1.00 . A A .  32 GLN HB2  1 1 
       17 10394 1 1 32 GLN HB3  H    0.150  -4.412  -6.527 1.00 . A A .  32 GLN HB3  1 1 
       17 10395 1 1 32 GLN HE21 H   -2.107  -0.815  -7.432 1.00 . A A .  32 GLN HE21 1 1 
       17 10396 1 1 32 GLN HE22 H   -2.549  -1.709  -8.843 1.00 . A A .  32 GLN HE22 1 1 
       17 10397 1 1 32 GLN HG2  H   -1.456  -2.631  -5.405 1.00 . A A .  32 GLN HG2  1 1 
       17 10398 1 1 32 GLN HG3  H   -0.307  -1.512  -6.138 1.00 . A A .  32 GLN HG3  1 1 
       17 10399 1 1 32 GLN N    N    1.262  -2.784  -3.802 1.00 . A A .  32 GLN N    1 1 
       17 10400 1 1 32 GLN NE2  N   -2.093  -1.628  -7.980 1.00 . A A .  32 GLN NE2  1 1 
       17 10401 1 1 32 GLN O    O    0.942  -6.260  -4.619 1.00 . A A .  32 GLN O    1 1 
       17 10402 1 1 32 GLN OE1  O   -1.340  -3.737  -8.148 1.00 . A A .  32 GLN OE1  1 1 
       17 10403 1 1 33 ALA C    C    3.514  -6.781  -2.592 1.00 . A A .  33 ALA C    1 1 
       17 10404 1 1 33 ALA CA   C    3.633  -6.135  -3.969 1.00 . A A .  33 ALA CA   1 1 
       17 10405 1 1 33 ALA CB   C    5.068  -5.701  -4.229 1.00 . A A .  33 ALA CB   1 1 
       17 10406 1 1 33 ALA H    H    3.075  -4.094  -3.941 1.00 . A A .  33 ALA H    1 1 
       17 10407 1 1 33 ALA HA   H    3.361  -6.863  -4.721 1.00 . A A .  33 ALA HA   1 1 
       17 10408 1 1 33 ALA HB1  H    5.251  -5.683  -5.293 1.00 . A A .  33 ALA HB1  1 1 
       17 10409 1 1 33 ALA HB2  H    5.224  -4.714  -3.819 1.00 . A A .  33 ALA HB2  1 1 
       17 10410 1 1 33 ALA HB3  H    5.745  -6.398  -3.759 1.00 . A A .  33 ALA HB3  1 1 
       17 10411 1 1 33 ALA N    N    2.730  -4.998  -4.095 1.00 . A A .  33 ALA N    1 1 
       17 10412 1 1 33 ALA O    O    4.364  -7.577  -2.193 1.00 . A A .  33 ALA O    1 1 
       17 10413 1 1 34 THR C    C    0.970  -7.838  -0.503 1.00 . A A .  34 THR C    1 1 
       17 10414 1 1 34 THR CA   C    2.226  -6.975  -0.537 1.00 . A A .  34 THR CA   1 1 
       17 10415 1 1 34 THR CB   C    2.094  -5.854   0.512 1.00 . A A .  34 THR CB   1 1 
       17 10416 1 1 34 THR CG2  C    3.339  -4.981   0.531 1.00 . A A .  34 THR CG2  1 1 
       17 10417 1 1 34 THR H    H    1.812  -5.792  -2.242 1.00 . A A .  34 THR H    1 1 
       17 10418 1 1 34 THR HA   H    3.078  -7.585  -0.275 1.00 . A A .  34 THR HA   1 1 
       17 10419 1 1 34 THR HB   H    1.974  -6.306   1.486 1.00 . A A .  34 THR HB   1 1 
       17 10420 1 1 34 THR HG1  H    0.847  -4.378   0.906 1.00 . A A .  34 THR HG1  1 1 
       17 10421 1 1 34 THR HG21 H    3.271  -4.275   1.345 1.00 . A A .  34 THR HG21 1 1 
       17 10422 1 1 34 THR HG22 H    3.418  -4.446  -0.404 1.00 . A A .  34 THR HG22 1 1 
       17 10423 1 1 34 THR HG23 H    4.212  -5.602   0.665 1.00 . A A .  34 THR HG23 1 1 
       17 10424 1 1 34 THR N    N    2.455  -6.431  -1.869 1.00 . A A .  34 THR N    1 1 
       17 10425 1 1 34 THR O    O    0.871  -8.777   0.288 1.00 . A A .  34 THR O    1 1 
       17 10426 1 1 34 THR OG1  O    0.945  -5.049   0.226 1.00 . A A .  34 THR OG1  1 1 
       17 10427 1 1 35 HIS C    C   -0.992  -9.691  -1.911 1.00 . A A .  35 HIS C    1 1 
       17 10428 1 1 35 HIS CA   C   -1.239  -8.262  -1.435 1.00 . A A .  35 HIS CA   1 1 
       17 10429 1 1 35 HIS CB   C   -2.224  -7.563  -2.371 1.00 . A A .  35 HIS CB   1 1 
       17 10430 1 1 35 HIS CD2  C   -2.656  -5.045  -1.924 1.00 . A A .  35 HIS CD2  1 1 
       17 10431 1 1 35 HIS CE1  C   -4.302  -5.251  -0.492 1.00 . A A .  35 HIS CE1  1 1 
       17 10432 1 1 35 HIS CG   C   -2.888  -6.368  -1.759 1.00 . A A .  35 HIS CG   1 1 
       17 10433 1 1 35 HIS H    H    0.149  -6.756  -1.970 1.00 . A A .  35 HIS H    1 1 
       17 10434 1 1 35 HIS HA   H   -1.661  -8.295  -0.442 1.00 . A A .  35 HIS HA   1 1 
       17 10435 1 1 35 HIS HB2  H   -1.698  -7.233  -3.255 1.00 . A A .  35 HIS HB2  1 1 
       17 10436 1 1 35 HIS HB3  H   -2.997  -8.262  -2.658 1.00 . A A .  35 HIS HB3  1 1 
       17 10437 1 1 35 HIS HD1  H   -4.325  -7.297  -0.529 1.00 . A A .  35 HIS HD1  1 1 
       17 10438 1 1 35 HIS HD2  H   -1.907  -4.600  -2.565 1.00 . A A .  35 HIS HD2  1 1 
       17 10439 1 1 35 HIS HE1  H   -5.093  -5.018   0.205 1.00 . A A .  35 HIS HE1  1 1 
       17 10440 1 1 35 HIS N    N    0.012  -7.515  -1.365 1.00 . A A .  35 HIS N    1 1 
       17 10441 1 1 35 HIS ND1  N   -3.924  -6.464  -0.855 1.00 . A A .  35 HIS ND1  1 1 
       17 10442 1 1 35 HIS NE2  N   -3.548  -4.372  -1.126 1.00 . A A .  35 HIS NE2  1 1 
       17 10443 1 1 35 HIS O    O   -1.469 -10.649  -1.303 1.00 . A A .  35 HIS O    1 1 
       17 10444 1 1 36 SER C    C    0.732 -12.028  -2.521 1.00 . A A .  36 SER C    1 1 
       17 10445 1 1 36 SER CA   C    0.062 -11.136  -3.562 1.00 . A A .  36 SER CA   1 1 
       17 10446 1 1 36 SER CB   C    0.968 -10.992  -4.786 1.00 . A A .  36 SER CB   1 1 
       17 10447 1 1 36 SER H    H    0.108  -9.023  -3.441 1.00 . A A .  36 SER H    1 1 
       17 10448 1 1 36 SER HA   H   -0.868 -11.592  -3.865 1.00 . A A .  36 SER HA   1 1 
       17 10449 1 1 36 SER HB2  H    0.443 -10.449  -5.557 1.00 . A A .  36 SER HB2  1 1 
       17 10450 1 1 36 SER HB3  H    1.861 -10.450  -4.508 1.00 . A A .  36 SER HB3  1 1 
       17 10451 1 1 36 SER HG   H    1.671 -12.809  -4.578 1.00 . A A .  36 SER HG   1 1 
       17 10452 1 1 36 SER N    N   -0.244  -9.825  -3.002 1.00 . A A .  36 SER N    1 1 
       17 10453 1 1 36 SER O    O    1.714 -11.638  -1.892 1.00 . A A .  36 SER O    1 1 
       17 10454 1 1 36 SER OG   O    1.343 -12.260  -5.295 1.00 . A A .  36 SER OG   1 1 
       17 10455 1 1 37 GLY C    C   -0.104 -15.402  -1.212 1.00 . A A .  37 GLY C    1 1 
       17 10456 1 1 37 GLY CA   C    0.750 -14.161  -1.382 1.00 . A A .  37 GLY CA   1 1 
       17 10457 1 1 37 GLY H    H   -0.590 -13.489  -2.877 1.00 . A A .  37 GLY H    1 1 
       17 10458 1 1 37 GLY HA2  H    1.735 -14.457  -1.711 1.00 . A A .  37 GLY HA2  1 1 
       17 10459 1 1 37 GLY HA3  H    0.835 -13.663  -0.427 1.00 . A A .  37 GLY HA3  1 1 
       17 10460 1 1 37 GLY N    N    0.193 -13.231  -2.347 1.00 . A A .  37 GLY N    1 1 
       17 10461 1 1 37 GLY O    O   -0.477 -16.045  -2.193 1.00 . A A .  37 GLY O    1 1 
       17 10462 1 1 38 GLU C    C   -2.605 -16.504   0.846 1.00 . A A .  38 GLU C    1 1 
       17 10463 1 1 38 GLU CA   C   -1.228 -16.912   0.330 1.00 . A A .  38 GLU CA   1 1 
       17 10464 1 1 38 GLU CB   C   -0.527 -17.801   1.360 1.00 . A A .  38 GLU CB   1 1 
       17 10465 1 1 38 GLU CD   C    0.897 -19.882   1.513 1.00 . A A .  38 GLU CD   1 1 
       17 10466 1 1 38 GLU CG   C    0.659 -18.566   0.797 1.00 . A A .  38 GLU CG   1 1 
       17 10467 1 1 38 GLU H    H   -0.087 -15.186   0.776 1.00 . A A .  38 GLU H    1 1 
       17 10468 1 1 38 GLU HA   H   -1.351 -17.469  -0.587 1.00 . A A .  38 GLU HA   1 1 
       17 10469 1 1 38 GLU HB2  H   -0.178 -17.183   2.173 1.00 . A A .  38 GLU HB2  1 1 
       17 10470 1 1 38 GLU HB3  H   -1.240 -18.516   1.744 1.00 . A A .  38 GLU HB3  1 1 
       17 10471 1 1 38 GLU HG2  H    0.476 -18.771  -0.247 1.00 . A A .  38 GLU HG2  1 1 
       17 10472 1 1 38 GLU HG3  H    1.544 -17.955   0.894 1.00 . A A .  38 GLU HG3  1 1 
       17 10473 1 1 38 GLU N    N   -0.414 -15.739   0.036 1.00 . A A .  38 GLU N    1 1 
       17 10474 1 1 38 GLU O    O   -3.557 -17.283   0.792 1.00 . A A .  38 GLU O    1 1 
       17 10475 1 1 38 GLU OE1  O    0.852 -19.895   2.761 1.00 . A A .  38 GLU OE1  1 1 
       17 10476 1 1 38 GLU OE2  O    1.129 -20.898   0.824 1.00 . A A .  38 GLU OE2  1 1 
       17 10477 1 1 39 LYS C    C   -4.303 -13.416   1.247 1.00 . A A .  39 LYS C    1 1 
       17 10478 1 1 39 LYS CA   C   -3.961 -14.764   1.874 1.00 . A A .  39 LYS CA   1 1 
       17 10479 1 1 39 LYS CB   C   -3.882 -14.625   3.396 1.00 . A A .  39 LYS CB   1 1 
       17 10480 1 1 39 LYS CD   C   -5.095 -14.237   5.562 1.00 . A A .  39 LYS CD   1 1 
       17 10481 1 1 39 LYS CE   C   -5.173 -15.588   6.256 1.00 . A A .  39 LYS CE   1 1 
       17 10482 1 1 39 LYS CG   C   -5.228 -14.377   4.055 1.00 . A A .  39 LYS CG   1 1 
       17 10483 1 1 39 LYS H    H   -1.907 -14.704   1.364 1.00 . A A .  39 LYS H    1 1 
       17 10484 1 1 39 LYS HA   H   -4.738 -15.471   1.625 1.00 . A A .  39 LYS HA   1 1 
       17 10485 1 1 39 LYS HB2  H   -3.465 -15.532   3.807 1.00 . A A .  39 LYS HB2  1 1 
       17 10486 1 1 39 LYS HB3  H   -3.230 -13.798   3.637 1.00 . A A .  39 LYS HB3  1 1 
       17 10487 1 1 39 LYS HD2  H   -4.142 -13.783   5.789 1.00 . A A .  39 LYS HD2  1 1 
       17 10488 1 1 39 LYS HD3  H   -5.893 -13.607   5.928 1.00 . A A .  39 LYS HD3  1 1 
       17 10489 1 1 39 LYS HE2  H   -5.958 -16.169   5.797 1.00 . A A .  39 LYS HE2  1 1 
       17 10490 1 1 39 LYS HE3  H   -4.229 -16.097   6.131 1.00 . A A .  39 LYS HE3  1 1 
       17 10491 1 1 39 LYS HG2  H   -5.652 -13.468   3.656 1.00 . A A .  39 LYS HG2  1 1 
       17 10492 1 1 39 LYS HG3  H   -5.884 -15.208   3.836 1.00 . A A .  39 LYS HG3  1 1 
       17 10493 1 1 39 LYS HZ1  H   -4.595 -15.617   8.263 1.00 . A A .  39 LYS HZ1  1 1 
       17 10494 1 1 39 LYS HZ2  H   -6.183 -16.138   8.000 1.00 . A A .  39 LYS HZ2  1 1 
       17 10495 1 1 39 LYS HZ3  H   -5.808 -14.491   7.916 1.00 . A A .  39 LYS HZ3  1 1 
       17 10496 1 1 39 LYS N    N   -2.702 -15.278   1.348 1.00 . A A .  39 LYS N    1 1 
       17 10497 1 1 39 LYS NZ   N   -5.460 -15.448   7.711 1.00 . A A .  39 LYS NZ   1 1 
       17 10498 1 1 39 LYS O    O   -4.129 -12.360   1.855 1.00 . A A .  39 LYS O    1 1 
       17 10499 1 1 40 PRO C    C   -6.421 -11.572  -0.149 1.00 . A A .  40 PRO C    1 1 
       17 10500 1 1 40 PRO CA   C   -5.181 -12.241  -0.733 1.00 . A A .  40 PRO CA   1 1 
       17 10501 1 1 40 PRO CB   C   -5.467 -12.759  -2.145 1.00 . A A .  40 PRO CB   1 1 
       17 10502 1 1 40 PRO CD   C   -5.036 -14.675  -0.782 1.00 . A A .  40 PRO CD   1 1 
       17 10503 1 1 40 PRO CG   C   -5.841 -14.188  -1.955 1.00 . A A .  40 PRO CG   1 1 
       17 10504 1 1 40 PRO HA   H   -4.371 -11.527  -0.767 1.00 . A A .  40 PRO HA   1 1 
       17 10505 1 1 40 PRO HB2  H   -6.278 -12.192  -2.581 1.00 . A A .  40 PRO HB2  1 1 
       17 10506 1 1 40 PRO HB3  H   -4.582 -12.660  -2.755 1.00 . A A .  40 PRO HB3  1 1 
       17 10507 1 1 40 PRO HD2  H   -5.600 -15.398  -0.211 1.00 . A A .  40 PRO HD2  1 1 
       17 10508 1 1 40 PRO HD3  H   -4.102 -15.102  -1.117 1.00 . A A .  40 PRO HD3  1 1 
       17 10509 1 1 40 PRO HG2  H   -6.897 -14.267  -1.744 1.00 . A A .  40 PRO HG2  1 1 
       17 10510 1 1 40 PRO HG3  H   -5.591 -14.753  -2.841 1.00 . A A .  40 PRO HG3  1 1 
       17 10511 1 1 40 PRO N    N   -4.802 -13.451   0.002 1.00 . A A .  40 PRO N    1 1 
       17 10512 1 1 40 PRO O    O   -7.539 -11.809  -0.607 1.00 . A A .  40 PRO O    1 1 
       17 10513 1 1 41 SER C    C   -7.910  -8.979   0.585 1.00 . A A .  41 SER C    1 1 
       17 10514 1 1 41 SER CA   C   -7.318 -10.035   1.512 1.00 . A A .  41 SER CA   1 1 
       17 10515 1 1 41 SER CB   C   -6.841  -9.381   2.810 1.00 . A A .  41 SER CB   1 1 
       17 10516 1 1 41 SER H    H   -5.301 -10.589   1.184 1.00 . A A .  41 SER H    1 1 
       17 10517 1 1 41 SER HA   H   -8.081 -10.762   1.745 1.00 . A A .  41 SER HA   1 1 
       17 10518 1 1 41 SER HB2  H   -6.207 -10.071   3.346 1.00 . A A .  41 SER HB2  1 1 
       17 10519 1 1 41 SER HB3  H   -6.282  -8.487   2.575 1.00 . A A .  41 SER HB3  1 1 
       17 10520 1 1 41 SER HG   H   -8.610  -8.595   3.110 1.00 . A A .  41 SER HG   1 1 
       17 10521 1 1 41 SER N    N   -6.215 -10.736   0.863 1.00 . A A .  41 SER N    1 1 
       17 10522 1 1 41 SER O    O   -7.200  -8.369  -0.214 1.00 . A A .  41 SER O    1 1 
       17 10523 1 1 41 SER OG   O   -7.937  -9.031   3.637 1.00 . A A .  41 SER OG   1 1 
       17 10524 1 1 42 GLY C    C  -11.170  -7.274   0.485 1.00 . A A .  42 GLY C    1 1 
       17 10525 1 1 42 GLY CA   C   -9.885  -7.785  -0.136 1.00 . A A .  42 GLY CA   1 1 
       17 10526 1 1 42 GLY H    H   -9.734  -9.283   1.352 1.00 . A A .  42 GLY H    1 1 
       17 10527 1 1 42 GLY HA2  H   -9.218  -6.951  -0.295 1.00 . A A .  42 GLY HA2  1 1 
       17 10528 1 1 42 GLY HA3  H  -10.115  -8.235  -1.090 1.00 . A A .  42 GLY HA3  1 1 
       17 10529 1 1 42 GLY N    N   -9.218  -8.767   0.698 1.00 . A A .  42 GLY N    1 1 
       17 10530 1 1 42 GLY O    O  -12.267  -7.725   0.154 1.00 . A A .  42 GLY O    1 1 
       17 10531 1 1 43 PRO C    C  -13.041  -4.853   1.174 1.00 . A A .  43 PRO C    1 1 
       17 10532 1 1 43 PRO CA   C  -12.193  -5.719   2.100 1.00 . A A .  43 PRO CA   1 1 
       17 10533 1 1 43 PRO CB   C  -11.549  -4.861   3.192 1.00 . A A .  43 PRO CB   1 1 
       17 10534 1 1 43 PRO CD   C   -9.767  -5.726   1.854 1.00 . A A .  43 PRO CD   1 1 
       17 10535 1 1 43 PRO CG   C  -10.193  -4.535   2.667 1.00 . A A .  43 PRO CG   1 1 
       17 10536 1 1 43 PRO HA   H  -12.816  -6.475   2.554 1.00 . A A .  43 PRO HA   1 1 
       17 10537 1 1 43 PRO HB2  H  -12.139  -3.968   3.347 1.00 . A A .  43 PRO HB2  1 1 
       17 10538 1 1 43 PRO HB3  H  -11.491  -5.425   4.110 1.00 . A A .  43 PRO HB3  1 1 
       17 10539 1 1 43 PRO HD2  H   -9.172  -5.412   1.009 1.00 . A A .  43 PRO HD2  1 1 
       17 10540 1 1 43 PRO HD3  H   -9.216  -6.424   2.467 1.00 . A A .  43 PRO HD3  1 1 
       17 10541 1 1 43 PRO HG2  H  -10.242  -3.654   2.045 1.00 . A A .  43 PRO HG2  1 1 
       17 10542 1 1 43 PRO HG3  H   -9.510  -4.378   3.489 1.00 . A A .  43 PRO HG3  1 1 
       17 10543 1 1 43 PRO N    N  -11.043  -6.311   1.410 1.00 . A A .  43 PRO N    1 1 
       17 10544 1 1 43 PRO O    O  -12.783  -4.774  -0.027 1.00 . A A .  43 PRO O    1 1 
       17 10545 1 1 44 SER C    C  -14.217  -2.088   0.504 1.00 . A A .  44 SER C    1 1 
       17 10546 1 1 44 SER CA   C  -14.943  -3.349   0.964 1.00 . A A .  44 SER CA   1 1 
       17 10547 1 1 44 SER CB   C  -16.172  -2.969   1.793 1.00 . A A .  44 SER CB   1 1 
       17 10548 1 1 44 SER H    H  -14.210  -4.310   2.703 1.00 . A A .  44 SER H    1 1 
       17 10549 1 1 44 SER HA   H  -15.263  -3.903   0.095 1.00 . A A .  44 SER HA   1 1 
       17 10550 1 1 44 SER HB2  H  -15.853  -2.488   2.705 1.00 . A A .  44 SER HB2  1 1 
       17 10551 1 1 44 SER HB3  H  -16.790  -2.289   1.224 1.00 . A A .  44 SER HB3  1 1 
       17 10552 1 1 44 SER HG   H  -17.398  -3.963   2.953 1.00 . A A .  44 SER HG   1 1 
       17 10553 1 1 44 SER N    N  -14.055  -4.206   1.740 1.00 . A A .  44 SER N    1 1 
       17 10554 1 1 44 SER O    O  -13.241  -1.661   1.120 1.00 . A A .  44 SER O    1 1 
       17 10555 1 1 44 SER OG   O  -16.938  -4.114   2.124 1.00 . A A .  44 SER OG   1 1 
       17 10556 1 1 45 SER C    C  -15.147   0.796  -1.341 1.00 . A A .  45 SER C    1 1 
       17 10557 1 1 45 SER CA   C  -14.096  -0.290  -1.132 1.00 . A A .  45 SER CA   1 1 
       17 10558 1 1 45 SER CB   C  -13.394  -0.599  -2.455 1.00 . A A .  45 SER CB   1 1 
       17 10559 1 1 45 SER H    H  -15.481  -1.888  -1.032 1.00 . A A .  45 SER H    1 1 
       17 10560 1 1 45 SER HA   H  -13.365   0.066  -0.421 1.00 . A A .  45 SER HA   1 1 
       17 10561 1 1 45 SER HB2  H  -12.675   0.177  -2.668 1.00 . A A .  45 SER HB2  1 1 
       17 10562 1 1 45 SER HB3  H  -12.886  -1.549  -2.377 1.00 . A A .  45 SER HB3  1 1 
       17 10563 1 1 45 SER HG   H  -14.396   0.198  -3.939 1.00 . A A .  45 SER HG   1 1 
       17 10564 1 1 45 SER N    N  -14.700  -1.499  -0.585 1.00 . A A .  45 SER N    1 1 
       17 10565 1 1 45 SER O    O  -16.343   0.558  -1.178 1.00 . A A .  45 SER O    1 1 
       17 10566 1 1 45 SER OG   O  -14.324  -0.664  -3.523 1.00 . A A .  45 SER OG   1 1 
       17 10567 1 1 46 GLY C    C  -16.196   3.631  -0.644 1.00 . A A .  46 GLY C    1 1 
       17 10568 1 1 46 GLY CA   C  -15.603   3.096  -1.932 1.00 . A A .  46 GLY CA   1 1 
       17 10569 1 1 46 GLY H    H  -13.726   2.123  -1.821 1.00 . A A .  46 GLY H    1 1 
       17 10570 1 1 46 GLY HA2  H  -15.070   3.893  -2.429 1.00 . A A .  46 GLY HA2  1 1 
       17 10571 1 1 46 GLY HA3  H  -16.406   2.760  -2.572 1.00 . A A .  46 GLY HA3  1 1 
       17 10572 1 1 46 GLY N    N  -14.691   1.991  -1.705 1.00 . A A .  46 GLY N    1 1 
       17 10573 1 1 46 GLY O    O  -15.972   3.039   0.411 1.00 . A A .  46 GLY O    1 1 
       17 10574 2 2  1 ZN  ZN   ZN  -4.036  -2.449  -1.455 1.00 . B A . 201 ZN  ZN   1 1 
       18 10575 1 1  1 GLY C    C  -15.311  18.631 -21.798 1.00 . A A .   1 GLY C    1 1 
       18 10576 1 1  1 GLY CA   C  -16.051  17.612 -22.641 1.00 . A A .   1 GLY CA   1 1 
       18 10577 1 1  1 GLY H1   H  -17.436  19.042 -23.363 1.00 . A A .   1 GLY H1   1 1 
       18 10578 1 1  1 GLY HA2  H  -16.631  16.974 -21.990 1.00 . A A .   1 GLY HA2  1 1 
       18 10579 1 1  1 GLY HA3  H  -15.330  17.008 -23.171 1.00 . A A .   1 GLY HA3  1 1 
       18 10580 1 1  1 GLY N    N  -16.942  18.231 -23.606 1.00 . A A .   1 GLY N    1 1 
       18 10581 1 1  1 GLY O    O  -14.105  18.512 -21.585 1.00 . A A .   1 GLY O    1 1 
       18 10582 1 1  2 SER C    C  -15.848  20.531 -19.036 1.00 . A A .   2 SER C    1 1 
       18 10583 1 1  2 SER CA   C  -15.438  20.685 -20.498 1.00 . A A .   2 SER CA   1 1 
       18 10584 1 1  2 SER CB   C  -15.853  22.064 -21.013 1.00 . A A .   2 SER CB   1 1 
       18 10585 1 1  2 SER H    H  -16.992  19.678 -21.523 1.00 . A A .   2 SER H    1 1 
       18 10586 1 1  2 SER HA   H  -14.364  20.591 -20.570 1.00 . A A .   2 SER HA   1 1 
       18 10587 1 1  2 SER HB2  H  -15.289  22.824 -20.494 1.00 . A A .   2 SER HB2  1 1 
       18 10588 1 1  2 SER HB3  H  -15.650  22.126 -22.073 1.00 . A A .   2 SER HB3  1 1 
       18 10589 1 1  2 SER HG   H  -17.657  22.509 -21.634 1.00 . A A .   2 SER HG   1 1 
       18 10590 1 1  2 SER N    N  -16.035  19.638 -21.318 1.00 . A A .   2 SER N    1 1 
       18 10591 1 1  2 SER O    O  -16.992  20.800 -18.670 1.00 . A A .   2 SER O    1 1 
       18 10592 1 1  2 SER OG   O  -17.234  22.294 -20.799 1.00 . A A .   2 SER OG   1 1 
       18 10593 1 1  3 SER C    C  -14.687  21.101 -15.975 1.00 . A A .   3 SER C    1 1 
       18 10594 1 1  3 SER CA   C  -15.169  19.902 -16.785 1.00 . A A .   3 SER CA   1 1 
       18 10595 1 1  3 SER CB   C  -14.484  18.627 -16.288 1.00 . A A .   3 SER CB   1 1 
       18 10596 1 1  3 SER H    H  -14.012  19.898 -18.559 1.00 . A A .   3 SER H    1 1 
       18 10597 1 1  3 SER HA   H  -16.236  19.800 -16.657 1.00 . A A .   3 SER HA   1 1 
       18 10598 1 1  3 SER HB2  H  -14.928  17.771 -16.771 1.00 . A A .   3 SER HB2  1 1 
       18 10599 1 1  3 SER HB3  H  -13.431  18.671 -16.527 1.00 . A A .   3 SER HB3  1 1 
       18 10600 1 1  3 SER HG   H  -15.468  18.860 -14.610 1.00 . A A .   3 SER HG   1 1 
       18 10601 1 1  3 SER N    N  -14.906  20.096 -18.206 1.00 . A A .   3 SER N    1 1 
       18 10602 1 1  3 SER O    O  -15.464  21.735 -15.262 1.00 . A A .   3 SER O    1 1 
       18 10603 1 1  3 SER OG   O  -14.627  18.486 -14.885 1.00 . A A .   3 SER OG   1 1 
       18 10604 1 1  4 GLY C    C  -12.172  22.106 -14.067 1.00 . A A .   4 GLY C    1 1 
       18 10605 1 1  4 GLY CA   C  -12.834  22.529 -15.364 1.00 . A A .   4 GLY CA   1 1 
       18 10606 1 1  4 GLY H    H  -12.826  20.866 -16.674 1.00 . A A .   4 GLY H    1 1 
       18 10607 1 1  4 GLY HA2  H  -12.100  23.016 -15.988 1.00 . A A .   4 GLY HA2  1 1 
       18 10608 1 1  4 GLY HA3  H  -13.624  23.231 -15.139 1.00 . A A .   4 GLY HA3  1 1 
       18 10609 1 1  4 GLY N    N  -13.398  21.407 -16.091 1.00 . A A .   4 GLY N    1 1 
       18 10610 1 1  4 GLY O    O  -12.850  21.832 -13.077 1.00 . A A .   4 GLY O    1 1 
       18 10611 1 1  5 SER C    C   -8.731  22.343 -12.854 1.00 . A A .   5 SER C    1 1 
       18 10612 1 1  5 SER CA   C  -10.091  21.653 -12.889 1.00 . A A .   5 SER CA   1 1 
       18 10613 1 1  5 SER CB   C   -9.906  20.135 -12.864 1.00 . A A .   5 SER CB   1 1 
       18 10614 1 1  5 SER H    H  -10.360  22.282 -14.893 1.00 . A A .   5 SER H    1 1 
       18 10615 1 1  5 SER HA   H  -10.656  21.953 -12.020 1.00 . A A .   5 SER HA   1 1 
       18 10616 1 1  5 SER HB2  H   -9.674  19.820 -11.858 1.00 . A A .   5 SER HB2  1 1 
       18 10617 1 1  5 SER HB3  H  -10.819  19.658 -13.189 1.00 . A A .   5 SER HB3  1 1 
       18 10618 1 1  5 SER HG   H   -8.590  18.836 -13.510 1.00 . A A .   5 SER HG   1 1 
       18 10619 1 1  5 SER N    N  -10.844  22.051 -14.073 1.00 . A A .   5 SER N    1 1 
       18 10620 1 1  5 SER O    O   -8.177  22.702 -13.893 1.00 . A A .   5 SER O    1 1 
       18 10621 1 1  5 SER OG   O   -8.851  19.735 -13.721 1.00 . A A .   5 SER OG   1 1 
       18 10622 1 1  6 SER C    C   -5.792  22.142 -11.333 1.00 . A A .   6 SER C    1 1 
       18 10623 1 1  6 SER CA   C   -6.904  23.176 -11.477 1.00 . A A .   6 SER CA   1 1 
       18 10624 1 1  6 SER CB   C   -6.929  24.090 -10.250 1.00 . A A .   6 SER CB   1 1 
       18 10625 1 1  6 SER H    H   -8.688  22.217 -10.859 1.00 . A A .   6 SER H    1 1 
       18 10626 1 1  6 SER HA   H   -6.713  23.773 -12.356 1.00 . A A .   6 SER HA   1 1 
       18 10627 1 1  6 SER HB2  H   -5.949  24.518 -10.104 1.00 . A A .   6 SER HB2  1 1 
       18 10628 1 1  6 SER HB3  H   -7.648  24.880 -10.408 1.00 . A A .   6 SER HB3  1 1 
       18 10629 1 1  6 SER HG   H   -7.792  23.940  -8.498 1.00 . A A .   6 SER HG   1 1 
       18 10630 1 1  6 SER N    N   -8.198  22.526 -11.650 1.00 . A A .   6 SER N    1 1 
       18 10631 1 1  6 SER O    O   -4.906  22.280 -10.490 1.00 . A A .   6 SER O    1 1 
       18 10632 1 1  6 SER OG   O   -7.291  23.369  -9.085 1.00 . A A .   6 SER OG   1 1 
       18 10633 1 1  7 GLY C    C   -4.966  19.190 -10.880 1.00 . A A .   7 GLY C    1 1 
       18 10634 1 1  7 GLY CA   C   -4.837  20.062 -12.113 1.00 . A A .   7 GLY CA   1 1 
       18 10635 1 1  7 GLY H    H   -6.574  21.047 -12.815 1.00 . A A .   7 GLY H    1 1 
       18 10636 1 1  7 GLY HA2  H   -4.932  19.442 -12.992 1.00 . A A .   7 GLY HA2  1 1 
       18 10637 1 1  7 GLY HA3  H   -3.859  20.522 -12.113 1.00 . A A .   7 GLY HA3  1 1 
       18 10638 1 1  7 GLY N    N   -5.845  21.105 -12.163 1.00 . A A .   7 GLY N    1 1 
       18 10639 1 1  7 GLY O    O   -4.133  19.252  -9.975 1.00 . A A .   7 GLY O    1 1 
       18 10640 1 1  8 THR C    C   -5.031  16.618  -9.426 1.00 . A A .   8 THR C    1 1 
       18 10641 1 1  8 THR CA   C   -6.252  17.487  -9.710 1.00 . A A .   8 THR CA   1 1 
       18 10642 1 1  8 THR CB   C   -7.470  16.576  -9.955 1.00 . A A .   8 THR CB   1 1 
       18 10643 1 1  8 THR CG2  C   -7.789  15.754  -8.716 1.00 . A A .   8 THR CG2  1 1 
       18 10644 1 1  8 THR H    H   -6.643  18.369 -11.593 1.00 . A A .   8 THR H    1 1 
       18 10645 1 1  8 THR HA   H   -6.455  18.099  -8.843 1.00 . A A .   8 THR HA   1 1 
       18 10646 1 1  8 THR HB   H   -7.238  15.902 -10.767 1.00 . A A .   8 THR HB   1 1 
       18 10647 1 1  8 THR HG1  H   -8.527  17.646 -11.231 1.00 . A A .   8 THR HG1  1 1 
       18 10648 1 1  8 THR HG21 H   -7.057  15.960  -7.949 1.00 . A A .   8 THR HG21 1 1 
       18 10649 1 1  8 THR HG22 H   -7.764  14.703  -8.964 1.00 . A A .   8 THR HG22 1 1 
       18 10650 1 1  8 THR HG23 H   -8.772  16.015  -8.354 1.00 . A A .   8 THR HG23 1 1 
       18 10651 1 1  8 THR N    N   -6.014  18.373 -10.842 1.00 . A A .   8 THR N    1 1 
       18 10652 1 1  8 THR O    O   -4.589  15.853 -10.282 1.00 . A A .   8 THR O    1 1 
       18 10653 1 1  8 THR OG1  O   -8.608  17.367 -10.315 1.00 . A A .   8 THR OG1  1 1 
       18 10654 1 1  9 GLY C    C   -3.432  15.399  -6.439 1.00 . A A .   9 GLY C    1 1 
       18 10655 1 1  9 GLY CA   C   -3.326  15.961  -7.843 1.00 . A A .   9 GLY CA   1 1 
       18 10656 1 1  9 GLY H    H   -4.886  17.368  -7.575 1.00 . A A .   9 GLY H    1 1 
       18 10657 1 1  9 GLY HA2  H   -3.215  15.144  -8.539 1.00 . A A .   9 GLY HA2  1 1 
       18 10658 1 1  9 GLY HA3  H   -2.451  16.592  -7.900 1.00 . A A .   9 GLY HA3  1 1 
       18 10659 1 1  9 GLY N    N   -4.491  16.742  -8.218 1.00 . A A .   9 GLY N    1 1 
       18 10660 1 1  9 GLY O    O   -2.465  15.426  -5.679 1.00 . A A .   9 GLY O    1 1 
       18 10661 1 1 10 GLU C    C   -5.502  12.951  -4.874 1.00 . A A .  10 GLU C    1 1 
       18 10662 1 1 10 GLU CA   C   -4.839  14.322  -4.771 1.00 . A A .  10 GLU CA   1 1 
       18 10663 1 1 10 GLU CB   C   -5.711  15.260  -3.932 1.00 . A A .  10 GLU CB   1 1 
       18 10664 1 1 10 GLU CD   C   -4.809  17.568  -4.424 1.00 . A A .  10 GLU CD   1 1 
       18 10665 1 1 10 GLU CG   C   -4.962  16.467  -3.392 1.00 . A A .  10 GLU CG   1 1 
       18 10666 1 1 10 GLU H    H   -5.344  14.898  -6.744 1.00 . A A .  10 GLU H    1 1 
       18 10667 1 1 10 GLU HA   H   -3.880  14.210  -4.288 1.00 . A A .  10 GLU HA   1 1 
       18 10668 1 1 10 GLU HB2  H   -6.529  15.613  -4.542 1.00 . A A .  10 GLU HB2  1 1 
       18 10669 1 1 10 GLU HB3  H   -6.111  14.707  -3.095 1.00 . A A .  10 GLU HB3  1 1 
       18 10670 1 1 10 GLU HG2  H   -5.503  16.861  -2.545 1.00 . A A .  10 GLU HG2  1 1 
       18 10671 1 1 10 GLU HG3  H   -3.978  16.152  -3.075 1.00 . A A .  10 GLU HG3  1 1 
       18 10672 1 1 10 GLU N    N   -4.611  14.891  -6.094 1.00 . A A .  10 GLU N    1 1 
       18 10673 1 1 10 GLU O    O   -6.559  12.804  -5.488 1.00 . A A .  10 GLU O    1 1 
       18 10674 1 1 10 GLU OE1  O   -5.770  17.808  -5.183 1.00 . A A .  10 GLU OE1  1 1 
       18 10675 1 1 10 GLU OE2  O   -3.726  18.189  -4.471 1.00 . A A .  10 GLU OE2  1 1 
       18 10676 1 1 11 LYS C    C   -5.863  10.209  -5.693 1.00 . A A .  11 LYS C    1 1 
       18 10677 1 1 11 LYS CA   C   -5.398  10.590  -4.292 1.00 . A A .  11 LYS CA   1 1 
       18 10678 1 1 11 LYS CB   C   -6.558  10.454  -3.303 1.00 . A A .  11 LYS CB   1 1 
       18 10679 1 1 11 LYS CD   C   -7.296  10.146  -0.922 1.00 . A A .  11 LYS CD   1 1 
       18 10680 1 1 11 LYS CE   C   -6.893  10.553   0.487 1.00 . A A .  11 LYS CE   1 1 
       18 10681 1 1 11 LYS CG   C   -6.113  10.193  -1.875 1.00 . A A .  11 LYS CG   1 1 
       18 10682 1 1 11 LYS H    H   -4.032  12.130  -3.796 1.00 . A A .  11 LYS H    1 1 
       18 10683 1 1 11 LYS HA   H   -4.604   9.922  -3.995 1.00 . A A .  11 LYS HA   1 1 
       18 10684 1 1 11 LYS HB2  H   -7.136  11.367  -3.317 1.00 . A A .  11 LYS HB2  1 1 
       18 10685 1 1 11 LYS HB3  H   -7.189   9.635  -3.617 1.00 . A A .  11 LYS HB3  1 1 
       18 10686 1 1 11 LYS HD2  H   -8.059  10.823  -1.275 1.00 . A A .  11 LYS HD2  1 1 
       18 10687 1 1 11 LYS HD3  H   -7.688   9.139  -0.898 1.00 . A A .  11 LYS HD3  1 1 
       18 10688 1 1 11 LYS HE2  H   -7.612  10.150   1.184 1.00 . A A .  11 LYS HE2  1 1 
       18 10689 1 1 11 LYS HE3  H   -5.917  10.144   0.701 1.00 . A A .  11 LYS HE3  1 1 
       18 10690 1 1 11 LYS HG2  H   -5.595   9.247  -1.836 1.00 . A A .  11 LYS HG2  1 1 
       18 10691 1 1 11 LYS HG3  H   -5.445  10.984  -1.565 1.00 . A A .  11 LYS HG3  1 1 
       18 10692 1 1 11 LYS HZ1  H   -7.722  12.460   0.289 1.00 . A A .  11 LYS HZ1  1 1 
       18 10693 1 1 11 LYS HZ2  H   -6.041  12.422   0.109 1.00 . A A .  11 LYS HZ2  1 1 
       18 10694 1 1 11 LYS HZ3  H   -6.729  12.283   1.647 1.00 . A A .  11 LYS HZ3  1 1 
       18 10695 1 1 11 LYS N    N   -4.872  11.950  -4.270 1.00 . A A .  11 LYS N    1 1 
       18 10696 1 1 11 LYS NZ   N   -6.843  12.033   0.644 1.00 . A A .  11 LYS NZ   1 1 
       18 10697 1 1 11 LYS O    O   -6.986   9.747  -5.897 1.00 . A A .  11 LYS O    1 1 
       18 10698 1 1 12 PRO C    C   -5.370   8.585  -8.330 1.00 . A A .  12 PRO C    1 1 
       18 10699 1 1 12 PRO CA   C   -5.279  10.087  -8.084 1.00 . A A .  12 PRO CA   1 1 
       18 10700 1 1 12 PRO CB   C   -4.091  10.683  -8.844 1.00 . A A .  12 PRO CB   1 1 
       18 10701 1 1 12 PRO CD   C   -3.624  10.953  -6.515 1.00 . A A .  12 PRO CD   1 1 
       18 10702 1 1 12 PRO CG   C   -2.980  10.707  -7.851 1.00 . A A .  12 PRO CG   1 1 
       18 10703 1 1 12 PRO HA   H   -6.192  10.561  -8.413 1.00 . A A .  12 PRO HA   1 1 
       18 10704 1 1 12 PRO HB2  H   -3.851  10.055  -9.691 1.00 . A A .  12 PRO HB2  1 1 
       18 10705 1 1 12 PRO HB3  H   -4.338  11.677  -9.184 1.00 . A A .  12 PRO HB3  1 1 
       18 10706 1 1 12 PRO HD2  H   -3.091  10.427  -5.736 1.00 . A A .  12 PRO HD2  1 1 
       18 10707 1 1 12 PRO HD3  H   -3.660  12.011  -6.302 1.00 . A A .  12 PRO HD3  1 1 
       18 10708 1 1 12 PRO HG2  H   -2.467   9.758  -7.851 1.00 . A A .  12 PRO HG2  1 1 
       18 10709 1 1 12 PRO HG3  H   -2.294  11.507  -8.088 1.00 . A A .  12 PRO HG3  1 1 
       18 10710 1 1 12 PRO N    N   -4.981  10.406  -6.684 1.00 . A A .  12 PRO N    1 1 
       18 10711 1 1 12 PRO O    O   -6.121   8.132  -9.194 1.00 . A A .  12 PRO O    1 1 
       18 10712 1 1 13 TYR C    C   -5.317   5.705  -6.534 1.00 . A A .  13 TYR C    1 1 
       18 10713 1 1 13 TYR CA   C   -4.593   6.366  -7.703 1.00 . A A .  13 TYR CA   1 1 
       18 10714 1 1 13 TYR CB   C   -3.156   5.848  -7.786 1.00 . A A .  13 TYR CB   1 1 
       18 10715 1 1 13 TYR CD1  C   -3.017   4.840 -10.097 1.00 . A A .  13 TYR CD1  1 1 
       18 10716 1 1 13 TYR CD2  C   -1.676   6.752  -9.621 1.00 . A A .  13 TYR CD2  1 1 
       18 10717 1 1 13 TYR CE1  C   -2.516   4.803 -11.384 1.00 . A A .  13 TYR CE1  1 1 
       18 10718 1 1 13 TYR CE2  C   -1.171   6.724 -10.907 1.00 . A A .  13 TYR CE2  1 1 
       18 10719 1 1 13 TYR CG   C   -2.606   5.812  -9.194 1.00 . A A .  13 TYR CG   1 1 
       18 10720 1 1 13 TYR CZ   C   -1.594   5.747 -11.784 1.00 . A A .  13 TYR CZ   1 1 
       18 10721 1 1 13 TYR H    H   -4.023   8.237  -6.895 1.00 . A A .  13 TYR H    1 1 
       18 10722 1 1 13 TYR HA   H   -5.109   6.116  -8.619 1.00 . A A .  13 TYR HA   1 1 
       18 10723 1 1 13 TYR HB2  H   -2.516   6.486  -7.197 1.00 . A A .  13 TYR HB2  1 1 
       18 10724 1 1 13 TYR HB3  H   -3.119   4.844  -7.390 1.00 . A A .  13 TYR HB3  1 1 
       18 10725 1 1 13 TYR HD1  H   -3.740   4.102  -9.781 1.00 . A A .  13 TYR HD1  1 1 
       18 10726 1 1 13 TYR HD2  H   -1.347   7.516  -8.932 1.00 . A A .  13 TYR HD2  1 1 
       18 10727 1 1 13 TYR HE1  H   -2.847   4.039 -12.072 1.00 . A A .  13 TYR HE1  1 1 
       18 10728 1 1 13 TYR HE2  H   -0.448   7.463 -11.221 1.00 . A A .  13 TYR HE2  1 1 
       18 10729 1 1 13 TYR HH   H   -0.553   4.929 -13.179 1.00 . A A .  13 TYR HH   1 1 
       18 10730 1 1 13 TYR N    N   -4.601   7.818  -7.566 1.00 . A A .  13 TYR N    1 1 
       18 10731 1 1 13 TYR O    O   -5.609   6.347  -5.525 1.00 . A A .  13 TYR O    1 1 
       18 10732 1 1 13 TYR OH   O   -1.094   5.715 -13.066 1.00 . A A .  13 TYR OH   1 1 
       18 10733 1 1 14 LYS C    C   -6.102   2.163  -5.831 1.00 . A A .  14 LYS C    1 1 
       18 10734 1 1 14 LYS CA   C   -6.291   3.663  -5.635 1.00 . A A .  14 LYS CA   1 1 
       18 10735 1 1 14 LYS CB   C   -7.783   4.004  -5.631 1.00 . A A .  14 LYS CB   1 1 
       18 10736 1 1 14 LYS CD   C   -9.811   4.292  -4.176 1.00 . A A .  14 LYS CD   1 1 
       18 10737 1 1 14 LYS CE   C   -9.558   5.676  -3.598 1.00 . A A .  14 LYS CE   1 1 
       18 10738 1 1 14 LYS CG   C   -8.513   3.531  -4.386 1.00 . A A .  14 LYS CG   1 1 
       18 10739 1 1 14 LYS H    H   -5.345   3.958  -7.505 1.00 . A A .  14 LYS H    1 1 
       18 10740 1 1 14 LYS HA   H   -5.864   3.947  -4.685 1.00 . A A .  14 LYS HA   1 1 
       18 10741 1 1 14 LYS HB2  H   -7.896   5.076  -5.703 1.00 . A A .  14 LYS HB2  1 1 
       18 10742 1 1 14 LYS HB3  H   -8.247   3.544  -6.492 1.00 . A A .  14 LYS HB3  1 1 
       18 10743 1 1 14 LYS HD2  H  -10.314   4.398  -5.126 1.00 . A A .  14 LYS HD2  1 1 
       18 10744 1 1 14 LYS HD3  H  -10.439   3.736  -3.495 1.00 . A A .  14 LYS HD3  1 1 
       18 10745 1 1 14 LYS HE2  H   -9.094   5.568  -2.630 1.00 . A A .  14 LYS HE2  1 1 
       18 10746 1 1 14 LYS HE3  H   -8.893   6.212  -4.259 1.00 . A A .  14 LYS HE3  1 1 
       18 10747 1 1 14 LYS HG2  H   -8.737   2.480  -4.489 1.00 . A A .  14 LYS HG2  1 1 
       18 10748 1 1 14 LYS HG3  H   -7.875   3.682  -3.527 1.00 . A A .  14 LYS HG3  1