NMR Restraints Grid

Result table
 (Save to zip file containing files for each block)

image mrblock_id pdb_id bmrb_id cing stage program type subtype item_count
501545 2lak 17530 cing 4-filtered-FRED STAR entry full 1711


data_FRED_restraints_with_modified_coordinates_PDB_code_2lak

# This FRED archive file contains, for PDB entry <2lak>:
# 
# - Coordinates and sequence information from the PDB mmCIF file
# - NMR restraints from the PDB MR file
# 
# In this file, the coordinates and NMR restraints share the same atom names,
# and in this way can differ from the data deposited at the wwPDB. To achieve
# this aim, the NMR restraints were parsed from their original format files, and
# the coordinates and NMR restraints information were subsequently harmonized.
# 
# Due to the complexity of this harmonization process and the filtering process
# used in creating these files, the NMR restraints information in these files
# may differ significantly from that in the originally deposited file. Other 
# modifications could have occurred to the NMR restraints information, or data 
# could have been lost because of parsing or conversion errors. The PDB file 
# remains the authoritative reference for the atomic coordinates and the 
# originally deposited restraints files remain the primary reference for these 
# data.
# 
# This file is generated at the BioMagResBank (BMRB) in collaboration with the 
# PDBe (formerly MSD) group at the European Bioinformatics Institute (EBI) and 
# the CMBI/IMM group at the Radboud University of Nijmegen.
# 
# Several software packages were used to produce this file:
# 
# - Wattos (BMRB and CMBI/IMM).
# - FormatConverter and NMRStarExport (PDBe).
# - CCPN framework (http://www.ccpn.ac.uk/).
# 
# More information about this process can be found in the references below.
# Please cite the original reference for this PDB entry.
# 
# JF Doreleijers, A Nederveen, W Vranken, J Lin, AM Bonvin, R Kaptein, JL
# Markley, and EL Ulrich (2005). BioMagResBank databases DOCR and FRED
# containing converted and filtered sets of experimental NMR restraints and
# coordinates from over 500 protein PDB structures. J. Biomol. NMR 32, 1-12.
# 
# WF Vranken, W Boucher, TJ Stevens, RH Fogh, A Pajon, M Llinas, EL Ulrich, JL
# Markley, J Ionides, ED Laue (2005). The CCPN data model for NMR spectroscopy:
# development of a software pipeline. Proteins 59, 687-696. 
# 
# JF Doreleijers, WF Vranken, C Schulte, J Lin, JR Wedell, CJ Penkett, GW Vuister, 
# G Vriend, JL Markley, and EL Ulrich (2009). The NMR Restraints Grid at BMRB for 
# 5,266 Protein and Nucleic Acid PDB Entries. J Biomol. NMR 45, 389?396.




save_Conversion_project_for_entry_Name_1
    _Study_list.Sf_category  study_list
    _Study_list.Entry_ID     1
    _Study_list.ID           1

    loop_
       _Study.ID
       _Study.Name
       _Study.Type
       _Study.Details
       _Study.Entry_ID
       _Study.Study_list_ID

       1 "Conversion project for entry 1" NMR . 1 1 
    stop_

save_


save_originalConstraints_1
    _Entry.PDB_coordinate_file_version  .
    _Entry.Sf_category                  entry_information
    _Entry.ID                           1
    _Entry.Title                        "Data for entry 1"
    _Entry.NMR_STAR_version             3.1.0.8
    _Entry.Experimental_method          NMR
    _Entry.Details                      .

save_


save_assembly_2lak
    _Assembly.Sf_category           assembly
    _Assembly.Entry_ID              1
    _Assembly.ID                    1
    _Assembly.Name                  2lak
    _Assembly.Number_of_components  1
    _Assembly.Organic_ligands       .
    _Assembly.Metal_ions            .
    _Assembly.Paramagnetic          .
    _Assembly.Thiol_state           "all free"
    _Assembly.Molecular_mass        17567.53

    loop_
       _Entity_assembly.ID
       _Entity_assembly.Entity_assembly_name
       _Entity_assembly.Entity_ID
       _Entity_assembly.Entity_label
       _Entity_assembly.Asym_ID
       _Entity_assembly.Details
       _Entity_assembly.Entry_ID
       _Entity_assembly.Assembly_ID

       1 . 1 $AHSA1_like_protein_RHE_CH02687 A . 1 1 
    stop_

save_


save_AHSA1_like_protein_RHE_CH02687
    _Entity.Sf_category                  entity
    _Entity.Entry_ID                     1
    _Entity.ID                           1
    _Entity.Name                         "AHSA1 like protein RHE CH02687"
    _Entity.Type                         polymer
    _Entity.Polymer_type                 polypeptide(L)
    _Entity.Polymer_seq_one_letter_code  MEKAMPESFVVRREAHLAAPPAAVFALMTDPEKILRWMGTEAEVEPEPGGLYLVNVTGARFARGSFREVVPVHRLAYSFGWDGSEVVPPGSSLVEIDLIEQGGGTLLRLTHSGLPSAEQCAGHEEGWAHYLGRLTEVAAGRDPGPDPFYGRRLEHHHHHH
    _Entity.Number_of_monomers           160

    loop_
       _Entity_comp_index.ID
       _Entity_comp_index.Comp_ID
       _Entity_comp_index.Comp_label
       _Entity_comp_index.Entry_ID
       _Entity_comp_index.Entity_ID

         1 MET . 1 1 
         2 GLU . 1 1 
         3 LYS . 1 1 
         4 ALA . 1 1 
         5 MET . 1 1 
         6 PRO . 1 1 
         7 GLU . 1 1 
         8 SER . 1 1 
         9 PHE . 1 1 
        10 VAL . 1 1 
        11 VAL . 1 1 
        12 ARG . 1 1 
        13 ARG . 1 1 
        14 GLU . 1 1 
        15 ALA . 1 1 
        16 HIS . 1 1 
        17 LEU . 1 1 
        18 ALA . 1 1 
        19 ALA . 1 1 
        20 PRO . 1 1 
        21 PRO . 1 1 
        22 ALA . 1 1 
        23 ALA . 1 1 
        24 VAL . 1 1 
        25 PHE . 1 1 
        26 ALA . 1 1 
        27 LEU . 1 1 
        28 MET . 1 1 
        29 THR . 1 1 
        30 ASP . 1 1 
        31 PRO . 1 1 
        32 GLU . 1 1 
        33 LYS . 1 1 
        34 ILE . 1 1 
        35 LEU . 1 1 
        36 ARG . 1 1 
        37 TRP . 1 1 
        38 MET . 1 1 
        39 GLY . 1 1 
        40 THR . 1 1 
        41 GLU . 1 1 
        42 ALA . 1 1 
        43 GLU . 1 1 
        44 VAL . 1 1 
        45 GLU . 1 1 
        46 PRO . 1 1 
        47 GLU . 1 1 
        48 PRO . 1 1 
        49 GLY . 1 1 
        50 GLY . 1 1 
        51 LEU . 1 1 
        52 TYR . 1 1 
        53 LEU . 1 1 
        54 VAL . 1 1 
        55 ASN . 1 1 
        56 VAL . 1 1 
        57 THR . 1 1 
        58 GLY . 1 1 
        59 ALA . 1 1 
        60 ARG . 1 1 
        61 PHE . 1 1 
        62 ALA . 1 1 
        63 ARG . 1 1 
        64 GLY . 1 1 
        65 SER . 1 1 
        66 PHE . 1 1 
        67 ARG . 1 1 
        68 GLU . 1 1 
        69 VAL . 1 1 
        70 VAL . 1 1 
        71 PRO . 1 1 
        72 VAL . 1 1 
        73 HIS . 1 1 
        74 ARG . 1 1 
        75 LEU . 1 1 
        76 ALA . 1 1 
        77 TYR . 1 1 
        78 SER . 1 1 
        79 PHE . 1 1 
        80 GLY . 1 1 
        81 TRP . 1 1 
        82 ASP . 1 1 
        83 GLY . 1 1 
        84 SER . 1 1 
        85 GLU . 1 1 
        86 VAL . 1 1 
        87 VAL . 1 1 
        88 PRO . 1 1 
        89 PRO . 1 1 
        90 GLY . 1 1 
        91 SER . 1 1 
        92 SER . 1 1 
        93 LEU . 1 1 
        94 VAL . 1 1 
        95 GLU . 1 1 
        96 ILE . 1 1 
        97 ASP . 1 1 
        98 LEU . 1 1 
        99 ILE . 1 1 
       100 GLU . 1 1 
       101 GLN . 1 1 
       102 GLY . 1 1 
       103 GLY . 1 1 
       104 GLY . 1 1 
       105 THR . 1 1 
       106 LEU . 1 1 
       107 LEU . 1 1 
       108 ARG . 1 1 
       109 LEU . 1 1 
       110 THR . 1 1 
       111 HIS . 1 1 
       112 SER . 1 1 
       113 GLY . 1 1 
       114 LEU . 1 1 
       115 PRO . 1 1 
       116 SER . 1 1 
       117 ALA . 1 1 
       118 GLU . 1 1 
       119 GLN . 1 1 
       120 CYS . 1 1 
       121 ALA . 1 1 
       122 GLY . 1 1 
       123 HIS . 1 1 
       124 GLU . 1 1 
       125 GLU . 1 1 
       126 GLY . 1 1 
       127 TRP . 1 1 
       128 ALA . 1 1 
       129 HIS . 1 1 
       130 TYR . 1 1 
       131 LEU . 1 1 
       132 GLY . 1 1 
       133 ARG . 1 1 
       134 LEU . 1 1 
       135 THR . 1 1 
       136 GLU . 1 1 
       137 VAL . 1 1 
       138 ALA . 1 1 
       139 ALA . 1 1 
       140 GLY . 1 1 
       141 ARG . 1 1 
       142 ASP . 1 1 
       143 PRO . 1 1 
       144 GLY . 1 1 
       145 PRO . 1 1 
       146 ASP . 1 1 
       147 PRO . 1 1 
       148 PHE . 1 1 
       149 TYR . 1 1 
       150 GLY . 1 1 
       151 ARG . 1 1 
       152 ARG . 1 1 
       153 LEU . 1 1 
       154 GLU . 1 1 
       155 HIS . 1 1 
       156 HIS . 1 1 
       157 HIS . 1 1 
       158 HIS . 1 1 
       159 HIS . 1 1 
       160 HIS . 1 1 
    stop_

    loop_
       _Entity_poly_seq.Mon_ID
       _Entity_poly_seq.Num
       _Entity_poly_seq.Comp_index_ID
       _Entity_poly_seq.Entry_ID
       _Entity_poly_seq.Entity_ID

       MET   1   1 1 1 
       GLU   2   2 1 1 
       LYS   3   3 1 1 
       ALA   4   4 1 1 
       MET   5   5 1 1 
       PRO   6   6 1 1 
       GLU   7   7 1 1 
       SER   8   8 1 1 
       PHE   9   9 1 1 
       VAL  10  10 1 1 
       VAL  11  11 1 1 
       ARG  12  12 1 1 
       ARG  13  13 1 1 
       GLU  14  14 1 1 
       ALA  15  15 1 1 
       HIS  16  16 1 1 
       LEU  17  17 1 1 
       ALA  18  18 1 1 
       ALA  19  19 1 1 
       PRO  20  20 1 1 
       PRO  21  21 1 1 
       ALA  22  22 1 1 
       ALA  23  23 1 1 
       VAL  24  24 1 1 
       PHE  25  25 1 1 
       ALA  26  26 1 1 
       LEU  27  27 1 1 
       MET  28  28 1 1 
       THR  29  29 1 1 
       ASP  30  30 1 1 
       PRO  31  31 1 1 
       GLU  32  32 1 1 
       LYS  33  33 1 1 
       ILE  34  34 1 1 
       LEU  35  35 1 1 
       ARG  36  36 1 1 
       TRP  37  37 1 1 
       MET  38  38 1 1 
       GLY  39  39 1 1 
       THR  40  40 1 1 
       GLU  41  41 1 1 
       ALA  42  42 1 1 
       GLU  43  43 1 1 
       VAL  44  44 1 1 
       GLU  45  45 1 1 
       PRO  46  46 1 1 
       GLU  47  47 1 1 
       PRO  48  48 1 1 
       GLY  49  49 1 1 
       GLY  50  50 1 1 
       LEU  51  51 1 1 
       TYR  52  52 1 1 
       LEU  53  53 1 1 
       VAL  54  54 1 1 
       ASN  55  55 1 1 
       VAL  56  56 1 1 
       THR  57  57 1 1 
       GLY  58  58 1 1 
       ALA  59  59 1 1 
       ARG  60  60 1 1 
       PHE  61  61 1 1 
       ALA  62  62 1 1 
       ARG  63  63 1 1 
       GLY  64  64 1 1 
       SER  65  65 1 1 
       PHE  66  66 1 1 
       ARG  67  67 1 1 
       GLU  68  68 1 1 
       VAL  69  69 1 1 
       VAL  70  70 1 1 
       PRO  71  71 1 1 
       VAL  72  72 1 1 
       HIS  73  73 1 1 
       ARG  74  74 1 1 
       LEU  75  75 1 1 
       ALA  76  76 1 1 
       TYR  77  77 1 1 
       SER  78  78 1 1 
       PHE  79  79 1 1 
       GLY  80  80 1 1 
       TRP  81  81 1 1 
       ASP  82  82 1 1 
       GLY  83  83 1 1 
       SER  84  84 1 1 
       GLU  85  85 1 1 
       VAL  86  86 1 1 
       VAL  87  87 1 1 
       PRO  88  88 1 1 
       PRO  89  89 1 1 
       GLY  90  90 1 1 
       SER  91  91 1 1 
       SER  92  92 1 1 
       LEU  93  93 1 1 
       VAL  94  94 1 1 
       GLU  95  95 1 1 
       ILE  96  96 1 1 
       ASP  97  97 1 1 
       LEU  98  98 1 1 
       ILE  99  99 1 1 
       GLU 100 100 1 1 
       GLN 101 101 1 1 
       GLY 102 102 1 1 
       GLY 103 103 1 1 
       GLY 104 104 1 1 
       THR 105 105 1 1 
       LEU 106 106 1 1 
       LEU 107 107 1 1 
       ARG 108 108 1 1 
       LEU 109 109 1 1 
       THR 110 110 1 1 
       HIS 111 111 1 1 
       SER 112 112 1 1 
       GLY 113 113 1 1 
       LEU 114 114 1 1 
       PRO 115 115 1 1 
       SER 116 116 1 1 
       ALA 117 117 1 1 
       GLU 118 118 1 1 
       GLN 119 119 1 1 
       CYS 120 120 1 1 
       ALA 121 121 1 1 
       GLY 122 122 1 1 
       HIS 123 123 1 1 
       GLU 124 124 1 1 
       GLU 125 125 1 1 
       GLY 126 126 1 1 
       TRP 127 127 1 1 
       ALA 128 128 1 1 
       HIS 129 129 1 1 
       TYR 130 130 1 1 
       LEU 131 131 1 1 
       GLY 132 132 1 1 
       ARG 133 133 1 1 
       LEU 134 134 1 1 
       THR 135 135 1 1 
       GLU 136 136 1 1 
       VAL 137 137 1 1 
       ALA 138 138 1 1 
       ALA 139 139 1 1 
       GLY 140 140 1 1 
       ARG 141 141 1 1 
       ASP 142 142 1 1 
       PRO 143 143 1 1 
       GLY 144 144 1 1 
       PRO 145 145 1 1 
       ASP 146 146 1 1 
       PRO 147 147 1 1 
       PHE 148 148 1 1 
       TYR 149 149 1 1 
       GLY 150 150 1 1 
       ARG 151 151 1 1 
       ARG 152 152 1 1 
       LEU 153 153 1 1 
       GLU 154 154 1 1 
       HIS 155 155 1 1 
       HIS 156 156 1 1 
       HIS 157 157 1 1 
       HIS 158 158 1 1 
       HIS 159 159 1 1 
       HIS 160 160 1 1 
    stop_

save_


save_CNS/XPLOR_distance_constraints_2_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  1
    _Distance_constraint_list.Constraint_type     NOE
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

          1 1 . . . 1 1 
          2 1 . . . 1 1 
          3 1 . . . 1 1 
          4 1 . . . 1 1 
          5 1 . . . 1 1 
          6 1 . . . 1 1 
          7 1 . . . 1 1 
          8 1 . . . 1 1 
          9 1 . . . 1 1 
         10 1 . . . 1 1 
         11 1 . . . 1 1 
         12 1 . . . 1 1 
         13 1 . . . 1 1 
         14 1 . . . 1 1 
         15 1 . . . 1 1 
         16 1 . . . 1 1 
         17 1 . . . 1 1 
         18 1 . . . 1 1 
         19 1 . . . 1 1 
         20 1 . . . 1 1 
         21 1 . . . 1 1 
         22 1 . . . 1 1 
         23 1 . . . 1 1 
         24 1 . . . 1 1 
         25 1 . . . 1 1 
         26 1 . . . 1 1 
         27 1 . . . 1 1 
         28 1 . . . 1 1 
         29 1 . . . 1 1 
         30 1 . . . 1 1 
         31 1 . . . 1 1 
         32 1 . . . 1 1 
         33 1 . . . 1 1 
         34 1 . . . 1 1 
         35 1 . . . 1 1 
         36 1 . . . 1 1 
         37 1 . . . 1 1 
         38 1 . . . 1 1 
         39 1 . . . 1 1 
         40 1 . . . 1 1 
         41 1 . . . 1 1 
         42 1 . . . 1 1 
         43 1 . . . 1 1 
         44 1 . . . 1 1 
         45 1 . . . 1 1 
         46 1 . . . 1 1 
         47 1 . . . 1 1 
         48 1 . . . 1 1 
         49 1 . . . 1 1 
         50 1 . . . 1 1 
         51 1 . . . 1 1 
         52 1 . . . 1 1 
         53 1 . . . 1 1 
         54 1 . . . 1 1 
         55 1 . . . 1 1 
         56 1 . . . 1 1 
         57 1 . . . 1 1 
         58 1 . . . 1 1 
         59 1 . . . 1 1 
         60 1 . . . 1 1 
         61 1 . . . 1 1 
         62 1 . . . 1 1 
         63 1 . . . 1 1 
         64 1 . . . 1 1 
         65 1 . . . 1 1 
         66 1 . . . 1 1 
         67 1 . . . 1 1 
         68 1 . . . 1 1 
         69 1 . . . 1 1 
         70 1 . . . 1 1 
         71 1 . . . 1 1 
         72 1 . . . 1 1 
         73 1 . . . 1 1 
         74 1 . . . 1 1 
         75 1 . . . 1 1 
         76 1 . . . 1 1 
         77 1 . . . 1 1 
         78 1 . . . 1 1 
         79 1 . . . 1 1 
         80 1 . . . 1 1 
         81 1 . . . 1 1 
         82 1 . . . 1 1 
         83 1 . . . 1 1 
         84 1 . . . 1 1 
         85 1 . . . 1 1 
         86 1 . . . 1 1 
         87 1 . . . 1 1 
         88 1 . . . 1 1 
         89 1 . . . 1 1 
         90 1 . . . 1 1 
         91 1 . . . 1 1 
         92 1 . . . 1 1 
         93 1 . . . 1 1 
         94 1 . . . 1 1 
         95 1 . . . 1 1 
         96 1 . . . 1 1 
         97 1 . . . 1 1 
         98 1 . . . 1 1 
         99 1 . . . 1 1 
        100 1 . . . 1 1 
        101 1 . . . 1 1 
        102 1 . . . 1 1 
        103 1 . . . 1 1 
        104 1 . . . 1 1 
        105 1 . . . 1 1 
        106 1 . . . 1 1 
        107 1 . . . 1 1 
        108 1 . . . 1 1 
        109 1 . . . 1 1 
        110 1 . . . 1 1 
        111 1 . . . 1 1 
        112 1 . . . 1 1 
        113 1 . . . 1 1 
        114 1 . . . 1 1 
        115 1 . . . 1 1 
        116 1 . . . 1 1 
        117 1 . . . 1 1 
        118 1 . . . 1 1 
        119 1 . . . 1 1 
        120 1 . . . 1 1 
        121 1 . . . 1 1 
        122 1 . . . 1 1 
        123 1 . . . 1 1 
        124 1 . . . 1 1 
        125 1 . . . 1 1 
        126 1 . . . 1 1 
        127 1 . . . 1 1 
        128 1 . . . 1 1 
        129 1 . . . 1 1 
        130 1 . . . 1 1 
        131 1 . . . 1 1 
        132 1 . . . 1 1 
        133 1 . . . 1 1 
        134 1 . . . 1 1 
        135 1 . . . 1 1 
        136 1 . . . 1 1 
        137 1 . . . 1 1 
        138 1 . . . 1 1 
        139 1 . . . 1 1 
        140 1 . . . 1 1 
        141 1 . . . 1 1 
        142 1 . . . 1 1 
        143 1 . . . 1 1 
        144 1 . . . 1 1 
        145 1 . . . 1 1 
        146 1 . . . 1 1 
        147 1 . . . 1 1 
        148 1 . . . 1 1 
        149 1 . . . 1 1 
        150 1 . . . 1 1 
        151 1 . . . 1 1 
        152 1 . . . 1 1 
        153 1 . . . 1 1 
        154 1 . . . 1 1 
        155 1 . . . 1 1 
        156 1 . . . 1 1 
        157 1 . . . 1 1 
        158 1 . . . 1 1 
        159 1 . . . 1 1 
        160 1 . . . 1 1 
        161 1 . . . 1 1 
        162 1 . . . 1 1 
        163 1 . . . 1 1 
        164 1 . . . 1 1 
        165 1 . . . 1 1 
        166 1 . . . 1 1 
        167 1 . . . 1 1 
        168 1 . . . 1 1 
        169 1 . . . 1 1 
        170 1 . . . 1 1 
        171 1 . . . 1 1 
        172 1 . . . 1 1 
        173 1 . . . 1 1 
        174 1 . . . 1 1 
        175 1 . . . 1 1 
        176 1 . . . 1 1 
        177 1 . . . 1 1 
        178 1 . . . 1 1 
        179 1 . . . 1 1 
        180 1 . . . 1 1 
        181 1 . . . 1 1 
        182 1 . . . 1 1 
        183 1 . . . 1 1 
        184 1 . . . 1 1 
        185 1 . . . 1 1 
        186 1 . . . 1 1 
        187 1 . . . 1 1 
        188 1 . . . 1 1 
        189 1 . . . 1 1 
        190 1 . . . 1 1 
        191 1 . . . 1 1 
        192 1 . . . 1 1 
        193 1 . . . 1 1 
        194 1 . . . 1 1 
        195 1 . . . 1 1 
        196 1 . . . 1 1 
        197 1 . . . 1 1 
        198 1 . . . 1 1 
        199 1 . . . 1 1 
        200 1 . . . 1 1 
        201 1 . . . 1 1 
        202 1 . . . 1 1 
        203 1 . . . 1 1 
        204 1 . . . 1 1 
        205 1 . . . 1 1 
        206 1 . . . 1 1 
        207 1 . . . 1 1 
        208 1 . . . 1 1 
        209 1 . . . 1 1 
        210 1 . . . 1 1 
        211 1 . . . 1 1 
        212 1 . . . 1 1 
        213 1 . . . 1 1 
        214 1 . . . 1 1 
        215 1 . . . 1 1 
        216 1 . . . 1 1 
        217 1 . . . 1 1 
        218 1 . . . 1 1 
        219 1 . . . 1 1 
        220 1 . . . 1 1 
        221 1 . . . 1 1 
        222 1 . . . 1 1 
        223 1 . . . 1 1 
        224 1 . . . 1 1 
        225 1 . . . 1 1 
        226 1 . . . 1 1 
        227 1 . . . 1 1 
        228 1 . . . 1 1 
        229 1 . . . 1 1 
        230 1 . . . 1 1 
        231 1 . . . 1 1 
        232 1 . . . 1 1 
        233 1 . . . 1 1 
        234 1 . . . 1 1 
        235 1 . . . 1 1 
        236 1 . . . 1 1 
        237 1 . . . 1 1 
        238 1 . . . 1 1 
        239 1 . . . 1 1 
        240 1 . . . 1 1 
        241 1 . . . 1 1 
        242 1 . . . 1 1 
        243 1 . . . 1 1 
        244 1 . . . 1 1 
        245 1 . . . 1 1 
        246 1 . . . 1 1 
        247 1 . . . 1 1 
        248 1 . . . 1 1 
        249 1 . . . 1 1 
        250 1 . . . 1 1 
        251 1 . . . 1 1 
        252 1 . . . 1 1 
        253 1 . . . 1 1 
        254 1 . . . 1 1 
        255 1 . . . 1 1 
        256 1 . . . 1 1 
        257 1 . . . 1 1 
        258 1 . . . 1 1 
        259 1 . . . 1 1 
        260 1 . . . 1 1 
        261 1 . . . 1 1 
        262 1 . . . 1 1 
        263 1 . . . 1 1 
        264 1 . . . 1 1 
        265 1 . . . 1 1 
        266 1 . . . 1 1 
        267 1 . . . 1 1 
        268 1 . . . 1 1 
        269 1 . . . 1 1 
        270 1 . . . 1 1 
        271 1 . . . 1 1 
        272 1 . . . 1 1 
        273 1 . . . 1 1 
        274 1 . . . 1 1 
        275 1 . . . 1 1 
        276 1 . . . 1 1 
        277 1 . . . 1 1 
        278 1 . . . 1 1 
        279 1 . . . 1 1 
        280 1 . . . 1 1 
        281 1 . . . 1 1 
        282 1 . . . 1 1 
        283 1 . . . 1 1 
        284 1 . . . 1 1 
        285 1 . . . 1 1 
        286 1 . . . 1 1 
        287 1 . . . 1 1 
        288 1 . . . 1 1 
        289 1 . . . 1 1 
        290 1 . . . 1 1 
        291 1 . . . 1 1 
        292 1 . . . 1 1 
        293 1 . . . 1 1 
        294 1 . . . 1 1 
        295 1 . . . 1 1 
        296 1 . . . 1 1 
        297 1 . . . 1 1 
        298 1 . . . 1 1 
        299 1 . . . 1 1 
        300 1 . . . 1 1 
        301 1 . . . 1 1 
        302 1 . . . 1 1 
        303 1 . . . 1 1 
        304 1 . . . 1 1 
        305 1 . . . 1 1 
        306 1 . . . 1 1 
        307 1 . . . 1 1 
        308 1 . . . 1 1 
        309 1 . . . 1 1 
        310 1 . . . 1 1 
        311 1 . . . 1 1 
        312 1 . . . 1 1 
        313 1 . . . 1 1 
        314 1 . . . 1 1 
        315 1 . . . 1 1 
        316 1 . . . 1 1 
        317 1 . . . 1 1 
        318 1 . . . 1 1 
        319 1 . . . 1 1 
        320 1 . . . 1 1 
        321 1 . . . 1 1 
        322 1 . . . 1 1 
        323 1 . . . 1 1 
        324 1 . . . 1 1 
        325 1 . . . 1 1 
        326 1 . . . 1 1 
        327 1 . . . 1 1 
        328 1 . . . 1 1 
        329 1 . . . 1 1 
        330 1 . . . 1 1 
        331 1 . . . 1 1 
        332 1 . . . 1 1 
        333 1 . . . 1 1 
        334 1 . . . 1 1 
        335 1 . . . 1 1 
        336 1 . . . 1 1 
        337 1 . . . 1 1 
        338 1 . . . 1 1 
        339 1 . . . 1 1 
        340 1 . . . 1 1 
        341 1 . . . 1 1 
        342 1 . . . 1 1 
        343 1 . . . 1 1 
        344 1 . . . 1 1 
        345 1 . . . 1 1 
        346 1 . . . 1 1 
        347 1 . . . 1 1 
        348 1 . . . 1 1 
        349 1 . . . 1 1 
        350 1 . . . 1 1 
        351 1 . . . 1 1 
        352 1 . . . 1 1 
        353 1 . . . 1 1 
        354 1 . . . 1 1 
        355 1 . . . 1 1 
        356 1 . . . 1 1 
        357 1 . . . 1 1 
        358 1 . . . 1 1 
        359 1 . . . 1 1 
        360 1 . . . 1 1 
        361 1 . . . 1 1 
        362 1 . . . 1 1 
        363 1 . . . 1 1 
        364 1 . . . 1 1 
        365 1 . . . 1 1 
        366 1 . . . 1 1 
        367 1 . . . 1 1 
        368 1 . . . 1 1 
        369 1 . . . 1 1 
        370 1 . . . 1 1 
        371 1 . . . 1 1 
        372 1 . . . 1 1 
        373 1 . . . 1 1 
        374 1 . . . 1 1 
        375 1 . . . 1 1 
        376 1 . . . 1 1 
        377 1 . . . 1 1 
        378 1 . . . 1 1 
        379 1 . . . 1 1 
        380 1 . . . 1 1 
        381 1 . . . 1 1 
        382 1 . . . 1 1 
        383 1 . . . 1 1 
        384 1 . . . 1 1 
        385 1 . . . 1 1 
        386 1 . . . 1 1 
        387 1 . . . 1 1 
        388 1 . . . 1 1 
        389 1 . . . 1 1 
        390 1 . . . 1 1 
        391 1 . . . 1 1 
        392 1 . . . 1 1 
        393 1 . . . 1 1 
        394 1 . . . 1 1 
        395 1 . . . 1 1 
        396 1 . . . 1 1 
        397 1 . . . 1 1 
        398 1 . . . 1 1 
        399 1 . . . 1 1 
        400 1 . . . 1 1 
        401 1 . . . 1 1 
        402 1 . . . 1 1 
        403 1 . . . 1 1 
        404 1 . . . 1 1 
        405 1 . . . 1 1 
        406 1 . . . 1 1 
        407 1 . . . 1 1 
        408 1 . . . 1 1 
        409 1 . . . 1 1 
        410 1 . . . 1 1 
        411 1 . . . 1 1 
        412 1 . . . 1 1 
        413 1 . . . 1 1 
        414 1 . . . 1 1 
        415 1 . . . 1 1 
        416 1 . . . 1 1 
        417 1 . . . 1 1 
        418 1 . . . 1 1 
        419 1 . . . 1 1 
        420 1 . . . 1 1 
        421 1 . . . 1 1 
        422 1 . . . 1 1 
        423 1 . . . 1 1 
        424 1 . . . 1 1 
        425 1 . . . 1 1 
        426 1 . . . 1 1 
        427 1 . . . 1 1 
        428 1 . . . 1 1 
        429 1 . . . 1 1 
        430 1 . . . 1 1 
        431 1 . . . 1 1 
        432 1 . . . 1 1 
        433 1 . . . 1 1 
        434 1 . . . 1 1 
        435 1 . . . 1 1 
        436 1 . . . 1 1 
        437 1 . . . 1 1 
        438 1 . . . 1 1 
        439 1 . . . 1 1 
        440 1 . . . 1 1 
        441 1 . . . 1 1 
        442 1 . . . 1 1 
        443 1 . . . 1 1 
        444 1 . . . 1 1 
        445 1 . . . 1 1 
        446 1 . . . 1 1 
        447 1 . . . 1 1 
        448 1 . . . 1 1 
        449 1 . . . 1 1 
        450 1 . . . 1 1 
        451 1 . . . 1 1 
        452 1 . . . 1 1 
        453 1 . . . 1 1 
        454 1 . . . 1 1 
        455 1 . . . 1 1 
        456 1 . . . 1 1 
        457 1 . . . 1 1 
        458 1 . . . 1 1 
        459 1 . . . 1 1 
        460 1 . . . 1 1 
        461 1 . . . 1 1 
        462 1 . . . 1 1 
        463 1 . . . 1 1 
        464 1 . . . 1 1 
        465 1 . . . 1 1 
        466 1 . . . 1 1 
        467 1 . . . 1 1 
        468 1 . . . 1 1 
        469 1 . . . 1 1 
        470 1 . . . 1 1 
        471 1 . . . 1 1 
        472 1 . . . 1 1 
        473 1 . . . 1 1 
        474 1 . . . 1 1 
        475 1 . . . 1 1 
        476 1 . . . 1 1 
        477 1 . . . 1 1 
        478 1 . . . 1 1 
        479 1 . . . 1 1 
        480 1 . . . 1 1 
        481 1 . . . 1 1 
        482 1 . . . 1 1 
        483 1 . . . 1 1 
        484 1 . . . 1 1 
        485 1 . . . 1 1 
        486 1 . . . 1 1 
        487 1 . . . 1 1 
        488 1 . . . 1 1 
        489 1 . . . 1 1 
        490 1 . . . 1 1 
        491 1 . . . 1 1 
        492 1 . . . 1 1 
        493 1 . . . 1 1 
        494 1 . . . 1 1 
        495 1 . . . 1 1 
        496 1 . . . 1 1 
        497 1 . . . 1 1 
        498 1 . . . 1 1 
        499 1 . . . 1 1 
        500 1 . . . 1 1 
        501 1 . . . 1 1 
        502 1 . . . 1 1 
        503 1 . . . 1 1 
        504 1 . . . 1 1 
        505 1 . . . 1 1 
        506 1 . . . 1 1 
        507 1 . . . 1 1 
        508 1 . . . 1 1 
        509 1 . . . 1 1 
        510 1 . . . 1 1 
        511 1 . . . 1 1 
        512 1 . . . 1 1 
        513 1 . . . 1 1 
        514 1 . . . 1 1 
        515 1 . . . 1 1 
        516 1 . . . 1 1 
        517 1 . . . 1 1 
        518 1 . . . 1 1 
        519 1 . . . 1 1 
        520 1 . . . 1 1 
        521 1 . . . 1 1 
        522 1 . . . 1 1 
        523 1 . . . 1 1 
        524 1 . . . 1 1 
        525 1 . . . 1 1 
        526 1 . . . 1 1 
        527 1 . . . 1 1 
        528 1 . . . 1 1 
        529 1 . . . 1 1 
        530 1 . . . 1 1 
        531 1 . . . 1 1 
        532 1 . . . 1 1 
        533 1 . . . 1 1 
        534 1 . . . 1 1 
        535 1 . . . 1 1 
        536 1 . . . 1 1 
        537 1 . . . 1 1 
        538 1 . . . 1 1 
        539 1 . . . 1 1 
        540 1 . . . 1 1 
        541 1 . . . 1 1 
        542 1 . . . 1 1 
        543 1 . . . 1 1 
        544 1 . . . 1 1 
        545 1 . . . 1 1 
        546 1 . . . 1 1 
        547 1 . . . 1 1 
        548 1 . . . 1 1 
        549 1 . . . 1 1 
        550 1 . . . 1 1 
        551 1 . . . 1 1 
        552 1 . . . 1 1 
        553 1 . . . 1 1 
        554 1 . . . 1 1 
        555 1 . . . 1 1 
        556 1 . . . 1 1 
        557 1 . . . 1 1 
        558 1 . . . 1 1 
        559 1 . . . 1 1 
        560 1 . . . 1 1 
        561 1 . . . 1 1 
        562 1 . . . 1 1 
        563 1 . . . 1 1 
        564 1 . . . 1 1 
        565 1 . . . 1 1 
        566 1 . . . 1 1 
        567 1 . . . 1 1 
        568 1 . . . 1 1 
        569 1 . . . 1 1 
        570 1 . . . 1 1 
        571 1 . . . 1 1 
        572 1 . . . 1 1 
        573 1 . . . 1 1 
        574 1 . . . 1 1 
        575 1 . . . 1 1 
        576 1 . . . 1 1 
        577 1 . . . 1 1 
        578 1 . . . 1 1 
        579 1 . . . 1 1 
        580 1 . . . 1 1 
        581 1 . . . 1 1 
        582 1 . . . 1 1 
        583 1 . . . 1 1 
        584 1 . . . 1 1 
        585 1 . . . 1 1 
        586 1 . . . 1 1 
        587 1 . . . 1 1 
        588 1 . . . 1 1 
        589 1 . . . 1 1 
        590 1 . . . 1 1 
        591 1 . . . 1 1 
        592 1 . . . 1 1 
        593 1 . . . 1 1 
        594 1 . . . 1 1 
        595 1 . . . 1 1 
        596 1 . . . 1 1 
        597 1 . . . 1 1 
        598 1 . . . 1 1 
        599 1 . . . 1 1 
        600 1 . . . 1 1 
        601 1 . . . 1 1 
        602 1 . . . 1 1 
        603 1 . . . 1 1 
        604 1 . . . 1 1 
        605 1 . . . 1 1 
        606 1 . . . 1 1 
        607 1 . . . 1 1 
        608 1 . . . 1 1 
        609 1 . . . 1 1 
        610 1 . . . 1 1 
        611 1 . . . 1 1 
        612 1 . . . 1 1 
        613 1 . . . 1 1 
        614 1 . . . 1 1 
        615 1 . . . 1 1 
        616 1 . . . 1 1 
        617 1 . . . 1 1 
        618 1 . . . 1 1 
        619 1 . . . 1 1 
        620 1 . . . 1 1 
        621 1 . . . 1 1 
        622 1 . . . 1 1 
        623 1 . . . 1 1 
        624 1 . . . 1 1 
        625 1 . . . 1 1 
        626 1 . . . 1 1 
        627 1 . . . 1 1 
        628 1 . . . 1 1 
        629 1 . . . 1 1 
        630 1 . . . 1 1 
        631 1 . . . 1 1 
        632 1 . . . 1 1 
        633 1 . . . 1 1 
        634 1 . . . 1 1 
        635 1 . . . 1 1 
        636 1 . . . 1 1 
        637 1 . . . 1 1 
        638 1 . . . 1 1 
        639 1 . . . 1 1 
        640 1 . . . 1 1 
        641 1 . . . 1 1 
        642 1 . . . 1 1 
        643 1 . . . 1 1 
        644 1 . . . 1 1 
        645 1 . . . 1 1 
        646 1 . . . 1 1 
        647 1 . . . 1 1 
        648 1 . . . 1 1 
        649 1 . . . 1 1 
        650 1 . . . 1 1 
        651 1 . . . 1 1 
        652 1 . . . 1 1 
        653 1 . . . 1 1 
        654 1 . . . 1 1 
        655 1 . . . 1 1 
        656 1 . . . 1 1 
        657 1 . . . 1 1 
        658 1 . . . 1 1 
        659 1 . . . 1 1 
        660 1 . . . 1 1 
        661 1 . . . 1 1 
        662 1 . . . 1 1 
        663 1 . . . 1 1 
        664 1 . . . 1 1 
        665 1 . . . 1 1 
        666 1 . . . 1 1 
        667 1 . . . 1 1 
        668 1 . . . 1 1 
        669 1 . . . 1 1 
        670 1 . . . 1 1 
        671 1 . . . 1 1 
        672 1 . . . 1 1 
        673 1 . . . 1 1 
        674 1 . . . 1 1 
        675 1 . . . 1 1 
        676 1 . . . 1 1 
        677 1 . . . 1 1 
        678 1 . . . 1 1 
        679 1 . . . 1 1 
        680 1 . . . 1 1 
        681 1 . . . 1 1 
        682 1 . . . 1 1 
        683 1 . . . 1 1 
        684 1 . . . 1 1 
        685 1 . . . 1 1 
        686 1 . . . 1 1 
        687 1 . . . 1 1 
        688 1 . . . 1 1 
        689 1 . . . 1 1 
        690 1 . . . 1 1 
        691 1 . . . 1 1 
        692 1 . . . 1 1 
        693 1 . . . 1 1 
        694 1 . . . 1 1 
        695 1 . . . 1 1 
        696 1 . . . 1 1 
        697 1 . . . 1 1 
        698 1 . . . 1 1 
        699 1 . . . 1 1 
        700 1 . . . 1 1 
        701 1 . . . 1 1 
        702 1 . . . 1 1 
        703 1 . . . 1 1 
        704 1 . . . 1 1 
        705 1 . . . 1 1 
        706 1 . . . 1 1 
        707 1 . . . 1 1 
        708 1 . . . 1 1 
        709 1 . . . 1 1 
        710 1 . . . 1 1 
        711 1 . . . 1 1 
        712 1 . . . 1 1 
        713 1 . . . 1 1 
        714 1 . . . 1 1 
        715 1 . . . 1 1 
        716 1 . . . 1 1 
        717 1 . . . 1 1 
        718 1 . . . 1 1 
        719 1 . . . 1 1 
        720 1 . . . 1 1 
        721 1 . . . 1 1 
        722 1 . . . 1 1 
        723 1 . . . 1 1 
        724 1 . . . 1 1 
        725 1 . . . 1 1 
        726 1 . . . 1 1 
        727 1 . . . 1 1 
        728 1 . . . 1 1 
        729 1 . . . 1 1 
        730 1 . . . 1 1 
        731 1 . . . 1 1 
        732 1 . . . 1 1 
        733 1 . . . 1 1 
        734 1 . . . 1 1 
        735 1 . . . 1 1 
        736 1 . . . 1 1 
        737 1 . . . 1 1 
        738 1 . . . 1 1 
        739 1 . . . 1 1 
        740 1 . . . 1 1 
        741 1 . . . 1 1 
        742 1 . . . 1 1 
        743 1 . . . 1 1 
        744 1 . . . 1 1 
        745 1 . . . 1 1 
        746 1 . . . 1 1 
        747 1 . . . 1 1 
        748 1 . . . 1 1 
        749 1 . . . 1 1 
        750 1 . . . 1 1 
        751 1 . . . 1 1 
        752 1 . . . 1 1 
        753 1 . . . 1 1 
        754 1 . . . 1 1 
        755 1 . . . 1 1 
        756 1 . . . 1 1 
        757 1 . . . 1 1 
        758 1 . . . 1 1 
        759 1 . . . 1 1 
        760 1 . . . 1 1 
        761 1 . . . 1 1 
        762 1 . . . 1 1 
        763 1 . . . 1 1 
        764 1 . . . 1 1 
        765 1 . . . 1 1 
        766 1 . . . 1 1 
        767 1 . . . 1 1 
        768 1 . . . 1 1 
        769 1 . . . 1 1 
        770 1 . . . 1 1 
        771 1 . . . 1 1 
        772 1 . . . 1 1 
        773 1 . . . 1 1 
        774 1 . . . 1 1 
        775 1 . . . 1 1 
        776 1 . . . 1 1 
        777 1 . . . 1 1 
        778 1 . . . 1 1 
        779 1 . . . 1 1 
        780 1 . . . 1 1 
        781 1 . . . 1 1 
        782 1 . . . 1 1 
        783 1 . . . 1 1 
        784 1 . . . 1 1 
        785 1 . . . 1 1 
        786 1 . . . 1 1 
        787 1 . . . 1 1 
        788 1 . . . 1 1 
        789 1 . . . 1 1 
        790 1 . . . 1 1 
        791 1 . . . 1 1 
        792 1 . . . 1 1 
        793 1 . . . 1 1 
        794 1 . . . 1 1 
        795 1 . . . 1 1 
        796 1 . . . 1 1 
        797 1 . . . 1 1 
        798 1 . . . 1 1 
        799 1 . . . 1 1 
        800 1 . . . 1 1 
        801 1 . . . 1 1 
        802 1 . . . 1 1 
        803 1 . . . 1 1 
        804 1 . . . 1 1 
        805 1 . . . 1 1 
        806 1 . . . 1 1 
        807 1 . . . 1 1 
        808 1 . . . 1 1 
        809 1 . . . 1 1 
        810 1 . . . 1 1 
        811 1 . . . 1 1 
        812 1 . . . 1 1 
        813 1 . . . 1 1 
        814 1 . . . 1 1 
        815 1 . . . 1 1 
        816 1 . . . 1 1 
        817 1 . . . 1 1 
        818 1 . . . 1 1 
        819 1 . . . 1 1 
        820 1 . . . 1 1 
        821 1 . . . 1 1 
        822 1 . . . 1 1 
        823 1 . . . 1 1 
        824 1 . . . 1 1 
        825 1 . . . 1 1 
        826 1 . . . 1 1 
        827 1 . . . 1 1 
        828 1 . . . 1 1 
        829 1 . . . 1 1 
        830 1 . . . 1 1 
        831 1 . . . 1 1 
        832 1 . . . 1 1 
        833 1 . . . 1 1 
        834 1 . . . 1 1 
        835 1 . . . 1 1 
        836 1 . . . 1 1 
        837 1 . . . 1 1 
        838 1 . . . 1 1 
        839 1 . . . 1 1 
        840 1 . . . 1 1 
        841 1 . . . 1 1 
        842 1 . . . 1 1 
        843 1 . . . 1 1 
        844 1 . . . 1 1 
        845 1 . . . 1 1 
        846 1 . . . 1 1 
        847 1 . . . 1 1 
        848 1 . . . 1 1 
        849 1 . . . 1 1 
        850 1 . . . 1 1 
        851 1 . . . 1 1 
        852 1 . . . 1 1 
        853 1 . . . 1 1 
        854 1 . . . 1 1 
        855 1 . . . 1 1 
        856 1 . . . 1 1 
        857 1 . . . 1 1 
        858 1 . . . 1 1 
        859 1 . . . 1 1 
        860 1 . . . 1 1 
        861 1 . . . 1 1 
        862 1 . . . 1 1 
        863 1 . . . 1 1 
        864 1 . . . 1 1 
        865 1 . . . 1 1 
        866 1 . . . 1 1 
        867 1 . . . 1 1 
        868 1 . . . 1 1 
        869 1 . . . 1 1 
        870 1 . . . 1 1 
        871 1 . . . 1 1 
        872 1 . . . 1 1 
        873 1 . . . 1 1 
        874 1 . . . 1 1 
        875 1 . . . 1 1 
        876 1 . . . 1 1 
        877 1 . . . 1 1 
        878 1 . . . 1 1 
        879 1 . . . 1 1 
        880 1 . . . 1 1 
        881 1 . . . 1 1 
        882 1 . . . 1 1 
        883 1 . . . 1 1 
        884 1 . . . 1 1 
        885 1 . . . 1 1 
        886 1 . . . 1 1 
        887 1 . . . 1 1 
        888 1 . . . 1 1 
        889 1 . . . 1 1 
        890 1 . . . 1 1 
        891 1 . . . 1 1 
        892 1 . . . 1 1 
        893 1 . . . 1 1 
        894 1 . . . 1 1 
        895 1 . . . 1 1 
        896 1 . . . 1 1 
        897 1 . . . 1 1 
        898 1 . . . 1 1 
        899 1 . . . 1 1 
        900 1 . . . 1 1 
        901 1 . . . 1 1 
        902 1 . . . 1 1 
        903 1 . . . 1 1 
        904 1 . . . 1 1 
        905 1 . . . 1 1 
        906 1 . . . 1 1 
        907 1 . . . 1 1 
        908 1 . . . 1 1 
        909 1 . . . 1 1 
        910 1 . . . 1 1 
        911 1 . . . 1 1 
        912 1 . . . 1 1 
        913 1 . . . 1 1 
        914 1 . . . 1 1 
        915 1 . . . 1 1 
        916 1 . . . 1 1 
        917 1 . . . 1 1 
        918 1 . . . 1 1 
        919 1 . . . 1 1 
        920 1 . . . 1 1 
        921 1 . . . 1 1 
        922 1 . . . 1 1 
        923 1 . . . 1 1 
        924 1 . . . 1 1 
        925 1 . . . 1 1 
        926 1 . . . 1 1 
        927 1 . . . 1 1 
        928 1 . . . 1 1 
        929 1 . . . 1 1 
        930 1 . . . 1 1 
        931 1 . . . 1 1 
        932 1 . . . 1 1 
        933 1 . . . 1 1 
        934 1 . . . 1 1 
        935 1 . . . 1 1 
        936 1 . . . 1 1 
        937 1 . . . 1 1 
        938 1 . . . 1 1 
        939 1 . . . 1 1 
        940 1 . . . 1 1 
        941 1 . . . 1 1 
        942 1 . . . 1 1 
        943 1 . . . 1 1 
        944 1 . . . 1 1 
        945 1 . . . 1 1 
        946 1 . . . 1 1 
        947 1 . . . 1 1 
        948 1 . . . 1 1 
        949 1 . . . 1 1 
        950 1 . . . 1 1 
        951 1 . . . 1 1 
        952 1 . . . 1 1 
        953 1 . . . 1 1 
        954 1 . . . 1 1 
        955 1 . . . 1 1 
        956 1 . . . 1 1 
        957 1 . . . 1 1 
        958 1 . . . 1 1 
        959 1 . . . 1 1 
        960 1 . . . 1 1 
        961 1 . . . 1 1 
        962 1 . . . 1 1 
        963 1 . . . 1 1 
        964 1 . . . 1 1 
        965 1 . . . 1 1 
        966 1 . . . 1 1 
        967 1 . . . 1 1 
        968 1 . . . 1 1 
        969 1 . . . 1 1 
        970 1 . . . 1 1 
        971 1 . . . 1 1 
        972 1 . . . 1 1 
        973 1 . . . 1 1 
        974 1 . . . 1 1 
        975 1 . . . 1 1 
        976 1 . . . 1 1 
        977 1 . . . 1 1 
        978 1 . . . 1 1 
        979 1 . . . 1 1 
        980 1 . . . 1 1 
        981 1 . . . 1 1 
        982 1 . . . 1 1 
        983 1 . . . 1 1 
        984 1 . . . 1 1 
        985 1 . . . 1 1 
        986 1 . . . 1 1 
        987 1 . . . 1 1 
        988 1 . . . 1 1 
        989 1 . . . 1 1 
        990 1 . . . 1 1 
        991 1 . . . 1 1 
        992 1 . . . 1 1 
        993 1 . . . 1 1 
        994 1 . . . 1 1 
        995 1 . . . 1 1 
        996 1 . . . 1 1 
        997 1 . . . 1 1 
        998 1 . . . 1 1 
        999 1 . . . 1 1 
       1000 1 . . . 1 1 
       1001 1 . . . 1 1 
       1002 1 . . . 1 1 
       1003 1 . . . 1 1 
       1004 1 . . . 1 1 
       1005 1 . . . 1 1 
       1006 1 . . . 1 1 
       1007 1 . . . 1 1 
       1008 1 . . . 1 1 
       1009 1 . . . 1 1 
       1010 1 . . . 1 1 
       1011 1 . . . 1 1 
       1012 1 . . . 1 1 
       1013 1 . . . 1 1 
       1014 1 . . . 1 1 
       1015 1 . . . 1 1 
       1016 1 . . . 1 1 
       1017 1 . . . 1 1 
       1018 1 . . . 1 1 
       1019 1 . . . 1 1 
       1020 1 . . . 1 1 
       1021 1 . . . 1 1 
       1022 1 . . . 1 1 
       1023 1 . . . 1 1 
       1024 1 . . . 1 1 
       1025 1 . . . 1 1 
       1026 1 . . . 1 1 
       1027 1 . . . 1 1 
       1028 1 . . . 1 1 
       1029 1 . . . 1 1 
       1030 1 . . . 1 1 
       1031 1 . . . 1 1 
       1032 1 . . . 1 1 
       1033 1 . . . 1 1 
       1034 1 . . . 1 1 
       1035 1 . . . 1 1 
       1036 1 . . . 1 1 
       1037 1 . . . 1 1 
       1038 1 . . . 1 1 
       1039 1 . . . 1 1 
       1040 1 . . . 1 1 
       1041 1 . . . 1 1 
       1042 1 . . . 1 1 
       1043 1 . . . 1 1 
       1044 1 . . . 1 1 
       1045 1 . . . 1 1 
       1046 1 . . . 1 1 
       1047 1 . . . 1 1 
       1048 1 . . . 1 1 
       1049 1 . . . 1 1 
       1050 1 . . . 1 1 
       1051 1 . . . 1 1 
       1052 1 . . . 1 1 
       1053 1 . . . 1 1 
       1054 1 . . . 1 1 
       1055 1 . . . 1 1 
       1056 1 . . . 1 1 
       1057 1 . . . 1 1 
       1058 1 . . . 1 1 
       1059 1 . . . 1 1 
       1060 1 . . . 1 1 
       1061 1 . . . 1 1 
       1062 1 . . . 1 1 
       1063 1 . . . 1 1 
       1064 1 . . . 1 1 
       1065 1 . . . 1 1 
       1066 1 . . . 1 1 
       1067 1 . . . 1 1 
       1068 1 . . . 1 1 
       1069 1 . . . 1 1 
       1070 1 . . . 1 1 
       1071 1 . . . 1 1 
       1072 1 . . . 1 1 
       1073 1 . . . 1 1 
       1074 1 . . . 1 1 
       1075 1 . . . 1 1 
       1076 1 . . . 1 1 
       1077 1 . . . 1 1 
       1078 1 . . . 1 1 
       1079 1 . . . 1 1 
       1080 1 . . . 1 1 
       1081 1 . . . 1 1 
       1082 1 . . . 1 1 
       1083 1 . . . 1 1 
       1084 1 . . . 1 1 
       1085 1 . . . 1 1 
       1086 1 . . . 1 1 
       1087 1 . . . 1 1 
       1088 1 . . . 1 1 
       1089 1 . . . 1 1 
       1090 1 . . . 1 1 
       1091 1 . . . 1 1 
       1092 1 . . . 1 1 
       1093 1 . . . 1 1 
       1094 1 . . . 1 1 
       1095 1 . . . 1 1 
       1096 1 . . . 1 1 
       1097 1 . . . 1 1 
       1098 1 . . . 1 1 
       1099 1 . . . 1 1 
       1100 1 . . . 1 1 
       1101 1 . . . 1 1 
       1102 1 . . . 1 1 
       1103 1 . . . 1 1 
       1104 1 . . . 1 1 
       1105 1 . . . 1 1 
       1106 1 . . . 1 1 
       1107 1 . . . 1 1 
       1108 1 . . . 1 1 
       1109 1 . . . 1 1 
       1110 1 . . . 1 1 
       1111 1 . . . 1 1 
       1112 1 . . . 1 1 
       1113 1 . . . 1 1 
       1114 1 . . . 1 1 
       1115 1 . . . 1 1 
       1116 1 . . . 1 1 
       1117 1 . . . 1 1 
       1118 1 . . . 1 1 
       1119 1 . . . 1 1 
       1120 1 . . . 1 1 
       1121 1 . . . 1 1 
       1122 1 . . . 1 1 
       1123 1 . . . 1 1 
       1124 1 . . . 1 1 
       1125 1 . . . 1 1 
       1126 1 . . . 1 1 
       1127 1 . . . 1 1 
       1128 1 . . . 1 1 
       1129 1 . . . 1 1 
       1130 1 . . . 1 1 
       1131 1 . . . 1 1 
       1132 1 . . . 1 1 
       1133 1 . . . 1 1 
       1134 1 . . . 1 1 
       1135 1 . . . 1 1 
       1136 1 . . . 1 1 
       1137 1 . . . 1 1 
       1138 1 . . . 1 1 
       1139 1 . . . 1 1 
       1140 1 . . . 1 1 
       1141 1 . . . 1 1 
       1142 1 . . . 1 1 
       1143 1 . . . 1 1 
       1144 1 . . . 1 1 
       1145 1 . . . 1 1 
       1146 1 . . . 1 1 
       1147 1 . . . 1 1 
       1148 1 . . . 1 1 
       1149 1 . . . 1 1 
       1150 1 . . . 1 1 
       1151 1 . . . 1 1 
       1152 1 . . . 1 1 
       1153 1 . . . 1 1 
       1154 1 . . . 1 1 
       1155 1 . . . 1 1 
       1156 1 . . . 1 1 
       1157 1 . . . 1 1 
       1158 1 . . . 1 1 
       1159 1 . . . 1 1 
       1160 1 . . . 1 1 
       1161 1 . . . 1 1 
       1162 1 . . . 1 1 
       1163 1 . . . 1 1 
       1164 1 . . . 1 1 
       1165 1 . . . 1 1 
       1166 1 . . . 1 1 
       1167 1 . . . 1 1 
       1168 1 . . . 1 1 
       1169 1 . . . 1 1 
       1170 1 . . . 1 1 
       1171 1 . . . 1 1 
       1172 1 . . . 1 1 
       1173 1 . . . 1 1 
       1174 1 . . . 1 1 
       1175 1 . . . 1 1 
       1176 1 . . . 1 1 
       1177 1 . . . 1 1 
       1178 1 . . . 1 1 
       1179 1 . . . 1 1 
       1180 1 . . . 1 1 
       1181 1 . . . 1 1 
       1182 1 . . . 1 1 
       1183 1 . . . 1 1 
       1184 1 . . . 1 1 
       1185 1 . . . 1 1 
       1186 1 . . . 1 1 
       1187 1 . . . 1 1 
       1188 1 . . . 1 1 
       1189 1 . . . 1 1 
       1190 1 . . . 1 1 
       1191 1 . . . 1 1 
       1192 1 . . . 1 1 
       1193 1 . . . 1 1 
       1194 1 . . . 1 1 
       1195 1 . . . 1 1 
       1196 1 . . . 1 1 
       1197 1 . . . 1 1 
       1198 1 . . . 1 1 
       1199 1 . . . 1 1 
       1200 1 . . . 1 1 
       1201 1 . . . 1 1 
       1202 1 . . . 1 1 
       1203 1 . . . 1 1 
       1204 1 . . . 1 1 
       1205 1 . . . 1 1 
       1206 1 . . . 1 1 
       1207 1 . . . 1 1 
       1208 1 . . . 1 1 
       1209 1 . . . 1 1 
       1210 1 . . . 1 1 
       1211 1 . . . 1 1 
       1212 1 . . . 1 1 
       1213 1 . . . 1 1 
       1214 1 . . . 1 1 
       1215 1 . . . 1 1 
       1216 1 . . . 1 1 
       1217 1 . . . 1 1 
       1218 1 . . . 1 1 
       1219 1 . . . 1 1 
       1220 1 . . . 1 1 
       1221 1 . . . 1 1 
       1222 1 . . . 1 1 
       1223 1 . . . 1 1 
       1224 1 . . . 1 1 
       1225 1 . . . 1 1 
       1226 1 . . . 1 1 
       1227 1 . . . 1 1 
       1228 1 . . . 1 1 
       1229 1 . . . 1 1 
       1230 1 . . . 1 1 
       1231 1 . . . 1 1 
       1232 1 . . . 1 1 
       1233 1 . . . 1 1 
       1234 1 . . . 1 1 
       1235 1 . . . 1 1 
       1236 1 . . . 1 1 
       1237 1 . . . 1 1 
       1238 1 . . . 1 1 
       1239 1 . . . 1 1 
       1240 1 . . . 1 1 
       1241 1 . . . 1 1 
       1242 1 . . . 1 1 
       1243 1 . . . 1 1 
       1244 1 . . . 1 1 
       1245 1 . . . 1 1 
       1246 1 . . . 1 1 
       1247 1 . . . 1 1 
       1248 1 . . . 1 1 
       1249 1 . . . 1 1 
       1250 1 . . . 1 1 
       1251 1 . . . 1 1 
       1252 1 . . . 1 1 
       1253 1 . . . 1 1 
       1254 1 . . . 1 1 
       1255 1 . . . 1 1 
       1256 1 . . . 1 1 
       1257 1 . . . 1 1 
       1258 1 . . . 1 1 
       1259 1 . . . 1 1 
       1260 1 . . . 1 1 
       1261 1 . . . 1 1 
       1262 1 . . . 1 1 
       1263 1 . . . 1 1 
       1264 1 . . . 1 1 
       1265 1 . . . 1 1 
       1266 1 . . . 1 1 
       1267 1 . . . 1 1 
       1268 1 . . . 1 1 
       1269 1 . . . 1 1 
       1270 1 . . . 1 1 
       1271 1 . . . 1 1 
       1272 1 . . . 1 1 
       1273 1 . . . 1 1 
       1274 1 . . . 1 1 
       1275 1 . . . 1 1 
       1276 1 . . . 1 1 
       1277 1 . . . 1 1 
       1278 1 . . . 1 1 
       1279 1 . . . 1 1 
       1280 1 . . . 1 1 
       1281 1 . . . 1 1 
       1282 1 . . . 1 1 
       1283 1 . . . 1 1 
       1284 1 . . . 1 1 
       1285 1 . . . 1 1 
       1286 1 . . . 1 1 
       1287 1 . . . 1 1 
       1288 1 . . . 1 1 
       1289 1 . . . 1 1 
       1290 1 . . . 1 1 
       1291 1 . . . 1 1 
       1292 1 . . . 1 1 
       1293 1 . . . 1 1 
       1294 1 . . . 1 1 
       1295 1 . . . 1 1 
       1296 1 . . . 1 1 
       1297 1 . . . 1 1 
       1298 1 . . . 1 1 
       1299 1 . . . 1 1 
       1300 1 . . . 1 1 
       1301 1 . . . 1 1 
       1302 1 . . . 1 1 
       1303 1 . . . 1 1 
       1304 1 . . . 1 1 
       1305 1 . . . 1 1 
       1306 1 . . . 1 1 
       1307 1 . . . 1 1 
       1308 1 . . . 1 1 
       1309 1 . . . 1 1 
       1310 1 . . . 1 1 
       1311 1 . . . 1 1 
       1312 1 . . . 1 1 
       1313 1 . . . 1 1 
       1314 1 . . . 1 1 
       1315 1 . . . 1 1 
       1316 1 . . . 1 1 
       1317 1 . . . 1 1 
       1318 1 . . . 1 1 
       1319 1 . . . 1 1 
       1320 1 . . . 1 1 
       1321 1 . . . 1 1 
       1322 1 . . . 1 1 
       1323 1 . . . 1 1 
       1324 1 . . . 1 1 
       1325 1 . . . 1 1 
       1326 1 . . . 1 1 
       1327 1 . . . 1 1 
       1328 1 . . . 1 1 
       1329 1 . . . 1 1 
       1330 1 . . . 1 1 
       1331 1 . . . 1 1 
       1332 1 . . . 1 1 
       1333 1 . . . 1 1 
       1334 1 . . . 1 1 
       1335 1 . . . 1 1 
       1336 1 . . . 1 1 
       1337 1 . . . 1 1 
       1338 1 . . . 1 1 
       1339 1 . . . 1 1 
       1340 1 . . . 1 1 
       1341 1 . . . 1 1 
       1342 1 . . . 1 1 
       1343 1 . . . 1 1 
       1344 1 . . . 1 1 
       1345 1 . . . 1 1 
       1346 1 . . . 1 1 
       1347 1 . . . 1 1 
       1348 1 . . . 1 1 
       1349 1 . . . 1 1 
       1350 1 . . . 1 1 
       1351 1 . . . 1 1 
       1352 1 . . . 1 1 
       1353 1 . . . 1 1 
       1354 1 . . . 1 1 
       1355 1 . . . 1 1 
       1356 1 . . . 1 1 
       1357 1 . . . 1 1 
       1358 1 . . . 1 1 
       1359 1 . . . 1 1 
       1360 1 . . . 1 1 
       1361 1 . . . 1 1 
       1362 1 . . . 1 1 
       1363 1 . . . 1 1 
       1364 1 . . . 1 1 
       1365 1 . . . 1 1 
       1366 1 . . . 1 1 
       1367 1 . . . 1 1 
       1368 1 . . . 1 1 
       1369 1 . . . 1 1 
       1370 1 . . . 1 1 
       1371 1 . . . 1 1 
       1372 1 . . . 1 1 
       1373 1 . . . 1 1 
       1374 1 . . . 1 1 
       1375 1 . . . 1 1 
       1376 1 . . . 1 1 
       1377 1 . . . 1 1 
       1378 1 . . . 1 1 
       1379 1 . . . 1 1 
       1380 1 . . . 1 1 
       1381 1 . . . 1 1 
       1382 1 . . . 1 1 
       1383 1 . . . 1 1 
       1384 1 . . . 1 1 
       1385 1 . . . 1 1 
       1386 1 . . . 1 1 
       1387 1 . . . 1 1 
       1388 1 . . . 1 1 
       1389 1 . . . 1 1 
       1390 1 . . . 1 1 
       1391 1 . . . 1 1 
       1392 1 . . . 1 1 
       1393 1 . . . 1 1 
       1394 1 . . . 1 1 
       1395 1 . . . 1 1 
       1396 1 . . . 1 1 
       1397 1 . . . 1 1 
       1398 1 . . . 1 1 
       1399 1 . . . 1 1 
       1400 1 . . . 1 1 
       1401 1 . . . 1 1 
       1402 1 . . . 1 1 
       1403 1 . . . 1 1 
       1404 1 . . . 1 1 
       1405 1 . . . 1 1 
       1406 1 . . . 1 1 
       1407 1 . . . 1 1 
       1408 1 . . . 1 1 
       1409 1 . . . 1 1 
       1410 1 . . . 1 1 
       1411 1 . . . 1 1 
       1412 1 . . . 1 1 
       1413 1 . . . 1 1 
       1414 1 . . . 1 1 
       1415 1 . . . 1 1 
       1416 1 . . . 1 1 
       1417 1 . . . 1 1 
       1418 1 . . . 1 1 
       1419 1 . . . 1 1 
       1420 1 . . . 1 1 
       1421 1 . . . 1 1 
       1422 1 . . . 1 1 
       1423 1 . . . 1 1 
       1424 1 . . . 1 1 
       1425 1 . . . 1 1 
       1426 1 . . . 1 1 
       1427 1 . . . 1 1 
       1428 1 . . . 1 1 
       1429 1 . . . 1 1 
       1430 1 . . . 1 1 
       1431 1 . . . 1 1 
       1432 1 . . . 1 1 
       1433 1 . . . 1 1 
       1434 1 . . . 1 1 
       1435 1 . . . 1 1 
       1436 1 . . . 1 1 
       1437 1 . . . 1 1 
       1438 1 . . . 1 1 
       1439 1 . . . 1 1 
       1440 1 . . . 1 1 
       1441 1 . . . 1 1 
       1442 1 . . . 1 1 
       1443 1 . . . 1 1 
       1444 1 . . . 1 1 
       1445 1 . . . 1 1 
       1446 1 . . . 1 1 
       1447 1 . . . 1 1 
       1448 1 . . . 1 1 
       1449 1 . . . 1 1 
       1450 1 . . . 1 1 
       1451 1 . . . 1 1 
       1452 1 . . . 1 1 
       1453 1 . . . 1 1 
       1454 1 . . . 1 1 
       1455 1 . . . 1 1 
       1456 1 . . . 1 1 
       1457 1 . . . 1 1 
       1458 1 . . . 1 1 
       1459 1 . . . 1 1 
       1460 1 . . . 1 1 
       1461 1 . . . 1 1 
       1462 1 . . . 1 1 
       1463 1 . . . 1 1 
       1464 1 . . . 1 1 
       1465 1 . . . 1 1 
       1466 1 . . . 1 1 
       1467 1 . . . 1 1 
       1468 1 . . . 1 1 
       1469 1 . . . 1 1 
       1470 1 . . . 1 1 
       1471 1 . . . 1 1 
       1472 1 . . . 1 1 
       1473 1 . . . 1 1 
       1474 1 . . . 1 1 
       1475 1 . . . 1 1 
       1476 1 . . . 1 1 
       1477 1 . . . 1 1 
       1478 1 . . . 1 1 
       1479 1 . . . 1 1 
       1480 1 . . . 1 1 
       1481 1 . . . 1 1 
       1482 1 . . . 1 1 
       1483 1 . . . 1 1 
       1484 1 . . . 1 1 
       1485 1 . . . 1 1 
       1486 1 . . . 1 1 
       1487 1 . . . 1 1 
       1488 1 . . . 1 1 
       1489 1 . . . 1 1 
       1490 1 . . . 1 1 
       1491 1 . . . 1 1 
       1492 1 . . . 1 1 
       1493 1 . . . 1 1 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

          1 1 1 1 1   2 GLU HA   .   2 . HA   1 1 
          1 1 2 1 1   3 LYS H    .   3 . HN   1 1 
          2 1 1 1 1   2 GLU QB   .   2 . HB*  1 1 
          2 1 2 1 1   3 LYS H    .   3 . HN   1 1 
          3 1 1 1 1   3 LYS HA   .   3 . HA   1 1 
          3 1 2 1 1   4 ALA H    .   4 . HN   1 1 
          4 1 1 1 1   3 LYS QB   .   3 . HB*  1 1 
          4 1 2 1 1   3 LYS QD   .   3 . HD*  1 1 
          5 1 1 1 1   3 LYS QB   .   3 . HB*  1 1 
          5 1 2 1 1   4 ALA H    .   4 . HN   1 1 
          6 1 1 1 1   3 LYS QG   .   3 . HG*  1 1 
          6 1 2 1 1   4 ALA H    .   4 . HN   1 1 
          7 1 1 1 1   3 LYS H    .   3 . HN   1 1 
          7 1 2 1 1   3 LYS QB   .   3 . HB*  1 1 
          8 1 1 1 1   3 LYS H    .   3 . HN   1 1 
          8 1 2 1 1   3 LYS QD   .   3 . HD*  1 1 
          9 1 1 1 1   3 LYS H    .   3 . HN   1 1 
          9 1 2 1 1   3 LYS QG   .   3 . HG*  1 1 
         10 1 1 1 1   4 ALA HA   .   4 . HA   1 1 
         10 1 2 1 1   5 MET H    .   5 . HN   1 1 
         11 1 1 1 1   4 ALA MB   .   4 . HB*  1 1 
         11 1 2 1 1   5 MET H    .   5 . HN   1 1 
         12 1 1 1 1   4 ALA H    .   4 . HN   1 1 
         12 1 2 1 1   4 ALA MB   .   4 . HB*  1 1 
         13 1 1 1 1   5 MET HA   .   5 . HA   1 1 
         13 1 2 1 1   6 PRO HD3  .   6 . HD1  1 1 
         14 1 1 1 1   5 MET HA   .   5 . HA   1 1 
         14 1 2 1 1   6 PRO HD2  .   6 . HD2  1 1 
         15 1 1 1 1   5 MET H    .   5 . HN   1 1 
         15 1 2 1 1   5 MET QB   .   5 . HB*  1 1 
         16 1 1 1 1   5 MET H    .   5 . HN   1 1 
         16 1 2 1 1   5 MET QG   .   5 . HG*  1 1 
         17 1 1 1 1   5 MET H    .   5 . HN   1 1 
         17 1 2 1 1   6 PRO QD   .   6 . HD*  1 1 
         18 1 1 1 1   6 PRO HA   .   6 . HA   1 1 
         18 1 2 1 1   7 GLU H    .   7 . HN   1 1 
         19 1 1 1 1   6 PRO HB3  .   6 . HB1  1 1 
         19 1 2 1 1   7 GLU H    .   7 . HN   1 1 
         20 1 1 1 1   6 PRO HB2  .   6 . HB2  1 1 
         20 1 2 1 1   7 GLU H    .   7 . HN   1 1 
         21 1 1 1 1   7 GLU HA   .   7 . HA   1 1 
         21 1 2 1 1   8 SER H    .   8 . HN   1 1 
         22 1 1 1 1   7 GLU QB   .   7 . HB*  1 1 
         22 1 2 1 1   8 SER H    .   8 . HN   1 1 
         23 1 1 1 1   7 GLU HG3  .   7 . HG1  1 1 
         23 1 2 1 1   8 SER H    .   8 . HN   1 1 
         24 1 1 1 1   7 GLU HG2  .   7 . HG2  1 1 
         24 1 2 1 1   8 SER H    .   8 . HN   1 1 
         25 1 1 1 1   7 GLU H    .   7 . HN   1 1 
         25 1 2 1 1   7 GLU HG3  .   7 . HG1  1 1 
         26 1 1 1 1   7 GLU H    .   7 . HN   1 1 
         26 1 2 1 1   7 GLU HG2  .   7 . HG2  1 1 
         27 1 1 1 1   7 GLU H    .   7 . HN   1 1 
         27 1 2 1 1   8 SER H    .   8 . HN   1 1 
         28 1 1 1 1   8 SER HA   .   8 . HA   1 1 
         28 1 2 1 1   9 PHE H    .   9 . HN   1 1 
         29 1 1 1 1   8 SER QB   .   8 . HB*  1 1 
         29 1 2 1 1   9 PHE H    .   9 . HN   1 1 
         30 1 1 1 1   8 SER H    .   8 . HN   1 1 
         30 1 2 1 1   8 SER QB   .   8 . HB*  1 1 
         31 1 1 1 1   8 SER H    .   8 . HN   1 1 
         31 1 2 1 1   9 PHE H    .   9 . HN   1 1 
         32 1 1 1 1   9 PHE HA   .   9 . HA   1 1 
         32 1 2 1 1   9 PHE QD   .   9 . HD*  1 1 
         33 1 1 1 1   9 PHE HA   .   9 . HA   1 1 
         33 1 2 1 1  10 VAL H    .  10 . HN   1 1 
         34 1 1 1 1   9 PHE QB   .   9 . HB*  1 1 
         34 1 2 1 1  10 VAL H    .  10 . HN   1 1 
         35 1 1 1 1   9 PHE QB   .   9 . HB*  1 1 
         35 1 2 1 1 114 LEU QB   . 114 . HB*  1 1 
         36 1 1 1 1   9 PHE HB3  .   9 . HB1  1 1 
         36 1 2 1 1 114 LEU QB   . 114 . HB*  1 1 
         37 1 1 1 1   9 PHE HB2  .   9 . HB2  1 1 
         37 1 2 1 1 114 LEU QB   . 114 . HB*  1 1 
         38 1 1 1 1   9 PHE QD   .   9 . HD*  1 1 
         38 1 2 1 1  10 VAL H    .  10 . HN   1 1 
         39 1 1 1 1   9 PHE H    .   9 . HN   1 1 
         39 1 2 1 1   9 PHE QB   .   9 . HB*  1 1 
         40 1 1 1 1   9 PHE H    .   9 . HN   1 1 
         40 1 2 1 1   9 PHE QD   .   9 . HD*  1 1 
         41 1 1 1 1   9 PHE H    .   9 . HN   1 1 
         41 1 2 1 1  10 VAL H    .  10 . HN   1 1 
         42 1 1 1 1  10 VAL HA   .  10 . HA   1 1 
         42 1 2 1 1  10 VAL MG1  .  10 . HG1* 1 1 
         43 1 1 1 1  10 VAL HA   .  10 . HA   1 1 
         43 1 2 1 1  10 VAL MG2  .  10 . HG2* 1 1 
         44 1 1 1 1  10 VAL HA   .  10 . HA   1 1 
         44 1 2 1 1  11 VAL H    .  11 . HN   1 1 
         45 1 1 1 1  10 VAL HA   .  10 . HA   1 1 
         45 1 2 1 1 112 SER HA   . 112 . HA   1 1 
         46 1 1 1 1  10 VAL HA   .  10 . HA   1 1 
         46 1 2 1 1 112 SER QB   . 112 . HB*  1 1 
         47 1 1 1 1  10 VAL HA   .  10 . HA   1 1 
         47 1 2 1 1 112 SER H    . 112 . HN   1 1 
         48 1 1 1 1  10 VAL HA   .  10 . HA   1 1 
         48 1 2 1 1 113 GLY H    . 113 . HN   1 1 
         49 1 1 1 1  10 VAL HB   .  10 . HB   1 1 
         49 1 2 1 1  11 VAL H    .  11 . HN   1 1 
         50 1 1 1 1  10 VAL HB   .  10 . HB   1 1 
         50 1 2 1 1 110 THR MG   . 110 . HG2* 1 1 
         51 1 1 1 1  10 VAL HB   .  10 . HB   1 1 
         51 1 2 1 1 112 SER HA   . 112 . HA   1 1 
         52 1 1 1 1  10 VAL MG1  .  10 . HG1* 1 1 
         52 1 2 1 1  11 VAL H    .  11 . HN   1 1 
         53 1 1 1 1  10 VAL MG1  .  10 . HG1* 1 1 
         53 1 2 1 1  12 ARG QD   .  12 . HD*  1 1 
         54 1 1 1 1  10 VAL MG1  .  10 . HG1* 1 1 
         54 1 2 1 1  12 ARG QG   .  12 . HG*  1 1 
         55 1 1 1 1  10 VAL MG1  .  10 . HG1* 1 1 
         55 1 2 1 1 110 THR HA   . 110 . HA   1 1 
         56 1 1 1 1  10 VAL MG1  .  10 . HG1* 1 1 
         56 1 2 1 1 110 THR HB   . 110 . HB   1 1 
         57 1 1 1 1  10 VAL MG1  .  10 . HG1* 1 1 
         57 1 2 1 1 110 THR MG   . 110 . HG2* 1 1 
         58 1 1 1 1  10 VAL MG1  .  10 . HG1* 1 1 
         58 1 2 1 1 111 HIS H    . 111 . HN   1 1 
         59 1 1 1 1  10 VAL MG1  .  10 . HG1* 1 1 
         59 1 2 1 1 112 SER HA   . 112 . HA   1 1 
         60 1 1 1 1  10 VAL MG1  .  10 . HG1* 1 1 
         60 1 2 1 1 112 SER QB   . 112 . HB*  1 1 
         61 1 1 1 1  10 VAL MG2  .  10 . HG2* 1 1 
         61 1 2 1 1  11 VAL H    .  11 . HN   1 1 
         62 1 1 1 1  10 VAL MG2  .  10 . HG2* 1 1 
         62 1 2 1 1 112 SER HA   . 112 . HA   1 1 
         63 1 1 1 1  10 VAL MG2  .  10 . HG2* 1 1 
         63 1 2 1 1 112 SER QB   . 112 . HB*  1 1 
         64 1 1 1 1  10 VAL MG2  .  10 . HG2* 1 1 
         64 1 2 1 1 112 SER H    . 112 . HN   1 1 
         65 1 1 1 1  10 VAL MG2  .  10 . HG2* 1 1 
         65 1 2 1 1 113 GLY H    . 113 . HN   1 1 
         66 1 1 1 1  10 VAL H    .  10 . HN   1 1 
         66 1 2 1 1  10 VAL HB   .  10 . HB   1 1 
         67 1 1 1 1  10 VAL H    .  10 . HN   1 1 
         67 1 2 1 1  10 VAL MG1  .  10 . HG1* 1 1 
         68 1 1 1 1  10 VAL H    .  10 . HN   1 1 
         68 1 2 1 1  10 VAL MG2  .  10 . HG2* 1 1 
         69 1 1 1 1  11 VAL HA   .  11 . HA   1 1 
         69 1 2 1 1  11 VAL MG1  .  11 . HG1* 1 1 
         70 1 1 1 1  11 VAL HA   .  11 . HA   1 1 
         70 1 2 1 1  11 VAL MG2  .  11 . HG2* 1 1 
         71 1 1 1 1  11 VAL HA   .  11 . HA   1 1 
         71 1 2 1 1  12 ARG H    .  12 . HN   1 1 
         72 1 1 1 1  11 VAL HB   .  11 . HB   1 1 
         72 1 2 1 1 111 HIS QB   . 111 . HB*  1 1 
         73 1 1 1 1  11 VAL HB   .  11 . HB   1 1 
         73 1 2 1 1 111 HIS H    . 111 . HN   1 1 
         74 1 1 1 1  11 VAL HB   .  11 . HB   1 1 
         74 1 2 1 1 114 LEU MD1  . 114 . HD1* 1 1 
         75 1 1 1 1  11 VAL MG1  .  11 . HG1* 1 1 
         75 1 2 1 1  12 ARG H    .  12 . HN   1 1 
         76 1 1 1 1  11 VAL MG1  .  11 . HG1* 1 1 
         76 1 2 1 1  13 ARG QD   .  13 . HD*  1 1 
         77 1 1 1 1  11 VAL MG1  .  11 . HG1* 1 1 
         77 1 2 1 1  13 ARG QG   .  13 . HG*  1 1 
         78 1 1 1 1  11 VAL MG1  .  11 . HG1* 1 1 
         78 1 2 1 1 109 LEU MD2  . 109 . HD2* 1 1 
         79 1 1 1 1  11 VAL MG1  .  11 . HG1* 1 1 
         79 1 2 1 1 111 HIS QB   . 111 . HB*  1 1 
         80 1 1 1 1  11 VAL MG1  .  11 . HG1* 1 1 
         80 1 2 1 1 111 HIS H    . 111 . HN   1 1 
         81 1 1 1 1  11 VAL MG1  .  11 . HG1* 1 1 
         81 1 2 1 1 120 CYS HA   . 120 . HA   1 1 
         82 1 1 1 1  11 VAL MG1  .  11 . HG1* 1 1 
         82 1 2 1 1 124 GLU HA   . 124 . HA   1 1 
         83 1 1 1 1  11 VAL MG1  .  11 . HG1* 1 1 
         83 1 2 1 1 124 GLU QB   . 124 . HB*  1 1 
         84 1 1 1 1  11 VAL MG1  .  11 . HG1* 1 1 
         84 1 2 1 1 124 GLU QG   . 124 . HG*  1 1 
         85 1 1 1 1  11 VAL MG1  .  11 . HG1* 1 1 
         85 1 2 1 1 124 GLU H    . 124 . HN   1 1 
         86 1 1 1 1  11 VAL MG1  .  11 . HG1* 1 1 
         86 1 2 1 1 127 TRP HE1  . 127 . HE1  1 1 
         87 1 1 1 1  11 VAL MG2  .  11 . HG2* 1 1 
         87 1 2 1 1  12 ARG H    .  12 . HN   1 1 
         88 1 1 1 1  11 VAL MG2  .  11 . HG2* 1 1 
         88 1 2 1 1 111 HIS HB3  . 111 . HB1  1 1 
         89 1 1 1 1  11 VAL MG2  .  11 . HG2* 1 1 
         89 1 2 1 1 111 HIS HB2  . 111 . HB2  1 1 
         90 1 1 1 1  11 VAL MG2  .  11 . HG2* 1 1 
         90 1 2 1 1 111 HIS H    . 111 . HN   1 1 
         91 1 1 1 1  11 VAL MG2  .  11 . HG2* 1 1 
         91 1 2 1 1 114 LEU MD1  . 114 . HD1* 1 1 
         92 1 1 1 1  11 VAL MG2  .  11 . HG2* 1 1 
         92 1 2 1 1 114 LEU MD2  . 114 . HD2* 1 1 
         93 1 1 1 1  11 VAL MG2  .  11 . HG2* 1 1 
         93 1 2 1 1 120 CYS HA   . 120 . HA   1 1 
         94 1 1 1 1  11 VAL MG2  .  11 . HG2* 1 1 
         94 1 2 1 1 120 CYS QB   . 120 . HB*  1 1 
         95 1 1 1 1  11 VAL MG2  .  11 . HG2* 1 1 
         95 1 2 1 1 123 HIS QB   . 123 . HB*  1 1 
         96 1 1 1 1  11 VAL MG2  .  11 . HG2* 1 1 
         96 1 2 1 1 123 HIS HD1  . 123 . HD*  1 1 
         96 1 2 1 1 123 HIS HD2  . 123 . HD*  1 1 
         97 1 1 1 1  11 VAL MG2  .  11 . HG2* 1 1 
         97 1 2 1 1 124 GLU QB   . 124 . HB*  1 1 
         98 1 1 1 1  11 VAL MG2  .  11 . HG2* 1 1 
         98 1 2 1 1 124 GLU QG   . 124 . HG*  1 1 
         99 1 1 1 1  11 VAL MG2  .  11 . HG2* 1 1 
         99 1 2 1 1 124 GLU H    . 124 . HN   1 1 
        100 1 1 1 1  11 VAL MG2  .  11 . HG2* 1 1 
        100 1 2 1 1 127 TRP HD1  . 127 . HD1  1 1 
        101 1 1 1 1  11 VAL H    .  11 . HN   1 1 
        101 1 2 1 1  11 VAL HB   .  11 . HB   1 1 
        102 1 1 1 1  11 VAL H    .  11 . HN   1 1 
        102 1 2 1 1  11 VAL MG1  .  11 . HG1* 1 1 
        103 1 1 1 1  11 VAL H    .  11 . HN   1 1 
        103 1 2 1 1  11 VAL MG2  .  11 . HG2* 1 1 
        104 1 1 1 1  11 VAL H    .  11 . HN   1 1 
        104 1 2 1 1 111 HIS QB   . 111 . HB*  1 1 
        105 1 1 1 1  11 VAL H    .  11 . HN   1 1 
        105 1 2 1 1 111 HIS H    . 111 . HN   1 1 
        106 1 1 1 1  11 VAL H    .  11 . HN   1 1 
        106 1 2 1 1 112 SER HA   . 112 . HA   1 1 
        107 1 1 1 1  11 VAL H    .  11 . HN   1 1 
        107 1 2 1 1 114 LEU MD1  . 114 . HD1* 1 1 
        108 1 1 1 1  12 ARG HA   .  12 . HA   1 1 
        108 1 2 1 1  12 ARG QD   .  12 . HD*  1 1 
        109 1 1 1 1  12 ARG HA   .  12 . HA   1 1 
        109 1 2 1 1  13 ARG H    .  13 . HN   1 1 
        110 1 1 1 1  12 ARG HA   .  12 . HA   1 1 
        110 1 2 1 1 110 THR HA   . 110 . HA   1 1 
        111 1 1 1 1  12 ARG HA   .  12 . HA   1 1 
        111 1 2 1 1 110 THR MG   . 110 . HG2* 1 1 
        112 1 1 1 1  12 ARG HA   .  12 . HA   1 1 
        112 1 2 1 1 111 HIS H    . 111 . HN   1 1 
        113 1 1 1 1  12 ARG QB   .  12 . HB*  1 1 
        113 1 2 1 1  12 ARG QD   .  12 . HD*  1 1 
        114 1 1 1 1  12 ARG QB   .  12 . HB*  1 1 
        114 1 2 1 1  13 ARG H    .  13 . HN   1 1 
        115 1 1 1 1  12 ARG QB   .  12 . HB*  1 1 
        115 1 2 1 1 110 THR HA   . 110 . HA   1 1 
        116 1 1 1 1  12 ARG QD   .  12 . HD*  1 1 
        116 1 2 1 1 110 THR MG   . 110 . HG2* 1 1 
        117 1 1 1 1  12 ARG QG   .  12 . HG*  1 1 
        117 1 2 1 1 110 THR HA   . 110 . HA   1 1 
        118 1 1 1 1  12 ARG QG   .  12 . HG*  1 1 
        118 1 2 1 1 110 THR MG   . 110 . HG2* 1 1 
        119 1 1 1 1  12 ARG H    .  12 . HN   1 1 
        119 1 2 1 1  12 ARG QB   .  12 . HB*  1 1 
        120 1 1 1 1  12 ARG H    .  12 . HN   1 1 
        120 1 2 1 1  12 ARG QD   .  12 . HD*  1 1 
        121 1 1 1 1  12 ARG H    .  12 . HN   1 1 
        121 1 2 1 1  12 ARG QG   .  12 . HG*  1 1 
        122 1 1 1 1  13 ARG HA   .  13 . HA   1 1 
        122 1 2 1 1  13 ARG QD   .  13 . HD*  1 1 
        123 1 1 1 1  13 ARG HA   .  13 . HA   1 1 
        123 1 2 1 1  13 ARG QG   .  13 . HG*  1 1 
        124 1 1 1 1  13 ARG HA   .  13 . HA   1 1 
        124 1 2 1 1  14 GLU H    .  14 . HN   1 1 
        125 1 1 1 1  13 ARG HA   .  13 . HA   1 1 
        125 1 2 1 1 131 LEU MD1  . 131 . HD1* 1 1 
        126 1 1 1 1  13 ARG QB   .  13 . HB*  1 1 
        126 1 2 1 1  13 ARG HE   .  13 . HE   1 1 
        127 1 1 1 1  13 ARG QB   .  13 . HB*  1 1 
        127 1 2 1 1 109 LEU MD1  . 109 . HD1* 1 1 
        128 1 1 1 1  13 ARG HB3  .  13 . HB1  1 1 
        128 1 2 1 1  14 GLU H    .  14 . HN   1 1 
        129 1 1 1 1  13 ARG HB3  .  13 . HB1  1 1 
        129 1 2 1 1 109 LEU HB3  . 109 . HB1  1 1 
        130 1 1 1 1  13 ARG HB3  .  13 . HB1  1 1 
        130 1 2 1 1 109 LEU HB2  . 109 . HB2  1 1 
        131 1 1 1 1  13 ARG HB3  .  13 . HB1  1 1 
        131 1 2 1 1 109 LEU MD2  . 109 . HD2* 1 1 
        132 1 1 1 1  13 ARG HB3  .  13 . HB1  1 1 
        132 1 2 1 1 131 LEU MD1  . 131 . HD1* 1 1 
        133 1 1 1 1  13 ARG HB3  .  13 . HB1  1 1 
        133 1 2 1 1 131 LEU MD2  . 131 . HD2* 1 1 
        134 1 1 1 1  13 ARG HB2  .  13 . HB2  1 1 
        134 1 2 1 1  14 GLU H    .  14 . HN   1 1 
        135 1 1 1 1  13 ARG HB2  .  13 . HB2  1 1 
        135 1 2 1 1 109 LEU HB3  . 109 . HB1  1 1 
        136 1 1 1 1  13 ARG HB2  .  13 . HB2  1 1 
        136 1 2 1 1 109 LEU HB2  . 109 . HB2  1 1 
        137 1 1 1 1  13 ARG HB2  .  13 . HB2  1 1 
        137 1 2 1 1 109 LEU MD2  . 109 . HD2* 1 1 
        138 1 1 1 1  13 ARG HB2  .  13 . HB2  1 1 
        138 1 2 1 1 131 LEU MD1  . 131 . HD1* 1 1 
        139 1 1 1 1  13 ARG HB2  .  13 . HB2  1 1 
        139 1 2 1 1 131 LEU MD2  . 131 . HD2* 1 1 
        140 1 1 1 1  13 ARG QD   .  13 . HD*  1 1 
        140 1 2 1 1  14 GLU H    .  14 . HN   1 1 
        141 1 1 1 1  13 ARG QD   .  13 . HD*  1 1 
        141 1 2 1 1 124 GLU QG   . 124 . HG*  1 1 
        142 1 1 1 1  13 ARG HD3  .  13 . HD1  1 1 
        142 1 2 1 1 131 LEU MD1  . 131 . HD1* 1 1 
        143 1 1 1 1  13 ARG HD2  .  13 . HD2  1 1 
        143 1 2 1 1 131 LEU MD1  . 131 . HD1* 1 1 
        144 1 1 1 1  13 ARG QG   .  13 . HG*  1 1 
        144 1 2 1 1  14 GLU H    .  14 . HN   1 1 
        145 1 1 1 1  13 ARG QG   .  13 . HG*  1 1 
        145 1 2 1 1 109 LEU MD2  . 109 . HD2* 1 1 
        146 1 1 1 1  13 ARG QG   .  13 . HG*  1 1 
        146 1 2 1 1 124 GLU QG   . 124 . HG*  1 1 
        147 1 1 1 1  13 ARG H    .  13 . HN   1 1 
        147 1 2 1 1  13 ARG HG3  .  13 . HG1  1 1 
        148 1 1 1 1  13 ARG H    .  13 . HN   1 1 
        148 1 2 1 1  13 ARG HG2  .  13 . HG2  1 1 
        149 1 1 1 1  13 ARG H    .  13 . HN   1 1 
        149 1 2 1 1 109 LEU HB3  . 109 . HB1  1 1 
        150 1 1 1 1  13 ARG H    .  13 . HN   1 1 
        150 1 2 1 1 109 LEU HB2  . 109 . HB2  1 1 
        151 1 1 1 1  13 ARG H    .  13 . HN   1 1 
        151 1 2 1 1 109 LEU MD2  . 109 . HD2* 1 1 
        152 1 1 1 1  13 ARG H    .  13 . HN   1 1 
        152 1 2 1 1 109 LEU H    . 109 . HN   1 1 
        153 1 1 1 1  13 ARG H    .  13 . HN   1 1 
        153 1 2 1 1 110 THR HA   . 110 . HA   1 1 
        154 1 1 1 1  13 ARG H    .  13 . HN   1 1 
        154 1 2 1 1 131 LEU MD1  . 131 . HD1* 1 1 
        155 1 1 1 1  14 GLU HA   .  14 . HA   1 1 
        155 1 2 1 1  15 ALA H    .  15 . HN   1 1 
        156 1 1 1 1  14 GLU HA   .  14 . HA   1 1 
        156 1 2 1 1 106 LEU MD1  . 106 . HD1* 1 1 
        157 1 1 1 1  14 GLU HA   .  14 . HA   1 1 
        157 1 2 1 1 107 LEU MD2  . 107 . HD2* 1 1 
        158 1 1 1 1  14 GLU HA   .  14 . HA   1 1 
        158 1 2 1 1 108 ARG HA   . 108 . HA   1 1 
        159 1 1 1 1  14 GLU HA   .  14 . HA   1 1 
        159 1 2 1 1 108 ARG QG   . 108 . HG*  1 1 
        160 1 1 1 1  14 GLU HA   .  14 . HA   1 1 
        160 1 2 1 1 109 LEU H    . 109 . HN   1 1 
        161 1 1 1 1  14 GLU QB   .  14 . HB*  1 1 
        161 1 2 1 1  15 ALA H    .  15 . HN   1 1 
        162 1 1 1 1  14 GLU QB   .  14 . HB*  1 1 
        162 1 2 1 1 106 LEU MD1  . 106 . HD1* 1 1 
        163 1 1 1 1  14 GLU QB   .  14 . HB*  1 1 
        163 1 2 1 1 106 LEU HG   . 106 . HG   1 1 
        164 1 1 1 1  14 GLU QB   .  14 . HB*  1 1 
        164 1 2 1 1 108 ARG HA   . 108 . HA   1 1 
        165 1 1 1 1  14 GLU QG   .  14 . HG*  1 1 
        165 1 2 1 1 108 ARG QD   . 108 . HD*  1 1 
        166 1 1 1 1  14 GLU QG   .  14 . HG*  1 1 
        166 1 2 1 1 108 ARG QG   . 108 . HG*  1 1 
        167 1 1 1 1  14 GLU HG3  .  14 . HG1  1 1 
        167 1 2 1 1  15 ALA H    .  15 . HN   1 1 
        168 1 1 1 1  14 GLU HG3  .  14 . HG1  1 1 
        168 1 2 1 1 106 LEU MD1  . 106 . HD1* 1 1 
        169 1 1 1 1  14 GLU HG3  .  14 . HG1  1 1 
        169 1 2 1 1 106 LEU MD2  . 106 . HD2* 1 1 
        170 1 1 1 1  14 GLU HG3  .  14 . HG1  1 1 
        170 1 2 1 1 108 ARG HA   . 108 . HA   1 1 
        171 1 1 1 1  14 GLU HG2  .  14 . HG2  1 1 
        171 1 2 1 1  15 ALA H    .  15 . HN   1 1 
        172 1 1 1 1  14 GLU HG2  .  14 . HG2  1 1 
        172 1 2 1 1 106 LEU MD1  . 106 . HD1* 1 1 
        173 1 1 1 1  14 GLU HG2  .  14 . HG2  1 1 
        173 1 2 1 1 106 LEU MD2  . 106 . HD2* 1 1 
        174 1 1 1 1  14 GLU HG2  .  14 . HG2  1 1 
        174 1 2 1 1 108 ARG HA   . 108 . HA   1 1 
        175 1 1 1 1  14 GLU H    .  14 . HN   1 1 
        175 1 2 1 1  14 GLU QB   .  14 . HB*  1 1 
        176 1 1 1 1  14 GLU H    .  14 . HN   1 1 
        176 1 2 1 1  14 GLU HG3  .  14 . HG1  1 1 
        177 1 1 1 1  14 GLU H    .  14 . HN   1 1 
        177 1 2 1 1  14 GLU HG2  .  14 . HG2  1 1 
        178 1 1 1 1  15 ALA HA   .  15 . HA   1 1 
        178 1 2 1 1  16 HIS H    .  16 . HN   1 1 
        179 1 1 1 1  15 ALA MB   .  15 . HB*  1 1 
        179 1 2 1 1  16 HIS H    .  16 . HN   1 1 
        180 1 1 1 1  15 ALA MB   .  15 . HB*  1 1 
        180 1 2 1 1  17 LEU MD1  .  17 . HD1* 1 1 
        181 1 1 1 1  15 ALA MB   .  15 . HB*  1 1 
        181 1 2 1 1  17 LEU MD2  .  17 . HD2* 1 1 
        182 1 1 1 1  15 ALA MB   .  15 . HB*  1 1 
        182 1 2 1 1  17 LEU HG   .  17 . HG   1 1 
        183 1 1 1 1  15 ALA MB   .  15 . HB*  1 1 
        183 1 2 1 1 106 LEU MD1  . 106 . HD1* 1 1 
        184 1 1 1 1  15 ALA MB   .  15 . HB*  1 1 
        184 1 2 1 1 107 LEU MD2  . 107 . HD2* 1 1 
        185 1 1 1 1  15 ALA MB   .  15 . HB*  1 1 
        185 1 2 1 1 107 LEU H    . 107 . HN   1 1 
        186 1 1 1 1  15 ALA MB   .  15 . HB*  1 1 
        186 1 2 1 1 131 LEU QB   . 131 . HB*  1 1 
        187 1 1 1 1  15 ALA MB   .  15 . HB*  1 1 
        187 1 2 1 1 131 LEU MD1  . 131 . HD1* 1 1 
        188 1 1 1 1  15 ALA MB   .  15 . HB*  1 1 
        188 1 2 1 1 131 LEU MD2  . 131 . HD2* 1 1 
        189 1 1 1 1  15 ALA MB   .  15 . HB*  1 1 
        189 1 2 1 1 134 LEU MD2  . 134 . HD2* 1 1 
        190 1 1 1 1  15 ALA H    .  15 . HN   1 1 
        190 1 2 1 1  15 ALA MB   .  15 . HB*  1 1 
        191 1 1 1 1  15 ALA H    .  15 . HN   1 1 
        191 1 2 1 1  16 HIS H    .  16 . HN   1 1 
        192 1 1 1 1  15 ALA H    .  15 . HN   1 1 
        192 1 2 1 1 107 LEU HB3  . 107 . HB1  1 1 
        193 1 1 1 1  15 ALA H    .  15 . HN   1 1 
        193 1 2 1 1 107 LEU HB2  . 107 . HB2  1 1 
        194 1 1 1 1  15 ALA H    .  15 . HN   1 1 
        194 1 2 1 1 107 LEU MD2  . 107 . HD2* 1 1 
        195 1 1 1 1  16 HIS HA   .  16 . HA   1 1 
        195 1 2 1 1  17 LEU H    .  17 . HN   1 1 
        196 1 1 1 1  16 HIS HA   .  16 . HA   1 1 
        196 1 2 1 1 106 LEU HA   . 106 . HA   1 1 
        197 1 1 1 1  16 HIS HA   .  16 . HA   1 1 
        197 1 2 1 1 106 LEU QB   . 106 . HB*  1 1 
        198 1 1 1 1  16 HIS HA   .  16 . HA   1 1 
        198 1 2 1 1 106 LEU MD1  . 106 . HD1* 1 1 
        199 1 1 1 1  16 HIS HA   .  16 . HA   1 1 
        199 1 2 1 1 107 LEU H    . 107 . HN   1 1 
        200 1 1 1 1  16 HIS QB   .  16 . HB*  1 1 
        200 1 2 1 1  17 LEU H    .  17 . HN   1 1 
        201 1 1 1 1  16 HIS QB   .  16 . HB*  1 1 
        201 1 2 1 1 106 LEU MD1  . 106 . HD1* 1 1 
        202 1 1 1 1  16 HIS H    .  16 . HN   1 1 
        202 1 2 1 1  16 HIS QB   .  16 . HB*  1 1 
        203 1 1 1 1  16 HIS H    .  16 . HN   1 1 
        203 1 2 1 1  17 LEU H    .  17 . HN   1 1 
        204 1 1 1 1  17 LEU HA   .  17 . HA   1 1 
        204 1 2 1 1  17 LEU MD1  .  17 . HD1* 1 1 
        205 1 1 1 1  17 LEU HA   .  17 . HA   1 1 
        205 1 2 1 1  17 LEU HG   .  17 . HG   1 1 
        206 1 1 1 1  17 LEU HA   .  17 . HA   1 1 
        206 1 2 1 1  18 ALA MB   .  18 . HB*  1 1 
        207 1 1 1 1  17 LEU HA   .  17 . HA   1 1 
        207 1 2 1 1  18 ALA H    .  18 . HN   1 1 
        208 1 1 1 1  17 LEU HA   .  17 . HA   1 1 
        208 1 2 1 1 135 THR HA   . 135 . HA   1 1 
        209 1 1 1 1  17 LEU HA   .  17 . HA   1 1 
        209 1 2 1 1 135 THR MG   . 135 . HG2* 1 1 
        210 1 1 1 1  17 LEU HA   .  17 . HA   1 1 
        210 1 2 1 1 138 ALA MB   . 138 . HB*  1 1 
        211 1 1 1 1  17 LEU QB   .  17 . HB*  1 1 
        211 1 2 1 1  17 LEU MD1  .  17 . HD1* 1 1 
        212 1 1 1 1  17 LEU QB   .  17 . HB*  1 1 
        212 1 2 1 1 105 THR MG   . 105 . HG2* 1 1 
        213 1 1 1 1  17 LEU QB   .  17 . HB*  1 1 
        213 1 2 1 1 134 LEU HG   . 134 . HG   1 1 
        214 1 1 1 1  17 LEU HB3  .  17 . HB1  1 1 
        214 1 2 1 1  17 LEU MD2  .  17 . HD2* 1 1 
        215 1 1 1 1  17 LEU HB3  .  17 . HB1  1 1 
        215 1 2 1 1  18 ALA H    .  18 . HN   1 1 
        216 1 1 1 1  17 LEU HB3  .  17 . HB1  1 1 
        216 1 2 1 1 105 THR HB   . 105 . HB   1 1 
        217 1 1 1 1  17 LEU HB2  .  17 . HB2  1 1 
        217 1 2 1 1  17 LEU MD2  .  17 . HD2* 1 1 
        218 1 1 1 1  17 LEU HB2  .  17 . HB2  1 1 
        218 1 2 1 1  18 ALA H    .  18 . HN   1 1 
        219 1 1 1 1  17 LEU HB2  .  17 . HB2  1 1 
        219 1 2 1 1 105 THR HB   . 105 . HB   1 1 
        220 1 1 1 1  17 LEU MD1  .  17 . HD1* 1 1 
        220 1 2 1 1 105 THR HB   . 105 . HB   1 1 
        221 1 1 1 1  17 LEU MD1  .  17 . HD1* 1 1 
        221 1 2 1 1 105 THR MG   . 105 . HG2* 1 1 
        222 1 1 1 1  17 LEU MD1  .  17 . HD1* 1 1 
        222 1 2 1 1 105 THR H    . 105 . HN   1 1 
        223 1 1 1 1  17 LEU MD1  .  17 . HD1* 1 1 
        223 1 2 1 1 106 LEU QB   . 106 . HB*  1 1 
        224 1 1 1 1  17 LEU MD1  .  17 . HD1* 1 1 
        224 1 2 1 1 107 LEU QB   . 107 . HB*  1 1 
        225 1 1 1 1  17 LEU MD1  .  17 . HD1* 1 1 
        225 1 2 1 1 107 LEU H    . 107 . HN   1 1 
        226 1 1 1 1  17 LEU MD1  .  17 . HD1* 1 1 
        226 1 2 1 1 134 LEU MD2  . 134 . HD2* 1 1 
        227 1 1 1 1  17 LEU MD2  .  17 . HD2* 1 1 
        227 1 2 1 1  18 ALA H    .  18 . HN   1 1 
        228 1 1 1 1  17 LEU MD2  .  17 . HD2* 1 1 
        228 1 2 1 1 107 LEU H    . 107 . HN   1 1 
        229 1 1 1 1  17 LEU MD2  .  17 . HD2* 1 1 
        229 1 2 1 1 134 LEU MD1  . 134 . HD1* 1 1 
        230 1 1 1 1  17 LEU MD2  .  17 . HD2* 1 1 
        230 1 2 1 1 134 LEU MD2  . 134 . HD2* 1 1 
        231 1 1 1 1  17 LEU MD2  .  17 . HD2* 1 1 
        231 1 2 1 1 135 THR HA   . 135 . HA   1 1 
        232 1 1 1 1  17 LEU MD2  .  17 . HD2* 1 1 
        232 1 2 1 1 135 THR HB   . 135 . HB   1 1 
        233 1 1 1 1  17 LEU MD2  .  17 . HD2* 1 1 
        233 1 2 1 1 135 THR H    . 135 . HN   1 1 
        234 1 1 1 1  17 LEU MD2  .  17 . HD2* 1 1 
        234 1 2 1 1 138 ALA MB   . 138 . HB*  1 1 
        235 1 1 1 1  17 LEU MD2  .  17 . HD2* 1 1 
        235 1 2 1 1 138 ALA H    . 138 . HN   1 1 
        236 1 1 1 1  17 LEU MD2  .  17 . HD2* 1 1 
        236 1 2 1 1 139 ALA H    . 139 . HN   1 1 
        237 1 1 1 1  17 LEU HG   .  17 . HG   1 1 
        237 1 2 1 1  18 ALA H    .  18 . HN   1 1 
        238 1 1 1 1  17 LEU HG   .  17 . HG   1 1 
        238 1 2 1 1 107 LEU H    . 107 . HN   1 1 
        239 1 1 1 1  17 LEU HG   .  17 . HG   1 1 
        239 1 2 1 1 135 THR HB   . 135 . HB   1 1 
        240 1 1 1 1  17 LEU HG   .  17 . HG   1 1 
        240 1 2 1 1 135 THR MG   . 135 . HG2* 1 1 
        241 1 1 1 1  17 LEU H    .  17 . HN   1 1 
        241 1 2 1 1  17 LEU HB3  .  17 . HB1  1 1 
        242 1 1 1 1  17 LEU H    .  17 . HN   1 1 
        242 1 2 1 1  17 LEU HB2  .  17 . HB2  1 1 
        243 1 1 1 1  17 LEU H    .  17 . HN   1 1 
        243 1 2 1 1  17 LEU MD1  .  17 . HD1* 1 1 
        244 1 1 1 1  17 LEU H    .  17 . HN   1 1 
        244 1 2 1 1  17 LEU HG   .  17 . HG   1 1 
        245 1 1 1 1  17 LEU H    .  17 . HN   1 1 
        245 1 2 1 1 105 THR HB   . 105 . HB   1 1 
        246 1 1 1 1  17 LEU H    .  17 . HN   1 1 
        246 1 2 1 1 105 THR MG   . 105 . HG2* 1 1 
        247 1 1 1 1  17 LEU H    .  17 . HN   1 1 
        247 1 2 1 1 105 THR H    . 105 . HN   1 1 
        248 1 1 1 1  18 ALA HA   .  18 . HA   1 1 
        248 1 2 1 1  19 ALA H    .  19 . HN   1 1 
        249 1 1 1 1  18 ALA HA   .  18 . HA   1 1 
        249 1 2 1 1 104 GLY QA   . 104 . HA*  1 1 
        250 1 1 1 1  18 ALA HA   .  18 . HA   1 1 
        250 1 2 1 1 105 THR H    . 105 . HN   1 1 
        251 1 1 1 1  18 ALA MB   .  18 . HB*  1 1 
        251 1 2 1 1  19 ALA H    .  19 . HN   1 1 
        252 1 1 1 1  18 ALA MB   .  18 . HB*  1 1 
        252 1 2 1 1 139 ALA H    . 139 . HN   1 1 
        253 1 1 1 1  18 ALA H    .  18 . HN   1 1 
        253 1 2 1 1  18 ALA MB   .  18 . HB*  1 1 
        254 1 1 1 1  18 ALA H    .  18 . HN   1 1 
        254 1 2 1 1  19 ALA H    .  19 . HN   1 1 
        255 1 1 1 1  18 ALA H    .  18 . HN   1 1 
        255 1 2 1 1 139 ALA MB   . 139 . HB*  1 1 
        256 1 1 1 1  19 ALA MB   .  19 . HB*  1 1 
        256 1 2 1 1  23 ALA MB   .  23 . HB*  1 1 
        257 1 1 1 1  19 ALA MB   .  19 . HB*  1 1 
        257 1 2 1 1  23 ALA H    .  23 . HN   1 1 
        258 1 1 1 1  19 ALA MB   .  19 . HB*  1 1 
        258 1 2 1 1  24 VAL HA   .  24 . HA   1 1 
        259 1 1 1 1  19 ALA MB   .  19 . HB*  1 1 
        259 1 2 1 1  24 VAL MG2  .  24 . HG2* 1 1 
        260 1 1 1 1  19 ALA MB   .  19 . HB*  1 1 
        260 1 2 1 1  24 VAL H    .  24 . HN   1 1 
        261 1 1 1 1  19 ALA MB   .  19 . HB*  1 1 
        261 1 2 1 1 138 ALA HA   . 138 . HA   1 1 
        262 1 1 1 1  19 ALA MB   .  19 . HB*  1 1 
        262 1 2 1 1 139 ALA HA   . 139 . HA   1 1 
        263 1 1 1 1  19 ALA MB   .  19 . HB*  1 1 
        263 1 2 1 1 139 ALA H    . 139 . HN   1 1 
        264 1 1 1 1  19 ALA H    .  19 . HN   1 1 
        264 1 2 1 1  19 ALA MB   .  19 . HB*  1 1 
        265 1 1 1 1  19 ALA H    .  19 . HN   1 1 
        265 1 2 1 1  24 VAL MG2  .  24 . HG2* 1 1 
        266 1 1 1 1  19 ALA H    .  19 . HN   1 1 
        266 1 2 1 1 104 GLY QA   . 104 . HA*  1 1 
        267 1 1 1 1  19 ALA H    .  19 . HN   1 1 
        267 1 2 1 1 105 THR HB   . 105 . HB   1 1 
        268 1 1 1 1  19 ALA H    .  19 . HN   1 1 
        268 1 2 1 1 105 THR HG1  . 105 . HG*  1 1 
        268 1 2 1 1 105 THR MG   . 105 . HG*  1 1 
        269 1 1 1 1  19 ALA H    .  19 . HN   1 1 
        269 1 2 1 1 105 THR H    . 105 . HN   1 1 
        270 1 1 1 1  19 ALA H    .  19 . HN   1 1 
        270 1 2 1 1 138 ALA MB   . 138 . HB*  1 1 
        271 1 1 1 1  20 PRO HA   .  20 . HA   1 1 
        271 1 2 1 1  21 PRO QD   .  21 . HD*  1 1 
        272 1 1 1 1  20 PRO HA   .  20 . HA   1 1 
        272 1 2 1 1  21 PRO QG   .  21 . HG*  1 1 
        273 1 1 1 1  20 PRO HA   .  20 . HA   1 1 
        273 1 2 1 1 105 THR HB   . 105 . HB   1 1 
        274 1 1 1 1  20 PRO HA   .  20 . HA   1 1 
        274 1 2 1 1 105 THR HG1  . 105 . HG*  1 1 
        274 1 2 1 1 105 THR MG   . 105 . HG*  1 1 
        275 1 1 1 1  20 PRO HB3  .  20 . HB1  1 1 
        275 1 2 1 1  21 PRO HD3  .  21 . HD1  1 1 
        276 1 1 1 1  20 PRO HB3  .  20 . HB1  1 1 
        276 1 2 1 1  21 PRO HD2  .  21 . HD2  1 1 
        277 1 1 1 1  20 PRO HB3  .  20 . HB1  1 1 
        277 1 2 1 1  22 ALA H    .  22 . HN   1 1 
        278 1 1 1 1  20 PRO HB3  .  20 . HB1  1 1 
        278 1 2 1 1  23 ALA MB   .  23 . HB*  1 1 
        279 1 1 1 1  20 PRO HB2  .  20 . HB2  1 1 
        279 1 2 1 1  21 PRO HD3  .  21 . HD1  1 1 
        280 1 1 1 1  20 PRO HB2  .  20 . HB2  1 1 
        280 1 2 1 1  21 PRO HD2  .  21 . HD2  1 1 
        281 1 1 1 1  20 PRO HB2  .  20 . HB2  1 1 
        281 1 2 1 1  22 ALA H    .  22 . HN   1 1 
        282 1 1 1 1  20 PRO HB2  .  20 . HB2  1 1 
        282 1 2 1 1  23 ALA MB   .  23 . HB*  1 1 
        283 1 1 1 1  20 PRO HB2  .  20 . HB2  1 1 
        283 1 2 1 1  23 ALA H    .  23 . HN   1 1 
        284 1 1 1 1  20 PRO QG   .  20 . HG*  1 1 
        284 1 2 1 1  23 ALA HA   .  23 . HA   1 1 
        285 1 1 1 1  20 PRO QG   .  20 . HG*  1 1 
        285 1 2 1 1  23 ALA MB   .  23 . HB*  1 1 
        286 1 1 1 1  20 PRO QG   .  20 . HG*  1 1 
        286 1 2 1 1  23 ALA H    .  23 . HN   1 1 
        287 1 1 1 1  21 PRO HA   .  21 . HA   1 1 
        287 1 2 1 1  23 ALA H    .  23 . HN   1 1 
        288 1 1 1 1  21 PRO HA   .  21 . HA   1 1 
        288 1 2 1 1  24 VAL HB   .  24 . HB   1 1 
        289 1 1 1 1  21 PRO HA   .  21 . HA   1 1 
        289 1 2 1 1  24 VAL MG1  .  24 . HG1* 1 1 
        290 1 1 1 1  21 PRO HA   .  21 . HA   1 1 
        290 1 2 1 1  24 VAL MG2  .  24 . HG2* 1 1 
        291 1 1 1 1  21 PRO HA   .  21 . HA   1 1 
        291 1 2 1 1  24 VAL H    .  24 . HN   1 1 
        292 1 1 1 1  21 PRO HA   .  21 . HA   1 1 
        292 1 2 1 1  25 PHE H    .  25 . HN   1 1 
        293 1 1 1 1  21 PRO HA   .  21 . HA   1 1 
        293 1 2 1 1  98 LEU MD1  .  98 . HD1* 1 1 
        294 1 1 1 1  21 PRO HA   .  21 . HA   1 1 
        294 1 2 1 1 105 THR HB   . 105 . HB   1 1 
        295 1 1 1 1  21 PRO HA   .  21 . HA   1 1 
        295 1 2 1 1 105 THR HG1  . 105 . HG*  1 1 
        295 1 2 1 1 105 THR MG   . 105 . HG*  1 1 
        296 1 1 1 1  21 PRO HA   .  21 . HA   1 1 
        296 1 2 1 1 105 THR MG   . 105 . HG2* 1 1 
        297 1 1 1 1  21 PRO QB   .  21 . HB*  1 1 
        297 1 2 1 1  22 ALA H    .  22 . HN   1 1 
        298 1 1 1 1  21 PRO QB   .  21 . HB*  1 1 
        298 1 2 1 1  72 VAL MG2  .  72 . HG2* 1 1 
        299 1 1 1 1  21 PRO QB   .  21 . HB*  1 1 
        299 1 2 1 1  98 LEU QB   .  98 . HB*  1 1 
        300 1 1 1 1  21 PRO QB   .  21 . HB*  1 1 
        300 1 2 1 1  98 LEU MD1  .  98 . HD1* 1 1 
        301 1 1 1 1  21 PRO QB   .  21 . HB*  1 1 
        301 1 2 1 1 105 THR MG   . 105 . HG2* 1 1 
        302 1 1 1 1  21 PRO QD   .  21 . HD*  1 1 
        302 1 2 1 1  22 ALA H    .  22 . HN   1 1 
        303 1 1 1 1  21 PRO QD   .  21 . HD*  1 1 
        303 1 2 1 1  23 ALA H    .  23 . HN   1 1 
        304 1 1 1 1  21 PRO QD   .  21 . HD*  1 1 
        304 1 2 1 1 100 GLU QG   . 100 . HG*  1 1 
        305 1 1 1 1  21 PRO QD   .  21 . HD*  1 1 
        305 1 2 1 1 105 THR HG1  . 105 . HG*  1 1 
        305 1 2 1 1 105 THR MG   . 105 . HG*  1 1 
        306 1 1 1 1  21 PRO QD   .  21 . HD*  1 1 
        306 1 2 1 1 105 THR MG   . 105 . HG2* 1 1 
        307 1 1 1 1  21 PRO QG   .  21 . HG*  1 1 
        307 1 2 1 1  72 VAL MG2  .  72 . HG2* 1 1 
        308 1 1 1 1  21 PRO QG   .  21 . HG*  1 1 
        308 1 2 1 1  98 LEU QB   .  98 . HB*  1 1 
        309 1 1 1 1  21 PRO QG   .  21 . HG*  1 1 
        309 1 2 1 1 100 GLU QG   . 100 . HG*  1 1 
        310 1 1 1 1  21 PRO QG   .  21 . HG*  1 1 
        310 1 2 1 1 105 THR MG   . 105 . HG2* 1 1 
        311 1 1 1 1  21 PRO HG3  .  21 . HG1  1 1 
        311 1 2 1 1  22 ALA H    .  22 . HN   1 1 
        312 1 1 1 1  21 PRO HG2  .  21 . HG2  1 1 
        312 1 2 1 1  22 ALA H    .  22 . HN   1 1 
        313 1 1 1 1  22 ALA HA   .  22 . HA   1 1 
        313 1 2 1 1  25 PHE HB3  .  25 . HB1  1 1 
        314 1 1 1 1  22 ALA HA   .  22 . HA   1 1 
        314 1 2 1 1  25 PHE HB2  .  25 . HB2  1 1 
        315 1 1 1 1  22 ALA HA   .  22 . HA   1 1 
        315 1 2 1 1  25 PHE H    .  25 . HN   1 1 
        316 1 1 1 1  22 ALA HA   .  22 . HA   1 1 
        316 1 2 1 1  26 ALA MB   .  26 . HB*  1 1 
        317 1 1 1 1  22 ALA HA   .  22 . HA   1 1 
        317 1 2 1 1  26 ALA H    .  26 . HN   1 1 
        318 1 1 1 1  22 ALA HA   .  22 . HA   1 1 
        318 1 2 1 1  72 VAL HB   .  72 . HB   1 1 
        319 1 1 1 1  22 ALA HA   .  22 . HA   1 1 
        319 1 2 1 1  72 VAL MG1  .  72 . HG1* 1 1 
        320 1 1 1 1  22 ALA HA   .  22 . HA   1 1 
        320 1 2 1 1  72 VAL MG2  .  72 . HG2* 1 1 
        321 1 1 1 1  22 ALA MB   .  22 . HB*  1 1 
        321 1 2 1 1  23 ALA H    .  23 . HN   1 1 
        322 1 1 1 1  22 ALA MB   .  22 . HB*  1 1 
        322 1 2 1 1  72 VAL MG1  .  72 . HG1* 1 1 
        323 1 1 1 1  22 ALA MB   .  22 . HB*  1 1 
        323 1 2 1 1  72 VAL MG2  .  72 . HG2* 1 1 
        324 1 1 1 1  22 ALA H    .  22 . HN   1 1 
        324 1 2 1 1  22 ALA MB   .  22 . HB*  1 1 
        325 1 1 1 1  22 ALA H    .  22 . HN   1 1 
        325 1 2 1 1  23 ALA H    .  23 . HN   1 1 
        326 1 1 1 1  22 ALA H    .  22 . HN   1 1 
        326 1 2 1 1  72 VAL MG1  .  72 . HG1* 1 1 
        327 1 1 1 1  22 ALA H    .  22 . HN   1 1 
        327 1 2 1 1  72 VAL MG2  .  72 . HG2* 1 1 
        328 1 1 1 1  23 ALA HA   .  23 . HA   1 1 
        328 1 2 1 1  26 ALA MB   .  26 . HB*  1 1 
        329 1 1 1 1  23 ALA HA   .  23 . HA   1 1 
        329 1 2 1 1  26 ALA H    .  26 . HN   1 1 
        330 1 1 1 1  23 ALA MB   .  23 . HB*  1 1 
        330 1 2 1 1  24 VAL MG2  .  24 . HG2* 1 1 
        331 1 1 1 1  23 ALA MB   .  23 . HB*  1 1 
        331 1 2 1 1  24 VAL H    .  24 . HN   1 1 
        332 1 1 1 1  23 ALA MB   .  23 . HB*  1 1 
        332 1 2 1 1 138 ALA HA   . 138 . HA   1 1 
        333 1 1 1 1  23 ALA H    .  23 . HN   1 1 
        333 1 2 1 1  23 ALA MB   .  23 . HB*  1 1 
        334 1 1 1 1  23 ALA H    .  23 . HN   1 1 
        334 1 2 1 1  24 VAL H    .  24 . HN   1 1 
        335 1 1 1 1  24 VAL HA   .  24 . HA   1 1 
        335 1 2 1 1  24 VAL MG1  .  24 . HG1* 1 1 
        336 1 1 1 1  24 VAL HA   .  24 . HA   1 1 
        336 1 2 1 1  24 VAL MG2  .  24 . HG2* 1 1 
        337 1 1 1 1  24 VAL HA   .  24 . HA   1 1 
        337 1 2 1 1  27 LEU HB3  .  27 . HB1  1 1 
        338 1 1 1 1  24 VAL HA   .  24 . HA   1 1 
        338 1 2 1 1  27 LEU HB2  .  27 . HB2  1 1 
        339 1 1 1 1  24 VAL HA   .  24 . HA   1 1 
        339 1 2 1 1  27 LEU MD1  .  27 . HD1* 1 1 
        340 1 1 1 1  24 VAL HA   .  24 . HA   1 1 
        340 1 2 1 1  27 LEU MD2  .  27 . HD2* 1 1 
        341 1 1 1 1  24 VAL HA   .  24 . HA   1 1 
        341 1 2 1 1  27 LEU HG   .  27 . HG   1 1 
        342 1 1 1 1  24 VAL HA   .  24 . HA   1 1 
        342 1 2 1 1  27 LEU H    .  27 . HN   1 1 
        343 1 1 1 1  24 VAL HA   .  24 . HA   1 1 
        343 1 2 1 1 134 LEU HG   . 134 . HG   1 1 
        344 1 1 1 1  24 VAL HA   .  24 . HA   1 1 
        344 1 2 1 1 138 ALA MB   . 138 . HB*  1 1 
        345 1 1 1 1  24 VAL HB   .  24 . HB   1 1 
        345 1 2 1 1  25 PHE H    .  25 . HN   1 1 
        346 1 1 1 1  24 VAL HB   .  24 . HB   1 1 
        346 1 2 1 1  98 LEU MD1  .  98 . HD1* 1 1 
        347 1 1 1 1  24 VAL HB   .  24 . HB   1 1 
        347 1 2 1 1 105 THR MG   . 105 . HG2* 1 1 
        348 1 1 1 1  24 VAL MG1  .  24 . HG1* 1 1 
        348 1 2 1 1  25 PHE HA   .  25 . HA   1 1 
        349 1 1 1 1  24 VAL MG1  .  24 . HG1* 1 1 
        349 1 2 1 1  25 PHE H    .  25 . HN   1 1 
        350 1 1 1 1  24 VAL MG1  .  24 . HG1* 1 1 
        350 1 2 1 1  28 MET ME   .  28 . HE*  1 1 
        351 1 1 1 1  24 VAL MG1  .  24 . HG1* 1 1 
        351 1 2 1 1  28 MET HG3  .  28 . HG1  1 1 
        352 1 1 1 1  24 VAL MG1  .  24 . HG1* 1 1 
        352 1 2 1 1  28 MET HG2  .  28 . HG2  1 1 
        353 1 1 1 1  24 VAL MG1  .  24 . HG1* 1 1 
        353 1 2 1 1  28 MET H    .  28 . HN   1 1 
        354 1 1 1 1  24 VAL MG1  .  24 . HG1* 1 1 
        354 1 2 1 1  98 LEU MD1  .  98 . HD1* 1 1 
        355 1 1 1 1  24 VAL MG1  .  24 . HG1* 1 1 
        355 1 2 1 1 105 THR HB   . 105 . HB   1 1 
        356 1 1 1 1  24 VAL MG1  .  24 . HG1* 1 1 
        356 1 2 1 1 134 LEU MD1  . 134 . HD1* 1 1 
        357 1 1 1 1  24 VAL MG1  .  24 . HG1* 1 1 
        357 1 2 1 1 134 LEU MD2  . 134 . HD2* 1 1 
        358 1 1 1 1  24 VAL MG2  .  24 . HG2* 1 1 
        358 1 2 1 1  25 PHE H    .  25 . HN   1 1 
        359 1 1 1 1  24 VAL MG2  .  24 . HG2* 1 1 
        359 1 2 1 1 105 THR HB   . 105 . HB   1 1 
        360 1 1 1 1  24 VAL MG2  .  24 . HG2* 1 1 
        360 1 2 1 1 105 THR HG1  . 105 . HG*  1 1 
        360 1 2 1 1 105 THR MG   . 105 . HG*  1 1 
        361 1 1 1 1  24 VAL MG2  .  24 . HG2* 1 1 
        361 1 2 1 1 138 ALA MB   . 138 . HB*  1 1 
        362 1 1 1 1  24 VAL H    .  24 . HN   1 1 
        362 1 2 1 1  24 VAL HB   .  24 . HB   1 1 
        363 1 1 1 1  24 VAL H    .  24 . HN   1 1 
        363 1 2 1 1  24 VAL MG1  .  24 . HG1* 1 1 
        364 1 1 1 1  24 VAL H    .  24 . HN   1 1 
        364 1 2 1 1  24 VAL MG2  .  24 . HG2* 1 1 
        365 1 1 1 1  24 VAL H    .  24 . HN   1 1 
        365 1 2 1 1  25 PHE H    .  25 . HN   1 1 
        366 1 1 1 1  25 PHE HA   .  25 . HA   1 1 
        366 1 2 1 1  28 MET HB3  .  28 . HB1  1 1 
        367 1 1 1 1  25 PHE HA   .  25 . HA   1 1 
        367 1 2 1 1  28 MET HB2  .  28 . HB2  1 1 
        368 1 1 1 1  25 PHE HA   .  25 . HA   1 1 
        368 1 2 1 1  28 MET ME   .  28 . HE*  1 1 
        369 1 1 1 1  25 PHE HA   .  25 . HA   1 1 
        369 1 2 1 1  28 MET H    .  28 . HN   1 1 
        370 1 1 1 1  25 PHE HA   .  25 . HA   1 1 
        370 1 2 1 1  98 LEU MD1  .  98 . HD1* 1 1 
        371 1 1 1 1  25 PHE QB   .  25 . HB*  1 1 
        371 1 2 1 1  72 VAL HA   .  72 . HA   1 1 
        372 1 1 1 1  25 PHE HB3  .  25 . HB1  1 1 
        372 1 2 1 1  26 ALA H    .  26 . HN   1 1 
        373 1 1 1 1  25 PHE HB3  .  25 . HB1  1 1 
        373 1 2 1 1  72 VAL HB   .  72 . HB   1 1 
        374 1 1 1 1  25 PHE HB3  .  25 . HB1  1 1 
        374 1 2 1 1  72 VAL MG1  .  72 . HG1* 1 1 
        375 1 1 1 1  25 PHE HB3  .  25 . HB1  1 1 
        375 1 2 1 1  72 VAL MG2  .  72 . HG2* 1 1 
        376 1 1 1 1  25 PHE HB3  .  25 . HB1  1 1 
        376 1 2 1 1  98 LEU MD1  .  98 . HD1* 1 1 
        377 1 1 1 1  25 PHE HB2  .  25 . HB2  1 1 
        377 1 2 1 1  26 ALA H    .  26 . HN   1 1 
        378 1 1 1 1  25 PHE HB2  .  25 . HB2  1 1 
        378 1 2 1 1  72 VAL HB   .  72 . HB   1 1 
        379 1 1 1 1  25 PHE HB2  .  25 . HB2  1 1 
        379 1 2 1 1  72 VAL MG1  .  72 . HG1* 1 1 
        380 1 1 1 1  25 PHE HB2  .  25 . HB2  1 1 
        380 1 2 1 1  72 VAL MG2  .  72 . HG2* 1 1 
        381 1 1 1 1  25 PHE HB2  .  25 . HB2  1 1 
        381 1 2 1 1  98 LEU MD1  .  98 . HD1* 1 1 
        382 1 1 1 1  25 PHE H    .  25 . HN   1 1 
        382 1 2 1 1  25 PHE HB3  .  25 . HB1  1 1 
        383 1 1 1 1  25 PHE H    .  25 . HN   1 1 
        383 1 2 1 1  25 PHE HB2  .  25 . HB2  1 1 
        384 1 1 1 1  25 PHE H    .  25 . HN   1 1 
        384 1 2 1 1  26 ALA H    .  26 . HN   1 1 
        385 1 1 1 1  25 PHE H    .  25 . HN   1 1 
        385 1 2 1 1  98 LEU MD1  .  98 . HD1* 1 1 
        386 1 1 1 1  26 ALA HA   .  26 . HA   1 1 
        386 1 2 1 1  29 THR HB   .  29 . HB   1 1 
        387 1 1 1 1  26 ALA HA   .  26 . HA   1 1 
        387 1 2 1 1  29 THR MG   .  29 . HG2* 1 1 
        388 1 1 1 1  26 ALA HA   .  26 . HA   1 1 
        388 1 2 1 1  29 THR H    .  29 . HN   1 1 
        389 1 1 1 1  26 ALA HA   .  26 . HA   1 1 
        389 1 2 1 1  30 ASP QB   .  30 . HB*  1 1 
        390 1 1 1 1  26 ALA MB   .  26 . HB*  1 1 
        390 1 2 1 1  27 LEU H    .  27 . HN   1 1 
        391 1 1 1 1  26 ALA MB   .  26 . HB*  1 1 
        391 1 2 1 1  28 MET H    .  28 . HN   1 1 
        392 1 1 1 1  26 ALA MB   .  26 . HB*  1 1 
        392 1 2 1 1  29 THR H    .  29 . HN   1 1 
        393 1 1 1 1  26 ALA MB   .  26 . HB*  1 1 
        393 1 2 1 1  30 ASP QB   .  30 . HB*  1 1 
        394 1 1 1 1  26 ALA H    .  26 . HN   1 1 
        394 1 2 1 1  26 ALA MB   .  26 . HB*  1 1 
        395 1 1 1 1  26 ALA H    .  26 . HN   1 1 
        395 1 2 1 1  27 LEU H    .  27 . HN   1 1 
        396 1 1 1 1  27 LEU HA   .  27 . HA   1 1 
        396 1 2 1 1  27 LEU MD1  .  27 . HD1* 1 1 
        397 1 1 1 1  27 LEU HA   .  27 . HA   1 1 
        397 1 2 1 1  27 LEU MD2  .  27 . HD2* 1 1 
        398 1 1 1 1  27 LEU HA   .  27 . HA   1 1 
        398 1 2 1 1  30 ASP HB3  .  30 . HB1  1 1 
        399 1 1 1 1  27 LEU HA   .  27 . HA   1 1 
        399 1 2 1 1  30 ASP HB2  .  30 . HB2  1 1 
        400 1 1 1 1  27 LEU HA   .  27 . HA   1 1 
        400 1 2 1 1  30 ASP H    .  30 . HN   1 1 
        401 1 1 1 1  27 LEU HA   .  27 . HA   1 1 
        401 1 2 1 1  33 LYS QB   .  33 . HB*  1 1 
        402 1 1 1 1  27 LEU HA   .  27 . HA   1 1 
        402 1 2 1 1  33 LYS QD   .  33 . HD*  1 1 
        403 1 1 1 1  27 LEU HA   .  27 . HA   1 1 
        403 1 2 1 1  33 LYS QG   .  33 . HG*  1 1 
        404 1 1 1 1  27 LEU QB   .  27 . HB*  1 1 
        404 1 2 1 1  33 LYS QB   .  33 . HB*  1 1 
        405 1 1 1 1  27 LEU QB   .  27 . HB*  1 1 
        405 1 2 1 1  37 TRP HD1  .  37 . HD1  1 1 
        406 1 1 1 1  27 LEU QB   .  27 . HB*  1 1 
        406 1 2 1 1  37 TRP HE1  .  37 . HE1  1 1 
        407 1 1 1 1  27 LEU HB3  .  27 . HB1  1 1 
        407 1 2 1 1  27 LEU MD1  .  27 . HD1* 1 1 
        408 1 1 1 1  27 LEU HB3  .  27 . HB1  1 1 
        408 1 2 1 1  27 LEU MD2  .  27 . HD2* 1 1 
        409 1 1 1 1  27 LEU HB3  .  27 . HB1  1 1 
        409 1 2 1 1  28 MET H    .  28 . HN   1 1 
        410 1 1 1 1  27 LEU HB3  .  27 . HB1  1 1 
        410 1 2 1 1 134 LEU MD1  . 134 . HD1* 1 1 
        411 1 1 1 1  27 LEU HB2  .  27 . HB2  1 1 
        411 1 2 1 1  27 LEU MD1  .  27 . HD1* 1 1 
        412 1 1 1 1  27 LEU HB2  .  27 . HB2  1 1 
        412 1 2 1 1  27 LEU MD2  .  27 . HD2* 1 1 
        413 1 1 1 1  27 LEU HB2  .  27 . HB2  1 1 
        413 1 2 1 1  28 MET H    .  28 . HN   1 1 
        414 1 1 1 1  27 LEU HB2  .  27 . HB2  1 1 
        414 1 2 1 1 134 LEU MD1  . 134 . HD1* 1 1 
        415 1 1 1 1  27 LEU MD1  .  27 . HD1* 1 1 
        415 1 2 1 1  33 LYS QB   .  33 . HB*  1 1 
        416 1 1 1 1  27 LEU MD1  .  27 . HD1* 1 1 
        416 1 2 1 1  37 TRP HD1  .  37 . HD1  1 1 
        417 1 1 1 1  27 LEU MD1  .  27 . HD1* 1 1 
        417 1 2 1 1 134 LEU MD1  . 134 . HD1* 1 1 
        418 1 1 1 1  27 LEU MD1  .  27 . HD1* 1 1 
        418 1 2 1 1 134 LEU MD2  . 134 . HD2* 1 1 
        419 1 1 1 1  27 LEU MD1  .  27 . HD1* 1 1 
        419 1 2 1 1 137 VAL MG1  . 137 . HG1* 1 1 
        420 1 1 1 1  27 LEU MD1  .  27 . HD1* 1 1 
        420 1 2 1 1 137 VAL MG2  . 137 . HG2* 1 1 
        421 1 1 1 1  27 LEU MD1  .  27 . HD1* 1 1 
        421 1 2 1 1 138 ALA HA   . 138 . HA   1 1 
        422 1 1 1 1  27 LEU MD1  .  27 . HD1* 1 1 
        422 1 2 1 1 138 ALA MB   . 138 . HB*  1 1 
        423 1 1 1 1  27 LEU MD1  .  27 . HD1* 1 1 
        423 1 2 1 1 138 ALA H    . 138 . HN   1 1 
        424 1 1 1 1  27 LEU MD2  .  27 . HD2* 1 1 
        424 1 2 1 1  28 MET H    .  28 . HN   1 1 
        425 1 1 1 1  27 LEU MD2  .  27 . HD2* 1 1 
        425 1 2 1 1  33 LYS HA   .  33 . HA   1 1 
        426 1 1 1 1  27 LEU MD2  .  27 . HD2* 1 1 
        426 1 2 1 1  33 LYS QB   .  33 . HB*  1 1 
        427 1 1 1 1  27 LEU MD2  .  27 . HD2* 1 1 
        427 1 2 1 1  33 LYS QD   .  33 . HD*  1 1 
        428 1 1 1 1  27 LEU MD2  .  27 . HD2* 1 1 
        428 1 2 1 1  33 LYS QE   .  33 . HE*  1 1 
        429 1 1 1 1  27 LEU MD2  .  27 . HD2* 1 1 
        429 1 2 1 1  33 LYS HE3  .  33 . HE1  1 1 
        430 1 1 1 1  27 LEU MD2  .  27 . HD2* 1 1 
        430 1 2 1 1  33 LYS HE2  .  33 . HE2  1 1 
        431 1 1 1 1  27 LEU MD2  .  27 . HD2* 1 1 
        431 1 2 1 1  33 LYS QG   .  33 . HG*  1 1 
        432 1 1 1 1  27 LEU MD2  .  27 . HD2* 1 1 
        432 1 2 1 1  33 LYS H    .  33 . HN   1 1 
        433 1 1 1 1  27 LEU MD2  .  27 . HD2* 1 1 
        433 1 2 1 1  34 ILE HA   .  34 . HA   1 1 
        434 1 1 1 1  27 LEU MD2  .  27 . HD2* 1 1 
        434 1 2 1 1  34 ILE H    .  34 . HN   1 1 
        435 1 1 1 1  27 LEU MD2  .  27 . HD2* 1 1 
        435 1 2 1 1  36 ARG HB3  .  36 . HB1  1 1 
        436 1 1 1 1  27 LEU MD2  .  27 . HD2* 1 1 
        436 1 2 1 1  36 ARG HB2  .  36 . HB2  1 1 
        437 1 1 1 1  27 LEU MD2  .  27 . HD2* 1 1 
        437 1 2 1 1  36 ARG QD   .  36 . HD*  1 1 
        438 1 1 1 1  27 LEU MD2  .  27 . HD2* 1 1 
        438 1 2 1 1  37 TRP HD1  .  37 . HD1  1 1 
        439 1 1 1 1  27 LEU MD2  .  27 . HD2* 1 1 
        439 1 2 1 1  37 TRP HE1  .  37 . HE1  1 1 
        440 1 1 1 1  27 LEU MD2  .  27 . HD2* 1 1 
        440 1 2 1 1  37 TRP H    .  37 . HN   1 1 
        441 1 1 1 1  27 LEU MD2  .  27 . HD2* 1 1 
        441 1 2 1 1 134 LEU MD1  . 134 . HD1* 1 1 
        442 1 1 1 1  27 LEU MD2  .  27 . HD2* 1 1 
        442 1 2 1 1 138 ALA HA   . 138 . HA   1 1 
        443 1 1 1 1  27 LEU HG   .  27 . HG   1 1 
        443 1 2 1 1  28 MET H    .  28 . HN   1 1 
        444 1 1 1 1  27 LEU HG   .  27 . HG   1 1 
        444 1 2 1 1 137 VAL MG1  . 137 . HG1* 1 1 
        445 1 1 1 1  27 LEU H    .  27 . HN   1 1 
        445 1 2 1 1  27 LEU HB3  .  27 . HB1  1 1 
        446 1 1 1 1  27 LEU H    .  27 . HN   1 1 
        446 1 2 1 1  27 LEU HB2  .  27 . HB2  1 1 
        447 1 1 1 1  27 LEU H    .  27 . HN   1 1 
        447 1 2 1 1  27 LEU MD1  .  27 . HD1* 1 1 
        448 1 1 1 1  27 LEU H    .  27 . HN   1 1 
        448 1 2 1 1  27 LEU MD2  .  27 . HD2* 1 1 
        449 1 1 1 1  27 LEU H    .  27 . HN   1 1 
        449 1 2 1 1  27 LEU HG   .  27 . HG   1 1 
        450 1 1 1 1  27 LEU H    .  27 . HN   1 1 
        450 1 2 1 1  28 MET H    .  28 . HN   1 1 
        451 1 1 1 1  28 MET HA   .  28 . HA   1 1 
        451 1 2 1 1  28 MET ME   .  28 . HE*  1 1 
        452 1 1 1 1  28 MET HA   .  28 . HA   1 1 
        452 1 2 1 1  34 ILE MD   .  34 . HD1* 1 1 
        453 1 1 1 1  28 MET HA   .  28 . HA   1 1 
        453 1 2 1 1  34 ILE QG   .  34 . HG1* 1 1 
        454 1 1 1 1  28 MET HA   .  28 . HA   1 1 
        454 1 2 1 1  37 TRP HZ2  .  37 . HZ2  1 1 
        455 1 1 1 1  28 MET QB   .  28 . HB*  1 1 
        455 1 2 1 1  28 MET ME   .  28 . HE*  1 1 
        456 1 1 1 1  28 MET HB3  .  28 . HB1  1 1 
        456 1 2 1 1  29 THR H    .  29 . HN   1 1 
        457 1 1 1 1  28 MET HB2  .  28 . HB2  1 1 
        457 1 2 1 1  29 THR H    .  29 . HN   1 1 
        458 1 1 1 1  28 MET ME   .  28 . HE*  1 1 
        458 1 2 1 1  75 LEU QD   .  75 . HD*  1 1 
        459 1 1 1 1  28 MET ME   .  28 . HE*  1 1 
        459 1 2 1 1  96 ILE MD   .  96 . HD1* 1 1 
        460 1 1 1 1  28 MET ME   .  28 . HE*  1 1 
        460 1 2 1 1  96 ILE MG   .  96 . HG2* 1 1 
        461 1 1 1 1  28 MET ME   .  28 . HE*  1 1 
        461 1 2 1 1  98 LEU MD1  .  98 . HD1* 1 1 
        462 1 1 1 1  28 MET ME   .  28 . HE*  1 1 
        462 1 2 1 1 107 LEU MD1  . 107 . HD1* 1 1 
        463 1 1 1 1  28 MET ME   .  28 . HE*  1 1 
        463 1 2 1 1 134 LEU MD1  . 134 . HD1* 1 1 
        464 1 1 1 1  28 MET ME   .  28 . HE*  1 1 
        464 1 2 1 1 134 LEU MD2  . 134 . HD2* 1 1 
        465 1 1 1 1  28 MET ME   .  28 . HE*  1 1 
        465 1 2 1 1  28 MET QG   .  28 . HG*  1 1 
        466 1 1 1 1  28 MET HG3  .  28 . HG1  1 1 
        466 1 2 1 1  37 TRP HZ2  .  37 . HZ2  1 1 
        467 1 1 1 1  28 MET HG3  .  28 . HG1  1 1 
        467 1 2 1 1 134 LEU MD1  . 134 . HD1* 1 1 
        468 1 1 1 1  28 MET HG3  .  28 . HG1  1 1 
        468 1 2 1 1 134 LEU MD2  . 134 . HD2* 1 1 
        469 1 1 1 1  28 MET HG2  .  28 . HG2  1 1 
        469 1 2 1 1  37 TRP HZ2  .  37 . HZ2  1 1 
        470 1 1 1 1  28 MET HG2  .  28 . HG2  1 1 
        470 1 2 1 1 134 LEU MD1  . 134 . HD1* 1 1 
        471 1 1 1 1  28 MET HG2  .  28 . HG2  1 1 
        471 1 2 1 1 134 LEU MD2  . 134 . HD2* 1 1 
        472 1 1 1 1  28 MET H    .  28 . HN   1 1 
        472 1 2 1 1  28 MET QB   .  28 . HB*  1 1 
        473 1 1 1 1  28 MET H    .  28 . HN   1 1 
        473 1 2 1 1  28 MET HG3  .  28 . HG1  1 1 
        474 1 1 1 1  28 MET H    .  28 . HN   1 1 
        474 1 2 1 1  28 MET HG2  .  28 . HG2  1 1 
        475 1 1 1 1  28 MET H    .  28 . HN   1 1 
        475 1 2 1 1  29 THR H    .  29 . HN   1 1 
        476 1 1 1 1  29 THR HA   .  29 . HA   1 1 
        476 1 2 1 1  29 THR MG   .  29 . HG2* 1 1 
        477 1 1 1 1  29 THR HA   .  29 . HA   1 1 
        477 1 2 1 1  34 ILE MD   .  34 . HD1* 1 1 
        478 1 1 1 1  29 THR H    .  29 . HN   1 1 
        478 1 2 1 1  29 THR MG   .  29 . HG2* 1 1 
        479 1 1 1 1  29 THR H    .  29 . HN   1 1 
        479 1 2 1 1  30 ASP H    .  30 . HN   1 1 
        480 1 1 1 1  30 ASP HA   .  30 . HA   1 1 
        480 1 2 1 1  31 PRO QD   .  31 . HD*  1 1 
        481 1 1 1 1  30 ASP HA   .  30 . HA   1 1 
        481 1 2 1 1  31 PRO QG   .  31 . HG*  1 1 
        482 1 1 1 1  30 ASP QB   .  30 . HB*  1 1 
        482 1 2 1 1  31 PRO QD   .  31 . HD*  1 1 
        483 1 1 1 1  30 ASP QB   .  30 . HB*  1 1 
        483 1 2 1 1  33 LYS QB   .  33 . HB*  1 1 
        484 1 1 1 1  30 ASP QB   .  30 . HB*  1 1 
        484 1 2 1 1  33 LYS QD   .  33 . HD*  1 1 
        485 1 1 1 1  30 ASP QB   .  30 . HB*  1 1 
        485 1 2 1 1  33 LYS QG   .  33 . HG*  1 1 
        486 1 1 1 1  30 ASP HB3  .  30 . HB1  1 1 
        486 1 2 1 1  33 LYS H    .  33 . HN   1 1 
        487 1 1 1 1  30 ASP HB2  .  30 . HB2  1 1 
        487 1 2 1 1  33 LYS H    .  33 . HN   1 1 
        488 1 1 1 1  30 ASP H    .  30 . HN   1 1 
        488 1 2 1 1  30 ASP QB   .  30 . HB*  1 1 
        489 1 1 1 1  31 PRO HA   .  31 . HA   1 1 
        489 1 2 1 1  34 ILE HB   .  34 . HB   1 1 
        490 1 1 1 1  31 PRO HA   .  31 . HA   1 1 
        490 1 2 1 1  34 ILE MD   .  34 . HD1* 1 1 
        491 1 1 1 1  31 PRO HA   .  31 . HA   1 1 
        491 1 2 1 1  34 ILE QG   .  34 . HG1* 1 1 
        492 1 1 1 1  31 PRO HA   .  31 . HA   1 1 
        492 1 2 1 1  34 ILE H    .  34 . HN   1 1 
        493 1 1 1 1  31 PRO HA   .  31 . HA   1 1 
        493 1 2 1 1  35 LEU H    .  35 . HN   1 1 
        494 1 1 1 1  31 PRO HA   .  31 . HA   1 1 
        494 1 2 1 1  42 ALA MB   .  42 . HB*  1 1 
        495 1 1 1 1  31 PRO HA   .  31 . HA   1 1 
        495 1 2 1 1  44 VAL HB   .  44 . HB   1 1 
        496 1 1 1 1  31 PRO HA   .  31 . HA   1 1 
        496 1 2 1 1  44 VAL MG2  .  44 . HG2* 1 1 
        497 1 1 1 1  31 PRO QB   .  31 . HB*  1 1 
        497 1 2 1 1  32 GLU H    .  32 . HN   1 1 
        498 1 1 1 1  31 PRO QB   .  31 . HB*  1 1 
        498 1 2 1 1  34 ILE HB   .  34 . HB   1 1 
        499 1 1 1 1  31 PRO QB   .  31 . HB*  1 1 
        499 1 2 1 1  34 ILE MD   .  34 . HD1* 1 1 
        500 1 1 1 1  31 PRO QB   .  31 . HB*  1 1 
        500 1 2 1 1  42 ALA MB   .  42 . HB*  1 1 
        501 1 1 1 1  31 PRO QB   .  31 . HB*  1 1 
        501 1 2 1 1  43 GLU HA   .  43 . HA   1 1 
        502 1 1 1 1  31 PRO QB   .  31 . HB*  1 1 
        502 1 2 1 1  44 VAL HB   .  44 . HB   1 1 
        503 1 1 1 1  31 PRO QB   .  31 . HB*  1 1 
        503 1 2 1 1  44 VAL MG2  .  44 . HG2* 1 1 
        504 1 1 1 1  31 PRO QB   .  31 . HB*  1 1 
        504 1 2 1 1  44 VAL H    .  44 . HN   1 1 
        505 1 1 1 1  31 PRO QD   .  31 . HD*  1 1 
        505 1 2 1 1  32 GLU H    .  32 . HN   1 1 
        506 1 1 1 1  31 PRO QD   .  31 . HD*  1 1 
        506 1 2 1 1  44 VAL HB   .  44 . HB   1 1 
        507 1 1 1 1  31 PRO QG   .  31 . HG*  1 1 
        507 1 2 1 1  32 GLU H    .  32 . HN   1 1 
        508 1 1 1 1  32 GLU HA   .  32 . HA   1 1 
        508 1 2 1 1  32 GLU QG   .  32 . HG*  1 1 
        509 1 1 1 1  32 GLU HA   .  32 . HA   1 1 
        509 1 2 1 1  34 ILE HB   .  34 . HB   1 1 
        510 1 1 1 1  32 GLU HA   .  32 . HA   1 1 
        510 1 2 1 1  35 LEU HB3  .  35 . HB1  1 1 
        511 1 1 1 1  32 GLU HA   .  32 . HA   1 1 
        511 1 2 1 1  35 LEU HB2  .  35 . HB2  1 1 
        512 1 1 1 1  32 GLU HA   .  32 . HA   1 1 
        512 1 2 1 1  35 LEU MD1  .  35 . HD1* 1 1 
        513 1 1 1 1  32 GLU HA   .  32 . HA   1 1 
        513 1 2 1 1  35 LEU HG   .  35 . HG   1 1 
        514 1 1 1 1  32 GLU HA   .  32 . HA   1 1 
        514 1 2 1 1  35 LEU H    .  35 . HN   1 1 
        515 1 1 1 1  32 GLU QB   .  32 . HB*  1 1 
        515 1 2 1 1  33 LYS H    .  33 . HN   1 1 
        516 1 1 1 1  32 GLU QG   .  32 . HG*  1 1 
        516 1 2 1 1  35 LEU MD1  .  35 . HD1* 1 1 
        517 1 1 1 1  32 GLU H    .  32 . HN   1 1 
        517 1 2 1 1  32 GLU QB   .  32 . HB*  1 1 
        518 1 1 1 1  32 GLU H    .  32 . HN   1 1 
        518 1 2 1 1  32 GLU QG   .  32 . HG*  1 1 
        519 1 1 1 1  32 GLU H    .  32 . HN   1 1 
        519 1 2 1 1  33 LYS H    .  33 . HN   1 1 
        520 1 1 1 1  33 LYS HA   .  33 . HA   1 1 
        520 1 2 1 1  33 LYS QD   .  33 . HD*  1 1 
        521 1 1 1 1  33 LYS HA   .  33 . HA   1 1 
        521 1 2 1 1  33 LYS QE   .  33 . HE*  1 1 
        522 1 1 1 1  33 LYS HA   .  33 . HA   1 1 
        522 1 2 1 1  33 LYS HG3  .  33 . HG1  1 1 
        523 1 1 1 1  33 LYS HA   .  33 . HA   1 1 
        523 1 2 1 1  33 LYS HG2  .  33 . HG2  1 1 
        524 1 1 1 1  33 LYS HA   .  33 . HA   1 1 
        524 1 2 1 1  36 ARG QB   .  36 . HB*  1 1 
        525 1 1 1 1  33 LYS HA   .  33 . HA   1 1 
        525 1 2 1 1  36 ARG QD   .  36 . HD*  1 1 
        526 1 1 1 1  33 LYS HA   .  33 . HA   1 1 
        526 1 2 1 1  36 ARG QG   .  36 . HG*  1 1 
        527 1 1 1 1  33 LYS HA   .  33 . HA   1 1 
        527 1 2 1 1  36 ARG H    .  36 . HN   1 1 
        528 1 1 1 1  33 LYS QB   .  33 . HB*  1 1 
        528 1 2 1 1  33 LYS QE   .  33 . HE*  1 1 
        529 1 1 1 1  33 LYS QB   .  33 . HB*  1 1 
        529 1 2 1 1  34 ILE QG   .  34 . HG1* 1 1 
        530 1 1 1 1  33 LYS QB   .  33 . HB*  1 1 
        530 1 2 1 1  34 ILE H    .  34 . HN   1 1 
        531 1 1 1 1  33 LYS HB3  .  33 . HB1  1 1 
        531 1 2 1 1  33 LYS QD   .  33 . HD*  1 1 
        532 1 1 1 1  33 LYS HB2  .  33 . HB2  1 1 
        532 1 2 1 1  33 LYS QD   .  33 . HD*  1 1 
        533 1 1 1 1  33 LYS QE   .  33 . HE*  1 1 
        533 1 2 1 1  33 LYS QG   .  33 . HG*  1 1 
        534 1 1 1 1  33 LYS QG   .  33 . HG*  1 1 
        534 1 2 1 1  36 ARG QD   .  36 . HD*  1 1 
        535 1 1 1 1  33 LYS H    .  33 . HN   1 1 
        535 1 2 1 1  33 LYS QB   .  33 . HB*  1 1 
        536 1 1 1 1  33 LYS H    .  33 . HN   1 1 
        536 1 2 1 1  33 LYS QD   .  33 . HD*  1 1 
        537 1 1 1 1  33 LYS H    .  33 . HN   1 1 
        537 1 2 1 1  33 LYS QG   .  33 . HG*  1 1 
        538 1 1 1 1  33 LYS H    .  33 . HN   1 1 
        538 1 2 1 1  34 ILE H    .  34 . HN   1 1 
        539 1 1 1 1  34 ILE HA   .  34 . HA   1 1 
        539 1 2 1 1  37 TRP HD1  .  37 . HD1  1 1 
        540 1 1 1 1  34 ILE HA   .  34 . HA   1 1 
        540 1 2 1 1  37 TRP HE1  .  37 . HE1  1 1 
        541 1 1 1 1  34 ILE HA   .  34 . HA   1 1 
        541 1 2 1 1  37 TRP HZ2  .  37 . HZ2  1 1 
        542 1 1 1 1  34 ILE HB   .  34 . HB   1 1 
        542 1 2 1 1  35 LEU HG   .  35 . HG   1 1 
        543 1 1 1 1  34 ILE HB   .  34 . HB   1 1 
        543 1 2 1 1  35 LEU H    .  35 . HN   1 1 
        544 1 1 1 1  34 ILE HB   .  34 . HB   1 1 
        544 1 2 1 1  42 ALA MB   .  42 . HB*  1 1 
        545 1 1 1 1  34 ILE MD   .  34 . HD1* 1 1 
        545 1 2 1 1  42 ALA MB   .  42 . HB*  1 1 
        546 1 1 1 1  34 ILE QG   .  34 . HG1* 1 1 
        546 1 2 1 1  37 TRP HZ2  .  37 . HZ2  1 1 
        547 1 1 1 1  34 ILE HG13 .  34 . HG11 1 1 
        547 1 2 1 1  37 TRP HE1  .  37 . HE1  1 1 
        548 1 1 1 1  34 ILE HG12 .  34 . HG12 1 1 
        548 1 2 1 1  37 TRP HE1  .  37 . HE1  1 1 
        549 1 1 1 1  34 ILE HG13 .  34 . HG11 1 1 
        549 1 2 1 1  34 ILE MG   .  34 . HG2* 1 1 
        550 1 1 1 1  34 ILE HG12 .  34 . HG12 1 1 
        550 1 2 1 1  34 ILE MG   .  34 . HG2* 1 1 
        551 1 1 1 1  34 ILE MG   .  34 . HG2* 1 1 
        551 1 2 1 1  35 LEU HA   .  35 . HA   1 1 
        552 1 1 1 1  34 ILE MG   .  34 . HG2* 1 1 
        552 1 2 1 1  35 LEU HG   .  35 . HG   1 1 
        553 1 1 1 1  34 ILE MG   .  34 . HG2* 1 1 
        553 1 2 1 1  35 LEU H    .  35 . HN   1 1 
        554 1 1 1 1  34 ILE MG   .  34 . HG2* 1 1 
        554 1 2 1 1  37 TRP HD1  .  37 . HD1  1 1 
        555 1 1 1 1  34 ILE MG   .  34 . HG2* 1 1 
        555 1 2 1 1  37 TRP HE1  .  37 . HE1  1 1 
        556 1 1 1 1  34 ILE MG   .  34 . HG2* 1 1 
        556 1 2 1 1  37 TRP H    .  37 . HN   1 1 
        557 1 1 1 1  34 ILE MG   .  34 . HG2* 1 1 
        557 1 2 1 1  37 TRP HZ2  .  37 . HZ2  1 1 
        558 1 1 1 1  34 ILE MG   .  34 . HG2* 1 1 
        558 1 2 1 1  38 MET QB   .  38 . HB*  1 1 
        559 1 1 1 1  34 ILE MG   .  34 . HG2* 1 1 
        559 1 2 1 1  38 MET H    .  38 . HN   1 1 
        560 1 1 1 1  34 ILE MG   .  34 . HG2* 1 1 
        560 1 2 1 1  42 ALA MB   .  42 . HB*  1 1 
        561 1 1 1 1  34 ILE H    .  34 . HN   1 1 
        561 1 2 1 1  34 ILE HB   .  34 . HB   1 1 
        562 1 1 1 1  34 ILE H    .  34 . HN   1 1 
        562 1 2 1 1  34 ILE MD   .  34 . HD1* 1 1 
        563 1 1 1 1  34 ILE H    .  34 . HN   1 1 
        563 1 2 1 1  34 ILE HG13 .  34 . HG11 1 1 
        564 1 1 1 1  34 ILE H    .  34 . HN   1 1 
        564 1 2 1 1  34 ILE HG12 .  34 . HG12 1 1 
        565 1 1 1 1  34 ILE H    .  34 . HN   1 1 
        565 1 2 1 1  34 ILE MG   .  34 . HG2* 1 1 
        566 1 1 1 1  34 ILE H    .  34 . HN   1 1 
        566 1 2 1 1  35 LEU H    .  35 . HN   1 1 
        567 1 1 1 1  35 LEU HA   .  35 . HA   1 1 
        567 1 2 1 1  35 LEU MD1  .  35 . HD1* 1 1 
        568 1 1 1 1  35 LEU HA   .  35 . HA   1 1 
        568 1 2 1 1  35 LEU MD2  .  35 . HD2* 1 1 
        569 1 1 1 1  35 LEU HA   .  35 . HA   1 1 
        569 1 2 1 1  37 TRP H    .  37 . HN   1 1 
        570 1 1 1 1  35 LEU HA   .  35 . HA   1 1 
        570 1 2 1 1  38 MET H    .  38 . HN   1 1 
        571 1 1 1 1  35 LEU HB3  .  35 . HB1  1 1 
        571 1 2 1 1  35 LEU MD1  .  35 . HD1* 1 1 
        572 1 1 1 1  35 LEU HB3  .  35 . HB1  1 1 
        572 1 2 1 1  35 LEU MD2  .  35 . HD2* 1 1 
        573 1 1 1 1  35 LEU HB3  .  35 . HB1  1 1 
        573 1 2 1 1  36 ARG H    .  36 . HN   1 1 
        574 1 1 1 1  35 LEU HB2  .  35 . HB2  1 1 
        574 1 2 1 1  35 LEU MD1  .  35 . HD1* 1 1 
        575 1 1 1 1  35 LEU HB2  .  35 . HB2  1 1 
        575 1 2 1 1  35 LEU MD2  .  35 . HD2* 1 1 
        576 1 1 1 1  35 LEU HB2  .  35 . HB2  1 1 
        576 1 2 1 1  36 ARG H    .  36 . HN   1 1 
        577 1 1 1 1  35 LEU MD1  .  35 . HD1* 1 1 
        577 1 2 1 1  41 GLU HA   .  41 . HA   1 1 
        578 1 1 1 1  35 LEU MD1  .  35 . HD1* 1 1 
        578 1 2 1 1  41 GLU QG   .  41 . HG*  1 1 
        579 1 1 1 1  35 LEU MD1  .  35 . HD1* 1 1 
        579 1 2 1 1  41 GLU H    .  41 . HN   1 1 
        580 1 1 1 1  35 LEU MD1  .  35 . HD1* 1 1 
        580 1 2 1 1  42 ALA H    .  42 . HN   1 1 
        581 1 1 1 1  35 LEU MD2  .  35 . HD2* 1 1 
        581 1 2 1 1  39 GLY QA   .  39 . HA*  1 1 
        582 1 1 1 1  35 LEU MD2  .  35 . HD2* 1 1 
        582 1 2 1 1  40 THR HA   .  40 . HA   1 1 
        583 1 1 1 1  35 LEU MD2  .  35 . HD2* 1 1 
        583 1 2 1 1  40 THR H    .  40 . HN   1 1 
        584 1 1 1 1  35 LEU MD2  .  35 . HD2* 1 1 
        584 1 2 1 1  41 GLU HA   .  41 . HA   1 1 
        585 1 1 1 1  35 LEU MD2  .  35 . HD2* 1 1 
        585 1 2 1 1  41 GLU H    .  41 . HN   1 1 
        586 1 1 1 1  35 LEU MD2  .  35 . HD2* 1 1 
        586 1 2 1 1  42 ALA MB   .  42 . HB*  1 1 
        587 1 1 1 1  35 LEU MD2  .  35 . HD2* 1 1 
        587 1 2 1 1  42 ALA H    .  42 . HN   1 1 
        588 1 1 1 1  35 LEU HG   .  35 . HG   1 1 
        588 1 2 1 1  42 ALA MB   .  42 . HB*  1 1 
        589 1 1 1 1  35 LEU H    .  35 . HN   1 1 
        589 1 2 1 1  35 LEU QB   .  35 . HB*  1 1 
        590 1 1 1 1  35 LEU H    .  35 . HN   1 1 
        590 1 2 1 1  35 LEU MD1  .  35 . HD1* 1 1 
        591 1 1 1 1  35 LEU H    .  35 . HN   1 1 
        591 1 2 1 1  35 LEU MD2  .  35 . HD2* 1 1 
        592 1 1 1 1  35 LEU H    .  35 . HN   1 1 
        592 1 2 1 1  35 LEU HG   .  35 . HG   1 1 
        593 1 1 1 1  35 LEU H    .  35 . HN   1 1 
        593 1 2 1 1  36 ARG H    .  36 . HN   1 1 
        594 1 1 1 1  35 LEU H    .  35 . HN   1 1 
        594 1 2 1 1  42 ALA MB   .  42 . HB*  1 1 
        595 1 1 1 1  36 ARG HA   .  36 . HA   1 1 
        595 1 2 1 1  36 ARG QD   .  36 . HD*  1 1 
        596 1 1 1 1  36 ARG HA   .  36 . HA   1 1 
        596 1 2 1 1  36 ARG HG3  .  36 . HG1  1 1 
        597 1 1 1 1  36 ARG HA   .  36 . HA   1 1 
        597 1 2 1 1  36 ARG HG2  .  36 . HG2  1 1 
        598 1 1 1 1  36 ARG QB   .  36 . HB*  1 1 
        598 1 2 1 1  36 ARG QD   .  36 . HD*  1 1 
        599 1 1 1 1  36 ARG QB   .  36 . HB*  1 1 
        599 1 2 1 1 137 VAL MG1  . 137 . HG1* 1 1 
        600 1 1 1 1  36 ARG QB   .  36 . HB*  1 1 
        600 1 2 1 1 137 VAL MG2  . 137 . HG2* 1 1 
        601 1 1 1 1  36 ARG HB3  .  36 . HB1  1 1 
        601 1 2 1 1  37 TRP HD1  .  37 . HD1  1 1 
        602 1 1 1 1  36 ARG HB3  .  36 . HB1  1 1 
        602 1 2 1 1  37 TRP H    .  37 . HN   1 1 
        603 1 1 1 1  36 ARG HB2  .  36 . HB2  1 1 
        603 1 2 1 1  37 TRP HD1  .  37 . HD1  1 1 
        604 1 1 1 1  36 ARG HB2  .  36 . HB2  1 1 
        604 1 2 1 1  37 TRP H    .  37 . HN   1 1 
        605 1 1 1 1  36 ARG QD   .  36 . HD*  1 1 
        605 1 2 1 1 137 VAL MG1  . 137 . HG1* 1 1 
        606 1 1 1 1  36 ARG QD   .  36 . HD*  1 1 
        606 1 2 1 1 137 VAL MG2  . 137 . HG2* 1 1 
        607 1 1 1 1  36 ARG QG   .  36 . HG*  1 1 
        607 1 2 1 1  37 TRP H    .  37 . HN   1 1 
        608 1 1 1 1  36 ARG QG   .  36 . HG*  1 1 
        608 1 2 1 1 137 VAL MG2  . 137 . HG2* 1 1 
        609 1 1 1 1  36 ARG H    .  36 . HN   1 1 
        609 1 2 1 1  36 ARG HB3  .  36 . HB1  1 1 
        610 1 1 1 1  36 ARG H    .  36 . HN   1 1 
        610 1 2 1 1  36 ARG HB2  .  36 . HB2  1 1 
        611 1 1 1 1  36 ARG H    .  36 . HN   1 1 
        611 1 2 1 1  36 ARG QD   .  36 . HD*  1 1 
        612 1 1 1 1  36 ARG H    .  36 . HN   1 1 
        612 1 2 1 1  36 ARG QG   .  36 . HG*  1 1 
        613 1 1 1 1  36 ARG H    .  36 . HN   1 1 
        613 1 2 1 1  37 TRP HD1  .  37 . HD1  1 1 
        614 1 1 1 1  36 ARG H    .  36 . HN   1 1 
        614 1 2 1 1  37 TRP H    .  37 . HN   1 1 
        615 1 1 1 1  37 TRP HA   .  37 . HA   1 1 
        615 1 2 1 1 137 VAL MG2  . 137 . HG2* 1 1 
        616 1 1 1 1  37 TRP HA   .  37 . HA   1 1 
        616 1 2 1 1 143 PRO HG3  . 143 . HG1  1 1 
        617 1 1 1 1  37 TRP HA   .  37 . HA   1 1 
        617 1 2 1 1 143 PRO HG2  . 143 . HG2  1 1 
        618 1 1 1 1  37 TRP QB   .  37 . HB*  1 1 
        618 1 2 1 1 133 ARG QB   . 133 . HB*  1 1 
        619 1 1 1 1  37 TRP QB   .  37 . HB*  1 1 
        619 1 2 1 1 134 LEU HA   . 134 . HA   1 1 
        620 1 1 1 1  37 TRP HB3  .  37 . HB1  1 1 
        620 1 2 1 1 137 VAL MG1  . 137 . HG1* 1 1 
        621 1 1 1 1  37 TRP HB3  .  37 . HB1  1 1 
        621 1 2 1 1 137 VAL MG2  . 137 . HG2* 1 1 
        622 1 1 1 1  37 TRP HB2  .  37 . HB2  1 1 
        622 1 2 1 1 137 VAL MG1  . 137 . HG1* 1 1 
        623 1 1 1 1  37 TRP HB2  .  37 . HB2  1 1 
        623 1 2 1 1 137 VAL MG2  . 137 . HG2* 1 1 
        624 1 1 1 1  37 TRP HD1  .  37 . HD1  1 1 
        624 1 2 1 1  38 MET H    .  38 . HN   1 1 
        625 1 1 1 1  37 TRP HD1  .  37 . HD1  1 1 
        625 1 2 1 1 134 LEU MD1  . 134 . HD1* 1 1 
        626 1 1 1 1  37 TRP HD1  .  37 . HD1  1 1 
        626 1 2 1 1 137 VAL HB   . 137 . HB   1 1 
        627 1 1 1 1  37 TRP HD1  .  37 . HD1  1 1 
        627 1 2 1 1 137 VAL MG1  . 137 . HG1* 1 1 
        628 1 1 1 1  37 TRP HD1  .  37 . HD1  1 1 
        628 1 2 1 1 137 VAL MG2  . 137 . HG2* 1 1 
        629 1 1 1 1  37 TRP HE1  .  37 . HE1  1 1 
        629 1 2 1 1 134 LEU MD1  . 134 . HD1* 1 1 
        630 1 1 1 1  37 TRP HE3  .  37 . HE3  1 1 
        630 1 2 1 1 133 ARG QB   . 133 . HB*  1 1 
        631 1 1 1 1  37 TRP HE3  .  37 . HE3  1 1 
        631 1 2 1 1 133 ARG QG   . 133 . HG*  1 1 
        632 1 1 1 1  37 TRP H    .  37 . HN   1 1 
        632 1 2 1 1  37 TRP HD1  .  37 . HD1  1 1 
        633 1 1 1 1  37 TRP H    .  37 . HN   1 1 
        633 1 2 1 1  38 MET H    .  38 . HN   1 1 
        634 1 1 1 1  37 TRP H    .  37 . HN   1 1 
        634 1 2 1 1 137 VAL MG1  . 137 . HG1* 1 1 
        635 1 1 1 1  37 TRP H    .  37 . HN   1 1 
        635 1 2 1 1 137 VAL MG2  . 137 . HG2* 1 1 
        636 1 1 1 1  38 MET HA   .  38 . HA   1 1 
        636 1 2 1 1  38 MET QG   .  38 . HG*  1 1 
        637 1 1 1 1  38 MET HA   .  38 . HA   1 1 
        637 1 2 1 1  39 GLY H    .  39 . HN   1 1 
        638 1 1 1 1  38 MET QB   .  38 . HB*  1 1 
        638 1 2 1 1  39 GLY H    .  39 . HN   1 1 
        639 1 1 1 1  38 MET QG   .  38 . HG*  1 1 
        639 1 2 1 1  39 GLY H    .  39 . HN   1 1 
        640 1 1 1 1  38 MET H    .  38 . HN   1 1 
        640 1 2 1 1  38 MET QG   .  38 . HG*  1 1 
        641 1 1 1 1  38 MET H    .  38 . HN   1 1 
        641 1 2 1 1  39 GLY H    .  39 . HN   1 1 
        642 1 1 1 1  39 GLY QA   .  39 . HA*  1 1 
        642 1 2 1 1  41 GLU H    .  41 . HN   1 1 
        643 1 1 1 1  40 THR HA   .  40 . HA   1 1 
        643 1 2 1 1  40 THR MG   .  40 . HG2* 1 1 
        644 1 1 1 1  40 THR HB   .  40 . HB   1 1 
        644 1 2 1 1  41 GLU H    .  41 . HN   1 1 
        645 1 1 1 1  40 THR MG   .  40 . HG2* 1 1 
        645 1 2 1 1  41 GLU H    .  41 . HN   1 1 
        646 1 1 1 1  40 THR H    .  40 . HN   1 1 
        646 1 2 1 1  40 THR MG   .  40 . HG2* 1 1 
        647 1 1 1 1  40 THR H    .  40 . HN   1 1 
        647 1 2 1 1  41 GLU H    .  41 . HN   1 1 
        648 1 1 1 1  41 GLU HA   .  41 . HA   1 1 
        648 1 2 1 1  41 GLU QG   .  41 . HG*  1 1 
        649 1 1 1 1  41 GLU HA   .  41 . HA   1 1 
        649 1 2 1 1  42 ALA H    .  42 . HN   1 1 
        650 1 1 1 1  41 GLU QB   .  41 . HB*  1 1 
        650 1 2 1 1  42 ALA H    .  42 . HN   1 1 
        651 1 1 1 1  41 GLU QB   .  41 . HB*  1 1 
        651 1 2 1 1  55 ASN QB   .  55 . HB*  1 1 
        652 1 1 1 1  41 GLU QB   .  41 . HB*  1 1 
        652 1 2 1 1  55 ASN H    .  55 . HN   1 1 
        653 1 1 1 1  41 GLU QG   .  41 . HG*  1 1 
        653 1 2 1 1  42 ALA H    .  42 . HN   1 1 
        654 1 1 1 1  41 GLU H    .  41 . HN   1 1 
        654 1 2 1 1  41 GLU QG   .  41 . HG*  1 1 
        655 1 1 1 1  41 GLU H    .  41 . HN   1 1 
        655 1 2 1 1  55 ASN QB   .  55 . HB*  1 1 
        656 1 1 1 1  41 GLU H    .  41 . HN   1 1 
        656 1 2 1 1  55 ASN H    .  55 . HN   1 1 
        657 1 1 1 1  42 ALA HA   .  42 . HA   1 1 
        657 1 2 1 1  54 VAL HA   .  54 . HA   1 1 
        658 1 1 1 1  42 ALA HA   .  42 . HA   1 1 
        658 1 2 1 1  54 VAL MG1  .  54 . HG1* 1 1 
        659 1 1 1 1  42 ALA HA   .  42 . HA   1 1 
        659 1 2 1 1  54 VAL MG2  .  54 . HG2* 1 1 
        660 1 1 1 1  42 ALA HA   .  42 . HA   1 1 
        660 1 2 1 1  55 ASN H    .  55 . HN   1 1 
        661 1 1 1 1  42 ALA MB   .  42 . HB*  1 1 
        661 1 2 1 1  43 GLU H    .  43 . HN   1 1 
        662 1 1 1 1  42 ALA MB   .  42 . HB*  1 1 
        662 1 2 1 1  54 VAL HA   .  54 . HA   1 1 
        663 1 1 1 1  42 ALA MB   .  42 . HB*  1 1 
        663 1 2 1 1  54 VAL HB   .  54 . HB   1 1 
        664 1 1 1 1  42 ALA MB   .  42 . HB*  1 1 
        664 1 2 1 1  54 VAL QG   .  54 . HG*  1 1 
        665 1 1 1 1  42 ALA MB   .  42 . HB*  1 1 
        665 1 2 1 1  55 ASN H    .  55 . HN   1 1 
        666 1 1 1 1  42 ALA H    .  42 . HN   1 1 
        666 1 2 1 1  42 ALA MB   .  42 . HB*  1 1 
        667 1 1 1 1  43 GLU HA   .  43 . HA   1 1 
        667 1 2 1 1  43 GLU QG   .  43 . HG*  1 1 
        668 1 1 1 1  43 GLU QG   .  43 . HG*  1 1 
        668 1 2 1 1  44 VAL H    .  44 . HN   1 1 
        669 1 1 1 1  43 GLU QG   .  43 . HG*  1 1 
        669 1 2 1 1  51 LEU QD   .  51 . HD*  1 1 
        670 1 1 1 1  44 VAL HA   .  44 . HA   1 1 
        670 1 2 1 1  44 VAL MG1  .  44 . HG1* 1 1 
        671 1 1 1 1  44 VAL MG1  .  44 . HG1* 1 1 
        671 1 2 1 1  45 GLU H    .  45 . HN   1 1 
        672 1 1 1 1  44 VAL MG1  .  44 . HG1* 1 1 
        672 1 2 1 1  46 PRO QD   .  46 . HD*  1 1 
        673 1 1 1 1  44 VAL MG2  .  44 . HG2* 1 1 
        673 1 2 1 1  45 GLU H    .  45 . HN   1 1 
        674 1 1 1 1  44 VAL H    .  44 . HN   1 1 
        674 1 2 1 1  44 VAL MG1  .  44 . HG1* 1 1 
        675 1 1 1 1  44 VAL H    .  44 . HN   1 1 
        675 1 2 1 1  44 VAL MG2  .  44 . HG2* 1 1 
        676 1 1 1 1  45 GLU HA   .  45 . HA   1 1 
        676 1 2 1 1  45 GLU QG   .  45 . HG*  1 1 
        677 1 1 1 1  45 GLU HA   .  45 . HA   1 1 
        677 1 2 1 1  46 PRO QD   .  46 . HD*  1 1 
        678 1 1 1 1  45 GLU QB   .  45 . HB*  1 1 
        678 1 2 1 1  50 GLY QA   .  50 . HA*  1 1 
        679 1 1 1 1  45 GLU QB   .  45 . HB*  1 1 
        679 1 2 1 1  50 GLY H    .  50 . HN   1 1 
        680 1 1 1 1  45 GLU QB   .  45 . HB*  1 1 
        680 1 2 1 1  51 LEU H    .  51 . HN   1 1 
        681 1 1 1 1  45 GLU QG   .  45 . HG*  1 1 
        681 1 2 1 1  51 LEU H    .  51 . HN   1 1 
        682 1 1 1 1  45 GLU H    .  45 . HN   1 1 
        682 1 2 1 1  45 GLU QG   .  45 . HG*  1 1 
        683 1 1 1 1  47 GLU QB   .  47 . HB*  1 1 
        683 1 2 1 1  48 PRO QD   .  48 . HD*  1 1 
        684 1 1 1 1  47 GLU H    .  47 . HN   1 1 
        684 1 2 1 1  47 GLU QG   .  47 . HG*  1 1 
        685 1 1 1 1  48 PRO HA   .  48 . HA   1 1 
        685 1 2 1 1  49 GLY H    .  49 . HN   1 1 
        686 1 1 1 1  48 PRO HA   .  48 . HA   1 1 
        686 1 2 1 1  50 GLY H    .  50 . HN   1 1 
        687 1 1 1 1  48 PRO QB   .  48 . HB*  1 1 
        687 1 2 1 1  49 GLY H    .  49 . HN   1 1 
        688 1 1 1 1  49 GLY H    .  49 . HN   1 1 
        688 1 2 1 1  50 GLY H    .  50 . HN   1 1 
        689 1 1 1 1  50 GLY QA   .  50 . HA*  1 1 
        689 1 2 1 1  51 LEU QB   .  51 . HB*  1 1 
        690 1 1 1 1  50 GLY H    .  50 . HN   1 1 
        690 1 2 1 1  51 LEU H    .  51 . HN   1 1 
        691 1 1 1 1  51 LEU HA   .  51 . HA   1 1 
        691 1 2 1 1  51 LEU QD   .  51 . HD*  1 1 
        692 1 1 1 1  51 LEU QB   .  51 . HB*  1 1 
        692 1 2 1 1  51 LEU MD1  .  51 . HD1* 1 1 
        693 1 1 1 1  51 LEU QB   .  51 . HB*  1 1 
        693 1 2 1 1  51 LEU MD2  .  51 . HD2* 1 1 
        694 1 1 1 1  51 LEU QB   .  51 . HB*  1 1 
        694 1 2 1 1  52 TYR H    .  52 . HN   1 1 
        695 1 1 1 1  51 LEU QD   .  51 . HD*  1 1 
        695 1 2 1 1  52 TYR H    .  52 . HN   1 1 
        696 1 1 1 1  51 LEU H    .  51 . HN   1 1 
        696 1 2 1 1  51 LEU QB   .  51 . HB*  1 1 
        697 1 1 1 1  51 LEU H    .  51 . HN   1 1 
        697 1 2 1 1  51 LEU MD1  .  51 . HD1* 1 1 
        698 1 1 1 1  51 LEU H    .  51 . HN   1 1 
        698 1 2 1 1  51 LEU MD2  .  51 . HD2* 1 1 
        699 1 1 1 1  51 LEU H    .  51 . HN   1 1 
        699 1 2 1 1  51 LEU HG   .  51 . HG   1 1 
        700 1 1 1 1  53 LEU HA   .  53 . HA   1 1 
        700 1 2 1 1  53 LEU MD1  .  53 . HD1* 1 1 
        701 1 1 1 1  53 LEU QB   .  53 . HB*  1 1 
        701 1 2 1 1  53 LEU MD2  .  53 . HD2* 1 1 
        702 1 1 1 1  53 LEU MD1  .  53 . HD1* 1 1 
        702 1 2 1 1  54 VAL H    .  54 . HN   1 1 
        703 1 1 1 1  53 LEU MD1  .  53 . HD1* 1 1 
        703 1 2 1 1  61 PHE QB   .  61 . HB*  1 1 
        704 1 1 1 1  53 LEU MD1  .  53 . HD1* 1 1 
        704 1 2 1 1  61 PHE QD   .  61 . HD*  1 1 
        705 1 1 1 1  53 LEU MD2  .  53 . HD2* 1 1 
        705 1 2 1 1  54 VAL H    .  54 . HN   1 1 
        706 1 1 1 1  53 LEU H    .  53 . HN   1 1 
        706 1 2 1 1  53 LEU MD1  .  53 . HD1* 1 1 
        707 1 1 1 1  54 VAL HA   .  54 . HA   1 1 
        707 1 2 1 1  54 VAL MG1  .  54 . HG1* 1 1 
        708 1 1 1 1  54 VAL HA   .  54 . HA   1 1 
        708 1 2 1 1  54 VAL MG2  .  54 . HG2* 1 1 
        709 1 1 1 1  54 VAL HA   .  54 . HA   1 1 
        709 1 2 1 1  55 ASN H    .  55 . HN   1 1 
        710 1 1 1 1  54 VAL QG   .  54 . HG*  1 1 
        710 1 2 1 1  55 ASN H    .  55 . HN   1 1 
        711 1 1 1 1  55 ASN QB   .  55 . HB*  1 1 
        711 1 2 1 1  56 VAL H    .  56 . HN   1 1 
        712 1 1 1 1  56 VAL HA   .  56 . HA   1 1 
        712 1 2 1 1  56 VAL MG1  .  56 . HG1* 1 1 
        713 1 1 1 1  56 VAL HA   .  56 . HA   1 1 
        713 1 2 1 1  56 VAL MG2  .  56 . HG2* 1 1 
        714 1 1 1 1  56 VAL QG   .  56 . HG*  1 1 
        714 1 2 1 1  57 THR H    .  57 . HN   1 1 
        715 1 1 1 1  57 THR HA   .  57 . HA   1 1 
        715 1 2 1 1  57 THR MG   .  57 . HG2* 1 1 
        716 1 1 1 1  57 THR MG   .  57 . HG2* 1 1 
        716 1 2 1 1  58 GLY H    .  58 . HN   1 1 
        717 1 1 1 1  57 THR H    .  57 . HN   1 1 
        717 1 2 1 1  58 GLY H    .  58 . HN   1 1 
        718 1 1 1 1  58 GLY QA   .  58 . HA*  1 1 
        718 1 2 1 1  59 ALA MB   .  59 . HB*  1 1 
        719 1 1 1 1  58 GLY H    .  58 . HN   1 1 
        719 1 2 1 1  59 ALA MB   .  59 . HB*  1 1 
        720 1 1 1 1  59 ALA MB   .  59 . HB*  1 1 
        720 1 2 1 1  60 ARG H    .  60 . HN   1 1 
        721 1 1 1 1  59 ALA H    .  59 . HN   1 1 
        721 1 2 1 1  60 ARG H    .  60 . HN   1 1 
        722 1 1 1 1  60 ARG HA   .  60 . HA   1 1 
        722 1 2 1 1  60 ARG QD   .  60 . HD*  1 1 
        723 1 1 1 1  60 ARG QB   .  60 . HB*  1 1 
        723 1 2 1 1  61 PHE H    .  61 . HN   1 1 
        724 1 1 1 1  61 PHE H    .  61 . HN   1 1 
        724 1 2 1 1  61 PHE QD   .  61 . HD*  1 1 
        725 1 1 1 1  62 ALA HA   .  62 . HA   1 1 
        725 1 2 1 1  63 ARG H    .  63 . HN   1 1 
        726 1 1 1 1  62 ALA MB   .  62 . HB*  1 1 
        726 1 2 1 1  63 ARG H    .  63 . HN   1 1 
        727 1 1 1 1  65 SER HA   .  65 . HA   1 1 
        727 1 2 1 1  66 PHE QD   .  66 . HD*  1 1 
        728 1 1 1 1  65 SER QB   .  65 . HB*  1 1 
        728 1 2 1 1  66 PHE H    .  66 . HN   1 1 
        729 1 1 1 1  66 PHE HA   .  66 . HA   1 1 
        729 1 2 1 1  66 PHE QD   .  66 . HD*  1 1 
        730 1 1 1 1  66 PHE HA   .  66 . HA   1 1 
        730 1 2 1 1  68 GLU H    .  68 . HN   1 1 
        731 1 1 1 1  66 PHE QB   .  66 . HB*  1 1 
        731 1 2 1 1  68 GLU H    .  68 . HN   1 1 
        732 1 1 1 1  66 PHE QB   .  66 . HB*  1 1 
        732 1 2 1 1  69 VAL MG2  .  69 . HG2* 1 1 
        733 1 1 1 1  66 PHE QD   .  66 . HD*  1 1 
        733 1 2 1 1  69 VAL MG1  .  69 . HG1* 1 1 
        734 1 1 1 1  66 PHE QD   .  66 . HD*  1 1 
        734 1 2 1 1  69 VAL MG2  .  69 . HG2* 1 1 
        735 1 1 1 1  66 PHE QD   .  66 . HD*  1 1 
        735 1 2 1 1  75 LEU QD   .  75 . HD*  1 1 
        736 1 1 1 1  66 PHE H    .  66 . HN   1 1 
        736 1 2 1 1  66 PHE QD   .  66 . HD*  1 1 
        737 1 1 1 1  67 ARG HA   .  67 . HA   1 1 
        737 1 2 1 1  67 ARG QG   .  67 . HG*  1 1 
        738 1 1 1 1  67 ARG QB   .  67 . HB*  1 1 
        738 1 2 1 1  68 GLU H    .  68 . HN   1 1 
        739 1 1 1 1  67 ARG QD   .  67 . HD*  1 1 
        739 1 2 1 1  76 ALA MB   .  76 . HB*  1 1 
        740 1 1 1 1  67 ARG QD   .  67 . HD*  1 1 
        740 1 2 1 1  93 LEU MD1  .  93 . HD1* 1 1 
        741 1 1 1 1  67 ARG QD   .  67 . HD*  1 1 
        741 1 2 1 1  93 LEU MD2  .  93 . HD2* 1 1 
        742 1 1 1 1  67 ARG QD   .  67 . HD*  1 1 
        742 1 2 1 1  93 LEU HG   .  93 . HG   1 1 
        743 1 1 1 1  67 ARG QG   .  67 . HG*  1 1 
        743 1 2 1 1  68 GLU H    .  68 . HN   1 1 
        744 1 1 1 1  67 ARG QG   .  67 . HG*  1 1 
        744 1 2 1 1  77 TYR HA   .  77 . HA   1 1 
        745 1 1 1 1  67 ARG QG   .  67 . HG*  1 1 
        745 1 2 1 1  78 SER H    .  78 . HN   1 1 
        746 1 1 1 1  67 ARG QG   .  67 . HG*  1 1 
        746 1 2 1 1  93 LEU MD1  .  93 . HD1* 1 1 
        747 1 1 1 1  67 ARG H    .  67 . HN   1 1 
        747 1 2 1 1  67 ARG QG   .  67 . HG*  1 1 
        748 1 1 1 1  67 ARG H    .  67 . HN   1 1 
        748 1 2 1 1  68 GLU H    .  68 . HN   1 1 
        749 1 1 1 1  67 ARG H    .  67 . HN   1 1 
        749 1 2 1 1  77 TYR HA   .  77 . HA   1 1 
        750 1 1 1 1  68 GLU HA   .  68 . HA   1 1 
        750 1 2 1 1  69 VAL H    .  69 . HN   1 1 
        751 1 1 1 1  68 GLU HB3  .  68 . HB1  1 1 
        751 1 2 1 1  69 VAL H    .  69 . HN   1 1 
        752 1 1 1 1  68 GLU HB3  .  68 . HB1  1 1 
        752 1 2 1 1  70 VAL MG2  .  70 . HG2* 1 1 
        753 1 1 1 1  68 GLU HB3  .  68 . HB1  1 1 
        753 1 2 1 1  76 ALA MB   .  76 . HB*  1 1 
        754 1 1 1 1  68 GLU HB3  .  68 . HB1  1 1 
        754 1 2 1 1  76 ALA H    .  76 . HN   1 1 
        755 1 1 1 1  68 GLU HB2  .  68 . HB2  1 1 
        755 1 2 1 1  69 VAL H    .  69 . HN   1 1 
        756 1 1 1 1  68 GLU HB2  .  68 . HB2  1 1 
        756 1 2 1 1  70 VAL MG2  .  70 . HG2* 1 1 
        757 1 1 1 1  68 GLU HB2  .  68 . HB2  1 1 
        757 1 2 1 1  76 ALA MB   .  76 . HB*  1 1 
        758 1 1 1 1  68 GLU HB2  .  68 . HB2  1 1 
        758 1 2 1 1  76 ALA H    .  76 . HN   1 1 
        759 1 1 1 1  68 GLU QG   .  68 . HG*  1 1 
        759 1 2 1 1  69 VAL H    .  69 . HN   1 1 
        760 1 1 1 1  68 GLU QG   .  68 . HG*  1 1 
        760 1 2 1 1  76 ALA MB   .  76 . HB*  1 1 
        761 1 1 1 1  68 GLU H    .  68 . HN   1 1 
        761 1 2 1 1  68 GLU QG   .  68 . HG*  1 1 
        762 1 1 1 1  68 GLU H    .  68 . HN   1 1 
        762 1 2 1 1  76 ALA MB   .  76 . HB*  1 1 
        763 1 1 1 1  68 GLU H    .  68 . HN   1 1 
        763 1 2 1 1  76 ALA H    .  76 . HN   1 1 
        764 1 1 1 1  68 GLU H    .  68 . HN   1 1 
        764 1 2 1 1  77 TYR HA   .  77 . HA   1 1 
        765 1 1 1 1  69 VAL HA   .  69 . HA   1 1 
        765 1 2 1 1  69 VAL MG1  .  69 . HG1* 1 1 
        766 1 1 1 1  69 VAL HA   .  69 . HA   1 1 
        766 1 2 1 1  69 VAL MG2  .  69 . HG2* 1 1 
        767 1 1 1 1  69 VAL HA   .  69 . HA   1 1 
        767 1 2 1 1  70 VAL H    .  70 . HN   1 1 
        768 1 1 1 1  69 VAL HA   .  69 . HA   1 1 
        768 1 2 1 1  75 LEU HA   .  75 . HA   1 1 
        769 1 1 1 1  69 VAL HA   .  69 . HA   1 1 
        769 1 2 1 1  75 LEU QD   .  75 . HD*  1 1 
        770 1 1 1 1  69 VAL HA   .  69 . HA   1 1 
        770 1 2 1 1  76 ALA H    .  76 . HN   1 1 
        771 1 1 1 1  69 VAL HB   .  69 . HB   1 1 
        771 1 2 1 1  70 VAL H    .  70 . HN   1 1 
        772 1 1 1 1  69 VAL HB   .  69 . HB   1 1 
        772 1 2 1 1  75 LEU QD   .  75 . HD*  1 1 
        773 1 1 1 1  69 VAL MG1  .  69 . HG1* 1 1 
        773 1 2 1 1  70 VAL HA   .  70 . HA   1 1 
        774 1 1 1 1  69 VAL MG1  .  69 . HG1* 1 1 
        774 1 2 1 1  70 VAL H    .  70 . HN   1 1 
        775 1 1 1 1  69 VAL MG1  .  69 . HG1* 1 1 
        775 1 2 1 1  75 LEU HA   .  75 . HA   1 1 
        776 1 1 1 1  69 VAL MG1  .  69 . HG1* 1 1 
        776 1 2 1 1  75 LEU QD   .  75 . HD*  1 1 
        777 1 1 1 1  69 VAL MG2  .  69 . HG2* 1 1 
        777 1 2 1 1  70 VAL H    .  70 . HN   1 1 
        778 1 1 1 1  69 VAL MG2  .  69 . HG2* 1 1 
        778 1 2 1 1  75 LEU HA   .  75 . HA   1 1 
        779 1 1 1 1  69 VAL MG2  .  69 . HG2* 1 1 
        779 1 2 1 1  75 LEU HB3  .  75 . HB1  1 1 
        780 1 1 1 1  69 VAL MG2  .  69 . HG2* 1 1 
        780 1 2 1 1  75 LEU HB2  .  75 . HB2  1 1 
        781 1 1 1 1  69 VAL MG2  .  69 . HG2* 1 1 
        781 1 2 1 1  75 LEU QD   .  75 . HD*  1 1 
        782 1 1 1 1  69 VAL MG2  .  69 . HG2* 1 1 
        782 1 2 1 1  76 ALA H    .  76 . HN   1 1 
        783 1 1 1 1  69 VAL H    .  69 . HN   1 1 
        783 1 2 1 1  69 VAL HB   .  69 . HB   1 1 
        784 1 1 1 1  69 VAL H    .  69 . HN   1 1 
        784 1 2 1 1  69 VAL MG1  .  69 . HG1* 1 1 
        785 1 1 1 1  69 VAL H    .  69 . HN   1 1 
        785 1 2 1 1  69 VAL MG2  .  69 . HG2* 1 1 
        786 1 1 1 1  70 VAL HA   .  70 . HA   1 1 
        786 1 2 1 1  70 VAL MG1  .  70 . HG1* 1 1 
        787 1 1 1 1  70 VAL HA   .  70 . HA   1 1 
        787 1 2 1 1  70 VAL MG2  .  70 . HG2* 1 1 
        788 1 1 1 1  70 VAL HA   .  70 . HA   1 1 
        788 1 2 1 1  71 PRO QD   .  71 . HD*  1 1 
        789 1 1 1 1  70 VAL HA   .  70 . HA   1 1 
        789 1 2 1 1  71 PRO QG   .  71 . HG*  1 1 
        790 1 1 1 1  70 VAL HB   .  70 . HB   1 1 
        790 1 2 1 1  73 HIS H    .  73 . HN   1 1 
        791 1 1 1 1  70 VAL HB   .  70 . HB   1 1 
        791 1 2 1 1  74 ARG QG   .  74 . HG*  1 1 
        792 1 1 1 1  70 VAL HB   .  70 . HB   1 1 
        792 1 2 1 1  74 ARG H    .  74 . HN   1 1 
        793 1 1 1 1  70 VAL MG1  .  70 . HG1* 1 1 
        793 1 2 1 1  71 PRO QD   .  71 . HD*  1 1 
        794 1 1 1 1  70 VAL MG1  .  70 . HG1* 1 1 
        794 1 2 1 1  71 PRO QG   .  71 . HG*  1 1 
        795 1 1 1 1  70 VAL MG1  .  70 . HG1* 1 1 
        795 1 2 1 1  73 HIS QB   .  73 . HB*  1 1 
        796 1 1 1 1  70 VAL MG1  .  70 . HG1* 1 1 
        796 1 2 1 1  73 HIS HD1  .  73 . HD*  1 1 
        796 1 2 1 1  73 HIS HD2  .  73 . HD*  1 1 
        797 1 1 1 1  70 VAL MG1  .  70 . HG1* 1 1 
        797 1 2 1 1  73 HIS H    .  73 . HN   1 1 
        798 1 1 1 1  70 VAL MG1  .  70 . HG1* 1 1 
        798 1 2 1 1  74 ARG H    .  74 . HN   1 1 
        799 1 1 1 1  70 VAL MG2  .  70 . HG2* 1 1 
        799 1 2 1 1  71 PRO QD   .  71 . HD*  1 1 
        800 1 1 1 1  70 VAL MG2  .  70 . HG2* 1 1 
        800 1 2 1 1  73 HIS QB   .  73 . HB*  1 1 
        801 1 1 1 1  70 VAL MG2  .  70 . HG2* 1 1 
        801 1 2 1 1  74 ARG HA   .  74 . HA   1 1 
        802 1 1 1 1  70 VAL MG2  .  70 . HG2* 1 1 
        802 1 2 1 1  74 ARG QB   .  74 . HB*  1 1 
        803 1 1 1 1  70 VAL MG2  .  70 . HG2* 1 1 
        803 1 2 1 1  74 ARG QD   .  74 . HD*  1 1 
        804 1 1 1 1  70 VAL MG2  .  70 . HG2* 1 1 
        804 1 2 1 1  74 ARG QG   .  74 . HG*  1 1 
        805 1 1 1 1  70 VAL MG2  .  70 . HG2* 1 1 
        805 1 2 1 1  74 ARG H    .  74 . HN   1 1 
        806 1 1 1 1  70 VAL MG2  .  70 . HG2* 1 1 
        806 1 2 1 1  75 LEU HA   .  75 . HA   1 1 
        807 1 1 1 1  70 VAL H    .  70 . HN   1 1 
        807 1 2 1 1  70 VAL HB   .  70 . HB   1 1 
        808 1 1 1 1  70 VAL H    .  70 . HN   1 1 
        808 1 2 1 1  70 VAL MG1  .  70 . HG1* 1 1 
        809 1 1 1 1  70 VAL H    .  70 . HN   1 1 
        809 1 2 1 1  70 VAL MG2  .  70 . HG2* 1 1 
        810 1 1 1 1  70 VAL H    .  70 . HN   1 1 
        810 1 2 1 1  71 PRO QD   .  71 . HD*  1 1 
        811 1 1 1 1  70 VAL H    .  70 . HN   1 1 
        811 1 2 1 1  74 ARG H    .  74 . HN   1 1 
        812 1 1 1 1  70 VAL H    .  70 . HN   1 1 
        812 1 2 1 1  75 LEU HA   .  75 . HA   1 1 
        813 1 1 1 1  70 VAL H    .  70 . HN   1 1 
        813 1 2 1 1  75 LEU QD   .  75 . HD*  1 1 
        814 1 1 1 1  71 PRO HB3  .  71 . HB1  1 1 
        814 1 2 1 1  72 VAL MG1  .  72 . HG1* 1 1 
        815 1 1 1 1  71 PRO HB2  .  71 . HB2  1 1 
        815 1 2 1 1  72 VAL MG1  .  72 . HG1* 1 1 
        816 1 1 1 1  72 VAL HA   .  72 . HA   1 1 
        816 1 2 1 1  72 VAL MG1  .  72 . HG1* 1 1 
        817 1 1 1 1  72 VAL HA   .  72 . HA   1 1 
        817 1 2 1 1  72 VAL MG2  .  72 . HG2* 1 1 
        818 1 1 1 1  72 VAL HB   .  72 . HB   1 1 
        818 1 2 1 1  98 LEU MD1  .  98 . HD1* 1 1 
        819 1 1 1 1  72 VAL MG1  .  72 . HG1* 1 1 
        819 1 2 1 1  73 HIS H    .  73 . HN   1 1 
        820 1 1 1 1  72 VAL MG1  .  72 . HG1* 1 1 
        820 1 2 1 1  98 LEU MD1  .  98 . HD1* 1 1 
        821 1 1 1 1  72 VAL MG2  .  72 . HG2* 1 1 
        821 1 2 1 1  73 HIS H    .  73 . HN   1 1 
        822 1 1 1 1  72 VAL H    .  72 . HN   1 1 
        822 1 2 1 1  72 VAL MG1  .  72 . HG1* 1 1 
        823 1 1 1 1  72 VAL H    .  72 . HN   1 1 
        823 1 2 1 1  72 VAL MG2  .  72 . HG2* 1 1 
        824 1 1 1 1  72 VAL H    .  72 . HN   1 1 
        824 1 2 1 1  73 HIS H    .  73 . HN   1 1 
        825 1 1 1 1  73 HIS HA   .  73 . HA   1 1 
        825 1 2 1 1  98 LEU QB   .  98 . HB*  1 1 
        826 1 1 1 1  73 HIS HA   .  73 . HA   1 1 
        826 1 2 1 1  98 LEU MD1  .  98 . HD1* 1 1 
        827 1 1 1 1  73 HIS HA   .  73 . HA   1 1 
        827 1 2 1 1  98 LEU MD2  .  98 . HD2* 1 1 
        828 1 1 1 1  73 HIS HA   .  73 . HA   1 1 
        828 1 2 1 1  98 LEU HG   .  98 . HG   1 1 
        829 1 1 1 1  73 HIS HA   .  73 . HA   1 1 
        829 1 2 1 1  98 LEU H    .  98 . HN   1 1 
        830 1 1 1 1  73 HIS QB   .  73 . HB*  1 1 
        830 1 2 1 1  74 ARG H    .  74 . HN   1 1 
        831 1 1 1 1  73 HIS QB   .  73 . HB*  1 1 
        831 1 2 1 1  98 LEU H    .  98 . HN   1 1 
        832 1 1 1 1  73 HIS HD1  .  73 . HD*  1 1 
        832 1 1 1 1  73 HIS HD2  .  73 . HD*  1 1 
        832 1 2 1 1  74 ARG H    .  74 . HN   1 1 
        833 1 1 1 1  73 HIS H    .  73 . HN   1 1 
        833 1 2 1 1  73 HIS QB   .  73 . HB*  1 1 
        834 1 1 1 1  73 HIS H    .  73 . HN   1 1 
        834 1 2 1 1  74 ARG H    .  74 . HN   1 1 
        835 1 1 1 1  74 ARG HA   .  74 . HA   1 1 
        835 1 2 1 1  74 ARG QD   .  74 . HD*  1 1 
        836 1 1 1 1  74 ARG HA   .  74 . HA   1 1 
        836 1 2 1 1  75 LEU H    .  75 . HN   1 1 
        837 1 1 1 1  74 ARG HA   .  74 . HA   1 1 
        837 1 2 1 1  96 ILE MG   .  96 . HG2* 1 1 
        838 1 1 1 1  74 ARG HA   .  74 . HA   1 1 
        838 1 2 1 1  98 LEU H    .  98 . HN   1 1 
        839 1 1 1 1  74 ARG QB   .  74 . HB*  1 1 
        839 1 2 1 1  74 ARG QD   .  74 . HD*  1 1 
        840 1 1 1 1  74 ARG QB   .  74 . HB*  1 1 
        840 1 2 1 1  75 LEU H    .  75 . HN   1 1 
        841 1 1 1 1  74 ARG HB3  .  74 . HB1  1 1 
        841 1 2 1 1  97 ASP HA   .  97 . HA   1 1 
        842 1 1 1 1  74 ARG HB2  .  74 . HB2  1 1 
        842 1 2 1 1  97 ASP HA   .  97 . HA   1 1 
        843 1 1 1 1  74 ARG QD   .  74 . HD*  1 1 
        843 1 2 1 1  75 LEU H    .  75 . HN   1 1 
        844 1 1 1 1  74 ARG QD   .  74 . HD*  1 1 
        844 1 2 1 1  97 ASP HA   .  97 . HA   1 1 
        845 1 1 1 1  74 ARG QD   .  74 . HD*  1 1 
        845 1 2 1 1  97 ASP QB   .  97 . HB*  1 1 
        846 1 1 1 1  74 ARG QG   .  74 . HG*  1 1 
        846 1 2 1 1  75 LEU H    .  75 . HN   1 1 
        847 1 1 1 1  74 ARG H    .  74 . HN   1 1 
        847 1 2 1 1  74 ARG QG   .  74 . HG*  1 1 
        848 1 1 1 1  74 ARG H    .  74 . HN   1 1 
        848 1 2 1 1  75 LEU H    .  75 . HN   1 1 
        849 1 1 1 1  75 LEU HA   .  75 . HA   1 1 
        849 1 2 1 1  75 LEU QD   .  75 . HD*  1 1 
        850 1 1 1 1  75 LEU HA   .  75 . HA   1 1 
        850 1 2 1 1  76 ALA H    .  76 . HN   1 1 
        851 1 1 1 1  75 LEU QB   .  75 . HB*  1 1 
        851 1 2 1 1  76 ALA H    .  76 . HN   1 1 
        852 1 1 1 1  75 LEU QB   .  75 . HB*  1 1 
        852 1 2 1 1  96 ILE H    .  96 . HN   1 1 
        853 1 1 1 1  75 LEU QD   .  75 . HD*  1 1 
        853 1 2 1 1  76 ALA H    .  76 . HN   1 1 
        854 1 1 1 1  75 LEU QD   .  75 . HD*  1 1 
        854 1 2 1 1  77 TYR QD   .  77 . HD*  1 1 
        855 1 1 1 1  75 LEU H    .  75 . HN   1 1 
        855 1 2 1 1  75 LEU QB   .  75 . HB*  1 1 
        856 1 1 1 1  75 LEU H    .  75 . HN   1 1 
        856 1 2 1 1  75 LEU QD   .  75 . HD*  1 1 
        857 1 1 1 1  75 LEU H    .  75 . HN   1 1 
        857 1 2 1 1  76 ALA H    .  76 . HN   1 1 
        858 1 1 1 1  75 LEU H    .  75 . HN   1 1 
        858 1 2 1 1  96 ILE HB   .  96 . HB   1 1 
        859 1 1 1 1  75 LEU H    .  75 . HN   1 1 
        859 1 2 1 1  96 ILE MD   .  96 . HD1* 1 1 
        860 1 1 1 1  75 LEU H    .  75 . HN   1 1 
        860 1 2 1 1  96 ILE MG   .  96 . HG2* 1 1 
        861 1 1 1 1  75 LEU H    .  75 . HN   1 1 
        861 1 2 1 1  96 ILE H    .  96 . HN   1 1 
        862 1 1 1 1  75 LEU H    .  75 . HN   1 1 
        862 1 2 1 1  97 ASP HA   .  97 . HA   1 1 
        863 1 1 1 1  76 ALA HA   .  76 . HA   1 1 
        863 1 2 1 1  77 TYR H    .  77 . HN   1 1 
        864 1 1 1 1  76 ALA HA   .  76 . HA   1 1 
        864 1 2 1 1  95 GLU HA   .  95 . HA   1 1 
        865 1 1 1 1  76 ALA HA   .  76 . HA   1 1 
        865 1 2 1 1  95 GLU QB   .  95 . HB*  1 1 
        866 1 1 1 1  76 ALA HA   .  76 . HA   1 1 
        866 1 2 1 1  95 GLU QG   .  95 . HG*  1 1 
        867 1 1 1 1  76 ALA HA   .  76 . HA   1 1 
        867 1 2 1 1  96 ILE H    .  96 . HN   1 1 
        868 1 1 1 1  76 ALA MB   .  76 . HB*  1 1 
        868 1 2 1 1  77 TYR H    .  77 . HN   1 1 
        869 1 1 1 1  76 ALA MB   .  76 . HB*  1 1 
        869 1 2 1 1  93 LEU MD1  .  93 . HD1* 1 1 
        870 1 1 1 1  76 ALA MB   .  76 . HB*  1 1 
        870 1 2 1 1  93 LEU MD2  .  93 . HD2* 1 1 
        871 1 1 1 1  76 ALA MB   .  76 . HB*  1 1 
        871 1 2 1 1  95 GLU HA   .  95 . HA   1 1 
        872 1 1 1 1  76 ALA MB   .  76 . HB*  1 1 
        872 1 2 1 1  95 GLU QB   .  95 . HB*  1 1 
        873 1 1 1 1  76 ALA MB   .  76 . HB*  1 1 
        873 1 2 1 1  95 GLU QG   .  95 . HG*  1 1 
        874 1 1 1 1  77 TYR HA   .  77 . HA   1 1 
        874 1 2 1 1  77 TYR QD   .  77 . HD*  1 1 
        875 1 1 1 1  77 TYR QD   .  77 . HD*  1 1 
        875 1 2 1 1  78 SER H    .  78 . HN   1 1 
        876 1 1 1 1  77 TYR H    .  77 . HN   1 1 
        876 1 2 1 1  77 TYR QD   .  77 . HD*  1 1 
        877 1 1 1 1  77 TYR H    .  77 . HN   1 1 
        877 1 2 1 1  93 LEU MD1  .  93 . HD1* 1 1 
        878 1 1 1 1  77 TYR H    .  77 . HN   1 1 
        878 1 2 1 1  94 VAL HB   .  94 . HB   1 1 
        879 1 1 1 1  77 TYR H    .  77 . HN   1 1 
        879 1 2 1 1  94 VAL MG1  .  94 . HG1* 1 1 
        880 1 1 1 1  77 TYR H    .  77 . HN   1 1 
        880 1 2 1 1  94 VAL H    .  94 . HN   1 1 
        881 1 1 1 1  77 TYR H    .  77 . HN   1 1 
        881 1 2 1 1  95 GLU HA   .  95 . HA   1 1 
        882 1 1 1 1  77 TYR H    .  77 . HN   1 1 
        882 1 2 1 1  95 GLU QG   .  95 . HG*  1 1 
        883 1 1 1 1  78 SER HA   .  78 . HA   1 1 
        883 1 2 1 1  93 LEU MD1  .  93 . HD1* 1 1 
        884 1 1 1 1  78 SER HA   .  78 . HA   1 1 
        884 1 2 1 1  94 VAL H    .  94 . HN   1 1 
        885 1 1 1 1  78 SER QB   .  78 . HB*  1 1 
        885 1 2 1 1  93 LEU HA   .  93 . HA   1 1 
        886 1 1 1 1  79 PHE QB   .  79 . HB*  1 1 
        886 1 2 1 1  94 VAL MG2  .  94 . HG2* 1 1 
        887 1 1 1 1  79 PHE H    .  79 . HN   1 1 
        887 1 2 1 1  93 LEU HA   .  93 . HA   1 1 
        888 1 1 1 1  80 GLY QA   .  80 . HA*  1 1 
        888 1 2 1 1  87 VAL MG1  .  87 . HG1* 1 1 
        889 1 1 1 1  81 TRP HA   .  81 . HA   1 1 
        889 1 2 1 1  82 ASP H    .  82 . HN   1 1 
        890 1 1 1 1  81 TRP QB   .  81 . HB*  1 1 
        890 1 2 1 1  82 ASP H    .  82 . HN   1 1 
        891 1 1 1 1  81 TRP H    .  81 . HN   1 1 
        891 1 2 1 1  81 TRP HD1  .  81 . HD1  1 1 
        892 1 1 1 1  81 TRP H    .  81 . HN   1 1 
        892 1 2 1 1  82 ASP H    .  82 . HN   1 1 
        893 1 1 1 1  81 TRP H    .  81 . HN   1 1 
        893 1 2 1 1  87 VAL HB   .  87 . HB   1 1 
        894 1 1 1 1  81 TRP H    .  81 . HN   1 1 
        894 1 2 1 1  87 VAL MG1  .  87 . HG1* 1 1 
        895 1 1 1 1  82 ASP H    .  82 . HN   1 1 
        895 1 2 1 1  82 ASP QB   .  82 . HB*  1 1 
        896 1 1 1 1  83 GLY H    .  83 . HN   1 1 
        896 1 2 1 1  84 SER H    .  84 . HN   1 1 
        897 1 1 1 1  84 SER HA   .  84 . HA   1 1 
        897 1 2 1 1  85 GLU H    .  85 . HN   1 1 
        898 1 1 1 1  84 SER QB   .  84 . HB*  1 1 
        898 1 2 1 1  86 VAL H    .  86 . HN   1 1 
        899 1 1 1 1  84 SER H    .  84 . HN   1 1 
        899 1 2 1 1  84 SER HG   .  84 . HG   1 1 
        900 1 1 1 1  85 GLU HA   .  85 . HA   1 1 
        900 1 2 1 1  85 GLU QG   .  85 . HG*  1 1 
        901 1 1 1 1  85 GLU HB3  .  85 . HB1  1 1 
        901 1 2 1 1  86 VAL H    .  86 . HN   1 1 
        902 1 1 1 1  85 GLU HB2  .  85 . HB2  1 1 
        902 1 2 1 1  86 VAL H    .  86 . HN   1 1 
        903 1 1 1 1  85 GLU QG   .  85 . HG*  1 1 
        903 1 2 1 1  86 VAL H    .  86 . HN   1 1 
        904 1 1 1 1  85 GLU H    .  85 . HN   1 1 
        904 1 2 1 1  85 GLU QB   .  85 . HB*  1 1 
        905 1 1 1 1  85 GLU H    .  85 . HN   1 1 
        905 1 2 1 1  85 GLU QG   .  85 . HG*  1 1 
        906 1 1 1 1  85 GLU H    .  85 . HN   1 1 
        906 1 2 1 1  86 VAL H    .  86 . HN   1 1 
        907 1 1 1 1  86 VAL HA   .  86 . HA   1 1 
        907 1 2 1 1  86 VAL MG1  .  86 . HG1* 1 1 
        908 1 1 1 1  86 VAL HA   .  86 . HA   1 1 
        908 1 2 1 1  86 VAL MG2  .  86 . HG2* 1 1 
        909 1 1 1 1  86 VAL HB   .  86 . HB   1 1 
        909 1 2 1 1  87 VAL H    .  87 . HN   1 1 
        910 1 1 1 1  86 VAL QG   .  86 . HG*  1 1 
        910 1 2 1 1  87 VAL H    .  87 . HN   1 1 
        911 1 1 1 1  86 VAL MG1  .  86 . HG1* 1 1 
        911 1 2 1 1  87 VAL H    .  87 . HN   1 1 
        912 1 1 1 1  86 VAL MG2  .  86 . HG2* 1 1 
        912 1 2 1 1  87 VAL H    .  87 . HN   1 1 
        913 1 1 1 1  86 VAL H    .  86 . HN   1 1 
        913 1 2 1 1  86 VAL QG   .  86 . HG*  1 1 
        914 1 1 1 1  86 VAL H    .  86 . HN   1 1 
        914 1 2 1 1  86 VAL MG1  .  86 . HG1* 1 1 
        915 1 1 1 1  86 VAL H    .  86 . HN   1 1 
        915 1 2 1 1  86 VAL MG2  .  86 . HG2* 1 1 
        916 1 1 1 1  86 VAL H    .  86 . HN   1 1 
        916 1 2 1 1  87 VAL H    .  87 . HN   1 1 
        917 1 1 1 1  87 VAL HA   .  87 . HA   1 1 
        917 1 2 1 1  87 VAL MG1  .  87 . HG1* 1 1 
        918 1 1 1 1  87 VAL HA   .  87 . HA   1 1 
        918 1 2 1 1  87 VAL MG2  .  87 . HG2* 1 1 
        919 1 1 1 1  87 VAL HA   .  87 . HA   1 1 
        919 1 2 1 1  88 PRO QD   .  88 . HD*  1 1 
        920 1 1 1 1  87 VAL MG1  .  87 . HG1* 1 1 
        920 1 2 1 1  88 PRO QD   .  88 . HD*  1 1 
        921 1 1 1 1  87 VAL MG1  .  87 . HG1* 1 1 
        921 1 2 1 1  91 SER HG   .  91 . HG   1 1 
        922 1 1 1 1  87 VAL MG1  .  87 . HG1* 1 1 
        922 1 2 1 1 114 LEU MD2  . 114 . HD2* 1 1 
        923 1 1 1 1  87 VAL MG1  .  87 . HG1* 1 1 
        923 1 2 1 1 115 PRO QD   . 115 . HD*  1 1 
        924 1 1 1 1  87 VAL MG2  .  87 . HG2* 1 1 
        924 1 2 1 1  88 PRO QD   .  88 . HD*  1 1 
        925 1 1 1 1  87 VAL MG2  .  87 . HG2* 1 1 
        925 1 2 1 1 114 LEU MD2  . 114 . HD2* 1 1 
        926 1 1 1 1  87 VAL MG2  .  87 . HG2* 1 1 
        926 1 2 1 1 115 PRO HD3  . 115 . HD1  1 1 
        927 1 1 1 1  87 VAL MG2  .  87 . HG2* 1 1 
        927 1 2 1 1 115 PRO HD2  . 115 . HD2  1 1 
        928 1 1 1 1  87 VAL MG2  .  87 . HG2* 1 1 
        928 1 2 1 1 115 PRO QG   . 115 . HG*  1 1 
        929 1 1 1 1  87 VAL H    .  87 . HN   1 1 
        929 1 2 1 1  87 VAL MG1  .  87 . HG1* 1 1 
        930 1 1 1 1  87 VAL H    .  87 . HN   1 1 
        930 1 2 1 1  87 VAL MG2  .  87 . HG2* 1 1 
        931 1 1 1 1  88 PRO HA   .  88 . HA   1 1 
        931 1 2 1 1  89 PRO QD   .  89 . HD*  1 1 
        932 1 1 1 1  88 PRO QB   .  88 . HB*  1 1 
        932 1 2 1 1  89 PRO QD   .  89 . HD*  1 1 
        933 1 1 1 1  88 PRO HB3  .  88 . HB1  1 1 
        933 1 2 1 1  89 PRO HD3  .  89 . HD1  1 1 
        934 1 1 1 1  88 PRO HB2  .  88 . HB2  1 1 
        934 1 2 1 1  89 PRO HD3  .  89 . HD1  1 1 
        935 1 1 1 1  88 PRO HB2  .  88 . HB2  1 1 
        935 1 2 1 1  89 PRO HD2  .  89 . HD2  1 1 
        936 1 1 1 1  88 PRO QD   .  88 . HD*  1 1 
        936 1 2 1 1  91 SER QB   .  91 . HB*  1 1 
        937 1 1 1 1  89 PRO HA   .  89 . HA   1 1 
        937 1 2 1 1  90 GLY H    .  90 . HN   1 1 
        938 1 1 1 1  90 GLY H    .  90 . HN   1 1 
        938 1 2 1 1  91 SER H    .  91 . HN   1 1 
        939 1 1 1 1  91 SER HG   .  91 . HG   1 1 
        939 1 2 1 1  92 SER H    .  92 . HN   1 1 
        940 1 1 1 1  91 SER H    .  91 . HN   1 1 
        940 1 2 1 1  91 SER QB   .  91 . HB*  1 1 
        941 1 1 1 1  91 SER H    .  91 . HN   1 1 
        941 1 2 1 1  91 SER HG   .  91 . HG   1 1 
        942 1 1 1 1  91 SER H    .  91 . HN   1 1 
        942 1 2 1 1  92 SER H    .  92 . HN   1 1 
        943 1 1 1 1  92 SER HA   .  92 . HA   1 1 
        943 1 2 1 1  93 LEU H    .  93 . HN   1 1 
        944 1 1 1 1  92 SER HA   .  92 . HA   1 1 
        944 1 2 1 1 113 GLY QA   . 113 . HA*  1 1 
        945 1 1 1 1  92 SER HA   .  92 . HA   1 1 
        945 1 2 1 1 114 LEU MD2  . 114 . HD2* 1 1 
        946 1 1 1 1  92 SER QB   .  92 . HB*  1 1 
        946 1 2 1 1  93 LEU H    .  93 . HN   1 1 
        947 1 1 1 1  92 SER QB   .  92 . HB*  1 1 
        947 1 2 1 1 111 HIS HE1  . 111 . HE1  1 1 
        948 1 1 1 1  92 SER QB   .  92 . HB*  1 1 
        948 1 2 1 1 114 LEU MD2  . 114 . HD2* 1 1 
        949 1 1 1 1  92 SER HB3  .  92 . HB1  1 1 
        949 1 2 1 1 111 HIS HD1  . 111 . HD*  1 1 
        949 1 2 1 1 111 HIS HD2  . 111 . HD*  1 1 
        950 1 1 1 1  92 SER HB2  .  92 . HB2  1 1 
        950 1 2 1 1 111 HIS HD1  . 111 . HD*  1 1 
        950 1 2 1 1 111 HIS HD2  . 111 . HD*  1 1 
        951 1 1 1 1  93 LEU HA   .  93 . HA   1 1 
        951 1 2 1 1  93 LEU MD1  .  93 . HD1* 1 1 
        952 1 1 1 1  93 LEU HA   .  93 . HA   1 1 
        952 1 2 1 1  93 LEU MD2  .  93 . HD2* 1 1 
        953 1 1 1 1  93 LEU HA   .  93 . HA   1 1 
        953 1 2 1 1  94 VAL H    .  94 . HN   1 1 
        954 1 1 1 1  93 LEU HA   .  93 . HA   1 1 
        954 1 2 1 1 112 SER H    . 112 . HN   1 1 
        955 1 1 1 1  93 LEU QB   .  93 . HB*  1 1 
        955 1 2 1 1 112 SER QB   . 112 . HB*  1 1 
        956 1 1 1 1  93 LEU QB   .  93 . HB*  1 1 
        956 1 2 1 1 112 SER H    . 112 . HN   1 1 
        957 1 1 1 1  93 LEU HB3  .  93 . HB1  1 1 
        957 1 2 1 1  93 LEU MD1  .  93 . HD1* 1 1 
        958 1 1 1 1  93 LEU HB3  .  93 . HB1  1 1 
        958 1 2 1 1  93 LEU MD2  .  93 . HD2* 1 1 
        959 1 1 1 1  93 LEU HB2  .  93 . HB2  1 1 
        959 1 2 1 1  93 LEU MD1  .  93 . HD1* 1 1 
        960 1 1 1 1  93 LEU HB2  .  93 . HB2  1 1 
        960 1 2 1 1  93 LEU MD2  .  93 . HD2* 1 1 
        961 1 1 1 1  93 LEU MD1  .  93 . HD1* 1 1 
        961 1 2 1 1  94 VAL H    .  94 . HN   1 1 
        962 1 1 1 1  93 LEU MD1  .  93 . HD1* 1 1 
        962 1 2 1 1  95 GLU QG   .  95 . HG*  1 1 
        963 1 1 1 1  93 LEU MD2  .  93 . HD2* 1 1 
        963 1 2 1 1  94 VAL H    .  94 . HN   1 1 
        964 1 1 1 1  93 LEU MD2  .  93 . HD2* 1 1 
        964 1 2 1 1  95 GLU QG   .  95 . HG*  1 1 
        965 1 1 1 1  93 LEU HG   .  93 . HG   1 1 
        965 1 2 1 1  94 VAL H    .  94 . HN   1 1 
        966 1 1 1 1  93 LEU HG   .  93 . HG   1 1 
        966 1 2 1 1  95 GLU QG   .  95 . HG*  1 1 
        967 1 1 1 1  93 LEU H    .  93 . HN   1 1 
        967 1 2 1 1  93 LEU HB3  .  93 . HB1  1 1 
        968 1 1 1 1  93 LEU H    .  93 . HN   1 1 
        968 1 2 1 1  93 LEU HB2  .  93 . HB2  1 1 
        969 1 1 1 1  93 LEU H    .  93 . HN   1 1 
        969 1 2 1 1  93 LEU MD1  .  93 . HD1* 1 1 
        970 1 1 1 1  93 LEU H    .  93 . HN   1 1 
        970 1 2 1 1  93 LEU MD2  .  93 . HD2* 1 1 
        971 1 1 1 1  93 LEU H    .  93 . HN   1 1 
        971 1 2 1 1 111 HIS HD1  . 111 . HD*  1 1 
        971 1 2 1 1 111 HIS HD2  . 111 . HD*  1 1 
        972 1 1 1 1  93 LEU H    .  93 . HN   1 1 
        972 1 2 1 1 112 SER H    . 112 . HN   1 1 
        973 1 1 1 1  93 LEU H    .  93 . HN   1 1 
        973 1 2 1 1 113 GLY QA   . 113 . HA*  1 1 
        974 1 1 1 1  94 VAL HA   .  94 . HA   1 1 
        974 1 2 1 1  95 GLU H    .  95 . HN   1 1 
        975 1 1 1 1  94 VAL HA   .  94 . HA   1 1 
        975 1 2 1 1 111 HIS HA   . 111 . HA   1 1 
        976 1 1 1 1  94 VAL HA   .  94 . HA   1 1 
        976 1 2 1 1 111 HIS HD1  . 111 . HD*  1 1 
        976 1 2 1 1 111 HIS HD2  . 111 . HD*  1 1 
        977 1 1 1 1  94 VAL MG1  .  94 . HG1* 1 1 
        977 1 2 1 1  95 GLU H    .  95 . HN   1 1 
        978 1 1 1 1  94 VAL MG1  .  94 . HG1* 1 1 
        978 1 2 1 1  96 ILE MD   .  96 . HD1* 1 1 
        979 1 1 1 1  94 VAL MG1  .  94 . HG1* 1 1 
        979 1 2 1 1  96 ILE HG13 .  96 . HG11 1 1 
        980 1 1 1 1  94 VAL MG1  .  94 . HG1* 1 1 
        980 1 2 1 1  96 ILE HG12 .  96 . HG12 1 1 
        981 1 1 1 1  94 VAL MG1  .  94 . HG1* 1 1 
        981 1 2 1 1  96 ILE H    .  96 . HN   1 1 
        982 1 1 1 1  94 VAL MG1  .  94 . HG1* 1 1 
        982 1 2 1 1 109 LEU MD1  . 109 . HD1* 1 1 
        983 1 1 1 1  94 VAL MG1  .  94 . HG1* 1 1 
        983 1 2 1 1 109 LEU MD2  . 109 . HD2* 1 1 
        984 1 1 1 1  94 VAL MG1  .  94 . HG1* 1 1 
        984 1 2 1 1 127 TRP HZ2  . 127 . HZ2  1 1 
        985 1 1 1 1  94 VAL MG2  .  94 . HG2* 1 1 
        985 1 2 1 1  95 GLU H    .  95 . HN   1 1 
        986 1 1 1 1  94 VAL MG2  .  94 . HG2* 1 1 
        986 1 2 1 1 111 HIS HA   . 111 . HA   1 1 
        987 1 1 1 1  94 VAL MG2  .  94 . HG2* 1 1 
        987 1 2 1 1 111 HIS HD1  . 111 . HD*  1 1 
        987 1 2 1 1 111 HIS HD2  . 111 . HD*  1 1 
        988 1 1 1 1  94 VAL MG2  .  94 . HG2* 1 1 
        988 1 2 1 1 127 TRP HZ2  . 127 . HZ2  1 1 
        989 1 1 1 1  94 VAL H    .  94 . HN   1 1 
        989 1 2 1 1  94 VAL MG2  .  94 . HG2* 1 1 
        990 1 1 1 1  95 GLU HA   .  95 . HA   1 1 
        990 1 2 1 1  96 ILE H    .  96 . HN   1 1 
        991 1 1 1 1  95 GLU QB   .  95 . HB*  1 1 
        991 1 2 1 1  96 ILE H    .  96 . HN   1 1 
        992 1 1 1 1  95 GLU QB   .  95 . HB*  1 1 
        992 1 2 1 1 110 THR HB   . 110 . HB   1 1 
        993 1 1 1 1  95 GLU H    .  95 . HN   1 1 
        993 1 2 1 1  95 GLU QG   .  95 . HG*  1 1 
        994 1 1 1 1  95 GLU H    .  95 . HN   1 1 
        994 1 2 1 1  96 ILE H    .  96 . HN   1 1 
        995 1 1 1 1  95 GLU H    .  95 . HN   1 1 
        995 1 2 1 1 109 LEU MD2  . 109 . HD2* 1 1 
        996 1 1 1 1  95 GLU H    .  95 . HN   1 1 
        996 1 2 1 1 109 LEU HG   . 109 . HG   1 1 
        997 1 1 1 1  95 GLU H    .  95 . HN   1 1 
        997 1 2 1 1 110 THR HB   . 110 . HB   1 1 
        998 1 1 1 1  95 GLU H    .  95 . HN   1 1 
        998 1 2 1 1 110 THR H    . 110 . HN   1 1 
        999 1 1 1 1  95 GLU H    .  95 . HN   1 1 
        999 1 2 1 1 111 HIS HA   . 111 . HA   1 1 
       1000 1 1 1 1  96 ILE HA   .  96 . HA   1 1 
       1000 1 2 1 1  96 ILE MD   .  96 . HD1* 1 1 
       1001 1 1 1 1  96 ILE HA   .  96 . HA   1 1 
       1001 1 2 1 1  97 ASP H    .  97 . HN   1 1 
       1002 1 1 1 1  96 ILE HB   .  96 . HB   1 1 
       1002 1 2 1 1  96 ILE MD   .  96 . HD1* 1 1 
       1003 1 1 1 1  96 ILE HB   .  96 . HB   1 1 
       1003 1 2 1 1  97 ASP H    .  97 . HN   1 1 
       1004 1 1 1 1  96 ILE MD   .  96 . HD1* 1 1 
       1004 1 2 1 1  97 ASP H    .  97 . HN   1 1 
       1005 1 1 1 1  96 ILE MD   .  96 . HD1* 1 1 
       1005 1 2 1 1 109 LEU MD1  . 109 . HD1* 1 1 
       1006 1 1 1 1  96 ILE QG   .  96 . HG1* 1 1 
       1006 1 2 1 1 109 LEU HG   . 109 . HG   1 1 
       1007 1 1 1 1  96 ILE HG13 .  96 . HG11 1 1 
       1007 1 2 1 1 109 LEU MD1  . 109 . HD1* 1 1 
       1008 1 1 1 1  96 ILE HG12 .  96 . HG12 1 1 
       1008 1 2 1 1 109 LEU MD1  . 109 . HD1* 1 1 
       1009 1 1 1 1  96 ILE QG   .  96 . HG1* 1 1 
       1009 1 2 1 1  96 ILE MG   .  96 . HG2* 1 1 
       1010 1 1 1 1  96 ILE MG   .  96 . HG2* 1 1 
       1010 1 2 1 1  97 ASP HA   .  97 . HA   1 1 
       1011 1 1 1 1  96 ILE MG   .  96 . HG2* 1 1 
       1011 1 2 1 1  97 ASP H    .  97 . HN   1 1 
       1012 1 1 1 1  96 ILE MG   .  96 . HG2* 1 1 
       1012 1 2 1 1  98 LEU MD1  .  98 . HD1* 1 1 
       1013 1 1 1 1  96 ILE MG   .  96 . HG2* 1 1 
       1013 1 2 1 1  98 LEU MD2  .  98 . HD2* 1 1 
       1014 1 1 1 1  96 ILE MG   .  96 . HG2* 1 1 
       1014 1 2 1 1  98 LEU HG   .  98 . HG   1 1 
       1015 1 1 1 1  96 ILE MG   .  96 . HG2* 1 1 
       1015 1 2 1 1 107 LEU HG   . 107 . HG   1 1 
       1016 1 1 1 1  96 ILE MG   .  96 . HG2* 1 1 
       1016 1 2 1 1 108 ARG H    . 108 . HN   1 1 
       1017 1 1 1 1  96 ILE MG   .  96 . HG2* 1 1 
       1017 1 2 1 1 109 LEU MD1  . 109 . HD1* 1 1 
       1018 1 1 1 1  96 ILE H    .  96 . HN   1 1 
       1018 1 2 1 1  96 ILE HB   .  96 . HB   1 1 
       1019 1 1 1 1  96 ILE H    .  96 . HN   1 1 
       1019 1 2 1 1  96 ILE MD   .  96 . HD1* 1 1 
       1020 1 1 1 1  96 ILE H    .  96 . HN   1 1 
       1020 1 2 1 1  96 ILE HG13 .  96 . HG11 1 1 
       1021 1 1 1 1  96 ILE H    .  96 . HN   1 1 
       1021 1 2 1 1  96 ILE HG12 .  96 . HG12 1 1 
       1022 1 1 1 1  96 ILE H    .  96 . HN   1 1 
       1022 1 2 1 1  97 ASP H    .  97 . HN   1 1 
       1023 1 1 1 1  97 ASP HA   .  97 . HA   1 1 
       1023 1 2 1 1  98 LEU H    .  98 . HN   1 1 
       1024 1 1 1 1  97 ASP QB   .  97 . HB*  1 1 
       1024 1 2 1 1  98 LEU H    .  98 . HN   1 1 
       1025 1 1 1 1  97 ASP QB   .  97 . HB*  1 1 
       1025 1 2 1 1  99 ILE MD   .  99 . HD1* 1 1 
       1026 1 1 1 1  97 ASP QB   .  97 . HB*  1 1 
       1026 1 2 1 1  99 ILE QG   .  99 . HG1* 1 1 
       1027 1 1 1 1  97 ASP QB   .  97 . HB*  1 1 
       1027 1 2 1 1 108 ARG QB   . 108 . HB*  1 1 
       1028 1 1 1 1  97 ASP QB   .  97 . HB*  1 1 
       1028 1 2 1 1 108 ARG QD   . 108 . HD*  1 1 
       1029 1 1 1 1  97 ASP QB   .  97 . HB*  1 1 
       1029 1 2 1 1 108 ARG QG   . 108 . HG*  1 1 
       1030 1 1 1 1  97 ASP QB   .  97 . HB*  1 1 
       1030 1 2 1 1 108 ARG H    . 108 . HN   1 1 
       1031 1 1 1 1  97 ASP HB3  .  97 . HB1  1 1 
       1031 1 2 1 1 108 ARG HB3  . 108 . HB1  1 1 
       1032 1 1 1 1  97 ASP HB3  .  97 . HB1  1 1 
       1032 1 2 1 1 108 ARG HB2  . 108 . HB2  1 1 
       1033 1 1 1 1  97 ASP HB2  .  97 . HB2  1 1 
       1033 1 2 1 1 108 ARG HB3  . 108 . HB1  1 1 
       1034 1 1 1 1  97 ASP HB2  .  97 . HB2  1 1 
       1034 1 2 1 1 108 ARG HB2  . 108 . HB2  1 1 
       1035 1 1 1 1  97 ASP H    .  97 . HN   1 1 
       1035 1 2 1 1 108 ARG QB   . 108 . HB*  1 1 
       1036 1 1 1 1  97 ASP H    .  97 . HN   1 1 
       1036 1 2 1 1 108 ARG H    . 108 . HN   1 1 
       1037 1 1 1 1  98 LEU HA   .  98 . HA   1 1 
       1037 1 2 1 1  98 LEU MD1  .  98 . HD1* 1 1 
       1038 1 1 1 1  98 LEU HA   .  98 . HA   1 1 
       1038 1 2 1 1  98 LEU MD2  .  98 . HD2* 1 1 
       1039 1 1 1 1  98 LEU HA   .  98 . HA   1 1 
       1039 1 2 1 1  99 ILE MD   .  99 . HD1* 1 1 
       1040 1 1 1 1  98 LEU HA   .  98 . HA   1 1 
       1040 1 2 1 1  99 ILE H    .  99 . HN   1 1 
       1041 1 1 1 1  98 LEU HA   .  98 . HA   1 1 
       1041 1 2 1 1 105 THR MG   . 105 . HG2* 1 1 
       1042 1 1 1 1  98 LEU HA   .  98 . HA   1 1 
       1042 1 2 1 1 108 ARG H    . 108 . HN   1 1 
       1043 1 1 1 1  98 LEU QB   .  98 . HB*  1 1 
       1043 1 2 1 1  98 LEU MD1  .  98 . HD1* 1 1 
       1044 1 1 1 1  98 LEU QB   .  98 . HB*  1 1 
       1044 1 2 1 1  99 ILE H    .  99 . HN   1 1 
       1045 1 1 1 1  98 LEU HB3  .  98 . HB1  1 1 
       1045 1 2 1 1  98 LEU MD2  .  98 . HD2* 1 1 
       1046 1 1 1 1  98 LEU HB2  .  98 . HB2  1 1 
       1046 1 2 1 1  98 LEU MD2  .  98 . HD2* 1 1 
       1047 1 1 1 1  98 LEU MD1  .  98 . HD1* 1 1 
       1047 1 2 1 1 107 LEU MD1  . 107 . HD1* 1 1 
       1048 1 1 1 1  98 LEU MD2  .  98 . HD2* 1 1 
       1048 1 2 1 1  99 ILE H    .  99 . HN   1 1 
       1049 1 1 1 1  98 LEU MD2  .  98 . HD2* 1 1 
       1049 1 2 1 1 105 THR HB   . 105 . HB   1 1 
       1050 1 1 1 1  98 LEU MD2  .  98 . HD2* 1 1 
       1050 1 2 1 1 107 LEU HA   . 107 . HA   1 1 
       1051 1 1 1 1  98 LEU MD2  .  98 . HD2* 1 1 
       1051 1 2 1 1 107 LEU QB   . 107 . HB*  1 1 
       1052 1 1 1 1  98 LEU MD2  .  98 . HD2* 1 1 
       1052 1 2 1 1 107 LEU MD1  . 107 . HD1* 1 1 
       1053 1 1 1 1  98 LEU MD2  .  98 . HD2* 1 1 
       1053 1 2 1 1 107 LEU HG   . 107 . HG   1 1 
       1054 1 1 1 1  98 LEU MD2  .  98 . HD2* 1 1 
       1054 1 2 1 1 108 ARG H    . 108 . HN   1 1 
       1055 1 1 1 1  98 LEU H    .  98 . HN   1 1 
       1055 1 2 1 1  98 LEU QB   .  98 . HB*  1 1 
       1056 1 1 1 1  98 LEU H    .  98 . HN   1 1 
       1056 1 2 1 1  98 LEU MD1  .  98 . HD1* 1 1 
       1057 1 1 1 1  98 LEU H    .  98 . HN   1 1 
       1057 1 2 1 1  98 LEU HG   .  98 . HG   1 1 
       1058 1 1 1 1  98 LEU H    .  98 . HN   1 1 
       1058 1 2 1 1  99 ILE H    .  99 . HN   1 1 
       1059 1 1 1 1  99 ILE HA   .  99 . HA   1 1 
       1059 1 2 1 1  99 ILE MD   .  99 . HD1* 1 1 
       1060 1 1 1 1  99 ILE HA   .  99 . HA   1 1 
       1060 1 2 1 1  99 ILE HG13 .  99 . HG11 1 1 
       1061 1 1 1 1  99 ILE HA   .  99 . HA   1 1 
       1061 1 2 1 1  99 ILE HG12 .  99 . HG12 1 1 
       1062 1 1 1 1  99 ILE HA   .  99 . HA   1 1 
       1062 1 2 1 1  99 ILE MG   .  99 . HG2* 1 1 
       1063 1 1 1 1  99 ILE HA   .  99 . HA   1 1 
       1063 1 2 1 1 100 GLU H    . 100 . HN   1 1 
       1064 1 1 1 1  99 ILE HB   .  99 . HB   1 1 
       1064 1 2 1 1  99 ILE MD   .  99 . HD1* 1 1 
       1065 1 1 1 1  99 ILE HB   .  99 . HB   1 1 
       1065 1 2 1 1 106 LEU HB3  . 106 . HB1  1 1 
       1066 1 1 1 1  99 ILE HB   .  99 . HB   1 1 
       1066 1 2 1 1 106 LEU HB2  . 106 . HB2  1 1 
       1067 1 1 1 1  99 ILE HB   .  99 . HB   1 1 
       1067 1 2 1 1 106 LEU MD2  . 106 . HD2* 1 1 
       1068 1 1 1 1  99 ILE HB   .  99 . HB   1 1 
       1068 1 2 1 1 106 LEU H    . 106 . HN   1 1 
       1069 1 1 1 1  99 ILE MD   .  99 . HD1* 1 1 
       1069 1 2 1 1 106 LEU MD2  . 106 . HD2* 1 1 
       1070 1 1 1 1  99 ILE MD   .  99 . HD1* 1 1 
       1070 1 2 1 1 108 ARG HA   . 108 . HA   1 1 
       1071 1 1 1 1  99 ILE MD   .  99 . HD1* 1 1 
       1071 1 2 1 1 108 ARG QD   . 108 . HD*  1 1 
       1072 1 1 1 1  99 ILE MD   .  99 . HD1* 1 1 
       1072 1 2 1 1 108 ARG HE   . 108 . HE   1 1 
       1073 1 1 1 1  99 ILE QG   .  99 . HG1* 1 1 
       1073 1 2 1 1 100 GLU H    . 100 . HN   1 1 
       1074 1 1 1 1  99 ILE HG13 .  99 . HG11 1 1 
       1074 1 2 1 1  99 ILE MG   .  99 . HG2* 1 1 
       1075 1 1 1 1  99 ILE HG12 .  99 . HG12 1 1 
       1075 1 2 1 1  99 ILE MG   .  99 . HG2* 1 1 
       1076 1 1 1 1  99 ILE MG   .  99 . HG2* 1 1 
       1076 1 2 1 1 100 GLU H    . 100 . HN   1 1 
       1077 1 1 1 1  99 ILE MG   .  99 . HG2* 1 1 
       1077 1 2 1 1 101 GLN QB   . 101 . HB*  1 1 
       1078 1 1 1 1  99 ILE MG   .  99 . HG2* 1 1 
       1078 1 2 1 1 101 GLN QE   . 101 . HE2* 1 1 
       1079 1 1 1 1  99 ILE MG   .  99 . HG2* 1 1 
       1079 1 2 1 1 101 GLN H    . 101 . HN   1 1 
       1080 1 1 1 1  99 ILE MG   .  99 . HG2* 1 1 
       1080 1 2 1 1 106 LEU QB   . 106 . HB*  1 1 
       1081 1 1 1 1  99 ILE MG   .  99 . HG2* 1 1 
       1081 1 2 1 1 106 LEU MD2  . 106 . HD2* 1 1 
       1082 1 1 1 1  99 ILE MG   .  99 . HG2* 1 1 
       1082 1 2 1 1 106 LEU H    . 106 . HN   1 1 
       1083 1 1 1 1  99 ILE H    .  99 . HN   1 1 
       1083 1 2 1 1  99 ILE HB   .  99 . HB   1 1 
       1084 1 1 1 1  99 ILE H    .  99 . HN   1 1 
       1084 1 2 1 1  99 ILE MD   .  99 . HD1* 1 1 
       1085 1 1 1 1  99 ILE H    .  99 . HN   1 1 
       1085 1 2 1 1  99 ILE HG13 .  99 . HG11 1 1 
       1086 1 1 1 1  99 ILE H    .  99 . HN   1 1 
       1086 1 2 1 1  99 ILE HG12 .  99 . HG12 1 1 
       1087 1 1 1 1  99 ILE H    .  99 . HN   1 1 
       1087 1 2 1 1 105 THR MG   . 105 . HG2* 1 1 
       1088 1 1 1 1  99 ILE H    .  99 . HN   1 1 
       1088 1 2 1 1 106 LEU HA   . 106 . HA   1 1 
       1089 1 1 1 1  99 ILE H    .  99 . HN   1 1 
       1089 1 2 1 1 106 LEU HB3  . 106 . HB1  1 1 
       1090 1 1 1 1  99 ILE H    .  99 . HN   1 1 
       1090 1 2 1 1 106 LEU HB2  . 106 . HB2  1 1 
       1091 1 1 1 1  99 ILE H    .  99 . HN   1 1 
       1091 1 2 1 1 106 LEU HG   . 106 . HG   1 1 
       1092 1 1 1 1  99 ILE H    .  99 . HN   1 1 
       1092 1 2 1 1 106 LEU H    . 106 . HN   1 1 
       1093 1 1 1 1  99 ILE H    .  99 . HN   1 1 
       1093 1 2 1 1 107 LEU HA   . 107 . HA   1 1 
       1094 1 1 1 1  99 ILE H    .  99 . HN   1 1 
       1094 1 2 1 1 107 LEU QB   . 107 . HB*  1 1 
       1095 1 1 1 1 100 GLU HA   . 100 . HA   1 1 
       1095 1 2 1 1 100 GLU QG   . 100 . HG*  1 1 
       1096 1 1 1 1 100 GLU HA   . 100 . HA   1 1 
       1096 1 2 1 1 101 GLN QB   . 101 . HB*  1 1 
       1097 1 1 1 1 100 GLU HA   . 100 . HA   1 1 
       1097 1 2 1 1 101 GLN H    . 101 . HN   1 1 
       1098 1 1 1 1 100 GLU HA   . 100 . HA   1 1 
       1098 1 2 1 1 105 THR HA   . 105 . HA   1 1 
       1099 1 1 1 1 100 GLU HA   . 100 . HA   1 1 
       1099 1 2 1 1 105 THR HB   . 105 . HB   1 1 
       1100 1 1 1 1 100 GLU HA   . 100 . HA   1 1 
       1100 1 2 1 1 105 THR MG   . 105 . HG2* 1 1 
       1101 1 1 1 1 100 GLU HA   . 100 . HA   1 1 
       1101 1 2 1 1 106 LEU H    . 106 . HN   1 1 
       1102 1 1 1 1 100 GLU QB   . 100 . HB*  1 1 
       1102 1 2 1 1 105 THR MG   . 105 . HG2* 1 1 
       1103 1 1 1 1 100 GLU HB3  . 100 . HB1  1 1 
       1103 1 2 1 1 101 GLN H    . 101 . HN   1 1 
       1104 1 1 1 1 100 GLU HB2  . 100 . HB2  1 1 
       1104 1 2 1 1 101 GLN H    . 101 . HN   1 1 
       1105 1 1 1 1 100 GLU QG   . 100 . HG*  1 1 
       1105 1 2 1 1 101 GLN H    . 101 . HN   1 1 
       1106 1 1 1 1 100 GLU QG   . 100 . HG*  1 1 
       1106 1 2 1 1 105 THR MG   . 105 . HG2* 1 1 
       1107 1 1 1 1 100 GLU H    . 100 . HN   1 1 
       1107 1 2 1 1 100 GLU HB3  . 100 . HB1  1 1 
       1108 1 1 1 1 100 GLU H    . 100 . HN   1 1 
       1108 1 2 1 1 100 GLU HB2  . 100 . HB2  1 1 
       1109 1 1 1 1 100 GLU H    . 100 . HN   1 1 
       1109 1 2 1 1 100 GLU QG   . 100 . HG*  1 1 
       1110 1 1 1 1 100 GLU H    . 100 . HN   1 1 
       1110 1 2 1 1 101 GLN H    . 101 . HN   1 1 
       1111 1 1 1 1 101 GLN HA   . 101 . HA   1 1 
       1111 1 2 1 1 101 GLN QG   . 101 . HG*  1 1 
       1112 1 1 1 1 101 GLN HA   . 101 . HA   1 1 
       1112 1 2 1 1 102 GLY QA   . 102 . HA*  1 1 
       1113 1 1 1 1 101 GLN QB   . 101 . HB*  1 1 
       1113 1 2 1 1 101 GLN QE   . 101 . HE2* 1 1 
       1114 1 1 1 1 101 GLN QB   . 101 . HB*  1 1 
       1114 1 2 1 1 105 THR HA   . 105 . HA   1 1 
       1115 1 1 1 1 101 GLN QB   . 101 . HB*  1 1 
       1115 1 2 1 1 106 LEU QB   . 106 . HB*  1 1 
       1116 1 1 1 1 101 GLN QB   . 101 . HB*  1 1 
       1116 1 2 1 1 106 LEU MD2  . 106 . HD2* 1 1 
       1117 1 1 1 1 101 GLN QB   . 101 . HB*  1 1 
       1117 1 2 1 1 106 LEU H    . 106 . HN   1 1 
       1118 1 1 1 1 101 GLN QE   . 101 . HE2* 1 1 
       1118 1 2 1 1 106 LEU QB   . 106 . HB*  1 1 
       1119 1 1 1 1 101 GLN HE21 . 101 . HE21 1 1 
       1119 1 2 1 1 106 LEU MD1  . 106 . HD1* 1 1 
       1120 1 1 1 1 101 GLN HE21 . 101 . HE21 1 1 
       1120 1 2 1 1 106 LEU MD2  . 106 . HD2* 1 1 
       1121 1 1 1 1 101 GLN HE22 . 101 . HE22 1 1 
       1121 1 2 1 1 106 LEU MD1  . 106 . HD1* 1 1 
       1122 1 1 1 1 101 GLN HE22 . 101 . HE22 1 1 
       1122 1 2 1 1 106 LEU MD2  . 106 . HD2* 1 1 
       1123 1 1 1 1 101 GLN H    . 101 . HN   1 1 
       1123 1 2 1 1 101 GLN HB3  . 101 . HB1  1 1 
       1124 1 1 1 1 101 GLN H    . 101 . HN   1 1 
       1124 1 2 1 1 101 GLN HB2  . 101 . HB2  1 1 
       1125 1 1 1 1 101 GLN H    . 101 . HN   1 1 
       1125 1 2 1 1 101 GLN QG   . 101 . HG*  1 1 
       1126 1 1 1 1 101 GLN H    . 101 . HN   1 1 
       1126 1 2 1 1 105 THR HA   . 105 . HA   1 1 
       1127 1 1 1 1 101 GLN H    . 101 . HN   1 1 
       1127 1 2 1 1 106 LEU H    . 106 . HN   1 1 
       1128 1 1 1 1 103 GLY H    . 103 . HN   1 1 
       1128 1 2 1 1 104 GLY H    . 104 . HN   1 1 
       1129 1 1 1 1 104 GLY QA   . 104 . HA*  1 1 
       1129 1 2 1 1 105 THR H    . 105 . HN   1 1 
       1130 1 1 1 1 104 GLY H    . 104 . HN   1 1 
       1130 1 2 1 1 105 THR H    . 105 . HN   1 1 
       1131 1 1 1 1 105 THR HA   . 105 . HA   1 1 
       1131 1 2 1 1 105 THR MG   . 105 . HG2* 1 1 
       1132 1 1 1 1 105 THR HA   . 105 . HA   1 1 
       1132 1 2 1 1 106 LEU H    . 106 . HN   1 1 
       1133 1 1 1 1 105 THR MG   . 105 . HG2* 1 1 
       1133 1 2 1 1 106 LEU H    . 106 . HN   1 1 
       1134 1 1 1 1 105 THR MG   . 105 . HG2* 1 1 
       1134 1 2 1 1 107 LEU HA   . 107 . HA   1 1 
       1135 1 1 1 1 105 THR MG   . 105 . HG2* 1 1 
       1135 1 2 1 1 107 LEU H    . 107 . HN   1 1 
       1136 1 1 1 1 105 THR H    . 105 . HN   1 1 
       1136 1 2 1 1 105 THR HB   . 105 . HB   1 1 
       1137 1 1 1 1 105 THR H    . 105 . HN   1 1 
       1137 1 2 1 1 105 THR HG1  . 105 . HG*  1 1 
       1137 1 2 1 1 105 THR MG   . 105 . HG*  1 1 
       1138 1 1 1 1 105 THR H    . 105 . HN   1 1 
       1138 1 2 1 1 105 THR MG   . 105 . HG2* 1 1 
       1139 1 1 1 1 105 THR H    . 105 . HN   1 1 
       1139 1 2 1 1 106 LEU H    . 106 . HN   1 1 
       1140 1 1 1 1 106 LEU HA   . 106 . HA   1 1 
       1140 1 2 1 1 106 LEU MD1  . 106 . HD1* 1 1 
       1141 1 1 1 1 106 LEU HA   . 106 . HA   1 1 
       1141 1 2 1 1 106 LEU MD2  . 106 . HD2* 1 1 
       1142 1 1 1 1 106 LEU HA   . 106 . HA   1 1 
       1142 1 2 1 1 107 LEU H    . 107 . HN   1 1 
       1143 1 1 1 1 106 LEU QB   . 106 . HB*  1 1 
       1143 1 2 1 1 107 LEU H    . 107 . HN   1 1 
       1144 1 1 1 1 106 LEU HB3  . 106 . HB1  1 1 
       1144 1 2 1 1 106 LEU MD1  . 106 . HD1* 1 1 
       1145 1 1 1 1 106 LEU HB3  . 106 . HB1  1 1 
       1145 1 2 1 1 106 LEU MD2  . 106 . HD2* 1 1 
       1146 1 1 1 1 106 LEU HB2  . 106 . HB2  1 1 
       1146 1 2 1 1 106 LEU MD1  . 106 . HD1* 1 1 
       1147 1 1 1 1 106 LEU HB2  . 106 . HB2  1 1 
       1147 1 2 1 1 106 LEU MD2  . 106 . HD2* 1 1 
       1148 1 1 1 1 106 LEU MD1  . 106 . HD1* 1 1 
       1148 1 2 1 1 107 LEU H    . 107 . HN   1 1 
       1149 1 1 1 1 106 LEU HG   . 106 . HG   1 1 
       1149 1 2 1 1 107 LEU H    . 107 . HN   1 1 
       1150 1 1 1 1 106 LEU H    . 106 . HN   1 1 
       1150 1 2 1 1 106 LEU HB3  . 106 . HB1  1 1 
       1151 1 1 1 1 106 LEU H    . 106 . HN   1 1 
       1151 1 2 1 1 106 LEU HB2  . 106 . HB2  1 1 
       1152 1 1 1 1 106 LEU H    . 106 . HN   1 1 
       1152 1 2 1 1 106 LEU MD1  . 106 . HD1* 1 1 
       1153 1 1 1 1 106 LEU H    . 106 . HN   1 1 
       1153 1 2 1 1 106 LEU MD2  . 106 . HD2* 1 1 
       1154 1 1 1 1 106 LEU H    . 106 . HN   1 1 
       1154 1 2 1 1 106 LEU HG   . 106 . HG   1 1 
       1155 1 1 1 1 106 LEU H    . 106 . HN   1 1 
       1155 1 2 1 1 107 LEU H    . 107 . HN   1 1 
       1156 1 1 1 1 107 LEU HA   . 107 . HA   1 1 
       1156 1 2 1 1 107 LEU MD1  . 107 . HD1* 1 1 
       1157 1 1 1 1 107 LEU HA   . 107 . HA   1 1 
       1157 1 2 1 1 107 LEU MD2  . 107 . HD2* 1 1 
       1158 1 1 1 1 107 LEU HA   . 107 . HA   1 1 
       1158 1 2 1 1 108 ARG H    . 108 . HN   1 1 
       1159 1 1 1 1 107 LEU QB   . 107 . HB*  1 1 
       1159 1 2 1 1 134 LEU MD2  . 134 . HD2* 1 1 
       1160 1 1 1 1 107 LEU HB3  . 107 . HB1  1 1 
       1160 1 2 1 1 107 LEU MD1  . 107 . HD1* 1 1 
       1161 1 1 1 1 107 LEU HB3  . 107 . HB1  1 1 
       1161 1 2 1 1 107 LEU MD2  . 107 . HD2* 1 1 
       1162 1 1 1 1 107 LEU HB3  . 107 . HB1  1 1 
       1162 1 2 1 1 108 ARG H    . 108 . HN   1 1 
       1163 1 1 1 1 107 LEU HB2  . 107 . HB2  1 1 
       1163 1 2 1 1 107 LEU MD1  . 107 . HD1* 1 1 
       1164 1 1 1 1 107 LEU HB2  . 107 . HB2  1 1 
       1164 1 2 1 1 107 LEU MD2  . 107 . HD2* 1 1 
       1165 1 1 1 1 107 LEU HB2  . 107 . HB2  1 1 
       1165 1 2 1 1 108 ARG H    . 108 . HN   1 1 
       1166 1 1 1 1 107 LEU MD1  . 107 . HD1* 1 1 
       1166 1 2 1 1 108 ARG H    . 108 . HN   1 1 
       1167 1 1 1 1 107 LEU MD1  . 107 . HD1* 1 1 
       1167 1 2 1 1 134 LEU MD1  . 134 . HD1* 1 1 
       1168 1 1 1 1 107 LEU MD1  . 107 . HD1* 1 1 
       1168 1 2 1 1 134 LEU MD2  . 134 . HD2* 1 1 
       1169 1 1 1 1 107 LEU MD2  . 107 . HD2* 1 1 
       1169 1 2 1 1 108 ARG HA   . 108 . HA   1 1 
       1170 1 1 1 1 107 LEU MD2  . 107 . HD2* 1 1 
       1170 1 2 1 1 108 ARG H    . 108 . HN   1 1 
       1171 1 1 1 1 107 LEU MD2  . 107 . HD2* 1 1 
       1171 1 2 1 1 109 LEU HA   . 109 . HA   1 1 
       1172 1 1 1 1 107 LEU MD2  . 107 . HD2* 1 1 
       1172 1 2 1 1 109 LEU HB3  . 109 . HB1  1 1 
       1173 1 1 1 1 107 LEU MD2  . 107 . HD2* 1 1 
       1173 1 2 1 1 109 LEU HB2  . 109 . HB2  1 1 
       1174 1 1 1 1 107 LEU MD2  . 107 . HD2* 1 1 
       1174 1 2 1 1 109 LEU MD1  . 109 . HD1* 1 1 
       1175 1 1 1 1 107 LEU MD2  . 107 . HD2* 1 1 
       1175 1 2 1 1 109 LEU H    . 109 . HN   1 1 
       1176 1 1 1 1 107 LEU MD2  . 107 . HD2* 1 1 
       1176 1 2 1 1 131 LEU MD2  . 131 . HD2* 1 1 
       1177 1 1 1 1 107 LEU MD2  . 107 . HD2* 1 1 
       1177 1 2 1 1 134 LEU MD2  . 134 . HD2* 1 1 
       1178 1 1 1 1 107 LEU HG   . 107 . HG   1 1 
       1178 1 2 1 1 108 ARG H    . 108 . HN   1 1 
       1179 1 1 1 1 107 LEU HG   . 107 . HG   1 1 
       1179 1 2 1 1 109 LEU QB   . 109 . HB*  1 1 
       1180 1 1 1 1 107 LEU H    . 107 . HN   1 1 
       1180 1 2 1 1 107 LEU HB3  . 107 . HB1  1 1 
       1181 1 1 1 1 107 LEU H    . 107 . HN   1 1 
       1181 1 2 1 1 107 LEU HB2  . 107 . HB2  1 1 
       1182 1 1 1 1 107 LEU H    . 107 . HN   1 1 
       1182 1 2 1 1 107 LEU MD1  . 107 . HD1* 1 1 
       1183 1 1 1 1 107 LEU H    . 107 . HN   1 1 
       1183 1 2 1 1 107 LEU MD2  . 107 . HD2* 1 1 
       1184 1 1 1 1 108 ARG HA   . 108 . HA   1 1 
       1184 1 2 1 1 108 ARG QD   . 108 . HD*  1 1 
       1185 1 1 1 1 108 ARG HA   . 108 . HA   1 1 
       1185 1 2 1 1 109 LEU H    . 109 . HN   1 1 
       1186 1 1 1 1 108 ARG QB   . 108 . HB*  1 1 
       1186 1 2 1 1 108 ARG QD   . 108 . HD*  1 1 
       1187 1 1 1 1 108 ARG HB3  . 108 . HB1  1 1 
       1187 1 2 1 1 109 LEU H    . 109 . HN   1 1 
       1188 1 1 1 1 108 ARG HB2  . 108 . HB2  1 1 
       1188 1 2 1 1 109 LEU H    . 109 . HN   1 1 
       1189 1 1 1 1 108 ARG QG   . 108 . HG*  1 1 
       1189 1 2 1 1 109 LEU H    . 109 . HN   1 1 
       1190 1 1 1 1 108 ARG H    . 108 . HN   1 1 
       1190 1 2 1 1 108 ARG QB   . 108 . HB*  1 1 
       1191 1 1 1 1 108 ARG H    . 108 . HN   1 1 
       1191 1 2 1 1 108 ARG QD   . 108 . HD*  1 1 
       1192 1 1 1 1 108 ARG H    . 108 . HN   1 1 
       1192 1 2 1 1 108 ARG QG   . 108 . HG*  1 1 
       1193 1 1 1 1 108 ARG H    . 108 . HN   1 1 
       1193 1 2 1 1 109 LEU H    . 109 . HN   1 1 
       1194 1 1 1 1 109 LEU HA   . 109 . HA   1 1 
       1194 1 2 1 1 109 LEU MD1  . 109 . HD1* 1 1 
       1195 1 1 1 1 109 LEU HA   . 109 . HA   1 1 
       1195 1 2 1 1 109 LEU MD2  . 109 . HD2* 1 1 
       1196 1 1 1 1 109 LEU HA   . 109 . HA   1 1 
       1196 1 2 1 1 110 THR H    . 110 . HN   1 1 
       1197 1 1 1 1 109 LEU QB   . 109 . HB*  1 1 
       1197 1 2 1 1 109 LEU MD2  . 109 . HD2* 1 1 
       1198 1 1 1 1 109 LEU QB   . 109 . HB*  1 1 
       1198 1 2 1 1 110 THR H    . 110 . HN   1 1 
       1199 1 1 1 1 109 LEU HB3  . 109 . HB1  1 1 
       1199 1 2 1 1 109 LEU MD1  . 109 . HD1* 1 1 
       1200 1 1 1 1 109 LEU HB2  . 109 . HB2  1 1 
       1200 1 2 1 1 109 LEU MD1  . 109 . HD1* 1 1 
       1201 1 1 1 1 109 LEU MD1  . 109 . HD1* 1 1 
       1201 1 2 1 1 111 HIS QB   . 111 . HB*  1 1 
       1202 1 1 1 1 109 LEU MD1  . 109 . HD1* 1 1 
       1202 1 2 1 1 127 TRP QB   . 127 . HB*  1 1 
       1203 1 1 1 1 109 LEU MD1  . 109 . HD1* 1 1 
       1203 1 2 1 1 127 TRP HE3  . 127 . HE3  1 1 
       1204 1 1 1 1 109 LEU MD1  . 109 . HD1* 1 1 
       1204 1 2 1 1 127 TRP HZ2  . 127 . HZ2  1 1 
       1205 1 1 1 1 109 LEU MD1  . 109 . HD1* 1 1 
       1205 1 2 1 1 131 LEU MD1  . 131 . HD1* 1 1 
       1206 1 1 1 1 109 LEU MD1  . 109 . HD1* 1 1 
       1206 1 2 1 1 131 LEU MD2  . 131 . HD2* 1 1 
       1207 1 1 1 1 109 LEU MD2  . 109 . HD2* 1 1 
       1207 1 2 1 1 110 THR HA   . 110 . HA   1 1 
       1208 1 1 1 1 109 LEU MD2  . 109 . HD2* 1 1 
       1208 1 2 1 1 110 THR H    . 110 . HN   1 1 
       1209 1 1 1 1 109 LEU MD2  . 109 . HD2* 1 1 
       1209 1 2 1 1 111 HIS HB3  . 111 . HB1  1 1 
       1210 1 1 1 1 109 LEU MD2  . 109 . HD2* 1 1 
       1210 1 2 1 1 111 HIS HB2  . 111 . HB2  1 1 
       1211 1 1 1 1 109 LEU MD2  . 109 . HD2* 1 1 
       1211 1 2 1 1 111 HIS H    . 111 . HN   1 1 
       1212 1 1 1 1 109 LEU MD2  . 109 . HD2* 1 1 
       1212 1 2 1 1 127 TRP QB   . 127 . HB*  1 1 
       1213 1 1 1 1 109 LEU MD2  . 109 . HD2* 1 1 
       1213 1 2 1 1 127 TRP HD1  . 127 . HD1  1 1 
       1214 1 1 1 1 109 LEU MD2  . 109 . HD2* 1 1 
       1214 1 2 1 1 131 LEU MD1  . 131 . HD1* 1 1 
       1215 1 1 1 1 109 LEU HG   . 109 . HG   1 1 
       1215 1 2 1 1 110 THR H    . 110 . HN   1 1 
       1216 1 1 1 1 109 LEU H    . 109 . HN   1 1 
       1216 1 2 1 1 109 LEU MD1  . 109 . HD1* 1 1 
       1217 1 1 1 1 109 LEU H    . 109 . HN   1 1 
       1217 1 2 1 1 109 LEU MD2  . 109 . HD2* 1 1 
       1218 1 1 1 1 109 LEU H    . 109 . HN   1 1 
       1218 1 2 1 1 109 LEU HG   . 109 . HG   1 1 
       1219 1 1 1 1 109 LEU H    . 109 . HN   1 1 
       1219 1 2 1 1 131 LEU MD1  . 131 . HD1* 1 1 
       1220 1 1 1 1 110 THR HA   . 110 . HA   1 1 
       1220 1 2 1 1 110 THR MG   . 110 . HG2* 1 1 
       1221 1 1 1 1 110 THR HA   . 110 . HA   1 1 
       1221 1 2 1 1 111 HIS H    . 111 . HN   1 1 
       1222 1 1 1 1 110 THR MG   . 110 . HG2* 1 1 
       1222 1 2 1 1 111 HIS H    . 111 . HN   1 1 
       1223 1 1 1 1 110 THR MG   . 110 . HG2* 1 1 
       1223 1 2 1 1 112 SER QB   . 112 . HB*  1 1 
       1224 1 1 1 1 110 THR H    . 110 . HN   1 1 
       1224 1 2 1 1 110 THR MG   . 110 . HG2* 1 1 
       1225 1 1 1 1 111 HIS HA   . 111 . HA   1 1 
       1225 1 2 1 1 111 HIS HD1  . 111 . HD*  1 1 
       1225 1 2 1 1 111 HIS HD2  . 111 . HD*  1 1 
       1226 1 1 1 1 111 HIS HA   . 111 . HA   1 1 
       1226 1 2 1 1 112 SER H    . 112 . HN   1 1 
       1227 1 1 1 1 111 HIS HD1  . 111 . HD*  1 1 
       1227 1 1 1 1 111 HIS HD2  . 111 . HD*  1 1 
       1227 1 2 1 1 112 SER H    . 112 . HN   1 1 
       1228 1 1 1 1 111 HIS HD1  . 111 . HD*  1 1 
       1228 1 1 1 1 111 HIS HD2  . 111 . HD*  1 1 
       1228 1 2 1 1 114 LEU MD2  . 114 . HD2* 1 1 
       1229 1 1 1 1 111 HIS HE1  . 111 . HE1  1 1 
       1229 1 2 1 1 114 LEU MD2  . 114 . HD2* 1 1 
       1230 1 1 1 1 112 SER HA   . 112 . HA   1 1 
       1230 1 2 1 1 114 LEU HG   . 114 . HG   1 1 
       1231 1 1 1 1 112 SER HA   . 112 . HA   1 1 
       1231 1 2 1 1 114 LEU H    . 114 . HN   1 1 
       1232 1 1 1 1 112 SER QB   . 112 . HB*  1 1 
       1232 1 2 1 1 113 GLY H    . 113 . HN   1 1 
       1233 1 1 1 1 113 GLY H    . 113 . HN   1 1 
       1233 1 2 1 1 114 LEU H    . 114 . HN   1 1 
       1234 1 1 1 1 114 LEU HA   . 114 . HA   1 1 
       1234 1 2 1 1 114 LEU MD1  . 114 . HD1* 1 1 
       1235 1 1 1 1 114 LEU HA   . 114 . HA   1 1 
       1235 1 2 1 1 114 LEU MD2  . 114 . HD2* 1 1 
       1236 1 1 1 1 114 LEU QB   . 114 . HB*  1 1 
       1236 1 2 1 1 114 LEU MD2  . 114 . HD2* 1 1 
       1237 1 1 1 1 114 LEU QB   . 114 . HB*  1 1 
       1237 1 2 1 1 116 SER H    . 116 . HN   1 1 
       1238 1 1 1 1 114 LEU HB3  . 114 . HB1  1 1 
       1238 1 2 1 1 114 LEU MD1  . 114 . HD1* 1 1 
       1239 1 1 1 1 114 LEU HB2  . 114 . HB2  1 1 
       1239 1 2 1 1 114 LEU MD1  . 114 . HD1* 1 1 
       1240 1 1 1 1 114 LEU MD1  . 114 . HD1* 1 1 
       1240 1 2 1 1 119 GLN QB   . 119 . HB*  1 1 
       1241 1 1 1 1 114 LEU MD1  . 114 . HD1* 1 1 
       1241 1 2 1 1 120 CYS HA   . 120 . HA   1 1 
       1242 1 1 1 1 114 LEU MD1  . 114 . HD1* 1 1 
       1242 1 2 1 1 120 CYS QB   . 120 . HB*  1 1 
       1243 1 1 1 1 114 LEU MD1  . 114 . HD1* 1 1 
       1243 1 2 1 1 120 CYS H    . 120 . HN   1 1 
       1244 1 1 1 1 114 LEU MD1  . 114 . HD1* 1 1 
       1244 1 2 1 1 123 HIS QB   . 123 . HB*  1 1 
       1245 1 1 1 1 114 LEU MD1  . 114 . HD1* 1 1 
       1245 1 2 1 1 123 HIS HD1  . 123 . HD*  1 1 
       1245 1 2 1 1 123 HIS HD2  . 123 . HD*  1 1 
       1246 1 1 1 1 114 LEU MD1  . 114 . HD1* 1 1 
       1246 1 2 1 1 123 HIS H    . 123 . HN   1 1 
       1247 1 1 1 1 114 LEU MD2  . 114 . HD2* 1 1 
       1247 1 2 1 1 115 PRO HD3  . 115 . HD1  1 1 
       1248 1 1 1 1 114 LEU MD2  . 114 . HD2* 1 1 
       1248 1 2 1 1 115 PRO HD2  . 115 . HD2  1 1 
       1249 1 1 1 1 114 LEU MD2  . 114 . HD2* 1 1 
       1249 1 2 1 1 116 SER H    . 116 . HN   1 1 
       1250 1 1 1 1 114 LEU MD2  . 114 . HD2* 1 1 
       1250 1 2 1 1 119 GLN HB3  . 119 . HB1  1 1 
       1251 1 1 1 1 114 LEU MD2  . 114 . HD2* 1 1 
       1251 1 2 1 1 119 GLN HB2  . 119 . HB2  1 1 
       1252 1 1 1 1 114 LEU MD2  . 114 . HD2* 1 1 
       1252 1 2 1 1 123 HIS HB3  . 123 . HB1  1 1 
       1253 1 1 1 1 114 LEU MD2  . 114 . HD2* 1 1 
       1253 1 2 1 1 123 HIS HB2  . 123 . HB2  1 1 
       1254 1 1 1 1 114 LEU MD2  . 114 . HD2* 1 1 
       1254 1 2 1 1 123 HIS HD1  . 123 . HD*  1 1 
       1254 1 2 1 1 123 HIS HD2  . 123 . HD*  1 1 
       1255 1 1 1 1 114 LEU H    . 114 . HN   1 1 
       1255 1 2 1 1 114 LEU HB3  . 114 . HB1  1 1 
       1256 1 1 1 1 114 LEU H    . 114 . HN   1 1 
       1256 1 2 1 1 114 LEU HB2  . 114 . HB2  1 1 
       1257 1 1 1 1 114 LEU H    . 114 . HN   1 1 
       1257 1 2 1 1 114 LEU MD1  . 114 . HD1* 1 1 
       1258 1 1 1 1 114 LEU H    . 114 . HN   1 1 
       1258 1 2 1 1 114 LEU MD2  . 114 . HD2* 1 1 
       1259 1 1 1 1 114 LEU H    . 114 . HN   1 1 
       1259 1 2 1 1 114 LEU HG   . 114 . HG   1 1 
       1260 1 1 1 1 115 PRO QB   . 115 . HB*  1 1 
       1260 1 2 1 1 116 SER H    . 116 . HN   1 1 
       1261 1 1 1 1 115 PRO QD   . 115 . HD*  1 1 
       1261 1 2 1 1 119 GLN QB   . 119 . HB*  1 1 
       1262 1 1 1 1 115 PRO QG   . 115 . HG*  1 1 
       1262 1 2 1 1 116 SER H    . 116 . HN   1 1 
       1263 1 1 1 1 116 SER HA   . 116 . HA   1 1 
       1263 1 2 1 1 117 ALA H    . 117 . HN   1 1 
       1264 1 1 1 1 116 SER HB3  . 116 . HB1  1 1 
       1264 1 2 1 1 117 ALA H    . 117 . HN   1 1 
       1265 1 1 1 1 116 SER HB2  . 116 . HB2  1 1 
       1265 1 2 1 1 117 ALA H    . 117 . HN   1 1 
       1266 1 1 1 1 116 SER H    . 116 . HN   1 1 
       1266 1 2 1 1 119 GLN QB   . 119 . HB*  1 1 
       1267 1 1 1 1 116 SER H    . 116 . HN   1 1 
       1267 1 2 1 1 119 GLN H    . 119 . HN   1 1 
       1268 1 1 1 1 116 SER H    . 116 . HN   1 1 
       1268 1 2 1 1 120 CYS H    . 120 . HN   1 1 
       1269 1 1 1 1 117 ALA HA   . 117 . HA   1 1 
       1269 1 2 1 1 120 CYS QB   . 120 . HB*  1 1 
       1270 1 1 1 1 117 ALA HA   . 117 . HA   1 1 
       1270 1 2 1 1 120 CYS H    . 120 . HN   1 1 
       1271 1 1 1 1 117 ALA HA   . 117 . HA   1 1 
       1271 1 2 1 1 121 ALA H    . 121 . HN   1 1 
       1272 1 1 1 1 117 ALA MB   . 117 . HB*  1 1 
       1272 1 2 1 1 118 GLU HA   . 118 . HA   1 1 
       1273 1 1 1 1 117 ALA MB   . 117 . HB*  1 1 
       1273 1 2 1 1 118 GLU H    . 118 . HN   1 1 
       1274 1 1 1 1 117 ALA MB   . 117 . HB*  1 1 
       1274 1 2 1 1 120 CYS QB   . 120 . HB*  1 1 
       1275 1 1 1 1 117 ALA H    . 117 . HN   1 1 
       1275 1 2 1 1 117 ALA MB   . 117 . HB*  1 1 
       1276 1 1 1 1 117 ALA H    . 117 . HN   1 1 
       1276 1 2 1 1 118 GLU H    . 118 . HN   1 1 
       1277 1 1 1 1 118 GLU HA   . 118 . HA   1 1 
       1277 1 2 1 1 118 GLU QG   . 118 . HG*  1 1 
       1278 1 1 1 1 118 GLU HA   . 118 . HA   1 1 
       1278 1 2 1 1 121 ALA MB   . 121 . HB*  1 1 
       1279 1 1 1 1 118 GLU HA   . 118 . HA   1 1 
       1279 1 2 1 1 121 ALA H    . 121 . HN   1 1 
       1280 1 1 1 1 118 GLU HA   . 118 . HA   1 1 
       1280 1 2 1 1 122 GLY H    . 122 . HN   1 1 
       1281 1 1 1 1 118 GLU QB   . 118 . HB*  1 1 
       1281 1 2 1 1 119 GLN H    . 119 . HN   1 1 
       1282 1 1 1 1 118 GLU H    . 118 . HN   1 1 
       1282 1 2 1 1 118 GLU QB   . 118 . HB*  1 1 
       1283 1 1 1 1 118 GLU H    . 118 . HN   1 1 
       1283 1 2 1 1 118 GLU QG   . 118 . HG*  1 1 
       1284 1 1 1 1 118 GLU H    . 118 . HN   1 1 
       1284 1 2 1 1 119 GLN H    . 119 . HN   1 1 
       1285 1 1 1 1 119 GLN HA   . 119 . HA   1 1 
       1285 1 2 1 1 119 GLN QG   . 119 . HG*  1 1 
       1286 1 1 1 1 119 GLN QB   . 119 . HB*  1 1 
       1286 1 2 1 1 120 CYS H    . 120 . HN   1 1 
       1287 1 1 1 1 119 GLN H    . 119 . HN   1 1 
       1287 1 2 1 1 119 GLN QG   . 119 . HG*  1 1 
       1288 1 1 1 1 119 GLN H    . 119 . HN   1 1 
       1288 1 2 1 1 120 CYS H    . 120 . HN   1 1 
       1289 1 1 1 1 120 CYS HA   . 120 . HA   1 1 
       1289 1 2 1 1 123 HIS QB   . 123 . HB*  1 1 
       1290 1 1 1 1 120 CYS HA   . 120 . HA   1 1 
       1290 1 2 1 1 123 HIS H    . 123 . HN   1 1 
       1291 1 1 1 1 120 CYS HA   . 120 . HA   1 1 
       1291 1 2 1 1 124 GLU H    . 124 . HN   1 1 
       1292 1 1 1 1 120 CYS QB   . 120 . HB*  1 1 
       1292 1 2 1 1 121 ALA H    . 121 . HN   1 1 
       1293 1 1 1 1 120 CYS H    . 120 . HN   1 1 
       1293 1 2 1 1 120 CYS HB3  . 120 . HB1  1 1 
       1294 1 1 1 1 120 CYS H    . 120 . HN   1 1 
       1294 1 2 1 1 120 CYS HB2  . 120 . HB2  1 1 
       1295 1 1 1 1 121 ALA HA   . 121 . HA   1 1 
       1295 1 2 1 1 124 GLU QB   . 124 . HB*  1 1 
       1296 1 1 1 1 121 ALA HA   . 121 . HA   1 1 
       1296 1 2 1 1 124 GLU H    . 124 . HN   1 1 
       1297 1 1 1 1 121 ALA MB   . 121 . HB*  1 1 
       1297 1 2 1 1 122 GLY H    . 122 . HN   1 1 
       1298 1 1 1 1 121 ALA MB   . 121 . HB*  1 1 
       1298 1 2 1 1 124 GLU QB   . 124 . HB*  1 1 
       1299 1 1 1 1 121 ALA H    . 121 . HN   1 1 
       1299 1 2 1 1 121 ALA MB   . 121 . HB*  1 1 
       1300 1 1 1 1 121 ALA H    . 121 . HN   1 1 
       1300 1 2 1 1 122 GLY H    . 122 . HN   1 1 
       1301 1 1 1 1 122 GLY QA   . 122 . HA*  1 1 
       1301 1 2 1 1 125 GLU QB   . 125 . HB*  1 1 
       1302 1 1 1 1 122 GLY H    . 122 . HN   1 1 
       1302 1 2 1 1 123 HIS H    . 123 . HN   1 1 
       1303 1 1 1 1 123 HIS QB   . 123 . HB*  1 1 
       1303 1 2 1 1 124 GLU H    . 124 . HN   1 1 
       1304 1 1 1 1 123 HIS H    . 123 . HN   1 1 
       1304 1 2 1 1 124 GLU H    . 124 . HN   1 1 
       1305 1 1 1 1 124 GLU HA   . 124 . HA   1 1 
       1305 1 2 1 1 124 GLU HG3  . 124 . HG1  1 1 
       1306 1 1 1 1 124 GLU HA   . 124 . HA   1 1 
       1306 1 2 1 1 124 GLU HG2  . 124 . HG2  1 1 
       1307 1 1 1 1 124 GLU HA   . 124 . HA   1 1 
       1307 1 2 1 1 127 TRP QB   . 127 . HB*  1 1 
       1308 1 1 1 1 124 GLU HA   . 124 . HA   1 1 
       1308 1 2 1 1 127 TRP HD1  . 127 . HD1  1 1 
       1309 1 1 1 1 124 GLU QB   . 124 . HB*  1 1 
       1309 1 2 1 1 125 GLU H    . 125 . HN   1 1 
       1310 1 1 1 1 124 GLU QG   . 124 . HG*  1 1 
       1310 1 2 1 1 125 GLU H    . 125 . HN   1 1 
       1311 1 1 1 1 124 GLU H    . 124 . HN   1 1 
       1311 1 2 1 1 124 GLU QB   . 124 . HB*  1 1 
       1312 1 1 1 1 124 GLU H    . 124 . HN   1 1 
       1312 1 2 1 1 124 GLU QG   . 124 . HG*  1 1 
       1313 1 1 1 1 124 GLU H    . 124 . HN   1 1 
       1313 1 2 1 1 125 GLU H    . 125 . HN   1 1 
       1314 1 1 1 1 125 GLU HA   . 125 . HA   1 1 
       1314 1 2 1 1 125 GLU QG   . 125 . HG*  1 1 
       1315 1 1 1 1 125 GLU HA   . 125 . HA   1 1 
       1315 1 2 1 1 128 ALA MB   . 128 . HB*  1 1 
       1316 1 1 1 1 125 GLU HA   . 125 . HA   1 1 
       1316 1 2 1 1 128 ALA H    . 128 . HN   1 1 
       1317 1 1 1 1 125 GLU QB   . 125 . HB*  1 1 
       1317 1 2 1 1 126 GLY H    . 126 . HN   1 1 
       1318 1 1 1 1 125 GLU QB   . 125 . HB*  1 1 
       1318 1 2 1 1 128 ALA MB   . 128 . HB*  1 1 
       1319 1 1 1 1 125 GLU H    . 125 . HN   1 1 
       1319 1 2 1 1 125 GLU QB   . 125 . HB*  1 1 
       1320 1 1 1 1 125 GLU H    . 125 . HN   1 1 
       1320 1 2 1 1 125 GLU QG   . 125 . HG*  1 1 
       1321 1 1 1 1 125 GLU H    . 125 . HN   1 1 
       1321 1 2 1 1 126 GLY H    . 126 . HN   1 1 
       1322 1 1 1 1 126 GLY H    . 126 . HN   1 1 
       1322 1 2 1 1 127 TRP H    . 127 . HN   1 1 
       1323 1 1 1 1 127 TRP QB   . 127 . HB*  1 1 
       1323 1 2 1 1 131 LEU MD1  . 131 . HD1* 1 1 
       1324 1 1 1 1 127 TRP HB3  . 127 . HB1  1 1 
       1324 1 2 1 1 128 ALA H    . 128 . HN   1 1 
       1325 1 1 1 1 127 TRP HB2  . 127 . HB2  1 1 
       1325 1 2 1 1 128 ALA H    . 128 . HN   1 1 
       1326 1 1 1 1 127 TRP HE3  . 127 . HE3  1 1 
       1326 1 2 1 1 131 LEU MD2  . 131 . HD2* 1 1 
       1327 1 1 1 1 127 TRP HE3  . 127 . HE3  1 1 
       1327 1 2 1 1 131 LEU HG   . 131 . HG   1 1 
       1328 1 1 1 1 127 TRP H    . 127 . HN   1 1 
       1328 1 2 1 1 128 ALA H    . 128 . HN   1 1 
       1329 1 1 1 1 127 TRP HZ3  . 127 . HZ3  1 1 
       1329 1 2 1 1 130 TYR QB   . 130 . HB*  1 1 
       1330 1 1 1 1 127 TRP HZ3  . 127 . HZ3  1 1 
       1330 1 2 1 1 131 LEU MD2  . 131 . HD2* 1 1 
       1331 1 1 1 1 128 ALA HA   . 128 . HA   1 1 
       1331 1 2 1 1 131 LEU QB   . 131 . HB*  1 1 
       1332 1 1 1 1 128 ALA HA   . 128 . HA   1 1 
       1332 1 2 1 1 131 LEU MD1  . 131 . HD1* 1 1 
       1333 1 1 1 1 128 ALA HA   . 128 . HA   1 1 
       1333 1 2 1 1 131 LEU H    . 131 . HN   1 1 
       1334 1 1 1 1 128 ALA MB   . 128 . HB*  1 1 
       1334 1 2 1 1 129 HIS H    . 129 . HN   1 1 
       1335 1 1 1 1 128 ALA MB   . 128 . HB*  1 1 
       1335 1 2 1 1 131 LEU QB   . 131 . HB*  1 1 
       1336 1 1 1 1 128 ALA H    . 128 . HN   1 1 
       1336 1 2 1 1 128 ALA MB   . 128 . HB*  1 1 
       1337 1 1 1 1 128 ALA H    . 128 . HN   1 1 
       1337 1 2 1 1 129 HIS H    . 129 . HN   1 1 
       1338 1 1 1 1 129 HIS HB3  . 129 . HB1  1 1 
       1338 1 2 1 1 130 TYR H    . 130 . HN   1 1 
       1339 1 1 1 1 129 HIS HB2  . 129 . HB2  1 1 
       1339 1 2 1 1 130 TYR H    . 130 . HN   1 1 
       1340 1 1 1 1 129 HIS H    . 129 . HN   1 1 
       1340 1 2 1 1 129 HIS HB2  . 129 . HB2  1 1 
       1341 1 1 1 1 129 HIS H    . 129 . HN   1 1 
       1341 1 2 1 1 130 TYR H    . 130 . HN   1 1 
       1342 1 1 1 1 130 TYR HA   . 130 . HA   1 1 
       1342 1 2 1 1 133 ARG QB   . 133 . HB*  1 1 
       1343 1 1 1 1 130 TYR HA   . 130 . HA   1 1 
       1343 1 2 1 1 133 ARG QD   . 133 . HD*  1 1 
       1344 1 1 1 1 130 TYR HA   . 130 . HA   1 1 
       1344 1 2 1 1 133 ARG QG   . 133 . HG*  1 1 
       1345 1 1 1 1 130 TYR HA   . 130 . HA   1 1 
       1345 1 2 1 1 133 ARG H    . 133 . HN   1 1 
       1346 1 1 1 1 130 TYR HB3  . 130 . HB1  1 1 
       1346 1 2 1 1 131 LEU H    . 131 . HN   1 1 
       1347 1 1 1 1 130 TYR HB3  . 130 . HB1  1 1 
       1347 1 2 1 1 133 ARG H    . 133 . HN   1 1 
       1348 1 1 1 1 130 TYR HB2  . 130 . HB2  1 1 
       1348 1 2 1 1 131 LEU H    . 131 . HN   1 1 
       1349 1 1 1 1 130 TYR HB2  . 130 . HB2  1 1 
       1349 1 2 1 1 133 ARG H    . 133 . HN   1 1 
       1350 1 1 1 1 130 TYR H    . 130 . HN   1 1 
       1350 1 2 1 1 131 LEU H    . 131 . HN   1 1 
       1351 1 1 1 1 131 LEU HA   . 131 . HA   1 1 
       1351 1 2 1 1 131 LEU MD1  . 131 . HD1* 1 1 
       1352 1 1 1 1 131 LEU HA   . 131 . HA   1 1 
       1352 1 2 1 1 131 LEU MD2  . 131 . HD2* 1 1 
       1353 1 1 1 1 131 LEU HA   . 131 . HA   1 1 
       1353 1 2 1 1 134 LEU QB   . 134 . HB*  1 1 
       1354 1 1 1 1 131 LEU HA   . 131 . HA   1 1 
       1354 1 2 1 1 134 LEU MD2  . 134 . HD2* 1 1 
       1355 1 1 1 1 131 LEU HA   . 131 . HA   1 1 
       1355 1 2 1 1 134 LEU H    . 134 . HN   1 1 
       1356 1 1 1 1 131 LEU HA   . 131 . HA   1 1 
       1356 1 2 1 1 135 THR H    . 135 . HN   1 1 
       1357 1 1 1 1 131 LEU QB   . 131 . HB*  1 1 
       1357 1 2 1 1 131 LEU MD1  . 131 . HD1* 1 1 
       1358 1 1 1 1 131 LEU QB   . 131 . HB*  1 1 
       1358 1 2 1 1 132 GLY H    . 132 . HN   1 1 
       1359 1 1 1 1 131 LEU HB3  . 131 . HB1  1 1 
       1359 1 2 1 1 131 LEU MD2  . 131 . HD2* 1 1 
       1360 1 1 1 1 131 LEU HB2  . 131 . HB2  1 1 
       1360 1 2 1 1 131 LEU MD2  . 131 . HD2* 1 1 
       1361 1 1 1 1 131 LEU MD2  . 131 . HD2* 1 1 
       1361 1 2 1 1 134 LEU MD2  . 134 . HD2* 1 1 
       1362 1 1 1 1 131 LEU H    . 131 . HN   1 1 
       1362 1 2 1 1 131 LEU MD1  . 131 . HD1* 1 1 
       1363 1 1 1 1 131 LEU H    . 131 . HN   1 1 
       1363 1 2 1 1 131 LEU MD2  . 131 . HD2* 1 1 
       1364 1 1 1 1 131 LEU H    . 131 . HN   1 1 
       1364 1 2 1 1 131 LEU HG   . 131 . HG   1 1 
       1365 1 1 1 1 131 LEU H    . 131 . HN   1 1 
       1365 1 2 1 1 132 GLY H    . 132 . HN   1 1 
       1366 1 1 1 1 132 GLY QA   . 132 . HA*  1 1 
       1366 1 2 1 1 135 THR H    . 135 . HN   1 1 
       1367 1 1 1 1 132 GLY QA   . 132 . HA*  1 1 
       1367 1 2 1 1 136 GLU H    . 136 . HN   1 1 
       1368 1 1 1 1 132 GLY HA3  . 132 . HA1  1 1 
       1368 1 2 1 1 135 THR HB   . 135 . HB   1 1 
       1369 1 1 1 1 132 GLY HA2  . 132 . HA2  1 1 
       1369 1 2 1 1 135 THR HB   . 135 . HB   1 1 
       1370 1 1 1 1 132 GLY H    . 132 . HN   1 1 
       1370 1 2 1 1 133 ARG H    . 133 . HN   1 1 
       1371 1 1 1 1 133 ARG HA   . 133 . HA   1 1 
       1371 1 2 1 1 133 ARG QD   . 133 . HD*  1 1 
       1372 1 1 1 1 133 ARG HA   . 133 . HA   1 1 
       1372 1 2 1 1 133 ARG HE   . 133 . HE   1 1 
       1373 1 1 1 1 133 ARG HA   . 133 . HA   1 1 
       1373 1 2 1 1 136 GLU HB3  . 136 . HB1  1 1 
       1374 1 1 1 1 133 ARG HA   . 133 . HA   1 1 
       1374 1 2 1 1 136 GLU HB2  . 136 . HB2  1 1 
       1375 1 1 1 1 133 ARG HA   . 133 . HA   1 1 
       1375 1 2 1 1 136 GLU H    . 136 . HN   1 1 
       1376 1 1 1 1 133 ARG HA   . 133 . HA   1 1 
       1376 1 2 1 1 137 VAL H    . 137 . HN   1 1 
       1377 1 1 1 1 133 ARG QB   . 133 . HB*  1 1 
       1377 1 2 1 1 134 LEU H    . 134 . HN   1 1 
       1378 1 1 1 1 133 ARG H    . 133 . HN   1 1 
       1378 1 2 1 1 133 ARG QG   . 133 . HG*  1 1 
       1379 1 1 1 1 133 ARG H    . 133 . HN   1 1 
       1379 1 2 1 1 134 LEU H    . 134 . HN   1 1 
       1380 1 1 1 1 134 LEU HA   . 134 . HA   1 1 
       1380 1 2 1 1 134 LEU MD1  . 134 . HD1* 1 1 
       1381 1 1 1 1 134 LEU HA   . 134 . HA   1 1 
       1381 1 2 1 1 134 LEU MD2  . 134 . HD2* 1 1 
       1382 1 1 1 1 134 LEU HA   . 134 . HA   1 1 
       1382 1 2 1 1 137 VAL HB   . 137 . HB   1 1 
       1383 1 1 1 1 134 LEU HA   . 134 . HA   1 1 
       1383 1 2 1 1 137 VAL MG1  . 137 . HG1* 1 1 
       1384 1 1 1 1 134 LEU HA   . 134 . HA   1 1 
       1384 1 2 1 1 137 VAL MG2  . 137 . HG2* 1 1 
       1385 1 1 1 1 134 LEU HA   . 134 . HA   1 1 
       1385 1 2 1 1 137 VAL H    . 137 . HN   1 1 
       1386 1 1 1 1 134 LEU QB   . 134 . HB*  1 1 
       1386 1 2 1 1 135 THR H    . 135 . HN   1 1 
       1387 1 1 1 1 134 LEU HB3  . 134 . HB1  1 1 
       1387 1 2 1 1 134 LEU MD2  . 134 . HD2* 1 1 
       1388 1 1 1 1 134 LEU HB2  . 134 . HB2  1 1 
       1388 1 2 1 1 134 LEU MD2  . 134 . HD2* 1 1 
       1389 1 1 1 1 134 LEU MD1  . 134 . HD1* 1 1 
       1389 1 2 1 1 135 THR H    . 135 . HN   1 1 
       1390 1 1 1 1 134 LEU MD1  . 134 . HD1* 1 1 
       1390 1 2 1 1 137 VAL HB   . 137 . HB   1 1 
       1391 1 1 1 1 134 LEU MD1  . 134 . HD1* 1 1 
       1391 1 2 1 1 137 VAL MG1  . 137 . HG1* 1 1 
       1392 1 1 1 1 134 LEU MD1  . 134 . HD1* 1 1 
       1392 1 2 1 1 137 VAL MG2  . 137 . HG2* 1 1 
       1393 1 1 1 1 134 LEU MD1  . 134 . HD1* 1 1 
       1393 1 2 1 1 137 VAL H    . 137 . HN   1 1 
       1394 1 1 1 1 134 LEU MD1  . 134 . HD1* 1 1 
       1394 1 2 1 1 138 ALA MB   . 138 . HB*  1 1 
       1395 1 1 1 1 134 LEU MD1  . 134 . HD1* 1 1 
       1395 1 2 1 1 138 ALA H    . 138 . HN   1 1 
       1396 1 1 1 1 134 LEU MD2  . 134 . HD2* 1 1 
       1396 1 2 1 1 135 THR H    . 135 . HN   1 1 
       1397 1 1 1 1 134 LEU HG   . 134 . HG   1 1 
       1397 1 2 1 1 135 THR H    . 135 . HN   1 1 
       1398 1 1 1 1 134 LEU H    . 134 . HN   1 1 
       1398 1 2 1 1 134 LEU QB   . 134 . HB*  1 1 
       1399 1 1 1 1 134 LEU H    . 134 . HN   1 1 
       1399 1 2 1 1 134 LEU MD1  . 134 . HD1* 1 1 
       1400 1 1 1 1 134 LEU H    . 134 . HN   1 1 
       1400 1 2 1 1 134 LEU MD2  . 134 . HD2* 1 1 
       1401 1 1 1 1 134 LEU H    . 134 . HN   1 1 
       1401 1 2 1 1 134 LEU HG   . 134 . HG   1 1 
       1402 1 1 1 1 134 LEU H    . 134 . HN   1 1 
       1402 1 2 1 1 135 THR H    . 135 . HN   1 1 
       1403 1 1 1 1 135 THR HA   . 135 . HA   1 1 
       1403 1 2 1 1 135 THR HG1  . 135 . HG*  1 1 
       1403 1 2 1 1 135 THR MG   . 135 . HG*  1 1 
       1404 1 1 1 1 135 THR HA   . 135 . HA   1 1 
       1404 1 2 1 1 135 THR MG   . 135 . HG2* 1 1 
       1405 1 1 1 1 135 THR HA   . 135 . HA   1 1 
       1405 1 2 1 1 138 ALA MB   . 138 . HB*  1 1 
       1406 1 1 1 1 135 THR HA   . 135 . HA   1 1 
       1406 1 2 1 1 138 ALA H    . 138 . HN   1 1 
       1407 1 1 1 1 135 THR HA   . 135 . HA   1 1 
       1407 1 2 1 1 139 ALA MB   . 139 . HB*  1 1 
       1408 1 1 1 1 135 THR HA   . 135 . HA   1 1 
       1408 1 2 1 1 139 ALA H    . 139 . HN   1 1 
       1409 1 1 1 1 135 THR HB   . 135 . HB   1 1 
       1409 1 2 1 1 136 GLU H    . 136 . HN   1 1 
       1410 1 1 1 1 135 THR HG1  . 135 . HG*  1 1 
       1410 1 1 1 1 135 THR MG   . 135 . HG*  1 1 
       1410 1 2 1 1 136 GLU H    . 136 . HN   1 1 
       1411 1 1 1 1 135 THR MG   . 135 . HG2* 1 1 
       1411 1 2 1 1 136 GLU HA   . 136 . HA   1 1 
       1412 1 1 1 1 135 THR MG   . 135 . HG2* 1 1 
       1412 1 2 1 1 136 GLU H    . 136 . HN   1 1 
       1413 1 1 1 1 135 THR H    . 135 . HN   1 1 
       1413 1 2 1 1 135 THR HB   . 135 . HB   1 1 
       1414 1 1 1 1 135 THR H    . 135 . HN   1 1 
       1414 1 2 1 1 135 THR HG1  . 135 . HG*  1 1 
       1414 1 2 1 1 135 THR MG   . 135 . HG*  1 1 
       1415 1 1 1 1 135 THR H    . 135 . HN   1 1 
       1415 1 2 1 1 135 THR MG   . 135 . HG2* 1 1 
       1416 1 1 1 1 135 THR H    . 135 . HN   1 1 
       1416 1 2 1 1 136 GLU H    . 136 . HN   1 1 
       1417 1 1 1 1 136 GLU HA   . 136 . HA   1 1 
       1417 1 2 1 1 136 GLU HG3  . 136 . HG1  1 1 
       1418 1 1 1 1 136 GLU HA   . 136 . HA   1 1 
       1418 1 2 1 1 136 GLU HG2  . 136 . HG2  1 1 
       1419 1 1 1 1 136 GLU HA   . 136 . HA   1 1 
       1419 1 2 1 1 138 ALA H    . 138 . HN   1 1 
       1420 1 1 1 1 136 GLU HA   . 136 . HA   1 1 
       1420 1 2 1 1 139 ALA MB   . 139 . HB*  1 1 
       1421 1 1 1 1 136 GLU HA   . 136 . HA   1 1 
       1421 1 2 1 1 139 ALA H    . 139 . HN   1 1 
       1422 1 1 1 1 136 GLU QB   . 136 . HB*  1 1 
       1422 1 2 1 1 137 VAL MG2  . 137 . HG2* 1 1 
       1423 1 1 1 1 136 GLU HB3  . 136 . HB1  1 1 
       1423 1 2 1 1 137 VAL H    . 137 . HN   1 1 
       1424 1 1 1 1 136 GLU HB2  . 136 . HB2  1 1 
       1424 1 2 1 1 137 VAL H    . 137 . HN   1 1 
       1425 1 1 1 1 136 GLU QG   . 136 . HG*  1 1 
       1425 1 2 1 1 137 VAL H    . 137 . HN   1 1 
       1426 1 1 1 1 136 GLU H    . 136 . HN   1 1 
       1426 1 2 1 1 136 GLU HB3  . 136 . HB1  1 1 
       1427 1 1 1 1 136 GLU H    . 136 . HN   1 1 
       1427 1 2 1 1 136 GLU HB2  . 136 . HB2  1 1 
       1428 1 1 1 1 136 GLU H    . 136 . HN   1 1 
       1428 1 2 1 1 136 GLU QG   . 136 . HG*  1 1 
       1429 1 1 1 1 136 GLU H    . 136 . HN   1 1 
       1429 1 2 1 1 137 VAL H    . 137 . HN   1 1 
       1430 1 1 1 1 137 VAL HA   . 137 . HA   1 1 
       1430 1 2 1 1 137 VAL MG1  . 137 . HG1* 1 1 
       1431 1 1 1 1 137 VAL HA   . 137 . HA   1 1 
       1431 1 2 1 1 137 VAL MG2  . 137 . HG2* 1 1 
       1432 1 1 1 1 137 VAL HA   . 137 . HA   1 1 
       1432 1 2 1 1 140 GLY H    . 140 . HN   1 1 
       1433 1 1 1 1 137 VAL HA   . 137 . HA   1 1 
       1433 1 2 1 1 141 ARG H    . 141 . HN   1 1 
       1434 1 1 1 1 137 VAL HB   . 137 . HB   1 1 
       1434 1 2 1 1 138 ALA H    . 138 . HN   1 1 
       1435 1 1 1 1 137 VAL MG1  . 137 . HG1* 1 1 
       1435 1 2 1 1 138 ALA HA   . 138 . HA   1 1 
       1436 1 1 1 1 137 VAL MG1  . 137 . HG1* 1 1 
       1436 1 2 1 1 138 ALA H    . 138 . HN   1 1 
       1437 1 1 1 1 137 VAL MG1  . 137 . HG1* 1 1 
       1437 1 2 1 1 140 GLY H    . 140 . HN   1 1 
       1438 1 1 1 1 137 VAL MG2  . 137 . HG2* 1 1 
       1438 1 2 1 1 138 ALA H    . 138 . HN   1 1 
       1439 1 1 1 1 137 VAL MG2  . 137 . HG2* 1 1 
       1439 1 2 1 1 142 ASP HA   . 142 . HA   1 1 
       1440 1 1 1 1 137 VAL MG2  . 137 . HG2* 1 1 
       1440 1 2 1 1 143 PRO QD   . 143 . HD*  1 1 
       1441 1 1 1 1 137 VAL MG2  . 137 . HG2* 1 1 
       1441 1 2 1 1 143 PRO HG2  . 143 . HG2  1 1 
       1442 1 1 1 1 137 VAL H    . 137 . HN   1 1 
       1442 1 2 1 1 137 VAL HB   . 137 . HB   1 1 
       1443 1 1 1 1 137 VAL H    . 137 . HN   1 1 
       1443 1 2 1 1 137 VAL MG1  . 137 . HG1* 1 1 
       1444 1 1 1 1 137 VAL H    . 137 . HN   1 1 
       1444 1 2 1 1 137 VAL MG2  . 137 . HG2* 1 1 
       1445 1 1 1 1 137 VAL H    . 137 . HN   1 1 
       1445 1 2 1 1 138 ALA H    . 138 . HN   1 1 
       1446 1 1 1 1 138 ALA HA   . 138 . HA   1 1 
       1446 1 2 1 1 139 ALA H    . 139 . HN   1 1 
       1447 1 1 1 1 138 ALA MB   . 138 . HB*  1 1 
       1447 1 2 1 1 139 ALA H    . 139 . HN   1 1 
       1448 1 1 1 1 138 ALA H    . 138 . HN   1 1 
       1448 1 2 1 1 138 ALA MB   . 138 . HB*  1 1 
       1449 1 1 1 1 138 ALA H    . 138 . HN   1 1 
       1449 1 2 1 1 139 ALA H    . 139 . HN   1 1 
       1450 1 1 1 1 139 ALA MB   . 139 . HB*  1 1 
       1450 1 2 1 1 140 GLY H    . 140 . HN   1 1 
       1451 1 1 1 1 139 ALA H    . 139 . HN   1 1 
       1451 1 2 1 1 139 ALA MB   . 139 . HB*  1 1 
       1452 1 1 1 1 139 ALA H    . 139 . HN   1 1 
       1452 1 2 1 1 140 GLY H    . 140 . HN   1 1 
       1453 1 1 1 1 140 GLY H    . 140 . HN   1 1 
       1453 1 2 1 1 141 ARG H    . 141 . HN   1 1 
       1454 1 1 1 1 141 ARG HA   . 141 . HA   1 1 
       1454 1 2 1 1 141 ARG QG   . 141 . HG*  1 1 
       1455 1 1 1 1 141 ARG HA   . 141 . HA   1 1 
       1455 1 2 1 1 142 ASP H    . 142 . HN   1 1 
       1456 1 1 1 1 141 ARG QB   . 141 . HB*  1 1 
       1456 1 2 1 1 141 ARG QD   . 141 . HD*  1 1 
       1457 1 1 1 1 141 ARG QB   . 141 . HB*  1 1 
       1457 1 2 1 1 142 ASP H    . 142 . HN   1 1 
       1458 1 1 1 1 141 ARG QG   . 141 . HG*  1 1 
       1458 1 2 1 1 142 ASP H    . 142 . HN   1 1 
       1459 1 1 1 1 141 ARG H    . 141 . HN   1 1 
       1459 1 2 1 1 141 ARG QB   . 141 . HB*  1 1 
       1460 1 1 1 1 141 ARG H    . 141 . HN   1 1 
       1460 1 2 1 1 141 ARG QG   . 141 . HG*  1 1 
       1461 1 1 1 1 141 ARG H    . 141 . HN   1 1 
       1461 1 2 1 1 142 ASP H    . 142 . HN   1 1 
       1462 1 1 1 1 142 ASP H    . 142 . HN   1 1 
       1462 1 2 1 1 142 ASP QB   . 142 . HB*  1 1 
       1463 1 1 1 1 142 ASP H    . 142 . HN   1 1 
       1463 1 2 1 1 143 PRO QD   . 143 . HD*  1 1 
       1464 1 1 1 1 143 PRO QB   . 143 . HB*  1 1 
       1464 1 2 1 1 144 GLY H    . 144 . HN   1 1 
       1465 1 1 1 1 143 PRO HG3  . 143 . HG1  1 1 
       1465 1 2 1 1 144 GLY H    . 144 . HN   1 1 
       1466 1 1 1 1 143 PRO HG2  . 143 . HG2  1 1 
       1466 1 2 1 1 144 GLY H    . 144 . HN   1 1 
       1467 1 1 1 1 144 GLY QA   . 144 . HA*  1 1 
       1467 1 2 1 1 145 PRO HA   . 145 . HA   1 1 
       1468 1 1 1 1 144 GLY QA   . 144 . HA*  1 1 
       1468 1 2 1 1 145 PRO QD   . 145 . HD*  1 1 
       1469 1 1 1 1 144 GLY H    . 144 . HN   1 1 
       1469 1 2 1 1 145 PRO QD   . 145 . HD*  1 1 
       1470 1 1 1 1 145 PRO HA   . 145 . HA   1 1 
       1470 1 2 1 1 146 ASP QB   . 146 . HB*  1 1 
       1471 1 1 1 1 145 PRO HA   . 145 . HA   1 1 
       1471 1 2 1 1 146 ASP H    . 146 . HN   1 1 
       1472 1 1 1 1 145 PRO HB3  . 145 . HB1  1 1 
       1472 1 2 1 1 146 ASP H    . 146 . HN   1 1 
       1473 1 1 1 1 145 PRO HB2  . 145 . HB2  1 1 
       1473 1 2 1 1 146 ASP H    . 146 . HN   1 1 
       1474 1 1 1 1 145 PRO QG   . 145 . HG*  1 1 
       1474 1 2 1 1 147 PRO HD3  . 147 . HD1  1 1 
       1475 1 1 1 1 145 PRO QG   . 145 . HG*  1 1 
       1475 1 2 1 1 147 PRO HD2  . 147 . HD2  1 1 
       1476 1 1 1 1 145 PRO QG   . 145 . HG*  1 1 
       1476 1 2 1 1 147 PRO QG   . 147 . HG*  1 1 
       1477 1 1 1 1 146 ASP HA   . 146 . HA   1 1 
       1477 1 2 1 1 147 PRO HD3  . 147 . HD1  1 1 
       1478 1 1 1 1 146 ASP HA   . 146 . HA   1 1 
       1478 1 2 1 1 147 PRO HD2  . 147 . HD2  1 1 
       1479 1 1 1 1 146 ASP H    . 146 . HN   1 1 
       1479 1 2 1 1 146 ASP HB3  . 146 . HB1  1 1 
       1480 1 1 1 1 146 ASP H    . 146 . HN   1 1 
       1480 1 2 1 1 146 ASP HB2  . 146 . HB2  1 1 
       1481 1 1 1 1 148 PHE H    . 148 . HN   1 1 
       1481 1 2 1 1 149 TYR H    . 149 . HN   1 1 
       1482 1 1 1 1 149 TYR HA   . 149 . HA   1 1 
       1482 1 2 1 1 149 TYR QD   . 149 . HD*  1 1 
       1483 1 1 1 1 149 TYR H    . 149 . HN   1 1 
       1483 1 2 1 1 149 TYR HB3  . 149 . HB1  1 1 
       1484 1 1 1 1 149 TYR H    . 149 . HN   1 1 
       1484 1 2 1 1 149 TYR HB2  . 149 . HB2  1 1 
       1485 1 1 1 1 151 ARG HA   . 151 . HA   1 1 
       1485 1 2 1 1 151 ARG QD   . 151 . HD*  1 1 
       1486 1 1 1 1 151 ARG HA   . 151 . HA   1 1 
       1486 1 2 1 1 151 ARG QG   . 151 . HG*  1 1 
       1487 1 1 1 1 151 ARG QB   . 151 . HB*  1 1 
       1487 1 2 1 1 151 ARG QD   . 151 . HD*  1 1 
       1488 1 1 1 1 151 ARG QB   . 151 . HB*  1 1 
       1488 1 2 1 1 152 ARG H    . 152 . HN   1 1 
       1489 1 1 1 1 151 ARG H    . 151 . HN   1 1 
       1489 1 2 1 1 151 ARG QB   . 151 . HB*  1 1 
       1490 1 1 1 1 151 ARG H    . 151 . HN   1 1 
       1490 1 2 1 1 151 ARG HG3  . 151 . HG1  1 1 
       1491 1 1 1 1 151 ARG H    . 151 . HN   1 1 
       1491 1 2 1 1 151 ARG HG2  . 151 . HG2  1 1 
       1492 1 1 1 1 159 HIS HA   . 159 . HA   1 1 
       1492 1 2 1 1 160 HIS H    . 160 . HN   1 1 
       1493 1 1 1 1 159 HIS QB   . 159 . HB*  1 1 
       1493 1 2 1 1 160 HIS H    . 160 . HN   1 1 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

          1 1 . . . . . 1.8 1.8 3.39 1 1 
          2 1 . . . . . 1.8 1.8  4.0 1 1 
          3 1 . . . . . 1.8 1.8  3.6 1 1 
          4 1 . . . . . 1.8 1.8 3.33 1 1 
          5 1 . . . . . 1.8 1.8  4.1 1 1 
          6 1 . . . . . 1.8 1.8 6.05 1 1 
          7 1 . . . . . 1.8 1.8 3.89 1 1 
          8 1 . . . . . 1.8 1.8 5.87 1 1 
          9 1 . . . . . 1.8 1.8 4.74 1 1 
         10 1 . . . . . 1.8 1.8  3.6 1 1 
         11 1 . . . . . 1.8 1.8 4.25 1 1 
         12 1 . . . . . 1.8 1.8 3.63 1 1 
         13 1 . . . . . 1.8 1.8  3.9 1 1 
         14 1 . . . . . 1.8 1.8  3.9 1 1 
         15 1 . . . . . 1.8 1.8 3.89 1 1 
         16 1 . . . . . 1.8 1.8  4.2 1 1 
         17 1 . . . . . 1.8 1.8 4.83 1 1 
         18 1 . . . . . 1.8 1.8 3.32 1 1 
         19 1 . . . . . 1.8 1.8  4.3 1 1 
         20 1 . . . . . 1.8 1.8  4.3 1 1 
         21 1 . . . . . 1.8 1.8  3.8 1 1 
         22 1 . . . . . 1.8 1.8  4.0 1 1 
         23 1 . . . . . 1.8 1.8  5.3 1 1 
         24 1 . . . . . 1.8 1.8  5.3 1 1 
         25 1 . . . . . 1.8 1.8  4.6 1 1 
         26 1 . . . . . 1.8 1.8  4.6 1 1 
         27 1 . . . . . 1.8 1.8 4.65 1 1 
         28 1 . . . . . 1.8 1.8 3.38 1 1 
         29 1 . . . . . 1.8 1.8  4.0 1 1 
         30 1 . . . . . 1.8 1.8 3.41 1 1 
         31 1 . . . . . 1.8 1.8 5.16 1 1 
         32 1 . . . . . 1.8 1.8 4.51 1 1 
         33 1 . . . . . 1.8 1.8  3.5 1 1 
         34 1 . . . . . 1.8 1.8 4.15 1 1 
         35 1 . . . . . 1.8 1.8 5.53 1 1 
         36 1 . . . . . 1.8 1.8 5.51 1 1 
         37 1 . . . . . 1.8 1.8 5.51 1 1 
         38 1 . . . . . 1.8 1.8  5.1 1 1 
         39 1 . . . . . 1.8 1.8 3.62 1 1 
         40 1 . . . . . 1.8 1.8 4.02 1 1 
         41 1 . . . . . 1.8 1.8  4.8 1 1 
         42 1 . . . . . 1.8 1.8 3.54 1 1 
         43 1 . . . . . 1.8 1.8 3.36 1 1 
         44 1 . . . . . 1.8 1.8 3.49 1 1 
         45 1 . . . . . 1.8 1.8 3.78 1 1 
         46 1 . . . . . 1.8 1.8 4.15 1 1 
         47 1 . . . . . 1.8 1.8 5.86 1 1 
         48 1 . . . . . 1.8 1.8 4.49 1 1 
         49 1 . . . . . 1.8 1.8 4.77 1 1 
         50 1 . . . . . 1.8 1.8  5.2 1 1 
         51 1 . . . . . 1.8 1.8 5.31 1 1 
         52 1 . . . . . 1.8 1.8 3.96 1 1 
         53 1 . . . . . 1.8 1.8 3.95 1 1 
         54 1 . . . . . 1.8 1.8 3.56 1 1 
         55 1 . . . . . 1.8 1.8 5.04 1 1 
         56 1 . . . . . 1.8 1.8 5.19 1 1 
         57 1 . . . . . 1.8 1.8  3.1 1 1 
         58 1 . . . . . 1.8 1.8  4.4 1 1 
         59 1 . . . . . 1.8 1.8 4.26 1 1 
         60 1 . . . . . 1.8 1.8 4.06 1 1 
         61 1 . . . . . 1.8 1.8 4.68 1 1 
         62 1 . . . . . 1.8 1.8 3.78 1 1 
         63 1 . . . . . 1.8 1.8 3.73 1 1 
         64 1 . . . . . 1.8 1.8 5.26 1 1 
         65 1 . . . . . 1.8 1.8  4.4 1 1 
         66 1 . . . . . 1.8 1.8 3.74 1 1 
         67 1 . . . . . 1.8 1.8  4.4 1 1 
         68 1 . . . . . 1.8 1.8 3.78 1 1 
         69 1 . . . . . 1.8 1.8 3.94 1 1 
         70 1 . . . . . 1.8 1.8 3.75 1 1 
         71 1 . . . . . 1.8 1.8 3.25 1 1 
         72 1 . . . . . 1.8 1.8 4.15 1 1 
         73 1 . . . . . 1.8 1.8 4.44 1 1 
         74 1 . . . . . 1.8 1.8 4.84 1 1 
         75 1 . . . . . 1.8 1.8 3.78 1 1 
         76 1 . . . . . 1.8 1.8 4.19 1 1 
         77 1 . . . . . 1.8 1.8  4.2 1 1 
         78 1 . . . . . 1.8 1.8 3.84 1 1 
         79 1 . . . . . 1.8 1.8 4.28 1 1 
         80 1 . . . . . 1.8 1.8 5.13 1 1 
         81 1 . . . . . 1.8 1.8 5.63 1 1 
         82 1 . . . . . 1.8 1.8 3.52 1 1 
         83 1 . . . . . 1.8 1.8 4.63 1 1 
         84 1 . . . . . 1.8 1.8 4.06 1 1 
         85 1 . . . . . 1.8 1.8 4.94 1 1 
         86 1 . . . . . 1.8 1.8 5.84 1 1 
         87 1 . . . . . 1.8 1.8 4.75 1 1 
         88 1 . . . . . 1.8 1.8 5.47 1 1 
         89 1 . . . . . 1.8 1.8 5.47 1 1 
         90 1 . . . . . 1.8 1.8  5.2 1 1 
         91 1 . . . . . 1.8 1.8 3.48 1 1 
         92 1 . . . . . 1.8 1.8 4.95 1 1 
         93 1 . . . . . 1.8 1.8 4.15 1 1 
         94 1 . . . . . 1.8 1.8 5.08 1 1 
         95 1 . . . . . 1.8 1.8 3.92 1 1 
         96 1 . . . . . 1.8 1.8  5.6 1 1 
         97 1 . . . . . 1.8 1.8 4.51 1 1 
         98 1 . . . . . 1.8 1.8 4.79 1 1 
         99 1 . . . . . 1.8 1.8  4.5 1 1 
        100 1 . . . . . 1.8 1.8 5.44 1 1 
        101 1 . . . . . 1.8 1.8 3.83 1 1 
        102 1 . . . . . 1.8 1.8 4.19 1 1 
        103 1 . . . . . 1.8 1.8 3.94 1 1 
        104 1 . . . . . 1.8 1.8 4.66 1 1 
        105 1 . . . . . 1.8 1.8  4.4 1 1 
        106 1 . . . . . 1.8 1.8 4.71 1 1 
        107 1 . . . . . 1.8 1.8 5.16 1 1 
        108 1 . . . . . 1.8 1.8  5.2 1 1 
        109 1 . . . . . 1.8 1.8 3.49 1 1 
        110 1 . . . . . 1.8 1.8 4.27 1 1 
        111 1 . . . . . 1.8 1.8 4.75 1 1 
        112 1 . . . . . 1.8 1.8 5.07 1 1 
        113 1 . . . . . 1.8 1.8  3.1 1 1 
        114 1 . . . . . 1.8 1.8 4.57 1 1 
        115 1 . . . . . 1.8 1.8 5.79 1 1 
        116 1 . . . . . 1.8 1.8  4.7 1 1 
        117 1 . . . . . 1.8 1.8 5.27 1 1 
        118 1 . . . . . 1.8 1.8 3.58 1 1 
        119 1 . . . . . 1.8 1.8  3.9 1 1 
        120 1 . . . . . 1.8 1.8 5.21 1 1 
        121 1 . . . . . 1.8 1.8 4.02 1 1 
        122 1 . . . . . 1.8 1.8  4.2 1 1 
        123 1 . . . . . 1.8 1.8 3.94 1 1 
        124 1 . . . . . 1.8 1.8 3.31 1 1 
        125 1 . . . . . 1.8 1.8 5.36 1 1 
        126 1 . . . . . 1.8 1.8 5.22 1 1 
        127 1 . . . . . 1.8 1.8 5.89 1 1 
        128 1 . . . . . 1.8 1.8 4.73 1 1 
        129 1 . . . . . 1.8 1.8 5.57 1 1 
        130 1 . . . . . 1.8 1.8 5.57 1 1 
        131 1 . . . . . 1.8 1.8 5.32 1 1 
        132 1 . . . . . 1.8 1.8  3.7 1 1 
        133 1 . . . . . 1.8 1.8 4.91 1 1 
        134 1 . . . . . 1.8 1.8 4.73 1 1 
        135 1 . . . . . 1.8 1.8 5.57 1 1 
        136 1 . . . . . 1.8 1.8 5.57 1 1 
        137 1 . . . . . 1.8 1.8 5.32 1 1 
        138 1 . . . . . 1.8 1.8  3.7 1 1 
        139 1 . . . . . 1.8 1.8 4.91 1 1 
        140 1 . . . . . 1.8 1.8  5.2 1 1 
        141 1 . . . . . 1.8 1.8 4.51 1 1 
        142 1 . . . . . 1.8 1.8 4.98 1 1 
        143 1 . . . . . 1.8 1.8 4.98 1 1 
        144 1 . . . . . 1.8 1.8 5.32 1 1 
        145 1 . . . . . 1.8 1.8 4.51 1 1 
        146 1 . . . . . 1.8 1.8 4.88 1 1 
        147 1 . . . . . 1.8 1.8 4.96 1 1 
        148 1 . . . . . 1.8 1.8 4.96 1 1 
        149 1 . . . . . 1.8 1.8 5.83 1 1 
        150 1 . . . . . 1.8 1.8 5.83 1 1 
        151 1 . . . . . 1.8 1.8 4.99 1 1 
        152 1 . . . . . 1.8 1.8 4.23 1 1 
        153 1 . . . . . 1.8 1.8 4.99 1 1 
        154 1 . . . . . 1.8 1.8 5.35 1 1 
        155 1 . . . . . 1.8 1.8 3.36 1 1 
        156 1 . . . . . 1.8 1.8 4.84 1 1 
        157 1 . . . . . 1.8 1.8 4.73 1 1 
        158 1 . . . . . 1.8 1.8 4.05 1 1 
        159 1 . . . . . 1.8 1.8 5.02 1 1 
        160 1 . . . . . 1.8 1.8 4.46 1 1 
        161 1 . . . . . 1.8 1.8 3.58 1 1 
        162 1 . . . . . 1.8 1.8 3.58 1 1 
        163 1 . . . . . 1.8 1.8 5.93 1 1 
        164 1 . . . . . 1.8 1.8 5.44 1 1 
        165 1 . . . . . 1.8 1.8 4.65 1 1 
        166 1 . . . . . 1.8 1.8 4.25 1 1 
        167 1 . . . . . 1.8 1.8  5.2 1 1 
        168 1 . . . . . 1.8 1.8  4.7 1 1 
        169 1 . . . . . 1.8 1.8  5.4 1 1 
        170 1 . . . . . 1.8 1.8 4.68 1 1 
        171 1 . . . . . 1.8 1.8  5.2 1 1 
        172 1 . . . . . 1.8 1.8  4.7 1 1 
        173 1 . . . . . 1.8 1.8  5.3 1 1 
        174 1 . . . . . 1.8 1.8 4.68 1 1 
        175 1 . . . . . 1.8 1.8 3.44 1 1 
        176 1 . . . . . 1.8 1.8 5.24 1 1 
        177 1 . . . . . 1.8 1.8 5.24 1 1 
        178 1 . . . . . 1.8 1.8 3.31 1 1 
        179 1 . . . . . 1.8 1.8 3.81 1 1 
        180 1 . . . . . 1.8 1.8 3.32 1 1 
        181 1 . . . . . 1.8 1.8 4.97 1 1 
        182 1 . . . . . 1.8 1.8 4.54 1 1 
        183 1 . . . . . 1.8 1.8 4.29 1 1 
        184 1 . . . . . 1.8 1.8  3.6 1 1 
        185 1 . . . . . 1.8 1.8  4.0 1 1 
        186 1 . . . . . 1.8 1.8 4.32 1 1 
        187 1 . . . . . 1.8 1.8 3.37 1 1 
        188 1 . . . . . 1.8 1.8 3.78 1 1 
        189 1 . . . . . 1.8 1.8 5.17 1 1 
        190 1 . . . . . 1.8 1.8 3.34 1 1 
        191 1 . . . . . 1.8 1.8 4.73 1 1 
        192 1 . . . . . 1.8 1.8 6.05 1 1 
        193 1 . . . . . 1.8 1.8 6.05 1 1 
        194 1 . . . . . 1.8 1.8 4.25 1 1 
        195 1 . . . . . 1.8 1.8 3.12 1 1 
        196 1 . . . . . 1.8 1.8  4.0 1 1 
        197 1 . . . . . 1.8 1.8 4.72 1 1 
        198 1 . . . . . 1.8 1.8  4.4 1 1 
        199 1 . . . . . 1.8 1.8 4.57 1 1 
        200 1 . . . . . 1.8 1.8 4.21 1 1 
        201 1 . . . . . 1.8 1.8 4.64 1 1 
        202 1 . . . . . 1.8 1.8 3.37 1 1 
        203 1 . . . . . 1.8 1.8 4.89 1 1 
        204 1 . . . . . 1.8 1.8 4.19 1 1 
        205 1 . . . . . 1.8 1.8 3.73 1 1 
        206 1 . . . . . 1.8 1.8 4.48 1 1 
        207 1 . . . . . 1.8 1.8 3.26 1 1 
        208 1 . . . . . 1.8 1.8 4.79 1 1 
        209 1 . . . . . 1.8 1.8 3.97 1 1 
        210 1 . . . . . 1.8 1.8 4.54 1 1 
        211 1 . . . . . 1.8 1.8  4.0 1 1 
        212 1 . . . . . 1.8 1.8 4.61 1 1 
        213 1 . . . . . 1.8 1.8 5.82 1 1 
        214 1 . . . . . 1.8 1.8 4.27 1 1 
        215 1 . . . . . 1.8 1.8 4.71 1 1 
        216 1 . . . . . 1.8 1.8 5.13 1 1 
        217 1 . . . . . 1.8 1.8 4.27 1 1 
        218 1 . . . . . 1.8 1.8 4.71 1 1 
        219 1 . . . . . 1.8 1.8 5.13 1 1 
        220 1 . . . . . 1.8 1.8 4.19 1 1 
        221 1 . . . . . 1.8 1.8 4.03 1 1 
        222 1 . . . . . 1.8 1.8 5.85 1 1 
        223 1 . . . . . 1.8 1.8  5.4 1 1 
        224 1 . . . . . 1.8 1.8 4.15 1 1 
        225 1 . . . . . 1.8 1.8 4.08 1 1 
        226 1 . . . . . 1.8 1.8 4.14 1 1 
        227 1 . . . . . 1.8 1.8 5.85 1 1 
        228 1 . . . . . 1.8 1.8 6.05 1 1 
        229 1 . . . . . 1.8 1.8 3.64 1 1 
        230 1 . . . . . 1.8 1.8 3.78 1 1 
        231 1 . . . . . 1.8 1.8 3.44 1 1 
        232 1 . . . . . 1.8 1.8 6.05 1 1 
        233 1 . . . . . 1.8 1.8 4.38 1 1 
        234 1 . . . . . 1.8 1.8 3.12 1 1 
        235 1 . . . . . 1.8 1.8 4.35 1 1 
        236 1 . . . . . 1.8 1.8  5.1 1 1 
        237 1 . . . . . 1.8 1.8 5.51 1 1 
        238 1 . . . . . 1.8 1.8 5.97 1 1 
        239 1 . . . . . 1.8 1.8 5.68 1 1 
        240 1 . . . . . 1.8 1.8 3.65 1 1 
        241 1 . . . . . 1.8 1.8 4.27 1 1 
        242 1 . . . . . 1.8 1.8 4.27 1 1 
        243 1 . . . . . 1.8 1.8 3.88 1 1 
        244 1 . . . . . 1.8 1.8 4.95 1 1 
        245 1 . . . . . 1.8 1.8 5.37 1 1 
        246 1 . . . . . 1.8 1.8 5.47 1 1 
        247 1 . . . . . 1.8 1.8 4.33 1 1 
        248 1 . . . . . 1.8 1.8 3.51 1 1 
        249 1 . . . . . 1.8 1.8 3.98 1 1 
        250 1 . . . . . 1.8 1.8 5.15 1 1 
        251 1 . . . . . 1.8 1.8  4.0 1 1 
        252 1 . . . . . 1.8 1.8 5.14 1 1 
        253 1 . . . . . 1.8 1.8 3.27 1 1 
        254 1 . . . . . 1.8 1.8 3.89 1 1 
        255 1 . . . . . 1.8 1.8 4.89 1 1 
        256 1 . . . . . 1.8 1.8  3.3 1 1 
        257 1 . . . . . 1.8 1.8 5.15 1 1 
        258 1 . . . . . 1.8 1.8 5.22 1 1 
        259 1 . . . . . 1.8 1.8 3.27 1 1 
        260 1 . . . . . 1.8 1.8 4.51 1 1 
        261 1 . . . . . 1.8 1.8  3.9 1 1 
        262 1 . . . . . 1.8 1.8 4.57 1 1 
        263 1 . . . . . 1.8 1.8 5.67 1 1 
        264 1 . . . . . 1.8 1.8 3.36 1 1 
        265 1 . . . . . 1.8 1.8 4.71 1 1 
        266 1 . . . . . 1.8 1.8  4.2 1 1 
        267 1 . . . . . 1.8 1.8 4.66 1 1 
        268 1 . . . . . 1.8 1.8 4.95 1 1 
        269 1 . . . . . 1.8 1.8  4.1 1 1 
        270 1 . . . . . 1.8 1.8 4.42 1 1 
        271 1 . . . . . 1.8 1.8 3.66 1 1 
        272 1 . . . . . 1.8 1.8 5.16 1 1 
        273 1 . . . . . 1.8 1.8 5.38 1 1 
        274 1 . . . . . 1.8 1.8 4.21 1 1 
        275 1 . . . . . 1.8 1.8 4.32 1 1 
        276 1 . . . . . 1.8 1.8 4.32 1 1 
        277 1 . . . . . 1.8 1.8 4.87 1 1 
        278 1 . . . . . 1.8 1.8 5.14 1 1 
        279 1 . . . . . 1.8 1.8 4.32 1 1 
        280 1 . . . . . 1.8 1.8 4.32 1 1 
        281 1 . . . . . 1.8 1.8 4.87 1 1 
        282 1 . . . . . 1.8 1.8 5.14 1 1 
        283 1 . . . . . 1.8 1.8 5.44 1 1 
        284 1 . . . . . 1.8 1.8 5.21 1 1 
        285 1 . . . . . 1.8 1.8 3.49 1 1 
        286 1 . . . . . 1.8 1.8  4.1 1 1 
        287 1 . . . . . 1.8 1.8 5.02 1 1 
        288 1 . . . . . 1.8 1.8 3.79 1 1 
        289 1 . . . . . 1.8 1.8 5.22 1 1 
        290 1 . . . . . 1.8 1.8  4.3 1 1 
        291 1 . . . . . 1.8 1.8 4.26 1 1 
        292 1 . . . . . 1.8 1.8  4.8 1 1 
        293 1 . . . . . 1.8 1.8 4.28 1 1 
        294 1 . . . . . 1.8 1.8 6.03 1 1 
        295 1 . . . . . 1.8 1.8 4.94 1 1 
        296 1 . . . . . 1.8 1.8 3.95 1 1 
        297 1 . . . . . 1.8 1.8 4.03 1 1 
        298 1 . . . . . 1.8 1.8  5.0 1 1 
        299 1 . . . . . 1.8 1.8 5.01 1 1 
        300 1 . . . . . 1.8 1.8 4.96 1 1 
        301 1 . . . . . 1.8 1.8 5.12 1 1 
        302 1 . . . . . 1.8 1.8 4.37 1 1 
        303 1 . . . . . 1.8 1.8 5.04 1 1 
        304 1 . . . . . 1.8 1.8 4.36 1 1 
        305 1 . . . . . 1.8 1.8 5.32 1 1 
        306 1 . . . . . 1.8 1.8 5.18 1 1 
        307 1 . . . . . 1.8 1.8  5.0 1 1 
        308 1 . . . . . 1.8 1.8 5.87 1 1 
        309 1 . . . . . 1.8 1.8 3.82 1 1 
        310 1 . . . . . 1.8 1.8 4.89 1 1 
        311 1 . . . . . 1.8 1.8  4.8 1 1 
        312 1 . . . . . 1.8 1.8  4.8 1 1 
        313 1 . . . . . 1.8 1.8 4.89 1 1 
        314 1 . . . . . 1.8 1.8 4.89 1 1 
        315 1 . . . . . 1.8 1.8 4.39 1 1 
        316 1 . . . . . 1.8 1.8 4.96 1 1 
        317 1 . . . . . 1.8 1.8 4.93 1 1 
        318 1 . . . . . 1.8 1.8  4.8 1 1 
        319 1 . . . . . 1.8 1.8  5.0 1 1 
        320 1 . . . . . 1.8 1.8  5.0 1 1 
        321 1 . . . . . 1.8 1.8 3.54 1 1 
        322 1 . . . . . 1.8 1.8  4.3 1 1 
        323 1 . . . . . 1.8 1.8  4.6 1 1 
        324 1 . . . . . 1.8 1.8 3.33 1 1 
        325 1 . . . . . 1.8 1.8 3.63 1 1 
        326 1 . . . . . 1.8 1.8  5.6 1 1 
        327 1 . . . . . 1.8 1.8  5.6 1 1 
        328 1 . . . . . 1.8 1.8  3.7 1 1 
        329 1 . . . . . 1.8 1.8 4.32 1 1 
        330 1 . . . . . 1.8 1.8 3.59 1 1 
        331 1 . . . . . 1.8 1.8 3.44 1 1 
        332 1 . . . . . 1.8 1.8  5.1 1 1 
        333 1 . . . . . 1.8 1.8 3.33 1 1 
        334 1 . . . . . 1.8 1.8 3.15 1 1 
        335 1 . . . . . 1.8 1.8 3.51 1 1 
        336 1 . . . . . 1.8 1.8 3.52 1 1 
        337 1 . . . . . 1.8 1.8 4.94 1 1 
        338 1 . . . . . 1.8 1.8 4.94 1 1 
        339 1 . . . . . 1.8 1.8 3.61 1 1 
        340 1 . . . . . 1.8 1.8 5.69 1 1 
        341 1 . . . . . 1.8 1.8 5.64 1 1 
        342 1 . . . . . 1.8 1.8  4.6 1 1 
        343 1 . . . . . 1.8 1.8 6.05 1 1 
        344 1 . . . . . 1.8 1.8 5.35 1 1 
        345 1 . . . . . 1.8 1.8 3.69 1 1 
        346 1 . . . . . 1.8 1.8  4.3 1 1 
        347 1 . . . . . 1.8 1.8 4.49 1 1 
        348 1 . . . . . 1.8 1.8 4.38 1 1 
        349 1 . . . . . 1.8 1.8 3.73 1 1 
        350 1 . . . . . 1.8 1.8  4.3 1 1 
        351 1 . . . . . 1.8 1.8  4.7 1 1 
        352 1 . . . . . 1.8 1.8  4.7 1 1 
        353 1 . . . . . 1.8 1.8 4.77 1 1 
        354 1 . . . . . 1.8 1.8 4.13 1 1 
        355 1 . . . . . 1.8 1.8 5.64 1 1 
        356 1 . . . . . 1.8 1.8 4.46 1 1 
        357 1 . . . . . 1.8 1.8 4.03 1 1 
        358 1 . . . . . 1.8 1.8 4.59 1 1 
        359 1 . . . . . 1.8 1.8  3.7 1 1 
        360 1 . . . . . 1.8 1.8 4.99 1 1 
        361 1 . . . . . 1.8 1.8 3.61 1 1 
        362 1 . . . . . 1.8 1.8 3.38 1 1 
        363 1 . . . . . 1.8 1.8 4.38 1 1 
        364 1 . . . . . 1.8 1.8 3.37 1 1 
        365 1 . . . . . 1.8 1.8 3.53 1 1 
        366 1 . . . . . 1.8 1.8 5.12 1 1 
        367 1 . . . . . 1.8 1.8 5.12 1 1 
        368 1 . . . . . 1.8 1.8 4.98 1 1 
        369 1 . . . . . 1.8 1.8 4.54 1 1 
        370 1 . . . . . 1.8 1.8 4.49 1 1 
        371 1 . . . . . 1.8 1.8 4.53 1 1 
        372 1 . . . . . 1.8 1.8 4.48 1 1 
        373 1 . . . . . 1.8 1.8 6.05 1 1 
        374 1 . . . . . 1.8 1.8 5.05 1 1 
        375 1 . . . . . 1.8 1.8 6.03 1 1 
        376 1 . . . . . 1.8 1.8 4.75 1 1 
        377 1 . . . . . 1.8 1.8 4.48 1 1 
        378 1 . . . . . 1.8 1.8 5.67 1 1 
        379 1 . . . . . 1.8 1.8 5.05 1 1 
        380 1 . . . . . 1.8 1.8 6.03 1 1 
        381 1 . . . . . 1.8 1.8 4.75 1 1 
        382 1 . . . . . 1.8 1.8 3.62 1 1 
        383 1 . . . . . 1.8 1.8 3.62 1 1 
        384 1 . . . . . 1.8 1.8 3.83 1 1 
        385 1 . . . . . 1.8 1.8 4.16 1 1 
        386 1 . . . . . 1.8 1.8 4.71 1 1 
        387 1 . . . . . 1.8 1.8  5.0 1 1 
        388 1 . . . . . 1.8 1.8  4.4 1 1 
        389 1 . . . . . 1.8 1.8 5.28 1 1 
        390 1 . . . . . 1.8 1.8 3.64 1 1 
        391 1 . . . . . 1.8 1.8 5.41 1 1 
        392 1 . . . . . 1.8 1.8 5.59 1 1 
        393 1 . . . . . 1.8 1.8 4.76 1 1 
        394 1 . . . . . 1.8 1.8 3.22 1 1 
        395 1 . . . . . 1.8 1.8 3.66 1 1 
        396 1 . . . . . 1.8 1.8 4.52 1 1 
        397 1 . . . . . 1.8 1.8 3.33 1 1 
        398 1 . . . . . 1.8 1.8  5.2 1 1 
        399 1 . . . . . 1.8 1.8  5.2 1 1 
        400 1 . . . . . 1.8 1.8 6.05 1 1 
        401 1 . . . . . 1.8 1.8  4.5 1 1 
        402 1 . . . . . 1.8 1.8 4.99 1 1 
        403 1 . . . . . 1.8 1.8  4.6 1 1 
        404 1 . . . . . 1.8 1.8 5.09 1 1 
        405 1 . . . . . 1.8 1.8  5.6 1 1 
        406 1 . . . . . 1.8 1.8 4.69 1 1 
        407 1 . . . . . 1.8 1.8  4.0 1 1 
        408 1 . . . . . 1.8 1.8  4.6 1 1 
        409 1 . . . . . 1.8 1.8 4.52 1 1 
        410 1 . . . . . 1.8 1.8 4.19 1 1 
        411 1 . . . . . 1.8 1.8  4.0 1 1 
        412 1 . . . . . 1.8 1.8  4.6 1 1 
        413 1 . . . . . 1.8 1.8 4.52 1 1 
        414 1 . . . . . 1.8 1.8 4.19 1 1 
        415 1 . . . . . 1.8 1.8 5.75 1 1 
        416 1 . . . . . 1.8 1.8 6.05 1 1 
        417 1 . . . . . 1.8 1.8 3.49 1 1 
        418 1 . . . . . 1.8 1.8 5.49 1 1 
        419 1 . . . . . 1.8 1.8 3.47 1 1 
        420 1 . . . . . 1.8 1.8 5.75 1 1 
        421 1 . . . . . 1.8 1.8 3.72 1 1 
        422 1 . . . . . 1.8 1.8 3.98 1 1 
        423 1 . . . . . 1.8 1.8  5.1 1 1 
        424 1 . . . . . 1.8 1.8 5.67 1 1 
        425 1 . . . . . 1.8 1.8 4.89 1 1 
        426 1 . . . . . 1.8 1.8  3.6 1 1 
        427 1 . . . . . 1.8 1.8 4.19 1 1 
        428 1 . . . . . 1.8 1.8 4.23 1 1 
        429 1 . . . . . 1.8 1.8  5.0 1 1 
        430 1 . . . . . 1.8 1.8  5.0 1 1 
        431 1 . . . . . 1.8 1.8 4.94 1 1 
        432 1 . . . . . 1.8 1.8  5.5 1 1 
        433 1 . . . . . 1.8 1.8 5.54 1 1 
        434 1 . . . . . 1.8 1.8 5.62 1 1 
        435 1 . . . . . 1.8 1.8 5.47 1 1 
        436 1 . . . . . 1.8 1.8 5.47 1 1 
        437 1 . . . . . 1.8 1.8  4.6 1 1 
        438 1 . . . . . 1.8 1.8  4.8 1 1 
        439 1 . . . . . 1.8 1.8  5.1 1 1 
        440 1 . . . . . 1.8 1.8 6.05 1 1 
        441 1 . . . . . 1.8 1.8  4.3 1 1 
        442 1 . . . . . 1.8 1.8 5.79 1 1 
        443 1 . . . . . 1.8 1.8 5.68 1 1 
        444 1 . . . . . 1.8 1.8  5.4 1 1 
        445 1 . . . . . 1.8 1.8 4.28 1 1 
        446 1 . . . . . 1.8 1.8 4.28 1 1 
        447 1 . . . . . 1.8 1.8 4.29 1 1 
        448 1 . . . . . 1.8 1.8 4.87 1 1 
        449 1 . . . . . 1.8 1.8 3.98 1 1 
        450 1 . . . . . 1.8 1.8 3.75 1 1 
        451 1 . . . . . 1.8 1.8 5.32 1 1 
        452 1 . . . . . 1.8 1.8 4.94 1 1 
        453 1 . . . . . 1.8 1.8 4.72 1 1 
        454 1 . . . . . 1.8 1.8 4.83 1 1 
        455 1 . . . . . 1.8 1.8 4.96 1 1 
        456 1 . . . . . 1.8 1.8 5.18 1 1 
        457 1 . . . . . 1.8 1.8 5.18 1 1 
        458 1 . . . . . 1.8 1.8 4.75 1 1 
        459 1 . . . . . 1.8 1.8 4.17 1 1 
        460 1 . . . . . 1.8 1.8 3.29 1 1 
        461 1 . . . . . 1.8 1.8  4.8 1 1 
        462 1 . . . . . 1.8 1.8 3.34 1 1 
        463 1 . . . . . 1.8 1.8  5.2 1 1 
        464 1 . . . . . 1.8 1.8  4.8 1 1 
        465 1 . . . . . 1.8 1.8 4.71 1 1 
        466 1 . . . . . 1.8 1.8 6.05 1 1 
        467 1 . . . . . 1.8 1.8 5.51 1 1 
        468 1 . . . . . 1.8 1.8 4.96 1 1 
        469 1 . . . . . 1.8 1.8  5.9 1 1 
        470 1 . . . . . 1.8 1.8 5.51 1 1 
        471 1 . . . . . 1.8 1.8 4.96 1 1 
        472 1 . . . . . 1.8 1.8 3.58 1 1 
        473 1 . . . . . 1.8 1.8  4.5 1 1 
        474 1 . . . . . 1.8 1.8  4.5 1 1 
        475 1 . . . . . 1.8 1.8  3.3 1 1 
        476 1 . . . . . 1.8 1.8 3.86 1 1 
        477 1 . . . . . 1.8 1.8  5.0 1 1 
        478 1 . . . . . 1.8 1.8 3.88 1 1 
        479 1 . . . . . 1.8 1.8  4.1 1 1 
        480 1 . . . . . 1.8 1.8 3.29 1 1 
        481 1 . . . . . 1.8 1.8 4.89 1 1 
        482 1 . . . . . 1.8 1.8  4.5 1 1 
        483 1 . . . . . 1.8 1.8 3.94 1 1 
        484 1 . . . . . 1.8 1.8  4.3 1 1 
        485 1 . . . . . 1.8 1.8 3.95 1 1 
        486 1 . . . . . 1.8 1.8 4.82 1 1 
        487 1 . . . . . 1.8 1.8 4.82 1 1 
        488 1 . . . . . 1.8 1.8 3.79 1 1 
        489 1 . . . . . 1.8 1.8 4.02 1 1 
        490 1 . . . . . 1.8 1.8 3.74 1 1 
        491 1 . . . . . 1.8 1.8 4.91 1 1 
        492 1 . . . . . 1.8 1.8 4.74 1 1 
        493 1 . . . . . 1.8 1.8 5.24 1 1 
        494 1 . . . . . 1.8 1.8 4.31 1 1 
        495 1 . . . . . 1.8 1.8 6.05 1 1 
        496 1 . . . . . 1.8 1.8  5.4 1 1 
        497 1 . . . . . 1.8 1.8 3.81 1 1 
        498 1 . . . . . 1.8 1.8 5.51 1 1 
        499 1 . . . . . 1.8 1.8 4.58 1 1 
        500 1 . . . . . 1.8 1.8 3.98 1 1 
        501 1 . . . . . 1.8 1.8  5.4 1 1 
        502 1 . . . . . 1.8 1.8 4.64 1 1 
        503 1 . . . . . 1.8 1.8 4.16 1 1 
        504 1 . . . . . 1.8 1.8 5.33 1 1 
        505 1 . . . . . 1.8 1.8 4.59 1 1 
        506 1 . . . . . 1.8 1.8 5.08 1 1 
        507 1 . . . . . 1.8 1.8  4.2 1 1 
        508 1 . . . . . 1.8 1.8 3.72 1 1 
        509 1 . . . . . 1.8 1.8 6.05 1 1 
        510 1 . . . . . 1.8 1.8 6.01 1 1 
        511 1 . . . . . 1.8 1.8 6.01 1 1 
        512 1 . . . . . 1.8 1.8 3.99 1 1 
        513 1 . . . . . 1.8 1.8 5.39 1 1 
        514 1 . . . . . 1.8 1.8 4.72 1 1 
        515 1 . . . . . 1.8 1.8 3.53 1 1 
        516 1 . . . . . 1.8 1.8 5.07 1 1 
        517 1 . . . . . 1.8 1.8 3.35 1 1 
        518 1 . . . . . 1.8 1.8  4.3 1 1 
        519 1 . . . . . 1.8 1.8 3.33 1 1 
        520 1 . . . . . 1.8 1.8 4.21 1 1 
        521 1 . . . . . 1.8 1.8  5.0 1 1 
        522 1 . . . . . 1.8 1.8 4.27 1 1 
        523 1 . . . . . 1.8 1.8 4.27 1 1 
        524 1 . . . . . 1.8 1.8  4.0 1 1 
        525 1 . . . . . 1.8 1.8  4.2 1 1 
        526 1 . . . . . 1.8 1.8 5.01 1 1 
        527 1 . . . . . 1.8 1.8 4.17 1 1 
        528 1 . . . . . 1.8 1.8 4.28 1 1 
        529 1 . . . . . 1.8 1.8 4.69 1 1 
        530 1 . . . . . 1.8 1.8 4.08 1 1 
        531 1 . . . . . 1.8 1.8 4.23 1 1 
        532 1 . . . . . 1.8 1.8 4.23 1 1 
        533 1 . . . . . 1.8 1.8 3.33 1 1 
        534 1 . . . . . 1.8 1.8 5.32 1 1 
        535 1 . . . . . 1.8 1.8 3.63 1 1 
        536 1 . . . . . 1.8 1.8 4.33 1 1 
        537 1 . . . . . 1.8 1.8  3.9 1 1 
        538 1 . . . . . 1.8 1.8 3.41 1 1 
        539 1 . . . . . 1.8 1.8 4.72 1 1 
        540 1 . . . . . 1.8 1.8 4.03 1 1 
        541 1 . . . . . 1.8 1.8 5.07 1 1 
        542 1 . . . . . 1.8 1.8  4.7 1 1 
        543 1 . . . . . 1.8 1.8 3.48 1 1 
        544 1 . . . . . 1.8 1.8 4.98 1 1 
        545 1 . . . . . 1.8 1.8 4.39 1 1 
        546 1 . . . . . 1.8 1.8 4.54 1 1 
        547 1 . . . . . 1.8 1.8 5.64 1 1 
        548 1 . . . . . 1.8 1.8 5.64 1 1 
        549 1 . . . . . 1.8 1.8 4.58 1 1 
        550 1 . . . . . 1.8 1.8 4.58 1 1 
        551 1 . . . . . 1.8 1.8 5.03 1 1 
        552 1 . . . . . 1.8 1.8 5.08 1 1 
        553 1 . . . . . 1.8 1.8 4.26 1 1 
        554 1 . . . . . 1.8 1.8 6.03 1 1 
        555 1 . . . . . 1.8 1.8  5.2 1 1 
        556 1 . . . . . 1.8 1.8 5.44 1 1 
        557 1 . . . . . 1.8 1.8 5.95 1 1 
        558 1 . . . . . 1.8 1.8  5.6 1 1 
        559 1 . . . . . 1.8 1.8 4.91 1 1 
        560 1 . . . . . 1.8 1.8  4.4 1 1 
        561 1 . . . . . 1.8 1.8 3.71 1 1 
        562 1 . . . . . 1.8 1.8 4.17 1 1 
        563 1 . . . . . 1.8 1.8 4.36 1 1 
        564 1 . . . . . 1.8 1.8 4.36 1 1 
        565 1 . . . . . 1.8 1.8 4.91 1 1 
        566 1 . . . . . 1.8 1.8 4.09 1 1 
        567 1 . . . . . 1.8 1.8 4.44 1 1 
        568 1 . . . . . 1.8 1.8 3.43 1 1 
        569 1 . . . . . 1.8 1.8 5.04 1 1 
        570 1 . . . . . 1.8 1.8 4.53 1 1 
        571 1 . . . . . 1.8 1.8 4.06 1 1 
        572 1 . . . . . 1.8 1.8 4.58 1 1 
        573 1 . . . . . 1.8 1.8 4.62 1 1 
        574 1 . . . . . 1.8 1.8 4.06 1 1 
        575 1 . . . . . 1.8 1.8 4.58 1 1 
        576 1 . . . . . 1.8 1.8 4.62 1 1 
        577 1 . . . . . 1.8 1.8 3.99 1 1 
        578 1 . . . . . 1.8 1.8 6.05 1 1 
        579 1 . . . . . 1.8 1.8  5.4 1 1 
        580 1 . . . . . 1.8 1.8  4.4 1 1 
        581 1 . . . . . 1.8 1.8 4.33 1 1 
        582 1 . . . . . 1.8 1.8 4.68 1 1 
        583 1 . . . . . 1.8 1.8 4.68 1 1 
        584 1 . . . . . 1.8 1.8 4.03 1 1 
        585 1 . . . . . 1.8 1.8 4.05 1 1 
        586 1 . . . . . 1.8 1.8  3.3 1 1 
        587 1 . . . . . 1.8 1.8 4.32 1 1 
        588 1 . . . . . 1.8 1.8 4.27 1 1 
        589 1 . . . . . 1.8 1.8 3.62 1 1 
        590 1 . . . . . 1.8 1.8 4.25 1 1 
        591 1 . . . . . 1.8 1.8 4.14 1 1 
        592 1 . . . . . 1.8 1.8 3.45 1 1 
        593 1 . . . . . 1.8 1.8 4.03 1 1 
        594 1 . . . . . 1.8 1.8  5.1 1 1 
        595 1 . . . . . 1.8 1.8 4.61 1 1 
        596 1 . . . . . 1.8 1.8  3.9 1 1 
        597 1 . . . . . 1.8 1.8  3.9 1 1 
        598 1 . . . . . 1.8 1.8 3.49 1 1 
        599 1 . . . . . 1.8 1.8 4.53 1 1 
        600 1 . . . . . 1.8 1.8 4.81 1 1 
        601 1 . . . . . 1.8 1.8 5.39 1 1 
        602 1 . . . . . 1.8 1.8  4.4 1 1 
        603 1 . . . . . 1.8 1.8 5.39 1 1 
        604 1 . . . . . 1.8 1.8  4.4 1 1 
        605 1 . . . . . 1.8 1.8  4.6 1 1 
        606 1 . . . . . 1.8 1.8  5.2 1 1 
        607 1 . . . . . 1.8 1.8 5.67 1 1 
        608 1 . . . . . 1.8 1.8 5.59 1 1 
        609 1 . . . . . 1.8 1.8  3.7 1 1 
        610 1 . . . . . 1.8 1.8  3.7 1 1 
        611 1 . . . . . 1.8 1.8 4.94 1 1 
        612 1 . . . . . 1.8 1.8 4.77 1 1 
        613 1 . . . . . 1.8 1.8 4.59 1 1 
        614 1 . . . . . 1.8 1.8 3.69 1 1 
        615 1 . . . . . 1.8 1.8 4.41 1 1 
        616 1 . . . . . 1.8 1.8  5.9 1 1 
        617 1 . . . . . 1.8 1.8  5.9 1 1 
        618 1 . . . . . 1.8 1.8 5.81 1 1 
        619 1 . . . . . 1.8 1.8 5.15 1 1 
        620 1 . . . . . 1.8 1.8 5.25 1 1 
        621 1 . . . . . 1.8 1.8 3.94 1 1 
        622 1 . . . . . 1.8 1.8 5.25 1 1 
        623 1 . . . . . 1.8 1.8 3.94 1 1 
        624 1 . . . . . 1.8 1.8  5.4 1 1 
        625 1 . . . . . 1.8 1.8  5.4 1 1 
        626 1 . . . . . 1.8 1.8 6.05 1 1 
        627 1 . . . . . 1.8 1.8 4.71 1 1 
        628 1 . . . . . 1.8 1.8 4.89 1 1 
        629 1 . . . . . 1.8 1.8 4.88 1 1 
        630 1 . . . . . 1.8 1.8 5.21 1 1 
        631 1 . . . . . 1.8 1.8 4.94 1 1 
        632 1 . . . . . 1.8 1.8 3.86 1 1 
        633 1 . . . . . 1.8 1.8  3.6 1 1 
        634 1 . . . . . 1.8 1.8  5.6 1 1 
        635 1 . . . . . 1.8 1.8  5.4 1 1 
        636 1 . . . . . 1.8 1.8 3.86 1 1 
        637 1 . . . . . 1.8 1.8 3.74 1 1 
        638 1 . . . . . 1.8 1.8  4.2 1 1 
        639 1 . . . . . 1.8 1.8 5.09 1 1 
        640 1 . . . . . 1.8 1.8 5.19 1 1 
        641 1 . . . . . 1.8 1.8 6.05 1 1 
        642 1 . . . . . 1.8 1.8 4.88 1 1 
        643 1 . . . . . 1.8 1.8 3.64 1 1 
        644 1 . . . . . 1.8 1.8 5.63 1 1 
        645 1 . . . . . 1.8 1.8 4.62 1 1 
        646 1 . . . . . 1.8 1.8  4.1 1 1 
        647 1 . . . . . 1.8 1.8  3.8 1 1 
        648 1 . . . . . 1.8 1.8 3.82 1 1 
        649 1 . . . . . 1.8 1.8  3.6 1 1 
        650 1 . . . . . 1.8 1.8 4.03 1 1 
        651 1 . . . . . 1.8 1.8 4.82 1 1 
        652 1 . . . . . 1.8 1.8 5.08 1 1 
        653 1 . . . . . 1.8 1.8 4.59 1 1 
        654 1 . . . . . 1.8 1.8 4.61 1 1 
        655 1 . . . . . 1.8 1.8  5.0 1 1 
        656 1 . . . . . 1.8 1.8 5.81 1 1 
        657 1 . . . . . 1.8 1.8  5.1 1 1 
        658 1 . . . . . 1.8 1.8 5.65 1 1 
        659 1 . . . . . 1.8 1.8 5.65 1 1 
        660 1 . . . . . 1.8 1.8 4.88 1 1 
        661 1 . . . . . 1.8 1.8 4.44 1 1 
        662 1 . . . . . 1.8 1.8 5.09 1 1 
        663 1 . . . . . 1.8 1.8  5.6 1 1 
        664 1 . . . . . 1.8 1.8  4.8 1 1 
        665 1 . . . . . 1.8 1.8 4.89 1 1 
        666 1 . . . . . 1.8 1.8 3.67 1 1 
        667 1 . . . . . 1.8 1.8 3.87 1 1 
        668 1 . . . . . 1.8 1.8 5.74 1 1 
        669 1 . . . . . 1.8 1.8  5.2 1 1 
        670 1 . . . . . 1.8 1.8 3.93 1 1 
        671 1 . . . . . 1.8 1.8  5.0 1 1 
        672 1 . . . . . 1.8 1.8  4.6 1 1 
        673 1 . . . . . 1.8 1.8 5.72 1 1 
        674 1 . . . . . 1.8 1.8 4.42 1 1 
        675 1 . . . . . 1.8 1.8 4.81 1 1 
        676 1 . . . . . 1.8 1.8 3.87 1 1 
        677 1 . . . . . 1.8 1.8 3.71 1 1 
        678 1 . . . . . 1.8 1.8  4.7 1 1 
        679 1 . . . . . 1.8 1.8 5.53 1 1 
        680 1 . . . . . 1.8 1.8  5.2 1 1 
        681 1 . . . . . 1.8 1.8 4.73 1 1 
        682 1 . . . . . 1.8 1.8 4.73 1 1 
        683 1 . . . . . 1.8 1.8  4.4 1 1 
        684 1 . . . . . 1.8 1.8  5.7 1 1 
        685 1 . . . . . 1.8 1.8  3.8 1 1 
        686 1 . . . . . 1.8 1.8 5.13 1 1 
        687 1 . . . . . 1.8 1.8 4.31 1 1 
        688 1 . . . . . 1.8 1.8 3.82 1 1 
        689 1 . . . . . 1.8 1.8 5.19 1 1 
        690 1 . . . . . 1.8 1.8  5.1 1 1 
        691 1 . . . . . 1.8 1.8 4.07 1 1 
        692 1 . . . . . 1.8 1.8 3.51 1 1 
        693 1 . . . . . 1.8 1.8 3.51 1 1 
        694 1 . . . . . 1.8 1.8  4.3 1 1 
        695 1 . . . . . 1.8 1.8 4.39 1 1 
        696 1 . . . . . 1.8 1.8 3.76 1 1 
        697 1 . . . . . 1.8 1.8 4.99 1 1 
        698 1 . . . . . 1.8 1.8 4.99 1 1 
        699 1 . . . . . 1.8 1.8 4.85 1 1 
        700 1 . . . . . 1.8 1.8 3.85 1 1 
        701 1 . . . . . 1.8 1.8 4.31 1 1 
        702 1 . . . . . 1.8 1.8 5.04 1 1 
        703 1 . . . . . 1.8 1.8 4.75 1 1 
        704 1 . . . . . 1.8 1.8 5.21 1 1 
        705 1 . . . . . 1.8 1.8 6.04 1 1 
        706 1 . . . . . 1.8 1.8  5.5 1 1 
        707 1 . . . . . 1.8 1.8 4.46 1 1 
        708 1 . . . . . 1.8 1.8 4.46 1 1 
        709 1 . . . . . 1.8 1.8 3.87 1 1 
        710 1 . . . . . 1.8 1.8 4.31 1 1 
        711 1 . . . . . 1.8 1.8  4.3 1 1 
        712 1 . . . . . 1.8 1.8 4.32 1 1 
        713 1 . . . . . 1.8 1.8 4.32 1 1 
        714 1 . . . . . 1.8 1.8 5.95 1 1 
        715 1 . . . . . 1.8 1.8 4.21 1 1 
        716 1 . . . . . 1.8 1.8 5.38 1 1 
        717 1 . . . . . 1.8 1.8 5.27 1 1 
        718 1 . . . . . 1.8 1.8 3.95 1 1 
        719 1 . . . . . 1.8 1.8 5.18 1 1 
        720 1 . . . . . 1.8 1.8  4.3 1 1 
        721 1 . . . . . 1.8 1.8 4.92 1 1 
        722 1 . . . . . 1.8 1.8 4.88 1 1 
        723 1 . . . . . 1.8 1.8  4.3 1 1 
        724 1 . . . . . 1.8 1.8 4.93 1 1 
        725 1 . . . . . 1.8 1.8 3.84 1 1 
        726 1 . . . . . 1.8 1.8  4.3 1 1 
        727 1 . . . . . 1.8 1.8 5.84 1 1 
        728 1 . . . . . 1.8 1.8 4.36 1 1 
        729 1 . . . . . 1.8 1.8 4.71 1 1 
        730 1 . . . . . 1.8 1.8 4.94 1 1 
        731 1 . . . . . 1.8 1.8 5.12 1 1 
        732 1 . . . . . 1.8 1.8 4.07 1 1 
        733 1 . . . . . 1.8 1.8 5.43 1 1 
        734 1 . . . . . 1.8 1.8 3.93 1 1 
        735 1 . . . . . 1.8 1.8 5.78 1 1 
        736 1 . . . . . 1.8 1.8  4.4 1 1 
        737 1 . . . . . 1.8 1.8 3.76 1 1 
        738 1 . . . . . 1.8 1.8 3.93 1 1 
        739 1 . . . . . 1.8 1.8 4.64 1 1 
        740 1 . . . . . 1.8 1.8 4.04 1 1 
        741 1 . . . . . 1.8 1.8 4.27 1 1 
        742 1 . . . . . 1.8 1.8  5.4 1 1 
        743 1 . . . . . 1.8 1.8 4.95 1 1 
        744 1 . . . . . 1.8 1.8  4.8 1 1 
        745 1 . . . . . 1.8 1.8 5.63 1 1 
        746 1 . . . . . 1.8 1.8 4.68 1 1 
        747 1 . . . . . 1.8 1.8  4.5 1 1 
        748 1 . . . . . 1.8 1.8 3.84 1 1 
        749 1 . . . . . 1.8 1.8 4.62 1 1 
        750 1 . . . . . 1.8 1.8 3.21 1 1 
        751 1 . . . . . 1.8 1.8 5.01 1 1 
        752 1 . . . . . 1.8 1.8  5.4 1 1 
        753 1 . . . . . 1.8 1.8 3.67 1 1 
        754 1 . . . . . 1.8 1.8  5.0 1 1 
        755 1 . . . . . 1.8 1.8 5.01 1 1 
        756 1 . . . . . 1.8 1.8  5.4 1 1 
        757 1 . . . . . 1.8 1.8 3.67 1 1 
        758 1 . . . . . 1.8 1.8  5.2 1 1 
        759 1 . . . . . 1.8 1.8 4.84 1 1 
        760 1 . . . . . 1.8 1.8 4.38 1 1 
        761 1 . . . . . 1.8 1.8 5.24 1 1 
        762 1 . . . . . 1.8 1.8 4.15 1 1 
        763 1 . . . . . 1.8 1.8 4.23 1 1 
        764 1 . . . . . 1.8 1.8 4.83 1 1 
        765 1 . . . . . 1.8 1.8 3.69 1 1 
        766 1 . . . . . 1.8 1.8 4.03 1 1 
        767 1 . . . . . 1.8 1.8 3.27 1 1 
        768 1 . . . . . 1.8 1.8  4.2 1 1 
        769 1 . . . . . 1.8 1.8  4.0 1 1 
        770 1 . . . . . 1.8 1.8 4.91 1 1 
        771 1 . . . . . 1.8 1.8 5.15 1 1 
        772 1 . . . . . 1.8 1.8 4.71 1 1 
        773 1 . . . . . 1.8 1.8 4.58 1 1 
        774 1 . . . . . 1.8 1.8 4.31 1 1 
        775 1 . . . . . 1.8 1.8 5.51 1 1 
        776 1 . . . . . 1.8 1.8 4.71 1 1 
        777 1 . . . . . 1.8 1.8 4.64 1 1 
        778 1 . . . . . 1.8 1.8  5.1 1 1 
        779 1 . . . . . 1.8 1.8 6.05 1 1 
        780 1 . . . . . 1.8 1.8 6.05 1 1 
        781 1 . . . . . 1.8 1.8 3.35 1 1 
        782 1 . . . . . 1.8 1.8 4.85 1 1 
        783 1 . . . . . 1.8 1.8 3.81 1 1 
        784 1 . . . . . 1.8 1.8 5.14 1 1 
        785 1 . . . . . 1.8 1.8 4.14 1 1 
        786 1 . . . . . 1.8 1.8 3.33 1 1 
        787 1 . . . . . 1.8 1.8 3.52 1 1 
        788 1 . . . . . 1.8 1.8  3.5 1 1 
        789 1 . . . . . 1.8 1.8 4.75 1 1 
        790 1 . . . . . 1.8 1.8 4.88 1 1 
        791 1 . . . . . 1.8 1.8 4.75 1 1 
        792 1 . . . . . 1.8 1.8  4.4 1 1 
        793 1 . . . . . 1.8 1.8 3.81 1 1 
        794 1 . . . . . 1.8 1.8 4.75 1 1 
        795 1 . . . . . 1.8 1.8 4.89 1 1 
        796 1 . . . . . 1.8 1.8 5.02 1 1 
        797 1 . . . . . 1.8 1.8 4.71 1 1 
        798 1 . . . . . 1.8 1.8 4.18 1 1 
        799 1 . . . . . 1.8 1.8 4.38 1 1 
        800 1 . . . . . 1.8 1.8 5.01 1 1 
        801 1 . . . . . 1.8 1.8 5.38 1 1 
        802 1 . . . . . 1.8 1.8 3.71 1 1 
        803 1 . . . . . 1.8 1.8  4.8 1 1 
        804 1 . . . . . 1.8 1.8  4.3 1 1 
        805 1 . . . . . 1.8 1.8 3.98 1 1 
        806 1 . . . . . 1.8 1.8 5.68 1 1 
        807 1 . . . . . 1.8 1.8 3.83 1 1 
        808 1 . . . . . 1.8 1.8  4.2 1 1 
        809 1 . . . . . 1.8 1.8 3.37 1 1 
        810 1 . . . . . 1.8 1.8 4.87 1 1 
        811 1 . . . . . 1.8 1.8 4.53 1 1 
        812 1 . . . . . 1.8 1.8 4.42 1 1 
        813 1 . . . . . 1.8 1.8 5.01 1 1 
        814 1 . . . . . 1.8 1.8 4.54 1 1 
        815 1 . . . . . 1.8 1.8 4.54 1 1 
        816 1 . . . . . 1.8 1.8 3.65 1 1 
        817 1 . . . . . 1.8 1.8 4.47 1 1 
        818 1 . . . . . 1.8 1.8 4.69 1 1 
        819 1 . . . . . 1.8 1.8 5.53 1 1 
        820 1 . . . . . 1.8 1.8 4.61 1 1 
        821 1 . . . . . 1.8 1.8 4.42 1 1 
        822 1 . . . . . 1.8 1.8  4.8 1 1 
        823 1 . . . . . 1.8 1.8  4.3 1 1 
        824 1 . . . . . 1.8 1.8 3.81 1 1 
        825 1 . . . . . 1.8 1.8 3.69 1 1 
        826 1 . . . . . 1.8 1.8  4.8 1 1 
        827 1 . . . . . 1.8 1.8 6.05 1 1 
        828 1 . . . . . 1.8 1.8  5.1 1 1 
        829 1 . . . . . 1.8 1.8 5.12 1 1 
        830 1 . . . . . 1.8 1.8 4.25 1 1 
        831 1 . . . . . 1.8 1.8 6.05 1 1 
        832 1 . . . . . 1.8 1.8 5.15 1 1 
        833 1 . . . . . 1.8 1.8 3.75 1 1 
        834 1 . . . . . 1.8 1.8 3.27 1 1 
        835 1 . . . . . 1.8 1.8 5.74 1 1 
        836 1 . . . . . 1.8 1.8 3.16 1 1 
        837 1 . . . . . 1.8 1.8 5.05 1 1 
        838 1 . . . . . 1.8 1.8 5.13 1 1 
        839 1 . . . . . 1.8 1.8 3.48 1 1 
        840 1 . . . . . 1.8 1.8 4.32 1 1 
        841 1 . . . . . 1.8 1.8 5.29 1 1 
        842 1 . . . . . 1.8 1.8 5.29 1 1 
        843 1 . . . . . 1.8 1.8 4.92 1 1 
        844 1 . . . . . 1.8 1.8 4.41 1 1 
        845 1 . . . . . 1.8 1.8  5.7 1 1 
        846 1 . . . . . 1.8 1.8  4.1 1 1 
        847 1 . . . . . 1.8 1.8 4.54 1 1 
        848 1 . . . . . 1.8 1.8 5.18 1 1 
        849 1 . . . . . 1.8 1.8 3.75 1 1 
        850 1 . . . . . 1.8 1.8 3.22 1 1 
        851 1 . . . . . 1.8 1.8 4.51 1 1 
        852 1 . . . . . 1.8 1.8 5.14 1 1 
        853 1 . . . . . 1.8 1.8 4.37 1 1 
        854 1 . . . . . 1.8 1.8  5.3 1 1 
        855 1 . . . . . 1.8 1.8 3.67 1 1 
        856 1 . . . . . 1.8 1.8 4.71 1 1 
        857 1 . . . . . 1.8 1.8 4.69 1 1 
        858 1 . . . . . 1.8 1.8 4.82 1 1 
        859 1 . . . . . 1.8 1.8 5.91 1 1 
        860 1 . . . . . 1.8 1.8 4.94 1 1 
        861 1 . . . . . 1.8 1.8 3.94 1 1 
        862 1 . . . . . 1.8 1.8 5.04 1 1 
        863 1 . . . . . 1.8 1.8 3.84 1 1 
        864 1 . . . . . 1.8 1.8 4.07 1 1 
        865 1 . . . . . 1.8 1.8 5.64 1 1 
        866 1 . . . . . 1.8 1.8 5.85 1 1 
        867 1 . . . . . 1.8 1.8 4.29 1 1 
        868 1 . . . . . 1.8 1.8 4.42 1 1 
        869 1 . . . . . 1.8 1.8 3.97 1 1 
        870 1 . . . . . 1.8 1.8 4.89 1 1 
        871 1 . . . . . 1.8 1.8 4.03 1 1 
        872 1 . . . . . 1.8 1.8 3.81 1 1 
        873 1 . . . . . 1.8 1.8 3.94 1 1 
        874 1 . . . . . 1.8 1.8 5.98 1 1 
        875 1 . . . . . 1.8 1.8 5.53 1 1 
        876 1 . . . . . 1.8 1.8 5.28 1 1 
        877 1 . . . . . 1.8 1.8 4.92 1 1 
        878 1 . . . . . 1.8 1.8 5.15 1 1 
        879 1 . . . . . 1.8 1.8 6.05 1 1 
        880 1 . . . . . 1.8 1.8 5.07 1 1 
        881 1 . . . . . 1.8 1.8 5.42 1 1 
        882 1 . . . . . 1.8 1.8 6.05 1 1 
        883 1 . . . . . 1.8 1.8  4.6 1 1 
        884 1 . . . . . 1.8 1.8 5.05 1 1 
        885 1 . . . . . 1.8 1.8 4.22 1 1 
        886 1 . . . . . 1.8 1.8 5.28 1 1 
        887 1 . . . . . 1.8 1.8  4.8 1 1 
        888 1 . . . . . 1.8 1.8 4.11 1 1 
        889 1 . . . . . 1.8 1.8 3.84 1 1 
        890 1 . . . . . 1.8 1.8  4.3 1 1 
        891 1 . . . . . 1.8 1.8  5.7 1 1 
        892 1 . . . . . 1.8 1.8 5.51 1 1 
        893 1 . . . . . 1.8 1.8  5.8 1 1 
        894 1 . . . . . 1.8 1.8  4.8 1 1 
        895 1 . . . . . 1.8 1.8 3.83 1 1 
        896 1 . . . . . 1.8 1.8 5.14 1 1 
        897 1 . . . . . 1.8 1.8 3.92 1 1 
        898 1 . . . . . 1.8 1.8 5.85 1 1 
        899 1 . . . . . 1.8 1.8 5.06 1 1 
        900 1 . . . . . 1.8 1.8 3.75 1 1 
        901 1 . . . . . 1.8 1.8 4.77 1 1 
        902 1 . . . . . 1.8 1.8 4.77 1 1 
        903 1 . . . . . 1.8 1.8 4.88 1 1 
        904 1 . . . . . 1.8 1.8 3.82 1 1 
        905 1 . . . . . 1.8 1.8 4.15 1 1 
        906 1 . . . . . 1.8 1.8  4.3 1 1 
        907 1 . . . . . 1.8 1.8 3.67 1 1 
        908 1 . . . . . 1.8 1.8 3.67 1 1 
        909 1 . . . . . 1.8 1.8  4.8 1 1 
        910 1 . . . . . 1.8 1.8 4.41 1 1 
        911 1 . . . . . 1.8 1.8 5.06 1 1 
        912 1 . . . . . 1.8 1.8 5.06 1 1 
        913 1 . . . . . 1.8 1.8  3.9 1 1 
        914 1 . . . . . 1.8 1.8 4.64 1 1 
        915 1 . . . . . 1.8 1.8 4.64 1 1 
        916 1 . . . . . 1.8 1.8  4.6 1 1 
        917 1 . . . . . 1.8 1.8 3.83 1 1 
        918 1 . . . . . 1.8 1.8 3.62 1 1 
        919 1 . . . . . 1.8 1.8 3.39 1 1 
        920 1 . . . . . 1.8 1.8 4.91 1 1 
        921 1 . . . . . 1.8 1.8 4.95 1 1 
        922 1 . . . . . 1.8 1.8  5.4 1 1 
        923 1 . . . . . 1.8 1.8 4.81 1 1 
        924 1 . . . . . 1.8 1.8 4.74 1 1 
        925 1 . . . . . 1.8 1.8  5.4 1 1 
        926 1 . . . . . 1.8 1.8 4.47 1 1 
        927 1 . . . . . 1.8 1.8 4.47 1 1 
        928 1 . . . . . 1.8 1.8 3.83 1 1 
        929 1 . . . . . 1.8 1.8 4.88 1 1 
        930 1 . . . . . 1.8 1.8 4.02 1 1 
        931 1 . . . . . 1.8 1.8  3.6 1 1 
        932 1 . . . . . 1.8 1.8 3.56 1 1 
        933 1 . . . . . 1.8 1.8 4.62 1 1 
        934 1 . . . . . 1.8 1.8 4.62 1 1 
        935 1 . . . . . 1.8 1.8 4.62 1 1 
        936 1 . . . . . 1.8 1.8 4.64 1 1 
        937 1 . . . . . 1.8 1.8 3.83 1 1 
        938 1 . . . . . 1.8 1.8  4.7 1 1 
        939 1 . . . . . 1.8 1.8 6.05 1 1 
        940 1 . . . . . 1.8 1.8 3.67 1 1 
        941 1 . . . . . 1.8 1.8  4.1 1 1 
        942 1 . . . . . 1.8 1.8  4.6 1 1 
        943 1 . . . . . 1.8 1.8 3.87 1 1 
        944 1 . . . . . 1.8 1.8 4.35 1 1 
        945 1 . . . . . 1.8 1.8 5.51 1 1 
        946 1 . . . . . 1.8 1.8 3.74 1 1 
        947 1 . . . . . 1.8 1.8 5.33 1 1 
        948 1 . . . . . 1.8 1.8 4.33 1 1 
        949 1 . . . . . 1.8 1.8  5.4 1 1 
        950 1 . . . . . 1.8 1.8  5.4 1 1 
        951 1 . . . . . 1.8 1.8 3.78 1 1 
        952 1 . . . . . 1.8 1.8 4.38 1 1 
        953 1 . . . . . 1.8 1.8 3.66 1 1 
        954 1 . . . . . 1.8 1.8 6.05 1 1 
        955 1 . . . . . 1.8 1.8 4.62 1 1 
        956 1 . . . . . 1.8 1.8 5.28 1 1 
        957 1 . . . . . 1.8 1.8 4.23 1 1 
        958 1 . . . . . 1.8 1.8 3.51 1 1 
        959 1 . . . . . 1.8 1.8 4.23 1 1 
        960 1 . . . . . 1.8 1.8 3.51 1 1 
        961 1 . . . . . 1.8 1.8 4.13 1 1 
        962 1 . . . . . 1.8 1.8 4.37 1 1 
        963 1 . . . . . 1.8 1.8 5.44 1 1 
        964 1 . . . . . 1.8 1.8  4.2 1 1 
        965 1 . . . . . 1.8 1.8 4.42 1 1 
        966 1 . . . . . 1.8 1.8 4.79 1 1 
        967 1 . . . . . 1.8 1.8 4.27 1 1 
        968 1 . . . . . 1.8 1.8 4.27 1 1 
        969 1 . . . . . 1.8 1.8 5.14 1 1 
        970 1 . . . . . 1.8 1.8 5.33 1 1 
        971 1 . . . . . 1.8 1.8  4.4 1 1 
        972 1 . . . . . 1.8 1.8 4.74 1 1 
        973 1 . . . . . 1.8 1.8 5.07 1 1 
        974 1 . . . . . 1.8 1.8 3.71 1 1 
        975 1 . . . . . 1.8 1.8 4.35 1 1 
        976 1 . . . . . 1.8 1.8 4.86 1 1 
        977 1 . . . . . 1.8 1.8 4.41 1 1 
        978 1 . . . . . 1.8 1.8 3.78 1 1 
        979 1 . . . . . 1.8 1.8 4.59 1 1 
        980 1 . . . . . 1.8 1.8 4.59 1 1 
        981 1 . . . . . 1.8 1.8 5.49 1 1 
        982 1 . . . . . 1.8 1.8 4.29 1 1 
        983 1 . . . . . 1.8 1.8 5.05 1 1 
        984 1 . . . . . 1.8 1.8 4.69 1 1 
        985 1 . . . . . 1.8 1.8 5.14 1 1 
        986 1 . . . . . 1.8 1.8 5.17 1 1 
        987 1 . . . . . 1.8 1.8 5.43 1 1 
        988 1 . . . . . 1.8 1.8 4.65 1 1 
        989 1 . . . . . 1.8 1.8 4.63 1 1 
        990 1 . . . . . 1.8 1.8 3.31 1 1 
        991 1 . . . . . 1.8 1.8 4.09 1 1 
        992 1 . . . . . 1.8 1.8 3.87 1 1 
        993 1 . . . . . 1.8 1.8 4.58 1 1 
        994 1 . . . . . 1.8 1.8 5.13 1 1 
        995 1 . . . . . 1.8 1.8 5.58 1 1 
        996 1 . . . . . 1.8 1.8 5.93 1 1 
        997 1 . . . . . 1.8 1.8 5.25 1 1 
        998 1 . . . . . 1.8 1.8 4.21 1 1 
        999 1 . . . . . 1.8 1.8 4.88 1 1 
       1000 1 . . . . . 1.8 1.8 4.48 1 1 
       1001 1 . . . . . 1.8 1.8 3.39 1 1 
       1002 1 . . . . . 1.8 1.8 3.73 1 1 
       1003 1 . . . . . 1.8 1.8 5.31 1 1 
       1004 1 . . . . . 1.8 1.8 6.05 1 1 
       1005 1 . . . . . 1.8 1.8  3.4 1 1 
       1006 1 . . . . . 1.8 1.8 3.52 1 1 
       1007 1 . . . . . 1.8 1.8 4.86 1 1 
       1008 1 . . . . . 1.8 1.8 4.86 1 1 
       1009 1 . . . . . 1.8 1.8 3.44 1 1 
       1010 1 . . . . . 1.8 1.8 5.57 1 1 
       1011 1 . . . . . 1.8 1.8 3.92 1 1 
       1012 1 . . . . . 1.8 1.8 4.81 1 1 
       1013 1 . . . . . 1.8 1.8 4.05 1 1 
       1014 1 . . . . . 1.8 1.8 4.07 1 1 
       1015 1 . . . . . 1.8 1.8 3.67 1 1 
       1016 1 . . . . . 1.8 1.8 5.21 1 1 
       1017 1 . . . . . 1.8 1.8 4.95 1 1 
       1018 1 . . . . . 1.8 1.8  3.9 1 1 
       1019 1 . . . . . 1.8 1.8 5.02 1 1 
       1020 1 . . . . . 1.8 1.8 5.37 1 1 
       1021 1 . . . . . 1.8 1.8 5.37 1 1 
       1022 1 . . . . . 1.8 1.8 5.53 1 1 
       1023 1 . . . . . 1.8 1.8 3.18 1 1 
       1024 1 . . . . . 1.8 1.8 4.33 1 1 
       1025 1 . . . . . 1.8 1.8  4.0 1 1 
       1026 1 . . . . . 1.8 1.8 5.87 1 1 
       1027 1 . . . . . 1.8 1.8 3.78 1 1 
       1028 1 . . . . . 1.8 1.8 5.12 1 1 
       1029 1 . . . . . 1.8 1.8 5.09 1 1 
       1030 1 . . . . . 1.8 1.8 4.47 1 1 
       1031 1 . . . . . 1.8 1.8  5.6 1 1 
       1032 1 . . . . . 1.8 1.8  5.6 1 1 
       1033 1 . . . . . 1.8 1.8  5.6 1 1 
       1034 1 . . . . . 1.8 1.8  5.6 1 1 
       1035 1 . . . . . 1.8 1.8 4.88 1 1 
       1036 1 . . . . . 1.8 1.8 4.23 1 1 
       1037 1 . . . . . 1.8 1.8 4.69 1 1 
       1038 1 . . . . . 1.8 1.8 3.51 1 1 
       1039 1 . . . . . 1.8 1.8  5.2 1 1 
       1040 1 . . . . . 1.8 1.8  3.2 1 1 
       1041 1 . . . . . 1.8 1.8 3.96 1 1 
       1042 1 . . . . . 1.8 1.8 4.57 1 1 
       1043 1 . . . . . 1.8 1.8 3.43 1 1 
       1044 1 . . . . . 1.8 1.8  4.3 1 1 
       1045 1 . . . . . 1.8 1.8 4.49 1 1 
       1046 1 . . . . . 1.8 1.8 4.49 1 1 
       1047 1 . . . . . 1.8 1.8 4.59 1 1 
       1048 1 . . . . . 1.8 1.8 4.33 1 1 
       1049 1 . . . . . 1.8 1.8 6.05 1 1 
       1050 1 . . . . . 1.8 1.8  3.7 1 1 
       1051 1 . . . . . 1.8 1.8 4.29 1 1 
       1052 1 . . . . . 1.8 1.8 4.08 1 1 
       1053 1 . . . . . 1.8 1.8 3.49 1 1 
       1054 1 . . . . . 1.8 1.8 4.06 1 1 
       1055 1 . . . . . 1.8 1.8 3.79 1 1 
       1056 1 . . . . . 1.8 1.8 4.63 1 1 
       1057 1 . . . . . 1.8 1.8 3.93 1 1 
       1058 1 . . . . . 1.8 1.8 4.91 1 1 
       1059 1 . . . . . 1.8 1.8 4.23 1 1 
       1060 1 . . . . . 1.8 1.8 4.22 1 1 
       1061 1 . . . . . 1.8 1.8 4.22 1 1 
       1062 1 . . . . . 1.8 1.8 3.48 1 1 
       1063 1 . . . . . 1.8 1.8 3.38 1 1 
       1064 1 . . . . . 1.8 1.8 3.41 1 1 
       1065 1 . . . . . 1.8 1.8 5.27 1 1 
       1066 1 . . . . . 1.8 1.8 5.27 1 1 
       1067 1 . . . . . 1.8 1.8 4.37 1 1 
       1068 1 . . . . . 1.8 1.8 4.52 1 1 
       1069 1 . . . . . 1.8 1.8 4.18 1 1 
       1070 1 . . . . . 1.8 1.8  5.6 1 1 
       1071 1 . . . . . 1.8 1.8 3.97 1 1 
       1072 1 . . . . . 1.8 1.8  5.6 1 1 
       1073 1 . . . . . 1.8 1.8 5.02 1 1 
       1074 1 . . . . . 1.8 1.8 3.55 1 1 
       1075 1 . . . . . 1.8 1.8 3.55 1 1 
       1076 1 . . . . . 1.8 1.8  3.4 1 1 
       1077 1 . . . . . 1.8 1.8 4.26 1 1 
       1078 1 . . . . . 1.8 1.8  5.2 1 1 
       1079 1 . . . . . 1.8 1.8 5.12 1 1 
       1080 1 . . . . . 1.8 1.8 4.57 1 1 
       1081 1 . . . . . 1.8 1.8 4.36 1 1 
       1082 1 . . . . . 1.8 1.8 4.72 1 1 
       1083 1 . . . . . 1.8 1.8 3.45 1 1 
       1084 1 . . . . . 1.8 1.8 4.04 1 1 
       1085 1 . . . . . 1.8 1.8 4.82 1 1 
       1086 1 . . . . . 1.8 1.8 4.82 1 1 
       1087 1 . . . . . 1.8 1.8 3.45 1 1 
       1088 1 . . . . . 1.8 1.8 5.73 1 1 
       1089 1 . . . . . 1.8 1.8 6.05 1 1 
       1090 1 . . . . . 1.8 1.8 6.05 1 1 
       1091 1 . . . . . 1.8 1.8 5.53 1 1 
       1092 1 . . . . . 1.8 1.8  4.1 1 1 
       1093 1 . . . . . 1.8 1.8 4.11 1 1 
       1094 1 . . . . . 1.8 1.8 6.05 1 1 
       1095 1 . . . . . 1.8 1.8 3.78 1 1 
       1096 1 . . . . . 1.8 1.8 5.09 1 1 
       1097 1 . . . . . 1.8 1.8 3.33 1 1 
       1098 1 . . . . . 1.8 1.8 4.17 1 1 
       1099 1 . . . . . 1.8 1.8 5.82 1 1 
       1100 1 . . . . . 1.8 1.8 4.47 1 1 
       1101 1 . . . . . 1.8 1.8 5.03 1 1 
       1102 1 . . . . . 1.8 1.8 6.05 1 1 
       1103 1 . . . . . 1.8 1.8 5.22 1 1 
       1104 1 . . . . . 1.8 1.8 5.22 1 1 
       1105 1 . . . . . 1.8 1.8 4.55 1 1 
       1106 1 . . . . . 1.8 1.8 4.22 1 1 
       1107 1 . . . . . 1.8 1.8 3.97 1 1 
       1108 1 . . . . . 1.8 1.8 3.97 1 1 
       1109 1 . . . . . 1.8 1.8  4.2 1 1 
       1110 1 . . . . . 1.8 1.8 4.94 1 1 
       1111 1 . . . . . 1.8 1.8 3.59 1 1 
       1112 1 . . . . . 1.8 1.8 4.43 1 1 
       1113 1 . . . . . 1.8 1.8 4.53 1 1 
       1114 1 . . . . . 1.8 1.8 5.09 1 1 
       1115 1 . . . . . 1.8 1.8 4.16 1 1 
       1116 1 . . . . . 1.8 1.8 4.84 1 1 
       1117 1 . . . . . 1.8 1.8 4.99 1 1 
       1118 1 . . . . . 1.8 1.8 4.91 1 1 
       1119 1 . . . . . 1.8 1.8 5.44 1 1 
       1120 1 . . . . . 1.8 1.8 4.62 1 1 
       1121 1 . . . . . 1.8 1.8 5.44 1 1 
       1122 1 . . . . . 1.8 1.8 4.62 1 1 
       1123 1 . . . . . 1.8 1.8 4.03 1 1 
       1124 1 . . . . . 1.8 1.8 4.03 1 1 
       1125 1 . . . . . 1.8 1.8 5.32 1 1 
       1126 1 . . . . . 1.8 1.8 3.84 1 1 
       1127 1 . . . . . 1.8 1.8 4.46 1 1 
       1128 1 . . . . . 1.8 1.8 4.74 1 1 
       1129 1 . . . . . 1.8 1.8 3.37 1 1 
       1130 1 . . . . . 1.8 1.8 4.98 1 1 
       1131 1 . . . . . 1.8 1.8 3.61 1 1 
       1132 1 . . . . . 1.8 1.8 3.47 1 1 
       1133 1 . . . . . 1.8 1.8 3.82 1 1 
       1134 1 . . . . . 1.8 1.8  4.8 1 1 
       1135 1 . . . . . 1.8 1.8 4.83 1 1 
       1136 1 . . . . . 1.8 1.8 3.89 1 1 
       1137 1 . . . . . 1.8 1.8 4.49 1 1 
       1138 1 . . . . . 1.8 1.8 4.55 1 1 
       1139 1 . . . . . 1.8 1.8 5.28 1 1 
       1140 1 . . . . . 1.8 1.8 3.39 1 1 
       1141 1 . . . . . 1.8 1.8 5.74 1 1 
       1142 1 . . . . . 1.8 1.8 3.31 1 1 
       1143 1 . . . . . 1.8 1.8  4.3 1 1 
       1144 1 . . . . . 1.8 1.8 3.73 1 1 
       1145 1 . . . . . 1.8 1.8 4.52 1 1 
       1146 1 . . . . . 1.8 1.8 3.73 1 1 
       1147 1 . . . . . 1.8 1.8 4.52 1 1 
       1148 1 . . . . . 1.8 1.8 3.77 1 1 
       1149 1 . . . . . 1.8 1.8 4.97 1 1 
       1150 1 . . . . . 1.8 1.8 4.05 1 1 
       1151 1 . . . . . 1.8 1.8 4.05 1 1 
       1152 1 . . . . . 1.8 1.8 4.98 1 1 
       1153 1 . . . . . 1.8 1.8 4.71 1 1 
       1154 1 . . . . . 1.8 1.8 5.15 1 1 
       1155 1 . . . . . 1.8 1.8 5.31 1 1 
       1156 1 . . . . . 1.8 1.8 4.49 1 1 
       1157 1 . . . . . 1.8 1.8 4.52 1 1 
       1158 1 . . . . . 1.8 1.8 3.26 1 1 
       1159 1 . . . . . 1.8 1.8 5.89 1 1 
       1160 1 . . . . . 1.8 1.8 3.82 1 1 
       1161 1 . . . . . 1.8 1.8 4.63 1 1 
       1162 1 . . . . . 1.8 1.8 5.28 1 1 
       1163 1 . . . . . 1.8 1.8 3.82 1 1 
       1164 1 . . . . . 1.8 1.8 4.63 1 1 
       1165 1 . . . . . 1.8 1.8 5.28 1 1 
       1166 1 . . . . . 1.8 1.8  5.7 1 1 
       1167 1 . . . . . 1.8 1.8 5.44 1 1 
       1168 1 . . . . . 1.8 1.8 3.66 1 1 
       1169 1 . . . . . 1.8 1.8 4.26 1 1 
       1170 1 . . . . . 1.8 1.8 4.19 1 1 
       1171 1 . . . . . 1.8 1.8  4.8 1 1 
       1172 1 . . . . . 1.8 1.8 5.18 1 1 
       1173 1 . . . . . 1.8 1.8 5.18 1 1 
       1174 1 . . . . . 1.8 1.8 4.13 1 1 
       1175 1 . . . . . 1.8 1.8 3.88 1 1 
       1176 1 . . . . . 1.8 1.8 3.35 1 1 
       1177 1 . . . . . 1.8 1.8 4.41 1 1 
       1178 1 . . . . . 1.8 1.8 4.19 1 1 
       1179 1 . . . . . 1.8 1.8  5.9 1 1 
       1180 1 . . . . . 1.8 1.8 4.13 1 1 
       1181 1 . . . . . 1.8 1.8 4.13 1 1 
       1182 1 . . . . . 1.8 1.8 5.43 1 1 
       1183 1 . . . . . 1.8 1.8 4.57 1 1 
       1184 1 . . . . . 1.8 1.8  4.2 1 1 
       1185 1 . . . . . 1.8 1.8 3.28 1 1 
       1186 1 . . . . . 1.8 1.8 3.34 1 1 
       1187 1 . . . . . 1.8 1.8 5.18 1 1 
       1188 1 . . . . . 1.8 1.8 5.18 1 1 
       1189 1 . . . . . 1.8 1.8 4.85 1 1 
       1190 1 . . . . . 1.8 1.8 3.72 1 1 
       1191 1 . . . . . 1.8 1.8 5.38 1 1 
       1192 1 . . . . . 1.8 1.8 5.47 1 1 
       1193 1 . . . . . 1.8 1.8 4.69 1 1 
       1194 1 . . . . . 1.8 1.8 4.23 1 1 
       1195 1 . . . . . 1.8 1.8 4.86 1 1 
       1196 1 . . . . . 1.8 1.8 3.42 1 1 
       1197 1 . . . . . 1.8 1.8 3.85 1 1 
       1198 1 . . . . . 1.8 1.8  4.3 1 1 
       1199 1 . . . . . 1.8 1.8 4.49 1 1 
       1200 1 . . . . . 1.8 1.8 4.49 1 1 
       1201 1 . . . . . 1.8 1.8 5.87 1 1 
       1202 1 . . . . . 1.8 1.8 5.87 1 1 
       1203 1 . . . . . 1.8 1.8 5.67 1 1 
       1204 1 . . . . . 1.8 1.8 5.29 1 1 
       1205 1 . . . . . 1.8 1.8 4.41 1 1 
       1206 1 . . . . . 1.8 1.8 4.31 1 1 
       1207 1 . . . . . 1.8 1.8 5.19 1 1 
       1208 1 . . . . . 1.8 1.8 4.18 1 1 
       1209 1 . . . . . 1.8 1.8 4.68 1 1 
       1210 1 . . . . . 1.8 1.8 4.68 1 1 
       1211 1 . . . . . 1.8 1.8 4.87 1 1 
       1212 1 . . . . . 1.8 1.8 4.76 1 1 
       1213 1 . . . . . 1.8 1.8 5.02 1 1 
       1214 1 . . . . . 1.8 1.8 4.97 1 1 
       1215 1 . . . . . 1.8 1.8 3.82 1 1 
       1216 1 . . . . . 1.8 1.8 5.36 1 1 
       1217 1 . . . . . 1.8 1.8 5.04 1 1 
       1218 1 . . . . . 1.8 1.8 5.49 1 1 
       1219 1 . . . . . 1.8 1.8 5.73 1 1 
       1220 1 . . . . . 1.8 1.8 3.52 1 1 
       1221 1 . . . . . 1.8 1.8  3.5 1 1 
       1222 1 . . . . . 1.8 1.8 3.93 1 1 
       1223 1 . . . . . 1.8 1.8 5.37 1 1 
       1224 1 . . . . . 1.8 1.8 4.77 1 1 
       1225 1 . . . . . 1.8 1.8 4.16 1 1 
       1226 1 . . . . . 1.8 1.8 3.85 1 1 
       1227 1 . . . . . 1.8 1.8 4.16 1 1 
       1228 1 . . . . . 1.8 1.8 5.03 1 1 
       1229 1 . . . . . 1.8 1.8 4.77 1 1 
       1230 1 . . . . . 1.8 1.8 4.91 1 1 
       1231 1 . . . . . 1.8 1.8 6.05 1 1 
       1232 1 . . . . . 1.8 1.8 4.26 1 1 
       1233 1 . . . . . 1.8 1.8 4.25 1 1 
       1234 1 . . . . . 1.8 1.8 4.25 1 1 
       1235 1 . . . . . 1.8 1.8 3.49 1 1 
       1236 1 . . . . . 1.8 1.8  4.3 1 1 
       1237 1 . . . . . 1.8 1.8 4.28 1 1 
       1238 1 . . . . . 1.8 1.8 3.94 1 1 
       1239 1 . . . . . 1.8 1.8 3.94 1 1 
       1240 1 . . . . . 1.8 1.8 5.87 1 1 
       1241 1 . . . . . 1.8 1.8  4.3 1 1 
       1242 1 . . . . . 1.8 1.8 4.39 1 1 
       1243 1 . . . . . 1.8 1.8 5.28 1 1 
       1244 1 . . . . . 1.8 1.8 4.37 1 1 
       1245 1 . . . . . 1.8 1.8 5.06 1 1 
       1246 1 . . . . . 1.8 1.8 5.38 1 1 
       1247 1 . . . . . 1.8 1.8 4.37 1 1 
       1248 1 . . . . . 1.8 1.8 4.37 1 1 
       1249 1 . . . . . 1.8 1.8  5.6 1 1 
       1250 1 . . . . . 1.8 1.8 4.83 1 1 
       1251 1 . . . . . 1.8 1.8 4.83 1 1 
       1252 1 . . . . . 1.8 1.8 5.76 1 1 
       1253 1 . . . . . 1.8 1.8 5.76 1 1 
       1254 1 . . . . . 1.8 1.8 5.31 1 1 
       1255 1 . . . . . 1.8 1.8 4.19 1 1 
       1256 1 . . . . . 1.8 1.8 4.19 1 1 
       1257 1 . . . . . 1.8 1.8 5.08 1 1 
       1258 1 . . . . . 1.8 1.8 4.48 1 1 
       1259 1 . . . . . 1.8 1.8 4.04 1 1 
       1260 1 . . . . . 1.8 1.8 4.15 1 1 
       1261 1 . . . . . 1.8 1.8 5.39 1 1 
       1262 1 . . . . . 1.8 1.8 4.35 1 1 
       1263 1 . . . . . 1.8 1.8  3.9 1 1 
       1264 1 . . . . . 1.8 1.8 4.57 1 1 
       1265 1 . . . . . 1.8 1.8 4.57 1 1 
       1266 1 . . . . . 1.8 1.8 3.96 1 1 
       1267 1 . . . . . 1.8 1.8 4.68 1 1 
       1268 1 . . . . . 1.8 1.8 4.96 1 1 
       1269 1 . . . . . 1.8 1.8 3.84 1 1 
       1270 1 . . . . . 1.8 1.8 4.87 1 1 
       1271 1 . . . . . 1.8 1.8  5.1 1 1 
       1272 1 . . . . . 1.8 1.8 4.27 1 1 
       1273 1 . . . . . 1.8 1.8 4.09 1 1 
       1274 1 . . . . . 1.8 1.8 4.92 1 1 
       1275 1 . . . . . 1.8 1.8 3.55 1 1 
       1276 1 . . . . . 1.8 1.8 4.65 1 1 
       1277 1 . . . . . 1.8 1.8 3.73 1 1 
       1278 1 . . . . . 1.8 1.8 3.83 1 1 
       1279 1 . . . . . 1.8 1.8 4.46 1 1 
       1280 1 . . . . . 1.8 1.8 4.75 1 1 
       1281 1 . . . . . 1.8 1.8 3.58 1 1 
       1282 1 . . . . . 1.8 1.8 3.89 1 1 
       1283 1 . . . . . 1.8 1.8 4.79 1 1 
       1284 1 . . . . . 1.8 1.8  4.8 1 1 
       1285 1 . . . . . 1.8 1.8  4.0 1 1 
       1286 1 . . . . . 1.8 1.8 4.46 1 1 
       1287 1 . . . . . 1.8 1.8 4.32 1 1 
       1288 1 . . . . . 1.8 1.8 4.04 1 1 
       1289 1 . . . . . 1.8 1.8 4.83 1 1 
       1290 1 . . . . . 1.8 1.8 5.07 1 1 
       1291 1 . . . . . 1.8 1.8 5.25 1 1 
       1292 1 . . . . . 1.8 1.8 3.75 1 1 
       1293 1 . . . . . 1.8 1.8 4.17 1 1 
       1294 1 . . . . . 1.8 1.8 4.17 1 1 
       1295 1 . . . . . 1.8 1.8 3.63 1 1 
       1296 1 . . . . . 1.8 1.8  4.5 1 1 
       1297 1 . . . . . 1.8 1.8 3.76 1 1 
       1298 1 . . . . . 1.8 1.8 4.52 1 1 
       1299 1 . . . . . 1.8 1.8 3.34 1 1 
       1300 1 . . . . . 1.8 1.8 3.98 1 1 
       1301 1 . . . . . 1.8 1.8 5.26 1 1 
       1302 1 . . . . . 1.8 1.8 3.86 1 1 
       1303 1 . . . . . 1.8 1.8 4.36 1 1 
       1304 1 . . . . . 1.8 1.8 4.16 1 1 
       1305 1 . . . . . 1.8 1.8 4.19 1 1 
       1306 1 . . . . . 1.8 1.8 4.19 1 1 
       1307 1 . . . . . 1.8 1.8 4.65 1 1 
       1308 1 . . . . . 1.8 1.8 5.17 1 1 
       1309 1 . . . . . 1.8 1.8 3.97 1 1 
       1310 1 . . . . . 1.8 1.8 4.79 1 1 
       1311 1 . . . . . 1.8 1.8 3.48 1 1 
       1312 1 . . . . . 1.8 1.8 4.71 1 1 
       1313 1 . . . . . 1.8 1.8 4.15 1 1 
       1314 1 . . . . . 1.8 1.8 3.94 1 1 
       1315 1 . . . . . 1.8 1.8 3.63 1 1 
       1316 1 . . . . . 1.8 1.8 5.13 1 1 
       1317 1 . . . . . 1.8 1.8 4.29 1 1 
       1318 1 . . . . . 1.8 1.8 5.25 1 1 
       1319 1 . . . . . 1.8 1.8 3.63 1 1 
       1320 1 . . . . . 1.8 1.8 4.32 1 1 
       1321 1 . . . . . 1.8 1.8 4.04 1 1 
       1322 1 . . . . . 1.8 1.8 4.91 1 1 
       1323 1 . . . . . 1.8 1.8 4.37 1 1 
       1324 1 . . . . . 1.8 1.8 4.87 1 1 
       1325 1 . . . . . 1.8 1.8 4.87 1 1 
       1326 1 . . . . . 1.8 1.8 4.62 1 1 
       1327 1 . . . . . 1.8 1.8 4.41 1 1 
       1328 1 . . . . . 1.8 1.8 4.63 1 1 
       1329 1 . . . . . 1.8 1.8 4.68 1 1 
       1330 1 . . . . . 1.8 1.8  5.4 1 1 
       1331 1 . . . . . 1.8 1.8  4.4 1 1 
       1332 1 . . . . . 1.8 1.8 4.54 1 1 
       1333 1 . . . . . 1.8 1.8 5.32 1 1 
       1334 1 . . . . . 1.8 1.8 3.85 1 1 
       1335 1 . . . . . 1.8 1.8 5.42 1 1 
       1336 1 . . . . . 1.8 1.8 3.54 1 1 
       1337 1 . . . . . 1.8 1.8 4.55 1 1 
       1338 1 . . . . . 1.8 1.8 4.63 1 1 
       1339 1 . . . . . 1.8 1.8 4.63 1 1 
       1340 1 . . . . . 1.8 1.8  4.0 1 1 
       1341 1 . . . . . 1.8 1.8 4.55 1 1 
       1342 1 . . . . . 1.8 1.8 5.33 1 1 
       1343 1 . . . . . 1.8 1.8 5.02 1 1 
       1344 1 . . . . . 1.8 1.8 5.29 1 1 
       1345 1 . . . . . 1.8 1.8 4.14 1 1 
       1346 1 . . . . . 1.8 1.8 5.86 1 1 
       1347 1 . . . . . 1.8 1.8 6.05 1 1 
       1348 1 . . . . . 1.8 1.8 5.86 1 1 
       1349 1 . . . . . 1.8 1.8 6.05 1 1 
       1350 1 . . . . . 1.8 1.8 4.71 1 1 
       1351 1 . . . . . 1.8 1.8 4.68 1 1 
       1352 1 . . . . . 1.8 1.8 3.61 1 1 
       1353 1 . . . . . 1.8 1.8  4.0 1 1 
       1354 1 . . . . . 1.8 1.8 4.69 1 1 
       1355 1 . . . . . 1.8 1.8 4.66 1 1 
       1356 1 . . . . . 1.8 1.8 4.86 1 1 
       1357 1 . . . . . 1.8 1.8 3.31 1 1 
       1358 1 . . . . . 1.8 1.8 4.48 1 1 
       1359 1 . . . . . 1.8 1.8  4.1 1 1 
       1360 1 . . . . . 1.8 1.8  4.1 1 1 
       1361 1 . . . . . 1.8 1.8 3.96 1 1 
       1362 1 . . . . . 1.8 1.8 5.05 1 1 
       1363 1 . . . . . 1.8 1.8 4.87 1 1 
       1364 1 . . . . . 1.8 1.8 4.27 1 1 
       1365 1 . . . . . 1.8 1.8 4.38 1 1 
       1366 1 . . . . . 1.8 1.8 4.63 1 1 
       1367 1 . . . . . 1.8 1.8 4.99 1 1 
       1368 1 . . . . . 1.8 1.8 5.03 1 1 
       1369 1 . . . . . 1.8 1.8 5.03 1 1 
       1370 1 . . . . . 1.8 1.8 4.13 1 1 
       1371 1 . . . . . 1.8 1.8 5.42 1 1 
       1372 1 . . . . . 1.8 1.8 6.05 1 1 
       1373 1 . . . . . 1.8 1.8 5.57 1 1 
       1374 1 . . . . . 1.8 1.8 5.57 1 1 
       1375 1 . . . . . 1.8 1.8 5.28 1 1 
       1376 1 . . . . . 1.8 1.8 6.05 1 1 
       1377 1 . . . . . 1.8 1.8 4.58 1 1 
       1378 1 . . . . . 1.8 1.8 4.19 1 1 
       1379 1 . . . . . 1.8 1.8 4.13 1 1 
       1380 1 . . . . . 1.8 1.8 3.66 1 1 
       1381 1 . . . . . 1.8 1.8 5.28 1 1 
       1382 1 . . . . . 1.8 1.8 4.65 1 1 
       1383 1 . . . . . 1.8 1.8 5.59 1 1 
       1384 1 . . . . . 1.8 1.8 4.47 1 1 
       1385 1 . . . . . 1.8 1.8 4.77 1 1 
       1386 1 . . . . . 1.8 1.8 4.21 1 1 
       1387 1 . . . . . 1.8 1.8 4.41 1 1 
       1388 1 . . . . . 1.8 1.8 4.41 1 1 
       1389 1 . . . . . 1.8 1.8 5.63 1 1 
       1390 1 . . . . . 1.8 1.8 4.58 1 1 
       1391 1 . . . . . 1.8 1.8 4.72 1 1 
       1392 1 . . . . . 1.8 1.8 5.15 1 1 
       1393 1 . . . . . 1.8 1.8 6.05 1 1 
       1394 1 . . . . . 1.8 1.8 4.37 1 1 
       1395 1 . . . . . 1.8 1.8 4.92 1 1 
       1396 1 . . . . . 1.8 1.8 5.17 1 1 
       1397 1 . . . . . 1.8 1.8 5.07 1 1 
       1398 1 . . . . . 1.8 1.8 3.82 1 1 
       1399 1 . . . . . 1.8 1.8  5.1 1 1 
       1400 1 . . . . . 1.8 1.8 4.94 1 1 
       1401 1 . . . . . 1.8 1.8  5.3 1 1 
       1402 1 . . . . . 1.8 1.8 4.41 1 1 
       1403 1 . . . . . 1.8 1.8 4.44 1 1 
       1404 1 . . . . . 1.8 1.8  3.5 1 1 
       1405 1 . . . . . 1.8 1.8 3.88 1 1 
       1406 1 . . . . . 1.8 1.8 4.87 1 1 
       1407 1 . . . . . 1.8 1.8 5.42 1 1 
       1408 1 . . . . . 1.8 1.8 4.82 1 1 
       1409 1 . . . . . 1.8 1.8  3.9 1 1 
       1410 1 . . . . . 1.8 1.8 4.72 1 1 
       1411 1 . . . . . 1.8 1.8 4.75 1 1 
       1412 1 . . . . . 1.8 1.8 4.26 1 1 
       1413 1 . . . . . 1.8 1.8 3.69 1 1 
       1414 1 . . . . . 1.8 1.8 3.49 1 1 
       1415 1 . . . . . 1.8 1.8 4.22 1 1 
       1416 1 . . . . . 1.8 1.8 3.79 1 1 
       1417 1 . . . . . 1.8 1.8 4.35 1 1 
       1418 1 . . . . . 1.8 1.8 4.35 1 1 
       1419 1 . . . . . 1.8 1.8 5.89 1 1 
       1420 1 . . . . . 1.8 1.8 3.93 1 1 
       1421 1 . . . . . 1.8 1.8 4.27 1 1 
       1422 1 . . . . . 1.8 1.8 4.26 1 1 
       1423 1 . . . . . 1.8 1.8 4.22 1 1 
       1424 1 . . . . . 1.8 1.8 4.22 1 1 
       1425 1 . . . . . 1.8 1.8 5.25 1 1 
       1426 1 . . . . . 1.8 1.8  4.2 1 1 
       1427 1 . . . . . 1.8 1.8  4.2 1 1 
       1428 1 . . . . . 1.8 1.8  4.1 1 1 
       1429 1 . . . . . 1.8 1.8 3.95 1 1 
       1430 1 . . . . . 1.8 1.8  3.6 1 1 
       1431 1 . . . . . 1.8 1.8 3.49 1 1 
       1432 1 . . . . . 1.8 1.8 4.22 1 1 
       1433 1 . . . . . 1.8 1.8 4.33 1 1 
       1434 1 . . . . . 1.8 1.8 3.86 1 1 
       1435 1 . . . . . 1.8 1.8 4.17 1 1 
       1436 1 . . . . . 1.8 1.8  4.3 1 1 
       1437 1 . . . . . 1.8 1.8 5.22 1 1 
       1438 1 . . . . . 1.8 1.8 4.76 1 1 
       1439 1 . . . . . 1.8 1.8 6.05 1 1 
       1440 1 . . . . . 1.8 1.8 3.43 1 1 
       1441 1 . . . . . 1.8 1.8 4.39 1 1 
       1442 1 . . . . . 1.8 1.8 3.59 1 1 
       1443 1 . . . . . 1.8 1.8 4.29 1 1 
       1444 1 . . . . . 1.8 1.8 3.55 1 1 
       1445 1 . . . . . 1.8 1.8 3.84 1 1 
       1446 1 . . . . . 1.8 1.8 3.93 1 1 
       1447 1 . . . . . 1.8 1.8  3.5 1 1 
       1448 1 . . . . . 1.8 1.8 3.18 1 1 
       1449 1 . . . . . 1.8 1.8 3.54 1 1 
       1450 1 . . . . . 1.8 1.8  4.0 1 1 
       1451 1 . . . . . 1.8 1.8 3.36 1 1 
       1452 1 . . . . . 1.8 1.8 3.39 1 1 
       1453 1 . . . . . 1.8 1.8  4.1 1 1 
       1454 1 . . . . . 1.8 1.8 3.78 1 1 
       1455 1 . . . . . 1.8 1.8  3.6 1 1 
       1456 1 . . . . . 1.8 1.8 3.41 1 1 
       1457 1 . . . . . 1.8 1.8  4.0 1 1 
       1458 1 . . . . . 1.8 1.8 4.76 1 1 
       1459 1 . . . . . 1.8 1.8 3.54 1 1 
       1460 1 . . . . . 1.8 1.8  4.2 1 1 
       1461 1 . . . . . 1.8 1.8 5.22 1 1 
       1462 1 . . . . . 1.8 1.8 3.39 1 1 
       1463 1 . . . . . 1.8 1.8  4.8 1 1 
       1464 1 . . . . . 1.8 1.8 4.04 1 1 
       1465 1 . . . . . 1.8 1.8  5.7 1 1 
       1466 1 . . . . . 1.8 1.8  5.7 1 1 
       1467 1 . . . . . 1.8 1.8 4.69 1 1 
       1468 1 . . . . . 1.8 1.8 3.26 1 1 
       1469 1 . . . . . 1.8 1.8  4.3 1 1 
       1470 1 . . . . . 1.8 1.8 5.01 1 1 
       1471 1 . . . . . 1.8 1.8  3.6 1 1 
       1472 1 . . . . . 1.8 1.8 5.09 1 1 
       1473 1 . . . . . 1.8 1.8 5.09 1 1 
       1474 1 . . . . . 1.8 1.8 5.14 1 1 
       1475 1 . . . . . 1.8 1.8 5.14 1 1 
       1476 1 . . . . . 1.8 1.8  5.0 1 1 
       1477 1 . . . . . 1.8 1.8 3.84 1 1 
       1478 1 . . . . . 1.8 1.8 3.84 1 1 
       1479 1 . . . . . 1.8 1.8 4.19 1 1 
       1480 1 . . . . . 1.8 1.8 4.19 1 1 
       1481 1 . . . . . 1.8 1.8 4.54 1 1 
       1482 1 . . . . . 1.8 1.8 4.35 1 1 
       1483 1 . . . . . 1.8 1.8 4.14 1 1 
       1484 1 . . . . . 1.8 1.8 4.14 1 1 
       1485 1 . . . . . 1.8 1.8 5.32 1 1 
       1486 1 . . . . . 1.8 1.8 3.92 1 1 
       1487 1 . . . . . 1.8 1.8  3.2 1 1 
       1488 1 . . . . . 1.8 1.8  4.3 1 1 
       1489 1 . . . . . 1.8 1.8  3.9 1 1 
       1490 1 . . . . . 1.8 1.8 5.28 1 1 
       1491 1 . . . . . 1.8 1.8 5.28 1 1 
       1492 1 . . . . . 1.8 1.8 3.84 1 1 
       1493 1 . . . . . 1.8 1.8 4.35 1 1 
    stop_

save_


save_CNS/XPLOR_distance_constraints_4_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  2
    _Distance_constraint_list.Constraint_type     "hydrogen bond"
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

        1 1 . . . 1 2 
        2 1 . . . 1 2 
        3 1 . . . 1 2 
        4 1 . . . 1 2 
        5 1 . . . 1 2 
        6 1 . . . 1 2 
        7 1 . . . 1 2 
        8 1 . . . 1 2 
        9 1 . . . 1 2 
       10 1 . . . 1 2 
       11 1 . . . 1 2 
       12 1 . . . 1 2 
       13 1 . . . 1 2 
       14 1 . . . 1 2 
       15 1 . . . 1 2 
       16 1 . . . 1 2 
       17 1 . . . 1 2 
       18 1 . . . 1 2 
       19 1 . . . 1 2 
       20 1 . . . 1 2 
       21 1 . . . 1 2 
       22 1 . . . 1 2 
       23 1 . . . 1 2 
       24 1 . . . 1 2 
       25 1 . . . 1 2 
       26 1 . . . 1 2 
       27 1 . . . 1 2 
       28 1 . . . 1 2 
       29 1 . . . 1 2 
       30 1 . . . 1 2 
       31 1 . . . 1 2 
       32 1 . . . 1 2 
       33 1 . . . 1 2 
       34 1 . . . 1 2 
       35 1 . . . 1 2 
       36 1 . . . 1 2 
       37 1 . . . 1 2 
       38 1 . . . 1 2 
       39 1 . . . 1 2 
       40 1 . . . 1 2 
       41 1 . . . 1 2 
       42 1 . . . 1 2 
       43 1 . . . 1 2 
       44 1 . . . 1 2 
       45 1 . . . 1 2 
       46 1 . . . 1 2 
       47 1 . . . 1 2 
       48 1 . . . 1 2 
       49 1 . . . 1 2 
       50 1 . . . 1 2 
       51 1 . . . 1 2 
       52 1 . . . 1 2 
       53 1 . . . 1 2 
       54 1 . . . 1 2 
       55 1 . . . 1 2 
       56 1 . . . 1 2 
       57 1 . . . 1 2 
       58 1 . . . 1 2 
       59 1 . . . 1 2 
       60 1 . . . 1 2 
       61 1 . . . 1 2 
       62 1 . . . 1 2 
       63 1 . . . 1 2 
       64 1 . . . 1 2 
       65 1 . . . 1 2 
       66 1 . . . 1 2 
       67 1 . . . 1 2 
       68 1 . . . 1 2 
       69 1 . . . 1 2 
       70 1 . . . 1 2 
       71 1 . . . 1 2 
       72 1 . . . 1 2 
       73 1 . . . 1 2 
       74 1 . . . 1 2 
       75 1 . . . 1 2 
       76 1 . . . 1 2 
       77 1 . . . 1 2 
       78 1 . . . 1 2 
       79 1 . . . 1 2 
       80 1 . . . 1 2 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

        1 1 1 1 1  11 VAL O .  11 . O  1 2 
        1 1 2 1 1 111 HIS H . 111 . HN 1 2 
        2 1 1 1 1  11 VAL O .  11 . O  1 2 
        2 1 2 1 1 111 HIS N . 111 . N  1 2 
        3 1 1 1 1  11 VAL H .  11 . HN 1 2 
        3 1 2 1 1 111 HIS O . 111 . O  1 2 
        4 1 1 1 1  11 VAL N .  11 . N  1 2 
        4 1 2 1 1 111 HIS O . 111 . O  1 2 
        5 1 1 1 1  13 ARG H .  13 . HN 1 2 
        5 1 2 1 1 109 LEU O . 109 . O  1 2 
        6 1 1 1 1  13 ARG N .  13 . N  1 2 
        6 1 2 1 1 109 LEU O . 109 . O  1 2 
        7 1 1 1 1  13 ARG O .  13 . O  1 2 
        7 1 2 1 1 109 LEU H . 109 . HN 1 2 
        8 1 1 1 1  13 ARG O .  13 . O  1 2 
        8 1 2 1 1 109 LEU N . 109 . N  1 2 
        9 1 1 1 1  93 LEU H .  93 . HN 1 2 
        9 1 2 1 1 112 SER O . 112 . O  1 2 
       10 1 1 1 1  93 LEU N .  93 . N  1 2 
       10 1 2 1 1 112 SER O . 112 . O  1 2 
       11 1 1 1 1  93 LEU O .  93 . O  1 2 
       11 1 2 1 1 112 SER H . 112 . HN 1 2 
       12 1 1 1 1  93 LEU O .  93 . O  1 2 
       12 1 2 1 1 112 SER N . 112 . N  1 2 
       13 1 1 1 1  95 GLU H .  95 . HN 1 2 
       13 1 2 1 1 110 THR O . 110 . O  1 2 
       14 1 1 1 1  95 GLU N .  95 . N  1 2 
       14 1 2 1 1 110 THR O . 110 . O  1 2 
       15 1 1 1 1  95 GLU O .  95 . O  1 2 
       15 1 2 1 1 110 THR H . 110 . HN 1 2 
       16 1 1 1 1  95 GLU O .  95 . O  1 2 
       16 1 2 1 1 110 THR N . 110 . N  1 2 
       17 1 1 1 1  97 ASP H .  97 . HN 1 2 
       17 1 2 1 1 108 ARG O . 108 . O  1 2 
       18 1 1 1 1  97 ASP N .  97 . N  1 2 
       18 1 2 1 1 108 ARG O . 108 . O  1 2 
       19 1 1 1 1  97 ASP O .  97 . O  1 2 
       19 1 2 1 1 108 ARG H . 108 . HN 1 2 
       20 1 1 1 1  97 ASP O .  97 . O  1 2 
       20 1 2 1 1 108 ARG N . 108 . N  1 2 
       21 1 1 1 1  99 ILE H .  99 . HN 1 2 
       21 1 2 1 1 106 LEU O . 106 . O  1 2 
       22 1 1 1 1  99 ILE N .  99 . N  1 2 
       22 1 2 1 1 106 LEU O . 106 . O  1 2 
       23 1 1 1 1  99 ILE O .  99 . O  1 2 
       23 1 2 1 1 106 LEU H . 106 . HN 1 2 
       24 1 1 1 1  99 ILE O .  99 . O  1 2 
       24 1 2 1 1 106 LEU N . 106 . N  1 2 
       25 1 1 1 1  77 TYR H .  77 . HN 1 2 
       25 1 2 1 1  94 VAL O .  94 . O  1 2 
       26 1 1 1 1  77 TYR N .  77 . N  1 2 
       26 1 2 1 1  94 VAL O .  94 . O  1 2 
       27 1 1 1 1  77 TYR O .  77 . O  1 2 
       27 1 2 1 1  94 VAL H .  94 . HN 1 2 
       28 1 1 1 1  77 TYR O .  77 . O  1 2 
       28 1 2 1 1  94 VAL N .  94 . N  1 2 
       29 1 1 1 1  75 LEU H .  75 . HN 1 2 
       29 1 2 1 1  96 ILE O .  96 . O  1 2 
       30 1 1 1 1  75 LEU N .  75 . N  1 2 
       30 1 2 1 1  96 ILE O .  96 . O  1 2 
       31 1 1 1 1  75 LEU O .  75 . O  1 2 
       31 1 2 1 1  96 ILE H .  96 . HN 1 2 
       32 1 1 1 1  75 LEU O .  75 . O  1 2 
       32 1 2 1 1  96 ILE N .  96 . N  1 2 
       33 1 1 1 1  68 GLU H .  68 . HN 1 2 
       33 1 2 1 1  76 ALA O .  76 . O  1 2 
       34 1 1 1 1  68 GLU N .  68 . N  1 2 
       34 1 2 1 1  76 ALA O .  76 . O  1 2 
       35 1 1 1 1  68 GLU O .  68 . O  1 2 
       35 1 2 1 1  76 ALA H .  76 . HN 1 2 
       36 1 1 1 1  68 GLU O .  68 . O  1 2 
       36 1 2 1 1  76 ALA N .  76 . N  1 2 
       37 1 1 1 1  70 VAL H .  70 . HN 1 2 
       37 1 2 1 1  74 ARG O .  74 . O  1 2 
       38 1 1 1 1  70 VAL N .  70 . N  1 2 
       38 1 2 1 1  74 ARG O .  74 . O  1 2 
       39 1 1 1 1  22 ALA O .  22 . O  1 2 
       39 1 2 1 1  26 ALA H .  26 . HN 1 2 
       40 1 1 1 1  22 ALA O .  22 . O  1 2 
       40 1 2 1 1  26 ALA N .  26 . N  1 2 
       41 1 1 1 1  23 ALA O .  23 . O  1 2 
       41 1 2 1 1  27 LEU H .  27 . HN 1 2 
       42 1 1 1 1  23 ALA O .  23 . O  1 2 
       42 1 2 1 1  27 LEU N .  27 . N  1 2 
       43 1 1 1 1  24 VAL O .  24 . O  1 2 
       43 1 2 1 1  28 MET H .  28 . HN 1 2 
       44 1 1 1 1  24 VAL O .  24 . O  1 2 
       44 1 2 1 1  28 MET N .  28 . N  1 2 
       45 1 1 1 1  25 PHE O .  25 . O  1 2 
       45 1 2 1 1  29 THR H .  29 . HN 1 2 
       46 1 1 1 1  25 PHE O .  25 . O  1 2 
       46 1 2 1 1  29 THR N .  29 . N  1 2 
       47 1 1 1 1  33 LYS O .  33 . O  1 2 
       47 1 2 1 1  36 ARG H .  36 . HN 1 2 
       48 1 1 1 1  33 LYS O .  33 . O  1 2 
       48 1 2 1 1  36 ARG N .  36 . N  1 2 
       49 1 1 1 1  34 ILE O .  34 . O  1 2 
       49 1 2 1 1  37 TRP H .  37 . HN 1 2 
       50 1 1 1 1  34 ILE O .  34 . O  1 2 
       50 1 2 1 1  37 TRP N .  37 . N  1 2 
       51 1 1 1 1 117 ALA O . 117 . O  1 2 
       51 1 2 1 1 121 ALA H . 121 . HN 1 2 
       52 1 1 1 1 117 ALA O . 117 . O  1 2 
       52 1 2 1 1 121 ALA N . 121 . N  1 2 
       53 1 1 1 1 118 GLU O . 118 . O  1 2 
       53 1 2 1 1 122 GLY H . 122 . HN 1 2 
       54 1 1 1 1 118 GLU O . 118 . O  1 2 
       54 1 2 1 1 122 GLY N . 122 . N  1 2 
       55 1 1 1 1 119 GLN O . 119 . O  1 2 
       55 1 2 1 1 123 HIS H . 123 . HN 1 2 
       56 1 1 1 1 119 GLN O . 119 . O  1 2 
       56 1 2 1 1 123 HIS N . 123 . N  1 2 
       57 1 1 1 1 120 CYS O . 120 . O  1 2 
       57 1 2 1 1 124 GLU H . 124 . HN 1 2 
       58 1 1 1 1 120 CYS O . 120 . O  1 2 
       58 1 2 1 1 124 GLU N . 124 . N  1 2 
       59 1 1 1 1 121 ALA O . 121 . O  1 2 
       59 1 2 1 1 125 GLU H . 125 . HN 1 2 
       60 1 1 1 1 121 ALA O . 121 . O  1 2 
       60 1 2 1 1 125 GLU N . 125 . N  1 2 
       61 1 1 1 1 122 GLY O . 122 . O  1 2 
       61 1 2 1 1 126 GLY H . 126 . HN 1 2 
       62 1 1 1 1 122 GLY O . 122 . O  1 2 
       62 1 2 1 1 126 GLY N . 126 . N  1 2 
       63 1 1 1 1 123 HIS O . 123 . O  1 2 
       63 1 2 1 1 127 TRP H . 127 . HN 1 2 
       64 1 1 1 1 123 HIS O . 123 . O  1 2 
       64 1 2 1 1 127 TRP N . 127 . N  1 2 
       65 1 1 1 1 124 GLU O . 124 . O  1 2 
       65 1 2 1 1 128 ALA H . 128 . HN 1 2 
       66 1 1 1 1 124 GLU O . 124 . O  1 2 
       66 1 2 1 1 128 ALA N . 128 . N  1 2 
       67 1 1 1 1 125 GLU O . 125 . O  1 2 
       67 1 2 1 1 129 HIS H . 129 . HN 1 2 
       68 1 1 1 1 125 GLU O . 125 . O  1 2 
       68 1 2 1 1 129 HIS N . 129 . N  1 2 
       69 1 1 1 1 126 GLY O . 126 . O  1 2 
       69 1 2 1 1 130 TYR H . 130 . HN 1 2 
       70 1 1 1 1 126 GLY O . 126 . O  1 2 
       70 1 2 1 1 130 TYR N . 130 . N  1 2 
       71 1 1 1 1 127 TRP O . 127 . O  1 2 
       71 1 2 1 1 131 LEU H . 131 . HN 1 2 
       72 1 1 1 1 127 TRP O . 127 . O  1 2 
       72 1 2 1 1 131 LEU N . 131 . N  1 2 
       73 1 1 1 1 128 ALA O . 128 . O  1 2 
       73 1 2 1 1 132 GLY H . 132 . HN 1 2 
       74 1 1 1 1 128 ALA O . 128 . O  1 2 
       74 1 2 1 1 132 GLY N . 132 . N  1 2 
       75 1 1 1 1 129 HIS O . 129 . O  1 2 
       75 1 2 1 1 133 ARG H . 133 . HN 1 2 
       76 1 1 1 1 129 HIS O . 129 . O  1 2 
       76 1 2 1 1 133 ARG N . 133 . N  1 2 
       77 1 1 1 1 130 TYR O . 130 . O  1 2 
       77 1 2 1 1 134 LEU H . 134 . HN 1 2 
       78 1 1 1 1 130 TYR O . 130 . O  1 2 
       78 1 2 1 1 134 LEU N . 134 . N  1 2 
       79 1 1 1 1 131 LEU O . 131 . O  1 2 
       79 1 2 1 1 135 THR H . 135 . HN 1 2 
       80 1 1 1 1 131 LEU O . 131 . O  1 2 
       80 1 2 1 1 135 THR N . 135 . N  1 2 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

        1 1 . . . . . 1.7 1.7 2.3 1 2 
        2 1 . . . . . 2.7 2.7 3.3 1 2 
        3 1 . . . . . 1.7 1.7 2.3 1 2 
        4 1 . . . . . 2.7 2.7 3.3 1 2 
        5 1 . . . . . 1.7 1.7 2.3 1 2 
        6 1 . . . . . 2.7 2.7 3.3 1 2 
        7 1 . . . . . 1.7 1.7 2.3 1 2 
        8 1 . . . . . 2.7 2.7 3.3 1 2 
        9 1 . . . . . 1.7 1.7 2.3 1 2 
       10 1 . . . . . 2.7 2.7 3.3 1 2 
       11 1 . . . . . 1.7 1.7 2.3 1 2 
       12 1 . . . . . 2.7 2.7 3.3 1 2 
       13 1 . . . . . 1.7 1.7 2.3 1 2 
       14 1 . . . . . 2.7 2.7 3.3 1 2 
       15 1 . . . . . 1.7 1.7 2.3 1 2 
       16 1 . . . . . 2.7 2.7 3.3 1 2 
       17 1 . . . . . 1.7 1.7 2.3 1 2 
       18 1 . . . . . 2.7 2.7 3.3 1 2 
       19 1 . . . . . 1.7 1.7 2.3 1 2 
       20 1 . . . . . 2.7 2.7 3.3 1 2 
       21 1 . . . . . 1.7 1.7 2.3 1 2 
       22 1 . . . . . 2.7 2.7 3.3 1 2 
       23 1 . . . . . 1.7 1.7 2.3 1 2 
       24 1 . . . . . 2.7 2.7 3.3 1 2 
       25 1 . . . . . 1.7 1.7 2.3 1 2 
       26 1 . . . . . 2.7 2.7 3.3 1 2 
       27 1 . . . . . 1.7 1.7 2.3 1 2 
       28 1 . . . . . 2.7 2.7 3.3 1 2 
       29 1 . . . . . 1.7 1.7 2.3 1 2 
       30 1 . . . . . 2.7 2.7 3.3 1 2 
       31 1 . . . . . 1.7 1.7 2.3 1 2 
       32 1 . . . . . 2.7 2.7 3.3 1 2 
       33 1 . . . . . 1.7 1.7 2.3 1 2 
       34 1 . . . . . 2.7 2.7 3.3 1 2 
       35 1 . . . . . 1.7 1.7 2.3 1 2 
       36 1 . . . . . 2.7 2.7 3.3 1 2 
       37 1 . . . . . 1.7 1.7 2.3 1 2 
       38 1 . . . . . 2.7 2.7 3.3 1 2 
       39 1 . . . . . 1.7 1.7 2.3 1 2 
       40 1 . . . . . 2.7 2.7 3.3 1 2 
       41 1 . . . . . 1.7 1.7 2.3 1 2 
       42 1 . . . . . 2.7 2.7 3.3 1 2 
       43 1 . . . . . 1.7 1.7 2.3 1 2 
       44 1 . . . . . 2.7 2.7 3.3 1 2 
       45 1 . . . . . 1.7 1.7 2.3 1 2 
       46 1 . . . . . 2.7 2.7 3.3 1 2 
       47 1 . . . . . 1.7 1.7 2.3 1 2 
       48 1 . . . . . 2.7 2.7 3.3 1 2 
       49 1 . . . . . 1.7 1.7 2.3 1 2 
       50 1 . . . . . 2.7 2.7 3.3 1 2 
       51 1 . . . . . 1.7 1.7 2.3 1 2 
       52 1 . . . . . 2.7 2.7 3.3 1 2 
       53 1 . . . . . 1.7 1.7 2.3 1 2 
       54 1 . . . . . 2.7 2.7 3.3 1 2 
       55 1 . . . . . 1.7 1.7 2.3 1 2 
       56 1 . . . . . 2.7 2.7 3.3 1 2 
       57 1 . . . . . 1.7 1.7 2.3 1 2 
       58 1 . . . . . 2.7 2.7 3.3 1 2 
       59 1 . . . . . 1.7 1.7 2.3 1 2 
       60 1 . . . . . 2.7 2.7 3.3 1 2 
       61 1 . . . . . 1.7 1.7 2.3 1 2 
       62 1 . . . . . 2.7 2.7 3.3 1 2 
       63 1 . . . . . 1.7 1.7 2.3 1 2 
       64 1 . . . . . 2.7 2.7 3.3 1 2 
       65 1 . . . . . 1.7 1.7 2.3 1 2 
       66 1 . . . . . 2.7 2.7 3.3 1 2 
       67 1 . . . . . 1.7 1.7 2.3 1 2 
       68 1 . . . . . 2.7 2.7 3.3 1 2 
       69 1 . . . . . 1.7 1.7 2.3 1 2 
       70 1 . . . . . 2.7 2.7 3.3 1 2 
       71 1 . . . . . 1.7 1.7 2.3 1 2 
       72 1 . . . . . 2.7 2.7 3.3 1 2 
       73 1 . . . . . 1.7 1.7 2.3 1 2 
       74 1 . . . . . 2.7 2.7 3.3 1 2 
       75 1 . . . . . 1.7 1.7 2.3 1 2 
       76 1 . . . . . 2.7 2.7 3.3 1 2 
       77 1 . . . . . 1.7 1.7 2.3 1 2 
       78 1 . . . . . 2.7 2.7 3.3 1 2 
       79 1 . . . . . 1.7 1.7 2.3 1 2 
       80 1 . . . . . 2.7 2.7 3.3 1 2 
    stop_

save_


save_CNS/XPLOR_dihedral_3
    _Torsion_angle_constraint_list.Sf_category         torsion_angle_constraints
    _Torsion_angle_constraint_list.Entry_ID            1
    _Torsion_angle_constraint_list.ID                  1
    _Torsion_angle_constraint_list.Constraint_file_ID  .
    _Torsion_angle_constraint_list.Block_ID            .

    loop_
       _Torsion_angle_constraint.ID
       _Torsion_angle_constraint.Torsion_angle_name
       _Torsion_angle_constraint.Entity_assembly_ID_1
       _Torsion_angle_constraint.Entity_ID_1
       _Torsion_angle_constraint.Comp_index_ID_1
       _Torsion_angle_constraint.Comp_ID_1
       _Torsion_angle_constraint.Atom_ID_1
       _Torsion_angle_constraint.Entity_assembly_ID_2
       _Torsion_angle_constraint.Entity_ID_2
       _Torsion_angle_constraint.Comp_index_ID_2
       _Torsion_angle_constraint.Comp_ID_2
       _Torsion_angle_constraint.Atom_ID_2
       _Torsion_angle_constraint.Entity_assembly_ID_3
       _Torsion_angle_constraint.Entity_ID_3
       _Torsion_angle_constraint.Comp_index_ID_3
       _Torsion_angle_constraint.Comp_ID_3
       _Torsion_angle_constraint.Atom_ID_3
       _Torsion_angle_constraint.Entity_assembly_ID_4
       _Torsion_angle_constraint.Entity_ID_4
       _Torsion_angle_constraint.Comp_index_ID_4
       _Torsion_angle_constraint.Comp_ID_4
       _Torsion_angle_constraint.Atom_ID_4
       _Torsion_angle_constraint.Angle_lower_bound_val
       _Torsion_angle_constraint.Angle_upper_bound_val
       _Torsion_angle_constraint.Auth_asym_ID_1
       _Torsion_angle_constraint.Auth_seq_ID_1
       _Torsion_angle_constraint.Auth_comp_ID_1
       _Torsion_angle_constraint.Auth_atom_ID_1
       _Torsion_angle_constraint.Auth_asym_ID_2
       _Torsion_angle_constraint.Auth_seq_ID_2
       _Torsion_angle_constraint.Auth_comp_ID_2
       _Torsion_angle_constraint.Auth_atom_ID_2
       _Torsion_angle_constraint.Auth_asym_ID_3
       _Torsion_angle_constraint.Auth_seq_ID_3
       _Torsion_angle_constraint.Auth_comp_ID_3
       _Torsion_angle_constraint.Auth_atom_ID_3
       _Torsion_angle_constraint.Auth_asym_ID_4
       _Torsion_angle_constraint.Auth_seq_ID_4
       _Torsion_angle_constraint.Auth_comp_ID_4
       _Torsion_angle_constraint.Auth_atom_ID_4
       _Torsion_angle_constraint.Entry_ID
       _Torsion_angle_constraint.Torsion_angle_constraint_list_ID

         1 . 1 1   9 PHE C 1 1  10 VAL N  1 1  10 VAL CA 1 1  10 VAL C  -152.29999  -94.09999 .   9 . C .  10 . N  .  10 . CA .  10 . C 1 1 
         2 . 1 1  10 VAL N 1 1  10 VAL CA 1 1  10 VAL C  1 1  11 VAL N       115.3      155.3 .  10 . N .  10 . CA .  10 . C  .  11 . N 1 1 
         3 . 1 1  10 VAL C 1 1  11 VAL N  1 1  11 VAL CA 1 1  11 VAL C  -143.39998      -93.2 .  10 . C .  11 . N  .  11 . CA .  11 . C 1 1 
         4 . 1 1  11 VAL N 1 1  11 VAL CA 1 1  11 VAL C  1 1  12 ARG N       103.0      143.0 .  11 . N .  11 . CA .  11 . C  .  12 . N 1 1 
         5 . 1 1  11 VAL C 1 1  12 ARG N  1 1  12 ARG CA 1 1  12 ARG C      -141.5      -73.3 .  11 . C .  12 . N  .  12 . CA .  12 . C 1 1 
         6 . 1 1  12 ARG N 1 1  12 ARG CA 1 1  12 ARG C  1 1  13 ARG N       102.8      164.8 .  12 . N .  12 . CA .  12 . C  .  13 . N 1 1 
         7 . 1 1  12 ARG C 1 1  13 ARG N  1 1  13 ARG CA 1 1  13 ARG C      -158.9 -100.09999 .  12 . C .  13 . N  .  13 . CA .  13 . C 1 1 
         8 . 1 1  13 ARG N 1 1  13 ARG CA 1 1  13 ARG C  1 1  14 GLU N       131.9      175.9 .  13 . N .  13 . CA .  13 . C  .  14 . N 1 1 
         9 . 1 1  13 ARG C 1 1  14 GLU N  1 1  14 GLU CA 1 1  14 GLU C      -154.6     -111.0 .  13 . C .  14 . N  .  14 . CA .  14 . C 1 1 
        10 . 1 1  14 GLU N 1 1  14 GLU CA 1 1  14 GLU C  1 1  15 ALA N       123.9      164.1 .  14 . N .  14 . CA .  14 . C  .  15 . N 1 1 
        11 . 1 1  14 GLU C 1 1  15 ALA N  1 1  15 ALA CA 1 1  15 ALA C      -168.2     -113.4 .  14 . C .  15 . N  .  15 . CA .  15 . C 1 1 
        12 . 1 1  15 ALA N 1 1  15 ALA CA 1 1  15 ALA C  1 1  16 HIS N       116.8      165.0 .  15 . N .  15 . CA .  15 . C  .  16 . N 1 1 
        13 . 1 1  15 ALA C 1 1  16 HIS N  1 1  16 HIS CA 1 1  16 HIS C -125.299995      -78.3 .  15 . C .  16 . N  .  16 . CA .  16 . C 1 1 
        14 . 1 1  16 HIS N 1 1  16 HIS CA 1 1  16 HIS C  1 1  17 LEU N        98.9      147.3 .  16 . N .  16 . CA .  16 . C  .  17 . N 1 1 
        15 . 1 1  16 HIS C 1 1  17 LEU N  1 1  17 LEU CA 1 1  17 LEU C      -151.6      -64.2 .  16 . C .  17 . N  .  17 . CA .  17 . C 1 1 
        16 . 1 1  17 LEU N 1 1  17 LEU CA 1 1  17 LEU C  1 1  18 ALA N        90.1      175.7 .  17 . N .  17 . CA .  17 . C  .  18 . N 1 1 
        17 . 1 1  21 PRO C 1 1  22 ALA N  1 1  22 ALA CA 1 1  22 ALA C       -82.9      -42.9 .  21 . C .  22 . N  .  22 . CA .  22 . C 1 1 
        18 . 1 1  22 ALA N 1 1  22 ALA CA 1 1  22 ALA C  1 1  23 ALA N       -55.5 -15.499999 .  22 . N .  22 . CA .  22 . C  .  23 . N 1 1 
        19 . 1 1  22 ALA C 1 1  23 ALA N  1 1  23 ALA CA 1 1  23 ALA C       -86.1 -46.099995 .  22 . C .  23 . N  .  23 . CA .  23 . C 1 1 
        20 . 1 1  23 ALA N 1 1  23 ALA CA 1 1  23 ALA C  1 1  24 VAL N       -60.7      -20.7 .  23 . N .  23 . CA .  23 . C  .  24 . N 1 1 
        21 . 1 1  23 ALA C 1 1  24 VAL N  1 1  24 VAL CA 1 1  24 VAL C       -86.8      -46.8 .  23 . C .  24 . N  .  24 . CA .  24 . C 1 1 
        22 . 1 1  24 VAL N 1 1  24 VAL CA 1 1  24 VAL C  1 1  25 PHE N  -62.899998      -22.9 .  24 . N .  24 . CA .  24 . C  .  25 . N 1 1 
        23 . 1 1  24 VAL C 1 1  25 PHE N  1 1  25 PHE CA 1 1  25 PHE C   -83.69999      -43.7 .  24 . C .  25 . N  .  25 . CA .  25 . C 1 1 
        24 . 1 1  25 PHE N 1 1  25 PHE CA 1 1  25 PHE C  1 1  26 ALA N  -58.699997      -18.7 .  25 . N .  25 . CA .  25 . C  .  26 . N 1 1 
        25 . 1 1  25 PHE C 1 1  26 ALA N  1 1  26 ALA CA 1 1  26 ALA C       -83.0      -43.0 .  25 . C .  26 . N  .  26 . CA .  26 . C 1 1 
        26 . 1 1  26 ALA N 1 1  26 ALA CA 1 1  26 ALA C  1 1  27 LEU N       -58.4 -18.399998 .  26 . N .  26 . CA .  26 . C  .  27 . N 1 1 
        27 . 1 1  26 ALA C 1 1  27 LEU N  1 1  27 LEU CA 1 1  27 LEU C      -103.3      -38.9 .  26 . C .  27 . N  .  27 . CA .  27 . C 1 1 
        28 . 1 1  27 LEU N 1 1  27 LEU CA 1 1  27 LEU C  1 1  28 MET N       -65.6      -17.2 .  27 . N .  27 . CA .  27 . C  .  28 . N 1 1 
        29 . 1 1  27 LEU C 1 1  28 MET N  1 1  28 MET CA 1 1  28 MET C      -109.1      -56.3 .  27 . C .  28 . N  .  28 . CA .  28 . C 1 1 
        30 . 1 1  28 MET N 1 1  28 MET CA 1 1  28 MET C  1 1  29 THR N       -60.9        2.1 .  28 . N .  28 . CA .  28 . C  .  29 . N 1 1 
        31 . 1 1  31 PRO C 1 1  32 GLU N  1 1  32 GLU CA 1 1  32 GLU C       -84.3      -44.3 .  31 . C .  32 . N  .  32 . CA .  32 . C 1 1 
        32 . 1 1  32 GLU N 1 1  32 GLU CA 1 1  32 GLU C  1 1  33 LYS N       -51.9      -11.9 .  32 . N .  32 . CA .  32 . C  .  33 . N 1 1 
        33 . 1 1  32 GLU C 1 1  33 LYS N  1 1  33 LYS CA 1 1  33 LYS C       -82.7      -42.7 .  32 . C .  33 . N  .  33 . CA .  33 . C 1 1 
        34 . 1 1  33 LYS N 1 1  33 LYS CA 1 1  33 LYS C  1 1  34 ILE N       -61.7      -21.7 .  33 . N .  33 . CA .  33 . C  .  34 . N 1 1 
        35 . 1 1  33 LYS C 1 1  34 ILE N  1 1  34 ILE CA 1 1  34 ILE C       -82.7      -42.7 .  33 . C .  34 . N  .  34 . CA .  34 . C 1 1 
        36 . 1 1  34 ILE N 1 1  34 ILE CA 1 1  34 ILE C  1 1  35 LEU N  -61.399998 -21.399998 .  34 . N .  34 . CA .  34 . C  .  35 . N 1 1 
        37 . 1 1  34 ILE C 1 1  35 LEU N  1 1  35 LEU CA 1 1  35 LEU C      -110.9      -35.9 .  34 . C .  35 . N  .  35 . CA .  35 . C 1 1 
        38 . 1 1  35 LEU N 1 1  35 LEU CA 1 1  35 LEU C  1 1  36 ARG N       -51.8       11.2 .  35 . N .  35 . CA .  35 . C  .  36 . N 1 1 
        39 . 1 1  35 LEU C 1 1  36 ARG N  1 1  36 ARG CA 1 1  36 ARG C       -84.2      -44.2 .  35 . C .  36 . N  .  36 . CA .  36 . C 1 1 
        40 . 1 1  36 ARG N 1 1  36 ARG CA 1 1  36 ARG C  1 1  37 TRP N       -55.2 -15.200001 .  36 . N .  36 . CA .  36 . C  .  37 . N 1 1 
        41 . 1 1  41 GLU C 1 1  42 ALA N  1 1  42 ALA CA 1 1  42 ALA C      -178.9     -103.7 .  41 . C .  42 . N  .  42 . CA .  42 . C 1 1 
        42 . 1 1  42 ALA N 1 1  42 ALA CA 1 1  42 ALA C  1 1  43 GLU N  112.399994      152.4 .  42 . N .  42 . CA .  42 . C  .  43 . N 1 1 
        43 . 1 1  42 ALA C 1 1  43 GLU N  1 1  43 GLU CA 1 1  43 GLU C      -150.5  -83.69999 .  42 . C .  43 . N  .  43 . CA .  43 . C 1 1 
        44 . 1 1  43 GLU N 1 1  43 GLU CA 1 1  43 GLU C  1 1  44 VAL N   97.899994      162.3 .  43 . N .  43 . CA .  43 . C  .  44 . N 1 1 
        45 . 1 1  52 TYR C 1 1  53 LEU N  1 1  53 LEU CA 1 1  53 LEU C      -173.2      -59.6 .  52 . C .  53 . N  .  53 . CA .  53 . C 1 1 
        46 . 1 1  53 LEU N 1 1  53 LEU CA 1 1  53 LEU C  1 1  54 VAL N       104.0      162.8 .  53 . N .  53 . CA .  53 . C  .  54 . N 1 1 
        47 . 1 1  53 LEU C 1 1  54 VAL N  1 1  54 VAL CA 1 1  54 VAL C      -155.2     -108.2 .  53 . C .  54 . N  .  54 . CA .  54 . C 1 1 
        48 . 1 1  54 VAL N 1 1  54 VAL CA 1 1  54 VAL C  1 1  55 ASN N       100.2      170.0 .  54 . N .  54 . CA .  54 . C  .  55 . N 1 1 
        49 . 1 1  67 ARG C 1 1  68 GLU N  1 1  68 GLU CA 1 1  68 GLU C      -172.1     -130.1 .  67 . C .  68 . N  .  68 . CA .  68 . C 1 1 
        50 . 1 1  68 GLU N 1 1  68 GLU CA 1 1  68 GLU C  1 1  69 VAL N       127.9      167.9 .  68 . N .  68 . CA .  68 . C  .  69 . N 1 1 
        51 . 1 1  68 GLU C 1 1  69 VAL N  1 1  69 VAL CA 1 1  69 VAL C      -165.4      -75.2 .  68 . C .  69 . N  .  69 . CA .  69 . C 1 1 
        52 . 1 1  69 VAL N 1 1  69 VAL CA 1 1  69 VAL C  1 1  70 VAL N       105.1      147.9 .  69 . N .  69 . CA .  69 . C  .  70 . N 1 1 
        53 . 1 1  69 VAL C 1 1  70 VAL N  1 1  70 VAL CA 1 1  70 VAL C      -146.9      -53.9 .  69 . C .  70 . N  .  70 . CA .  70 . C 1 1 
        54 . 1 1  70 VAL N 1 1  70 VAL CA 1 1  70 VAL C  1 1  71 PRO N        80.8      151.4 .  70 . N .  70 . CA .  70 . C  .  71 . N 1 1 
        55 . 1 1  73 HIS C 1 1  74 ARG N  1 1  74 ARG CA 1 1  74 ARG C  -167.39998     -114.8 .  73 . C .  74 . N  .  74 . CA .  74 . C 1 1 
        56 . 1 1  74 ARG N 1 1  74 ARG CA 1 1  74 ARG C  1 1  75 LEU N   100.69999      170.7 .  74 . N .  74 . CA .  74 . C  .  75 . N 1 1 
        57 . 1 1  74 ARG C 1 1  75 LEU N  1 1  75 LEU CA 1 1  75 LEU C      -150.9     -110.9 .  74 . C .  75 . N  .  75 . CA .  75 . C 1 1 
        58 . 1 1  75 LEU N 1 1  75 LEU CA 1 1  75 LEU C  1 1  76 ALA N   120.59999      174.0 .  75 . N .  75 . CA .  75 . C  .  76 . N 1 1 
        59 . 1 1  75 LEU C 1 1  76 ALA N  1 1  76 ALA CA 1 1  76 ALA C      -148.4     -102.2 .  75 . C .  76 . N  .  76 . CA .  76 . C 1 1 
        60 . 1 1  76 ALA N 1 1  76 ALA CA 1 1  76 ALA C  1 1  77 TYR N   116.30001      156.3 .  76 . N .  76 . CA .  76 . C  .  77 . N 1 1 
        61 . 1 1  76 ALA C 1 1  77 TYR N  1 1  77 TYR CA 1 1  77 TYR C      -166.9      -83.1 .  76 . C .  77 . N  .  77 . CA .  77 . C 1 1 
        62 . 1 1  77 TYR N 1 1  77 TYR CA 1 1  77 TYR C  1 1  78 SER N        94.9      177.1 .  77 . N .  77 . CA .  77 . C  .  78 . N 1 1 
        63 . 1 1  92 SER C 1 1  93 LEU N  1 1  93 LEU CA 1 1  93 LEU C      -176.7     -103.1 .  92 . C .  93 . N  .  93 . CA .  93 . C 1 1 
        64 . 1 1  93 LEU N 1 1  93 LEU CA 1 1  93 LEU C  1 1  94 VAL N       106.3      148.7 .  93 . N .  93 . CA .  93 . C  .  94 . N 1 1 
        65 . 1 1  93 LEU C 1 1  94 VAL N  1 1  94 VAL CA 1 1  94 VAL C      -130.3      -86.7 .  93 . C .  94 . N  .  94 . CA .  94 . C 1 1 
        66 . 1 1  94 VAL N 1 1  94 VAL CA 1 1  94 VAL C  1 1  95 GLU N   108.59999      148.6 .  94 . N .  94 . CA .  94 . C  .  95 . N 1 1 
        67 . 1 1  94 VAL C 1 1  95 GLU N  1 1  95 GLU CA 1 1  95 GLU C      -139.8 -99.799995 .  94 . C .  95 . N  .  95 . CA .  95 . C 1 1 
        68 . 1 1  95 GLU N 1 1  95 GLU CA 1 1  95 GLU C  1 1  96 ILE N       111.3      156.3 .  95 . N .  95 . CA .  95 . C  .  96 . N 1 1 
        69 . 1 1  95 GLU C 1 1  96 ILE N  1 1  96 ILE CA 1 1  96 ILE C      -153.0      -96.8 .  95 . C .  96 . N  .  96 . CA .  96 . C 1 1 
        70 . 1 1  96 ILE N 1 1  96 ILE CA 1 1  96 ILE C  1 1  97 ASP N       107.1      151.3 .  96 . N .  96 . CA .  96 . C  .  97 . N 1 1 
        71 . 1 1  96 ILE C 1 1  97 ASP N  1 1  97 ASP CA 1 1  97 ASP C      -158.5      -94.3 .  96 . C .  97 . N  .  97 . CA .  97 . C 1 1 
        72 . 1 1  97 ASP N 1 1  97 ASP CA 1 1  97 ASP C  1 1  98 LEU N       112.3      172.1 .  97 . N .  97 . CA .  97 . C  .  98 . N 1 1 
        73 . 1 1  97 ASP C 1 1  98 LEU N  1 1  98 LEU CA 1 1  98 LEU C      -138.1      -70.1 .  97 . C .  98 . N  .  98 . CA .  98 . C 1 1 
        74 . 1 1  98 LEU N 1 1  98 LEU CA 1 1  98 LEU C  1 1  99 ILE N       111.3      151.3 .  98 . N .  98 . CA .  98 . C  .  99 . N 1 1 
        75 . 1 1  98 LEU C 1 1  99 ILE N  1 1  99 ILE CA 1 1  99 ILE C      -138.4      -91.4 .  98 . C .  99 . N  .  99 . CA .  99 . C 1 1 
        76 . 1 1  99 ILE N 1 1  99 ILE CA 1 1  99 ILE C  1 1 100 GLU N       111.1      158.3 .  99 . N .  99 . CA .  99 . C  . 100 . N 1 1 
        77 . 1 1 104 GLY C 1 1 105 THR N  1 1 105 THR CA 1 1 105 THR C      -159.0      -95.0 . 104 . C . 105 . N  . 105 . CA . 105 . C 1 1 
        78 . 1 1 105 THR N 1 1 105 THR CA 1 1 105 THR C  1 1 106 LEU N       104.1      149.5 . 105 . N . 105 . CA . 105 . C  . 106 . N 1 1 
        79 . 1 1 105 THR C 1 1 106 LEU N  1 1 106 LEU CA 1 1 106 LEU C      -127.9      -80.9 . 105 . C . 106 . N  . 106 . CA . 106 . C 1 1 
        80 . 1 1 106 LEU N 1 1 106 LEU CA 1 1 106 LEU C  1 1 107 LEU N        91.5      146.1 . 106 . N . 106 . CA . 106 . C  . 107 . N 1 1 
        81 . 1 1 106 LEU C 1 1 107 LEU N  1 1 107 LEU CA 1 1 107 LEU C      -135.3      -79.9 . 106 . C . 107 . N  . 107 . CA . 107 . C 1 1 
        82 . 1 1 107 LEU N 1 1 107 LEU CA 1 1 107 LEU C  1 1 108 ARG N       100.5      167.7 . 107 . N . 107 . CA . 107 . C  . 108 . N 1 1 
        83 . 1 1 107 LEU C 1 1 108 ARG N  1 1 108 ARG CA 1 1 108 ARG C      -140.6      -97.8 . 107 . C . 108 . N  . 108 . CA . 108 . C 1 1 
        84 . 1 1 108 ARG N 1 1 108 ARG CA 1 1 108 ARG C  1 1 109 LEU N       104.0      144.0 . 108 . N . 108 . CA . 108 . C  . 109 . N 1 1 
        85 . 1 1 108 ARG C 1 1 109 LEU N  1 1 109 LEU CA 1 1 109 LEU C      -140.6      -78.2 . 108 . C . 109 . N  . 109 . CA . 109 . C 1 1 
        86 . 1 1 109 LEU N 1 1 109 LEU CA 1 1 109 LEU C  1 1 110 THR N  106.399994      146.4 . 109 . N . 109 . CA . 109 . C  . 110 . N 1 1 
        87 . 1 1 109 LEU C 1 1 110 THR N  1 1 110 THR CA 1 1 110 THR C      -141.1      -89.5 . 109 . C . 110 . N  . 110 . CA . 110 . C 1 1 
        88 . 1 1 110 THR N 1 1 110 THR CA 1 1 110 THR C  1 1 111 HIS N        99.9      139.9 . 110 . N . 110 . CA . 110 . C  . 111 . N 1 1 
        89 . 1 1 110 THR C 1 1 111 HIS N  1 1 111 HIS CA 1 1 111 HIS C      -135.2      -88.4 . 110 . C . 111 . N  . 111 . CA . 111 . C 1 1 
        90 . 1 1 111 HIS N 1 1 111 HIS CA 1 1 111 HIS C  1 1 112 SER N       103.2      143.2 . 111 . N . 111 . CA . 111 . C  . 112 . N 1 1 
        91 . 1 1 111 HIS C 1 1 112 SER N  1 1 112 SER CA 1 1 112 SER C      -161.9      -90.3 . 111 . C . 112 . N  . 112 . CA . 112 . C 1 1 
        92 . 1 1 112 SER N 1 1 112 SER CA 1 1 112 SER C  1 1 113 GLY N       127.6  174.99998 . 112 . N . 112 . CA . 112 . C  . 113 . N 1 1 
        93 . 1 1 116 SER C 1 1 117 ALA N  1 1 117 ALA CA 1 1 117 ALA C       -84.3      -44.3 . 116 . C . 117 . N  . 117 . CA . 117 . C 1 1 
        94 . 1 1 117 ALA N 1 1 117 ALA CA 1 1 117 ALA C  1 1 118 GLU N       -55.7 -15.699999 . 117 . N . 117 . CA . 117 . C  . 118 . N 1 1 
        95 . 1 1 117 ALA C 1 1 118 GLU N  1 1 118 GLU CA 1 1 118 GLU C       -84.6      -44.6 . 117 . C . 118 . N  . 118 . CA . 118 . C 1 1 
        96 . 1 1 118 GLU N 1 1 118 GLU CA 1 1 118 GLU C  1 1 119 GLN N  -60.800003      -20.8 . 118 . N . 118 . CA . 118 . C  . 119 . N 1 1 
        97 . 1 1 118 GLU C 1 1 119 GLN N  1 1 119 GLN CA 1 1 119 GLN C       -85.4      -45.4 . 118 . C . 119 . N  . 119 . CA . 119 . C 1 1 
        98 . 1 1 119 GLN N 1 1 119 GLN CA 1 1 119 GLN C  1 1 120 CYS N       -57.3      -17.3 . 119 . N . 119 . CA . 119 . C  . 120 . N 1 1 
        99 . 1 1 119 GLN C 1 1 120 CYS N  1 1 120 CYS CA 1 1 120 CYS C   -85.59999      -45.6 . 119 . C . 120 . N  . 120 . CA . 120 . C 1 1 
       100 . 1 1 120 CYS N 1 1 120 CYS CA 1 1 120 CYS C  1 1 121 ALA N  -62.199997      -22.2 . 120 . N . 120 . CA . 120 . C  . 121 . N 1 1 
       101 . 1 1 120 CYS C 1 1 121 ALA N  1 1 121 ALA CA 1 1 121 ALA C       -77.3      -37.3 . 120 . C . 121 . N  . 121 . CA . 121 . C 1 1 
       102 . 1 1 121 ALA N 1 1 121 ALA CA 1 1 121 ALA C  1 1 122 GLY N       -67.6      -27.6 . 121 . N . 121 . CA . 121 . C  . 122 . N 1 1 
       103 . 1 1 121 ALA C 1 1 122 GLY N  1 1 122 GLY CA 1 1 122 GLY C       -83.6      -43.6 . 121 . C . 122 . N  . 122 . CA . 122 . C 1 1 
       104 . 1 1 122 GLY N 1 1 122 GLY CA 1 1 122 GLY C  1 1 123 HIS N       -64.6      -24.6 . 122 . N . 122 . CA . 122 . C  . 123 . N 1 1 
       105 . 1 1 122 GLY C 1 1 123 HIS N  1 1 123 HIS CA 1 1 123 HIS C       -83.2      -43.2 . 122 . C . 123 . N  . 123 . CA . 123 . C 1 1 
       106 . 1 1 123 HIS N 1 1 123 HIS CA 1 1 123 HIS C  1 1 124 GLU N       -61.7      -21.7 . 123 . N . 123 . CA . 123 . C  . 124 . N 1 1 
       107 . 1 1 123 HIS C 1 1 124 GLU N  1 1 124 GLU CA 1 1 124 GLU C       -82.8 -42.799995 . 123 . C . 124 . N  . 124 . CA . 124 . C 1 1 
       108 . 1 1 124 GLU N 1 1 124 GLU CA 1 1 124 GLU C  1 1 125 GLU N  -62.199997      -22.2 . 124 . N . 124 . CA . 124 . C  . 125 . N 1 1 
       109 . 1 1 124 GLU C 1 1 125 GLU N  1 1 125 GLU CA 1 1 125 GLU C       -82.4      -42.4 . 124 . C . 125 . N  . 125 . CA . 125 . C 1 1 
       110 . 1 1 125 GLU N 1 1 125 GLU CA 1 1 125 GLU C  1 1 126 GLY N       -58.6      -18.6 . 125 . N . 125 . CA . 125 . C  . 126 . N 1 1 
       111 . 1 1 125 GLU C 1 1 126 GLY N  1 1 126 GLY CA 1 1 126 GLY C       -86.8      -46.8 . 125 . C . 126 . N  . 126 . CA . 126 . C 1 1 
       112 . 1 1 126 GLY N 1 1 126 GLY CA 1 1 126 GLY C  1 1 127 TRP N       -58.6      -18.6 . 126 . N . 126 . CA . 126 . C  . 127 . N 1 1 
       113 . 1 1 126 GLY C 1 1 127 TRP N  1 1 127 TRP CA 1 1 127 TRP C       -82.8 -42.799995 . 126 . C . 127 . N  . 127 . CA . 127 . C 1 1 
       114 . 1 1 127 TRP N 1 1 127 TRP CA 1 1 127 TRP C  1 1 128 ALA N  -63.699997      -23.7 . 127 . N . 127 . CA . 127 . C  . 128 . N 1 1 
       115 . 1 1 127 TRP C 1 1 128 ALA N  1 1 128 ALA CA 1 1 128 ALA C       -84.6      -44.6 . 127 . C . 128 . N  . 128 . CA . 128 . C 1 1 
       116 . 1 1 128 ALA N 1 1 128 ALA CA 1 1 128 ALA C  1 1 129 HIS N  -58.499996      -18.5 . 128 . N . 128 . CA . 128 . C  . 129 . N 1 1 
       117 . 1 1 128 ALA C 1 1 129 HIS N  1 1 129 HIS CA 1 1 129 HIS C       -86.8      -46.8 . 128 . C . 129 . N  . 129 . CA . 129 . C 1 1 
       118 . 1 1 129 HIS N 1 1 129 HIS CA 1 1 129 HIS C  1 1 130 TYR N       -63.3      -23.3 . 129 . N . 129 . CA . 129 . C  . 130 . N 1 1 
       119 . 1 1 129 HIS C 1 1 130 TYR N  1 1 130 TYR CA 1 1 130 TYR C       -83.6      -43.6 . 129 . C . 130 . N  . 130 . CA . 130 . C 1 1 
       120 . 1 1 130 TYR N 1 1 130 TYR CA 1 1 130 TYR C  1 1 131 LEU N   -65.09999      -22.1 . 130 . N . 130 . CA . 130 . C  . 131 . N 1 1 
       121 . 1 1 130 TYR C 1 1 131 LEU N  1 1 131 LEU CA 1 1 131 LEU C       -83.0      -43.0 . 130 . C . 131 . N  . 131 . CA . 131 . C 1 1 
       122 . 1 1 131 LEU N 1 1 131 LEU CA 1 1 131 LEU C  1 1 132 GLY N       -59.9 -19.899998 . 131 . N . 131 . CA . 131 . C  . 132 . N 1 1 
       123 . 1 1 131 LEU C 1 1 132 GLY N  1 1 132 GLY CA 1 1 132 GLY C       -86.6      -46.6 . 131 . C . 132 . N  . 132 . CA . 132 . C 1 1 
       124 . 1 1 132 GLY N 1 1 132 GLY CA 1 1 132 GLY C  1 1 133 ARG N  -59.299995      -19.3 . 132 . N . 132 . CA . 132 . C  . 133 . N 1 1 
       125 . 1 1 132 GLY C 1 1 133 ARG N  1 1 133 ARG CA 1 1 133 ARG C       -83.5      -43.5 . 132 . C . 133 . N  . 133 . CA . 133 . C 1 1 
       126 . 1 1 133 ARG N 1 1 133 ARG CA 1 1 133 ARG C  1 1 134 LEU N  -61.799995      -21.8 . 133 . N . 133 . CA . 133 . C  . 134 . N 1 1 
       127 . 1 1 133 ARG C 1 1 134 LEU N  1 1 134 LEU CA 1 1 134 LEU C       -82.8 -42.799995 . 133 . C . 134 . N  . 134 . CA . 134 . C 1 1 
       128 . 1 1 134 LEU N 1 1 134 LEU CA 1 1 134 LEU C  1 1 135 THR N  -62.700005      -22.7 . 134 . N . 134 . CA . 134 . C  . 135 . N 1 1 
       129 . 1 1 134 LEU C 1 1 135 THR N  1 1 135 THR CA 1 1 135 THR C       -82.1      -42.1 . 134 . C . 135 . N  . 135 . CA . 135 . C 1 1 
       130 . 1 1 135 THR N 1 1 135 THR CA 1 1 135 THR C  1 1 136 GLU N       -61.9      -21.9 . 135 . N . 135 . CA . 135 . C  . 136 . N 1 1 
       131 . 1 1 135 THR C 1 1 136 GLU N  1 1 136 GLU CA 1 1 136 GLU C       -84.1      -44.1 . 135 . C . 136 . N  . 136 . CA . 136 . C 1 1 
       132 . 1 1 136 GLU N 1 1 136 GLU CA 1 1 136 GLU C  1 1 137 VAL N       -60.6      -20.6 . 136 . N . 136 . CA . 136 . C  . 137 . N 1 1 
       133 . 1 1 136 GLU C 1 1 137 VAL N  1 1 137 VAL CA 1 1 137 VAL C       -85.1      -45.1 . 136 . C . 137 . N  . 137 . CA . 137 . C 1 1 
       134 . 1 1 137 VAL N 1 1 137 VAL CA 1 1 137 VAL C  1 1 138 ALA N       -60.6      -20.6 . 137 . N . 137 . CA . 137 . C  . 138 . N 1 1 
       135 . 1 1 137 VAL C 1 1 138 ALA N  1 1 138 ALA CA 1 1 138 ALA C       -84.9      -44.9 . 137 . C . 138 . N  . 138 . CA . 138 . C 1 1 
       136 . 1 1 138 ALA N 1 1 138 ALA CA 1 1 138 ALA C  1 1 139 ALA N       -47.8       -6.2 . 138 . N . 138 . CA . 138 . C  . 139 . N 1 1 
       137 . 1 1 138 ALA C 1 1 139 ALA N  1 1 139 ALA CA 1 1 139 ALA C      -117.8 -61.600002 . 138 . C . 139 . N  . 139 . CA . 139 . C 1 1 
       138 . 1 1 139 ALA N 1 1 139 ALA CA 1 1 139 ALA C  1 1 140 GLY N       -22.3       21.5 . 139 . N . 139 . CA . 139 . C  . 140 . N 1 1 
    stop_

save_


save_conformer_family_coord_set_1
    _Conformer_family_coord_set.Sf_category  conformer_family_coord_set
    _Conformer_family_coord_set.Entry_ID     1
    _Conformer_family_coord_set.ID           1

    loop_
       _Atom_site.Model_ID
       _Atom_site.ID
       _Atom_site.Label_entity_assembly_ID
       _Atom_site.Label_entity_ID
       _Atom_site.Label_comp_index_ID
       _Atom_site.Label_comp_ID
       _Atom_site.Label_atom_ID
       _Atom_site.Type_symbol
       _Atom_site.Cartn_x
       _Atom_site.Cartn_y
       _Atom_site.Cartn_z
       _Atom_site.Occupancy
       _Atom_site.Uncertainty
       _Atom_site.PDBX_label_asym_ID
       _Atom_site.PDB_strand_ID
       _Atom_site.PDB_ins_code
       _Atom_site.PDB_residue_no
       _Atom_site.PDB_residue_name
       _Atom_site.PDB_atom_name
       _Atom_site.Entry_ID
       _Atom_site.Conformer_family_coord_set_ID

        1     1 1 1   1 MET C    C  30.409   5.351  -1.500 1.00 . A A .   1 MET C    1 1 
        1     2 1 1   1 MET CA   C  31.898   5.492  -1.823 1.00 . A A .   1 MET CA   1 1 
        1     3 1 1   1 MET CB   C  32.711   5.372  -0.533 1.00 . A A .   1 MET CB   1 1 
        1     4 1 1   1 MET CE   C  36.793   5.477  -0.040 1.00 . A A .   1 MET CE   1 1 
        1     5 1 1   1 MET CG   C  34.205   5.336  -0.865 1.00 . A A .   1 MET CG   1 1 
        1     6 1 1   1 MET H1   H  32.986   7.256  -2.019 1.00 . A A .   1 MET H1   1 1 
        1     7 1 1   1 MET H2   H  31.318   7.439  -2.281 1.00 . A A .   1 MET H2   1 1 
        1     8 1 1   1 MET H3   H  32.292   6.708  -3.466 1.00 . A A .   1 MET H3   1 1 
        1     9 1 1   1 MET HA   H  32.193   4.713  -2.510 1.00 . A A .   1 MET HA   1 1 
        1    10 1 1   1 MET HB2  H  32.506   6.223   0.101 1.00 . A A .   1 MET HB2  1 1 
        1    11 1 1   1 MET HB3  H  32.437   4.465  -0.017 1.00 . A A .   1 MET HB3  1 1 
        1    12 1 1   1 MET HE1  H  36.866   6.505  -0.367 1.00 . A A .   1 MET HE1  1 1 
        1    13 1 1   1 MET HE2  H  36.944   4.814  -0.881 1.00 . A A .   1 MET HE2  1 1 
        1    14 1 1   1 MET HE3  H  37.548   5.286   0.705 1.00 . A A .   1 MET HE3  1 1 
        1    15 1 1   1 MET HG2  H  34.412   4.488  -1.502 1.00 . A A .   1 MET HG2  1 1 
        1    16 1 1   1 MET HG3  H  34.484   6.246  -1.375 1.00 . A A .   1 MET HG3  1 1 
        1    17 1 1   1 MET N    N  32.143   6.824  -2.444 1.00 . A A .   1 MET N    1 1 
        1    18 1 1   1 MET O    O  29.706   4.557  -2.091 1.00 . A A .   1 MET O    1 1 
        1    19 1 1   1 MET SD   S  35.154   5.186   0.669 1.00 . A A .   1 MET SD   1 1 
        1    20 1 1   2 GLU C    C  28.089   7.306   0.559 1.00 . A A .   2 GLU C    1 1 
        1    21 1 1   2 GLU CA   C  28.482   6.039  -0.205 1.00 . A A .   2 GLU CA   1 1 
        1    22 1 1   2 GLU CB   C  28.238   4.799   0.664 1.00 . A A .   2 GLU CB   1 1 
        1    23 1 1   2 GLU CD   C  29.080   3.431   2.580 1.00 . A A .   2 GLU CD   1 1 
        1    24 1 1   2 GLU CG   C  29.330   4.682   1.733 1.00 . A A .   2 GLU CG   1 1 
        1    25 1 1   2 GLU H    H  30.510   6.755  -0.104 1.00 . A A .   2 GLU H    1 1 
        1    26 1 1   2 GLU HA   H  27.890   5.967  -1.107 1.00 . A A .   2 GLU HA   1 1 
        1    27 1 1   2 GLU HB2  H  27.274   4.882   1.145 1.00 . A A .   2 GLU HB2  1 1 
        1    28 1 1   2 GLU HB3  H  28.253   3.917   0.041 1.00 . A A .   2 GLU HB3  1 1 
        1    29 1 1   2 GLU HG2  H  30.297   4.604   1.255 1.00 . A A .   2 GLU HG2  1 1 
        1    30 1 1   2 GLU HG3  H  29.311   5.553   2.368 1.00 . A A .   2 GLU HG3  1 1 
        1    31 1 1   2 GLU N    N  29.924   6.121  -0.568 1.00 . A A .   2 GLU N    1 1 
        1    32 1 1   2 GLU O    O  27.794   7.270   1.738 1.00 . A A .   2 GLU O    1 1 
        1    33 1 1   2 GLU OE1  O  28.746   2.407   2.005 1.00 . A A .   2 GLU OE1  1 1 
        1    34 1 1   2 GLU OE2  O  29.229   3.518   3.787 1.00 . A A .   2 GLU OE2  1 1 
        1    35 1 1   3 LYS C    C  26.249   9.726   0.943 1.00 . A A .   3 LYS C    1 1 
        1    36 1 1   3 LYS CA   C  27.735   9.713   0.569 1.00 . A A .   3 LYS CA   1 1 
        1    37 1 1   3 LYS CB   C  28.012  10.883  -0.379 1.00 . A A .   3 LYS CB   1 1 
        1    38 1 1   3 LYS CD   C  29.774  12.161  -1.621 1.00 . A A .   3 LYS CD   1 1 
        1    39 1 1   3 LYS CE   C  29.547  13.549  -1.006 1.00 . A A .   3 LYS CE   1 1 
        1    40 1 1   3 LYS CG   C  29.520  11.061  -0.578 1.00 . A A .   3 LYS CG   1 1 
        1    41 1 1   3 LYS H    H  28.343   8.435  -1.054 1.00 . A A .   3 LYS H    1 1 
        1    42 1 1   3 LYS HA   H  28.330   9.829   1.463 1.00 . A A .   3 LYS HA   1 1 
        1    43 1 1   3 LYS HB2  H  27.546  10.686  -1.332 1.00 . A A .   3 LYS HB2  1 1 
        1    44 1 1   3 LYS HB3  H  27.598  11.784   0.044 1.00 . A A .   3 LYS HB3  1 1 
        1    45 1 1   3 LYS HD2  H  30.792  12.090  -1.975 1.00 . A A .   3 LYS HD2  1 1 
        1    46 1 1   3 LYS HD3  H  29.098  12.028  -2.453 1.00 . A A .   3 LYS HD3  1 1 
        1    47 1 1   3 LYS HE2  H  28.491  13.711  -0.852 1.00 . A A .   3 LYS HE2  1 1 
        1    48 1 1   3 LYS HE3  H  30.064  13.618  -0.061 1.00 . A A .   3 LYS HE3  1 1 
        1    49 1 1   3 LYS HG2  H  29.978  11.334   0.360 1.00 . A A .   3 LYS HG2  1 1 
        1    50 1 1   3 LYS HG3  H  29.946  10.133  -0.929 1.00 . A A .   3 LYS HG3  1 1 
        1    51 1 1   3 LYS HZ1  H  30.032  14.241  -2.910 1.00 . A A .   3 LYS HZ1  1 1 
        1    52 1 1   3 LYS HZ2  H  31.056  14.816  -1.686 1.00 . A A .   3 LYS HZ2  1 1 
        1    53 1 1   3 LYS HZ3  H  29.491  15.454  -1.851 1.00 . A A .   3 LYS HZ3  1 1 
        1    54 1 1   3 LYS N    N  28.094   8.431  -0.107 1.00 . A A .   3 LYS N    1 1 
        1    55 1 1   3 LYS NZ   N  30.072  14.593  -1.934 1.00 . A A .   3 LYS NZ   1 1 
        1    56 1 1   3 LYS O    O  25.830   9.110   1.901 1.00 . A A .   3 LYS O    1 1 
        1    57 1 1   4 ALA C    C  23.273   9.261   0.065 1.00 . A A .   4 ALA C    1 1 
        1    58 1 1   4 ALA CA   C  23.997  10.536   0.505 1.00 . A A .   4 ALA CA   1 1 
        1    59 1 1   4 ALA CB   C  23.401  11.736  -0.232 1.00 . A A .   4 ALA CB   1 1 
        1    60 1 1   4 ALA H    H  25.820  10.947  -0.562 1.00 . A A .   4 ALA H    1 1 
        1    61 1 1   4 ALA HA   H  23.867  10.672   1.568 1.00 . A A .   4 ALA HA   1 1 
        1    62 1 1   4 ALA HB1  H  22.330  11.748  -0.093 1.00 . A A .   4 ALA HB1  1 1 
        1    63 1 1   4 ALA HB2  H  23.626  11.660  -1.285 1.00 . A A .   4 ALA HB2  1 1 
        1    64 1 1   4 ALA HB3  H  23.825  12.647   0.163 1.00 . A A .   4 ALA HB3  1 1 
        1    65 1 1   4 ALA N    N  25.454  10.448   0.196 1.00 . A A .   4 ALA N    1 1 
        1    66 1 1   4 ALA O    O  23.647   8.619  -0.894 1.00 . A A .   4 ALA O    1 1 
        1    67 1 1   5 MET C    C  22.399   6.529   0.063 1.00 . A A .   5 MET C    1 1 
        1    68 1 1   5 MET CA   C  21.447   7.680   0.400 1.00 . A A .   5 MET CA   1 1 
        1    69 1 1   5 MET CB   C  20.559   7.979  -0.813 1.00 . A A .   5 MET CB   1 1 
        1    70 1 1   5 MET CE   C  18.397  11.378  -1.643 1.00 . A A .   5 MET CE   1 1 
        1    71 1 1   5 MET CG   C  19.910   9.354  -0.647 1.00 . A A .   5 MET CG   1 1 
        1    72 1 1   5 MET H    H  21.944   9.448   1.527 1.00 . A A .   5 MET H    1 1 
        1    73 1 1   5 MET HA   H  20.823   7.395   1.234 1.00 . A A .   5 MET HA   1 1 
        1    74 1 1   5 MET HB2  H  21.160   7.969  -1.712 1.00 . A A .   5 MET HB2  1 1 
        1    75 1 1   5 MET HB3  H  19.788   7.227  -0.886 1.00 . A A .   5 MET HB3  1 1 
        1    76 1 1   5 MET HE1  H  17.706  11.443  -0.812 1.00 . A A .   5 MET HE1  1 1 
        1    77 1 1   5 MET HE2  H  17.964  11.845  -2.517 1.00 . A A .   5 MET HE2  1 1 
        1    78 1 1   5 MET HE3  H  19.313  11.883  -1.386 1.00 . A A .   5 MET HE3  1 1 
        1    79 1 1   5 MET HG2  H  19.387   9.396   0.296 1.00 . A A .   5 MET HG2  1 1 
        1    80 1 1   5 MET HG3  H  20.676  10.117  -0.668 1.00 . A A .   5 MET HG3  1 1 
        1    81 1 1   5 MET N    N  22.226   8.904   0.763 1.00 . A A .   5 MET N    1 1 
        1    82 1 1   5 MET O    O  22.603   6.202  -1.089 1.00 . A A .   5 MET O    1 1 
        1    83 1 1   5 MET SD   S  18.742   9.637  -2.000 1.00 . A A .   5 MET SD   1 1 
        1    84 1 1   6 PRO C    C  23.270   3.587   0.146 1.00 . A A .   6 PRO C    1 1 
        1    85 1 1   6 PRO CA   C  23.921   4.774   0.874 1.00 . A A .   6 PRO CA   1 1 
        1    86 1 1   6 PRO CB   C  24.324   4.387   2.314 1.00 . A A .   6 PRO CB   1 1 
        1    87 1 1   6 PRO CD   C  22.798   6.249   2.484 1.00 . A A .   6 PRO CD   1 1 
        1    88 1 1   6 PRO CG   C  24.005   5.591   3.146 1.00 . A A .   6 PRO CG   1 1 
        1    89 1 1   6 PRO HA   H  24.793   5.104   0.333 1.00 . A A .   6 PRO HA   1 1 
        1    90 1 1   6 PRO HB2  H  23.748   3.533   2.653 1.00 . A A .   6 PRO HB2  1 1 
        1    91 1 1   6 PRO HB3  H  25.381   4.168   2.367 1.00 . A A .   6 PRO HB3  1 1 
        1    92 1 1   6 PRO HD2  H  21.877   5.829   2.869 1.00 . A A .   6 PRO HD2  1 1 
        1    93 1 1   6 PRO HD3  H  22.819   7.320   2.623 1.00 . A A .   6 PRO HD3  1 1 
        1    94 1 1   6 PRO HG2  H  23.764   5.295   4.161 1.00 . A A .   6 PRO HG2  1 1 
        1    95 1 1   6 PRO HG3  H  24.838   6.278   3.148 1.00 . A A .   6 PRO HG3  1 1 
        1    96 1 1   6 PRO N    N  22.973   5.917   1.063 1.00 . A A .   6 PRO N    1 1 
        1    97 1 1   6 PRO O    O  22.103   3.296   0.328 1.00 . A A .   6 PRO O    1 1 
        1    98 1 1   7 GLU C    C  22.096   2.068  -1.995 1.00 . A A .   7 GLU C    1 1 
        1    99 1 1   7 GLU CA   C  23.472   1.733  -1.418 1.00 . A A .   7 GLU CA   1 1 
        1   100 1 1   7 GLU CB   C  23.338   0.540  -0.470 1.00 . A A .   7 GLU CB   1 1 
        1   101 1 1   7 GLU CD   C  25.540  -0.423  -1.169 1.00 . A A .   7 GLU CD   1 1 
        1   102 1 1   7 GLU CG   C  24.723   0.098   0.014 1.00 . A A .   7 GLU CG   1 1 
        1   103 1 1   7 GLU H    H  24.961   3.158  -0.797 1.00 . A A .   7 GLU H    1 1 
        1   104 1 1   7 GLU HA   H  24.140   1.475  -2.226 1.00 . A A .   7 GLU HA   1 1 
        1   105 1 1   7 GLU HB2  H  22.733   0.823   0.378 1.00 . A A .   7 GLU HB2  1 1 
        1   106 1 1   7 GLU HB3  H  22.866  -0.281  -0.991 1.00 . A A .   7 GLU HB3  1 1 
        1   107 1 1   7 GLU HG2  H  25.231   0.943   0.463 1.00 . A A .   7 GLU HG2  1 1 
        1   108 1 1   7 GLU HG3  H  24.616  -0.686   0.743 1.00 . A A .   7 GLU HG3  1 1 
        1   109 1 1   7 GLU N    N  24.023   2.903  -0.673 1.00 . A A .   7 GLU N    1 1 
        1   110 1 1   7 GLU O    O  21.668   3.204  -1.997 1.00 . A A .   7 GLU O    1 1 
        1   111 1 1   7 GLU OE1  O  24.937  -0.754  -2.178 1.00 . A A .   7 GLU OE1  1 1 
        1   112 1 1   7 GLU OE2  O  26.752  -0.471  -1.052 1.00 . A A .   7 GLU OE2  1 1 
        1   113 1 1   8 SER C    C  19.032   0.420  -2.344 1.00 . A A .   8 SER C    1 1 
        1   114 1 1   8 SER CA   C  20.052   1.281  -3.084 1.00 . A A .   8 SER CA   1 1 
        1   115 1 1   8 SER CB   C  20.083   0.865  -4.553 1.00 . A A .   8 SER CB   1 1 
        1   116 1 1   8 SER H    H  21.789   0.169  -2.471 1.00 . A A .   8 SER H    1 1 
        1   117 1 1   8 SER HA   H  19.763   2.317  -3.010 1.00 . A A .   8 SER HA   1 1 
        1   118 1 1   8 SER HB2  H  19.152   1.130  -5.025 1.00 . A A .   8 SER HB2  1 1 
        1   119 1 1   8 SER HB3  H  20.896   1.375  -5.052 1.00 . A A .   8 SER HB3  1 1 
        1   120 1 1   8 SER HG   H  21.148  -0.706  -4.982 1.00 . A A .   8 SER HG   1 1 
        1   121 1 1   8 SER N    N  21.407   1.071  -2.489 1.00 . A A .   8 SER N    1 1 
        1   122 1 1   8 SER O    O  18.203   0.916  -1.609 1.00 . A A .   8 SER O    1 1 
        1   123 1 1   8 SER OG   O  20.267  -0.541  -4.636 1.00 . A A .   8 SER OG   1 1 
        1   124 1 1   9 PHE C    C  16.700  -1.262  -2.079 1.00 . A A .   9 PHE C    1 1 
        1   125 1 1   9 PHE CA   C  18.122  -1.781  -1.865 1.00 . A A .   9 PHE CA   1 1 
        1   126 1 1   9 PHE CB   C  18.428  -1.847  -0.365 1.00 . A A .   9 PHE CB   1 1 
        1   127 1 1   9 PHE CD1  C  19.569  -4.084  -0.219 1.00 . A A .   9 PHE CD1  1 1 
        1   128 1 1   9 PHE CD2  C  20.895  -2.082   0.118 1.00 . A A .   9 PHE CD2  1 1 
        1   129 1 1   9 PHE CE1  C  20.709  -4.872  -0.027 1.00 . A A .   9 PHE CE1  1 1 
        1   130 1 1   9 PHE CE2  C  22.036  -2.871   0.308 1.00 . A A .   9 PHE CE2  1 1 
        1   131 1 1   9 PHE CG   C  19.661  -2.690  -0.144 1.00 . A A .   9 PHE CG   1 1 
        1   132 1 1   9 PHE CZ   C  21.943  -4.266   0.235 1.00 . A A .   9 PHE CZ   1 1 
        1   133 1 1   9 PHE H    H  19.769  -1.231  -3.144 1.00 . A A .   9 PHE H    1 1 
        1   134 1 1   9 PHE HA   H  18.208  -2.768  -2.294 1.00 . A A .   9 PHE HA   1 1 
        1   135 1 1   9 PHE HB2  H  18.599  -0.849   0.011 1.00 . A A .   9 PHE HB2  1 1 
        1   136 1 1   9 PHE HB3  H  17.591  -2.290   0.154 1.00 . A A .   9 PHE HB3  1 1 
        1   137 1 1   9 PHE HD1  H  18.617  -4.553  -0.419 1.00 . A A .   9 PHE HD1  1 1 
        1   138 1 1   9 PHE HD2  H  20.965  -1.007   0.177 1.00 . A A .   9 PHE HD2  1 1 
        1   139 1 1   9 PHE HE1  H  20.638  -5.949  -0.083 1.00 . A A .   9 PHE HE1  1 1 
        1   140 1 1   9 PHE HE2  H  22.988  -2.403   0.512 1.00 . A A .   9 PHE HE2  1 1 
        1   141 1 1   9 PHE HZ   H  22.824  -4.874   0.379 1.00 . A A .   9 PHE HZ   1 1 
        1   142 1 1   9 PHE N    N  19.090  -0.867  -2.541 1.00 . A A .   9 PHE N    1 1 
        1   143 1 1   9 PHE O    O  16.255  -0.349  -1.417 1.00 . A A .   9 PHE O    1 1 
        1   144 1 1  10 VAL C    C  13.644  -2.593  -3.177 1.00 . A A .  10 VAL C    1 1 
        1   145 1 1  10 VAL CA   C  14.587  -1.398  -3.300 1.00 . A A .  10 VAL CA   1 1 
        1   146 1 1  10 VAL CB   C  14.528  -0.847  -4.727 1.00 . A A .  10 VAL CB   1 1 
        1   147 1 1  10 VAL CG1  C  13.071  -0.616  -5.143 1.00 . A A .  10 VAL CG1  1 1 
        1   148 1 1  10 VAL CG2  C  15.293   0.476  -4.784 1.00 . A A .  10 VAL CG2  1 1 
        1   149 1 1  10 VAL H    H  16.378  -2.576  -3.531 1.00 . A A .  10 VAL H    1 1 
        1   150 1 1  10 VAL HA   H  14.282  -0.626  -2.604 1.00 . A A .  10 VAL HA   1 1 
        1   151 1 1  10 VAL HB   H  14.984  -1.556  -5.402 1.00 . A A .  10 VAL HB   1 1 
        1   152 1 1  10 VAL HG11 H  12.533  -0.149  -4.332 1.00 . A A .  10 VAL HG11 1 1 
        1   153 1 1  10 VAL HG12 H  12.610  -1.565  -5.379 1.00 . A A .  10 VAL HG12 1 1 
        1   154 1 1  10 VAL HG13 H  13.040   0.024  -6.012 1.00 . A A .  10 VAL HG13 1 1 
        1   155 1 1  10 VAL HG21 H  14.737   1.237  -4.257 1.00 . A A .  10 VAL HG21 1 1 
        1   156 1 1  10 VAL HG22 H  15.423   0.772  -5.814 1.00 . A A .  10 VAL HG22 1 1 
        1   157 1 1  10 VAL HG23 H  16.260   0.350  -4.320 1.00 . A A .  10 VAL HG23 1 1 
        1   158 1 1  10 VAL N    N  15.987  -1.843  -3.010 1.00 . A A .  10 VAL N    1 1 
        1   159 1 1  10 VAL O    O  13.928  -3.669  -3.662 1.00 . A A .  10 VAL O    1 1 
        1   160 1 1  11 VAL C    C  10.238  -3.148  -3.071 1.00 . A A .  11 VAL C    1 1 
        1   161 1 1  11 VAL CA   C  11.538  -3.524  -2.361 1.00 . A A .  11 VAL CA   1 1 
        1   162 1 1  11 VAL CB   C  11.262  -3.728  -0.870 1.00 . A A .  11 VAL CB   1 1 
        1   163 1 1  11 VAL CG1  C  10.068  -4.671  -0.680 1.00 . A A .  11 VAL CG1  1 1 
        1   164 1 1  11 VAL CG2  C  12.502  -4.332  -0.208 1.00 . A A .  11 VAL CG2  1 1 
        1   165 1 1  11 VAL H    H  12.323  -1.527  -2.149 1.00 . A A .  11 VAL H    1 1 
        1   166 1 1  11 VAL HA   H  11.927  -4.443  -2.785 1.00 . A A .  11 VAL HA   1 1 
        1   167 1 1  11 VAL HB   H  11.039  -2.773  -0.414 1.00 . A A .  11 VAL HB   1 1 
        1   168 1 1  11 VAL HG11 H  10.052  -5.035   0.336 1.00 . A A .  11 VAL HG11 1 1 
        1   169 1 1  11 VAL HG12 H  10.157  -5.505  -1.361 1.00 . A A .  11 VAL HG12 1 1 
        1   170 1 1  11 VAL HG13 H   9.153  -4.136  -0.886 1.00 . A A .  11 VAL HG13 1 1 
        1   171 1 1  11 VAL HG21 H  12.376  -4.330   0.864 1.00 . A A .  11 VAL HG21 1 1 
        1   172 1 1  11 VAL HG22 H  13.370  -3.745  -0.470 1.00 . A A .  11 VAL HG22 1 1 
        1   173 1 1  11 VAL HG23 H  12.636  -5.346  -0.554 1.00 . A A .  11 VAL HG23 1 1 
        1   174 1 1  11 VAL N    N  12.522  -2.408  -2.529 1.00 . A A .  11 VAL N    1 1 
        1   175 1 1  11 VAL O    O   9.721  -2.062  -2.901 1.00 . A A .  11 VAL O    1 1 
        1   176 1 1  12 ARG C    C   7.459  -4.914  -4.352 1.00 . A A .  12 ARG C    1 1 
        1   177 1 1  12 ARG CA   C   8.427  -3.761  -4.590 1.00 . A A .  12 ARG CA   1 1 
        1   178 1 1  12 ARG CB   C   8.705  -3.631  -6.087 1.00 . A A .  12 ARG CB   1 1 
        1   179 1 1  12 ARG CD   C   9.738  -2.196  -7.847 1.00 . A A .  12 ARG CD   1 1 
        1   180 1 1  12 ARG CG   C   9.443  -2.321  -6.354 1.00 . A A .  12 ARG CG   1 1 
        1   181 1 1  12 ARG CZ   C  10.836  -0.608  -9.303 1.00 . A A .  12 ARG CZ   1 1 
        1   182 1 1  12 ARG H    H  10.144  -4.909  -3.976 1.00 . A A .  12 ARG H    1 1 
        1   183 1 1  12 ARG HA   H   7.981  -2.842  -4.227 1.00 . A A .  12 ARG HA   1 1 
        1   184 1 1  12 ARG HB2  H   9.316  -4.461  -6.411 1.00 . A A .  12 ARG HB2  1 1 
        1   185 1 1  12 ARG HB3  H   7.772  -3.635  -6.631 1.00 . A A .  12 ARG HB3  1 1 
        1   186 1 1  12 ARG HD2  H  10.379  -3.008  -8.158 1.00 . A A .  12 ARG HD2  1 1 
        1   187 1 1  12 ARG HD3  H   8.812  -2.234  -8.402 1.00 . A A .  12 ARG HD3  1 1 
        1   188 1 1  12 ARG HE   H  10.544  -0.256  -7.372 1.00 . A A .  12 ARG HE   1 1 
        1   189 1 1  12 ARG HG2  H   8.827  -1.492  -6.037 1.00 . A A .  12 ARG HG2  1 1 
        1   190 1 1  12 ARG HG3  H  10.371  -2.311  -5.803 1.00 . A A .  12 ARG HG3  1 1 
        1   191 1 1  12 ARG HH11 H  10.226  -2.342 -10.095 1.00 . A A .  12 ARG HH11 1 1 
        1   192 1 1  12 ARG HH12 H  10.993  -1.246 -11.194 1.00 . A A .  12 ARG HH12 1 1 
        1   193 1 1  12 ARG HH21 H  11.543   1.193  -8.788 1.00 . A A .  12 ARG HH21 1 1 
        1   194 1 1  12 ARG HH22 H  11.739   0.757 -10.453 1.00 . A A .  12 ARG HH22 1 1 
        1   195 1 1  12 ARG N    N   9.704  -4.041  -3.862 1.00 . A A .  12 ARG N    1 1 
        1   196 1 1  12 ARG NE   N  10.416  -0.896  -8.104 1.00 . A A .  12 ARG NE   1 1 
        1   197 1 1  12 ARG NH1  N  10.673  -1.465 -10.273 1.00 . A A .  12 ARG NH1  1 1 
        1   198 1 1  12 ARG NH2  N  11.419   0.537  -9.533 1.00 . A A .  12 ARG NH2  1 1 
        1   199 1 1  12 ARG O    O   7.849  -6.064  -4.323 1.00 . A A .  12 ARG O    1 1 
        1   200 1 1  13 ARG C    C   3.919  -5.382  -4.706 1.00 . A A .  13 ARG C    1 1 
        1   201 1 1  13 ARG CA   C   5.196  -5.702  -3.932 1.00 . A A .  13 ARG CA   1 1 
        1   202 1 1  13 ARG CB   C   4.887  -5.785  -2.436 1.00 . A A .  13 ARG CB   1 1 
        1   203 1 1  13 ARG CD   C   5.855  -6.271  -0.184 1.00 . A A .  13 ARG CD   1 1 
        1   204 1 1  13 ARG CG   C   6.142  -6.234  -1.685 1.00 . A A .  13 ARG CG   1 1 
        1   205 1 1  13 ARG CZ   C   5.180  -8.556   0.297 1.00 . A A .  13 ARG CZ   1 1 
        1   206 1 1  13 ARG H    H   5.909  -3.685  -4.199 1.00 . A A .  13 ARG H    1 1 
        1   207 1 1  13 ARG HA   H   5.587  -6.654  -4.270 1.00 . A A .  13 ARG HA   1 1 
        1   208 1 1  13 ARG HB2  H   4.580  -4.813  -2.079 1.00 . A A .  13 ARG HB2  1 1 
        1   209 1 1  13 ARG HB3  H   4.093  -6.498  -2.269 1.00 . A A .  13 ARG HB3  1 1 
        1   210 1 1  13 ARG HD2  H   6.765  -6.502   0.351 1.00 . A A .  13 ARG HD2  1 1 
        1   211 1 1  13 ARG HD3  H   5.490  -5.307   0.133 1.00 . A A .  13 ARG HD3  1 1 
        1   212 1 1  13 ARG HE   H   3.878  -7.063   0.148 1.00 . A A .  13 ARG HE   1 1 
        1   213 1 1  13 ARG HG2  H   6.430  -7.219  -2.022 1.00 . A A .  13 ARG HG2  1 1 
        1   214 1 1  13 ARG HG3  H   6.944  -5.539  -1.879 1.00 . A A .  13 ARG HG3  1 1 
        1   215 1 1  13 ARG HH11 H   7.134  -8.208   0.015 1.00 . A A .  13 ARG HH11 1 1 
        1   216 1 1  13 ARG HH12 H   6.708  -9.848   0.376 1.00 . A A .  13 ARG HH12 1 1 
        1   217 1 1  13 ARG HH21 H   3.310  -9.198   0.618 1.00 . A A .  13 ARG HH21 1 1 
        1   218 1 1  13 ARG HH22 H   4.546 -10.408   0.716 1.00 . A A .  13 ARG HH22 1 1 
        1   219 1 1  13 ARG N    N   6.199  -4.621  -4.175 1.00 . A A .  13 ARG N    1 1 
        1   220 1 1  13 ARG NE   N   4.825  -7.313   0.101 1.00 . A A .  13 ARG NE   1 1 
        1   221 1 1  13 ARG NH1  N   6.439  -8.896   0.224 1.00 . A A .  13 ARG NH1  1 1 
        1   222 1 1  13 ARG NH2  N   4.275  -9.457   0.563 1.00 . A A .  13 ARG NH2  1 1 
        1   223 1 1  13 ARG O    O   3.651  -4.244  -5.033 1.00 . A A .  13 ARG O    1 1 
        1   224 1 1  14 GLU C    C   0.745  -6.972  -5.148 1.00 . A A .  14 GLU C    1 1 
        1   225 1 1  14 GLU CA   C   1.869  -6.152  -5.774 1.00 . A A .  14 GLU CA   1 1 
        1   226 1 1  14 GLU CB   C   2.071  -6.586  -7.226 1.00 . A A .  14 GLU CB   1 1 
        1   227 1 1  14 GLU CD   C   3.293  -6.087  -9.343 1.00 . A A .  14 GLU CD   1 1 
        1   228 1 1  14 GLU CG   C   3.018  -5.606  -7.919 1.00 . A A .  14 GLU CG   1 1 
        1   229 1 1  14 GLU H    H   3.380  -7.290  -4.739 1.00 . A A .  14 GLU H    1 1 
        1   230 1 1  14 GLU HA   H   1.600  -5.103  -5.749 1.00 . A A .  14 GLU HA   1 1 
        1   231 1 1  14 GLU HB2  H   2.501  -7.577  -7.247 1.00 . A A .  14 GLU HB2  1 1 
        1   232 1 1  14 GLU HB3  H   1.121  -6.592  -7.739 1.00 . A A .  14 GLU HB3  1 1 
        1   233 1 1  14 GLU HG2  H   2.561  -4.627  -7.950 1.00 . A A .  14 GLU HG2  1 1 
        1   234 1 1  14 GLU HG3  H   3.947  -5.552  -7.372 1.00 . A A .  14 GLU HG3  1 1 
        1   235 1 1  14 GLU N    N   3.135  -6.380  -5.010 1.00 . A A .  14 GLU N    1 1 
        1   236 1 1  14 GLU O    O   0.982  -7.952  -4.472 1.00 . A A .  14 GLU O    1 1 
        1   237 1 1  14 GLU OE1  O   2.792  -7.141  -9.698 1.00 . A A .  14 GLU OE1  1 1 
        1   238 1 1  14 GLU OE2  O   4.005  -5.396 -10.054 1.00 . A A .  14 GLU OE2  1 1 
        1   239 1 1  15 ALA C    C  -2.854  -7.152  -5.648 1.00 . A A .  15 ALA C    1 1 
        1   240 1 1  15 ALA CA   C  -1.619  -7.338  -4.768 1.00 . A A .  15 ALA CA   1 1 
        1   241 1 1  15 ALA CB   C  -1.908  -6.810  -3.362 1.00 . A A .  15 ALA CB   1 1 
        1   242 1 1  15 ALA H    H  -0.651  -5.782  -5.904 1.00 . A A .  15 ALA H    1 1 
        1   243 1 1  15 ALA HA   H  -1.372  -8.390  -4.714 1.00 . A A .  15 ALA HA   1 1 
        1   244 1 1  15 ALA HB1  H  -1.074  -7.036  -2.713 1.00 . A A .  15 ALA HB1  1 1 
        1   245 1 1  15 ALA HB2  H  -2.802  -7.280  -2.976 1.00 . A A .  15 ALA HB2  1 1 
        1   246 1 1  15 ALA HB3  H  -2.052  -5.741  -3.402 1.00 . A A .  15 ALA HB3  1 1 
        1   247 1 1  15 ALA N    N  -0.479  -6.580  -5.358 1.00 . A A .  15 ALA N    1 1 
        1   248 1 1  15 ALA O    O  -3.008  -6.142  -6.302 1.00 . A A .  15 ALA O    1 1 
        1   249 1 1  16 HIS C    C  -6.168  -7.731  -5.607 1.00 . A A .  16 HIS C    1 1 
        1   250 1 1  16 HIS CA   C  -4.967  -8.007  -6.512 1.00 . A A .  16 HIS CA   1 1 
        1   251 1 1  16 HIS CB   C  -5.184  -9.321  -7.266 1.00 . A A .  16 HIS CB   1 1 
        1   252 1 1  16 HIS CD2  C  -3.748 -11.067  -5.927 1.00 . A A .  16 HIS CD2  1 1 
        1   253 1 1  16 HIS CE1  C  -5.371 -12.169  -5.007 1.00 . A A .  16 HIS CE1  1 1 
        1   254 1 1  16 HIS CG   C  -4.916 -10.480  -6.347 1.00 . A A .  16 HIS CG   1 1 
        1   255 1 1  16 HIS H    H  -3.583  -8.925  -5.131 1.00 . A A .  16 HIS H    1 1 
        1   256 1 1  16 HIS HA   H  -4.864  -7.199  -7.224 1.00 . A A .  16 HIS HA   1 1 
        1   257 1 1  16 HIS HB2  H  -6.204  -9.371  -7.622 1.00 . A A .  16 HIS HB2  1 1 
        1   258 1 1  16 HIS HB3  H  -4.509  -9.366  -8.106 1.00 . A A .  16 HIS HB3  1 1 
        1   259 1 1  16 HIS HD1  H  -6.898 -11.026  -5.838 1.00 . A A .  16 HIS HD1  1 1 
        1   260 1 1  16 HIS HD2  H  -2.755 -10.750  -6.210 1.00 . A A .  16 HIS HD2  1 1 
        1   261 1 1  16 HIS HE1  H  -5.926 -12.892  -4.429 1.00 . A A .  16 HIS HE1  1 1 
        1   262 1 1  16 HIS N    N  -3.733  -8.119  -5.671 1.00 . A A .  16 HIS N    1 1 
        1   263 1 1  16 HIS ND1  N  -5.937 -11.198  -5.746 1.00 . A A .  16 HIS ND1  1 1 
        1   264 1 1  16 HIS NE2  N  -4.038 -12.134  -5.082 1.00 . A A .  16 HIS NE2  1 1 
        1   265 1 1  16 HIS O    O  -6.455  -8.485  -4.700 1.00 . A A .  16 HIS O    1 1 
        1   266 1 1  17 LEU C    C  -9.316  -6.382  -5.869 1.00 . A A .  17 LEU C    1 1 
        1   267 1 1  17 LEU CA   C  -8.056  -6.300  -5.010 1.00 . A A .  17 LEU CA   1 1 
        1   268 1 1  17 LEU CB   C  -7.890  -4.877  -4.462 1.00 . A A .  17 LEU CB   1 1 
        1   269 1 1  17 LEU CD1  C  -5.409  -4.360  -4.366 1.00 . A A .  17 LEU CD1  1 1 
        1   270 1 1  17 LEU CD2  C  -6.862  -3.794  -2.421 1.00 . A A .  17 LEU CD2  1 1 
        1   271 1 1  17 LEU CG   C  -6.634  -4.802  -3.554 1.00 . A A .  17 LEU CG   1 1 
        1   272 1 1  17 LEU H    H  -6.606  -6.063  -6.588 1.00 . A A .  17 LEU H    1 1 
        1   273 1 1  17 LEU HA   H  -8.149  -6.991  -4.181 1.00 . A A .  17 LEU HA   1 1 
        1   274 1 1  17 LEU HB2  H  -7.790  -4.187  -5.290 1.00 . A A .  17 LEU HB2  1 1 
        1   275 1 1  17 LEU HB3  H  -8.770  -4.619  -3.888 1.00 . A A .  17 LEU HB3  1 1 
        1   276 1 1  17 LEU HD11 H  -4.547  -4.314  -3.716 1.00 . A A .  17 LEU HD11 1 1 
        1   277 1 1  17 LEU HD12 H  -5.592  -3.383  -4.789 1.00 . A A .  17 LEU HD12 1 1 
        1   278 1 1  17 LEU HD13 H  -5.224  -5.067  -5.159 1.00 . A A .  17 LEU HD13 1 1 
        1   279 1 1  17 LEU HD21 H  -7.652  -4.151  -1.775 1.00 . A A .  17 LEU HD21 1 1 
        1   280 1 1  17 LEU HD22 H  -7.142  -2.838  -2.838 1.00 . A A .  17 LEU HD22 1 1 
        1   281 1 1  17 LEU HD23 H  -5.953  -3.685  -1.849 1.00 . A A .  17 LEU HD23 1 1 
        1   282 1 1  17 LEU HG   H  -6.437  -5.777  -3.122 1.00 . A A .  17 LEU HG   1 1 
        1   283 1 1  17 LEU N    N  -6.866  -6.652  -5.848 1.00 . A A .  17 LEU N    1 1 
        1   284 1 1  17 LEU O    O  -9.343  -5.933  -6.997 1.00 . A A .  17 LEU O    1 1 
        1   285 1 1  18 ALA C    C -12.423  -5.789  -6.012 1.00 . A A .  18 ALA C    1 1 
        1   286 1 1  18 ALA CA   C -11.617  -7.084  -6.127 1.00 . A A .  18 ALA CA   1 1 
        1   287 1 1  18 ALA CB   C -12.438  -8.243  -5.566 1.00 . A A .  18 ALA CB   1 1 
        1   288 1 1  18 ALA H    H -10.311  -7.321  -4.436 1.00 . A A .  18 ALA H    1 1 
        1   289 1 1  18 ALA HA   H -11.386  -7.276  -7.164 1.00 . A A .  18 ALA HA   1 1 
        1   290 1 1  18 ALA HB1  H -11.979  -9.178  -5.846 1.00 . A A .  18 ALA HB1  1 1 
        1   291 1 1  18 ALA HB2  H -13.442  -8.200  -5.964 1.00 . A A .  18 ALA HB2  1 1 
        1   292 1 1  18 ALA HB3  H -12.475  -8.167  -4.488 1.00 . A A .  18 ALA HB3  1 1 
        1   293 1 1  18 ALA N    N -10.357  -6.961  -5.346 1.00 . A A .  18 ALA N    1 1 
        1   294 1 1  18 ALA O    O -13.494  -5.665  -6.573 1.00 . A A .  18 ALA O    1 1 
        1   295 1 1  19 ALA C    C -12.023  -2.456  -6.013 1.00 . A A .  19 ALA C    1 1 
        1   296 1 1  19 ALA CA   C -12.661  -3.530  -5.115 1.00 . A A .  19 ALA CA   1 1 
        1   297 1 1  19 ALA CB   C -12.572  -3.095  -3.645 1.00 . A A .  19 ALA CB   1 1 
        1   298 1 1  19 ALA H    H -11.059  -4.951  -4.833 1.00 . A A .  19 ALA H    1 1 
        1   299 1 1  19 ALA HA   H -13.700  -3.667  -5.385 1.00 . A A .  19 ALA HA   1 1 
        1   300 1 1  19 ALA HB1  H -13.349  -3.584  -3.075 1.00 . A A .  19 ALA HB1  1 1 
        1   301 1 1  19 ALA HB2  H -12.692  -2.023  -3.568 1.00 . A A .  19 ALA HB2  1 1 
        1   302 1 1  19 ALA HB3  H -11.609  -3.376  -3.249 1.00 . A A .  19 ALA HB3  1 1 
        1   303 1 1  19 ALA N    N -11.922  -4.823  -5.280 1.00 . A A .  19 ALA N    1 1 
        1   304 1 1  19 ALA O    O -10.851  -2.521  -6.324 1.00 . A A .  19 ALA O    1 1 
        1   305 1 1  20 PRO C    C -11.248   0.521  -6.558 1.00 . A A .  20 PRO C    1 1 
        1   306 1 1  20 PRO CA   C -12.278  -0.360  -7.289 1.00 . A A .  20 PRO CA   1 1 
        1   307 1 1  20 PRO CB   C -13.547   0.446  -7.633 1.00 . A A .  20 PRO CB   1 1 
        1   308 1 1  20 PRO CD   C -14.218  -1.298  -6.106 1.00 . A A .  20 PRO CD   1 1 
        1   309 1 1  20 PRO CG   C -14.512   0.138  -6.533 1.00 . A A .  20 PRO CG   1 1 
        1   310 1 1  20 PRO HA   H -11.850  -0.767  -8.191 1.00 . A A .  20 PRO HA   1 1 
        1   311 1 1  20 PRO HB2  H -13.333   1.508  -7.663 1.00 . A A .  20 PRO HB2  1 1 
        1   312 1 1  20 PRO HB3  H -13.953   0.122  -8.581 1.00 . A A .  20 PRO HB3  1 1 
        1   313 1 1  20 PRO HD2  H -14.398  -1.424  -5.046 1.00 . A A .  20 PRO HD2  1 1 
        1   314 1 1  20 PRO HD3  H -14.810  -1.994  -6.678 1.00 . A A .  20 PRO HD3  1 1 
        1   315 1 1  20 PRO HG2  H -14.359   0.815  -5.702 1.00 . A A .  20 PRO HG2  1 1 
        1   316 1 1  20 PRO HG3  H -15.530   0.212  -6.890 1.00 . A A .  20 PRO HG3  1 1 
        1   317 1 1  20 PRO N    N -12.787  -1.468  -6.421 1.00 . A A .  20 PRO N    1 1 
        1   318 1 1  20 PRO O    O -11.163   0.504  -5.346 1.00 . A A .  20 PRO O    1 1 
        1   319 1 1  21 PRO C    C -10.066   3.260  -5.801 1.00 . A A .  21 PRO C    1 1 
        1   320 1 1  21 PRO CA   C  -9.441   2.193  -6.708 1.00 . A A .  21 PRO CA   1 1 
        1   321 1 1  21 PRO CB   C  -8.770   2.831  -7.943 1.00 . A A .  21 PRO CB   1 1 
        1   322 1 1  21 PRO CD   C -10.509   1.374  -8.761 1.00 . A A .  21 PRO CD   1 1 
        1   323 1 1  21 PRO CG   C  -9.764   2.674  -9.051 1.00 . A A .  21 PRO CG   1 1 
        1   324 1 1  21 PRO HA   H  -8.715   1.619  -6.154 1.00 . A A .  21 PRO HA   1 1 
        1   325 1 1  21 PRO HB2  H  -8.557   3.880  -7.768 1.00 . A A .  21 PRO HB2  1 1 
        1   326 1 1  21 PRO HB3  H  -7.859   2.304  -8.190 1.00 . A A .  21 PRO HB3  1 1 
        1   327 1 1  21 PRO HD2  H -11.526   1.430  -9.124 1.00 . A A .  21 PRO HD2  1 1 
        1   328 1 1  21 PRO HD3  H  -9.993   0.532  -9.196 1.00 . A A .  21 PRO HD3  1 1 
        1   329 1 1  21 PRO HG2  H -10.453   3.510  -9.054 1.00 . A A .  21 PRO HG2  1 1 
        1   330 1 1  21 PRO HG3  H  -9.261   2.603 -10.004 1.00 . A A .  21 PRO HG3  1 1 
        1   331 1 1  21 PRO N    N -10.478   1.286  -7.293 1.00 . A A .  21 PRO N    1 1 
        1   332 1 1  21 PRO O    O  -9.461   3.718  -4.853 1.00 . A A .  21 PRO O    1 1 
        1   333 1 1  22 ALA C    C -12.149   4.148  -3.830 1.00 . A A .  22 ALA C    1 1 
        1   334 1 1  22 ALA CA   C -11.945   4.687  -5.248 1.00 . A A .  22 ALA CA   1 1 
        1   335 1 1  22 ALA CB   C -13.301   5.023  -5.867 1.00 . A A .  22 ALA CB   1 1 
        1   336 1 1  22 ALA H    H -11.745   3.271  -6.855 1.00 . A A .  22 ALA H    1 1 
        1   337 1 1  22 ALA HA   H -11.334   5.576  -5.212 1.00 . A A .  22 ALA HA   1 1 
        1   338 1 1  22 ALA HB1  H -13.739   5.862  -5.347 1.00 . A A .  22 ALA HB1  1 1 
        1   339 1 1  22 ALA HB2  H -13.957   4.167  -5.787 1.00 . A A .  22 ALA HB2  1 1 
        1   340 1 1  22 ALA HB3  H -13.167   5.275  -6.908 1.00 . A A .  22 ALA HB3  1 1 
        1   341 1 1  22 ALA N    N -11.275   3.655  -6.087 1.00 . A A .  22 ALA N    1 1 
        1   342 1 1  22 ALA O    O -11.993   4.859  -2.857 1.00 . A A .  22 ALA O    1 1 
        1   343 1 1  23 ALA C    C -11.402   2.266  -1.576 1.00 . A A .  23 ALA C    1 1 
        1   344 1 1  23 ALA CA   C -12.722   2.316  -2.351 1.00 . A A .  23 ALA CA   1 1 
        1   345 1 1  23 ALA CB   C -13.277   0.900  -2.502 1.00 . A A .  23 ALA CB   1 1 
        1   346 1 1  23 ALA H    H -12.624   2.343  -4.502 1.00 . A A .  23 ALA H    1 1 
        1   347 1 1  23 ALA HA   H -13.432   2.924  -1.810 1.00 . A A .  23 ALA HA   1 1 
        1   348 1 1  23 ALA HB1  H -12.585   0.303  -3.078 1.00 . A A .  23 ALA HB1  1 1 
        1   349 1 1  23 ALA HB2  H -14.228   0.941  -3.012 1.00 . A A .  23 ALA HB2  1 1 
        1   350 1 1  23 ALA HB3  H -13.409   0.458  -1.526 1.00 . A A .  23 ALA HB3  1 1 
        1   351 1 1  23 ALA N    N -12.502   2.898  -3.705 1.00 . A A .  23 ALA N    1 1 
        1   352 1 1  23 ALA O    O -11.361   2.518  -0.388 1.00 . A A .  23 ALA O    1 1 
        1   353 1 1  24 VAL C    C  -8.636   3.239  -0.989 1.00 . A A .  24 VAL C    1 1 
        1   354 1 1  24 VAL CA   C  -9.014   1.857  -1.529 1.00 . A A .  24 VAL CA   1 1 
        1   355 1 1  24 VAL CB   C  -7.943   1.375  -2.509 1.00 . A A .  24 VAL CB   1 1 
        1   356 1 1  24 VAL CG1  C  -6.569   1.431  -1.840 1.00 . A A .  24 VAL CG1  1 1 
        1   357 1 1  24 VAL CG2  C  -8.251  -0.065  -2.930 1.00 . A A .  24 VAL CG2  1 1 
        1   358 1 1  24 VAL H    H -10.378   1.729  -3.191 1.00 . A A .  24 VAL H    1 1 
        1   359 1 1  24 VAL HA   H  -9.088   1.161  -0.708 1.00 . A A .  24 VAL HA   1 1 
        1   360 1 1  24 VAL HB   H  -7.943   2.013  -3.381 1.00 . A A .  24 VAL HB   1 1 
        1   361 1 1  24 VAL HG11 H  -5.863   0.846  -2.412 1.00 . A A .  24 VAL HG11 1 1 
        1   362 1 1  24 VAL HG12 H  -6.638   1.032  -0.838 1.00 . A A .  24 VAL HG12 1 1 
        1   363 1 1  24 VAL HG13 H  -6.233   2.456  -1.797 1.00 . A A .  24 VAL HG13 1 1 
        1   364 1 1  24 VAL HG21 H  -8.274  -0.698  -2.055 1.00 . A A .  24 VAL HG21 1 1 
        1   365 1 1  24 VAL HG22 H  -7.487  -0.415  -3.609 1.00 . A A .  24 VAL HG22 1 1 
        1   366 1 1  24 VAL HG23 H  -9.212  -0.098  -3.423 1.00 . A A .  24 VAL HG23 1 1 
        1   367 1 1  24 VAL N    N -10.325   1.934  -2.234 1.00 . A A .  24 VAL N    1 1 
        1   368 1 1  24 VAL O    O  -8.233   3.384   0.150 1.00 . A A .  24 VAL O    1 1 
        1   369 1 1  25 PHE C    C  -9.316   6.004  -0.145 1.00 . A A .  25 PHE C    1 1 
        1   370 1 1  25 PHE CA   C  -8.423   5.627  -1.327 1.00 . A A .  25 PHE CA   1 1 
        1   371 1 1  25 PHE CB   C  -8.630   6.625  -2.466 1.00 . A A .  25 PHE CB   1 1 
        1   372 1 1  25 PHE CD1  C  -6.955   8.355  -1.721 1.00 . A A .  25 PHE CD1  1 1 
        1   373 1 1  25 PHE CD2  C  -9.304   8.959  -1.781 1.00 . A A .  25 PHE CD2  1 1 
        1   374 1 1  25 PHE CE1  C  -6.637   9.641  -1.266 1.00 . A A .  25 PHE CE1  1 1 
        1   375 1 1  25 PHE CE2  C  -8.986  10.243  -1.327 1.00 . A A .  25 PHE CE2  1 1 
        1   376 1 1  25 PHE CG   C  -8.289   8.014  -1.979 1.00 . A A .  25 PHE CG   1 1 
        1   377 1 1  25 PHE CZ   C  -7.652  10.584  -1.069 1.00 . A A .  25 PHE CZ   1 1 
        1   378 1 1  25 PHE H    H  -9.101   4.120  -2.705 1.00 . A A .  25 PHE H    1 1 
        1   379 1 1  25 PHE HA   H  -7.389   5.648  -1.015 1.00 . A A .  25 PHE HA   1 1 
        1   380 1 1  25 PHE HB2  H  -7.986   6.364  -3.293 1.00 . A A .  25 PHE HB2  1 1 
        1   381 1 1  25 PHE HB3  H  -9.662   6.595  -2.789 1.00 . A A .  25 PHE HB3  1 1 
        1   382 1 1  25 PHE HD1  H  -6.173   7.627  -1.872 1.00 . A A .  25 PHE HD1  1 1 
        1   383 1 1  25 PHE HD2  H -10.332   8.696  -1.981 1.00 . A A .  25 PHE HD2  1 1 
        1   384 1 1  25 PHE HE1  H  -5.608   9.904  -1.067 1.00 . A A .  25 PHE HE1  1 1 
        1   385 1 1  25 PHE HE2  H  -9.768  10.971  -1.174 1.00 . A A .  25 PHE HE2  1 1 
        1   386 1 1  25 PHE HZ   H  -7.407  11.576  -0.719 1.00 . A A .  25 PHE HZ   1 1 
        1   387 1 1  25 PHE N    N  -8.769   4.256  -1.793 1.00 . A A .  25 PHE N    1 1 
        1   388 1 1  25 PHE O    O  -8.864   6.567   0.831 1.00 . A A .  25 PHE O    1 1 
        1   389 1 1  26 ALA C    C -10.984   5.470   2.199 1.00 . A A .  26 ALA C    1 1 
        1   390 1 1  26 ALA CA   C -11.509   6.052   0.882 1.00 . A A .  26 ALA CA   1 1 
        1   391 1 1  26 ALA CB   C -12.889   5.470   0.579 1.00 . A A .  26 ALA CB   1 1 
        1   392 1 1  26 ALA H    H -10.925   5.255  -1.028 1.00 . A A .  26 ALA H    1 1 
        1   393 1 1  26 ALA HA   H -11.582   7.125   0.966 1.00 . A A .  26 ALA HA   1 1 
        1   394 1 1  26 ALA HB1  H -13.628   5.945   1.206 1.00 . A A .  26 ALA HB1  1 1 
        1   395 1 1  26 ALA HB2  H -12.882   4.407   0.771 1.00 . A A .  26 ALA HB2  1 1 
        1   396 1 1  26 ALA HB3  H -13.130   5.645  -0.459 1.00 . A A .  26 ALA HB3  1 1 
        1   397 1 1  26 ALA N    N -10.581   5.704  -0.230 1.00 . A A .  26 ALA N    1 1 
        1   398 1 1  26 ALA O    O -11.020   6.113   3.229 1.00 . A A .  26 ALA O    1 1 
        1   399 1 1  27 LEU C    C  -8.768   4.449   3.929 1.00 . A A .  27 LEU C    1 1 
        1   400 1 1  27 LEU CA   C  -9.966   3.645   3.425 1.00 . A A .  27 LEU CA   1 1 
        1   401 1 1  27 LEU CB   C  -9.525   2.207   3.131 1.00 . A A .  27 LEU CB   1 1 
        1   402 1 1  27 LEU CD1  C -10.288   0.002   2.243 1.00 . A A .  27 LEU CD1  1 1 
        1   403 1 1  27 LEU CD2  C -11.456   0.984   4.223 1.00 . A A .  27 LEU CD2  1 1 
        1   404 1 1  27 LEU CG   C -10.750   1.308   2.891 1.00 . A A .  27 LEU CG   1 1 
        1   405 1 1  27 LEU H    H -10.470   3.759   1.334 1.00 . A A .  27 LEU H    1 1 
        1   406 1 1  27 LEU HA   H -10.736   3.644   4.178 1.00 . A A .  27 LEU HA   1 1 
        1   407 1 1  27 LEU HB2  H  -8.904   2.206   2.245 1.00 . A A .  27 LEU HB2  1 1 
        1   408 1 1  27 LEU HB3  H  -8.952   1.827   3.964 1.00 . A A .  27 LEU HB3  1 1 
        1   409 1 1  27 LEU HD11 H -11.138  -0.649   2.097 1.00 . A A .  27 LEU HD11 1 1 
        1   410 1 1  27 LEU HD12 H  -9.570  -0.484   2.886 1.00 . A A .  27 LEU HD12 1 1 
        1   411 1 1  27 LEU HD13 H  -9.830   0.215   1.290 1.00 . A A .  27 LEU HD13 1 1 
        1   412 1 1  27 LEU HD21 H -12.067   0.098   4.105 1.00 . A A .  27 LEU HD21 1 1 
        1   413 1 1  27 LEU HD22 H -12.086   1.811   4.507 1.00 . A A .  27 LEU HD22 1 1 
        1   414 1 1  27 LEU HD23 H -10.724   0.809   4.999 1.00 . A A .  27 LEU HD23 1 1 
        1   415 1 1  27 LEU HG   H -11.439   1.812   2.229 1.00 . A A .  27 LEU HG   1 1 
        1   416 1 1  27 LEU N    N -10.494   4.261   2.174 1.00 . A A .  27 LEU N    1 1 
        1   417 1 1  27 LEU O    O  -8.625   4.694   5.110 1.00 . A A .  27 LEU O    1 1 
        1   418 1 1  28 MET C    C  -7.071   7.111   3.632 1.00 . A A .  28 MET C    1 1 
        1   419 1 1  28 MET CA   C  -6.703   5.635   3.477 1.00 . A A .  28 MET CA   1 1 
        1   420 1 1  28 MET CB   C  -5.606   5.488   2.429 1.00 . A A .  28 MET CB   1 1 
        1   421 1 1  28 MET CE   C  -4.663   4.193  -0.282 1.00 . A A .  28 MET CE   1 1 
        1   422 1 1  28 MET CG   C  -5.126   4.037   2.407 1.00 . A A .  28 MET CG   1 1 
        1   423 1 1  28 MET H    H  -8.029   4.645   2.097 1.00 . A A .  28 MET H    1 1 
        1   424 1 1  28 MET HA   H  -6.346   5.254   4.425 1.00 . A A .  28 MET HA   1 1 
        1   425 1 1  28 MET HB2  H  -5.998   5.757   1.458 1.00 . A A .  28 MET HB2  1 1 
        1   426 1 1  28 MET HB3  H  -4.778   6.135   2.677 1.00 . A A .  28 MET HB3  1 1 
        1   427 1 1  28 MET HE1  H  -5.716   4.004  -0.123 1.00 . A A .  28 MET HE1  1 1 
        1   428 1 1  28 MET HE2  H  -4.290   3.544  -1.061 1.00 . A A .  28 MET HE2  1 1 
        1   429 1 1  28 MET HE3  H  -4.528   5.221  -0.579 1.00 . A A .  28 MET HE3  1 1 
        1   430 1 1  28 MET HG2  H  -4.802   3.752   3.396 1.00 . A A .  28 MET HG2  1 1 
        1   431 1 1  28 MET HG3  H  -5.935   3.393   2.097 1.00 . A A .  28 MET HG3  1 1 
        1   432 1 1  28 MET N    N  -7.899   4.856   3.045 1.00 . A A .  28 MET N    1 1 
        1   433 1 1  28 MET O    O  -6.284   7.909   4.102 1.00 . A A .  28 MET O    1 1 
        1   434 1 1  28 MET SD   S  -3.744   3.880   1.248 1.00 . A A .  28 MET SD   1 1 
        1   435 1 1  29 THR C    C  -9.570   9.048   4.609 1.00 . A A .  29 THR C    1 1 
        1   436 1 1  29 THR CA   C  -8.693   8.905   3.371 1.00 . A A .  29 THR CA   1 1 
        1   437 1 1  29 THR CB   C  -9.505   9.302   2.135 1.00 . A A .  29 THR CB   1 1 
        1   438 1 1  29 THR CG2  C  -9.765  10.810   2.150 1.00 . A A .  29 THR CG2  1 1 
        1   439 1 1  29 THR H    H  -8.879   6.817   2.873 1.00 . A A .  29 THR H    1 1 
        1   440 1 1  29 THR HA   H  -7.829   9.553   3.460 1.00 . A A .  29 THR HA   1 1 
        1   441 1 1  29 THR HB   H -10.448   8.781   2.146 1.00 . A A .  29 THR HB   1 1 
        1   442 1 1  29 THR HG1  H  -8.130   8.291   1.207 1.00 . A A .  29 THR HG1  1 1 
        1   443 1 1  29 THR HG21 H -10.173  11.115   1.198 1.00 . A A .  29 THR HG21 1 1 
        1   444 1 1  29 THR HG22 H  -8.838  11.335   2.327 1.00 . A A .  29 THR HG22 1 1 
        1   445 1 1  29 THR HG23 H -10.468  11.047   2.936 1.00 . A A .  29 THR HG23 1 1 
        1   446 1 1  29 THR N    N  -8.262   7.479   3.245 1.00 . A A .  29 THR N    1 1 
        1   447 1 1  29 THR O    O  -9.826  10.141   5.075 1.00 . A A .  29 THR O    1 1 
        1   448 1 1  29 THR OG1  O  -8.781   8.953   0.964 1.00 . A A .  29 THR OG1  1 1 
        1   449 1 1  30 ASP C    C -10.099   7.560   7.592 1.00 . A A .  30 ASP C    1 1 
        1   450 1 1  30 ASP CA   C -10.913   8.007   6.359 1.00 . A A .  30 ASP CA   1 1 
        1   451 1 1  30 ASP CB   C -12.095   7.055   6.159 1.00 . A A .  30 ASP CB   1 1 
        1   452 1 1  30 ASP CG   C -13.127   7.711   5.235 1.00 . A A .  30 ASP CG   1 1 
        1   453 1 1  30 ASP H    H  -9.818   7.079   4.746 1.00 . A A .  30 ASP H    1 1 
        1   454 1 1  30 ASP HA   H -11.284   9.012   6.491 1.00 . A A .  30 ASP HA   1 1 
        1   455 1 1  30 ASP HB2  H -11.742   6.138   5.713 1.00 . A A .  30 ASP HB2  1 1 
        1   456 1 1  30 ASP HB3  H -12.553   6.841   7.113 1.00 . A A .  30 ASP HB3  1 1 
        1   457 1 1  30 ASP N    N -10.039   7.948   5.145 1.00 . A A .  30 ASP N    1 1 
        1   458 1 1  30 ASP O    O  -9.542   6.479   7.595 1.00 . A A .  30 ASP O    1 1 
        1   459 1 1  30 ASP OD1  O -13.963   8.442   5.740 1.00 . A A .  30 ASP OD1  1 1 
        1   460 1 1  30 ASP OD2  O -13.059   7.475   4.040 1.00 . A A .  30 ASP OD2  1 1 
        1   461 1 1  31 PRO C    C  -9.949   6.978  10.727 1.00 . A A .  31 PRO C    1 1 
        1   462 1 1  31 PRO CA   C  -9.227   8.015   9.849 1.00 . A A .  31 PRO CA   1 1 
        1   463 1 1  31 PRO CB   C  -9.077   9.355  10.584 1.00 . A A .  31 PRO CB   1 1 
        1   464 1 1  31 PRO CD   C -10.641   9.706   8.768 1.00 . A A .  31 PRO CD   1 1 
        1   465 1 1  31 PRO CG   C -10.287  10.141  10.194 1.00 . A A .  31 PRO CG   1 1 
        1   466 1 1  31 PRO HA   H  -8.253   7.648   9.568 1.00 . A A .  31 PRO HA   1 1 
        1   467 1 1  31 PRO HB2  H  -9.046   9.203  11.656 1.00 . A A .  31 PRO HB2  1 1 
        1   468 1 1  31 PRO HB3  H  -8.183   9.866  10.251 1.00 . A A .  31 PRO HB3  1 1 
        1   469 1 1  31 PRO HD2  H -11.714   9.636   8.655 1.00 . A A .  31 PRO HD2  1 1 
        1   470 1 1  31 PRO HD3  H -10.229  10.389   8.043 1.00 . A A .  31 PRO HD3  1 1 
        1   471 1 1  31 PRO HG2  H -11.107   9.917  10.869 1.00 . A A .  31 PRO HG2  1 1 
        1   472 1 1  31 PRO HG3  H -10.073  11.199  10.210 1.00 . A A .  31 PRO HG3  1 1 
        1   473 1 1  31 PRO N    N -10.010   8.373   8.629 1.00 . A A .  31 PRO N    1 1 
        1   474 1 1  31 PRO O    O  -9.336   6.279  11.506 1.00 . A A .  31 PRO O    1 1 
        1   475 1 1  32 GLU C    C -12.002   4.524  10.772 1.00 . A A .  32 GLU C    1 1 
        1   476 1 1  32 GLU CA   C -12.010   5.902  11.440 1.00 . A A .  32 GLU CA   1 1 
        1   477 1 1  32 GLU CB   C -13.455   6.379  11.583 1.00 . A A .  32 GLU CB   1 1 
        1   478 1 1  32 GLU CD   C -15.640   5.952  12.713 1.00 . A A .  32 GLU CD   1 1 
        1   479 1 1  32 GLU CG   C -14.212   5.440  12.522 1.00 . A A .  32 GLU CG   1 1 
        1   480 1 1  32 GLU H    H -11.725   7.460   9.979 1.00 . A A .  32 GLU H    1 1 
        1   481 1 1  32 GLU HA   H -11.559   5.829  12.420 1.00 . A A .  32 GLU HA   1 1 
        1   482 1 1  32 GLU HB2  H -13.465   7.381  11.989 1.00 . A A .  32 GLU HB2  1 1 
        1   483 1 1  32 GLU HB3  H -13.933   6.379  10.615 1.00 . A A .  32 GLU HB3  1 1 
        1   484 1 1  32 GLU HG2  H -14.240   4.447  12.097 1.00 . A A .  32 GLU HG2  1 1 
        1   485 1 1  32 GLU HG3  H -13.713   5.409  13.479 1.00 . A A .  32 GLU HG3  1 1 
        1   486 1 1  32 GLU N    N -11.248   6.883  10.610 1.00 . A A .  32 GLU N    1 1 
        1   487 1 1  32 GLU O    O -11.894   3.507  11.429 1.00 . A A .  32 GLU O    1 1 
        1   488 1 1  32 GLU OE1  O -15.889   7.095  12.369 1.00 . A A .  32 GLU OE1  1 1 
        1   489 1 1  32 GLU OE2  O -16.460   5.191  13.200 1.00 . A A .  32 GLU OE2  1 1 
        1   490 1 1  33 LYS C    C -10.807   2.449   8.989 1.00 . A A .  33 LYS C    1 1 
        1   491 1 1  33 LYS CA   C -12.141   3.169   8.772 1.00 . A A .  33 LYS CA   1 1 
        1   492 1 1  33 LYS CB   C -12.385   3.385   7.274 1.00 . A A .  33 LYS CB   1 1 
        1   493 1 1  33 LYS CD   C -14.106   3.994   5.557 1.00 . A A .  33 LYS CD   1 1 
        1   494 1 1  33 LYS CE   C -15.548   4.453   5.338 1.00 . A A .  33 LYS CE   1 1 
        1   495 1 1  33 LYS CG   C -13.811   3.907   7.059 1.00 . A A .  33 LYS CG   1 1 
        1   496 1 1  33 LYS H    H -12.223   5.312   8.965 1.00 . A A .  33 LYS H    1 1 
        1   497 1 1  33 LYS HA   H -12.939   2.561   9.177 1.00 . A A .  33 LYS HA   1 1 
        1   498 1 1  33 LYS HB2  H -11.676   4.107   6.894 1.00 . A A .  33 LYS HB2  1 1 
        1   499 1 1  33 LYS HB3  H -12.264   2.449   6.750 1.00 . A A .  33 LYS HB3  1 1 
        1   500 1 1  33 LYS HD2  H -13.432   4.698   5.096 1.00 . A A .  33 LYS HD2  1 1 
        1   501 1 1  33 LYS HD3  H -13.973   3.022   5.111 1.00 . A A .  33 LYS HD3  1 1 
        1   502 1 1  33 LYS HE2  H -15.766   4.459   4.281 1.00 . A A .  33 LYS HE2  1 1 
        1   503 1 1  33 LYS HE3  H -16.221   3.774   5.841 1.00 . A A .  33 LYS HE3  1 1 
        1   504 1 1  33 LYS HG2  H -14.516   3.236   7.526 1.00 . A A .  33 LYS HG2  1 1 
        1   505 1 1  33 LYS HG3  H -13.905   4.889   7.498 1.00 . A A .  33 LYS HG3  1 1 
        1   506 1 1  33 LYS HZ1  H -16.052   6.463   5.135 1.00 . A A .  33 LYS HZ1  1 1 
        1   507 1 1  33 LYS HZ2  H -14.818   6.171   6.262 1.00 . A A .  33 LYS HZ2  1 1 
        1   508 1 1  33 LYS HZ3  H -16.431   5.804   6.654 1.00 . A A .  33 LYS HZ3  1 1 
        1   509 1 1  33 LYS N    N -12.128   4.482   9.476 1.00 . A A .  33 LYS N    1 1 
        1   510 1 1  33 LYS NZ   N -15.726   5.826   5.889 1.00 . A A .  33 LYS NZ   1 1 
        1   511 1 1  33 LYS O    O -10.750   1.240   9.053 1.00 . A A .  33 LYS O    1 1 
        1   512 1 1  34 ILE C    C  -8.408   1.759  10.640 1.00 . A A .  34 ILE C    1 1 
        1   513 1 1  34 ILE CA   C  -8.409   2.529   9.314 1.00 . A A .  34 ILE CA   1 1 
        1   514 1 1  34 ILE CB   C  -7.321   3.601   9.345 1.00 . A A .  34 ILE CB   1 1 
        1   515 1 1  34 ILE CD1  C  -6.309   5.470   8.025 1.00 . A A .  34 ILE CD1  1 1 
        1   516 1 1  34 ILE CG1  C  -7.187   4.221   7.950 1.00 . A A .  34 ILE CG1  1 1 
        1   517 1 1  34 ILE CG2  C  -5.988   2.969   9.757 1.00 . A A .  34 ILE CG2  1 1 
        1   518 1 1  34 ILE H    H  -9.798   4.154   9.049 1.00 . A A .  34 ILE H    1 1 
        1   519 1 1  34 ILE HA   H  -8.213   1.843   8.503 1.00 . A A .  34 ILE HA   1 1 
        1   520 1 1  34 ILE HB   H  -7.592   4.365  10.058 1.00 . A A .  34 ILE HB   1 1 
        1   521 1 1  34 ILE HD11 H  -5.283   5.178   8.195 1.00 . A A .  34 ILE HD11 1 1 
        1   522 1 1  34 ILE HD12 H  -6.643   6.099   8.836 1.00 . A A .  34 ILE HD12 1 1 
        1   523 1 1  34 ILE HD13 H  -6.378   6.015   7.095 1.00 . A A .  34 ILE HD13 1 1 
        1   524 1 1  34 ILE HG12 H  -6.737   3.503   7.280 1.00 . A A .  34 ILE HG12 1 1 
        1   525 1 1  34 ILE HG13 H  -8.166   4.493   7.582 1.00 . A A .  34 ILE HG13 1 1 
        1   526 1 1  34 ILE HG21 H  -5.997   2.771  10.820 1.00 . A A .  34 ILE HG21 1 1 
        1   527 1 1  34 ILE HG22 H  -5.179   3.645   9.523 1.00 . A A .  34 ILE HG22 1 1 
        1   528 1 1  34 ILE HG23 H  -5.847   2.040   9.221 1.00 . A A .  34 ILE HG23 1 1 
        1   529 1 1  34 ILE N    N  -9.735   3.177   9.103 1.00 . A A .  34 ILE N    1 1 
        1   530 1 1  34 ILE O    O  -7.890   0.663  10.731 1.00 . A A .  34 ILE O    1 1 
        1   531 1 1  35 LEU C    C  -9.616   0.255  12.847 1.00 . A A .  35 LEU C    1 1 
        1   532 1 1  35 LEU CA   C  -8.981   1.640  12.991 1.00 . A A .  35 LEU CA   1 1 
        1   533 1 1  35 LEU CB   C  -9.803   2.469  13.979 1.00 . A A .  35 LEU CB   1 1 
        1   534 1 1  35 LEU CD1  C -10.210   4.751  14.898 1.00 . A A .  35 LEU CD1  1 1 
        1   535 1 1  35 LEU CD2  C  -7.863   3.992  14.472 1.00 . A A .  35 LEU CD2  1 1 
        1   536 1 1  35 LEU CG   C  -9.316   3.923  13.977 1.00 . A A .  35 LEU CG   1 1 
        1   537 1 1  35 LEU H    H  -9.369   3.214  11.574 1.00 . A A .  35 LEU H    1 1 
        1   538 1 1  35 LEU HA   H  -7.970   1.534  13.356 1.00 . A A .  35 LEU HA   1 1 
        1   539 1 1  35 LEU HB2  H -10.844   2.438  13.691 1.00 . A A .  35 LEU HB2  1 1 
        1   540 1 1  35 LEU HB3  H  -9.693   2.058  14.972 1.00 . A A .  35 LEU HB3  1 1 
        1   541 1 1  35 LEU HD11 H -10.143   4.367  15.905 1.00 . A A .  35 LEU HD11 1 1 
        1   542 1 1  35 LEU HD12 H -11.232   4.690  14.556 1.00 . A A .  35 LEU HD12 1 1 
        1   543 1 1  35 LEU HD13 H  -9.887   5.782  14.882 1.00 . A A .  35 LEU HD13 1 1 
        1   544 1 1  35 LEU HD21 H  -7.733   3.320  15.308 1.00 . A A .  35 LEU HD21 1 1 
        1   545 1 1  35 LEU HD22 H  -7.635   5.002  14.784 1.00 . A A .  35 LEU HD22 1 1 
        1   546 1 1  35 LEU HD23 H  -7.196   3.706  13.672 1.00 . A A .  35 LEU HD23 1 1 
        1   547 1 1  35 LEU HG   H  -9.375   4.321  12.973 1.00 . A A .  35 LEU HG   1 1 
        1   548 1 1  35 LEU N    N  -8.967   2.327  11.667 1.00 . A A .  35 LEU N    1 1 
        1   549 1 1  35 LEU O    O  -9.288  -0.662  13.573 1.00 . A A .  35 LEU O    1 1 
        1   550 1 1  36 ARG C    C -10.069  -2.267  11.404 1.00 . A A .  36 ARG C    1 1 
        1   551 1 1  36 ARG CA   C -11.152  -1.246  11.741 1.00 . A A .  36 ARG CA   1 1 
        1   552 1 1  36 ARG CB   C -12.159  -1.190  10.593 1.00 . A A .  36 ARG CB   1 1 
        1   553 1 1  36 ARG CD   C -14.324  -0.229   9.826 1.00 . A A .  36 ARG CD   1 1 
        1   554 1 1  36 ARG CG   C -13.345  -0.321  10.996 1.00 . A A .  36 ARG CG   1 1 
        1   555 1 1  36 ARG CZ   C -16.496   0.162  10.836 1.00 . A A .  36 ARG CZ   1 1 
        1   556 1 1  36 ARG H    H -10.766   0.836  11.334 1.00 . A A .  36 ARG H    1 1 
        1   557 1 1  36 ARG HA   H -11.654  -1.533  12.654 1.00 . A A .  36 ARG HA   1 1 
        1   558 1 1  36 ARG HB2  H -11.686  -0.773   9.721 1.00 . A A .  36 ARG HB2  1 1 
        1   559 1 1  36 ARG HB3  H -12.507  -2.188  10.370 1.00 . A A .  36 ARG HB3  1 1 
        1   560 1 1  36 ARG HD2  H -13.815   0.183   8.968 1.00 . A A .  36 ARG HD2  1 1 
        1   561 1 1  36 ARG HD3  H -14.691  -1.217   9.585 1.00 . A A .  36 ARG HD3  1 1 
        1   562 1 1  36 ARG HE   H -15.447   1.604   9.962 1.00 . A A .  36 ARG HE   1 1 
        1   563 1 1  36 ARG HG2  H -13.839  -0.762  11.850 1.00 . A A .  36 ARG HG2  1 1 
        1   564 1 1  36 ARG HG3  H -12.996   0.667  11.250 1.00 . A A .  36 ARG HG3  1 1 
        1   565 1 1  36 ARG HH11 H -15.742  -1.689  10.947 1.00 . A A .  36 ARG HH11 1 1 
        1   566 1 1  36 ARG HH12 H -17.305  -1.473  11.657 1.00 . A A .  36 ARG HH12 1 1 
        1   567 1 1  36 ARG HH21 H -17.487   1.903  10.885 1.00 . A A .  36 ARG HH21 1 1 
        1   568 1 1  36 ARG HH22 H -18.293   0.559  11.623 1.00 . A A .  36 ARG HH22 1 1 
        1   569 1 1  36 ARG N    N -10.514   0.089  11.917 1.00 . A A .  36 ARG N    1 1 
        1   570 1 1  36 ARG NE   N -15.466   0.654  10.202 1.00 . A A .  36 ARG NE   1 1 
        1   571 1 1  36 ARG NH1  N -16.516  -1.098  11.173 1.00 . A A .  36 ARG NH1  1 1 
        1   572 1 1  36 ARG NH2  N -17.504   0.935  11.138 1.00 . A A .  36 ARG NH2  1 1 
        1   573 1 1  36 ARG O    O -10.145  -3.414  11.797 1.00 . A A .  36 ARG O    1 1 
        1   574 1 1  37 TRP C    C  -6.606  -2.125  10.559 1.00 . A A .  37 TRP C    1 1 
        1   575 1 1  37 TRP CA   C  -7.957  -2.793  10.302 1.00 . A A .  37 TRP CA   1 1 
        1   576 1 1  37 TRP CB   C  -8.080  -3.167   8.821 1.00 . A A .  37 TRP CB   1 1 
        1   577 1 1  37 TRP CD1  C  -8.838  -0.950   7.879 1.00 . A A .  37 TRP CD1  1 1 
        1   578 1 1  37 TRP CD2  C  -6.850  -1.602   7.055 1.00 . A A .  37 TRP CD2  1 1 
        1   579 1 1  37 TRP CE2  C  -7.154  -0.361   6.449 1.00 . A A .  37 TRP CE2  1 1 
        1   580 1 1  37 TRP CE3  C  -5.643  -2.232   6.705 1.00 . A A .  37 TRP CE3  1 1 
        1   581 1 1  37 TRP CG   C  -7.936  -1.952   7.963 1.00 . A A .  37 TRP CG   1 1 
        1   582 1 1  37 TRP CH2  C  -5.098  -0.406   5.188 1.00 . A A .  37 TRP CH2  1 1 
        1   583 1 1  37 TRP CZ2  C  -6.293   0.233   5.526 1.00 . A A .  37 TRP CZ2  1 1 
        1   584 1 1  37 TRP CZ3  C  -4.773  -1.638   5.776 1.00 . A A .  37 TRP CZ3  1 1 
        1   585 1 1  37 TRP H    H  -9.028  -0.925  10.373 1.00 . A A .  37 TRP H    1 1 
        1   586 1 1  37 TRP HA   H  -8.019  -3.694  10.901 1.00 . A A .  37 TRP HA   1 1 
        1   587 1 1  37 TRP HB2  H  -7.308  -3.875   8.568 1.00 . A A .  37 TRP HB2  1 1 
        1   588 1 1  37 TRP HB3  H  -9.047  -3.616   8.647 1.00 . A A .  37 TRP HB3  1 1 
        1   589 1 1  37 TRP HD1  H  -9.766  -0.896   8.423 1.00 . A A .  37 TRP HD1  1 1 
        1   590 1 1  37 TRP HE1  H  -8.843   0.822   6.742 1.00 . A A .  37 TRP HE1  1 1 
        1   591 1 1  37 TRP HE3  H  -5.383  -3.181   7.151 1.00 . A A .  37 TRP HE3  1 1 
        1   592 1 1  37 TRP HH2  H  -4.428   0.046   4.475 1.00 . A A .  37 TRP HH2  1 1 
        1   593 1 1  37 TRP HZ2  H  -6.550   1.181   5.076 1.00 . A A .  37 TRP HZ2  1 1 
        1   594 1 1  37 TRP HZ3  H  -3.849  -2.129   5.513 1.00 . A A .  37 TRP HZ3  1 1 
        1   595 1 1  37 TRP N    N  -9.061  -1.856  10.674 1.00 . A A .  37 TRP N    1 1 
        1   596 1 1  37 TRP NE1  N  -8.376  -0.005   6.982 1.00 . A A .  37 TRP NE1  1 1 
        1   597 1 1  37 TRP O    O  -6.018  -1.527   9.682 1.00 . A A .  37 TRP O    1 1 
        1   598 1 1  38 MET C    C  -4.963  -0.163  12.485 1.00 . A A .  38 MET C    1 1 
        1   599 1 1  38 MET CA   C  -4.800  -1.644  12.148 1.00 . A A .  38 MET CA   1 1 
        1   600 1 1  38 MET CB   C  -3.781  -1.801  11.003 1.00 . A A .  38 MET CB   1 1 
        1   601 1 1  38 MET CE   C  -0.268  -3.359  12.235 1.00 . A A .  38 MET CE   1 1 
        1   602 1 1  38 MET CG   C  -2.359  -1.766  11.573 1.00 . A A .  38 MET CG   1 1 
        1   603 1 1  38 MET H    H  -6.631  -2.730  12.437 1.00 . A A .  38 MET H    1 1 
        1   604 1 1  38 MET HA   H  -4.434  -2.160  13.025 1.00 . A A .  38 MET HA   1 1 
        1   605 1 1  38 MET HB2  H  -3.945  -2.743  10.503 1.00 . A A .  38 MET HB2  1 1 
        1   606 1 1  38 MET HB3  H  -3.893  -0.992  10.296 1.00 . A A .  38 MET HB3  1 1 
        1   607 1 1  38 MET HE1  H   0.140  -4.219  12.750 1.00 . A A .  38 MET HE1  1 1 
        1   608 1 1  38 MET HE2  H   0.199  -2.457  12.605 1.00 . A A .  38 MET HE2  1 1 
        1   609 1 1  38 MET HE3  H  -0.077  -3.452  11.178 1.00 . A A .  38 MET HE3  1 1 
        1   610 1 1  38 MET HG2  H  -1.648  -1.699  10.764 1.00 . A A .  38 MET HG2  1 1 
        1   611 1 1  38 MET HG3  H  -2.252  -0.907  12.218 1.00 . A A .  38 MET HG3  1 1 
        1   612 1 1  38 MET N    N  -6.121  -2.239  11.767 1.00 . A A .  38 MET N    1 1 
        1   613 1 1  38 MET O    O  -5.905   0.482  12.073 1.00 . A A .  38 MET O    1 1 
        1   614 1 1  38 MET SD   S  -2.050  -3.275  12.525 1.00 . A A .  38 MET SD   1 1 
        1   615 1 1  39 GLY C    C  -4.837   1.985  14.936 1.00 . A A .  39 GLY C    1 1 
        1   616 1 1  39 GLY CA   C  -4.106   1.821  13.603 1.00 . A A .  39 GLY CA   1 1 
        1   617 1 1  39 GLY H    H  -3.286  -0.169  13.546 1.00 . A A .  39 GLY H    1 1 
        1   618 1 1  39 GLY HA2  H  -3.104   2.213  13.693 1.00 . A A .  39 GLY HA2  1 1 
        1   619 1 1  39 GLY HA3  H  -4.637   2.372  12.837 1.00 . A A .  39 GLY HA3  1 1 
        1   620 1 1  39 GLY N    N  -4.036   0.378  13.231 1.00 . A A .  39 GLY N    1 1 
        1   621 1 1  39 GLY O    O  -6.019   1.727  15.041 1.00 . A A .  39 GLY O    1 1 
        1   622 1 1  40 THR C    C  -5.204   4.088  17.409 1.00 . A A .  40 THR C    1 1 
        1   623 1 1  40 THR CA   C  -4.796   2.622  17.282 1.00 . A A .  40 THR CA   1 1 
        1   624 1 1  40 THR CB   C  -3.808   2.260  18.392 1.00 . A A .  40 THR CB   1 1 
        1   625 1 1  40 THR CG2  C  -4.409   2.606  19.756 1.00 . A A .  40 THR CG2  1 1 
        1   626 1 1  40 THR H    H  -3.193   2.634  15.843 1.00 . A A .  40 THR H    1 1 
        1   627 1 1  40 THR HA   H  -5.673   1.995  17.361 1.00 . A A .  40 THR HA   1 1 
        1   628 1 1  40 THR HB   H  -2.894   2.813  18.254 1.00 . A A .  40 THR HB   1 1 
        1   629 1 1  40 THR HG1  H  -2.661   0.755  17.942 1.00 . A A .  40 THR HG1  1 1 
        1   630 1 1  40 THR HG21 H  -5.432   2.263  19.797 1.00 . A A .  40 THR HG21 1 1 
        1   631 1 1  40 THR HG22 H  -4.381   3.675  19.899 1.00 . A A .  40 THR HG22 1 1 
        1   632 1 1  40 THR HG23 H  -3.835   2.124  20.534 1.00 . A A .  40 THR HG23 1 1 
        1   633 1 1  40 THR N    N  -4.143   2.423  15.954 1.00 . A A .  40 THR N    1 1 
        1   634 1 1  40 THR O    O  -6.045   4.446  18.210 1.00 . A A .  40 THR O    1 1 
        1   635 1 1  40 THR OG1  O  -3.529   0.867  18.335 1.00 . A A .  40 THR OG1  1 1 
        1   636 1 1  41 GLU C    C  -4.626   7.019  15.310 1.00 . A A .  41 GLU C    1 1 
        1   637 1 1  41 GLU CA   C  -4.985   6.383  16.651 1.00 . A A .  41 GLU CA   1 1 
        1   638 1 1  41 GLU CB   C  -4.220   7.087  17.774 1.00 . A A .  41 GLU CB   1 1 
        1   639 1 1  41 GLU CD   C  -3.984   9.244  19.023 1.00 . A A .  41 GLU CD   1 1 
        1   640 1 1  41 GLU CG   C  -4.660   8.551  17.838 1.00 . A A .  41 GLU CG   1 1 
        1   641 1 1  41 GLU H    H  -3.960   4.622  15.960 1.00 . A A .  41 GLU H    1 1 
        1   642 1 1  41 GLU HA   H  -6.049   6.483  16.823 1.00 . A A .  41 GLU HA   1 1 
        1   643 1 1  41 GLU HB2  H  -4.433   6.603  18.717 1.00 . A A .  41 GLU HB2  1 1 
        1   644 1 1  41 GLU HB3  H  -3.160   7.040  17.575 1.00 . A A .  41 GLU HB3  1 1 
        1   645 1 1  41 GLU HG2  H  -4.379   9.051  16.923 1.00 . A A .  41 GLU HG2  1 1 
        1   646 1 1  41 GLU HG3  H  -5.732   8.600  17.960 1.00 . A A .  41 GLU HG3  1 1 
        1   647 1 1  41 GLU N    N  -4.625   4.938  16.606 1.00 . A A .  41 GLU N    1 1 
        1   648 1 1  41 GLU O    O  -3.481   7.024  14.905 1.00 . A A .  41 GLU O    1 1 
        1   649 1 1  41 GLU OE1  O  -3.070   8.663  19.582 1.00 . A A .  41 GLU OE1  1 1 
        1   650 1 1  41 GLU OE2  O  -4.395  10.346  19.351 1.00 . A A .  41 GLU OE2  1 1 
        1   651 1 1  42 ALA C    C  -6.130   9.466  13.147 1.00 . A A .  42 ALA C    1 1 
        1   652 1 1  42 ALA CA   C  -5.314   8.180  13.283 1.00 . A A .  42 ALA CA   1 1 
        1   653 1 1  42 ALA CB   C  -5.710   7.210  12.167 1.00 . A A .  42 ALA CB   1 1 
        1   654 1 1  42 ALA H    H  -6.513   7.525  14.953 1.00 . A A .  42 ALA H    1 1 
        1   655 1 1  42 ALA HA   H  -4.261   8.415  13.197 1.00 . A A .  42 ALA HA   1 1 
        1   656 1 1  42 ALA HB1  H  -6.735   6.900  12.307 1.00 . A A .  42 ALA HB1  1 1 
        1   657 1 1  42 ALA HB2  H  -5.065   6.345  12.197 1.00 . A A .  42 ALA HB2  1 1 
        1   658 1 1  42 ALA HB3  H  -5.611   7.702  11.210 1.00 . A A .  42 ALA HB3  1 1 
        1   659 1 1  42 ALA N    N  -5.596   7.549  14.610 1.00 . A A .  42 ALA N    1 1 
        1   660 1 1  42 ALA O    O  -7.235   9.569  13.642 1.00 . A A .  42 ALA O    1 1 
        1   661 1 1  43 GLU C    C  -5.883  12.374  10.989 1.00 . A A .  43 GLU C    1 1 
        1   662 1 1  43 GLU CA   C  -6.326  11.737  12.306 1.00 . A A .  43 GLU CA   1 1 
        1   663 1 1  43 GLU CB   C  -6.003  12.679  13.474 1.00 . A A .  43 GLU CB   1 1 
        1   664 1 1  43 GLU CD   C  -4.201  13.529  14.983 1.00 . A A .  43 GLU CD   1 1 
        1   665 1 1  43 GLU CG   C  -4.488  12.739  13.706 1.00 . A A .  43 GLU CG   1 1 
        1   666 1 1  43 GLU H    H  -4.699  10.341  12.093 1.00 . A A .  43 GLU H    1 1 
        1   667 1 1  43 GLU HA   H  -7.392  11.550  12.276 1.00 . A A .  43 GLU HA   1 1 
        1   668 1 1  43 GLU HB2  H  -6.368  13.671  13.244 1.00 . A A .  43 GLU HB2  1 1 
        1   669 1 1  43 GLU HB3  H  -6.487  12.320  14.370 1.00 . A A .  43 GLU HB3  1 1 
        1   670 1 1  43 GLU HG2  H  -4.094  11.739  13.807 1.00 . A A .  43 GLU HG2  1 1 
        1   671 1 1  43 GLU HG3  H  -4.013  13.232  12.870 1.00 . A A .  43 GLU HG3  1 1 
        1   672 1 1  43 GLU N    N  -5.593  10.449  12.482 1.00 . A A .  43 GLU N    1 1 
        1   673 1 1  43 GLU O    O  -4.708  12.548  10.746 1.00 . A A .  43 GLU O    1 1 
        1   674 1 1  43 GLU OE1  O  -4.953  14.445  15.271 1.00 . A A .  43 GLU OE1  1 1 
        1   675 1 1  43 GLU OE2  O  -3.238  13.198  15.656 1.00 . A A .  43 GLU OE2  1 1 
        1   676 1 1  44 VAL C    C  -7.346  14.512   8.513 1.00 . A A .  44 VAL C    1 1 
        1   677 1 1  44 VAL CA   C  -6.428  13.328   8.812 1.00 . A A .  44 VAL CA   1 1 
        1   678 1 1  44 VAL CB   C  -6.562  12.285   7.703 1.00 . A A .  44 VAL CB   1 1 
        1   679 1 1  44 VAL CG1  C  -5.590  11.134   7.967 1.00 . A A .  44 VAL CG1  1 1 
        1   680 1 1  44 VAL CG2  C  -7.997  11.753   7.666 1.00 . A A .  44 VAL CG2  1 1 
        1   681 1 1  44 VAL H    H  -7.755  12.551  10.333 1.00 . A A .  44 VAL H    1 1 
        1   682 1 1  44 VAL HA   H  -5.405  13.679   8.847 1.00 . A A .  44 VAL HA   1 1 
        1   683 1 1  44 VAL HB   H  -6.324  12.737   6.756 1.00 . A A .  44 VAL HB   1 1 
        1   684 1 1  44 VAL HG11 H  -4.578  11.514   7.976 1.00 . A A .  44 VAL HG11 1 1 
        1   685 1 1  44 VAL HG12 H  -5.688  10.393   7.188 1.00 . A A .  44 VAL HG12 1 1 
        1   686 1 1  44 VAL HG13 H  -5.813  10.686   8.923 1.00 . A A .  44 VAL HG13 1 1 
        1   687 1 1  44 VAL HG21 H  -8.029  10.840   7.091 1.00 . A A .  44 VAL HG21 1 1 
        1   688 1 1  44 VAL HG22 H  -8.641  12.490   7.210 1.00 . A A .  44 VAL HG22 1 1 
        1   689 1 1  44 VAL HG23 H  -8.332  11.558   8.672 1.00 . A A .  44 VAL HG23 1 1 
        1   690 1 1  44 VAL N    N  -6.809  12.711  10.124 1.00 . A A .  44 VAL N    1 1 
        1   691 1 1  44 VAL O    O  -8.450  14.600   9.011 1.00 . A A .  44 VAL O    1 1 
        1   692 1 1  45 GLU C    C  -8.420  17.168   8.594 1.00 . A A .  45 GLU C    1 1 
        1   693 1 1  45 GLU CA   C  -7.700  16.628   7.351 1.00 . A A .  45 GLU CA   1 1 
        1   694 1 1  45 GLU CB   C  -8.727  16.249   6.283 1.00 . A A .  45 GLU CB   1 1 
        1   695 1 1  45 GLU CD   C  -9.000  15.500   3.913 1.00 . A A .  45 GLU CD   1 1 
        1   696 1 1  45 GLU CG   C  -7.994  15.738   5.041 1.00 . A A .  45 GLU CG   1 1 
        1   697 1 1  45 GLU H    H  -5.987  15.324   7.319 1.00 . A A .  45 GLU H    1 1 
        1   698 1 1  45 GLU HA   H  -7.049  17.395   6.958 1.00 . A A .  45 GLU HA   1 1 
        1   699 1 1  45 GLU HB2  H  -9.378  15.477   6.665 1.00 . A A .  45 GLU HB2  1 1 
        1   700 1 1  45 GLU HB3  H  -9.312  17.118   6.022 1.00 . A A .  45 GLU HB3  1 1 
        1   701 1 1  45 GLU HG2  H  -7.267  16.472   4.726 1.00 . A A .  45 GLU HG2  1 1 
        1   702 1 1  45 GLU HG3  H  -7.494  14.811   5.275 1.00 . A A .  45 GLU HG3  1 1 
        1   703 1 1  45 GLU N    N  -6.883  15.427   7.701 1.00 . A A .  45 GLU N    1 1 
        1   704 1 1  45 GLU O    O  -9.627  17.303   8.604 1.00 . A A .  45 GLU O    1 1 
        1   705 1 1  45 GLU OE1  O  -9.594  16.465   3.462 1.00 . A A .  45 GLU OE1  1 1 
        1   706 1 1  45 GLU OE2  O  -9.157  14.357   3.516 1.00 . A A .  45 GLU OE2  1 1 
        1   707 1 1  46 PRO C    C  -8.700  19.487  10.747 1.00 . A A .  46 PRO C    1 1 
        1   708 1 1  46 PRO CA   C  -8.268  18.024  10.892 1.00 . A A .  46 PRO CA   1 1 
        1   709 1 1  46 PRO CB   C  -7.121  17.896  11.906 1.00 . A A .  46 PRO CB   1 1 
        1   710 1 1  46 PRO CD   C  -6.217  17.349   9.723 1.00 . A A .  46 PRO CD   1 1 
        1   711 1 1  46 PRO CG   C  -5.874  17.973  11.081 1.00 . A A .  46 PRO CG   1 1 
        1   712 1 1  46 PRO HA   H  -9.101  17.420  11.211 1.00 . A A .  46 PRO HA   1 1 
        1   713 1 1  46 PRO HB2  H  -7.155  18.705  12.627 1.00 . A A .  46 PRO HB2  1 1 
        1   714 1 1  46 PRO HB3  H  -7.172  16.942  12.411 1.00 . A A .  46 PRO HB3  1 1 
        1   715 1 1  46 PRO HD2  H  -5.732  17.890   8.921 1.00 . A A .  46 PRO HD2  1 1 
        1   716 1 1  46 PRO HD3  H  -5.933  16.311   9.705 1.00 . A A .  46 PRO HD3  1 1 
        1   717 1 1  46 PRO HG2  H  -5.574  19.006  10.956 1.00 . A A .  46 PRO HG2  1 1 
        1   718 1 1  46 PRO HG3  H  -5.078  17.413  11.551 1.00 . A A .  46 PRO HG3  1 1 
        1   719 1 1  46 PRO N    N  -7.684  17.481   9.632 1.00 . A A .  46 PRO N    1 1 
        1   720 1 1  46 PRO O    O  -9.824  19.780  10.396 1.00 . A A .  46 PRO O    1 1 
        1   721 1 1  47 GLU C    C  -8.126  22.284   9.441 1.00 . A A .  47 GLU C    1 1 
        1   722 1 1  47 GLU CA   C  -8.187  21.845  10.916 1.00 . A A .  47 GLU CA   1 1 
        1   723 1 1  47 GLU CB   C  -7.203  22.676  11.762 1.00 . A A .  47 GLU CB   1 1 
        1   724 1 1  47 GLU CD   C  -6.736  23.575  14.054 1.00 . A A .  47 GLU CD   1 1 
        1   725 1 1  47 GLU CG   C  -7.703  22.744  13.211 1.00 . A A .  47 GLU CG   1 1 
        1   726 1 1  47 GLU H    H  -6.917  20.152  11.315 1.00 . A A .  47 GLU H    1 1 
        1   727 1 1  47 GLU HA   H  -9.187  21.975  11.290 1.00 . A A .  47 GLU HA   1 1 
        1   728 1 1  47 GLU HB2  H  -6.230  22.205  11.742 1.00 . A A .  47 GLU HB2  1 1 
        1   729 1 1  47 GLU HB3  H  -7.126  23.677  11.364 1.00 . A A .  47 GLU HB3  1 1 
        1   730 1 1  47 GLU HG2  H  -8.681  23.202  13.230 1.00 . A A .  47 GLU HG2  1 1 
        1   731 1 1  47 GLU HG3  H  -7.766  21.744  13.617 1.00 . A A .  47 GLU HG3  1 1 
        1   732 1 1  47 GLU N    N  -7.818  20.407  11.025 1.00 . A A .  47 GLU N    1 1 
        1   733 1 1  47 GLU O    O  -7.447  21.671   8.641 1.00 . A A .  47 GLU O    1 1 
        1   734 1 1  47 GLU OE1  O  -5.786  24.091  13.494 1.00 . A A .  47 GLU OE1  1 1 
        1   735 1 1  47 GLU OE2  O  -6.966  23.680  15.249 1.00 . A A .  47 GLU OE2  1 1 
        1   736 1 1  48 PRO C    C  -7.392  23.995   7.103 1.00 . A A .  48 PRO C    1 1 
        1   737 1 1  48 PRO CA   C  -8.813  23.852   7.669 1.00 . A A .  48 PRO CA   1 1 
        1   738 1 1  48 PRO CB   C  -9.490  25.230   7.773 1.00 . A A .  48 PRO CB   1 1 
        1   739 1 1  48 PRO CD   C  -9.699  24.161   9.949 1.00 . A A .  48 PRO CD   1 1 
        1   740 1 1  48 PRO CG   C -10.362  25.156   8.988 1.00 . A A .  48 PRO CG   1 1 
        1   741 1 1  48 PRO HA   H  -9.402  23.207   7.038 1.00 . A A .  48 PRO HA   1 1 
        1   742 1 1  48 PRO HB2  H  -8.744  26.009   7.895 1.00 . A A .  48 PRO HB2  1 1 
        1   743 1 1  48 PRO HB3  H -10.089  25.424   6.895 1.00 . A A .  48 PRO HB3  1 1 
        1   744 1 1  48 PRO HD2  H  -9.118  24.684  10.698 1.00 . A A .  48 PRO HD2  1 1 
        1   745 1 1  48 PRO HD3  H -10.450  23.543  10.412 1.00 . A A .  48 PRO HD3  1 1 
        1   746 1 1  48 PRO HG2  H -10.441  26.133   9.452 1.00 . A A .  48 PRO HG2  1 1 
        1   747 1 1  48 PRO HG3  H -11.346  24.797   8.716 1.00 . A A .  48 PRO HG3  1 1 
        1   748 1 1  48 PRO N    N  -8.820  23.344   9.077 1.00 . A A .  48 PRO N    1 1 
        1   749 1 1  48 PRO O    O  -6.488  24.452   7.773 1.00 . A A .  48 PRO O    1 1 
        1   750 1 1  49 GLY C    C  -5.492  22.315   4.650 1.00 . A A .  49 GLY C    1 1 
        1   751 1 1  49 GLY CA   C  -5.847  23.685   5.227 1.00 . A A .  49 GLY CA   1 1 
        1   752 1 1  49 GLY H    H  -7.950  23.227   5.362 1.00 . A A .  49 GLY H    1 1 
        1   753 1 1  49 GLY HA2  H  -5.877  24.415   4.430 1.00 . A A .  49 GLY HA2  1 1 
        1   754 1 1  49 GLY HA3  H  -5.099  23.971   5.954 1.00 . A A .  49 GLY HA3  1 1 
        1   755 1 1  49 GLY N    N  -7.198  23.597   5.870 1.00 . A A .  49 GLY N    1 1 
        1   756 1 1  49 GLY O    O  -4.656  22.193   3.778 1.00 . A A .  49 GLY O    1 1 
        1   757 1 1  50 GLY C    C  -4.492  19.438   5.084 1.00 . A A .  50 GLY C    1 1 
        1   758 1 1  50 GLY CA   C  -5.857  19.921   4.592 1.00 . A A .  50 GLY CA   1 1 
        1   759 1 1  50 GLY H    H  -6.817  21.409   5.818 1.00 . A A .  50 GLY H    1 1 
        1   760 1 1  50 GLY HA2  H  -6.624  19.241   4.925 1.00 . A A .  50 GLY HA2  1 1 
        1   761 1 1  50 GLY HA3  H  -5.850  19.955   3.513 1.00 . A A .  50 GLY HA3  1 1 
        1   762 1 1  50 GLY N    N  -6.138  21.285   5.122 1.00 . A A .  50 GLY N    1 1 
        1   763 1 1  50 GLY O    O  -3.478  20.058   4.832 1.00 . A A .  50 GLY O    1 1 
        1   764 1 1  51 LEU C    C  -3.272  16.297   6.475 1.00 . A A .  51 LEU C    1 1 
        1   765 1 1  51 LEU CA   C  -3.139  17.800   6.246 1.00 . A A .  51 LEU CA   1 1 
        1   766 1 1  51 LEU CB   C  -2.749  18.485   7.563 1.00 . A A .  51 LEU CB   1 1 
        1   767 1 1  51 LEU CD1  C  -0.278  18.531   7.030 1.00 . A A .  51 LEU CD1  1 1 
        1   768 1 1  51 LEU CD2  C  -1.067  18.568   9.414 1.00 . A A .  51 LEU CD2  1 1 
        1   769 1 1  51 LEU CG   C  -1.351  18.022   8.010 1.00 . A A .  51 LEU CG   1 1 
        1   770 1 1  51 LEU H    H  -5.275  17.829   5.948 1.00 . A A .  51 LEU H    1 1 
        1   771 1 1  51 LEU HA   H  -2.383  17.987   5.499 1.00 . A A .  51 LEU HA   1 1 
        1   772 1 1  51 LEU HB2  H  -2.747  19.556   7.424 1.00 . A A .  51 LEU HB2  1 1 
        1   773 1 1  51 LEU HB3  H  -3.468  18.226   8.326 1.00 . A A .  51 LEU HB3  1 1 
        1   774 1 1  51 LEU HD11 H  -0.206  17.854   6.193 1.00 . A A .  51 LEU HD11 1 1 
        1   775 1 1  51 LEU HD12 H   0.680  18.578   7.529 1.00 . A A .  51 LEU HD12 1 1 
        1   776 1 1  51 LEU HD13 H  -0.544  19.516   6.674 1.00 . A A .  51 LEU HD13 1 1 
        1   777 1 1  51 LEU HD21 H  -1.639  18.008  10.140 1.00 . A A .  51 LEU HD21 1 1 
        1   778 1 1  51 LEU HD22 H  -1.347  19.610   9.460 1.00 . A A .  51 LEU HD22 1 1 
        1   779 1 1  51 LEU HD23 H  -0.014  18.469   9.632 1.00 . A A .  51 LEU HD23 1 1 
        1   780 1 1  51 LEU HG   H  -1.320  16.943   8.037 1.00 . A A .  51 LEU HG   1 1 
        1   781 1 1  51 LEU N    N  -4.450  18.326   5.764 1.00 . A A .  51 LEU N    1 1 
        1   782 1 1  51 LEU O    O  -3.987  15.854   7.351 1.00 . A A .  51 LEU O    1 1 
        1   783 1 1  52 TYR C    C  -1.568  13.529   6.766 1.00 . A A .  52 TYR C    1 1 
        1   784 1 1  52 TYR CA   C  -2.694  14.025   5.855 1.00 . A A .  52 TYR CA   1 1 
        1   785 1 1  52 TYR CB   C  -2.560  13.356   4.487 1.00 . A A .  52 TYR CB   1 1 
        1   786 1 1  52 TYR CD1  C  -3.793  11.200   4.907 1.00 . A A .  52 TYR CD1  1 1 
        1   787 1 1  52 TYR CD2  C  -1.394  11.121   4.565 1.00 . A A .  52 TYR CD2  1 1 
        1   788 1 1  52 TYR CE1  C  -3.816   9.810   5.062 1.00 . A A .  52 TYR CE1  1 1 
        1   789 1 1  52 TYR CE2  C  -1.416   9.730   4.721 1.00 . A A .  52 TYR CE2  1 1 
        1   790 1 1  52 TYR CG   C  -2.582  11.856   4.658 1.00 . A A .  52 TYR CG   1 1 
        1   791 1 1  52 TYR CZ   C  -2.628   9.075   4.969 1.00 . A A .  52 TYR CZ   1 1 
        1   792 1 1  52 TYR H    H  -2.032  15.882   4.982 1.00 . A A .  52 TYR H    1 1 
        1   793 1 1  52 TYR HA   H  -3.652  13.763   6.289 1.00 . A A .  52 TYR HA   1 1 
        1   794 1 1  52 TYR HB2  H  -3.385  13.660   3.857 1.00 . A A .  52 TYR HB2  1 1 
        1   795 1 1  52 TYR HB3  H  -1.629  13.655   4.031 1.00 . A A .  52 TYR HB3  1 1 
        1   796 1 1  52 TYR HD1  H  -4.710  11.767   4.980 1.00 . A A .  52 TYR HD1  1 1 
        1   797 1 1  52 TYR HD2  H  -0.459  11.629   4.375 1.00 . A A .  52 TYR HD2  1 1 
        1   798 1 1  52 TYR HE1  H  -4.750   9.303   5.254 1.00 . A A .  52 TYR HE1  1 1 
        1   799 1 1  52 TYR HE2  H  -0.499   9.163   4.648 1.00 . A A .  52 TYR HE2  1 1 
        1   800 1 1  52 TYR HH   H  -1.847   7.347   4.737 1.00 . A A .  52 TYR HH   1 1 
        1   801 1 1  52 TYR N    N  -2.598  15.504   5.687 1.00 . A A .  52 TYR N    1 1 
        1   802 1 1  52 TYR O    O  -0.403  13.737   6.496 1.00 . A A .  52 TYR O    1 1 
        1   803 1 1  52 TYR OH   O  -2.652   7.703   5.120 1.00 . A A .  52 TYR OH   1 1 
        1   804 1 1  53 LEU C    C  -1.478  11.298   9.676 1.00 . A A .  53 LEU C    1 1 
        1   805 1 1  53 LEU CA   C  -0.851  12.333   8.749 1.00 . A A .  53 LEU CA   1 1 
        1   806 1 1  53 LEU CB   C  -0.248  13.476   9.577 1.00 . A A .  53 LEU CB   1 1 
        1   807 1 1  53 LEU CD1  C   1.824  12.070   9.910 1.00 . A A .  53 LEU CD1  1 1 
        1   808 1 1  53 LEU CD2  C   1.415  14.088  11.342 1.00 . A A .  53 LEU CD2  1 1 
        1   809 1 1  53 LEU CG   C   0.748  12.919  10.610 1.00 . A A .  53 LEU CG   1 1 
        1   810 1 1  53 LEU H    H  -2.850  12.693   8.028 1.00 . A A .  53 LEU H    1 1 
        1   811 1 1  53 LEU HA   H  -0.075  11.865   8.161 1.00 . A A .  53 LEU HA   1 1 
        1   812 1 1  53 LEU HB2  H   0.265  14.162   8.919 1.00 . A A .  53 LEU HB2  1 1 
        1   813 1 1  53 LEU HB3  H  -1.038  13.999  10.093 1.00 . A A .  53 LEU HB3  1 1 
        1   814 1 1  53 LEU HD11 H   1.444  11.070   9.756 1.00 . A A .  53 LEU HD11 1 1 
        1   815 1 1  53 LEU HD12 H   2.712  12.021  10.526 1.00 . A A .  53 LEU HD12 1 1 
        1   816 1 1  53 LEU HD13 H   2.074  12.510   8.955 1.00 . A A .  53 LEU HD13 1 1 
        1   817 1 1  53 LEU HD21 H   2.002  14.665  10.644 1.00 . A A .  53 LEU HD21 1 1 
        1   818 1 1  53 LEU HD22 H   2.058  13.704  12.122 1.00 . A A .  53 LEU HD22 1 1 
        1   819 1 1  53 LEU HD23 H   0.655  14.718  11.782 1.00 . A A .  53 LEU HD23 1 1 
        1   820 1 1  53 LEU HG   H   0.222  12.306  11.325 1.00 . A A .  53 LEU HG   1 1 
        1   821 1 1  53 LEU N    N  -1.903  12.861   7.833 1.00 . A A .  53 LEU N    1 1 
        1   822 1 1  53 LEU O    O  -2.493  11.545  10.295 1.00 . A A .  53 LEU O    1 1 
        1   823 1 1  54 VAL C    C  -0.314   8.412  11.442 1.00 . A A .  54 VAL C    1 1 
        1   824 1 1  54 VAL CA   C  -1.453   9.075  10.668 1.00 . A A .  54 VAL CA   1 1 
        1   825 1 1  54 VAL CB   C  -2.181   8.032   9.813 1.00 . A A .  54 VAL CB   1 1 
        1   826 1 1  54 VAL CG1  C  -1.278   7.593   8.658 1.00 . A A .  54 VAL CG1  1 1 
        1   827 1 1  54 VAL CG2  C  -2.540   6.815  10.673 1.00 . A A .  54 VAL CG2  1 1 
        1   828 1 1  54 VAL H    H  -0.070   9.958   9.266 1.00 . A A .  54 VAL H    1 1 
        1   829 1 1  54 VAL HA   H  -2.152   9.511  11.372 1.00 . A A .  54 VAL HA   1 1 
        1   830 1 1  54 VAL HB   H  -3.086   8.469   9.413 1.00 . A A .  54 VAL HB   1 1 
        1   831 1 1  54 VAL HG11 H  -0.390   7.124   9.054 1.00 . A A .  54 VAL HG11 1 1 
        1   832 1 1  54 VAL HG12 H  -0.999   8.455   8.069 1.00 . A A .  54 VAL HG12 1 1 
        1   833 1 1  54 VAL HG13 H  -1.809   6.889   8.035 1.00 . A A .  54 VAL HG13 1 1 
        1   834 1 1  54 VAL HG21 H  -2.942   7.148  11.619 1.00 . A A .  54 VAL HG21 1 1 
        1   835 1 1  54 VAL HG22 H  -1.654   6.223  10.846 1.00 . A A .  54 VAL HG22 1 1 
        1   836 1 1  54 VAL HG23 H  -3.278   6.216  10.159 1.00 . A A .  54 VAL HG23 1 1 
        1   837 1 1  54 VAL N    N  -0.888  10.137   9.778 1.00 . A A .  54 VAL N    1 1 
        1   838 1 1  54 VAL O    O   0.733   8.120  10.901 1.00 . A A .  54 VAL O    1 1 
        1   839 1 1  55 ASN C    C   0.441   6.004  13.405 1.00 . A A .  55 ASN C    1 1 
        1   840 1 1  55 ASN CA   C   0.557   7.525  13.524 1.00 . A A .  55 ASN CA   1 1 
        1   841 1 1  55 ASN CB   C   0.389   7.948  14.983 1.00 . A A .  55 ASN CB   1 1 
        1   842 1 1  55 ASN CG   C   0.768   9.423  15.124 1.00 . A A .  55 ASN CG   1 1 
        1   843 1 1  55 ASN H    H  -1.365   8.413  13.123 1.00 . A A .  55 ASN H    1 1 
        1   844 1 1  55 ASN HA   H   1.528   7.842  13.168 1.00 . A A .  55 ASN HA   1 1 
        1   845 1 1  55 ASN HB2  H  -0.641   7.809  15.281 1.00 . A A .  55 ASN HB2  1 1 
        1   846 1 1  55 ASN HB3  H   1.032   7.350  15.611 1.00 . A A .  55 ASN HB3  1 1 
        1   847 1 1  55 ASN HD21 H   2.527   9.201  14.226 1.00 . A A .  55 ASN HD21 1 1 
        1   848 1 1  55 ASN HD22 H   2.169  10.777  14.740 1.00 . A A .  55 ASN HD22 1 1 
        1   849 1 1  55 ASN N    N  -0.511   8.170  12.708 1.00 . A A .  55 ASN N    1 1 
        1   850 1 1  55 ASN ND2  N   1.917   9.834  14.658 1.00 . A A .  55 ASN ND2  1 1 
        1   851 1 1  55 ASN O    O  -0.193   5.356  14.214 1.00 . A A .  55 ASN O    1 1 
        1   852 1 1  55 ASN OD1  O   0.014  10.210  15.660 1.00 . A A .  55 ASN OD1  1 1 
        1   853 1 1  56 VAL C    C   1.600   3.268  13.450 1.00 . A A .  56 VAL C    1 1 
        1   854 1 1  56 VAL CA   C   0.964   3.948  12.237 1.00 . A A .  56 VAL CA   1 1 
        1   855 1 1  56 VAL CB   C   1.721   3.540  10.970 1.00 . A A .  56 VAL CB   1 1 
        1   856 1 1  56 VAL CG1  C   1.771   2.013  10.857 1.00 . A A .  56 VAL CG1  1 1 
        1   857 1 1  56 VAL CG2  C   1.013   4.126   9.747 1.00 . A A .  56 VAL CG2  1 1 
        1   858 1 1  56 VAL H    H   1.551   5.965  11.757 1.00 . A A .  56 VAL H    1 1 
        1   859 1 1  56 VAL HA   H  -0.072   3.647  12.152 1.00 . A A .  56 VAL HA   1 1 
        1   860 1 1  56 VAL HB   H   2.728   3.925  11.020 1.00 . A A .  56 VAL HB   1 1 
        1   861 1 1  56 VAL HG11 H   0.808   1.597  11.114 1.00 . A A .  56 VAL HG11 1 1 
        1   862 1 1  56 VAL HG12 H   2.520   1.629  11.532 1.00 . A A .  56 VAL HG12 1 1 
        1   863 1 1  56 VAL HG13 H   2.024   1.733   9.844 1.00 . A A .  56 VAL HG13 1 1 
        1   864 1 1  56 VAL HG21 H   0.772   5.161   9.933 1.00 . A A .  56 VAL HG21 1 1 
        1   865 1 1  56 VAL HG22 H   0.104   3.574   9.558 1.00 . A A .  56 VAL HG22 1 1 
        1   866 1 1  56 VAL HG23 H   1.663   4.055   8.887 1.00 . A A .  56 VAL HG23 1 1 
        1   867 1 1  56 VAL N    N   1.045   5.426  12.402 1.00 . A A .  56 VAL N    1 1 
        1   868 1 1  56 VAL O    O   1.045   2.350  14.019 1.00 . A A .  56 VAL O    1 1 
        1   869 1 1  57 THR C    C   4.132   4.186  15.867 1.00 . A A .  57 THR C    1 1 
        1   870 1 1  57 THR CA   C   3.443   3.098  15.037 1.00 . A A .  57 THR CA   1 1 
        1   871 1 1  57 THR CB   C   4.492   2.080  14.552 1.00 . A A .  57 THR CB   1 1 
        1   872 1 1  57 THR CG2  C   3.819   0.738  14.251 1.00 . A A .  57 THR CG2  1 1 
        1   873 1 1  57 THR H    H   3.191   4.457  13.377 1.00 . A A .  57 THR H    1 1 
        1   874 1 1  57 THR HA   H   2.712   2.593  15.658 1.00 . A A .  57 THR HA   1 1 
        1   875 1 1  57 THR HB   H   5.239   1.933  15.320 1.00 . A A .  57 THR HB   1 1 
        1   876 1 1  57 THR HG1  H   5.274   3.514  13.490 1.00 . A A .  57 THR HG1  1 1 
        1   877 1 1  57 THR HG21 H   4.482   0.128  13.656 1.00 . A A .  57 THR HG21 1 1 
        1   878 1 1  57 THR HG22 H   2.901   0.908  13.711 1.00 . A A .  57 THR HG22 1 1 
        1   879 1 1  57 THR HG23 H   3.600   0.232  15.179 1.00 . A A .  57 THR HG23 1 1 
        1   880 1 1  57 THR N    N   2.764   3.714  13.853 1.00 . A A .  57 THR N    1 1 
        1   881 1 1  57 THR O    O   4.503   5.229  15.364 1.00 . A A .  57 THR O    1 1 
        1   882 1 1  57 THR OG1  O   5.118   2.572  13.374 1.00 . A A .  57 THR OG1  1 1 
        1   883 1 1  58 GLY C    C   4.484   6.335  17.728 1.00 . A A .  58 GLY C    1 1 
        1   884 1 1  58 GLY CA   C   4.996   4.925  18.021 1.00 . A A .  58 GLY CA   1 1 
        1   885 1 1  58 GLY H    H   4.016   3.082  17.509 1.00 . A A .  58 GLY H    1 1 
        1   886 1 1  58 GLY HA2  H   4.794   4.679  19.054 1.00 . A A .  58 GLY HA2  1 1 
        1   887 1 1  58 GLY HA3  H   6.061   4.891  17.846 1.00 . A A .  58 GLY HA3  1 1 
        1   888 1 1  58 GLY N    N   4.317   3.933  17.136 1.00 . A A .  58 GLY N    1 1 
        1   889 1 1  58 GLY O    O   3.296   6.587  17.696 1.00 . A A .  58 GLY O    1 1 
        1   890 1 1  59 ALA C    C   6.226   9.442  16.845 1.00 . A A .  59 ALA C    1 1 
        1   891 1 1  59 ALA CA   C   4.976   8.652  17.228 1.00 . A A .  59 ALA CA   1 1 
        1   892 1 1  59 ALA CB   C   4.344   9.266  18.478 1.00 . A A .  59 ALA CB   1 1 
        1   893 1 1  59 ALA H    H   6.331   7.018  17.554 1.00 . A A .  59 ALA H    1 1 
        1   894 1 1  59 ALA HA   H   4.269   8.669  16.413 1.00 . A A .  59 ALA HA   1 1 
        1   895 1 1  59 ALA HB1  H   3.998  10.265  18.256 1.00 . A A .  59 ALA HB1  1 1 
        1   896 1 1  59 ALA HB2  H   5.078   9.306  19.270 1.00 . A A .  59 ALA HB2  1 1 
        1   897 1 1  59 ALA HB3  H   3.510   8.657  18.796 1.00 . A A .  59 ALA HB3  1 1 
        1   898 1 1  59 ALA N    N   5.381   7.252  17.518 1.00 . A A .  59 ALA N    1 1 
        1   899 1 1  59 ALA O    O   6.493  10.495  17.388 1.00 . A A .  59 ALA O    1 1 
        1   900 1 1  60 ARG C    C   8.284   9.804  13.984 1.00 . A A .  60 ARG C    1 1 
        1   901 1 1  60 ARG CA   C   8.262   9.626  15.503 1.00 . A A .  60 ARG CA   1 1 
        1   902 1 1  60 ARG CB   C   9.477   8.793  15.927 1.00 . A A .  60 ARG CB   1 1 
        1   903 1 1  60 ARG CD   C  10.788   7.926  17.876 1.00 . A A .  60 ARG CD   1 1 
        1   904 1 1  60 ARG CG   C   9.594   8.787  17.454 1.00 . A A .  60 ARG CG   1 1 
        1   905 1 1  60 ARG CZ   C  11.385   5.576  17.847 1.00 . A A .  60 ARG CZ   1 1 
        1   906 1 1  60 ARG H    H   6.769   8.068  15.515 1.00 . A A .  60 ARG H    1 1 
        1   907 1 1  60 ARG HA   H   8.323  10.601  15.971 1.00 . A A .  60 ARG HA   1 1 
        1   908 1 1  60 ARG HB2  H   9.360   7.780  15.570 1.00 . A A .  60 ARG HB2  1 1 
        1   909 1 1  60 ARG HB3  H  10.371   9.222  15.502 1.00 . A A .  60 ARG HB3  1 1 
        1   910 1 1  60 ARG HD2  H  11.666   8.229  17.324 1.00 . A A .  60 ARG HD2  1 1 
        1   911 1 1  60 ARG HD3  H  10.969   8.053  18.935 1.00 . A A .  60 ARG HD3  1 1 
        1   912 1 1  60 ARG HE   H   9.621   6.238  17.222 1.00 . A A .  60 ARG HE   1 1 
        1   913 1 1  60 ARG HG2  H   9.735   9.798  17.808 1.00 . A A .  60 ARG HG2  1 1 
        1   914 1 1  60 ARG HG3  H   8.691   8.379  17.883 1.00 . A A .  60 ARG HG3  1 1 
        1   915 1 1  60 ARG HH11 H  12.758   6.874  18.513 1.00 . A A .  60 ARG HH11 1 1 
        1   916 1 1  60 ARG HH12 H  13.233   5.209  18.526 1.00 . A A .  60 ARG HH12 1 1 
        1   917 1 1  60 ARG HH21 H  10.224   4.063  17.237 1.00 . A A .  60 ARG HH21 1 1 
        1   918 1 1  60 ARG HH22 H  11.799   3.618  17.804 1.00 . A A .  60 ARG HH22 1 1 
        1   919 1 1  60 ARG N    N   7.005   8.927  15.924 1.00 . A A .  60 ARG N    1 1 
        1   920 1 1  60 ARG NE   N  10.491   6.493  17.594 1.00 . A A .  60 ARG NE   1 1 
        1   921 1 1  60 ARG NH1  N  12.550   5.913  18.333 1.00 . A A .  60 ARG NH1  1 1 
        1   922 1 1  60 ARG NH2  N  11.115   4.322  17.610 1.00 . A A .  60 ARG NH2  1 1 
        1   923 1 1  60 ARG O    O   7.963   8.908  13.229 1.00 . A A .  60 ARG O    1 1 
        1   924 1 1  61 PHE C    C   9.412  12.616  11.923 1.00 . A A .  61 PHE C    1 1 
        1   925 1 1  61 PHE CA   C   8.768  11.241  12.085 1.00 . A A .  61 PHE CA   1 1 
        1   926 1 1  61 PHE CB   C   7.373  11.230  11.446 1.00 . A A .  61 PHE CB   1 1 
        1   927 1 1  61 PHE CD1  C   5.745  12.121  13.150 1.00 . A A .  61 PHE CD1  1 1 
        1   928 1 1  61 PHE CD2  C   6.521  13.600  11.393 1.00 . A A .  61 PHE CD2  1 1 
        1   929 1 1  61 PHE CE1  C   4.955  13.153  13.669 1.00 . A A .  61 PHE CE1  1 1 
        1   930 1 1  61 PHE CE2  C   5.733  14.633  11.913 1.00 . A A .  61 PHE CE2  1 1 
        1   931 1 1  61 PHE CG   C   6.528  12.345  12.013 1.00 . A A .  61 PHE CG   1 1 
        1   932 1 1  61 PHE CZ   C   4.949  14.409  13.051 1.00 . A A .  61 PHE CZ   1 1 
        1   933 1 1  61 PHE H    H   8.946  11.653  14.182 1.00 . A A .  61 PHE H    1 1 
        1   934 1 1  61 PHE HA   H   9.389  10.496  11.609 1.00 . A A .  61 PHE HA   1 1 
        1   935 1 1  61 PHE HB2  H   7.468  11.362  10.378 1.00 . A A .  61 PHE HB2  1 1 
        1   936 1 1  61 PHE HB3  H   6.894  10.283  11.646 1.00 . A A .  61 PHE HB3  1 1 
        1   937 1 1  61 PHE HD1  H   5.751  11.153  13.628 1.00 . A A .  61 PHE HD1  1 1 
        1   938 1 1  61 PHE HD2  H   7.126  13.773  10.515 1.00 . A A .  61 PHE HD2  1 1 
        1   939 1 1  61 PHE HE1  H   4.349  12.980  14.547 1.00 . A A .  61 PHE HE1  1 1 
        1   940 1 1  61 PHE HE2  H   5.728  15.602  11.436 1.00 . A A .  61 PHE HE2  1 1 
        1   941 1 1  61 PHE HZ   H   4.338  15.206  13.452 1.00 . A A .  61 PHE HZ   1 1 
        1   942 1 1  61 PHE N    N   8.683  10.959  13.543 1.00 . A A .  61 PHE N    1 1 
        1   943 1 1  61 PHE O    O   9.525  13.148  10.836 1.00 . A A .  61 PHE O    1 1 
        1   944 1 1  62 ALA C    C   9.569  15.531  12.293 1.00 . A A .  62 ALA C    1 1 
        1   945 1 1  62 ALA CA   C  10.484  14.527  12.990 1.00 . A A .  62 ALA CA   1 1 
        1   946 1 1  62 ALA CB   C  11.813  14.440  12.242 1.00 . A A .  62 ALA CB   1 1 
        1   947 1 1  62 ALA H    H   9.725  12.722  13.877 1.00 . A A .  62 ALA H    1 1 
        1   948 1 1  62 ALA HA   H  10.668  14.855  14.002 1.00 . A A .  62 ALA HA   1 1 
        1   949 1 1  62 ALA HB1  H  11.636  14.112  11.229 1.00 . A A .  62 ALA HB1  1 1 
        1   950 1 1  62 ALA HB2  H  12.460  13.733  12.741 1.00 . A A .  62 ALA HB2  1 1 
        1   951 1 1  62 ALA HB3  H  12.282  15.412  12.230 1.00 . A A .  62 ALA HB3  1 1 
        1   952 1 1  62 ALA N    N   9.835  13.185  13.021 1.00 . A A .  62 ALA N    1 1 
        1   953 1 1  62 ALA O    O   8.864  16.284  12.934 1.00 . A A .  62 ALA O    1 1 
        1   954 1 1  63 ARG C    C   8.141  15.856   8.998 1.00 . A A .  63 ARG C    1 1 
        1   955 1 1  63 ARG CA   C   8.708  16.526  10.247 1.00 . A A .  63 ARG CA   1 1 
        1   956 1 1  63 ARG CB   C   9.537  17.753   9.851 1.00 . A A .  63 ARG CB   1 1 
        1   957 1 1  63 ARG CD   C   9.465  19.997   8.744 1.00 . A A .  63 ARG CD   1 1 
        1   958 1 1  63 ARG CG   C   8.635  18.780   9.159 1.00 . A A .  63 ARG CG   1 1 
        1   959 1 1  63 ARG CZ   C   9.166  21.588  10.551 1.00 . A A .  63 ARG CZ   1 1 
        1   960 1 1  63 ARG H    H  10.158  14.946  10.491 1.00 . A A .  63 ARG H    1 1 
        1   961 1 1  63 ARG HA   H   7.887  16.842  10.879 1.00 . A A .  63 ARG HA   1 1 
        1   962 1 1  63 ARG HB2  H   9.970  18.194  10.737 1.00 . A A .  63 ARG HB2  1 1 
        1   963 1 1  63 ARG HB3  H  10.325  17.454   9.176 1.00 . A A .  63 ARG HB3  1 1 
        1   964 1 1  63 ARG HD2  H  10.314  19.670   8.164 1.00 . A A .  63 ARG HD2  1 1 
        1   965 1 1  63 ARG HD3  H   8.855  20.660   8.147 1.00 . A A .  63 ARG HD3  1 1 
        1   966 1 1  63 ARG HE   H  10.839  20.545  10.312 1.00 . A A .  63 ARG HE   1 1 
        1   967 1 1  63 ARG HG2  H   8.191  18.337   8.280 1.00 . A A .  63 ARG HG2  1 1 
        1   968 1 1  63 ARG HG3  H   7.857  19.091   9.838 1.00 . A A .  63 ARG HG3  1 1 
        1   969 1 1  63 ARG HH11 H   7.632  21.302   9.295 1.00 . A A .  63 ARG HH11 1 1 
        1   970 1 1  63 ARG HH12 H   7.369  22.471  10.544 1.00 . A A .  63 ARG HH12 1 1 
        1   971 1 1  63 ARG HH21 H  10.514  22.073  11.950 1.00 . A A .  63 ARG HH21 1 1 
        1   972 1 1  63 ARG HH22 H   9.000  22.909  12.046 1.00 . A A .  63 ARG HH22 1 1 
        1   973 1 1  63 ARG N    N   9.577  15.558  10.987 1.00 . A A .  63 ARG N    1 1 
        1   974 1 1  63 ARG NE   N   9.940  20.717   9.961 1.00 . A A .  63 ARG NE   1 1 
        1   975 1 1  63 ARG NH1  N   7.961  21.803  10.094 1.00 . A A .  63 ARG NH1  1 1 
        1   976 1 1  63 ARG NH2  N   9.593  22.239  11.598 1.00 . A A .  63 ARG NH2  1 1 
        1   977 1 1  63 ARG O    O   8.806  15.088   8.330 1.00 . A A .  63 ARG O    1 1 
        1   978 1 1  64 GLY C    C   6.857  16.164   6.210 1.00 . A A .  64 GLY C    1 1 
        1   979 1 1  64 GLY CA   C   6.284  15.525   7.476 1.00 . A A .  64 GLY CA   1 1 
        1   980 1 1  64 GLY H    H   6.393  16.764   9.233 1.00 . A A .  64 GLY H    1 1 
        1   981 1 1  64 GLY HA2  H   6.487  14.464   7.469 1.00 . A A .  64 GLY HA2  1 1 
        1   982 1 1  64 GLY HA3  H   5.217  15.687   7.503 1.00 . A A .  64 GLY HA3  1 1 
        1   983 1 1  64 GLY N    N   6.910  16.143   8.678 1.00 . A A .  64 GLY N    1 1 
        1   984 1 1  64 GLY O    O   7.477  17.208   6.256 1.00 . A A .  64 GLY O    1 1 
        1   985 1 1  65 SER C    C   6.408  15.520   2.634 1.00 . A A .  65 SER C    1 1 
        1   986 1 1  65 SER CA   C   7.183  16.121   3.808 1.00 . A A .  65 SER CA   1 1 
        1   987 1 1  65 SER CB   C   8.670  15.785   3.683 1.00 . A A .  65 SER CB   1 1 
        1   988 1 1  65 SER H    H   6.149  14.708   5.065 1.00 . A A .  65 SER H    1 1 
        1   989 1 1  65 SER HA   H   7.054  17.193   3.814 1.00 . A A .  65 SER HA   1 1 
        1   990 1 1  65 SER HB2  H   8.797  14.719   3.594 1.00 . A A .  65 SER HB2  1 1 
        1   991 1 1  65 SER HB3  H   9.075  16.269   2.802 1.00 . A A .  65 SER HB3  1 1 
        1   992 1 1  65 SER HG   H  10.193  15.788   4.897 1.00 . A A .  65 SER HG   1 1 
        1   993 1 1  65 SER N    N   6.654  15.547   5.079 1.00 . A A .  65 SER N    1 1 
        1   994 1 1  65 SER O    O   6.773  14.496   2.091 1.00 . A A .  65 SER O    1 1 
        1   995 1 1  65 SER OG   O   9.350  16.244   4.845 1.00 . A A .  65 SER OG   1 1 
        1   996 1 1  66 PHE C    C   5.246  15.839  -0.207 1.00 . A A .  66 PHE C    1 1 
        1   997 1 1  66 PHE CA   C   4.518  15.600   1.117 1.00 . A A .  66 PHE CA   1 1 
        1   998 1 1  66 PHE CB   C   3.165  16.312   1.090 1.00 . A A .  66 PHE CB   1 1 
        1   999 1 1  66 PHE CD1  C   1.828  14.971   2.755 1.00 . A A .  66 PHE CD1  1 1 
        1  1000 1 1  66 PHE CD2  C   2.543  17.207   3.362 1.00 . A A .  66 PHE CD2  1 1 
        1  1001 1 1  66 PHE CE1  C   1.210  14.830   4.004 1.00 . A A .  66 PHE CE1  1 1 
        1  1002 1 1  66 PHE CE2  C   1.927  17.066   4.611 1.00 . A A .  66 PHE CE2  1 1 
        1  1003 1 1  66 PHE CG   C   2.494  16.160   2.434 1.00 . A A .  66 PHE CG   1 1 
        1  1004 1 1  66 PHE CZ   C   1.260  15.876   4.932 1.00 . A A .  66 PHE CZ   1 1 
        1  1005 1 1  66 PHE H    H   5.044  16.961   2.704 1.00 . A A .  66 PHE H    1 1 
        1  1006 1 1  66 PHE HA   H   4.364  14.541   1.259 1.00 . A A .  66 PHE HA   1 1 
        1  1007 1 1  66 PHE HB2  H   3.315  17.359   0.876 1.00 . A A .  66 PHE HB2  1 1 
        1  1008 1 1  66 PHE HB3  H   2.543  15.872   0.325 1.00 . A A .  66 PHE HB3  1 1 
        1  1009 1 1  66 PHE HD1  H   1.789  14.164   2.040 1.00 . A A .  66 PHE HD1  1 1 
        1  1010 1 1  66 PHE HD2  H   3.056  18.125   3.114 1.00 . A A .  66 PHE HD2  1 1 
        1  1011 1 1  66 PHE HE1  H   0.695  13.914   4.252 1.00 . A A .  66 PHE HE1  1 1 
        1  1012 1 1  66 PHE HE2  H   1.966  17.873   5.327 1.00 . A A .  66 PHE HE2  1 1 
        1  1013 1 1  66 PHE HZ   H   0.786  15.765   5.896 1.00 . A A .  66 PHE HZ   1 1 
        1  1014 1 1  66 PHE N    N   5.329  16.141   2.246 1.00 . A A .  66 PHE N    1 1 
        1  1015 1 1  66 PHE O    O   5.778  16.902  -0.450 1.00 . A A .  66 PHE O    1 1 
        1  1016 1 1  67 ARG C    C   4.889  15.224  -3.483 1.00 . A A .  67 ARG C    1 1 
        1  1017 1 1  67 ARG CA   C   5.944  15.017  -2.396 1.00 . A A .  67 ARG CA   1 1 
        1  1018 1 1  67 ARG CB   C   6.741  13.753  -2.712 1.00 . A A .  67 ARG CB   1 1 
        1  1019 1 1  67 ARG CD   C   8.576  12.258  -1.943 1.00 . A A .  67 ARG CD   1 1 
        1  1020 1 1  67 ARG CG   C   7.859  13.581  -1.684 1.00 . A A .  67 ARG CG   1 1 
        1  1021 1 1  67 ARG CZ   C  10.437  12.819  -3.404 1.00 . A A .  67 ARG CZ   1 1 
        1  1022 1 1  67 ARG H    H   4.817  14.011  -0.857 1.00 . A A .  67 ARG H    1 1 
        1  1023 1 1  67 ARG HA   H   6.613  15.867  -2.375 1.00 . A A .  67 ARG HA   1 1 
        1  1024 1 1  67 ARG HB2  H   6.084  12.896  -2.677 1.00 . A A .  67 ARG HB2  1 1 
        1  1025 1 1  67 ARG HB3  H   7.174  13.835  -3.699 1.00 . A A .  67 ARG HB3  1 1 
        1  1026 1 1  67 ARG HD2  H   9.316  12.088  -1.175 1.00 . A A .  67 ARG HD2  1 1 
        1  1027 1 1  67 ARG HD3  H   7.854  11.457  -1.930 1.00 . A A .  67 ARG HD3  1 1 
        1  1028 1 1  67 ARG HE   H   8.778  11.954  -4.069 1.00 . A A .  67 ARG HE   1 1 
        1  1029 1 1  67 ARG HG2  H   8.559  14.399  -1.771 1.00 . A A .  67 ARG HG2  1 1 
        1  1030 1 1  67 ARG HG3  H   7.436  13.571  -0.690 1.00 . A A .  67 ARG HG3  1 1 
        1  1031 1 1  67 ARG HH11 H  10.621  13.262  -1.459 1.00 . A A .  67 ARG HH11 1 1 
        1  1032 1 1  67 ARG HH12 H  11.974  13.681  -2.455 1.00 . A A .  67 ARG HH12 1 1 
        1  1033 1 1  67 ARG HH21 H  10.537  12.496  -5.379 1.00 . A A .  67 ARG HH21 1 1 
        1  1034 1 1  67 ARG HH22 H  11.926  13.250  -4.670 1.00 . A A .  67 ARG HH22 1 1 
        1  1035 1 1  67 ARG N    N   5.262  14.856  -1.074 1.00 . A A .  67 ARG N    1 1 
        1  1036 1 1  67 ARG NE   N   9.240  12.308  -3.280 1.00 . A A .  67 ARG NE   1 1 
        1  1037 1 1  67 ARG NH1  N  11.058  13.291  -2.357 1.00 . A A .  67 ARG NH1  1 1 
        1  1038 1 1  67 ARG NH2  N  11.010  12.859  -4.575 1.00 . A A .  67 ARG NH2  1 1 
        1  1039 1 1  67 ARG O    O   4.951  16.163  -4.252 1.00 . A A .  67 ARG O    1 1 
        1  1040 1 1  68 GLU C    C   1.581  13.829  -4.096 1.00 . A A .  68 GLU C    1 1 
        1  1041 1 1  68 GLU CA   C   2.863  14.489  -4.596 1.00 . A A .  68 GLU CA   1 1 
        1  1042 1 1  68 GLU CB   C   3.319  13.792  -5.876 1.00 . A A .  68 GLU CB   1 1 
        1  1043 1 1  68 GLU CD   C   2.771  13.381  -8.280 1.00 . A A .  68 GLU CD   1 1 
        1  1044 1 1  68 GLU CG   C   2.285  14.025  -6.979 1.00 . A A .  68 GLU CG   1 1 
        1  1045 1 1  68 GLU H    H   3.896  13.596  -2.926 1.00 . A A .  68 GLU H    1 1 
        1  1046 1 1  68 GLU HA   H   2.678  15.536  -4.798 1.00 . A A .  68 GLU HA   1 1 
        1  1047 1 1  68 GLU HB2  H   4.274  14.190  -6.183 1.00 . A A .  68 GLU HB2  1 1 
        1  1048 1 1  68 GLU HB3  H   3.413  12.732  -5.694 1.00 . A A .  68 GLU HB3  1 1 
        1  1049 1 1  68 GLU HG2  H   1.344  13.582  -6.687 1.00 . A A .  68 GLU HG2  1 1 
        1  1050 1 1  68 GLU HG3  H   2.154  15.085  -7.132 1.00 . A A .  68 GLU HG3  1 1 
        1  1051 1 1  68 GLU N    N   3.924  14.349  -3.555 1.00 . A A .  68 GLU N    1 1 
        1  1052 1 1  68 GLU O    O   1.616  12.764  -3.514 1.00 . A A .  68 GLU O    1 1 
        1  1053 1 1  68 GLU OE1  O   3.945  13.061  -8.357 1.00 . A A .  68 GLU OE1  1 1 
        1  1054 1 1  68 GLU OE2  O   1.959  13.222  -9.178 1.00 . A A .  68 GLU OE2  1 1 
        1  1055 1 1  69 VAL C    C  -1.807  13.719  -5.045 1.00 . A A .  69 VAL C    1 1 
        1  1056 1 1  69 VAL CA   C  -0.850  13.856  -3.858 1.00 . A A .  69 VAL CA   1 1 
        1  1057 1 1  69 VAL CB   C  -1.476  14.775  -2.800 1.00 . A A .  69 VAL CB   1 1 
        1  1058 1 1  69 VAL CG1  C  -2.922  14.342  -2.508 1.00 . A A .  69 VAL CG1  1 1 
        1  1059 1 1  69 VAL CG2  C  -0.646  14.694  -1.516 1.00 . A A .  69 VAL CG2  1 1 
        1  1060 1 1  69 VAL H    H   0.448  15.307  -4.792 1.00 . A A .  69 VAL H    1 1 
        1  1061 1 1  69 VAL HA   H  -0.686  12.878  -3.423 1.00 . A A .  69 VAL HA   1 1 
        1  1062 1 1  69 VAL HB   H  -1.475  15.792  -3.165 1.00 . A A .  69 VAL HB   1 1 
        1  1063 1 1  69 VAL HG11 H  -3.230  14.719  -1.543 1.00 . A A .  69 VAL HG11 1 1 
        1  1064 1 1  69 VAL HG12 H  -2.987  13.264  -2.510 1.00 . A A .  69 VAL HG12 1 1 
        1  1065 1 1  69 VAL HG13 H  -3.572  14.743  -3.270 1.00 . A A .  69 VAL HG13 1 1 
        1  1066 1 1  69 VAL HG21 H   0.344  15.083  -1.703 1.00 . A A .  69 VAL HG21 1 1 
        1  1067 1 1  69 VAL HG22 H  -0.574  13.665  -1.198 1.00 . A A .  69 VAL HG22 1 1 
        1  1068 1 1  69 VAL HG23 H  -1.122  15.279  -0.743 1.00 . A A .  69 VAL HG23 1 1 
        1  1069 1 1  69 VAL N    N   0.448  14.449  -4.320 1.00 . A A .  69 VAL N    1 1 
        1  1070 1 1  69 VAL O    O  -2.037  14.652  -5.786 1.00 . A A .  69 VAL O    1 1 
        1  1071 1 1  70 VAL C    C  -4.448  11.389  -5.809 1.00 . A A .  70 VAL C    1 1 
        1  1072 1 1  70 VAL CA   C  -3.344  12.331  -6.327 1.00 . A A .  70 VAL CA   1 1 
        1  1073 1 1  70 VAL CB   C  -2.618  11.683  -7.521 1.00 . A A .  70 VAL CB   1 1 
        1  1074 1 1  70 VAL CG1  C  -3.354  12.024  -8.831 1.00 . A A .  70 VAL CG1  1 1 
        1  1075 1 1  70 VAL CG2  C  -1.181  12.214  -7.591 1.00 . A A .  70 VAL CG2  1 1 
        1  1076 1 1  70 VAL H    H  -2.180  11.827  -4.594 1.00 . A A .  70 VAL H    1 1 
        1  1077 1 1  70 VAL HA   H  -3.774  13.275  -6.638 1.00 . A A .  70 VAL HA   1 1 
        1  1078 1 1  70 VAL HB   H  -2.595  10.610  -7.395 1.00 . A A .  70 VAL HB   1 1 
        1  1079 1 1  70 VAL HG11 H  -3.103  11.292  -9.585 1.00 . A A .  70 VAL HG11 1 1 
        1  1080 1 1  70 VAL HG12 H  -3.058  13.007  -9.172 1.00 . A A .  70 VAL HG12 1 1 
        1  1081 1 1  70 VAL HG13 H  -4.421  12.012  -8.661 1.00 . A A .  70 VAL HG13 1 1 
        1  1082 1 1  70 VAL HG21 H  -1.195  13.295  -7.603 1.00 . A A .  70 VAL HG21 1 1 
        1  1083 1 1  70 VAL HG22 H  -0.704  11.850  -8.488 1.00 . A A .  70 VAL HG22 1 1 
        1  1084 1 1  70 VAL HG23 H  -0.629  11.871  -6.727 1.00 . A A .  70 VAL HG23 1 1 
        1  1085 1 1  70 VAL N    N  -2.378  12.558  -5.215 1.00 . A A .  70 VAL N    1 1 
        1  1086 1 1  70 VAL O    O  -4.283  10.184  -5.815 1.00 . A A .  70 VAL O    1 1 
        1  1087 1 1  71 PRO C    C  -7.137   9.998  -5.797 1.00 . A A .  71 PRO C    1 1 
        1  1088 1 1  71 PRO CA   C  -6.674  11.070  -4.803 1.00 . A A .  71 PRO CA   1 1 
        1  1089 1 1  71 PRO CB   C  -7.802  12.080  -4.527 1.00 . A A .  71 PRO CB   1 1 
        1  1090 1 1  71 PRO CD   C  -5.891  13.350  -5.268 1.00 . A A .  71 PRO CD   1 1 
        1  1091 1 1  71 PRO CG   C  -7.110  13.390  -4.348 1.00 . A A .  71 PRO CG   1 1 
        1  1092 1 1  71 PRO HA   H  -6.369  10.609  -3.876 1.00 . A A .  71 PRO HA   1 1 
        1  1093 1 1  71 PRO HB2  H  -8.481  12.126  -5.372 1.00 . A A .  71 PRO HB2  1 1 
        1  1094 1 1  71 PRO HB3  H  -8.340  11.815  -3.628 1.00 . A A .  71 PRO HB3  1 1 
        1  1095 1 1  71 PRO HD2  H  -6.141  13.741  -6.245 1.00 . A A .  71 PRO HD2  1 1 
        1  1096 1 1  71 PRO HD3  H  -5.071  13.901  -4.834 1.00 . A A .  71 PRO HD3  1 1 
        1  1097 1 1  71 PRO HG2  H  -7.768  14.204  -4.628 1.00 . A A .  71 PRO HG2  1 1 
        1  1098 1 1  71 PRO HG3  H  -6.789  13.507  -3.323 1.00 . A A .  71 PRO HG3  1 1 
        1  1099 1 1  71 PRO N    N  -5.561  11.913  -5.343 1.00 . A A .  71 PRO N    1 1 
        1  1100 1 1  71 PRO O    O  -7.015  10.159  -6.994 1.00 . A A .  71 PRO O    1 1 
        1  1101 1 1  72 VAL C    C  -7.216   7.623  -7.375 1.00 . A A .  72 VAL C    1 1 
        1  1102 1 1  72 VAL CA   C  -8.139   7.785  -6.163 1.00 . A A .  72 VAL CA   1 1 
        1  1103 1 1  72 VAL CB   C  -9.590   8.056  -6.618 1.00 . A A .  72 VAL CB   1 1 
        1  1104 1 1  72 VAL CG1  C  -9.676   9.386  -7.382 1.00 . A A .  72 VAL CG1  1 1 
        1  1105 1 1  72 VAL CG2  C -10.095   6.897  -7.516 1.00 . A A .  72 VAL CG2  1 1 
        1  1106 1 1  72 VAL H    H  -7.733   8.815  -4.315 1.00 . A A .  72 VAL H    1 1 
        1  1107 1 1  72 VAL HA   H  -8.121   6.868  -5.592 1.00 . A A .  72 VAL HA   1 1 
        1  1108 1 1  72 VAL HB   H -10.218   8.123  -5.739 1.00 . A A .  72 VAL HB   1 1 
        1  1109 1 1  72 VAL HG11 H -10.645   9.463  -7.854 1.00 . A A .  72 VAL HG11 1 1 
        1  1110 1 1  72 VAL HG12 H  -8.908   9.423  -8.139 1.00 . A A .  72 VAL HG12 1 1 
        1  1111 1 1  72 VAL HG13 H  -9.548  10.209  -6.695 1.00 . A A .  72 VAL HG13 1 1 
        1  1112 1 1  72 VAL HG21 H  -9.986   7.160  -8.559 1.00 . A A .  72 VAL HG21 1 1 
        1  1113 1 1  72 VAL HG22 H -11.139   6.708  -7.307 1.00 . A A .  72 VAL HG22 1 1 
        1  1114 1 1  72 VAL HG23 H  -9.528   5.999  -7.315 1.00 . A A .  72 VAL HG23 1 1 
        1  1115 1 1  72 VAL N    N  -7.659   8.904  -5.289 1.00 . A A .  72 VAL N    1 1 
        1  1116 1 1  72 VAL O    O  -7.655   7.370  -8.477 1.00 . A A .  72 VAL O    1 1 
        1  1117 1 1  73 HIS C    C  -3.619   7.158  -7.785 1.00 . A A .  73 HIS C    1 1 
        1  1118 1 1  73 HIS CA   C  -4.974   7.637  -8.310 1.00 . A A .  73 HIS CA   1 1 
        1  1119 1 1  73 HIS CB   C  -4.800   8.994  -8.985 1.00 . A A .  73 HIS CB   1 1 
        1  1120 1 1  73 HIS CD2  C  -6.867  10.463  -9.673 1.00 . A A .  73 HIS CD2  1 1 
        1  1121 1 1  73 HIS CE1  C  -7.716   9.135 -11.159 1.00 . A A .  73 HIS CE1  1 1 
        1  1122 1 1  73 HIS CG   C  -6.057   9.356  -9.725 1.00 . A A .  73 HIS CG   1 1 
        1  1123 1 1  73 HIS H    H  -5.601   7.981  -6.276 1.00 . A A .  73 HIS H    1 1 
        1  1124 1 1  73 HIS HA   H  -5.354   6.923  -9.029 1.00 . A A .  73 HIS HA   1 1 
        1  1125 1 1  73 HIS HB2  H  -4.602   9.739  -8.231 1.00 . A A .  73 HIS HB2  1 1 
        1  1126 1 1  73 HIS HB3  H  -3.972   8.952  -9.676 1.00 . A A .  73 HIS HB3  1 1 
        1  1127 1 1  73 HIS HD1  H  -6.276   7.645 -10.955 1.00 . A A .  73 HIS HD1  1 1 
        1  1128 1 1  73 HIS HD2  H  -6.713  11.315  -9.027 1.00 . A A .  73 HIS HD2  1 1 
        1  1129 1 1  73 HIS HE1  H  -8.358   8.719 -11.921 1.00 . A A .  73 HIS HE1  1 1 
        1  1130 1 1  73 HIS N    N  -5.934   7.774  -7.174 1.00 . A A .  73 HIS N    1 1 
        1  1131 1 1  73 HIS ND1  N  -6.617   8.522 -10.680 1.00 . A A .  73 HIS ND1  1 1 
        1  1132 1 1  73 HIS NE2  N  -7.913  10.322 -10.579 1.00 . A A .  73 HIS NE2  1 1 
        1  1133 1 1  73 HIS O    O  -3.216   6.036  -8.014 1.00 . A A .  73 HIS O    1 1 
        1  1134 1 1  74 ARG C    C  -1.120   8.536  -5.460 1.00 . A A .  74 ARG C    1 1 
        1  1135 1 1  74 ARG CA   C  -1.577   7.578  -6.561 1.00 . A A .  74 ARG CA   1 1 
        1  1136 1 1  74 ARG CB   C  -0.554   7.576  -7.696 1.00 . A A .  74 ARG CB   1 1 
        1  1137 1 1  74 ARG CD   C   0.562   8.948  -9.446 1.00 . A A .  74 ARG CD   1 1 
        1  1138 1 1  74 ARG CG   C  -0.520   8.947  -8.369 1.00 . A A .  74 ARG CG   1 1 
        1  1139 1 1  74 ARG CZ   C   2.980   8.815  -9.533 1.00 . A A .  74 ARG CZ   1 1 
        1  1140 1 1  74 ARG H    H  -3.241   8.904  -6.912 1.00 . A A .  74 ARG H    1 1 
        1  1141 1 1  74 ARG HA   H  -1.656   6.579  -6.152 1.00 . A A .  74 ARG HA   1 1 
        1  1142 1 1  74 ARG HB2  H   0.424   7.349  -7.296 1.00 . A A .  74 ARG HB2  1 1 
        1  1143 1 1  74 ARG HB3  H  -0.828   6.828  -8.422 1.00 . A A .  74 ARG HB3  1 1 
        1  1144 1 1  74 ARG HD2  H   0.429   8.089 -10.087 1.00 . A A .  74 ARG HD2  1 1 
        1  1145 1 1  74 ARG HD3  H   0.487   9.851 -10.032 1.00 . A A .  74 ARG HD3  1 1 
        1  1146 1 1  74 ARG HE   H   1.976   8.896  -7.821 1.00 . A A .  74 ARG HE   1 1 
        1  1147 1 1  74 ARG HG2  H  -1.481   9.149  -8.822 1.00 . A A .  74 ARG HG2  1 1 
        1  1148 1 1  74 ARG HG3  H  -0.297   9.707  -7.635 1.00 . A A .  74 ARG HG3  1 1 
        1  1149 1 1  74 ARG HH11 H   1.984   8.811 -11.271 1.00 . A A .  74 ARG HH11 1 1 
        1  1150 1 1  74 ARG HH12 H   3.710   8.732 -11.396 1.00 . A A .  74 ARG HH12 1 1 
        1  1151 1 1  74 ARG HH21 H   4.229   8.795  -7.968 1.00 . A A .  74 ARG HH21 1 1 
        1  1152 1 1  74 ARG HH22 H   4.980   8.723  -9.526 1.00 . A A .  74 ARG HH22 1 1 
        1  1153 1 1  74 ARG N    N  -2.906   7.999  -7.088 1.00 . A A .  74 ARG N    1 1 
        1  1154 1 1  74 ARG NE   N   1.902   8.882  -8.799 1.00 . A A .  74 ARG NE   1 1 
        1  1155 1 1  74 ARG NH1  N   2.883   8.784 -10.835 1.00 . A A .  74 ARG NH1  1 1 
        1  1156 1 1  74 ARG NH2  N   4.154   8.774  -8.964 1.00 . A A .  74 ARG NH2  1 1 
        1  1157 1 1  74 ARG O    O  -1.587   9.654  -5.358 1.00 . A A .  74 ARG O    1 1 
        1  1158 1 1  75 LEU C    C   1.816   8.827  -3.402 1.00 . A A .  75 LEU C    1 1 
        1  1159 1 1  75 LEU CA   C   0.300   8.978  -3.527 1.00 . A A .  75 LEU CA   1 1 
        1  1160 1 1  75 LEU CB   C  -0.354   8.557  -2.206 1.00 . A A .  75 LEU CB   1 1 
        1  1161 1 1  75 LEU CD1  C  -2.532   8.241  -1.023 1.00 . A A .  75 LEU CD1  1 1 
        1  1162 1 1  75 LEU CD2  C  -2.050  10.431  -2.147 1.00 . A A .  75 LEU CD2  1 1 
        1  1163 1 1  75 LEU CG   C  -1.850   8.904  -2.222 1.00 . A A .  75 LEU CG   1 1 
        1  1164 1 1  75 LEU H    H   0.157   7.198  -4.741 1.00 . A A .  75 LEU H    1 1 
        1  1165 1 1  75 LEU HA   H   0.068  10.010  -3.734 1.00 . A A .  75 LEU HA   1 1 
        1  1166 1 1  75 LEU HB2  H  -0.238   7.490  -2.076 1.00 . A A .  75 LEU HB2  1 1 
        1  1167 1 1  75 LEU HB3  H   0.127   9.069  -1.386 1.00 . A A .  75 LEU HB3  1 1 
        1  1168 1 1  75 LEU HD11 H  -3.551   8.591  -0.951 1.00 . A A .  75 LEU HD11 1 1 
        1  1169 1 1  75 LEU HD12 H  -2.000   8.497  -0.119 1.00 . A A .  75 LEU HD12 1 1 
        1  1170 1 1  75 LEU HD13 H  -2.526   7.169  -1.153 1.00 . A A .  75 LEU HD13 1 1 
        1  1171 1 1  75 LEU HD21 H  -1.304  10.870  -1.500 1.00 . A A .  75 LEU HD21 1 1 
        1  1172 1 1  75 LEU HD22 H  -3.035  10.650  -1.758 1.00 . A A .  75 LEU HD22 1 1 
        1  1173 1 1  75 LEU HD23 H  -1.962  10.851  -3.134 1.00 . A A .  75 LEU HD23 1 1 
        1  1174 1 1  75 LEU HG   H  -2.292   8.527  -3.133 1.00 . A A .  75 LEU HG   1 1 
        1  1175 1 1  75 LEU N    N  -0.203   8.103  -4.633 1.00 . A A .  75 LEU N    1 1 
        1  1176 1 1  75 LEU O    O   2.365   7.766  -3.620 1.00 . A A .  75 LEU O    1 1 
        1  1177 1 1  76 ALA C    C   4.385  10.579  -1.628 1.00 . A A .  76 ALA C    1 1 
        1  1178 1 1  76 ALA CA   C   3.983   9.822  -2.898 1.00 . A A .  76 ALA CA   1 1 
        1  1179 1 1  76 ALA CB   C   4.644  10.473  -4.117 1.00 . A A .  76 ALA CB   1 1 
        1  1180 1 1  76 ALA H    H   2.030  10.731  -2.878 1.00 . A A .  76 ALA H    1 1 
        1  1181 1 1  76 ALA HA   H   4.306   8.794  -2.816 1.00 . A A .  76 ALA HA   1 1 
        1  1182 1 1  76 ALA HB1  H   4.132  10.157  -5.013 1.00 . A A .  76 ALA HB1  1 1 
        1  1183 1 1  76 ALA HB2  H   5.680  10.174  -4.168 1.00 . A A .  76 ALA HB2  1 1 
        1  1184 1 1  76 ALA HB3  H   4.585  11.550  -4.030 1.00 . A A .  76 ALA HB3  1 1 
        1  1185 1 1  76 ALA N    N   2.498   9.887  -3.048 1.00 . A A .  76 ALA N    1 1 
        1  1186 1 1  76 ALA O    O   4.124  11.758  -1.488 1.00 . A A .  76 ALA O    1 1 
        1  1187 1 1  77 TYR C    C   6.434   9.706   1.298 1.00 . A A .  77 TYR C    1 1 
        1  1188 1 1  77 TYR CA   C   5.427  10.586   0.560 1.00 . A A .  77 TYR CA   1 1 
        1  1189 1 1  77 TYR CB   C   4.201  10.821   1.449 1.00 . A A .  77 TYR CB   1 1 
        1  1190 1 1  77 TYR CD1  C   2.625   8.980   0.767 1.00 . A A .  77 TYR CD1  1 1 
        1  1191 1 1  77 TYR CD2  C   3.732   8.824   2.918 1.00 . A A .  77 TYR CD2  1 1 
        1  1192 1 1  77 TYR CE1  C   1.972   7.768   1.013 1.00 . A A .  77 TYR CE1  1 1 
        1  1193 1 1  77 TYR CE2  C   3.078   7.610   3.165 1.00 . A A .  77 TYR CE2  1 1 
        1  1194 1 1  77 TYR CG   C   3.504   9.509   1.718 1.00 . A A .  77 TYR CG   1 1 
        1  1195 1 1  77 TYR CZ   C   2.198   7.083   2.211 1.00 . A A .  77 TYR CZ   1 1 
        1  1196 1 1  77 TYR H    H   5.210   8.958  -0.833 1.00 . A A .  77 TYR H    1 1 
        1  1197 1 1  77 TYR HA   H   5.885  11.536   0.324 1.00 . A A .  77 TYR HA   1 1 
        1  1198 1 1  77 TYR HB2  H   4.515  11.260   2.385 1.00 . A A .  77 TYR HB2  1 1 
        1  1199 1 1  77 TYR HB3  H   3.519  11.493   0.948 1.00 . A A .  77 TYR HB3  1 1 
        1  1200 1 1  77 TYR HD1  H   2.450   9.510  -0.158 1.00 . A A .  77 TYR HD1  1 1 
        1  1201 1 1  77 TYR HD2  H   4.410   9.229   3.654 1.00 . A A .  77 TYR HD2  1 1 
        1  1202 1 1  77 TYR HE1  H   1.295   7.361   0.277 1.00 . A A .  77 TYR HE1  1 1 
        1  1203 1 1  77 TYR HE2  H   3.251   7.080   4.090 1.00 . A A .  77 TYR HE2  1 1 
        1  1204 1 1  77 TYR HH   H   0.612   6.027   2.317 1.00 . A A .  77 TYR HH   1 1 
        1  1205 1 1  77 TYR N    N   5.012   9.909  -0.701 1.00 . A A .  77 TYR N    1 1 
        1  1206 1 1  77 TYR O    O   6.592   8.541   0.992 1.00 . A A .  77 TYR O    1 1 
        1  1207 1 1  77 TYR OH   O   1.552   5.887   2.453 1.00 . A A .  77 TYR OH   1 1 
        1  1208 1 1  78 SER C    C   7.930   9.682   4.534 1.00 . A A .  78 SER C    1 1 
        1  1209 1 1  78 SER CA   C   8.127   9.452   3.035 1.00 . A A .  78 SER CA   1 1 
        1  1210 1 1  78 SER CB   C   9.535   9.895   2.636 1.00 . A A .  78 SER CB   1 1 
        1  1211 1 1  78 SER H    H   6.977  11.196   2.493 1.00 . A A .  78 SER H    1 1 
        1  1212 1 1  78 SER HA   H   8.011   8.398   2.821 1.00 . A A .  78 SER HA   1 1 
        1  1213 1 1  78 SER HB2  H  10.243   9.125   2.892 1.00 . A A .  78 SER HB2  1 1 
        1  1214 1 1  78 SER HB3  H   9.566  10.069   1.568 1.00 . A A .  78 SER HB3  1 1 
        1  1215 1 1  78 SER HG   H   9.458  11.824   2.874 1.00 . A A .  78 SER HG   1 1 
        1  1216 1 1  78 SER N    N   7.122  10.254   2.269 1.00 . A A .  78 SER N    1 1 
        1  1217 1 1  78 SER O    O   7.502  10.734   4.964 1.00 . A A .  78 SER O    1 1 
        1  1218 1 1  78 SER OG   O   9.867  11.088   3.334 1.00 . A A .  78 SER OG   1 1 
        1  1219 1 1  79 PHE C    C   8.772   7.652   7.471 1.00 . A A .  79 PHE C    1 1 
        1  1220 1 1  79 PHE CA   C   8.092   8.846   6.803 1.00 . A A .  79 PHE CA   1 1 
        1  1221 1 1  79 PHE CB   C   6.602   8.889   7.171 1.00 . A A .  79 PHE CB   1 1 
        1  1222 1 1  79 PHE CD1  C   5.729   7.094   5.631 1.00 . A A .  79 PHE CD1  1 1 
        1  1223 1 1  79 PHE CD2  C   5.610   6.731   8.025 1.00 . A A .  79 PHE CD2  1 1 
        1  1224 1 1  79 PHE CE1  C   5.135   5.845   5.414 1.00 . A A .  79 PHE CE1  1 1 
        1  1225 1 1  79 PHE CE2  C   5.016   5.482   7.807 1.00 . A A .  79 PHE CE2  1 1 
        1  1226 1 1  79 PHE CG   C   5.968   7.537   6.937 1.00 . A A .  79 PHE CG   1 1 
        1  1227 1 1  79 PHE CZ   C   4.779   5.039   6.501 1.00 . A A .  79 PHE CZ   1 1 
        1  1228 1 1  79 PHE H    H   8.593   7.866   4.957 1.00 . A A .  79 PHE H    1 1 
        1  1229 1 1  79 PHE HA   H   8.570   9.758   7.130 1.00 . A A .  79 PHE HA   1 1 
        1  1230 1 1  79 PHE HB2  H   6.500   9.162   8.212 1.00 . A A .  79 PHE HB2  1 1 
        1  1231 1 1  79 PHE HB3  H   6.107   9.628   6.559 1.00 . A A .  79 PHE HB3  1 1 
        1  1232 1 1  79 PHE HD1  H   6.006   7.714   4.791 1.00 . A A .  79 PHE HD1  1 1 
        1  1233 1 1  79 PHE HD2  H   5.792   7.072   9.033 1.00 . A A .  79 PHE HD2  1 1 
        1  1234 1 1  79 PHE HE1  H   4.951   5.503   4.405 1.00 . A A .  79 PHE HE1  1 1 
        1  1235 1 1  79 PHE HE2  H   4.740   4.861   8.646 1.00 . A A .  79 PHE HE2  1 1 
        1  1236 1 1  79 PHE HZ   H   4.321   4.076   6.333 1.00 . A A .  79 PHE HZ   1 1 
        1  1237 1 1  79 PHE N    N   8.246   8.702   5.330 1.00 . A A .  79 PHE N    1 1 
        1  1238 1 1  79 PHE O    O   9.085   7.673   8.645 1.00 . A A .  79 PHE O    1 1 
        1  1239 1 1  80 GLY C    C   8.656   4.505   7.961 1.00 . A A .  80 GLY C    1 1 
        1  1240 1 1  80 GLY CA   C   9.683   5.408   7.280 1.00 . A A .  80 GLY CA   1 1 
        1  1241 1 1  80 GLY H    H   8.750   6.629   5.772 1.00 . A A .  80 GLY H    1 1 
        1  1242 1 1  80 GLY HA2  H  10.168   4.865   6.482 1.00 . A A .  80 GLY HA2  1 1 
        1  1243 1 1  80 GLY HA3  H  10.423   5.716   8.007 1.00 . A A .  80 GLY HA3  1 1 
        1  1244 1 1  80 GLY N    N   9.010   6.612   6.717 1.00 . A A .  80 GLY N    1 1 
        1  1245 1 1  80 GLY O    O   7.572   4.929   8.306 1.00 . A A .  80 GLY O    1 1 
        1  1246 1 1  81 TRP C    C   8.295   2.371  10.344 1.00 . A A .  81 TRP C    1 1 
        1  1247 1 1  81 TRP CA   C   8.053   2.320   8.833 1.00 . A A .  81 TRP CA   1 1 
        1  1248 1 1  81 TRP CB   C   8.309   0.901   8.316 1.00 . A A .  81 TRP CB   1 1 
        1  1249 1 1  81 TRP CD1  C   7.667  -0.985   9.869 1.00 . A A .  81 TRP CD1  1 1 
        1  1250 1 1  81 TRP CD2  C   5.910  -0.165   8.732 1.00 . A A .  81 TRP CD2  1 1 
        1  1251 1 1  81 TRP CE2  C   5.412  -1.201   9.556 1.00 . A A .  81 TRP CE2  1 1 
        1  1252 1 1  81 TRP CE3  C   5.002   0.521   7.904 1.00 . A A .  81 TRP CE3  1 1 
        1  1253 1 1  81 TRP CG   C   7.344  -0.047   8.952 1.00 . A A .  81 TRP CG   1 1 
        1  1254 1 1  81 TRP CH2  C   3.171  -0.853   8.733 1.00 . A A .  81 TRP CH2  1 1 
        1  1255 1 1  81 TRP CZ2  C   4.060  -1.545   9.561 1.00 . A A .  81 TRP CZ2  1 1 
        1  1256 1 1  81 TRP CZ3  C   3.641   0.177   7.907 1.00 . A A .  81 TRP CZ3  1 1 
        1  1257 1 1  81 TRP H    H   9.880   2.946   7.881 1.00 . A A .  81 TRP H    1 1 
        1  1258 1 1  81 TRP HA   H   7.031   2.605   8.620 1.00 . A A .  81 TRP HA   1 1 
        1  1259 1 1  81 TRP HB2  H   8.179   0.880   7.245 1.00 . A A .  81 TRP HB2  1 1 
        1  1260 1 1  81 TRP HB3  H   9.317   0.606   8.562 1.00 . A A .  81 TRP HB3  1 1 
        1  1261 1 1  81 TRP HD1  H   8.658  -1.169  10.257 1.00 . A A .  81 TRP HD1  1 1 
        1  1262 1 1  81 TRP HE1  H   6.482  -2.401  10.882 1.00 . A A .  81 TRP HE1  1 1 
        1  1263 1 1  81 TRP HE3  H   5.354   1.315   7.264 1.00 . A A .  81 TRP HE3  1 1 
        1  1264 1 1  81 TRP HH2  H   2.122  -1.111   8.730 1.00 . A A .  81 TRP HH2  1 1 
        1  1265 1 1  81 TRP HZ2  H   3.703  -2.338  10.199 1.00 . A A .  81 TRP HZ2  1 1 
        1  1266 1 1  81 TRP HZ3  H   2.952   0.711   7.269 1.00 . A A .  81 TRP HZ3  1 1 
        1  1267 1 1  81 TRP N    N   8.997   3.261   8.163 1.00 . A A .  81 TRP N    1 1 
        1  1268 1 1  81 TRP NE1  N   6.521  -1.671  10.230 1.00 . A A .  81 TRP NE1  1 1 
        1  1269 1 1  81 TRP O    O   7.636   1.698  11.113 1.00 . A A .  81 TRP O    1 1 
        1  1270 1 1  82 ASP C    C   9.777   1.873  12.809 1.00 . A A .  82 ASP C    1 1 
        1  1271 1 1  82 ASP CA   C   9.538   3.267  12.230 1.00 . A A .  82 ASP CA   1 1 
        1  1272 1 1  82 ASP CB   C   8.365   3.937  12.952 1.00 . A A .  82 ASP CB   1 1 
        1  1273 1 1  82 ASP CG   C   8.351   5.432  12.619 1.00 . A A .  82 ASP CG   1 1 
        1  1274 1 1  82 ASP H    H   9.759   3.694  10.132 1.00 . A A .  82 ASP H    1 1 
        1  1275 1 1  82 ASP HA   H  10.429   3.861  12.370 1.00 . A A .  82 ASP HA   1 1 
        1  1276 1 1  82 ASP HB2  H   7.437   3.486  12.634 1.00 . A A .  82 ASP HB2  1 1 
        1  1277 1 1  82 ASP HB3  H   8.480   3.811  14.020 1.00 . A A .  82 ASP HB3  1 1 
        1  1278 1 1  82 ASP N    N   9.242   3.164  10.772 1.00 . A A .  82 ASP N    1 1 
        1  1279 1 1  82 ASP O    O   9.501   1.616  13.963 1.00 . A A .  82 ASP O    1 1 
        1  1280 1 1  82 ASP OD1  O   9.340   5.913  12.091 1.00 . A A .  82 ASP OD1  1 1 
        1  1281 1 1  82 ASP OD2  O   7.349   6.070  12.894 1.00 . A A .  82 ASP OD2  1 1 
        1  1282 1 1  83 GLY C    C  11.952  -0.431  13.196 1.00 . A A .  83 GLY C    1 1 
        1  1283 1 1  83 GLY CA   C  10.570  -0.403  12.536 1.00 . A A .  83 GLY CA   1 1 
        1  1284 1 1  83 GLY H    H  10.527   1.200  11.096 1.00 . A A .  83 GLY H    1 1 
        1  1285 1 1  83 GLY HA2  H   9.817  -0.673  13.266 1.00 . A A .  83 GLY HA2  1 1 
        1  1286 1 1  83 GLY HA3  H  10.551  -1.106  11.719 1.00 . A A .  83 GLY HA3  1 1 
        1  1287 1 1  83 GLY N    N  10.301   0.971  12.022 1.00 . A A .  83 GLY N    1 1 
        1  1288 1 1  83 GLY O    O  12.327  -1.398  13.827 1.00 . A A .  83 GLY O    1 1 
        1  1289 1 1  84 SER C    C  14.576   2.088  13.767 1.00 . A A .  84 SER C    1 1 
        1  1290 1 1  84 SER CA   C  14.067   0.646  13.688 1.00 . A A .  84 SER CA   1 1 
        1  1291 1 1  84 SER CB   C  15.034  -0.194  12.855 1.00 . A A .  84 SER CB   1 1 
        1  1292 1 1  84 SER H    H  12.396   1.397  12.549 1.00 . A A .  84 SER H    1 1 
        1  1293 1 1  84 SER HA   H  14.005   0.234  14.685 1.00 . A A .  84 SER HA   1 1 
        1  1294 1 1  84 SER HB2  H  15.998  -0.219  13.336 1.00 . A A .  84 SER HB2  1 1 
        1  1295 1 1  84 SER HB3  H  14.650  -1.203  12.770 1.00 . A A .  84 SER HB3  1 1 
        1  1296 1 1  84 SER HG   H  15.937  -0.007  11.143 1.00 . A A .  84 SER HG   1 1 
        1  1297 1 1  84 SER N    N  12.714   0.623  13.060 1.00 . A A .  84 SER N    1 1 
        1  1298 1 1  84 SER O    O  14.105   2.959  13.063 1.00 . A A .  84 SER O    1 1 
        1  1299 1 1  84 SER OG   O  15.170   0.385  11.565 1.00 . A A .  84 SER OG   1 1 
        1  1300 1 1  85 GLU C    C  14.979   4.758  14.701 1.00 . A A .  85 GLU C    1 1 
        1  1301 1 1  85 GLU CA   C  16.104   3.720  14.757 1.00 . A A .  85 GLU CA   1 1 
        1  1302 1 1  85 GLU CB   C  17.093   3.995  13.618 1.00 . A A .  85 GLU CB   1 1 
        1  1303 1 1  85 GLU CD   C  19.268   3.341  12.585 1.00 . A A .  85 GLU CD   1 1 
        1  1304 1 1  85 GLU CG   C  18.325   3.099  13.766 1.00 . A A .  85 GLU CG   1 1 
        1  1305 1 1  85 GLU H    H  15.904   1.614  15.164 1.00 . A A .  85 GLU H    1 1 
        1  1306 1 1  85 GLU HA   H  16.620   3.802  15.703 1.00 . A A .  85 GLU HA   1 1 
        1  1307 1 1  85 GLU HB2  H  16.613   3.794  12.671 1.00 . A A .  85 GLU HB2  1 1 
        1  1308 1 1  85 GLU HB3  H  17.400   5.030  13.652 1.00 . A A .  85 GLU HB3  1 1 
        1  1309 1 1  85 GLU HG2  H  18.833   3.333  14.690 1.00 . A A .  85 GLU HG2  1 1 
        1  1310 1 1  85 GLU HG3  H  18.020   2.063  13.773 1.00 . A A .  85 GLU HG3  1 1 
        1  1311 1 1  85 GLU N    N  15.542   2.339  14.617 1.00 . A A .  85 GLU N    1 1 
        1  1312 1 1  85 GLU O    O  14.223   4.928  15.635 1.00 . A A .  85 GLU O    1 1 
        1  1313 1 1  85 GLU OE1  O  18.957   4.195  11.770 1.00 . A A .  85 GLU OE1  1 1 
        1  1314 1 1  85 GLU OE2  O  20.286   2.673  12.518 1.00 . A A .  85 GLU OE2  1 1 
        1  1315 1 1  86 VAL C    C  13.494   6.634  11.948 1.00 . A A .  86 VAL C    1 1 
        1  1316 1 1  86 VAL CA   C  13.817   6.486  13.440 1.00 . A A .  86 VAL CA   1 1 
        1  1317 1 1  86 VAL CB   C  14.329   7.818  14.005 1.00 . A A .  86 VAL CB   1 1 
        1  1318 1 1  86 VAL CG1  C  15.358   8.435  13.050 1.00 . A A .  86 VAL CG1  1 1 
        1  1319 1 1  86 VAL CG2  C  13.154   8.785  14.182 1.00 . A A .  86 VAL CG2  1 1 
        1  1320 1 1  86 VAL H    H  15.505   5.282  12.870 1.00 . A A .  86 VAL H    1 1 
        1  1321 1 1  86 VAL HA   H  12.926   6.183  13.974 1.00 . A A .  86 VAL HA   1 1 
        1  1322 1 1  86 VAL HB   H  14.793   7.641  14.964 1.00 . A A .  86 VAL HB   1 1 
        1  1323 1 1  86 VAL HG11 H  16.027   7.663  12.698 1.00 . A A .  86 VAL HG11 1 1 
        1  1324 1 1  86 VAL HG12 H  15.924   9.191  13.571 1.00 . A A .  86 VAL HG12 1 1 
        1  1325 1 1  86 VAL HG13 H  14.848   8.882  12.209 1.00 . A A .  86 VAL HG13 1 1 
        1  1326 1 1  86 VAL HG21 H  12.663   8.935  13.232 1.00 . A A .  86 VAL HG21 1 1 
        1  1327 1 1  86 VAL HG22 H  13.520   9.733  14.551 1.00 . A A .  86 VAL HG22 1 1 
        1  1328 1 1  86 VAL HG23 H  12.451   8.371  14.889 1.00 . A A .  86 VAL HG23 1 1 
        1  1329 1 1  86 VAL N    N  14.877   5.448  13.601 1.00 . A A .  86 VAL N    1 1 
        1  1330 1 1  86 VAL O    O  12.371   6.900  11.569 1.00 . A A .  86 VAL O    1 1 
        1  1331 1 1  87 VAL C    C  13.736   7.992   9.312 1.00 . A A .  87 VAL C    1 1 
        1  1332 1 1  87 VAL CA   C  14.281   6.594   9.638 1.00 . A A .  87 VAL CA   1 1 
        1  1333 1 1  87 VAL CB   C  13.300   5.519   9.159 1.00 . A A .  87 VAL CB   1 1 
        1  1334 1 1  87 VAL CG1  C  13.148   5.610   7.641 1.00 . A A .  87 VAL CG1  1 1 
        1  1335 1 1  87 VAL CG2  C  13.854   4.139   9.524 1.00 . A A .  87 VAL CG2  1 1 
        1  1336 1 1  87 VAL H    H  15.380   6.261  11.453 1.00 . A A .  87 VAL H    1 1 
        1  1337 1 1  87 VAL HA   H  15.224   6.448   9.137 1.00 . A A .  87 VAL HA   1 1 
        1  1338 1 1  87 VAL HB   H  12.337   5.660   9.627 1.00 . A A .  87 VAL HB   1 1 
        1  1339 1 1  87 VAL HG11 H  14.115   5.493   7.176 1.00 . A A .  87 VAL HG11 1 1 
        1  1340 1 1  87 VAL HG12 H  12.734   6.571   7.377 1.00 . A A .  87 VAL HG12 1 1 
        1  1341 1 1  87 VAL HG13 H  12.487   4.828   7.298 1.00 . A A .  87 VAL HG13 1 1 
        1  1342 1 1  87 VAL HG21 H  14.123   4.124  10.570 1.00 . A A .  87 VAL HG21 1 1 
        1  1343 1 1  87 VAL HG22 H  14.729   3.934   8.925 1.00 . A A .  87 VAL HG22 1 1 
        1  1344 1 1  87 VAL HG23 H  13.104   3.387   9.335 1.00 . A A .  87 VAL HG23 1 1 
        1  1345 1 1  87 VAL N    N  14.488   6.467  11.109 1.00 . A A .  87 VAL N    1 1 
        1  1346 1 1  87 VAL O    O  12.549   8.172   9.128 1.00 . A A .  87 VAL O    1 1 
        1  1347 1 1  88 PRO C    C  13.935  10.598   7.442 1.00 . A A .  88 PRO C    1 1 
        1  1348 1 1  88 PRO CA   C  14.197  10.383   8.947 1.00 . A A .  88 PRO CA   1 1 
        1  1349 1 1  88 PRO CB   C  15.388  11.227   9.439 1.00 . A A .  88 PRO CB   1 1 
        1  1350 1 1  88 PRO CD   C  16.058   8.860   9.452 1.00 . A A .  88 PRO CD   1 1 
        1  1351 1 1  88 PRO CG   C  16.582  10.308   9.438 1.00 . A A .  88 PRO CG   1 1 
        1  1352 1 1  88 PRO HA   H  13.320  10.625   9.519 1.00 . A A .  88 PRO HA   1 1 
        1  1353 1 1  88 PRO HB2  H  15.558  12.066   8.775 1.00 . A A .  88 PRO HB2  1 1 
        1  1354 1 1  88 PRO HB3  H  15.200  11.587  10.442 1.00 . A A .  88 PRO HB3  1 1 
        1  1355 1 1  88 PRO HD2  H  16.506   8.292   8.647 1.00 . A A .  88 PRO HD2  1 1 
        1  1356 1 1  88 PRO HD3  H  16.261   8.386  10.402 1.00 . A A .  88 PRO HD3  1 1 
        1  1357 1 1  88 PRO HG2  H  17.179  10.478   8.548 1.00 . A A .  88 PRO HG2  1 1 
        1  1358 1 1  88 PRO HG3  H  17.189  10.483  10.318 1.00 . A A .  88 PRO HG3  1 1 
        1  1359 1 1  88 PRO N    N  14.603   8.980   9.247 1.00 . A A .  88 PRO N    1 1 
        1  1360 1 1  88 PRO O    O  14.262   9.755   6.632 1.00 . A A .  88 PRO O    1 1 
        1  1361 1 1  89 PRO C    C  14.272  11.869   4.700 1.00 . A A .  89 PRO C    1 1 
        1  1362 1 1  89 PRO CA   C  13.046  12.009   5.618 1.00 . A A .  89 PRO CA   1 1 
        1  1363 1 1  89 PRO CB   C  12.559  13.469   5.640 1.00 . A A .  89 PRO CB   1 1 
        1  1364 1 1  89 PRO CD   C  12.887  12.815   7.939 1.00 . A A .  89 PRO CD   1 1 
        1  1365 1 1  89 PRO CG   C  12.018  13.669   7.015 1.00 . A A .  89 PRO CG   1 1 
        1  1366 1 1  89 PRO HA   H  12.251  11.372   5.269 1.00 . A A .  89 PRO HA   1 1 
        1  1367 1 1  89 PRO HB2  H  13.386  14.148   5.460 1.00 . A A .  89 PRO HB2  1 1 
        1  1368 1 1  89 PRO HB3  H  11.782  13.623   4.906 1.00 . A A .  89 PRO HB3  1 1 
        1  1369 1 1  89 PRO HD2  H  13.724  13.394   8.308 1.00 . A A .  89 PRO HD2  1 1 
        1  1370 1 1  89 PRO HD3  H  12.297  12.431   8.754 1.00 . A A .  89 PRO HD3  1 1 
        1  1371 1 1  89 PRO HG2  H  12.077  14.714   7.296 1.00 . A A .  89 PRO HG2  1 1 
        1  1372 1 1  89 PRO HG3  H  10.993  13.329   7.065 1.00 . A A .  89 PRO HG3  1 1 
        1  1373 1 1  89 PRO N    N  13.346  11.715   7.060 1.00 . A A .  89 PRO N    1 1 
        1  1374 1 1  89 PRO O    O  15.359  12.309   5.019 1.00 . A A .  89 PRO O    1 1 
        1  1375 1 1  90 GLY C    C  15.892   9.734   2.821 1.00 . A A .  90 GLY C    1 1 
        1  1376 1 1  90 GLY CA   C  15.223  11.090   2.594 1.00 . A A .  90 GLY CA   1 1 
        1  1377 1 1  90 GLY H    H  13.202  10.925   3.320 1.00 . A A .  90 GLY H    1 1 
        1  1378 1 1  90 GLY HA2  H  14.842  11.137   1.583 1.00 . A A .  90 GLY HA2  1 1 
        1  1379 1 1  90 GLY HA3  H  15.950  11.876   2.738 1.00 . A A .  90 GLY HA3  1 1 
        1  1380 1 1  90 GLY N    N  14.090  11.264   3.554 1.00 . A A .  90 GLY N    1 1 
        1  1381 1 1  90 GLY O    O  16.459   9.153   1.917 1.00 . A A .  90 GLY O    1 1 
        1  1382 1 1  91 SER C    C  15.704   6.800   3.559 1.00 . A A .  91 SER C    1 1 
        1  1383 1 1  91 SER CA   C  16.473   7.901   4.290 1.00 . A A .  91 SER CA   1 1 
        1  1384 1 1  91 SER CB   C  16.450   7.618   5.789 1.00 . A A .  91 SER CB   1 1 
        1  1385 1 1  91 SER H    H  15.374   9.700   4.740 1.00 . A A .  91 SER H    1 1 
        1  1386 1 1  91 SER HA   H  17.495   7.917   3.942 1.00 . A A .  91 SER HA   1 1 
        1  1387 1 1  91 SER HB2  H  16.913   6.666   5.985 1.00 . A A .  91 SER HB2  1 1 
        1  1388 1 1  91 SER HB3  H  16.995   8.395   6.308 1.00 . A A .  91 SER HB3  1 1 
        1  1389 1 1  91 SER HG   H  15.036   8.139   7.017 1.00 . A A .  91 SER HG   1 1 
        1  1390 1 1  91 SER N    N  15.833   9.220   4.019 1.00 . A A .  91 SER N    1 1 
        1  1391 1 1  91 SER O    O  16.225   5.735   3.297 1.00 . A A .  91 SER O    1 1 
        1  1392 1 1  91 SER OG   O  15.102   7.586   6.237 1.00 . A A .  91 SER OG   1 1 
        1  1393 1 1  92 SER C    C  12.533   6.712   1.769 1.00 . A A .  92 SER C    1 1 
        1  1394 1 1  92 SER CA   C  13.663   6.013   2.516 1.00 . A A .  92 SER CA   1 1 
        1  1395 1 1  92 SER CB   C  13.073   5.027   3.524 1.00 . A A .  92 SER CB   1 1 
        1  1396 1 1  92 SER H    H  14.065   7.911   3.452 1.00 . A A .  92 SER H    1 1 
        1  1397 1 1  92 SER HA   H  14.290   5.483   1.812 1.00 . A A .  92 SER HA   1 1 
        1  1398 1 1  92 SER HB2  H  12.363   4.385   3.027 1.00 . A A .  92 SER HB2  1 1 
        1  1399 1 1  92 SER HB3  H  13.866   4.425   3.946 1.00 . A A .  92 SER HB3  1 1 
        1  1400 1 1  92 SER HG   H  11.484   5.842   4.302 1.00 . A A .  92 SER HG   1 1 
        1  1401 1 1  92 SER N    N  14.469   7.045   3.229 1.00 . A A .  92 SER N    1 1 
        1  1402 1 1  92 SER O    O  12.209   7.847   2.052 1.00 . A A .  92 SER O    1 1 
        1  1403 1 1  92 SER OG   O  12.408   5.750   4.552 1.00 . A A .  92 SER OG   1 1 
        1  1404 1 1  93 LEU C    C   9.651   5.703  -0.074 1.00 . A A .  93 LEU C    1 1 
        1  1405 1 1  93 LEU CA   C  10.813   6.685   0.045 1.00 . A A .  93 LEU CA   1 1 
        1  1406 1 1  93 LEU CB   C  11.314   7.062  -1.354 1.00 . A A .  93 LEU CB   1 1 
        1  1407 1 1  93 LEU CD1  C   9.520   8.838  -1.475 1.00 . A A .  93 LEU CD1  1 1 
        1  1408 1 1  93 LEU CD2  C  10.724   8.098  -3.551 1.00 . A A .  93 LEU CD2  1 1 
        1  1409 1 1  93 LEU CG   C  10.168   7.644  -2.195 1.00 . A A .  93 LEU CG   1 1 
        1  1410 1 1  93 LEU H    H  12.213   5.133   0.604 1.00 . A A .  93 LEU H    1 1 
        1  1411 1 1  93 LEU HA   H  10.470   7.573   0.556 1.00 . A A .  93 LEU HA   1 1 
        1  1412 1 1  93 LEU HB2  H  12.101   7.797  -1.264 1.00 . A A .  93 LEU HB2  1 1 
        1  1413 1 1  93 LEU HB3  H  11.701   6.181  -1.843 1.00 . A A .  93 LEU HB3  1 1 
        1  1414 1 1  93 LEU HD11 H  10.277   9.401  -0.945 1.00 . A A .  93 LEU HD11 1 1 
        1  1415 1 1  93 LEU HD12 H   8.784   8.476  -0.772 1.00 . A A .  93 LEU HD12 1 1 
        1  1416 1 1  93 LEU HD13 H   9.035   9.478  -2.197 1.00 . A A .  93 LEU HD13 1 1 
        1  1417 1 1  93 LEU HD21 H  10.903   7.235  -4.173 1.00 . A A .  93 LEU HD21 1 1 
        1  1418 1 1  93 LEU HD22 H  11.650   8.634  -3.402 1.00 . A A .  93 LEU HD22 1 1 
        1  1419 1 1  93 LEU HD23 H  10.008   8.747  -4.033 1.00 . A A .  93 LEU HD23 1 1 
        1  1420 1 1  93 LEU HG   H   9.424   6.881  -2.357 1.00 . A A .  93 LEU HG   1 1 
        1  1421 1 1  93 LEU N    N  11.930   6.051   0.816 1.00 . A A .  93 LEU N    1 1 
        1  1422 1 1  93 LEU O    O   9.825   4.567  -0.462 1.00 . A A .  93 LEU O    1 1 
        1  1423 1 1  94 VAL C    C   6.333   5.779  -0.908 1.00 . A A .  94 VAL C    1 1 
        1  1424 1 1  94 VAL CA   C   7.268   5.243   0.172 1.00 . A A .  94 VAL CA   1 1 
        1  1425 1 1  94 VAL CB   C   6.538   5.251   1.512 1.00 . A A .  94 VAL CB   1 1 
        1  1426 1 1  94 VAL CG1  C   5.254   4.428   1.398 1.00 . A A .  94 VAL CG1  1 1 
        1  1427 1 1  94 VAL CG2  C   7.447   4.654   2.586 1.00 . A A .  94 VAL CG2  1 1 
        1  1428 1 1  94 VAL H    H   8.352   7.064   0.569 1.00 . A A .  94 VAL H    1 1 
        1  1429 1 1  94 VAL HA   H   7.567   4.230  -0.073 1.00 . A A .  94 VAL HA   1 1 
        1  1430 1 1  94 VAL HB   H   6.286   6.267   1.777 1.00 . A A .  94 VAL HB   1 1 
        1  1431 1 1  94 VAL HG11 H   4.536   4.958   0.793 1.00 . A A .  94 VAL HG11 1 1 
        1  1432 1 1  94 VAL HG12 H   4.844   4.260   2.383 1.00 . A A .  94 VAL HG12 1 1 
        1  1433 1 1  94 VAL HG13 H   5.482   3.476   0.938 1.00 . A A .  94 VAL HG13 1 1 
        1  1434 1 1  94 VAL HG21 H   7.032   4.854   3.562 1.00 . A A .  94 VAL HG21 1 1 
        1  1435 1 1  94 VAL HG22 H   8.427   5.103   2.513 1.00 . A A .  94 VAL HG22 1 1 
        1  1436 1 1  94 VAL HG23 H   7.527   3.589   2.438 1.00 . A A .  94 VAL HG23 1 1 
        1  1437 1 1  94 VAL N    N   8.462   6.139   0.259 1.00 . A A .  94 VAL N    1 1 
        1  1438 1 1  94 VAL O    O   6.028   6.953  -0.945 1.00 . A A .  94 VAL O    1 1 
        1  1439 1 1  95 GLU C    C   3.865   4.364  -3.106 1.00 . A A .  95 GLU C    1 1 
        1  1440 1 1  95 GLU CA   C   4.960   5.399  -2.880 1.00 . A A .  95 GLU CA   1 1 
        1  1441 1 1  95 GLU CB   C   5.749   5.589  -4.177 1.00 . A A .  95 GLU CB   1 1 
        1  1442 1 1  95 GLU CD   C   7.501   6.962  -5.306 1.00 . A A .  95 GLU CD   1 1 
        1  1443 1 1  95 GLU CG   C   6.641   6.822  -4.051 1.00 . A A .  95 GLU CG   1 1 
        1  1444 1 1  95 GLU H    H   6.141   3.991  -1.749 1.00 . A A .  95 GLU H    1 1 
        1  1445 1 1  95 GLU HA   H   4.503   6.341  -2.604 1.00 . A A .  95 GLU HA   1 1 
        1  1446 1 1  95 GLU HB2  H   6.362   4.717  -4.355 1.00 . A A .  95 GLU HB2  1 1 
        1  1447 1 1  95 GLU HB3  H   5.065   5.723  -5.002 1.00 . A A .  95 GLU HB3  1 1 
        1  1448 1 1  95 GLU HG2  H   6.023   7.700  -3.939 1.00 . A A .  95 GLU HG2  1 1 
        1  1449 1 1  95 GLU HG3  H   7.277   6.717  -3.189 1.00 . A A .  95 GLU HG3  1 1 
        1  1450 1 1  95 GLU N    N   5.877   4.935  -1.795 1.00 . A A .  95 GLU N    1 1 
        1  1451 1 1  95 GLU O    O   4.106   3.173  -3.109 1.00 . A A .  95 GLU O    1 1 
        1  1452 1 1  95 GLU OE1  O   7.387   6.117  -6.178 1.00 . A A .  95 GLU OE1  1 1 
        1  1453 1 1  95 GLU OE2  O   8.257   7.918  -5.377 1.00 . A A .  95 GLU OE2  1 1 
        1  1454 1 1  96 ILE C    C   0.837   4.333  -4.849 1.00 . A A .  96 ILE C    1 1 
        1  1455 1 1  96 ILE CA   C   1.508   3.906  -3.549 1.00 . A A .  96 ILE CA   1 1 
        1  1456 1 1  96 ILE CB   C   0.521   4.020  -2.385 1.00 . A A .  96 ILE CB   1 1 
        1  1457 1 1  96 ILE CD1  C   0.325   3.844   0.103 1.00 . A A .  96 ILE CD1  1 1 
        1  1458 1 1  96 ILE CG1  C   1.190   3.501  -1.110 1.00 . A A .  96 ILE CG1  1 1 
        1  1459 1 1  96 ILE CG2  C  -0.730   3.195  -2.685 1.00 . A A .  96 ILE CG2  1 1 
        1  1460 1 1  96 ILE H    H   2.510   5.792  -3.302 1.00 . A A .  96 ILE H    1 1 
        1  1461 1 1  96 ILE HA   H   1.851   2.882  -3.637 1.00 . A A .  96 ILE HA   1 1 
        1  1462 1 1  96 ILE HB   H   0.244   5.055  -2.251 1.00 . A A .  96 ILE HB   1 1 
        1  1463 1 1  96 ILE HD11 H  -0.631   3.351   0.015 1.00 . A A .  96 ILE HD11 1 1 
        1  1464 1 1  96 ILE HD12 H   0.177   4.913   0.148 1.00 . A A .  96 ILE HD12 1 1 
        1  1465 1 1  96 ILE HD13 H   0.821   3.511   1.004 1.00 . A A .  96 ILE HD13 1 1 
        1  1466 1 1  96 ILE HG12 H   1.306   2.428  -1.177 1.00 . A A .  96 ILE HG12 1 1 
        1  1467 1 1  96 ILE HG13 H   2.160   3.961  -1.001 1.00 . A A .  96 ILE HG13 1 1 
        1  1468 1 1  96 ILE HG21 H  -1.353   3.152  -1.804 1.00 . A A .  96 ILE HG21 1 1 
        1  1469 1 1  96 ILE HG22 H  -0.442   2.194  -2.972 1.00 . A A .  96 ILE HG22 1 1 
        1  1470 1 1  96 ILE HG23 H  -1.281   3.656  -3.492 1.00 . A A .  96 ILE HG23 1 1 
        1  1471 1 1  96 ILE N    N   2.660   4.823  -3.304 1.00 . A A .  96 ILE N    1 1 
        1  1472 1 1  96 ILE O    O   0.538   5.493  -5.043 1.00 . A A .  96 ILE O    1 1 
        1  1473 1 1  97 ASP C    C  -1.235   2.879  -7.305 1.00 . A A .  97 ASP C    1 1 
        1  1474 1 1  97 ASP CA   C  -0.019   3.768  -7.062 1.00 . A A .  97 ASP CA   1 1 
        1  1475 1 1  97 ASP CB   C   1.000   3.552  -8.180 1.00 . A A .  97 ASP CB   1 1 
        1  1476 1 1  97 ASP CG   C   2.096   4.614  -8.078 1.00 . A A .  97 ASP CG   1 1 
        1  1477 1 1  97 ASP H    H   0.882   2.486  -5.576 1.00 . A A .  97 ASP H    1 1 
        1  1478 1 1  97 ASP HA   H  -0.332   4.803  -7.063 1.00 . A A .  97 ASP HA   1 1 
        1  1479 1 1  97 ASP HB2  H   1.440   2.569  -8.080 1.00 . A A .  97 ASP HB2  1 1 
        1  1480 1 1  97 ASP HB3  H   0.511   3.632  -9.138 1.00 . A A .  97 ASP HB3  1 1 
        1  1481 1 1  97 ASP N    N   0.617   3.413  -5.752 1.00 . A A .  97 ASP N    1 1 
        1  1482 1 1  97 ASP O    O  -1.191   1.682  -7.113 1.00 . A A .  97 ASP O    1 1 
        1  1483 1 1  97 ASP OD1  O   1.929   5.534  -7.294 1.00 . A A .  97 ASP OD1  1 1 
        1  1484 1 1  97 ASP OD2  O   3.082   4.489  -8.784 1.00 . A A .  97 ASP OD2  1 1 
        1  1485 1 1  98 LEU C    C  -3.755   2.586  -9.519 1.00 . A A .  98 LEU C    1 1 
        1  1486 1 1  98 LEU CA   C  -3.559   2.673  -8.010 1.00 . A A .  98 LEU CA   1 1 
        1  1487 1 1  98 LEU CB   C  -4.759   3.389  -7.388 1.00 . A A .  98 LEU CB   1 1 
        1  1488 1 1  98 LEU CD1  C  -5.708   4.361  -5.295 1.00 . A A .  98 LEU CD1  1 1 
        1  1489 1 1  98 LEU CD2  C  -4.373   2.242  -5.181 1.00 . A A .  98 LEU CD2  1 1 
        1  1490 1 1  98 LEU CG   C  -4.521   3.599  -5.890 1.00 . A A .  98 LEU CG   1 1 
        1  1491 1 1  98 LEU H    H  -2.323   4.431  -7.886 1.00 . A A .  98 LEU H    1 1 
        1  1492 1 1  98 LEU HA   H  -3.476   1.675  -7.600 1.00 . A A .  98 LEU HA   1 1 
        1  1493 1 1  98 LEU HB2  H  -4.889   4.348  -7.869 1.00 . A A .  98 LEU HB2  1 1 
        1  1494 1 1  98 LEU HB3  H  -5.648   2.793  -7.531 1.00 . A A .  98 LEU HB3  1 1 
        1  1495 1 1  98 LEU HD11 H  -6.614   3.793  -5.450 1.00 . A A .  98 LEU HD11 1 1 
        1  1496 1 1  98 LEU HD12 H  -5.798   5.322  -5.780 1.00 . A A .  98 LEU HD12 1 1 
        1  1497 1 1  98 LEU HD13 H  -5.550   4.505  -4.237 1.00 . A A .  98 LEU HD13 1 1 
        1  1498 1 1  98 LEU HD21 H  -5.071   1.533  -5.604 1.00 . A A .  98 LEU HD21 1 1 
        1  1499 1 1  98 LEU HD22 H  -4.575   2.359  -4.126 1.00 . A A .  98 LEU HD22 1 1 
        1  1500 1 1  98 LEU HD23 H  -3.366   1.875  -5.310 1.00 . A A .  98 LEU HD23 1 1 
        1  1501 1 1  98 LEU HG   H  -3.619   4.179  -5.750 1.00 . A A .  98 LEU HG   1 1 
        1  1502 1 1  98 LEU N    N  -2.321   3.463  -7.735 1.00 . A A .  98 LEU N    1 1 
        1  1503 1 1  98 LEU O    O  -3.718   3.582 -10.211 1.00 . A A .  98 LEU O    1 1 
        1  1504 1 1  99 ILE C    C  -5.498   0.545 -11.766 1.00 . A A .  99 ILE C    1 1 
        1  1505 1 1  99 ILE CA   C  -4.162   1.242 -11.515 1.00 . A A .  99 ILE CA   1 1 
        1  1506 1 1  99 ILE CB   C  -3.025   0.399 -12.090 1.00 . A A .  99 ILE CB   1 1 
        1  1507 1 1  99 ILE CD1  C  -0.534   0.234 -12.260 1.00 . A A .  99 ILE CD1  1 1 
        1  1508 1 1  99 ILE CG1  C  -1.706   1.157 -11.921 1.00 . A A .  99 ILE CG1  1 1 
        1  1509 1 1  99 ILE CG2  C  -3.283   0.143 -13.576 1.00 . A A .  99 ILE CG2  1 1 
        1  1510 1 1  99 ILE H    H  -3.985   0.613  -9.458 1.00 . A A .  99 ILE H    1 1 
        1  1511 1 1  99 ILE HA   H  -4.171   2.209 -12.004 1.00 . A A .  99 ILE HA   1 1 
        1  1512 1 1  99 ILE HB   H  -2.973  -0.543 -11.565 1.00 . A A .  99 ILE HB   1 1 
        1  1513 1 1  99 ILE HD11 H  -0.400  -0.483 -11.464 1.00 . A A .  99 ILE HD11 1 1 
        1  1514 1 1  99 ILE HD12 H   0.365   0.822 -12.370 1.00 . A A .  99 ILE HD12 1 1 
        1  1515 1 1  99 ILE HD13 H  -0.740  -0.285 -13.183 1.00 . A A .  99 ILE HD13 1 1 
        1  1516 1 1  99 ILE HG12 H  -1.695   2.012 -12.583 1.00 . A A .  99 ILE HG12 1 1 
        1  1517 1 1  99 ILE HG13 H  -1.614   1.493 -10.899 1.00 . A A .  99 ILE HG13 1 1 
        1  1518 1 1  99 ILE HG21 H  -3.557   1.069 -14.058 1.00 . A A .  99 ILE HG21 1 1 
        1  1519 1 1  99 ILE HG22 H  -4.088  -0.570 -13.682 1.00 . A A .  99 ILE HG22 1 1 
        1  1520 1 1  99 ILE HG23 H  -2.389  -0.252 -14.034 1.00 . A A .  99 ILE HG23 1 1 
        1  1521 1 1  99 ILE N    N  -3.961   1.403 -10.040 1.00 . A A .  99 ILE N    1 1 
        1  1522 1 1  99 ILE O    O  -5.764  -0.520 -11.243 1.00 . A A .  99 ILE O    1 1 
        1  1523 1 1 100 GLU C    C  -7.487  -0.669 -13.780 1.00 . A A . 100 GLU C    1 1 
        1  1524 1 1 100 GLU CA   C  -7.664   0.527 -12.845 1.00 . A A . 100 GLU CA   1 1 
        1  1525 1 1 100 GLU CB   C  -8.574   1.559 -13.508 1.00 . A A . 100 GLU CB   1 1 
        1  1526 1 1 100 GLU CD   C -10.889   2.002 -14.334 1.00 . A A . 100 GLU CD   1 1 
        1  1527 1 1 100 GLU CG   C  -9.956   0.946 -13.739 1.00 . A A . 100 GLU CG   1 1 
        1  1528 1 1 100 GLU H    H  -6.103   2.004 -12.966 1.00 . A A . 100 GLU H    1 1 
        1  1529 1 1 100 GLU HA   H  -8.112   0.197 -11.917 1.00 . A A . 100 GLU HA   1 1 
        1  1530 1 1 100 GLU HB2  H  -8.665   2.425 -12.867 1.00 . A A . 100 GLU HB2  1 1 
        1  1531 1 1 100 GLU HB3  H  -8.151   1.856 -14.456 1.00 . A A . 100 GLU HB3  1 1 
        1  1532 1 1 100 GLU HG2  H  -9.871   0.115 -14.426 1.00 . A A . 100 GLU HG2  1 1 
        1  1533 1 1 100 GLU HG3  H -10.358   0.600 -12.800 1.00 . A A . 100 GLU HG3  1 1 
        1  1534 1 1 100 GLU N    N  -6.340   1.144 -12.560 1.00 . A A . 100 GLU N    1 1 
        1  1535 1 1 100 GLU O    O  -6.735  -0.618 -14.731 1.00 . A A . 100 GLU O    1 1 
        1  1536 1 1 100 GLU OE1  O -10.393   3.038 -14.744 1.00 . A A . 100 GLU OE1  1 1 
        1  1537 1 1 100 GLU OE2  O -12.083   1.756 -14.369 1.00 . A A . 100 GLU OE2  1 1 
        1  1538 1 1 101 GLN C    C  -9.425  -3.639 -14.497 1.00 . A A . 101 GLN C    1 1 
        1  1539 1 1 101 GLN CA   C  -8.063  -2.948 -14.402 1.00 . A A . 101 GLN CA   1 1 
        1  1540 1 1 101 GLN CB   C  -7.027  -3.913 -13.821 1.00 . A A . 101 GLN CB   1 1 
        1  1541 1 1 101 GLN CD   C  -4.585  -4.280 -13.438 1.00 . A A . 101 GLN CD   1 1 
        1  1542 1 1 101 GLN CG   C  -5.629  -3.316 -13.996 1.00 . A A . 101 GLN CG   1 1 
        1  1543 1 1 101 GLN H    H  -8.786  -1.763 -12.750 1.00 . A A . 101 GLN H    1 1 
        1  1544 1 1 101 GLN HA   H  -7.751  -2.646 -15.393 1.00 . A A . 101 GLN HA   1 1 
        1  1545 1 1 101 GLN HB2  H  -7.227  -4.064 -12.771 1.00 . A A . 101 GLN HB2  1 1 
        1  1546 1 1 101 GLN HB3  H  -7.081  -4.858 -14.340 1.00 . A A . 101 GLN HB3  1 1 
        1  1547 1 1 101 GLN HE21 H  -3.064  -3.071 -13.838 1.00 . A A . 101 GLN HE21 1 1 
        1  1548 1 1 101 GLN HE22 H  -2.646  -4.546 -13.112 1.00 . A A . 101 GLN HE22 1 1 
        1  1549 1 1 101 GLN HG2  H  -5.440  -3.147 -15.046 1.00 . A A . 101 GLN HG2  1 1 
        1  1550 1 1 101 GLN HG3  H  -5.568  -2.379 -13.465 1.00 . A A . 101 GLN HG3  1 1 
        1  1551 1 1 101 GLN N    N  -8.180  -1.745 -13.521 1.00 . A A . 101 GLN N    1 1 
        1  1552 1 1 101 GLN NE2  N  -3.327  -3.937 -13.464 1.00 . A A . 101 GLN NE2  1 1 
        1  1553 1 1 101 GLN O    O -10.264  -3.496 -13.630 1.00 . A A . 101 GLN O    1 1 
        1  1554 1 1 101 GLN OE1  O  -4.914  -5.356 -12.980 1.00 . A A . 101 GLN OE1  1 1 
        1  1555 1 1 102 GLY C    C -11.170  -6.066 -14.561 1.00 . A A . 102 GLY C    1 1 
        1  1556 1 1 102 GLY CA   C -10.976  -5.056 -15.693 1.00 . A A . 102 GLY CA   1 1 
        1  1557 1 1 102 GLY H    H  -8.975  -4.475 -16.243 1.00 . A A . 102 GLY H    1 1 
        1  1558 1 1 102 GLY HA2  H -11.766  -4.320 -15.655 1.00 . A A . 102 GLY HA2  1 1 
        1  1559 1 1 102 GLY HA3  H -11.014  -5.573 -16.641 1.00 . A A . 102 GLY HA3  1 1 
        1  1560 1 1 102 GLY N    N  -9.660  -4.376 -15.547 1.00 . A A . 102 GLY N    1 1 
        1  1561 1 1 102 GLY O    O -12.240  -6.171 -13.994 1.00 . A A . 102 GLY O    1 1 
        1  1562 1 1 103 GLY C    C  -9.793  -7.233 -11.804 1.00 . A A . 103 GLY C    1 1 
        1  1563 1 1 103 GLY CA   C -10.292  -7.823 -13.126 1.00 . A A . 103 GLY CA   1 1 
        1  1564 1 1 103 GLY H    H  -9.299  -6.720 -14.696 1.00 . A A . 103 GLY H    1 1 
        1  1565 1 1 103 GLY HA2  H -11.331  -8.112 -13.023 1.00 . A A . 103 GLY HA2  1 1 
        1  1566 1 1 103 GLY HA3  H  -9.702  -8.693 -13.365 1.00 . A A . 103 GLY HA3  1 1 
        1  1567 1 1 103 GLY N    N -10.153  -6.815 -14.224 1.00 . A A . 103 GLY N    1 1 
        1  1568 1 1 103 GLY O    O  -8.666  -7.447 -11.407 1.00 . A A . 103 GLY O    1 1 
        1  1569 1 1 104 GLY C    C  -9.267  -4.734 -10.026 1.00 . A A . 104 GLY C    1 1 
        1  1570 1 1 104 GLY CA   C -10.200  -5.927  -9.801 1.00 . A A . 104 GLY CA   1 1 
        1  1571 1 1 104 GLY H    H -11.537  -6.355 -11.440 1.00 . A A . 104 GLY H    1 1 
        1  1572 1 1 104 GLY HA2  H -11.072  -5.599  -9.253 1.00 . A A . 104 GLY HA2  1 1 
        1  1573 1 1 104 GLY HA3  H  -9.680  -6.680  -9.228 1.00 . A A . 104 GLY HA3  1 1 
        1  1574 1 1 104 GLY N    N -10.628  -6.507 -11.109 1.00 . A A . 104 GLY N    1 1 
        1  1575 1 1 104 GLY O    O  -9.164  -4.210 -11.116 1.00 . A A . 104 GLY O    1 1 
        1  1576 1 1 105 THR C    C  -6.248  -3.578  -8.692 1.00 . A A . 105 THR C    1 1 
        1  1577 1 1 105 THR CA   C  -7.654  -3.138  -9.104 1.00 . A A . 105 THR CA   1 1 
        1  1578 1 1 105 THR CB   C  -8.130  -2.016  -8.177 1.00 . A A . 105 THR CB   1 1 
        1  1579 1 1 105 THR CG2  C  -7.224  -0.795  -8.343 1.00 . A A . 105 THR CG2  1 1 
        1  1580 1 1 105 THR H    H  -8.700  -4.748  -8.123 1.00 . A A . 105 THR H    1 1 
        1  1581 1 1 105 THR HA   H  -7.628  -2.774 -10.122 1.00 . A A . 105 THR HA   1 1 
        1  1582 1 1 105 THR HB   H  -8.093  -2.351  -7.151 1.00 . A A . 105 THR HB   1 1 
        1  1583 1 1 105 THR HG1  H  -9.969  -2.478  -8.602 1.00 . A A . 105 THR HG1  1 1 
        1  1584 1 1 105 THR HG21 H  -7.216  -0.492  -9.379 1.00 . A A . 105 THR HG21 1 1 
        1  1585 1 1 105 THR HG22 H  -6.221  -1.047  -8.032 1.00 . A A . 105 THR HG22 1 1 
        1  1586 1 1 105 THR HG23 H  -7.597   0.015  -7.732 1.00 . A A . 105 THR HG23 1 1 
        1  1587 1 1 105 THR N    N  -8.589  -4.303  -8.988 1.00 . A A . 105 THR N    1 1 
        1  1588 1 1 105 THR O    O  -6.059  -4.236  -7.689 1.00 . A A . 105 THR O    1 1 
        1  1589 1 1 105 THR OG1  O  -9.464  -1.666  -8.518 1.00 . A A . 105 THR OG1  1 1 
        1  1590 1 1 106 LEU C    C  -3.203  -2.514  -8.308 1.00 . A A . 106 LEU C    1 1 
        1  1591 1 1 106 LEU CA   C  -3.859  -3.618  -9.136 1.00 . A A . 106 LEU CA   1 1 
        1  1592 1 1 106 LEU CB   C  -3.088  -3.803 -10.445 1.00 . A A . 106 LEU CB   1 1 
        1  1593 1 1 106 LEU CD1  C  -1.516  -5.410  -9.294 1.00 . A A . 106 LEU CD1  1 1 
        1  1594 1 1 106 LEU CD2  C  -0.912  -4.384 -11.504 1.00 . A A . 106 LEU CD2  1 1 
        1  1595 1 1 106 LEU CG   C  -1.618  -4.148 -10.168 1.00 . A A . 106 LEU CG   1 1 
        1  1596 1 1 106 LEU H    H  -5.441  -2.691 -10.271 1.00 . A A . 106 LEU H    1 1 
        1  1597 1 1 106 LEU HA   H  -3.859  -4.544  -8.578 1.00 . A A . 106 LEU HA   1 1 
        1  1598 1 1 106 LEU HB2  H  -3.539  -4.602 -11.015 1.00 . A A . 106 LEU HB2  1 1 
        1  1599 1 1 106 LEU HB3  H  -3.134  -2.888 -11.016 1.00 . A A . 106 LEU HB3  1 1 
        1  1600 1 1 106 LEU HD11 H  -0.552  -5.878  -9.439 1.00 . A A . 106 LEU HD11 1 1 
        1  1601 1 1 106 LEU HD12 H  -2.297  -6.107  -9.565 1.00 . A A . 106 LEU HD12 1 1 
        1  1602 1 1 106 LEU HD13 H  -1.625  -5.137  -8.255 1.00 . A A . 106 LEU HD13 1 1 
        1  1603 1 1 106 LEU HD21 H  -1.143  -3.573 -12.180 1.00 . A A . 106 LEU HD21 1 1 
        1  1604 1 1 106 LEU HD22 H  -1.254  -5.317 -11.932 1.00 . A A . 106 LEU HD22 1 1 
        1  1605 1 1 106 LEU HD23 H   0.155  -4.430 -11.347 1.00 . A A . 106 LEU HD23 1 1 
        1  1606 1 1 106 LEU HG   H  -1.145  -3.323  -9.656 1.00 . A A . 106 LEU HG   1 1 
        1  1607 1 1 106 LEU N    N  -5.261  -3.221  -9.465 1.00 . A A . 106 LEU N    1 1 
        1  1608 1 1 106 LEU O    O  -3.220  -1.361  -8.683 1.00 . A A . 106 LEU O    1 1 
        1  1609 1 1 107 LEU C    C  -0.459  -2.108  -6.273 1.00 . A A . 107 LEU C    1 1 
        1  1610 1 1 107 LEU CA   C  -1.960  -1.832  -6.318 1.00 . A A . 107 LEU CA   1 1 
        1  1611 1 1 107 LEU CB   C  -2.547  -1.914  -4.898 1.00 . A A . 107 LEU CB   1 1 
        1  1612 1 1 107 LEU CD1  C  -3.103  -0.225  -3.097 1.00 . A A . 107 LEU CD1  1 1 
        1  1613 1 1 107 LEU CD2  C  -0.846  -1.274  -3.125 1.00 . A A . 107 LEU CD2  1 1 
        1  1614 1 1 107 LEU CG   C  -1.995  -0.761  -4.009 1.00 . A A . 107 LEU CG   1 1 
        1  1615 1 1 107 LEU H    H  -2.627  -3.799  -6.906 1.00 . A A . 107 LEU H    1 1 
        1  1616 1 1 107 LEU HA   H  -2.128  -0.840  -6.716 1.00 . A A . 107 LEU HA   1 1 
        1  1617 1 1 107 LEU HB2  H  -3.625  -1.842  -4.967 1.00 . A A . 107 LEU HB2  1 1 
        1  1618 1 1 107 LEU HB3  H  -2.286  -2.869  -4.462 1.00 . A A . 107 LEU HB3  1 1 
        1  1619 1 1 107 LEU HD11 H  -3.446  -1.014  -2.444 1.00 . A A . 107 LEU HD11 1 1 
        1  1620 1 1 107 LEU HD12 H  -3.928   0.124  -3.701 1.00 . A A . 107 LEU HD12 1 1 
        1  1621 1 1 107 LEU HD13 H  -2.720   0.594  -2.504 1.00 . A A . 107 LEU HD13 1 1 
        1  1622 1 1 107 LEU HD21 H  -0.032  -1.613  -3.750 1.00 . A A . 107 LEU HD21 1 1 
        1  1623 1 1 107 LEU HD22 H  -1.200  -2.093  -2.517 1.00 . A A . 107 LEU HD22 1 1 
        1  1624 1 1 107 LEU HD23 H  -0.501  -0.475  -2.486 1.00 . A A . 107 LEU HD23 1 1 
        1  1625 1 1 107 LEU HG   H  -1.633   0.047  -4.631 1.00 . A A . 107 LEU HG   1 1 
        1  1626 1 1 107 LEU N    N  -2.626  -2.859  -7.183 1.00 . A A . 107 LEU N    1 1 
        1  1627 1 1 107 LEU O    O  -0.025  -3.186  -5.923 1.00 . A A . 107 LEU O    1 1 
        1  1628 1 1 108 ARG C    C   2.393  -0.566  -5.409 1.00 . A A . 108 ARG C    1 1 
        1  1629 1 1 108 ARG CA   C   1.819  -1.309  -6.611 1.00 . A A . 108 ARG CA   1 1 
        1  1630 1 1 108 ARG CB   C   2.406  -0.723  -7.893 1.00 . A A . 108 ARG CB   1 1 
        1  1631 1 1 108 ARG CD   C   2.414  -0.899 -10.381 1.00 . A A . 108 ARG CD   1 1 
        1  1632 1 1 108 ARG CG   C   1.923  -1.544  -9.087 1.00 . A A . 108 ARG CG   1 1 
        1  1633 1 1 108 ARG CZ   C   4.547  -0.372 -11.398 1.00 . A A . 108 ARG CZ   1 1 
        1  1634 1 1 108 ARG H    H  -0.047  -0.274  -6.904 1.00 . A A . 108 ARG H    1 1 
        1  1635 1 1 108 ARG HA   H   2.073  -2.360  -6.545 1.00 . A A . 108 ARG HA   1 1 
        1  1636 1 1 108 ARG HB2  H   2.080   0.302  -8.000 1.00 . A A . 108 ARG HB2  1 1 
        1  1637 1 1 108 ARG HB3  H   3.484  -0.756  -7.845 1.00 . A A . 108 ARG HB3  1 1 
        1  1638 1 1 108 ARG HD2  H   2.010  -1.437 -11.227 1.00 . A A . 108 ARG HD2  1 1 
        1  1639 1 1 108 ARG HD3  H   2.087   0.130 -10.420 1.00 . A A . 108 ARG HD3  1 1 
        1  1640 1 1 108 ARG HE   H   4.397  -1.415  -9.718 1.00 . A A . 108 ARG HE   1 1 
        1  1641 1 1 108 ARG HG2  H   2.315  -2.548  -9.013 1.00 . A A . 108 ARG HG2  1 1 
        1  1642 1 1 108 ARG HG3  H   0.844  -1.577  -9.088 1.00 . A A . 108 ARG HG3  1 1 
        1  1643 1 1 108 ARG HH11 H   2.889   0.269 -12.322 1.00 . A A . 108 ARG HH11 1 1 
        1  1644 1 1 108 ARG HH12 H   4.385   0.686 -13.092 1.00 . A A . 108 ARG HH12 1 1 
        1  1645 1 1 108 ARG HH21 H   6.355  -0.883 -10.707 1.00 . A A . 108 ARG HH21 1 1 
        1  1646 1 1 108 ARG HH22 H   6.346   0.034 -12.176 1.00 . A A . 108 ARG HH22 1 1 
        1  1647 1 1 108 ARG N    N   0.335  -1.132  -6.627 1.00 . A A . 108 ARG N    1 1 
        1  1648 1 1 108 ARG NE   N   3.902  -0.950 -10.424 1.00 . A A . 108 ARG NE   1 1 
        1  1649 1 1 108 ARG NH1  N   3.889   0.243 -12.345 1.00 . A A . 108 ARG NH1  1 1 
        1  1650 1 1 108 ARG NH2  N   5.850  -0.410 -11.429 1.00 . A A . 108 ARG NH2  1 1 
        1  1651 1 1 108 ARG O    O   2.018   0.556  -5.133 1.00 . A A . 108 ARG O    1 1 
        1  1652 1 1 109 LEU C    C   5.429  -0.580  -3.617 1.00 . A A . 109 LEU C    1 1 
        1  1653 1 1 109 LEU CA   C   3.911  -0.513  -3.501 1.00 . A A . 109 LEU CA   1 1 
        1  1654 1 1 109 LEU CB   C   3.459  -1.238  -2.226 1.00 . A A . 109 LEU CB   1 1 
        1  1655 1 1 109 LEU CD1  C   2.923  -0.519   0.138 1.00 . A A . 109 LEU CD1  1 1 
        1  1656 1 1 109 LEU CD2  C   5.251  -1.194  -0.426 1.00 . A A . 109 LEU CD2  1 1 
        1  1657 1 1 109 LEU CG   C   3.988  -0.500  -0.962 1.00 . A A . 109 LEU CG   1 1 
        1  1658 1 1 109 LEU H    H   3.581  -2.083  -4.942 1.00 . A A . 109 LEU H    1 1 
        1  1659 1 1 109 LEU HA   H   3.606   0.524  -3.451 1.00 . A A . 109 LEU HA   1 1 
        1  1660 1 1 109 LEU HB2  H   2.377  -1.268  -2.210 1.00 . A A . 109 LEU HB2  1 1 
        1  1661 1 1 109 LEU HB3  H   3.839  -2.251  -2.242 1.00 . A A . 109 LEU HB3  1 1 
        1  1662 1 1 109 LEU HD11 H   3.336  -0.103   1.043 1.00 . A A . 109 LEU HD11 1 1 
        1  1663 1 1 109 LEU HD12 H   2.608  -1.536   0.319 1.00 . A A . 109 LEU HD12 1 1 
        1  1664 1 1 109 LEU HD13 H   2.073   0.071  -0.173 1.00 . A A . 109 LEU HD13 1 1 
        1  1665 1 1 109 LEU HD21 H   5.033  -2.233  -0.224 1.00 . A A . 109 LEU HD21 1 1 
        1  1666 1 1 109 LEU HD22 H   5.567  -0.709   0.486 1.00 . A A . 109 LEU HD22 1 1 
        1  1667 1 1 109 LEU HD23 H   6.041  -1.129  -1.159 1.00 . A A . 109 LEU HD23 1 1 
        1  1668 1 1 109 LEU HG   H   4.220   0.528  -1.205 1.00 . A A . 109 LEU HG   1 1 
        1  1669 1 1 109 LEU N    N   3.298  -1.179  -4.693 1.00 . A A . 109 LEU N    1 1 
        1  1670 1 1 109 LEU O    O   5.999  -1.640  -3.779 1.00 . A A . 109 LEU O    1 1 
        1  1671 1 1 110 THR C    C   8.157   1.256  -2.404 1.00 . A A . 110 THR C    1 1 
        1  1672 1 1 110 THR CA   C   7.581   0.570  -3.640 1.00 . A A . 110 THR CA   1 1 
        1  1673 1 1 110 THR CB   C   7.990   1.352  -4.888 1.00 . A A . 110 THR CB   1 1 
        1  1674 1 1 110 THR CG2  C   9.514   1.392  -4.986 1.00 . A A . 110 THR CG2  1 1 
        1  1675 1 1 110 THR H    H   5.597   1.386  -3.408 1.00 . A A . 110 THR H    1 1 
        1  1676 1 1 110 THR HA   H   7.974  -0.439  -3.704 1.00 . A A . 110 THR HA   1 1 
        1  1677 1 1 110 THR HB   H   7.611   2.360  -4.821 1.00 . A A . 110 THR HB   1 1 
        1  1678 1 1 110 THR HG1  H   6.622   0.303  -5.791 1.00 . A A . 110 THR HG1  1 1 
        1  1679 1 1 110 THR HG21 H   9.907   2.038  -4.214 1.00 . A A . 110 THR HG21 1 1 
        1  1680 1 1 110 THR HG22 H   9.804   1.771  -5.954 1.00 . A A . 110 THR HG22 1 1 
        1  1681 1 1 110 THR HG23 H   9.909   0.395  -4.854 1.00 . A A . 110 THR HG23 1 1 
        1  1682 1 1 110 THR N    N   6.088   0.546  -3.537 1.00 . A A . 110 THR N    1 1 
        1  1683 1 1 110 THR O    O   7.755   2.346  -2.049 1.00 . A A . 110 THR O    1 1 
        1  1684 1 1 110 THR OG1  O   7.451   0.717  -6.040 1.00 . A A . 110 THR OG1  1 1 
        1  1685 1 1 111 HIS C    C  11.240   1.266  -0.717 1.00 . A A . 111 HIS C    1 1 
        1  1686 1 1 111 HIS CA   C   9.721   1.236  -0.527 1.00 . A A . 111 HIS CA   1 1 
        1  1687 1 1 111 HIS CB   C   9.374   0.384   0.694 1.00 . A A . 111 HIS CB   1 1 
        1  1688 1 1 111 HIS CD2  C  11.101   1.278   2.453 1.00 . A A . 111 HIS CD2  1 1 
        1  1689 1 1 111 HIS CE1  C   9.706   2.234   3.808 1.00 . A A . 111 HIS CE1  1 1 
        1  1690 1 1 111 HIS CG   C   9.845   1.081   1.936 1.00 . A A . 111 HIS CG   1 1 
        1  1691 1 1 111 HIS H    H   9.403  -0.250  -2.059 1.00 . A A . 111 HIS H    1 1 
        1  1692 1 1 111 HIS HA   H   9.357   2.245  -0.378 1.00 . A A . 111 HIS HA   1 1 
        1  1693 1 1 111 HIS HB2  H   8.304   0.243   0.744 1.00 . A A . 111 HIS HB2  1 1 
        1  1694 1 1 111 HIS HB3  H   9.860  -0.577   0.614 1.00 . A A . 111 HIS HB3  1 1 
        1  1695 1 1 111 HIS HD1  H   7.996   1.737   2.732 1.00 . A A . 111 HIS HD1  1 1 
        1  1696 1 1 111 HIS HD2  H  12.019   0.926   2.006 1.00 . A A . 111 HIS HD2  1 1 
        1  1697 1 1 111 HIS HE1  H   9.292   2.780   4.642 1.00 . A A . 111 HIS HE1  1 1 
        1  1698 1 1 111 HIS N    N   9.098   0.628  -1.746 1.00 . A A . 111 HIS N    1 1 
        1  1699 1 1 111 HIS ND1  N   8.971   1.698   2.816 1.00 . A A . 111 HIS ND1  1 1 
        1  1700 1 1 111 HIS NE2  N  11.011   2.007   3.635 1.00 . A A . 111 HIS NE2  1 1 
        1  1701 1 1 111 HIS O    O  11.902   0.249  -0.670 1.00 . A A . 111 HIS O    1 1 
        1  1702 1 1 112 SER C    C  13.984   2.795   0.162 1.00 . A A . 112 SER C    1 1 
        1  1703 1 1 112 SER CA   C  13.270   2.534  -1.167 1.00 . A A . 112 SER CA   1 1 
        1  1704 1 1 112 SER CB   C  13.547   3.702  -2.111 1.00 . A A . 112 SER CB   1 1 
        1  1705 1 1 112 SER H    H  11.235   3.231  -0.999 1.00 . A A . 112 SER H    1 1 
        1  1706 1 1 112 SER HA   H  13.644   1.619  -1.609 1.00 . A A . 112 SER HA   1 1 
        1  1707 1 1 112 SER HB2  H  14.489   3.550  -2.613 1.00 . A A . 112 SER HB2  1 1 
        1  1708 1 1 112 SER HB3  H  12.755   3.766  -2.843 1.00 . A A . 112 SER HB3  1 1 
        1  1709 1 1 112 SER HG   H  14.420   4.888  -0.839 1.00 . A A . 112 SER HG   1 1 
        1  1710 1 1 112 SER N    N  11.793   2.426  -0.953 1.00 . A A . 112 SER N    1 1 
        1  1711 1 1 112 SER O    O  13.364   3.114   1.155 1.00 . A A . 112 SER O    1 1 
        1  1712 1 1 112 SER OG   O  13.608   4.902  -1.354 1.00 . A A . 112 SER OG   1 1 
        1  1713 1 1 113 GLY C    C  16.557   1.619   2.026 1.00 . A A . 113 GLY C    1 1 
        1  1714 1 1 113 GLY CA   C  16.071   2.941   1.430 1.00 . A A . 113 GLY CA   1 1 
        1  1715 1 1 113 GLY H    H  15.765   2.437  -0.645 1.00 . A A . 113 GLY H    1 1 
        1  1716 1 1 113 GLY HA2  H  16.927   3.557   1.192 1.00 . A A . 113 GLY HA2  1 1 
        1  1717 1 1 113 GLY HA3  H  15.453   3.453   2.153 1.00 . A A . 113 GLY HA3  1 1 
        1  1718 1 1 113 GLY N    N  15.292   2.682   0.176 1.00 . A A . 113 GLY N    1 1 
        1  1719 1 1 113 GLY O    O  17.369   0.924   1.447 1.00 . A A . 113 GLY O    1 1 
        1  1720 1 1 114 LEU C    C  18.019   0.003   4.021 1.00 . A A . 114 LEU C    1 1 
        1  1721 1 1 114 LEU CA   C  16.498  -0.004   3.828 1.00 . A A . 114 LEU CA   1 1 
        1  1722 1 1 114 LEU CB   C  16.099  -1.194   2.948 1.00 . A A . 114 LEU CB   1 1 
        1  1723 1 1 114 LEU CD1  C  14.241  -2.223   1.626 1.00 . A A . 114 LEU CD1  1 1 
        1  1724 1 1 114 LEU CD2  C  13.719  -0.794   3.609 1.00 . A A . 114 LEU CD2  1 1 
        1  1725 1 1 114 LEU CG   C  14.674  -0.992   2.427 1.00 . A A . 114 LEU CG   1 1 
        1  1726 1 1 114 LEU H    H  15.416   1.847   3.627 1.00 . A A . 114 LEU H    1 1 
        1  1727 1 1 114 LEU HA   H  16.014  -0.101   4.787 1.00 . A A . 114 LEU HA   1 1 
        1  1728 1 1 114 LEU HB2  H  16.783  -1.275   2.115 1.00 . A A . 114 LEU HB2  1 1 
        1  1729 1 1 114 LEU HB3  H  16.138  -2.100   3.534 1.00 . A A . 114 LEU HB3  1 1 
        1  1730 1 1 114 LEU HD11 H  15.013  -2.482   0.917 1.00 . A A . 114 LEU HD11 1 1 
        1  1731 1 1 114 LEU HD12 H  13.325  -2.005   1.098 1.00 . A A . 114 LEU HD12 1 1 
        1  1732 1 1 114 LEU HD13 H  14.078  -3.050   2.300 1.00 . A A . 114 LEU HD13 1 1 
        1  1733 1 1 114 LEU HD21 H  13.838   0.204   4.003 1.00 . A A . 114 LEU HD21 1 1 
        1  1734 1 1 114 LEU HD22 H  13.944  -1.516   4.380 1.00 . A A . 114 LEU HD22 1 1 
        1  1735 1 1 114 LEU HD23 H  12.700  -0.929   3.276 1.00 . A A . 114 LEU HD23 1 1 
        1  1736 1 1 114 LEU HG   H  14.642  -0.123   1.787 1.00 . A A . 114 LEU HG   1 1 
        1  1737 1 1 114 LEU N    N  16.067   1.269   3.182 1.00 . A A . 114 LEU N    1 1 
        1  1738 1 1 114 LEU O    O  18.735  -0.720   3.357 1.00 . A A . 114 LEU O    1 1 
        1  1739 1 1 115 PRO C    C  20.463  -0.319   5.997 1.00 . A A . 115 PRO C    1 1 
        1  1740 1 1 115 PRO CA   C  19.967   0.902   5.213 1.00 . A A . 115 PRO CA   1 1 
        1  1741 1 1 115 PRO CB   C  20.107   2.193   6.036 1.00 . A A . 115 PRO CB   1 1 
        1  1742 1 1 115 PRO CD   C  17.725   1.728   5.780 1.00 . A A . 115 PRO CD   1 1 
        1  1743 1 1 115 PRO CG   C  18.771   2.395   6.687 1.00 . A A . 115 PRO CG   1 1 
        1  1744 1 1 115 PRO HA   H  20.520   0.998   4.293 1.00 . A A . 115 PRO HA   1 1 
        1  1745 1 1 115 PRO HB2  H  20.886   2.086   6.785 1.00 . A A . 115 PRO HB2  1 1 
        1  1746 1 1 115 PRO HB3  H  20.331   3.028   5.387 1.00 . A A . 115 PRO HB3  1 1 
        1  1747 1 1 115 PRO HD2  H  17.011   1.179   6.377 1.00 . A A . 115 PRO HD2  1 1 
        1  1748 1 1 115 PRO HD3  H  17.222   2.463   5.169 1.00 . A A . 115 PRO HD3  1 1 
        1  1749 1 1 115 PRO HG2  H  18.765   1.934   7.668 1.00 . A A . 115 PRO HG2  1 1 
        1  1750 1 1 115 PRO HG3  H  18.554   3.451   6.778 1.00 . A A . 115 PRO HG3  1 1 
        1  1751 1 1 115 PRO N    N  18.508   0.811   4.928 1.00 . A A . 115 PRO N    1 1 
        1  1752 1 1 115 PRO O    O  21.648  -0.510   6.178 1.00 . A A . 115 PRO O    1 1 
        1  1753 1 1 116 SER C    C  19.127  -3.562   6.801 1.00 . A A . 116 SER C    1 1 
        1  1754 1 1 116 SER CA   C  19.965  -2.359   7.240 1.00 . A A . 116 SER CA   1 1 
        1  1755 1 1 116 SER CB   C  19.735  -2.102   8.729 1.00 . A A . 116 SER CB   1 1 
        1  1756 1 1 116 SER H    H  18.608  -0.966   6.305 1.00 . A A . 116 SER H    1 1 
        1  1757 1 1 116 SER HA   H  21.012  -2.577   7.073 1.00 . A A . 116 SER HA   1 1 
        1  1758 1 1 116 SER HB2  H  19.861  -3.020   9.278 1.00 . A A . 116 SER HB2  1 1 
        1  1759 1 1 116 SER HB3  H  20.453  -1.373   9.082 1.00 . A A . 116 SER HB3  1 1 
        1  1760 1 1 116 SER HG   H  18.103  -1.930   9.775 1.00 . A A . 116 SER HG   1 1 
        1  1761 1 1 116 SER N    N  19.558  -1.145   6.464 1.00 . A A . 116 SER N    1 1 
        1  1762 1 1 116 SER O    O  18.005  -3.427   6.355 1.00 . A A . 116 SER O    1 1 
        1  1763 1 1 116 SER OG   O  18.412  -1.619   8.922 1.00 . A A . 116 SER OG   1 1 
        1  1764 1 1 117 ALA C    C  17.727  -6.176   7.453 1.00 . A A . 117 ALA C    1 1 
        1  1765 1 1 117 ALA CA   C  18.931  -5.970   6.529 1.00 . A A . 117 ALA CA   1 1 
        1  1766 1 1 117 ALA CB   C  19.869  -7.172   6.632 1.00 . A A . 117 ALA CB   1 1 
        1  1767 1 1 117 ALA H    H  20.576  -4.818   7.295 1.00 . A A . 117 ALA H    1 1 
        1  1768 1 1 117 ALA HA   H  18.588  -5.867   5.510 1.00 . A A . 117 ALA HA   1 1 
        1  1769 1 1 117 ALA HB1  H  20.615  -7.110   5.856 1.00 . A A . 117 ALA HB1  1 1 
        1  1770 1 1 117 ALA HB2  H  19.302  -8.083   6.517 1.00 . A A . 117 ALA HB2  1 1 
        1  1771 1 1 117 ALA HB3  H  20.353  -7.167   7.598 1.00 . A A . 117 ALA HB3  1 1 
        1  1772 1 1 117 ALA N    N  19.671  -4.740   6.929 1.00 . A A . 117 ALA N    1 1 
        1  1773 1 1 117 ALA O    O  16.681  -6.627   7.031 1.00 . A A . 117 ALA O    1 1 
        1  1774 1 1 118 GLU C    C  15.524  -5.257   9.131 1.00 . A A . 118 GLU C    1 1 
        1  1775 1 1 118 GLU CA   C  16.730  -6.035   9.653 1.00 . A A . 118 GLU CA   1 1 
        1  1776 1 1 118 GLU CB   C  17.122  -5.495  11.031 1.00 . A A . 118 GLU CB   1 1 
        1  1777 1 1 118 GLU CD   C  17.755  -7.758  11.897 1.00 . A A . 118 GLU CD   1 1 
        1  1778 1 1 118 GLU CG   C  18.257  -6.340  11.619 1.00 . A A . 118 GLU CG   1 1 
        1  1779 1 1 118 GLU H    H  18.719  -5.492   9.031 1.00 . A A . 118 GLU H    1 1 
        1  1780 1 1 118 GLU HA   H  16.482  -7.084   9.726 1.00 . A A . 118 GLU HA   1 1 
        1  1781 1 1 118 GLU HB2  H  17.450  -4.471  10.933 1.00 . A A . 118 GLU HB2  1 1 
        1  1782 1 1 118 GLU HB3  H  16.268  -5.537  11.690 1.00 . A A . 118 GLU HB3  1 1 
        1  1783 1 1 118 GLU HG2  H  19.077  -6.379  10.916 1.00 . A A . 118 GLU HG2  1 1 
        1  1784 1 1 118 GLU HG3  H  18.597  -5.893  12.542 1.00 . A A . 118 GLU HG3  1 1 
        1  1785 1 1 118 GLU N    N  17.868  -5.853   8.709 1.00 . A A . 118 GLU N    1 1 
        1  1786 1 1 118 GLU O    O  14.413  -5.749   9.115 1.00 . A A . 118 GLU O    1 1 
        1  1787 1 1 118 GLU OE1  O  16.739  -7.886  12.560 1.00 . A A . 118 GLU OE1  1 1 
        1  1788 1 1 118 GLU OE2  O  18.395  -8.692  11.445 1.00 . A A . 118 GLU OE2  1 1 
        1  1789 1 1 119 GLN C    C  14.084  -3.885   6.881 1.00 . A A . 119 GLN C    1 1 
        1  1790 1 1 119 GLN CA   C  14.610  -3.237   8.165 1.00 . A A . 119 GLN CA   1 1 
        1  1791 1 1 119 GLN CB   C  15.102  -1.820   7.867 1.00 . A A . 119 GLN CB   1 1 
        1  1792 1 1 119 GLN CD   C  15.955   0.294   8.885 1.00 . A A . 119 GLN CD   1 1 
        1  1793 1 1 119 GLN CG   C  15.432  -1.111   9.183 1.00 . A A . 119 GLN CG   1 1 
        1  1794 1 1 119 GLN H    H  16.643  -3.674   8.712 1.00 . A A . 119 GLN H    1 1 
        1  1795 1 1 119 GLN HA   H  13.817  -3.198   8.898 1.00 . A A . 119 GLN HA   1 1 
        1  1796 1 1 119 GLN HB2  H  15.989  -1.870   7.252 1.00 . A A . 119 GLN HB2  1 1 
        1  1797 1 1 119 GLN HB3  H  14.333  -1.271   7.347 1.00 . A A . 119 GLN HB3  1 1 
        1  1798 1 1 119 GLN HE21 H  17.546   0.106  10.059 1.00 . A A . 119 GLN HE21 1 1 
        1  1799 1 1 119 GLN HE22 H  17.402   1.599   9.264 1.00 . A A . 119 GLN HE22 1 1 
        1  1800 1 1 119 GLN HG2  H  14.540  -1.044   9.789 1.00 . A A . 119 GLN HG2  1 1 
        1  1801 1 1 119 GLN HG3  H  16.188  -1.670   9.715 1.00 . A A . 119 GLN HG3  1 1 
        1  1802 1 1 119 GLN N    N  15.737  -4.048   8.696 1.00 . A A . 119 GLN N    1 1 
        1  1803 1 1 119 GLN NE2  N  17.059   0.700   9.450 1.00 . A A . 119 GLN NE2  1 1 
        1  1804 1 1 119 GLN O    O  12.896  -3.899   6.624 1.00 . A A . 119 GLN O    1 1 
        1  1805 1 1 119 GLN OE1  O  15.354   1.030   8.127 1.00 . A A . 119 GLN OE1  1 1 
        1  1806 1 1 120 CYS C    C  13.640  -6.291   5.144 1.00 . A A . 120 CYS C    1 1 
        1  1807 1 1 120 CYS CA   C  14.507  -5.073   4.810 1.00 . A A . 120 CYS CA   1 1 
        1  1808 1 1 120 CYS CB   C  15.742  -5.504   4.002 1.00 . A A . 120 CYS CB   1 1 
        1  1809 1 1 120 CYS H    H  15.910  -4.403   6.301 1.00 . A A . 120 CYS H    1 1 
        1  1810 1 1 120 CYS HA   H  13.927  -4.369   4.234 1.00 . A A . 120 CYS HA   1 1 
        1  1811 1 1 120 CYS HB2  H  16.568  -4.850   4.242 1.00 . A A . 120 CYS HB2  1 1 
        1  1812 1 1 120 CYS HB3  H  16.013  -6.523   4.250 1.00 . A A . 120 CYS HB3  1 1 
        1  1813 1 1 120 CYS HG   H  14.463  -5.157   2.128 1.00 . A A . 120 CYS HG   1 1 
        1  1814 1 1 120 CYS N    N  14.958  -4.423   6.074 1.00 . A A . 120 CYS N    1 1 
        1  1815 1 1 120 CYS O    O  12.541  -6.441   4.648 1.00 . A A . 120 CYS O    1 1 
        1  1816 1 1 120 CYS SG   S  15.389  -5.387   2.230 1.00 . A A . 120 CYS SG   1 1 
        1  1817 1 1 121 ALA C    C  12.100  -7.944   7.139 1.00 . A A . 121 ALA C    1 1 
        1  1818 1 1 121 ALA CA   C  13.344  -8.365   6.356 1.00 . A A . 121 ALA CA   1 1 
        1  1819 1 1 121 ALA CB   C  14.212  -9.274   7.225 1.00 . A A . 121 ALA CB   1 1 
        1  1820 1 1 121 ALA H    H  15.017  -7.015   6.373 1.00 . A A . 121 ALA H    1 1 
        1  1821 1 1 121 ALA HA   H  13.047  -8.893   5.462 1.00 . A A . 121 ALA HA   1 1 
        1  1822 1 1 121 ALA HB1  H  15.152  -9.454   6.726 1.00 . A A . 121 ALA HB1  1 1 
        1  1823 1 1 121 ALA HB2  H  13.704 -10.212   7.386 1.00 . A A . 121 ALA HB2  1 1 
        1  1824 1 1 121 ALA HB3  H  14.396  -8.793   8.174 1.00 . A A . 121 ALA HB3  1 1 
        1  1825 1 1 121 ALA N    N  14.130  -7.158   5.984 1.00 . A A . 121 ALA N    1 1 
        1  1826 1 1 121 ALA O    O  11.027  -8.485   6.957 1.00 . A A . 121 ALA O    1 1 
        1  1827 1 1 122 GLY C    C  10.053  -5.831   7.896 1.00 . A A . 122 GLY C    1 1 
        1  1828 1 1 122 GLY CA   C  11.059  -6.533   8.810 1.00 . A A . 122 GLY CA   1 1 
        1  1829 1 1 122 GLY H    H  13.109  -6.560   8.146 1.00 . A A . 122 GLY H    1 1 
        1  1830 1 1 122 GLY HA2  H  10.589  -7.390   9.271 1.00 . A A . 122 GLY HA2  1 1 
        1  1831 1 1 122 GLY HA3  H  11.386  -5.847   9.576 1.00 . A A . 122 GLY HA3  1 1 
        1  1832 1 1 122 GLY N    N  12.235  -6.984   8.013 1.00 . A A . 122 GLY N    1 1 
        1  1833 1 1 122 GLY O    O   8.861  -6.042   7.993 1.00 . A A . 122 GLY O    1 1 
        1  1834 1 1 123 HIS C    C   8.937  -5.279   5.139 1.00 . A A . 123 HIS C    1 1 
        1  1835 1 1 123 HIS CA   C   9.595  -4.278   6.091 1.00 . A A . 123 HIS CA   1 1 
        1  1836 1 1 123 HIS CB   C  10.384  -3.249   5.280 1.00 . A A . 123 HIS CB   1 1 
        1  1837 1 1 123 HIS CD2  C  10.714  -0.727   5.939 1.00 . A A . 123 HIS CD2  1 1 
        1  1838 1 1 123 HIS CE1  C  11.458  -1.017   7.953 1.00 . A A . 123 HIS CE1  1 1 
        1  1839 1 1 123 HIS CG   C  10.748  -2.081   6.159 1.00 . A A . 123 HIS CG   1 1 
        1  1840 1 1 123 HIS H    H  11.489  -4.838   6.950 1.00 . A A . 123 HIS H    1 1 
        1  1841 1 1 123 HIS HA   H   8.832  -3.776   6.670 1.00 . A A . 123 HIS HA   1 1 
        1  1842 1 1 123 HIS HB2  H  11.286  -3.706   4.901 1.00 . A A . 123 HIS HB2  1 1 
        1  1843 1 1 123 HIS HB3  H   9.781  -2.902   4.455 1.00 . A A . 123 HIS HB3  1 1 
        1  1844 1 1 123 HIS HD1  H  11.369  -3.095   7.913 1.00 . A A . 123 HIS HD1  1 1 
        1  1845 1 1 123 HIS HD2  H  10.388  -0.254   5.025 1.00 . A A . 123 HIS HD2  1 1 
        1  1846 1 1 123 HIS HE1  H  11.839  -0.831   8.947 1.00 . A A . 123 HIS HE1  1 1 
        1  1847 1 1 123 HIS N    N  10.524  -4.996   7.010 1.00 . A A . 123 HIS N    1 1 
        1  1848 1 1 123 HIS ND1  N  11.226  -2.244   7.450 1.00 . A A . 123 HIS ND1  1 1 
        1  1849 1 1 123 HIS NE2  N  11.162  -0.057   7.073 1.00 . A A . 123 HIS NE2  1 1 
        1  1850 1 1 123 HIS O    O   7.749  -5.225   4.892 1.00 . A A . 123 HIS O    1 1 
        1  1851 1 1 124 GLU C    C   7.979  -7.942   4.372 1.00 . A A . 124 GLU C    1 1 
        1  1852 1 1 124 GLU CA   C   9.106  -7.192   3.665 1.00 . A A . 124 GLU CA   1 1 
        1  1853 1 1 124 GLU CB   C  10.189  -8.185   3.240 1.00 . A A . 124 GLU CB   1 1 
        1  1854 1 1 124 GLU CD   C  10.715 -10.124   1.759 1.00 . A A . 124 GLU CD   1 1 
        1  1855 1 1 124 GLU CG   C   9.620  -9.153   2.201 1.00 . A A . 124 GLU CG   1 1 
        1  1856 1 1 124 GLU H    H  10.653  -6.228   4.815 1.00 . A A . 124 GLU H    1 1 
        1  1857 1 1 124 GLU HA   H   8.716  -6.686   2.795 1.00 . A A . 124 GLU HA   1 1 
        1  1858 1 1 124 GLU HB2  H  11.023  -7.648   2.813 1.00 . A A . 124 GLU HB2  1 1 
        1  1859 1 1 124 GLU HB3  H  10.524  -8.743   4.101 1.00 . A A . 124 GLU HB3  1 1 
        1  1860 1 1 124 GLU HG2  H   8.800  -9.708   2.633 1.00 . A A . 124 GLU HG2  1 1 
        1  1861 1 1 124 GLU HG3  H   9.269  -8.597   1.344 1.00 . A A . 124 GLU HG3  1 1 
        1  1862 1 1 124 GLU N    N   9.697  -6.196   4.603 1.00 . A A . 124 GLU N    1 1 
        1  1863 1 1 124 GLU O    O   6.894  -8.093   3.850 1.00 . A A . 124 GLU O    1 1 
        1  1864 1 1 124 GLU OE1  O  11.739 -10.170   2.421 1.00 . A A . 124 GLU OE1  1 1 
        1  1865 1 1 124 GLU OE2  O  10.512 -10.806   0.768 1.00 . A A . 124 GLU OE2  1 1 
        1  1866 1 1 125 GLU C    C   6.093  -8.160   6.754 1.00 . A A . 125 GLU C    1 1 
        1  1867 1 1 125 GLU CA   C   7.181  -9.143   6.314 1.00 . A A . 125 GLU CA   1 1 
        1  1868 1 1 125 GLU CB   C   7.820  -9.787   7.547 1.00 . A A . 125 GLU CB   1 1 
        1  1869 1 1 125 GLU CD   C   6.553 -11.934   7.379 1.00 . A A . 125 GLU CD   1 1 
        1  1870 1 1 125 GLU CG   C   6.808 -10.699   8.245 1.00 . A A . 125 GLU CG   1 1 
        1  1871 1 1 125 GLU H    H   9.112  -8.267   5.964 1.00 . A A . 125 GLU H    1 1 
        1  1872 1 1 125 GLU HA   H   6.748  -9.907   5.686 1.00 . A A . 125 GLU HA   1 1 
        1  1873 1 1 125 GLU HB2  H   8.676 -10.370   7.240 1.00 . A A . 125 GLU HB2  1 1 
        1  1874 1 1 125 GLU HB3  H   8.137  -9.015   8.231 1.00 . A A . 125 GLU HB3  1 1 
        1  1875 1 1 125 GLU HG2  H   7.206 -11.007   9.202 1.00 . A A . 125 GLU HG2  1 1 
        1  1876 1 1 125 GLU HG3  H   5.882 -10.167   8.394 1.00 . A A . 125 GLU HG3  1 1 
        1  1877 1 1 125 GLU N    N   8.231  -8.408   5.561 1.00 . A A . 125 GLU N    1 1 
        1  1878 1 1 125 GLU O    O   4.921  -8.482   6.772 1.00 . A A . 125 GLU O    1 1 
        1  1879 1 1 125 GLU OE1  O   7.252 -12.099   6.393 1.00 . A A . 125 GLU OE1  1 1 
        1  1880 1 1 125 GLU OE2  O   5.662 -12.696   7.718 1.00 . A A . 125 GLU OE2  1 1 
        1  1881 1 1 126 GLY C    C   4.540  -5.574   6.424 1.00 . A A . 126 GLY C    1 1 
        1  1882 1 1 126 GLY CA   C   5.469  -5.965   7.578 1.00 . A A . 126 GLY CA   1 1 
        1  1883 1 1 126 GLY H    H   7.426  -6.731   7.107 1.00 . A A . 126 GLY H    1 1 
        1  1884 1 1 126 GLY HA2  H   4.882  -6.390   8.379 1.00 . A A . 126 GLY HA2  1 1 
        1  1885 1 1 126 GLY HA3  H   5.979  -5.085   7.937 1.00 . A A . 126 GLY HA3  1 1 
        1  1886 1 1 126 GLY N    N   6.475  -6.966   7.122 1.00 . A A . 126 GLY N    1 1 
        1  1887 1 1 126 GLY O    O   3.335  -5.545   6.574 1.00 . A A . 126 GLY O    1 1 
        1  1888 1 1 127 TRP C    C   3.333  -6.034   3.704 1.00 . A A . 127 TRP C    1 1 
        1  1889 1 1 127 TRP CA   C   4.222  -4.862   4.130 1.00 . A A . 127 TRP CA   1 1 
        1  1890 1 1 127 TRP CB   C   5.099  -4.432   2.950 1.00 . A A . 127 TRP CB   1 1 
        1  1891 1 1 127 TRP CD1  C   7.018  -2.830   3.339 1.00 . A A . 127 TRP CD1  1 1 
        1  1892 1 1 127 TRP CD2  C   5.016  -1.808   3.413 1.00 . A A . 127 TRP CD2  1 1 
        1  1893 1 1 127 TRP CE2  C   5.992  -0.808   3.641 1.00 . A A . 127 TRP CE2  1 1 
        1  1894 1 1 127 TRP CE3  C   3.663  -1.422   3.410 1.00 . A A . 127 TRP CE3  1 1 
        1  1895 1 1 127 TRP CG   C   5.695  -3.085   3.221 1.00 . A A . 127 TRP CG   1 1 
        1  1896 1 1 127 TRP CH2  C   4.290   0.889   3.853 1.00 . A A . 127 TRP CH2  1 1 
        1  1897 1 1 127 TRP CZ2  C   5.639   0.524   3.859 1.00 . A A . 127 TRP CZ2  1 1 
        1  1898 1 1 127 TRP CZ3  C   3.304  -0.082   3.630 1.00 . A A . 127 TRP CZ3  1 1 
        1  1899 1 1 127 TRP H    H   6.059  -5.282   5.177 1.00 . A A . 127 TRP H    1 1 
        1  1900 1 1 127 TRP HA   H   3.597  -4.035   4.431 1.00 . A A . 127 TRP HA   1 1 
        1  1901 1 1 127 TRP HB2  H   5.891  -5.153   2.814 1.00 . A A . 127 TRP HB2  1 1 
        1  1902 1 1 127 TRP HB3  H   4.499  -4.385   2.053 1.00 . A A . 127 TRP HB3  1 1 
        1  1903 1 1 127 TRP HD1  H   7.809  -3.560   3.248 1.00 . A A . 127 TRP HD1  1 1 
        1  1904 1 1 127 TRP HE1  H   8.061  -1.038   3.709 1.00 . A A . 127 TRP HE1  1 1 
        1  1905 1 1 127 TRP HE3  H   2.894  -2.160   3.237 1.00 . A A . 127 TRP HE3  1 1 
        1  1906 1 1 127 TRP HH2  H   4.007   1.918   4.019 1.00 . A A . 127 TRP HH2  1 1 
        1  1907 1 1 127 TRP HZ2  H   6.403   1.269   4.029 1.00 . A A . 127 TRP HZ2  1 1 
        1  1908 1 1 127 TRP HZ3  H   2.262   0.202   3.624 1.00 . A A . 127 TRP HZ3  1 1 
        1  1909 1 1 127 TRP N    N   5.085  -5.263   5.279 1.00 . A A . 127 TRP N    1 1 
        1  1910 1 1 127 TRP NE1  N   7.196  -1.481   3.585 1.00 . A A . 127 TRP NE1  1 1 
        1  1911 1 1 127 TRP O    O   2.186  -5.854   3.347 1.00 . A A . 127 TRP O    1 1 
        1  1912 1 1 128 ALA C    C   1.787  -8.509   4.192 1.00 . A A . 128 ALA C    1 1 
        1  1913 1 1 128 ALA CA   C   3.032  -8.404   3.310 1.00 . A A . 128 ALA CA   1 1 
        1  1914 1 1 128 ALA CB   C   3.868  -9.675   3.458 1.00 . A A . 128 ALA CB   1 1 
        1  1915 1 1 128 ALA H    H   4.779  -7.358   4.013 1.00 . A A . 128 ALA H    1 1 
        1  1916 1 1 128 ALA HA   H   2.734  -8.288   2.279 1.00 . A A . 128 ALA HA   1 1 
        1  1917 1 1 128 ALA HB1  H   4.838  -9.520   3.010 1.00 . A A . 128 ALA HB1  1 1 
        1  1918 1 1 128 ALA HB2  H   3.369 -10.495   2.962 1.00 . A A . 128 ALA HB2  1 1 
        1  1919 1 1 128 ALA HB3  H   3.989  -9.905   4.506 1.00 . A A . 128 ALA HB3  1 1 
        1  1920 1 1 128 ALA N    N   3.852  -7.230   3.727 1.00 . A A . 128 ALA N    1 1 
        1  1921 1 1 128 ALA O    O   0.683  -8.658   3.708 1.00 . A A . 128 ALA O    1 1 
        1  1922 1 1 129 HIS C    C  -0.111  -7.298   6.198 1.00 . A A . 129 HIS C    1 1 
        1  1923 1 1 129 HIS CA   C   0.783  -8.525   6.393 1.00 . A A . 129 HIS CA   1 1 
        1  1924 1 1 129 HIS CB   C   1.275  -8.579   7.841 1.00 . A A . 129 HIS CB   1 1 
        1  1925 1 1 129 HIS CD2  C   1.527 -11.200   7.787 1.00 . A A . 129 HIS CD2  1 1 
        1  1926 1 1 129 HIS CE1  C   3.390 -11.354   8.881 1.00 . A A . 129 HIS CE1  1 1 
        1  1927 1 1 129 HIS CG   C   1.907  -9.918   8.108 1.00 . A A . 129 HIS CG   1 1 
        1  1928 1 1 129 HIS H    H   2.854  -8.309   5.852 1.00 . A A . 129 HIS H    1 1 
        1  1929 1 1 129 HIS HA   H   0.221  -9.420   6.169 1.00 . A A . 129 HIS HA   1 1 
        1  1930 1 1 129 HIS HB2  H   2.005  -7.798   8.000 1.00 . A A . 129 HIS HB2  1 1 
        1  1931 1 1 129 HIS HB3  H   0.441  -8.434   8.512 1.00 . A A . 129 HIS HB3  1 1 
        1  1932 1 1 129 HIS HD1  H   3.632  -9.309   9.175 1.00 . A A . 129 HIS HD1  1 1 
        1  1933 1 1 129 HIS HD2  H   0.635 -11.466   7.238 1.00 . A A . 129 HIS HD2  1 1 
        1  1934 1 1 129 HIS HE1  H   4.265 -11.751   9.374 1.00 . A A . 129 HIS HE1  1 1 
        1  1935 1 1 129 HIS N    N   1.956  -8.432   5.482 1.00 . A A . 129 HIS N    1 1 
        1  1936 1 1 129 HIS ND1  N   3.098 -10.043   8.806 1.00 . A A . 129 HIS ND1  1 1 
        1  1937 1 1 129 HIS NE2  N   2.465 -12.103   8.276 1.00 . A A . 129 HIS NE2  1 1 
        1  1938 1 1 129 HIS O    O  -1.321  -7.399   6.152 1.00 . A A . 129 HIS O    1 1 
        1  1939 1 1 130 TYR C    C  -1.126  -5.029   4.577 1.00 . A A . 130 TYR C    1 1 
        1  1940 1 1 130 TYR CA   C  -0.330  -4.906   5.875 1.00 . A A . 130 TYR CA   1 1 
        1  1941 1 1 130 TYR CB   C   0.619  -3.712   5.774 1.00 . A A . 130 TYR CB   1 1 
        1  1942 1 1 130 TYR CD1  C  -0.864  -1.804   6.491 1.00 . A A . 130 TYR CD1  1 1 
        1  1943 1 1 130 TYR CD2  C  -0.179  -1.940   4.168 1.00 . A A . 130 TYR CD2  1 1 
        1  1944 1 1 130 TYR CE1  C  -1.579  -0.633   6.209 1.00 . A A . 130 TYR CE1  1 1 
        1  1945 1 1 130 TYR CE2  C  -0.895  -0.772   3.887 1.00 . A A . 130 TYR CE2  1 1 
        1  1946 1 1 130 TYR CG   C  -0.163  -2.457   5.470 1.00 . A A . 130 TYR CG   1 1 
        1  1947 1 1 130 TYR CZ   C  -1.595  -0.118   4.908 1.00 . A A . 130 TYR CZ   1 1 
        1  1948 1 1 130 TYR H    H   1.456  -6.084   6.110 1.00 . A A . 130 TYR H    1 1 
        1  1949 1 1 130 TYR HA   H  -1.002  -4.766   6.707 1.00 . A A . 130 TYR HA   1 1 
        1  1950 1 1 130 TYR HB2  H   1.144  -3.592   6.709 1.00 . A A . 130 TYR HB2  1 1 
        1  1951 1 1 130 TYR HB3  H   1.332  -3.891   4.983 1.00 . A A . 130 TYR HB3  1 1 
        1  1952 1 1 130 TYR HD1  H  -0.851  -2.202   7.494 1.00 . A A . 130 TYR HD1  1 1 
        1  1953 1 1 130 TYR HD2  H   0.362  -2.445   3.381 1.00 . A A . 130 TYR HD2  1 1 
        1  1954 1 1 130 TYR HE1  H  -2.120  -0.130   6.997 1.00 . A A . 130 TYR HE1  1 1 
        1  1955 1 1 130 TYR HE2  H  -0.907  -0.374   2.883 1.00 . A A . 130 TYR HE2  1 1 
        1  1956 1 1 130 TYR HH   H  -2.348   1.553   5.439 1.00 . A A . 130 TYR HH   1 1 
        1  1957 1 1 130 TYR N    N   0.478  -6.141   6.077 1.00 . A A . 130 TYR N    1 1 
        1  1958 1 1 130 TYR O    O  -2.320  -4.805   4.542 1.00 . A A . 130 TYR O    1 1 
        1  1959 1 1 130 TYR OH   O  -2.299   1.036   4.632 1.00 . A A . 130 TYR OH   1 1 
        1  1960 1 1 131 LEU C    C  -2.170  -6.692   2.294 1.00 . A A . 131 LEU C    1 1 
        1  1961 1 1 131 LEU CA   C  -1.168  -5.538   2.206 1.00 . A A . 131 LEU CA   1 1 
        1  1962 1 1 131 LEU CB   C  -0.136  -5.831   1.112 1.00 . A A . 131 LEU CB   1 1 
        1  1963 1 1 131 LEU CD1  C   1.905  -4.992  -0.056 1.00 . A A . 131 LEU CD1  1 1 
        1  1964 1 1 131 LEU CD2  C  -0.082  -3.459   0.227 1.00 . A A . 131 LEU CD2  1 1 
        1  1965 1 1 131 LEU CG   C   0.744  -4.596   0.869 1.00 . A A . 131 LEU CG   1 1 
        1  1966 1 1 131 LEU H    H   0.493  -5.566   3.570 1.00 . A A . 131 LEU H    1 1 
        1  1967 1 1 131 LEU HA   H  -1.697  -4.627   1.973 1.00 . A A . 131 LEU HA   1 1 
        1  1968 1 1 131 LEU HB2  H   0.487  -6.657   1.428 1.00 . A A . 131 LEU HB2  1 1 
        1  1969 1 1 131 LEU HB3  H  -0.644  -6.097   0.199 1.00 . A A . 131 LEU HB3  1 1 
        1  1970 1 1 131 LEU HD11 H   1.518  -5.382  -0.991 1.00 . A A . 131 LEU HD11 1 1 
        1  1971 1 1 131 LEU HD12 H   2.504  -5.746   0.431 1.00 . A A . 131 LEU HD12 1 1 
        1  1972 1 1 131 LEU HD13 H   2.516  -4.132  -0.261 1.00 . A A . 131 LEU HD13 1 1 
        1  1973 1 1 131 LEU HD21 H   0.570  -2.817  -0.347 1.00 . A A . 131 LEU HD21 1 1 
        1  1974 1 1 131 LEU HD22 H  -0.564  -2.876   1.000 1.00 . A A . 131 LEU HD22 1 1 
        1  1975 1 1 131 LEU HD23 H  -0.834  -3.878  -0.427 1.00 . A A . 131 LEU HD23 1 1 
        1  1976 1 1 131 LEU HG   H   1.147  -4.260   1.813 1.00 . A A . 131 LEU HG   1 1 
        1  1977 1 1 131 LEU N    N  -0.467  -5.388   3.510 1.00 . A A . 131 LEU N    1 1 
        1  1978 1 1 131 LEU O    O  -3.274  -6.607   1.795 1.00 . A A . 131 LEU O    1 1 
        1  1979 1 1 132 GLY C    C  -3.952  -8.524   3.845 1.00 . A A . 132 GLY C    1 1 
        1  1980 1 1 132 GLY CA   C  -2.725  -8.932   3.031 1.00 . A A . 132 GLY CA   1 1 
        1  1981 1 1 132 GLY H    H  -0.896  -7.826   3.317 1.00 . A A . 132 GLY H    1 1 
        1  1982 1 1 132 GLY HA2  H  -3.033  -9.237   2.041 1.00 . A A . 132 GLY HA2  1 1 
        1  1983 1 1 132 GLY HA3  H  -2.226  -9.752   3.522 1.00 . A A . 132 GLY HA3  1 1 
        1  1984 1 1 132 GLY N    N  -1.792  -7.774   2.921 1.00 . A A . 132 GLY N    1 1 
        1  1985 1 1 132 GLY O    O  -5.070  -8.869   3.515 1.00 . A A . 132 GLY O    1 1 
        1  1986 1 1 133 ARG C    C  -5.796  -6.410   4.926 1.00 . A A . 133 ARG C    1 1 
        1  1987 1 1 133 ARG CA   C  -4.908  -7.353   5.739 1.00 . A A . 133 ARG CA   1 1 
        1  1988 1 1 133 ARG CB   C  -4.385  -6.635   6.983 1.00 . A A . 133 ARG CB   1 1 
        1  1989 1 1 133 ARG CD   C  -5.016  -5.676   9.199 1.00 . A A . 133 ARG CD   1 1 
        1  1990 1 1 133 ARG CG   C  -5.555  -6.260   7.891 1.00 . A A . 133 ARG CG   1 1 
        1  1991 1 1 133 ARG CZ   C  -3.712  -6.469  11.087 1.00 . A A . 133 ARG CZ   1 1 
        1  1992 1 1 133 ARG H    H  -2.845  -7.521   5.150 1.00 . A A . 133 ARG H    1 1 
        1  1993 1 1 133 ARG HA   H  -5.483  -8.219   6.038 1.00 . A A . 133 ARG HA   1 1 
        1  1994 1 1 133 ARG HB2  H  -3.709  -7.287   7.518 1.00 . A A . 133 ARG HB2  1 1 
        1  1995 1 1 133 ARG HB3  H  -3.860  -5.740   6.687 1.00 . A A . 133 ARG HB3  1 1 
        1  1996 1 1 133 ARG HD2  H  -4.331  -4.870   8.978 1.00 . A A . 133 ARG HD2  1 1 
        1  1997 1 1 133 ARG HD3  H  -5.836  -5.301   9.793 1.00 . A A . 133 ARG HD3  1 1 
        1  1998 1 1 133 ARG HE   H  -4.272  -7.659   9.599 1.00 . A A . 133 ARG HE   1 1 
        1  1999 1 1 133 ARG HG2  H  -6.174  -5.529   7.394 1.00 . A A . 133 ARG HG2  1 1 
        1  2000 1 1 133 ARG HG3  H  -6.141  -7.141   8.108 1.00 . A A . 133 ARG HG3  1 1 
        1  2001 1 1 133 ARG HH11 H  -4.235  -4.535  11.068 1.00 . A A . 133 ARG HH11 1 1 
        1  2002 1 1 133 ARG HH12 H  -3.298  -5.046  12.433 1.00 . A A . 133 ARG HH12 1 1 
        1  2003 1 1 133 ARG HH21 H  -3.053  -8.338  11.373 1.00 . A A . 133 ARG HH21 1 1 
        1  2004 1 1 133 ARG HH22 H  -2.630  -7.198  12.605 1.00 . A A . 133 ARG HH22 1 1 
        1  2005 1 1 133 ARG N    N  -3.755  -7.790   4.904 1.00 . A A . 133 ARG N    1 1 
        1  2006 1 1 133 ARG NE   N  -4.302  -6.746   9.955 1.00 . A A . 133 ARG NE   1 1 
        1  2007 1 1 133 ARG NH1  N  -3.752  -5.255  11.566 1.00 . A A . 133 ARG NH1  1 1 
        1  2008 1 1 133 ARG NH2  N  -3.083  -7.408  11.740 1.00 . A A . 133 ARG NH2  1 1 
        1  2009 1 1 133 ARG O    O  -7.008  -6.485   4.974 1.00 . A A . 133 ARG O    1 1 
        1  2010 1 1 134 LEU C    C  -6.850  -5.358   2.347 1.00 . A A . 134 LEU C    1 1 
        1  2011 1 1 134 LEU CA   C  -6.011  -4.573   3.356 1.00 . A A . 134 LEU CA   1 1 
        1  2012 1 1 134 LEU CB   C  -5.074  -3.607   2.621 1.00 . A A . 134 LEU CB   1 1 
        1  2013 1 1 134 LEU CD1  C  -6.965  -1.940   2.488 1.00 . A A . 134 LEU CD1  1 1 
        1  2014 1 1 134 LEU CD2  C  -4.919  -1.661   1.064 1.00 . A A . 134 LEU CD2  1 1 
        1  2015 1 1 134 LEU CG   C  -5.876  -2.680   1.694 1.00 . A A . 134 LEU CG   1 1 
        1  2016 1 1 134 LEU H    H  -4.224  -5.479   4.148 1.00 . A A . 134 LEU H    1 1 
        1  2017 1 1 134 LEU HA   H  -6.665  -4.016   4.010 1.00 . A A . 134 LEU HA   1 1 
        1  2018 1 1 134 LEU HB2  H  -4.536  -3.011   3.344 1.00 . A A . 134 LEU HB2  1 1 
        1  2019 1 1 134 LEU HB3  H  -4.368  -4.174   2.032 1.00 . A A . 134 LEU HB3  1 1 
        1  2020 1 1 134 LEU HD11 H  -6.589  -1.680   3.467 1.00 . A A . 134 LEU HD11 1 1 
        1  2021 1 1 134 LEU HD12 H  -7.829  -2.579   2.593 1.00 . A A . 134 LEU HD12 1 1 
        1  2022 1 1 134 LEU HD13 H  -7.251  -1.038   1.962 1.00 . A A . 134 LEU HD13 1 1 
        1  2023 1 1 134 LEU HD21 H  -4.300  -1.225   1.834 1.00 . A A . 134 LEU HD21 1 1 
        1  2024 1 1 134 LEU HD22 H  -5.490  -0.885   0.578 1.00 . A A . 134 LEU HD22 1 1 
        1  2025 1 1 134 LEU HD23 H  -4.294  -2.158   0.338 1.00 . A A . 134 LEU HD23 1 1 
        1  2026 1 1 134 LEU HG   H  -6.339  -3.264   0.912 1.00 . A A . 134 LEU HG   1 1 
        1  2027 1 1 134 LEU N    N  -5.202  -5.522   4.174 1.00 . A A . 134 LEU N    1 1 
        1  2028 1 1 134 LEU O    O  -7.997  -5.041   2.100 1.00 . A A . 134 LEU O    1 1 
        1  2029 1 1 135 THR C    C  -8.307  -7.748   1.439 1.00 . A A . 135 THR C    1 1 
        1  2030 1 1 135 THR CA   C  -7.058  -7.179   0.770 1.00 . A A . 135 THR CA   1 1 
        1  2031 1 1 135 THR CB   C  -6.182  -8.325   0.264 1.00 . A A . 135 THR CB   1 1 
        1  2032 1 1 135 THR CG2  C  -6.850  -8.986  -0.942 1.00 . A A . 135 THR CG2  1 1 
        1  2033 1 1 135 THR H    H  -5.365  -6.618   1.975 1.00 . A A . 135 THR H    1 1 
        1  2034 1 1 135 THR HA   H  -7.347  -6.549  -0.059 1.00 . A A . 135 THR HA   1 1 
        1  2035 1 1 135 THR HB   H  -6.059  -9.056   1.048 1.00 . A A . 135 THR HB   1 1 
        1  2036 1 1 135 THR HG1  H  -4.905  -7.707  -1.066 1.00 . A A . 135 THR HG1  1 1 
        1  2037 1 1 135 THR HG21 H  -6.854  -8.297  -1.774 1.00 . A A . 135 THR HG21 1 1 
        1  2038 1 1 135 THR HG22 H  -7.867  -9.252  -0.689 1.00 . A A . 135 THR HG22 1 1 
        1  2039 1 1 135 THR HG23 H  -6.302  -9.876  -1.213 1.00 . A A . 135 THR HG23 1 1 
        1  2040 1 1 135 THR N    N  -6.291  -6.377   1.761 1.00 . A A . 135 THR N    1 1 
        1  2041 1 1 135 THR O    O  -9.385  -7.735   0.880 1.00 . A A . 135 THR O    1 1 
        1  2042 1 1 135 THR OG1  O  -4.912  -7.814  -0.112 1.00 . A A . 135 THR OG1  1 1 
        1  2043 1 1 136 GLU C    C -10.439  -7.747   3.451 1.00 . A A . 136 GLU C    1 1 
        1  2044 1 1 136 GLU CA   C  -9.350  -8.818   3.341 1.00 . A A . 136 GLU CA   1 1 
        1  2045 1 1 136 GLU CB   C  -8.925  -9.255   4.743 1.00 . A A . 136 GLU CB   1 1 
        1  2046 1 1 136 GLU CD   C  -8.539 -11.625   4.034 1.00 . A A . 136 GLU CD   1 1 
        1  2047 1 1 136 GLU CG   C  -7.892 -10.381   4.645 1.00 . A A . 136 GLU CG   1 1 
        1  2048 1 1 136 GLU H    H  -7.293  -8.248   3.069 1.00 . A A . 136 GLU H    1 1 
        1  2049 1 1 136 GLU HA   H  -9.728  -9.668   2.791 1.00 . A A . 136 GLU HA   1 1 
        1  2050 1 1 136 GLU HB2  H  -8.491  -8.414   5.263 1.00 . A A . 136 GLU HB2  1 1 
        1  2051 1 1 136 GLU HB3  H  -9.788  -9.608   5.287 1.00 . A A . 136 GLU HB3  1 1 
        1  2052 1 1 136 GLU HG2  H  -7.068 -10.061   4.023 1.00 . A A . 136 GLU HG2  1 1 
        1  2053 1 1 136 GLU HG3  H  -7.524 -10.619   5.633 1.00 . A A . 136 GLU HG3  1 1 
        1  2054 1 1 136 GLU N    N  -8.171  -8.248   2.635 1.00 . A A . 136 GLU N    1 1 
        1  2055 1 1 136 GLU O    O -11.598  -7.998   3.188 1.00 . A A . 136 GLU O    1 1 
        1  2056 1 1 136 GLU OE1  O  -9.755 -11.710   4.061 1.00 . A A . 136 GLU OE1  1 1 
        1  2057 1 1 136 GLU OE2  O  -7.807 -12.472   3.547 1.00 . A A . 136 GLU OE2  1 1 
        1  2058 1 1 137 VAL C    C -11.652  -5.132   2.579 1.00 . A A . 137 VAL C    1 1 
        1  2059 1 1 137 VAL CA   C -11.082  -5.462   3.960 1.00 . A A . 137 VAL CA   1 1 
        1  2060 1 1 137 VAL CB   C -10.412  -4.219   4.547 1.00 . A A . 137 VAL CB   1 1 
        1  2061 1 1 137 VAL CG1  C -11.395  -3.046   4.527 1.00 . A A . 137 VAL CG1  1 1 
        1  2062 1 1 137 VAL CG2  C  -9.987  -4.501   5.990 1.00 . A A . 137 VAL CG2  1 1 
        1  2063 1 1 137 VAL H    H  -9.132  -6.373   4.036 1.00 . A A . 137 VAL H    1 1 
        1  2064 1 1 137 VAL HA   H -11.880  -5.782   4.612 1.00 . A A . 137 VAL HA   1 1 
        1  2065 1 1 137 VAL HB   H  -9.543  -3.967   3.957 1.00 . A A . 137 VAL HB   1 1 
        1  2066 1 1 137 VAL HG11 H -11.494  -2.678   3.517 1.00 . A A . 137 VAL HG11 1 1 
        1  2067 1 1 137 VAL HG12 H -11.027  -2.255   5.164 1.00 . A A . 137 VAL HG12 1 1 
        1  2068 1 1 137 VAL HG13 H -12.358  -3.377   4.886 1.00 . A A . 137 VAL HG13 1 1 
        1  2069 1 1 137 VAL HG21 H  -9.471  -5.449   6.035 1.00 . A A . 137 VAL HG21 1 1 
        1  2070 1 1 137 VAL HG22 H -10.861  -4.536   6.624 1.00 . A A . 137 VAL HG22 1 1 
        1  2071 1 1 137 VAL HG23 H  -9.328  -3.717   6.330 1.00 . A A . 137 VAL HG23 1 1 
        1  2072 1 1 137 VAL N    N -10.073  -6.554   3.835 1.00 . A A . 137 VAL N    1 1 
        1  2073 1 1 137 VAL O    O -12.844  -4.964   2.410 1.00 . A A . 137 VAL O    1 1 
        1  2074 1 1 138 ALA C    C -12.222  -5.807  -0.276 1.00 . A A . 138 ALA C    1 1 
        1  2075 1 1 138 ALA CA   C -11.287  -4.705   0.221 1.00 . A A . 138 ALA CA   1 1 
        1  2076 1 1 138 ALA CB   C -10.081  -4.590  -0.714 1.00 . A A . 138 ALA CB   1 1 
        1  2077 1 1 138 ALA H    H  -9.851  -5.171   1.753 1.00 . A A . 138 ALA H    1 1 
        1  2078 1 1 138 ALA HA   H -11.820  -3.765   0.241 1.00 . A A . 138 ALA HA   1 1 
        1  2079 1 1 138 ALA HB1  H  -9.382  -5.384  -0.497 1.00 . A A . 138 ALA HB1  1 1 
        1  2080 1 1 138 ALA HB2  H  -9.601  -3.636  -0.562 1.00 . A A . 138 ALA HB2  1 1 
        1  2081 1 1 138 ALA HB3  H -10.407  -4.669  -1.740 1.00 . A A . 138 ALA HB3  1 1 
        1  2082 1 1 138 ALA N    N -10.807  -5.033   1.592 1.00 . A A . 138 ALA N    1 1 
        1  2083 1 1 138 ALA O    O -13.202  -5.548  -0.947 1.00 . A A . 138 ALA O    1 1 
        1  2084 1 1 139 ALA C    C -13.932  -8.367   0.593 1.00 . A A . 139 ALA C    1 1 
        1  2085 1 1 139 ALA CA   C -12.799  -8.156  -0.413 1.00 . A A . 139 ALA CA   1 1 
        1  2086 1 1 139 ALA CB   C -11.959  -9.429  -0.517 1.00 . A A . 139 ALA CB   1 1 
        1  2087 1 1 139 ALA H    H -11.135  -7.223   0.586 1.00 . A A . 139 ALA H    1 1 
        1  2088 1 1 139 ALA HA   H -13.217  -7.921  -1.383 1.00 . A A . 139 ALA HA   1 1 
        1  2089 1 1 139 ALA HB1  H -11.292  -9.350  -1.361 1.00 . A A . 139 ALA HB1  1 1 
        1  2090 1 1 139 ALA HB2  H -12.610 -10.280  -0.650 1.00 . A A . 139 ALA HB2  1 1 
        1  2091 1 1 139 ALA HB3  H -11.383  -9.553   0.388 1.00 . A A . 139 ALA HB3  1 1 
        1  2092 1 1 139 ALA N    N -11.929  -7.037   0.044 1.00 . A A . 139 ALA N    1 1 
        1  2093 1 1 139 ALA O    O -14.819  -9.169   0.382 1.00 . A A . 139 ALA O    1 1 
        1  2094 1 1 140 GLY C    C -14.562  -7.157   4.015 1.00 . A A . 140 GLY C    1 1 
        1  2095 1 1 140 GLY CA   C -14.994  -7.816   2.702 1.00 . A A . 140 GLY CA   1 1 
        1  2096 1 1 140 GLY H    H -13.190  -7.008   1.837 1.00 . A A . 140 GLY H    1 1 
        1  2097 1 1 140 GLY HA2  H -15.899  -7.348   2.339 1.00 . A A . 140 GLY HA2  1 1 
        1  2098 1 1 140 GLY HA3  H -15.175  -8.867   2.870 1.00 . A A . 140 GLY HA3  1 1 
        1  2099 1 1 140 GLY N    N -13.913  -7.652   1.685 1.00 . A A . 140 GLY N    1 1 
        1  2100 1 1 140 GLY O    O -13.506  -7.440   4.541 1.00 . A A . 140 GLY O    1 1 
        1  2101 1 1 141 ARG C    C -15.070  -6.536   7.005 1.00 . A A . 141 ARG C    1 1 
        1  2102 1 1 141 ARG CA   C -15.005  -5.575   5.812 1.00 . A A . 141 ARG CA   1 1 
        1  2103 1 1 141 ARG CB   C -15.982  -4.423   6.045 1.00 . A A . 141 ARG CB   1 1 
        1  2104 1 1 141 ARG CD   C -16.720  -2.180   5.227 1.00 . A A . 141 ARG CD   1 1 
        1  2105 1 1 141 ARG CG   C -15.720  -3.320   5.021 1.00 . A A . 141 ARG CG   1 1 
        1  2106 1 1 141 ARG CZ   C -15.598  -0.166   4.450 1.00 . A A . 141 ARG CZ   1 1 
        1  2107 1 1 141 ARG H    H -16.209  -6.057   4.089 1.00 . A A . 141 ARG H    1 1 
        1  2108 1 1 141 ARG HA   H -14.005  -5.178   5.728 1.00 . A A . 141 ARG HA   1 1 
        1  2109 1 1 141 ARG HB2  H -16.995  -4.784   5.937 1.00 . A A . 141 ARG HB2  1 1 
        1  2110 1 1 141 ARG HB3  H -15.844  -4.029   7.040 1.00 . A A . 141 ARG HB3  1 1 
        1  2111 1 1 141 ARG HD2  H -17.724  -2.560   5.109 1.00 . A A . 141 ARG HD2  1 1 
        1  2112 1 1 141 ARG HD3  H -16.606  -1.773   6.221 1.00 . A A . 141 ARG HD3  1 1 
        1  2113 1 1 141 ARG HE   H -16.957  -1.124   3.364 1.00 . A A . 141 ARG HE   1 1 
        1  2114 1 1 141 ARG HG2  H -14.715  -2.946   5.146 1.00 . A A . 141 ARG HG2  1 1 
        1  2115 1 1 141 ARG HG3  H -15.835  -3.719   4.024 1.00 . A A . 141 ARG HG3  1 1 
        1  2116 1 1 141 ARG HH11 H -15.102  -0.849   6.268 1.00 . A A . 141 ARG HH11 1 1 
        1  2117 1 1 141 ARG HH12 H -14.280   0.584   5.756 1.00 . A A . 141 ARG HH12 1 1 
        1  2118 1 1 141 ARG HH21 H -15.882   0.740   2.687 1.00 . A A . 141 ARG HH21 1 1 
        1  2119 1 1 141 ARG HH22 H -14.717   1.481   3.732 1.00 . A A . 141 ARG HH22 1 1 
        1  2120 1 1 141 ARG N    N -15.368  -6.274   4.539 1.00 . A A . 141 ARG N    1 1 
        1  2121 1 1 141 ARG NE   N -16.469  -1.114   4.213 1.00 . A A . 141 ARG NE   1 1 
        1  2122 1 1 141 ARG NH1  N -14.942  -0.143   5.579 1.00 . A A . 141 ARG NH1  1 1 
        1  2123 1 1 141 ARG NH2  N -15.382   0.757   3.553 1.00 . A A . 141 ARG NH2  1 1 
        1  2124 1 1 141 ARG O    O -15.353  -7.708   6.862 1.00 . A A . 141 ARG O    1 1 
        1  2125 1 1 142 ASP C    C -13.855  -8.052   9.247 1.00 . A A . 142 ASP C    1 1 
        1  2126 1 1 142 ASP CA   C -14.829  -6.884   9.413 1.00 . A A . 142 ASP CA   1 1 
        1  2127 1 1 142 ASP CB   C -16.243  -7.422   9.644 1.00 . A A . 142 ASP CB   1 1 
        1  2128 1 1 142 ASP CG   C -17.236  -6.258   9.670 1.00 . A A . 142 ASP CG   1 1 
        1  2129 1 1 142 ASP H    H -14.569  -5.082   8.264 1.00 . A A . 142 ASP H    1 1 
        1  2130 1 1 142 ASP HA   H -14.530  -6.291  10.266 1.00 . A A . 142 ASP HA   1 1 
        1  2131 1 1 142 ASP HB2  H -16.506  -8.104   8.851 1.00 . A A . 142 ASP HB2  1 1 
        1  2132 1 1 142 ASP HB3  H -16.280  -7.941  10.590 1.00 . A A . 142 ASP HB3  1 1 
        1  2133 1 1 142 ASP N    N -14.798  -6.031   8.186 1.00 . A A . 142 ASP N    1 1 
        1  2134 1 1 142 ASP O    O -14.256  -9.177   9.022 1.00 . A A . 142 ASP O    1 1 
        1  2135 1 1 142 ASP OD1  O -17.191  -5.446   8.760 1.00 . A A . 142 ASP OD1  1 1 
        1  2136 1 1 142 ASP OD2  O -18.024  -6.197  10.599 1.00 . A A . 142 ASP OD2  1 1 
        1  2137 1 1 143 PRO C    C -11.667  -9.955  10.252 1.00 . A A . 143 PRO C    1 1 
        1  2138 1 1 143 PRO CA   C -11.517  -8.827   9.221 1.00 . A A . 143 PRO CA   1 1 
        1  2139 1 1 143 PRO CB   C -10.201  -8.049   9.434 1.00 . A A . 143 PRO CB   1 1 
        1  2140 1 1 143 PRO CD   C -12.007  -6.455   9.624 1.00 . A A . 143 PRO CD   1 1 
        1  2141 1 1 143 PRO CG   C -10.550  -6.611   9.196 1.00 . A A . 143 PRO CG   1 1 
        1  2142 1 1 143 PRO HA   H -11.535  -9.237   8.223 1.00 . A A . 143 PRO HA   1 1 
        1  2143 1 1 143 PRO HB2  H  -9.841  -8.184  10.447 1.00 . A A . 143 PRO HB2  1 1 
        1  2144 1 1 143 PRO HB3  H  -9.450  -8.371   8.725 1.00 . A A . 143 PRO HB3  1 1 
        1  2145 1 1 143 PRO HD2  H -12.069  -6.208  10.676 1.00 . A A . 143 PRO HD2  1 1 
        1  2146 1 1 143 PRO HD3  H -12.506  -5.708   9.025 1.00 . A A . 143 PRO HD3  1 1 
        1  2147 1 1 143 PRO HG2  H  -9.912  -5.966   9.788 1.00 . A A . 143 PRO HG2  1 1 
        1  2148 1 1 143 PRO HG3  H -10.452  -6.368   8.148 1.00 . A A . 143 PRO HG3  1 1 
        1  2149 1 1 143 PRO N    N -12.581  -7.783   9.360 1.00 . A A . 143 PRO N    1 1 
        1  2150 1 1 143 PRO O    O -12.078  -9.735  11.374 1.00 . A A . 143 PRO O    1 1 
        1  2151 1 1 144 GLY C    C -10.489 -12.150  11.983 1.00 . A A . 144 GLY C    1 1 
        1  2152 1 1 144 GLY CA   C -11.467 -12.306  10.815 1.00 . A A . 144 GLY CA   1 1 
        1  2153 1 1 144 GLY H    H -11.013 -11.311   8.960 1.00 . A A . 144 GLY H    1 1 
        1  2154 1 1 144 GLY HA2  H -12.477 -12.344  11.198 1.00 . A A . 144 GLY HA2  1 1 
        1  2155 1 1 144 GLY HA3  H -11.248 -13.224  10.292 1.00 . A A . 144 GLY HA3  1 1 
        1  2156 1 1 144 GLY N    N -11.340 -11.159   9.872 1.00 . A A . 144 GLY N    1 1 
        1  2157 1 1 144 GLY O    O -10.837 -12.376  13.125 1.00 . A A . 144 GLY O    1 1 
        1  2158 1 1 145 PRO C    C  -8.579 -10.538  13.785 1.00 . A A . 145 PRO C    1 1 
        1  2159 1 1 145 PRO CA   C  -8.214 -11.600  12.746 1.00 . A A . 145 PRO CA   1 1 
        1  2160 1 1 145 PRO CB   C  -6.965 -11.174  11.949 1.00 . A A . 145 PRO CB   1 1 
        1  2161 1 1 145 PRO CD   C  -8.747 -11.480  10.359 1.00 . A A . 145 PRO CD   1 1 
        1  2162 1 1 145 PRO CG   C  -7.238 -11.605  10.545 1.00 . A A . 145 PRO CG   1 1 
        1  2163 1 1 145 PRO HA   H  -8.022 -12.542  13.236 1.00 . A A . 145 PRO HA   1 1 
        1  2164 1 1 145 PRO HB2  H  -6.836 -10.097  11.991 1.00 . A A . 145 PRO HB2  1 1 
        1  2165 1 1 145 PRO HB3  H  -6.082 -11.671  12.327 1.00 . A A . 145 PRO HB3  1 1 
        1  2166 1 1 145 PRO HD2  H  -9.009 -10.475  10.057 1.00 . A A . 145 PRO HD2  1 1 
        1  2167 1 1 145 PRO HD3  H  -9.110 -12.204   9.647 1.00 . A A . 145 PRO HD3  1 1 
        1  2168 1 1 145 PRO HG2  H  -6.716 -10.963   9.847 1.00 . A A . 145 PRO HG2  1 1 
        1  2169 1 1 145 PRO HG3  H  -6.938 -12.632  10.404 1.00 . A A . 145 PRO HG3  1 1 
        1  2170 1 1 145 PRO N    N  -9.269 -11.775  11.701 1.00 . A A . 145 PRO N    1 1 
        1  2171 1 1 145 PRO O    O  -9.251  -9.570  13.494 1.00 . A A . 145 PRO O    1 1 
        1  2172 1 1 146 ASP C    C  -7.132  -9.476  16.881 1.00 . A A . 146 ASP C    1 1 
        1  2173 1 1 146 ASP CA   C  -8.409  -9.729  16.074 1.00 . A A . 146 ASP CA   1 1 
        1  2174 1 1 146 ASP CB   C  -9.496 -10.295  16.995 1.00 . A A . 146 ASP CB   1 1 
        1  2175 1 1 146 ASP CG   C -10.859 -10.176  16.309 1.00 . A A . 146 ASP CG   1 1 
        1  2176 1 1 146 ASP H    H  -7.574 -11.507  15.193 1.00 . A A . 146 ASP H    1 1 
        1  2177 1 1 146 ASP HA   H  -8.751  -8.797  15.646 1.00 . A A . 146 ASP HA   1 1 
        1  2178 1 1 146 ASP HB2  H  -9.286 -11.334  17.202 1.00 . A A . 146 ASP HB2  1 1 
        1  2179 1 1 146 ASP HB3  H  -9.512  -9.739  17.921 1.00 . A A . 146 ASP HB3  1 1 
        1  2180 1 1 146 ASP N    N  -8.121 -10.718  14.995 1.00 . A A . 146 ASP N    1 1 
        1  2181 1 1 146 ASP O    O  -7.090  -9.717  18.072 1.00 . A A . 146 ASP O    1 1 
        1  2182 1 1 146 ASP OD1  O -10.903  -9.648  15.211 1.00 . A A . 146 ASP OD1  1 1 
        1  2183 1 1 146 ASP OD2  O -11.834 -10.617  16.894 1.00 . A A . 146 ASP OD2  1 1 
        1  2184 1 1 147 PRO C    C  -5.056  -7.869  18.220 1.00 . A A . 147 PRO C    1 1 
        1  2185 1 1 147 PRO CA   C  -4.814  -8.672  16.939 1.00 . A A . 147 PRO CA   1 1 
        1  2186 1 1 147 PRO CB   C  -4.035  -7.824  15.917 1.00 . A A . 147 PRO CB   1 1 
        1  2187 1 1 147 PRO CD   C  -6.034  -8.661  14.803 1.00 . A A . 147 PRO CD   1 1 
        1  2188 1 1 147 PRO CG   C  -4.584  -8.206  14.576 1.00 . A A . 147 PRO CG   1 1 
        1  2189 1 1 147 PRO HA   H  -4.275  -9.580  17.152 1.00 . A A . 147 PRO HA   1 1 
        1  2190 1 1 147 PRO HB2  H  -4.193  -6.767  16.101 1.00 . A A . 147 PRO HB2  1 1 
        1  2191 1 1 147 PRO HB3  H  -2.978  -8.054  15.965 1.00 . A A . 147 PRO HB3  1 1 
        1  2192 1 1 147 PRO HD2  H  -6.728  -7.870  14.549 1.00 . A A . 147 PRO HD2  1 1 
        1  2193 1 1 147 PRO HD3  H  -6.239  -9.543  14.221 1.00 . A A . 147 PRO HD3  1 1 
        1  2194 1 1 147 PRO HG2  H  -4.558  -7.353  13.906 1.00 . A A . 147 PRO HG2  1 1 
        1  2195 1 1 147 PRO HG3  H  -4.010  -9.020  14.154 1.00 . A A . 147 PRO HG3  1 1 
        1  2196 1 1 147 PRO N    N  -6.099  -8.974  16.245 1.00 . A A . 147 PRO N    1 1 
        1  2197 1 1 147 PRO O    O  -4.405  -8.067  19.226 1.00 . A A . 147 PRO O    1 1 
        1  2198 1 1 148 PHE C    C  -7.780  -5.758  19.351 1.00 . A A . 148 PHE C    1 1 
        1  2199 1 1 148 PHE CA   C  -6.300  -6.135  19.380 1.00 . A A . 148 PHE CA   1 1 
        1  2200 1 1 148 PHE CB   C  -5.457  -4.860  19.350 1.00 . A A . 148 PHE CB   1 1 
        1  2201 1 1 148 PHE CD1  C  -3.459  -5.728  20.619 1.00 . A A . 148 PHE CD1  1 1 
        1  2202 1 1 148 PHE CD2  C  -3.163  -5.046  18.309 1.00 . A A . 148 PHE CD2  1 1 
        1  2203 1 1 148 PHE CE1  C  -2.102  -6.062  20.692 1.00 . A A . 148 PHE CE1  1 1 
        1  2204 1 1 148 PHE CE2  C  -1.806  -5.379  18.384 1.00 . A A . 148 PHE CE2  1 1 
        1  2205 1 1 148 PHE CG   C  -3.991  -5.220  19.427 1.00 . A A . 148 PHE CG   1 1 
        1  2206 1 1 148 PHE CZ   C  -1.275  -5.887  19.576 1.00 . A A . 148 PHE CZ   1 1 
        1  2207 1 1 148 PHE H    H  -6.501  -6.828  17.355 1.00 . A A . 148 PHE H    1 1 
        1  2208 1 1 148 PHE HA   H  -6.085  -6.693  20.281 1.00 . A A . 148 PHE HA   1 1 
        1  2209 1 1 148 PHE HB2  H  -5.652  -4.323  18.433 1.00 . A A . 148 PHE HB2  1 1 
        1  2210 1 1 148 PHE HB3  H  -5.718  -4.236  20.193 1.00 . A A . 148 PHE HB3  1 1 
        1  2211 1 1 148 PHE HD1  H  -4.096  -5.863  21.479 1.00 . A A . 148 PHE HD1  1 1 
        1  2212 1 1 148 PHE HD2  H  -3.572  -4.654  17.390 1.00 . A A . 148 PHE HD2  1 1 
        1  2213 1 1 148 PHE HE1  H  -1.692  -6.453  21.611 1.00 . A A . 148 PHE HE1  1 1 
        1  2214 1 1 148 PHE HE2  H  -1.168  -5.245  17.524 1.00 . A A . 148 PHE HE2  1 1 
        1  2215 1 1 148 PHE HZ   H  -0.227  -6.144  19.635 1.00 . A A . 148 PHE HZ   1 1 
        1  2216 1 1 148 PHE N    N  -5.992  -6.964  18.180 1.00 . A A . 148 PHE N    1 1 
        1  2217 1 1 148 PHE O    O  -8.510  -5.982  20.295 1.00 . A A . 148 PHE O    1 1 
        1  2218 1 1 149 TYR C    C -10.529  -5.984  17.818 1.00 . A A . 149 TYR C    1 1 
        1  2219 1 1 149 TYR CA   C  -9.657  -4.775  18.171 1.00 . A A . 149 TYR CA   1 1 
        1  2220 1 1 149 TYR CB   C  -9.802  -3.704  17.092 1.00 . A A . 149 TYR CB   1 1 
        1  2221 1 1 149 TYR CD1  C  -7.763  -2.230  17.262 1.00 . A A . 149 TYR CD1  1 1 
        1  2222 1 1 149 TYR CD2  C  -9.836  -1.483  18.274 1.00 . A A . 149 TYR CD2  1 1 
        1  2223 1 1 149 TYR CE1  C  -7.130  -1.058  17.695 1.00 . A A . 149 TYR CE1  1 1 
        1  2224 1 1 149 TYR CE2  C  -9.203  -0.312  18.708 1.00 . A A . 149 TYR CE2  1 1 
        1  2225 1 1 149 TYR CG   C  -9.117  -2.441  17.552 1.00 . A A . 149 TYR CG   1 1 
        1  2226 1 1 149 TYR CZ   C  -7.851  -0.100  18.419 1.00 . A A . 149 TYR CZ   1 1 
        1  2227 1 1 149 TYR H    H  -7.616  -5.007  17.524 1.00 . A A . 149 TYR H    1 1 
        1  2228 1 1 149 TYR HA   H  -9.979  -4.370  19.120 1.00 . A A . 149 TYR HA   1 1 
        1  2229 1 1 149 TYR HB2  H  -9.346  -4.050  16.176 1.00 . A A . 149 TYR HB2  1 1 
        1  2230 1 1 149 TYR HB3  H -10.849  -3.503  16.922 1.00 . A A . 149 TYR HB3  1 1 
        1  2231 1 1 149 TYR HD1  H  -7.208  -2.968  16.703 1.00 . A A . 149 TYR HD1  1 1 
        1  2232 1 1 149 TYR HD2  H -10.880  -1.648  18.496 1.00 . A A . 149 TYR HD2  1 1 
        1  2233 1 1 149 TYR HE1  H  -6.086  -0.894  17.472 1.00 . A A . 149 TYR HE1  1 1 
        1  2234 1 1 149 TYR HE2  H  -9.758   0.427  19.266 1.00 . A A . 149 TYR HE2  1 1 
        1  2235 1 1 149 TYR HH   H  -6.779   0.855  19.675 1.00 . A A . 149 TYR HH   1 1 
        1  2236 1 1 149 TYR N    N  -8.226  -5.181  18.271 1.00 . A A . 149 TYR N    1 1 
        1  2237 1 1 149 TYR O    O -10.160  -6.821  17.020 1.00 . A A . 149 TYR O    1 1 
        1  2238 1 1 149 TYR OH   O  -7.227   1.052  18.850 1.00 . A A . 149 TYR OH   1 1 
        1  2239 1 1 150 GLY C    C -13.806  -7.115  19.077 1.00 . A A . 150 GLY C    1 1 
        1  2240 1 1 150 GLY CA   C -12.609  -7.212  18.128 1.00 . A A . 150 GLY CA   1 1 
        1  2241 1 1 150 GLY H    H -11.958  -5.380  19.051 1.00 . A A . 150 GLY H    1 1 
        1  2242 1 1 150 GLY HA2  H -12.947  -7.161  17.101 1.00 . A A . 150 GLY HA2  1 1 
        1  2243 1 1 150 GLY HA3  H -12.095  -8.148  18.295 1.00 . A A . 150 GLY HA3  1 1 
        1  2244 1 1 150 GLY N    N -11.688  -6.072  18.412 1.00 . A A . 150 GLY N    1 1 
        1  2245 1 1 150 GLY O    O -14.004  -7.955  19.932 1.00 . A A . 150 GLY O    1 1 
        1  2246 1 1 151 ARG C    C -16.782  -7.036  19.624 1.00 . A A . 151 ARG C    1 1 
        1  2247 1 1 151 ARG CA   C -15.768  -5.911  19.844 1.00 . A A . 151 ARG CA   1 1 
        1  2248 1 1 151 ARG CB   C -16.435  -4.564  19.549 1.00 . A A . 151 ARG CB   1 1 
        1  2249 1 1 151 ARG CD   C -18.234  -2.970  20.236 1.00 . A A . 151 ARG CD   1 1 
        1  2250 1 1 151 ARG CG   C -17.607  -4.340  20.511 1.00 . A A . 151 ARG CG   1 1 
        1  2251 1 1 151 ARG CZ   C -20.507  -3.061  21.108 1.00 . A A . 151 ARG CZ   1 1 
        1  2252 1 1 151 ARG H    H -14.405  -5.415  18.251 1.00 . A A . 151 ARG H    1 1 
        1  2253 1 1 151 ARG HA   H -15.433  -5.926  20.871 1.00 . A A . 151 ARG HA   1 1 
        1  2254 1 1 151 ARG HB2  H -15.712  -3.772  19.674 1.00 . A A . 151 ARG HB2  1 1 
        1  2255 1 1 151 ARG HB3  H -16.801  -4.561  18.533 1.00 . A A . 151 ARG HB3  1 1 
        1  2256 1 1 151 ARG HD2  H -17.464  -2.213  20.269 1.00 . A A . 151 ARG HD2  1 1 
        1  2257 1 1 151 ARG HD3  H -18.691  -2.971  19.257 1.00 . A A . 151 ARG HD3  1 1 
        1  2258 1 1 151 ARG HE   H -19.017  -2.183  22.083 1.00 . A A . 151 ARG HE   1 1 
        1  2259 1 1 151 ARG HG2  H -18.349  -5.110  20.363 1.00 . A A . 151 ARG HG2  1 1 
        1  2260 1 1 151 ARG HG3  H -17.252  -4.372  21.529 1.00 . A A . 151 ARG HG3  1 1 
        1  2261 1 1 151 ARG HH11 H -20.174  -3.929  19.332 1.00 . A A . 151 ARG HH11 1 1 
        1  2262 1 1 151 ARG HH12 H -21.804  -4.009  19.913 1.00 . A A . 151 ARG HH12 1 1 
        1  2263 1 1 151 ARG HH21 H -21.137  -2.291  22.847 1.00 . A A . 151 ARG HH21 1 1 
        1  2264 1 1 151 ARG HH22 H -22.347  -3.087  21.897 1.00 . A A . 151 ARG HH22 1 1 
        1  2265 1 1 151 ARG N    N -14.594  -6.085  18.940 1.00 . A A . 151 ARG N    1 1 
        1  2266 1 1 151 ARG NE   N -19.268  -2.674  21.273 1.00 . A A . 151 ARG NE   1 1 
        1  2267 1 1 151 ARG NH1  N -20.854  -3.718  20.034 1.00 . A A . 151 ARG NH1  1 1 
        1  2268 1 1 151 ARG NH2  N -21.399  -2.792  22.022 1.00 . A A . 151 ARG NH2  1 1 
        1  2269 1 1 151 ARG O    O -17.109  -7.383  18.509 1.00 . A A . 151 ARG O    1 1 
        1  2270 1 1 152 ARG C    C -19.067  -8.823  21.864 1.00 . A A . 152 ARG C    1 1 
        1  2271 1 1 152 ARG CA   C -18.305  -8.680  20.542 1.00 . A A . 152 ARG CA   1 1 
        1  2272 1 1 152 ARG CB   C -17.603 -10.000  20.195 1.00 . A A . 152 ARG CB   1 1 
        1  2273 1 1 152 ARG CD   C -18.795 -10.856  18.139 1.00 . A A . 152 ARG CD   1 1 
        1  2274 1 1 152 ARG CG   C -18.626 -11.022  19.655 1.00 . A A . 152 ARG CG   1 1 
        1  2275 1 1 152 ARG CZ   C -17.201 -12.427  17.208 1.00 . A A . 152 ARG CZ   1 1 
        1  2276 1 1 152 ARG H    H -17.027  -7.290  21.579 1.00 . A A . 152 ARG H    1 1 
        1  2277 1 1 152 ARG HA   H -18.998  -8.421  19.757 1.00 . A A . 152 ARG HA   1 1 
        1  2278 1 1 152 ARG HB2  H -16.841  -9.814  19.448 1.00 . A A . 152 ARG HB2  1 1 
        1  2279 1 1 152 ARG HB3  H -17.138 -10.398  21.084 1.00 . A A . 152 ARG HB3  1 1 
        1  2280 1 1 152 ARG HD2  H -19.570 -11.523  17.787 1.00 . A A . 152 ARG HD2  1 1 
        1  2281 1 1 152 ARG HD3  H -19.072  -9.837  17.913 1.00 . A A . 152 ARG HD3  1 1 
        1  2282 1 1 152 ARG HE   H -16.898 -10.466  17.189 1.00 . A A . 152 ARG HE   1 1 
        1  2283 1 1 152 ARG HG2  H -18.273 -12.024  19.860 1.00 . A A . 152 ARG HG2  1 1 
        1  2284 1 1 152 ARG HG3  H -19.581 -10.875  20.137 1.00 . A A . 152 ARG HG3  1 1 
        1  2285 1 1 152 ARG HH11 H -18.868 -13.164  18.042 1.00 . A A . 152 ARG HH11 1 1 
        1  2286 1 1 152 ARG HH12 H -17.778 -14.337  17.383 1.00 . A A . 152 ARG HH12 1 1 
        1  2287 1 1 152 ARG HH21 H -15.462 -11.981  16.324 1.00 . A A . 152 ARG HH21 1 1 
        1  2288 1 1 152 ARG HH22 H -15.849 -13.667  16.409 1.00 . A A . 152 ARG HH22 1 1 
        1  2289 1 1 152 ARG N    N -17.295  -7.594  20.685 1.00 . A A . 152 ARG N    1 1 
        1  2290 1 1 152 ARG NE   N -17.510 -11.184  17.457 1.00 . A A . 152 ARG NE   1 1 
        1  2291 1 1 152 ARG NH1  N -18.012 -13.385  17.573 1.00 . A A . 152 ARG NH1  1 1 
        1  2292 1 1 152 ARG NH2  N -16.084 -12.714  16.601 1.00 . A A . 152 ARG NH2  1 1 
        1  2293 1 1 152 ARG O    O -18.895  -9.784  22.589 1.00 . A A . 152 ARG O    1 1 
        1  2294 1 1 153 LEU C    C -19.827  -8.434  24.591 1.00 . A A . 153 LEU C    1 1 
        1  2295 1 1 153 LEU CA   C -20.695  -7.911  23.445 1.00 . A A . 153 LEU CA   1 1 
        1  2296 1 1 153 LEU CB   C -21.911  -8.819  23.252 1.00 . A A . 153 LEU CB   1 1 
        1  2297 1 1 153 LEU CD1  C -23.965  -9.226  21.882 1.00 . A A . 153 LEU CD1  1 1 
        1  2298 1 1 153 LEU CD2  C -23.337  -6.874  22.504 1.00 . A A . 153 LEU CD2  1 1 
        1  2299 1 1 153 LEU CG   C -22.796  -8.268  22.125 1.00 . A A . 153 LEU CG   1 1 
        1  2300 1 1 153 LEU H    H -20.018  -7.108  21.563 1.00 . A A . 153 LEU H    1 1 
        1  2301 1 1 153 LEU HA   H -21.028  -6.915  23.692 1.00 . A A . 153 LEU HA   1 1 
        1  2302 1 1 153 LEU HB2  H -21.579  -9.814  22.994 1.00 . A A . 153 LEU HB2  1 1 
        1  2303 1 1 153 LEU HB3  H -22.482  -8.857  24.169 1.00 . A A . 153 LEU HB3  1 1 
        1  2304 1 1 153 LEU HD11 H -23.583 -10.218  21.691 1.00 . A A . 153 LEU HD11 1 1 
        1  2305 1 1 153 LEU HD12 H -24.533  -8.888  21.029 1.00 . A A . 153 LEU HD12 1 1 
        1  2306 1 1 153 LEU HD13 H -24.601  -9.246  22.755 1.00 . A A . 153 LEU HD13 1 1 
        1  2307 1 1 153 LEU HD21 H -24.258  -6.682  21.973 1.00 . A A . 153 LEU HD21 1 1 
        1  2308 1 1 153 LEU HD22 H -22.610  -6.122  22.234 1.00 . A A . 153 LEU HD22 1 1 
        1  2309 1 1 153 LEU HD23 H -23.522  -6.830  23.569 1.00 . A A . 153 LEU HD23 1 1 
        1  2310 1 1 153 LEU HG   H -22.207  -8.189  21.222 1.00 . A A . 153 LEU HG   1 1 
        1  2311 1 1 153 LEU N    N -19.906  -7.866  22.173 1.00 . A A . 153 LEU N    1 1 
        1  2312 1 1 153 LEU O    O -19.728  -9.623  24.819 1.00 . A A . 153 LEU O    1 1 
        1  2313 1 1 154 GLU C    C -18.949  -7.470  27.773 1.00 . A A . 154 GLU C    1 1 
        1  2314 1 1 154 GLU CA   C -18.319  -7.942  26.458 1.00 . A A . 154 GLU CA   1 1 
        1  2315 1 1 154 GLU CB   C -16.935  -7.306  26.291 1.00 . A A . 154 GLU CB   1 1 
        1  2316 1 1 154 GLU CD   C -17.556  -5.604  24.563 1.00 . A A . 154 GLU CD   1 1 
        1  2317 1 1 154 GLU CG   C -17.073  -5.807  26.001 1.00 . A A . 154 GLU CG   1 1 
        1  2318 1 1 154 GLU H    H -19.303  -6.589  25.098 1.00 . A A . 154 GLU H    1 1 
        1  2319 1 1 154 GLU HA   H -18.213  -9.020  26.485 1.00 . A A . 154 GLU HA   1 1 
        1  2320 1 1 154 GLU HB2  H -16.364  -7.444  27.197 1.00 . A A . 154 GLU HB2  1 1 
        1  2321 1 1 154 GLU HB3  H -16.421  -7.781  25.468 1.00 . A A . 154 GLU HB3  1 1 
        1  2322 1 1 154 GLU HG2  H -17.788  -5.373  26.686 1.00 . A A . 154 GLU HG2  1 1 
        1  2323 1 1 154 GLU HG3  H -16.116  -5.325  26.128 1.00 . A A . 154 GLU HG3  1 1 
        1  2324 1 1 154 GLU N    N -19.197  -7.539  25.314 1.00 . A A . 154 GLU N    1 1 
        1  2325 1 1 154 GLU O    O -19.614  -6.456  27.829 1.00 . A A . 154 GLU O    1 1 
        1  2326 1 1 154 GLU OE1  O -17.203  -6.413  23.721 1.00 . A A . 154 GLU OE1  1 1 
        1  2327 1 1 154 GLU OE2  O -18.265  -4.640  24.326 1.00 . A A . 154 GLU OE2  1 1 
        1  2328 1 1 155 HIS C    C -18.767  -6.502  30.625 1.00 . A A . 155 HIS C    1 1 
        1  2329 1 1 155 HIS CA   C -19.341  -7.835  30.143 1.00 . A A . 155 HIS CA   1 1 
        1  2330 1 1 155 HIS CB   C -19.006  -8.918  31.164 1.00 . A A . 155 HIS CB   1 1 
        1  2331 1 1 155 HIS CD2  C -19.101 -11.404  30.328 1.00 . A A . 155 HIS CD2  1 1 
        1  2332 1 1 155 HIS CE1  C -21.255 -11.639  30.292 1.00 . A A . 155 HIS CE1  1 1 
        1  2333 1 1 155 HIS CG   C -19.640 -10.211  30.740 1.00 . A A . 155 HIS CG   1 1 
        1  2334 1 1 155 HIS H    H -18.219  -9.030  28.749 1.00 . A A . 155 HIS H    1 1 
        1  2335 1 1 155 HIS HA   H -20.414  -7.752  30.048 1.00 . A A . 155 HIS HA   1 1 
        1  2336 1 1 155 HIS HB2  H -17.934  -9.041  31.216 1.00 . A A . 155 HIS HB2  1 1 
        1  2337 1 1 155 HIS HB3  H -19.384  -8.632  32.134 1.00 . A A . 155 HIS HB3  1 1 
        1  2338 1 1 155 HIS HD1  H -21.687  -9.710  30.943 1.00 . A A . 155 HIS HD1  1 1 
        1  2339 1 1 155 HIS HD2  H -18.046 -11.610  30.234 1.00 . A A . 155 HIS HD2  1 1 
        1  2340 1 1 155 HIS HE1  H -22.243 -12.058  30.173 1.00 . A A . 155 HIS HE1  1 1 
        1  2341 1 1 155 HIS N    N -18.751  -8.212  28.826 1.00 . A A . 155 HIS N    1 1 
        1  2342 1 1 155 HIS ND1  N -21.014 -10.382  30.709 1.00 . A A . 155 HIS ND1  1 1 
        1  2343 1 1 155 HIS NE2  N -20.124 -12.305  30.045 1.00 . A A . 155 HIS NE2  1 1 
        1  2344 1 1 155 HIS O    O -17.881  -5.938  30.016 1.00 . A A . 155 HIS O    1 1 
        1  2345 1 1 156 HIS C    C -18.832  -4.723  33.796 1.00 . A A . 156 HIS C    1 1 
        1  2346 1 1 156 HIS CA   C -18.749  -4.703  32.268 1.00 . A A . 156 HIS CA   1 1 
        1  2347 1 1 156 HIS CB   C -19.581  -3.543  31.719 1.00 . A A . 156 HIS CB   1 1 
        1  2348 1 1 156 HIS CD2  C -21.784  -3.322  33.136 1.00 . A A . 156 HIS CD2  1 1 
        1  2349 1 1 156 HIS CE1  C -23.111  -4.427  31.828 1.00 . A A . 156 HIS CE1  1 1 
        1  2350 1 1 156 HIS CG   C -21.031  -3.743  32.069 1.00 . A A . 156 HIS CG   1 1 
        1  2351 1 1 156 HIS H    H -19.975  -6.477  32.203 1.00 . A A . 156 HIS H    1 1 
        1  2352 1 1 156 HIS HA   H -17.716  -4.572  31.973 1.00 . A A . 156 HIS HA   1 1 
        1  2353 1 1 156 HIS HB2  H -19.233  -2.616  32.151 1.00 . A A . 156 HIS HB2  1 1 
        1  2354 1 1 156 HIS HB3  H -19.474  -3.501  30.645 1.00 . A A . 156 HIS HB3  1 1 
        1  2355 1 1 156 HIS HD1  H -21.667  -4.883  30.401 1.00 . A A . 156 HIS HD1  1 1 
        1  2356 1 1 156 HIS HD2  H -21.414  -2.742  33.969 1.00 . A A . 156 HIS HD2  1 1 
        1  2357 1 1 156 HIS HE1  H -23.991  -4.893  31.408 1.00 . A A . 156 HIS HE1  1 1 
        1  2358 1 1 156 HIS N    N -19.263  -5.998  31.726 1.00 . A A . 156 HIS N    1 1 
        1  2359 1 1 156 HIS ND1  N -21.897  -4.447  31.248 1.00 . A A . 156 HIS ND1  1 1 
        1  2360 1 1 156 HIS NE2  N -23.098  -3.755  32.982 1.00 . A A . 156 HIS NE2  1 1 
        1  2361 1 1 156 HIS O    O -19.481  -5.566  34.383 1.00 . A A . 156 HIS O    1 1 
        1  2362 1 1 157 HIS C    C -19.551  -3.276  36.428 1.00 . A A . 157 HIS C    1 1 
        1  2363 1 1 157 HIS CA   C -18.191  -3.780  35.934 1.00 . A A . 157 HIS CA   1 1 
        1  2364 1 1 157 HIS CB   C -17.082  -2.855  36.433 1.00 . A A . 157 HIS CB   1 1 
        1  2365 1 1 157 HIS CD2  C -16.272  -3.705  38.780 1.00 . A A . 157 HIS CD2  1 1 
        1  2366 1 1 157 HIS CE1  C -17.483  -2.405  40.018 1.00 . A A . 157 HIS CE1  1 1 
        1  2367 1 1 157 HIS CG   C -17.012  -2.921  37.931 1.00 . A A . 157 HIS CG   1 1 
        1  2368 1 1 157 HIS H    H -17.643  -3.144  33.951 1.00 . A A . 157 HIS H    1 1 
        1  2369 1 1 157 HIS HA   H -18.021  -4.777  36.313 1.00 . A A . 157 HIS HA   1 1 
        1  2370 1 1 157 HIS HB2  H -16.137  -3.168  36.013 1.00 . A A . 157 HIS HB2  1 1 
        1  2371 1 1 157 HIS HB3  H -17.293  -1.841  36.127 1.00 . A A . 157 HIS HB3  1 1 
        1  2372 1 1 157 HIS HD1  H -18.418  -1.423  38.440 1.00 . A A . 157 HIS HD1  1 1 
        1  2373 1 1 157 HIS HD2  H -15.568  -4.464  38.471 1.00 . A A . 157 HIS HD2  1 1 
        1  2374 1 1 157 HIS HE1  H -17.929  -1.921  40.874 1.00 . A A . 157 HIS HE1  1 1 
        1  2375 1 1 157 HIS N    N -18.167  -3.809  34.444 1.00 . A A . 157 HIS N    1 1 
        1  2376 1 1 157 HIS ND1  N -17.777  -2.100  38.741 1.00 . A A . 157 HIS ND1  1 1 
        1  2377 1 1 157 HIS NE2  N -16.571  -3.377  40.098 1.00 . A A . 157 HIS NE2  1 1 
        1  2378 1 1 157 HIS O    O -20.081  -2.300  35.939 1.00 . A A . 157 HIS O    1 1 
        1  2379 1 1 158 HIS C    C -21.296  -2.328  38.865 1.00 . A A . 158 HIS C    1 1 
        1  2380 1 1 158 HIS CA   C -21.452  -3.527  37.924 1.00 . A A . 158 HIS CA   1 1 
        1  2381 1 1 158 HIS CB   C -22.071  -4.697  38.685 1.00 . A A . 158 HIS CB   1 1 
        1  2382 1 1 158 HIS CD2  C -22.237  -5.902  36.354 1.00 . A A . 158 HIS CD2  1 1 
        1  2383 1 1 158 HIS CE1  C -22.896  -7.842  37.052 1.00 . A A . 158 HIS CE1  1 1 
        1  2384 1 1 158 HIS CG   C -22.335  -5.822  37.722 1.00 . A A . 158 HIS CG   1 1 
        1  2385 1 1 158 HIS H    H -19.676  -4.733  37.769 1.00 . A A . 158 HIS H    1 1 
        1  2386 1 1 158 HIS HA   H -22.098  -3.252  37.105 1.00 . A A . 158 HIS HA   1 1 
        1  2387 1 1 158 HIS HB2  H -21.385  -5.030  39.450 1.00 . A A . 158 HIS HB2  1 1 
        1  2388 1 1 158 HIS HB3  H -22.999  -4.386  39.140 1.00 . A A . 158 HIS HB3  1 1 
        1  2389 1 1 158 HIS HD1  H -22.920  -7.344  39.071 1.00 . A A . 158 HIS HD1  1 1 
        1  2390 1 1 158 HIS HD2  H -21.926  -5.098  35.702 1.00 . A A . 158 HIS HD2  1 1 
        1  2391 1 1 158 HIS HE1  H -23.215  -8.873  37.074 1.00 . A A . 158 HIS HE1  1 1 
        1  2392 1 1 158 HIS N    N -20.121  -3.946  37.394 1.00 . A A . 158 HIS N    1 1 
        1  2393 1 1 158 HIS ND1  N -22.756  -7.071  38.145 1.00 . A A . 158 HIS ND1  1 1 
        1  2394 1 1 158 HIS NE2  N -22.593  -7.179  35.933 1.00 . A A . 158 HIS NE2  1 1 
        1  2395 1 1 158 HIS O    O -20.284  -2.157  39.511 1.00 . A A . 158 HIS O    1 1 
        1  2396 1 1 159 HIS C    C -22.214  -0.737  41.293 1.00 . A A . 159 HIS C    1 1 
        1  2397 1 1 159 HIS CA   C -22.225  -0.303  39.825 1.00 . A A . 159 HIS CA   1 1 
        1  2398 1 1 159 HIS CB   C -23.441   0.590  39.569 1.00 . A A . 159 HIS CB   1 1 
        1  2399 1 1 159 HIS CD2  C -25.125  -1.427  39.783 1.00 . A A . 159 HIS CD2  1 1 
        1  2400 1 1 159 HIS CE1  C -26.700  -0.401  40.859 1.00 . A A . 159 HIS CE1  1 1 
        1  2401 1 1 159 HIS CG   C -24.700  -0.133  39.972 1.00 . A A . 159 HIS CG   1 1 
        1  2402 1 1 159 HIS H    H -23.104  -1.657  38.403 1.00 . A A . 159 HIS H    1 1 
        1  2403 1 1 159 HIS HA   H -21.323   0.250  39.609 1.00 . A A . 159 HIS HA   1 1 
        1  2404 1 1 159 HIS HB2  H -23.349   1.498  40.147 1.00 . A A . 159 HIS HB2  1 1 
        1  2405 1 1 159 HIS HB3  H -23.490   0.836  38.520 1.00 . A A . 159 HIS HB3  1 1 
        1  2406 1 1 159 HIS HD1  H -25.729   1.436  40.954 1.00 . A A . 159 HIS HD1  1 1 
        1  2407 1 1 159 HIS HD2  H -24.567  -2.199  39.274 1.00 . A A . 159 HIS HD2  1 1 
        1  2408 1 1 159 HIS HE1  H -27.626  -0.187  41.370 1.00 . A A . 159 HIS HE1  1 1 
        1  2409 1 1 159 HIS N    N -22.299  -1.497  38.938 1.00 . A A . 159 HIS N    1 1 
        1  2410 1 1 159 HIS ND1  N -25.722   0.501  40.662 1.00 . A A . 159 HIS ND1  1 1 
        1  2411 1 1 159 HIS NE2  N -26.388  -1.592  40.343 1.00 . A A . 159 HIS NE2  1 1 
        1  2412 1 1 159 HIS O    O -22.891  -1.666  41.684 1.00 . A A . 159 HIS O    1 1 
        1  2413 1 1 160 HIS C    C -20.920   0.793  44.353 1.00 . A A . 160 HIS C    1 1 
        1  2414 1 1 160 HIS CA   C -21.381  -0.428  43.553 1.00 . A A . 160 HIS CA   1 1 
        1  2415 1 1 160 HIS CB   C -20.385  -1.574  43.750 1.00 . A A . 160 HIS CB   1 1 
        1  2416 1 1 160 HIS CD2  C -19.215  -1.547  46.102 1.00 . A A . 160 HIS CD2  1 1 
        1  2417 1 1 160 HIS CE1  C -20.741  -2.598  47.226 1.00 . A A . 160 HIS CE1  1 1 
        1  2418 1 1 160 HIS CG   C -20.222  -1.850  45.219 1.00 . A A . 160 HIS CG   1 1 
        1  2419 1 1 160 HIS H    H -20.910   0.680  41.768 1.00 . A A . 160 HIS H    1 1 
        1  2420 1 1 160 HIS HA   H -22.359  -0.736  43.896 1.00 . A A . 160 HIS HA   1 1 
        1  2421 1 1 160 HIS HB2  H -20.754  -2.460  43.255 1.00 . A A . 160 HIS HB2  1 1 
        1  2422 1 1 160 HIS HB3  H -19.431  -1.296  43.328 1.00 . A A . 160 HIS HB3  1 1 
        1  2423 1 1 160 HIS HD1  H -22.033  -2.873  45.618 1.00 . A A . 160 HIS HD1  1 1 
        1  2424 1 1 160 HIS HD2  H -18.306  -1.022  45.852 1.00 . A A . 160 HIS HD2  1 1 
        1  2425 1 1 160 HIS HE1  H -21.286  -3.069  48.031 1.00 . A A . 160 HIS HE1  1 1 
        1  2426 1 1 160 HIS N    N -21.446  -0.066  42.108 1.00 . A A . 160 HIS N    1 1 
        1  2427 1 1 160 HIS ND1  N -21.185  -2.520  45.957 1.00 . A A . 160 HIS ND1  1 1 
        1  2428 1 1 160 HIS NE2  N -19.545  -2.020  47.369 1.00 . A A . 160 HIS NE2  1 1 
        1  2429 1 1 160 HIS O    O -19.921   1.381  43.972 1.00 . A A . 160 HIS O    1 1 
        1  2430 1 1 160 HIS OXT  O -21.573   1.118  45.330 1.00 . A A . 160 HIS OXT  1 1 
        2  2431 1 1   1 MET C    C  35.318   2.890  -3.209 1.00 . A A .   1 MET C    1 1 
        2  2432 1 1   1 MET CA   C  35.700   4.264  -2.647 1.00 . A A .   1 MET CA   1 1 
        2  2433 1 1   1 MET CB   C  34.968   4.496  -1.322 1.00 . A A .   1 MET CB   1 1 
        2  2434 1 1   1 MET CE   C  37.087   4.529   1.069 1.00 . A A .   1 MET CE   1 1 
        2  2435 1 1   1 MET CG   C  35.432   5.815  -0.692 1.00 . A A .   1 MET CG   1 1 
        2  2436 1 1   1 MET H1   H  36.181   5.763  -4.011 1.00 . A A .   1 MET H1   1 1 
        2  2437 1 1   1 MET H2   H  34.756   6.056  -3.134 1.00 . A A .   1 MET H2   1 1 
        2  2438 1 1   1 MET H3   H  34.763   4.914  -4.392 1.00 . A A .   1 MET H3   1 1 
        2  2439 1 1   1 MET HA   H  36.764   4.292  -2.481 1.00 . A A .   1 MET HA   1 1 
        2  2440 1 1   1 MET HB2  H  33.904   4.541  -1.504 1.00 . A A .   1 MET HB2  1 1 
        2  2441 1 1   1 MET HB3  H  35.183   3.682  -0.647 1.00 . A A .   1 MET HB3  1 1 
        2  2442 1 1   1 MET HE1  H  36.159   4.675   1.604 1.00 . A A .   1 MET HE1  1 1 
        2  2443 1 1   1 MET HE2  H  37.921   4.672   1.741 1.00 . A A .   1 MET HE2  1 1 
        2  2444 1 1   1 MET HE3  H  37.117   3.528   0.672 1.00 . A A .   1 MET HE3  1 1 
        2  2445 1 1   1 MET HG2  H  35.269   6.620  -1.394 1.00 . A A .   1 MET HG2  1 1 
        2  2446 1 1   1 MET HG3  H  34.863   6.004   0.207 1.00 . A A .   1 MET HG3  1 1 
        2  2447 1 1   1 MET N    N  35.320   5.329  -3.620 1.00 . A A .   1 MET N    1 1 
        2  2448 1 1   1 MET O    O  34.842   2.773  -4.319 1.00 . A A .   1 MET O    1 1 
        2  2449 1 1   1 MET SD   S  37.198   5.724  -0.287 1.00 . A A .   1 MET SD   1 1 
        2  2450 1 1   2 GLU C    C  33.690   0.338  -3.126 1.00 . A A .   2 GLU C    1 1 
        2  2451 1 1   2 GLU CA   C  35.203   0.480  -2.934 1.00 . A A .   2 GLU CA   1 1 
        2  2452 1 1   2 GLU CB   C  35.693  -0.551  -1.915 1.00 . A A .   2 GLU CB   1 1 
        2  2453 1 1   2 GLU CD   C  35.993  -2.988  -1.467 1.00 . A A .   2 GLU CD   1 1 
        2  2454 1 1   2 GLU CG   C  35.414  -1.960  -2.439 1.00 . A A .   2 GLU CG   1 1 
        2  2455 1 1   2 GLU H    H  35.927   1.970  -1.558 1.00 . A A .   2 GLU H    1 1 
        2  2456 1 1   2 GLU HA   H  35.697   0.308  -3.879 1.00 . A A .   2 GLU HA   1 1 
        2  2457 1 1   2 GLU HB2  H  36.755  -0.429  -1.762 1.00 . A A .   2 GLU HB2  1 1 
        2  2458 1 1   2 GLU HB3  H  35.175  -0.408  -0.979 1.00 . A A .   2 GLU HB3  1 1 
        2  2459 1 1   2 GLU HG2  H  34.346  -2.110  -2.524 1.00 . A A .   2 GLU HG2  1 1 
        2  2460 1 1   2 GLU HG3  H  35.872  -2.083  -3.407 1.00 . A A .   2 GLU HG3  1 1 
        2  2461 1 1   2 GLU N    N  35.535   1.851  -2.448 1.00 . A A .   2 GLU N    1 1 
        2  2462 1 1   2 GLU O    O  32.903   0.824  -2.341 1.00 . A A .   2 GLU O    1 1 
        2  2463 1 1   2 GLU OE1  O  36.797  -2.597  -0.636 1.00 . A A .   2 GLU OE1  1 1 
        2  2464 1 1   2 GLU OE2  O  35.628  -4.147  -1.572 1.00 . A A .   2 GLU OE2  1 1 
        2  2465 1 1   3 LYS C    C  31.259  -1.589  -3.503 1.00 . A A .   3 LYS C    1 1 
        2  2466 1 1   3 LYS CA   C  31.832  -0.520  -4.438 1.00 . A A .   3 LYS CA   1 1 
        2  2467 1 1   3 LYS CB   C  31.650  -0.973  -5.888 1.00 . A A .   3 LYS CB   1 1 
        2  2468 1 1   3 LYS CD   C  31.860  -0.283  -8.277 1.00 . A A .   3 LYS CD   1 1 
        2  2469 1 1   3 LYS CE   C  32.201   0.871  -9.219 1.00 . A A .   3 LYS CE   1 1 
        2  2470 1 1   3 LYS CG   C  32.021   0.173  -6.827 1.00 . A A .   3 LYS CG   1 1 
        2  2471 1 1   3 LYS H    H  33.947  -0.714  -4.787 1.00 . A A .   3 LYS H    1 1 
        2  2472 1 1   3 LYS HA   H  31.310   0.413  -4.285 1.00 . A A .   3 LYS HA   1 1 
        2  2473 1 1   3 LYS HB2  H  32.293  -1.820  -6.080 1.00 . A A .   3 LYS HB2  1 1 
        2  2474 1 1   3 LYS HB3  H  30.621  -1.255  -6.053 1.00 . A A .   3 LYS HB3  1 1 
        2  2475 1 1   3 LYS HD2  H  32.524  -1.114  -8.468 1.00 . A A .   3 LYS HD2  1 1 
        2  2476 1 1   3 LYS HD3  H  30.839  -0.593  -8.445 1.00 . A A .   3 LYS HD3  1 1 
        2  2477 1 1   3 LYS HE2  H  31.538   1.701  -9.026 1.00 . A A .   3 LYS HE2  1 1 
        2  2478 1 1   3 LYS HE3  H  33.223   1.181  -9.054 1.00 . A A .   3 LYS HE3  1 1 
        2  2479 1 1   3 LYS HG2  H  31.372   1.016  -6.639 1.00 . A A .   3 LYS HG2  1 1 
        2  2480 1 1   3 LYS HG3  H  33.046   0.464  -6.655 1.00 . A A .   3 LYS HG3  1 1 
        2  2481 1 1   3 LYS HZ1  H  31.236   0.921 -11.064 1.00 . A A .   3 LYS HZ1  1 1 
        2  2482 1 1   3 LYS HZ2  H  31.864  -0.601 -10.653 1.00 . A A .   3 LYS HZ2  1 1 
        2  2483 1 1   3 LYS HZ3  H  32.909   0.638 -11.164 1.00 . A A .   3 LYS HZ3  1 1 
        2  2484 1 1   3 LYS N    N  33.287  -0.332  -4.171 1.00 . A A .   3 LYS N    1 1 
        2  2485 1 1   3 LYS NZ   N  32.040   0.424 -10.631 1.00 . A A .   3 LYS NZ   1 1 
        2  2486 1 1   3 LYS O    O  31.903  -2.573  -3.203 1.00 . A A .   3 LYS O    1 1 
        2  2487 1 1   4 ALA C    C  27.913  -2.195  -2.096 1.00 . A A .   4 ALA C    1 1 
        2  2488 1 1   4 ALA CA   C  29.428  -2.415  -2.140 1.00 . A A .   4 ALA CA   1 1 
        2  2489 1 1   4 ALA CB   C  30.007  -2.267  -0.731 1.00 . A A .   4 ALA CB   1 1 
        2  2490 1 1   4 ALA H    H  29.542  -0.606  -3.307 1.00 . A A .   4 ALA H    1 1 
        2  2491 1 1   4 ALA HA   H  29.637  -3.408  -2.513 1.00 . A A .   4 ALA HA   1 1 
        2  2492 1 1   4 ALA HB1  H  29.749  -1.298  -0.334 1.00 . A A .   4 ALA HB1  1 1 
        2  2493 1 1   4 ALA HB2  H  31.082  -2.368  -0.770 1.00 . A A .   4 ALA HB2  1 1 
        2  2494 1 1   4 ALA HB3  H  29.598  -3.038  -0.093 1.00 . A A .   4 ALA HB3  1 1 
        2  2495 1 1   4 ALA N    N  30.047  -1.405  -3.047 1.00 . A A .   4 ALA N    1 1 
        2  2496 1 1   4 ALA O    O  27.440  -1.131  -1.748 1.00 . A A .   4 ALA O    1 1 
        2  2497 1 1   5 MET C    C  25.235  -1.716  -3.005 1.00 . A A .   5 MET C    1 1 
        2  2498 1 1   5 MET CA   C  25.660  -3.070  -2.432 1.00 . A A .   5 MET CA   1 1 
        2  2499 1 1   5 MET CB   C  25.150  -3.194  -0.995 1.00 . A A .   5 MET CB   1 1 
        2  2500 1 1   5 MET CE   C  26.924  -4.449   1.635 1.00 . A A .   5 MET CE   1 1 
        2  2501 1 1   5 MET CG   C  25.301  -4.642  -0.525 1.00 . A A .   5 MET CG   1 1 
        2  2502 1 1   5 MET H    H  27.559  -4.046  -2.721 1.00 . A A .   5 MET H    1 1 
        2  2503 1 1   5 MET HA   H  25.228  -3.859  -3.030 1.00 . A A .   5 MET HA   1 1 
        2  2504 1 1   5 MET HB2  H  25.721  -2.540  -0.353 1.00 . A A .   5 MET HB2  1 1 
        2  2505 1 1   5 MET HB3  H  24.108  -2.912  -0.959 1.00 . A A .   5 MET HB3  1 1 
        2  2506 1 1   5 MET HE1  H  27.076  -4.445   2.706 1.00 . A A .   5 MET HE1  1 1 
        2  2507 1 1   5 MET HE2  H  27.240  -3.504   1.217 1.00 . A A .   5 MET HE2  1 1 
        2  2508 1 1   5 MET HE3  H  27.502  -5.247   1.195 1.00 . A A .   5 MET HE3  1 1 
        2  2509 1 1   5 MET HG2  H  24.521  -5.245  -0.965 1.00 . A A .   5 MET HG2  1 1 
        2  2510 1 1   5 MET HG3  H  26.265  -5.022  -0.829 1.00 . A A .   5 MET HG3  1 1 
        2  2511 1 1   5 MET N    N  27.150  -3.199  -2.447 1.00 . A A .   5 MET N    1 1 
        2  2512 1 1   5 MET O    O  24.785  -0.846  -2.288 1.00 . A A .   5 MET O    1 1 
        2  2513 1 1   5 MET SD   S  25.169  -4.708   1.278 1.00 . A A .   5 MET SD   1 1 
        2  2514 1 1   6 PRO C    C  23.504   0.079  -4.797 1.00 . A A .   6 PRO C    1 1 
        2  2515 1 1   6 PRO CA   C  24.990  -0.274  -4.983 1.00 . A A .   6 PRO CA   1 1 
        2  2516 1 1   6 PRO CB   C  25.310  -0.556  -6.466 1.00 . A A .   6 PRO CB   1 1 
        2  2517 1 1   6 PRO CD   C  25.921  -2.532  -5.234 1.00 . A A .   6 PRO CD   1 1 
        2  2518 1 1   6 PRO CG   C  26.302  -1.674  -6.436 1.00 . A A .   6 PRO CG   1 1 
        2  2519 1 1   6 PRO HA   H  25.608   0.539  -4.633 1.00 . A A .   6 PRO HA   1 1 
        2  2520 1 1   6 PRO HB2  H  24.413  -0.864  -6.995 1.00 . A A .   6 PRO HB2  1 1 
        2  2521 1 1   6 PRO HB3  H  25.743   0.313  -6.939 1.00 . A A .   6 PRO HB3  1 1 
        2  2522 1 1   6 PRO HD2  H  25.172  -3.262  -5.511 1.00 . A A .   6 PRO HD2  1 1 
        2  2523 1 1   6 PRO HD3  H  26.791  -3.011  -4.812 1.00 . A A .   6 PRO HD3  1 1 
        2  2524 1 1   6 PRO HG2  H  26.245  -2.255  -7.349 1.00 . A A .   6 PRO HG2  1 1 
        2  2525 1 1   6 PRO HG3  H  27.301  -1.286  -6.304 1.00 . A A .   6 PRO HG3  1 1 
        2  2526 1 1   6 PRO N    N  25.373  -1.544  -4.291 1.00 . A A .   6 PRO N    1 1 
        2  2527 1 1   6 PRO O    O  22.649  -0.784  -4.770 1.00 . A A .   6 PRO O    1 1 
        2  2528 1 1   7 GLU C    C  21.181   1.155  -3.260 1.00 . A A .   7 GLU C    1 1 
        2  2529 1 1   7 GLU CA   C  21.805   1.803  -4.499 1.00 . A A .   7 GLU CA   1 1 
        2  2530 1 1   7 GLU CB   C  20.991   1.451  -5.742 1.00 . A A .   7 GLU CB   1 1 
        2  2531 1 1   7 GLU CD   C  18.778   1.752  -6.862 1.00 . A A .   7 GLU CD   1 1 
        2  2532 1 1   7 GLU CG   C  19.588   2.029  -5.596 1.00 . A A .   7 GLU CG   1 1 
        2  2533 1 1   7 GLU H    H  23.922   2.010  -4.707 1.00 . A A .   7 GLU H    1 1 
        2  2534 1 1   7 GLU HA   H  21.797   2.875  -4.370 1.00 . A A .   7 GLU HA   1 1 
        2  2535 1 1   7 GLU HB2  H  21.468   1.872  -6.616 1.00 . A A .   7 GLU HB2  1 1 
        2  2536 1 1   7 GLU HB3  H  20.928   0.380  -5.845 1.00 . A A .   7 GLU HB3  1 1 
        2  2537 1 1   7 GLU HG2  H  19.104   1.569  -4.753 1.00 . A A .   7 GLU HG2  1 1 
        2  2538 1 1   7 GLU HG3  H  19.653   3.095  -5.437 1.00 . A A .   7 GLU HG3  1 1 
        2  2539 1 1   7 GLU N    N  23.210   1.348  -4.676 1.00 . A A .   7 GLU N    1 1 
        2  2540 1 1   7 GLU O    O  21.547   0.070  -2.854 1.00 . A A .   7 GLU O    1 1 
        2  2541 1 1   7 GLU OE1  O  19.223   0.945  -7.662 1.00 . A A .   7 GLU OE1  1 1 
        2  2542 1 1   7 GLU OE2  O  17.727   2.351  -7.010 1.00 . A A .   7 GLU OE2  1 1 
        2  2543 1 1   8 SER C    C  18.624   0.145  -1.821 1.00 . A A .   8 SER C    1 1 
        2  2544 1 1   8 SER CA   C  19.563   1.294  -1.443 1.00 . A A .   8 SER CA   1 1 
        2  2545 1 1   8 SER CB   C  18.759   2.416  -0.787 1.00 . A A .   8 SER CB   1 1 
        2  2546 1 1   8 SER H    H  19.965   2.703  -3.014 1.00 . A A .   8 SER H    1 1 
        2  2547 1 1   8 SER HA   H  20.308   0.934  -0.748 1.00 . A A .   8 SER HA   1 1 
        2  2548 1 1   8 SER HB2  H  18.575   2.175   0.246 1.00 . A A .   8 SER HB2  1 1 
        2  2549 1 1   8 SER HB3  H  19.322   3.339  -0.844 1.00 . A A .   8 SER HB3  1 1 
        2  2550 1 1   8 SER HG   H  17.510   3.420  -1.892 1.00 . A A .   8 SER HG   1 1 
        2  2551 1 1   8 SER N    N  20.235   1.829  -2.661 1.00 . A A .   8 SER N    1 1 
        2  2552 1 1   8 SER O    O  18.294  -0.050  -2.972 1.00 . A A .   8 SER O    1 1 
        2  2553 1 1   8 SER OG   O  17.516   2.560  -1.462 1.00 . A A .   8 SER OG   1 1 
        2  2554 1 1   9 PHE C    C  15.888  -1.246  -1.470 1.00 . A A .   9 PHE C    1 1 
        2  2555 1 1   9 PHE CA   C  17.288  -1.762  -1.135 1.00 . A A .   9 PHE CA   1 1 
        2  2556 1 1   9 PHE CB   C  17.220  -2.650   0.106 1.00 . A A .   9 PHE CB   1 1 
        2  2557 1 1   9 PHE CD1  C  19.147  -4.230  -0.222 1.00 . A A .   9 PHE CD1  1 1 
        2  2558 1 1   9 PHE CD2  C  19.365  -2.452   1.413 1.00 . A A .   9 PHE CD2  1 1 
        2  2559 1 1   9 PHE CE1  C  20.440  -4.669   0.083 1.00 . A A .   9 PHE CE1  1 1 
        2  2560 1 1   9 PHE CE2  C  20.658  -2.889   1.716 1.00 . A A .   9 PHE CE2  1 1 
        2  2561 1 1   9 PHE CG   C  18.610  -3.124   0.443 1.00 . A A .   9 PHE CG   1 1 
        2  2562 1 1   9 PHE CZ   C  21.197  -3.999   1.052 1.00 . A A .   9 PHE CZ   1 1 
        2  2563 1 1   9 PHE H    H  18.485  -0.438   0.068 1.00 . A A .   9 PHE H    1 1 
        2  2564 1 1   9 PHE HA   H  17.672  -2.334  -1.965 1.00 . A A .   9 PHE HA   1 1 
        2  2565 1 1   9 PHE HB2  H  16.820  -2.083   0.934 1.00 . A A .   9 PHE HB2  1 1 
        2  2566 1 1   9 PHE HB3  H  16.586  -3.501  -0.090 1.00 . A A .   9 PHE HB3  1 1 
        2  2567 1 1   9 PHE HD1  H  18.563  -4.746  -0.970 1.00 . A A .   9 PHE HD1  1 1 
        2  2568 1 1   9 PHE HD2  H  18.948  -1.597   1.924 1.00 . A A .   9 PHE HD2  1 1 
        2  2569 1 1   9 PHE HE1  H  20.855  -5.524  -0.430 1.00 . A A .   9 PHE HE1  1 1 
        2  2570 1 1   9 PHE HE2  H  21.242  -2.371   2.463 1.00 . A A .   9 PHE HE2  1 1 
        2  2571 1 1   9 PHE HZ   H  22.195  -4.336   1.286 1.00 . A A .   9 PHE HZ   1 1 
        2  2572 1 1   9 PHE N    N  18.200  -0.617  -0.853 1.00 . A A .   9 PHE N    1 1 
        2  2573 1 1   9 PHE O    O  15.422  -0.277  -0.910 1.00 . A A .   9 PHE O    1 1 
        2  2574 1 1  10 VAL C    C  12.895  -2.673  -2.636 1.00 . A A .  10 VAL C    1 1 
        2  2575 1 1  10 VAL CA   C  13.834  -1.477  -2.783 1.00 . A A .  10 VAL CA   1 1 
        2  2576 1 1  10 VAL CB   C  13.847  -1.012  -4.243 1.00 . A A .  10 VAL CB   1 1 
        2  2577 1 1  10 VAL CG1  C  12.412  -0.818  -4.746 1.00 . A A .  10 VAL CG1  1 1 
        2  2578 1 1  10 VAL CG2  C  14.604   0.314  -4.340 1.00 . A A .  10 VAL CG2  1 1 
        2  2579 1 1  10 VAL H    H  15.622  -2.681  -2.816 1.00 . A A .  10 VAL H    1 1 
        2  2580 1 1  10 VAL HA   H  13.489  -0.670  -2.147 1.00 . A A .  10 VAL HA   1 1 
        2  2581 1 1  10 VAL HB   H  14.342  -1.755  -4.852 1.00 . A A .  10 VAL HB   1 1 
        2  2582 1 1  10 VAL HG11 H  11.965  -1.784  -4.933 1.00 . A A .  10 VAL HG11 1 1 
        2  2583 1 1  10 VAL HG12 H  12.423  -0.243  -5.660 1.00 . A A .  10 VAL HG12 1 1 
        2  2584 1 1  10 VAL HG13 H  11.836  -0.294  -3.998 1.00 . A A .  10 VAL HG13 1 1 
        2  2585 1 1  10 VAL HG21 H  14.709   0.593  -5.377 1.00 . A A .  10 VAL HG21 1 1 
        2  2586 1 1  10 VAL HG22 H  15.583   0.199  -3.895 1.00 . A A .  10 VAL HG22 1 1 
        2  2587 1 1  10 VAL HG23 H  14.057   1.080  -3.813 1.00 . A A .  10 VAL HG23 1 1 
        2  2588 1 1  10 VAL N    N  15.215  -1.900  -2.385 1.00 . A A .  10 VAL N    1 1 
        2  2589 1 1  10 VAL O    O  13.211  -3.772  -3.043 1.00 . A A .  10 VAL O    1 1 
        2  2590 1 1  11 VAL C    C   9.524  -3.296  -2.727 1.00 . A A .  11 VAL C    1 1 
        2  2591 1 1  11 VAL CA   C  10.760  -3.584  -1.873 1.00 . A A .  11 VAL CA   1 1 
        2  2592 1 1  11 VAL CB   C  10.362  -3.661  -0.394 1.00 . A A .  11 VAL CB   1 1 
        2  2593 1 1  11 VAL CG1  C   9.156  -4.590  -0.222 1.00 . A A .  11 VAL CG1  1 1 
        2  2594 1 1  11 VAL CG2  C  11.542  -4.202   0.418 1.00 . A A .  11 VAL CG2  1 1 
        2  2595 1 1  11 VAL H    H  11.513  -1.568  -1.740 1.00 . A A .  11 VAL H    1 1 
        2  2596 1 1  11 VAL HA   H  11.198  -4.527  -2.178 1.00 . A A .  11 VAL HA   1 1 
        2  2597 1 1  11 VAL HB   H  10.106  -2.671  -0.040 1.00 . A A .  11 VAL HB   1 1 
        2  2598 1 1  11 VAL HG11 H   9.298  -5.477  -0.821 1.00 . A A .  11 VAL HG11 1 1 
        2  2599 1 1  11 VAL HG12 H   8.260  -4.078  -0.547 1.00 . A A .  11 VAL HG12 1 1 
        2  2600 1 1  11 VAL HG13 H   9.055  -4.867   0.817 1.00 . A A .  11 VAL HG13 1 1 
        2  2601 1 1  11 VAL HG21 H  11.644  -5.263   0.239 1.00 . A A .  11 VAL HG21 1 1 
        2  2602 1 1  11 VAL HG22 H  11.366  -4.029   1.469 1.00 . A A .  11 VAL HG22 1 1 
        2  2603 1 1  11 VAL HG23 H  12.448  -3.700   0.115 1.00 . A A .  11 VAL HG23 1 1 
        2  2604 1 1  11 VAL N    N  11.740  -2.467  -2.058 1.00 . A A .  11 VAL N    1 1 
        2  2605 1 1  11 VAL O    O   8.995  -2.204  -2.716 1.00 . A A .  11 VAL O    1 1 
        2  2606 1 1  12 ARG C    C   6.830  -5.146  -4.004 1.00 . A A .  12 ARG C    1 1 
        2  2607 1 1  12 ARG CA   C   7.867  -4.078  -4.341 1.00 . A A .  12 ARG CA   1 1 
        2  2608 1 1  12 ARG CB   C   8.283  -4.208  -5.806 1.00 . A A .  12 ARG CB   1 1 
        2  2609 1 1  12 ARG CD   C   9.586  -3.133  -7.647 1.00 . A A .  12 ARG CD   1 1 
        2  2610 1 1  12 ARG CG   C   9.180  -3.026  -6.177 1.00 . A A .  12 ARG CG   1 1 
        2  2611 1 1  12 ARG CZ   C  10.893  -4.636  -9.020 1.00 . A A .  12 ARG CZ   1 1 
        2  2612 1 1  12 ARG H    H   9.524  -5.142  -3.460 1.00 . A A .  12 ARG H    1 1 
        2  2613 1 1  12 ARG HA   H   7.437  -3.099  -4.176 1.00 . A A .  12 ARG HA   1 1 
        2  2614 1 1  12 ARG HB2  H   8.827  -5.132  -5.945 1.00 . A A .  12 ARG HB2  1 1 
        2  2615 1 1  12 ARG HB3  H   7.406  -4.206  -6.434 1.00 . A A .  12 ARG HB3  1 1 
        2  2616 1 1  12 ARG HD2  H   8.705  -3.274  -8.254 1.00 . A A .  12 ARG HD2  1 1 
        2  2617 1 1  12 ARG HD3  H  10.089  -2.226  -7.948 1.00 . A A .  12 ARG HD3  1 1 
        2  2618 1 1  12 ARG HE   H  10.815  -4.797  -7.042 1.00 . A A .  12 ARG HE   1 1 
        2  2619 1 1  12 ARG HG2  H   8.642  -2.101  -6.017 1.00 . A A .  12 ARG HG2  1 1 
        2  2620 1 1  12 ARG HG3  H  10.066  -3.038  -5.560 1.00 . A A .  12 ARG HG3  1 1 
        2  2621 1 1  12 ARG HH11 H   9.852  -3.193  -9.943 1.00 . A A .  12 ARG HH11 1 1 
        2  2622 1 1  12 ARG HH12 H  10.771  -4.232 -10.978 1.00 . A A .  12 ARG HH12 1 1 
        2  2623 1 1  12 ARG HH21 H  12.025  -6.160  -8.381 1.00 . A A .  12 ARG HH21 1 1 
        2  2624 1 1  12 ARG HH22 H  12.001  -5.911 -10.095 1.00 . A A .  12 ARG HH22 1 1 
        2  2625 1 1  12 ARG N    N   9.069  -4.273  -3.470 1.00 . A A .  12 ARG N    1 1 
        2  2626 1 1  12 ARG NE   N  10.503  -4.293  -7.825 1.00 . A A .  12 ARG NE   1 1 
        2  2627 1 1  12 ARG NH1  N  10.474  -3.968 -10.062 1.00 . A A .  12 ARG NH1  1 1 
        2  2628 1 1  12 ARG NH2  N  11.703  -5.648  -9.177 1.00 . A A .  12 ARG NH2  1 1 
        2  2629 1 1  12 ARG O    O   7.154  -6.304  -3.830 1.00 . A A .  12 ARG O    1 1 
        2  2630 1 1  13 ARG C    C   3.284  -5.504  -4.436 1.00 . A A .  13 ARG C    1 1 
        2  2631 1 1  13 ARG CA   C   4.510  -5.750  -3.559 1.00 . A A .  13 ARG CA   1 1 
        2  2632 1 1  13 ARG CB   C   4.121  -5.585  -2.080 1.00 . A A .  13 ARG CB   1 1 
        2  2633 1 1  13 ARG CD   C   4.956  -7.736  -1.070 1.00 . A A .  13 ARG CD   1 1 
        2  2634 1 1  13 ARG CG   C   5.183  -6.220  -1.166 1.00 . A A .  13 ARG CG   1 1 
        2  2635 1 1  13 ARG CZ   C   6.318  -9.553  -0.191 1.00 . A A .  13 ARG CZ   1 1 
        2  2636 1 1  13 ARG H    H   5.351  -3.820  -4.036 1.00 . A A .  13 ARG H    1 1 
        2  2637 1 1  13 ARG HA   H   4.865  -6.753  -3.731 1.00 . A A .  13 ARG HA   1 1 
        2  2638 1 1  13 ARG HB2  H   4.045  -4.532  -1.853 1.00 . A A .  13 ARG HB2  1 1 
        2  2639 1 1  13 ARG HB3  H   3.164  -6.056  -1.903 1.00 . A A .  13 ARG HB3  1 1 
        2  2640 1 1  13 ARG HD2  H   3.941  -7.930  -0.756 1.00 . A A .  13 ARG HD2  1 1 
        2  2641 1 1  13 ARG HD3  H   5.127  -8.188  -2.032 1.00 . A A .  13 ARG HD3  1 1 
        2  2642 1 1  13 ARG HE   H   6.210  -7.770   0.681 1.00 . A A .  13 ARG HE   1 1 
        2  2643 1 1  13 ARG HG2  H   6.166  -6.028  -1.568 1.00 . A A .  13 ARG HG2  1 1 
        2  2644 1 1  13 ARG HG3  H   5.108  -5.788  -0.179 1.00 . A A .  13 ARG HG3  1 1 
        2  2645 1 1  13 ARG HH11 H   5.293  -9.917  -1.874 1.00 . A A .  13 ARG HH11 1 1 
        2  2646 1 1  13 ARG HH12 H   6.242 -11.233  -1.276 1.00 . A A .  13 ARG HH12 1 1 
        2  2647 1 1  13 ARG HH21 H   7.427  -9.491   1.469 1.00 . A A .  13 ARG HH21 1 1 
        2  2648 1 1  13 ARG HH22 H   7.450 -10.993   0.612 1.00 . A A .  13 ARG HH22 1 1 
        2  2649 1 1  13 ARG N    N   5.582  -4.764  -3.899 1.00 . A A .  13 ARG N    1 1 
        2  2650 1 1  13 ARG NE   N   5.902  -8.317  -0.071 1.00 . A A .  13 ARG NE   1 1 
        2  2651 1 1  13 ARG NH1  N   5.919 -10.292  -1.191 1.00 . A A .  13 ARG NH1  1 1 
        2  2652 1 1  13 ARG NH2  N   7.128 -10.051   0.700 1.00 . A A .  13 ARG NH2  1 1 
        2  2653 1 1  13 ARG O    O   3.047  -4.408  -4.903 1.00 . A A .  13 ARG O    1 1 
        2  2654 1 1  14 GLU C    C   0.146  -7.189  -4.879 1.00 . A A .  14 GLU C    1 1 
        2  2655 1 1  14 GLU CA   C   1.281  -6.385  -5.505 1.00 . A A .  14 GLU CA   1 1 
        2  2656 1 1  14 GLU CB   C   1.570  -6.918  -6.908 1.00 . A A .  14 GLU CB   1 1 
        2  2657 1 1  14 GLU CD   C   2.881  -6.538  -8.997 1.00 . A A .  14 GLU CD   1 1 
        2  2658 1 1  14 GLU CG   C   2.551  -5.982  -7.611 1.00 . A A .  14 GLU CG   1 1 
        2  2659 1 1  14 GLU H    H   2.723  -7.399  -4.270 1.00 . A A .  14 GLU H    1 1 
        2  2660 1 1  14 GLU HA   H   0.992  -5.344  -5.569 1.00 . A A .  14 GLU HA   1 1 
        2  2661 1 1  14 GLU HB2  H   2.003  -7.905  -6.833 1.00 . A A .  14 GLU HB2  1 1 
        2  2662 1 1  14 GLU HB3  H   0.652  -6.968  -7.474 1.00 . A A .  14 GLU HB3  1 1 
        2  2663 1 1  14 GLU HG2  H   2.105  -5.004  -7.709 1.00 . A A .  14 GLU HG2  1 1 
        2  2664 1 1  14 GLU HG3  H   3.458  -5.907  -7.031 1.00 . A A .  14 GLU HG3  1 1 
        2  2665 1 1  14 GLU N    N   2.503  -6.526  -4.662 1.00 . A A .  14 GLU N    1 1 
        2  2666 1 1  14 GLU O    O   0.368  -8.186  -4.220 1.00 . A A .  14 GLU O    1 1 
        2  2667 1 1  14 GLU OE1  O   2.358  -7.589  -9.330 1.00 . A A .  14 GLU OE1  1 1 
        2  2668 1 1  14 GLU OE2  O   3.645  -5.902  -9.702 1.00 . A A .  14 GLU OE2  1 1 
        2  2669 1 1  15 ALA C    C  -3.469  -7.271  -5.328 1.00 . A A .  15 ALA C    1 1 
        2  2670 1 1  15 ALA CA   C  -2.222  -7.511  -4.479 1.00 . A A .  15 ALA CA   1 1 
        2  2671 1 1  15 ALA CB   C  -2.471  -7.012  -3.055 1.00 . A A .  15 ALA CB   1 1 
        2  2672 1 1  15 ALA H    H  -1.233  -5.958  -5.602 1.00 . A A .  15 ALA H    1 1 
        2  2673 1 1  15 ALA HA   H  -2.001  -8.568  -4.457 1.00 . A A .  15 ALA HA   1 1 
        2  2674 1 1  15 ALA HB1  H  -1.676  -7.356  -2.409 1.00 . A A .  15 ALA HB1  1 1 
        2  2675 1 1  15 ALA HB2  H  -3.416  -7.395  -2.699 1.00 . A A .  15 ALA HB2  1 1 
        2  2676 1 1  15 ALA HB3  H  -2.495  -5.931  -3.052 1.00 . A A .  15 ALA HB3  1 1 
        2  2677 1 1  15 ALA N    N  -1.072  -6.766  -5.071 1.00 . A A .  15 ALA N    1 1 
        2  2678 1 1  15 ALA O    O  -3.619  -6.235  -5.942 1.00 . A A .  15 ALA O    1 1 
        2  2679 1 1  16 HIS C    C  -6.776  -7.747  -5.226 1.00 . A A .  16 HIS C    1 1 
        2  2680 1 1  16 HIS CA   C  -5.616  -8.055  -6.172 1.00 . A A .  16 HIS CA   1 1 
        2  2681 1 1  16 HIS CB   C  -5.903  -9.353  -6.933 1.00 . A A .  16 HIS CB   1 1 
        2  2682 1 1  16 HIS CD2  C  -7.205 -11.045  -5.399 1.00 . A A .  16 HIS CD2  1 1 
        2  2683 1 1  16 HIS CE1  C  -5.506 -12.155  -4.641 1.00 . A A .  16 HIS CE1  1 1 
        2  2684 1 1  16 HIS CG   C  -6.083 -10.487  -5.960 1.00 . A A .  16 HIS CG   1 1 
        2  2685 1 1  16 HIS H    H  -4.223  -9.047  -4.858 1.00 . A A .  16 HIS H    1 1 
        2  2686 1 1  16 HIS HA   H  -5.502  -7.244  -6.879 1.00 . A A .  16 HIS HA   1 1 
        2  2687 1 1  16 HIS HB2  H  -6.803  -9.236  -7.519 1.00 . A A .  16 HIS HB2  1 1 
        2  2688 1 1  16 HIS HB3  H  -5.073  -9.573  -7.590 1.00 . A A .  16 HIS HB3  1 1 
        2  2689 1 1  16 HIS HD1  H  -4.065 -11.056  -5.663 1.00 . A A .  16 HIS HD1  1 1 
        2  2690 1 1  16 HIS HD2  H  -8.219 -10.715  -5.577 1.00 . A A .  16 HIS HD2  1 1 
        2  2691 1 1  16 HIS HE1  H  -4.900 -12.876  -4.111 1.00 . A A .  16 HIS HE1  1 1 
        2  2692 1 1  16 HIS N    N  -4.366  -8.221  -5.367 1.00 . A A .  16 HIS N    1 1 
        2  2693 1 1  16 HIS ND1  N  -5.012 -11.210  -5.461 1.00 . A A .  16 HIS ND1  1 1 
        2  2694 1 1  16 HIS NE2  N  -6.839 -12.099  -4.567 1.00 . A A .  16 HIS NE2  1 1 
        2  2695 1 1  16 HIS O    O  -7.168  -8.571  -4.427 1.00 . A A .  16 HIS O    1 1 
        2  2696 1 1  17 LEU C    C  -9.749  -6.119  -5.213 1.00 . A A .  17 LEU C    1 1 
        2  2697 1 1  17 LEU CA   C  -8.457  -6.177  -4.405 1.00 . A A .  17 LEU CA   1 1 
        2  2698 1 1  17 LEU CB   C  -8.177  -4.799  -3.787 1.00 . A A .  17 LEU CB   1 1 
        2  2699 1 1  17 LEU CD1  C  -5.663  -4.482  -3.740 1.00 . A A .  17 LEU CD1  1 1 
        2  2700 1 1  17 LEU CD2  C  -7.025  -3.878  -1.738 1.00 . A A .  17 LEU CD2  1 1 
        2  2701 1 1  17 LEU CG   C  -6.899  -4.859  -2.911 1.00 . A A .  17 LEU CG   1 1 
        2  2702 1 1  17 LEU H    H  -6.985  -5.911  -5.958 1.00 . A A .  17 LEU H    1 1 
        2  2703 1 1  17 LEU HA   H  -8.567  -6.904  -3.611 1.00 . A A .  17 LEU HA   1 1 
        2  2704 1 1  17 LEU HB2  H  -8.046  -4.073  -4.581 1.00 . A A .  17 LEU HB2  1 1 
        2  2705 1 1  17 LEU HB3  H  -9.023  -4.510  -3.178 1.00 . A A .  17 LEU HB3  1 1 
        2  2706 1 1  17 LEU HD11 H  -5.797  -3.494  -4.156 1.00 . A A .  17 LEU HD11 1 1 
        2  2707 1 1  17 LEU HD12 H  -5.531  -5.194  -4.540 1.00 . A A .  17 LEU HD12 1 1 
        2  2708 1 1  17 LEU HD13 H  -4.790  -4.489  -3.104 1.00 . A A .  17 LEU HD13 1 1 
        2  2709 1 1  17 LEU HD21 H  -6.058  -3.742  -1.276 1.00 . A A .  17 LEU HD21 1 1 
        2  2710 1 1  17 LEU HD22 H  -7.717  -4.277  -1.010 1.00 . A A .  17 LEU HD22 1 1 
        2  2711 1 1  17 LEU HD23 H  -7.389  -2.928  -2.100 1.00 . A A .  17 LEU HD23 1 1 
        2  2712 1 1  17 LEU HG   H  -6.771  -5.861  -2.523 1.00 . A A .  17 LEU HG   1 1 
        2  2713 1 1  17 LEU N    N  -7.324  -6.559  -5.307 1.00 . A A .  17 LEU N    1 1 
        2  2714 1 1  17 LEU O    O  -9.823  -5.480  -6.244 1.00 . A A .  17 LEU O    1 1 
        2  2715 1 1  18 ALA C    C -12.869  -5.541  -5.097 1.00 . A A .  18 ALA C    1 1 
        2  2716 1 1  18 ALA CA   C -12.060  -6.776  -5.497 1.00 . A A .  18 ALA CA   1 1 
        2  2717 1 1  18 ALA CB   C -12.844  -8.041  -5.147 1.00 . A A .  18 ALA CB   1 1 
        2  2718 1 1  18 ALA H    H -10.688  -7.297  -3.924 1.00 . A A .  18 ALA H    1 1 
        2  2719 1 1  18 ALA HA   H -11.869  -6.758  -6.558 1.00 . A A .  18 ALA HA   1 1 
        2  2720 1 1  18 ALA HB1  H -13.081  -8.034  -4.097 1.00 . A A .  18 ALA HB1  1 1 
        2  2721 1 1  18 ALA HB2  H -12.242  -8.909  -5.376 1.00 . A A .  18 ALA HB2  1 1 
        2  2722 1 1  18 ALA HB3  H -13.755  -8.073  -5.725 1.00 . A A .  18 ALA HB3  1 1 
        2  2723 1 1  18 ALA N    N -10.770  -6.786  -4.757 1.00 . A A .  18 ALA N    1 1 
        2  2724 1 1  18 ALA O    O -13.812  -5.622  -4.336 1.00 . A A .  18 ALA O    1 1 
        2  2725 1 1  19 ALA C    C -12.666  -1.979  -6.064 1.00 . A A .  19 ALA C    1 1 
        2  2726 1 1  19 ALA CA   C -13.254  -3.150  -5.261 1.00 . A A .  19 ALA CA   1 1 
        2  2727 1 1  19 ALA CB   C -13.110  -2.876  -3.758 1.00 . A A .  19 ALA CB   1 1 
        2  2728 1 1  19 ALA H    H -11.743  -4.348  -6.218 1.00 . A A .  19 ALA H    1 1 
        2  2729 1 1  19 ALA HA   H -14.295  -3.284  -5.508 1.00 . A A .  19 ALA HA   1 1 
        2  2730 1 1  19 ALA HB1  H -13.254  -1.822  -3.562 1.00 . A A .  19 ALA HB1  1 1 
        2  2731 1 1  19 ALA HB2  H -12.123  -3.170  -3.433 1.00 . A A .  19 ALA HB2  1 1 
        2  2732 1 1  19 ALA HB3  H -13.852  -3.446  -3.215 1.00 . A A .  19 ALA HB3  1 1 
        2  2733 1 1  19 ALA N    N -12.508  -4.393  -5.607 1.00 . A A .  19 ALA N    1 1 
        2  2734 1 1  19 ALA O    O -11.502  -1.990  -6.415 1.00 . A A .  19 ALA O    1 1 
        2  2735 1 1  20 PRO C    C -11.822   0.930  -6.418 1.00 . A A .  20 PRO C    1 1 
        2  2736 1 1  20 PRO CA   C -12.979   0.208  -7.133 1.00 . A A .  20 PRO CA   1 1 
        2  2737 1 1  20 PRO CB   C -14.221   1.122  -7.245 1.00 . A A .  20 PRO CB   1 1 
        2  2738 1 1  20 PRO CD   C -14.875  -0.856  -5.987 1.00 . A A .  20 PRO CD   1 1 
        2  2739 1 1  20 PRO CG   C -15.195   0.622  -6.216 1.00 . A A .  20 PRO CG   1 1 
        2  2740 1 1  20 PRO HA   H -12.667  -0.106  -8.118 1.00 . A A .  20 PRO HA   1 1 
        2  2741 1 1  20 PRO HB2  H -13.956   2.154  -7.044 1.00 . A A .  20 PRO HB2  1 1 
        2  2742 1 1  20 PRO HB3  H -14.656   1.042  -8.233 1.00 . A A .  20 PRO HB3  1 1 
        2  2743 1 1  20 PRO HD2  H -15.021  -1.121  -4.947 1.00 . A A .  20 PRO HD2  1 1 
        2  2744 1 1  20 PRO HD3  H -15.478  -1.483  -6.626 1.00 . A A .  20 PRO HD3  1 1 
        2  2745 1 1  20 PRO HG2  H -15.080   1.175  -5.293 1.00 . A A .  20 PRO HG2  1 1 
        2  2746 1 1  20 PRO HG3  H -16.210   0.720  -6.579 1.00 . A A .  20 PRO HG3  1 1 
        2  2747 1 1  20 PRO N    N -13.455  -0.974  -6.357 1.00 . A A .  20 PRO N    1 1 
        2  2748 1 1  20 PRO O    O -11.602   0.742  -5.238 1.00 . A A .  20 PRO O    1 1 
        2  2749 1 1  21 PRO C    C -10.396   3.481  -5.462 1.00 . A A .  21 PRO C    1 1 
        2  2750 1 1  21 PRO CA   C  -9.941   2.515  -6.562 1.00 . A A .  21 PRO CA   1 1 
        2  2751 1 1  21 PRO CB   C  -9.359   3.278  -7.775 1.00 . A A .  21 PRO CB   1 1 
        2  2752 1 1  21 PRO CD   C -11.285   2.037  -8.562 1.00 . A A .  21 PRO CD   1 1 
        2  2753 1 1  21 PRO CG   C -10.457   3.301  -8.795 1.00 . A A .  21 PRO CG   1 1 
        2  2754 1 1  21 PRO HA   H  -9.201   1.835  -6.172 1.00 . A A .  21 PRO HA   1 1 
        2  2755 1 1  21 PRO HB2  H  -9.078   4.287  -7.495 1.00 . A A .  21 PRO HB2  1 1 
        2  2756 1 1  21 PRO HB3  H  -8.500   2.752  -8.170 1.00 . A A .  21 PRO HB3  1 1 
        2  2757 1 1  21 PRO HD2  H -12.329   2.222  -8.776 1.00 . A A .  21 PRO HD2  1 1 
        2  2758 1 1  21 PRO HD3  H -10.912   1.219  -9.158 1.00 . A A .  21 PRO HD3  1 1 
        2  2759 1 1  21 PRO HG2  H -11.072   4.183  -8.663 1.00 . A A .  21 PRO HG2  1 1 
        2  2760 1 1  21 PRO HG3  H -10.044   3.286  -9.793 1.00 . A A .  21 PRO HG3  1 1 
        2  2761 1 1  21 PRO N    N -11.091   1.750  -7.134 1.00 . A A .  21 PRO N    1 1 
        2  2762 1 1  21 PRO O    O  -9.671   3.764  -4.528 1.00 . A A .  21 PRO O    1 1 
        2  2763 1 1  22 ALA C    C -12.252   4.231  -3.192 1.00 . A A .  22 ALA C    1 1 
        2  2764 1 1  22 ALA CA   C -12.111   4.934  -4.546 1.00 . A A .  22 ALA CA   1 1 
        2  2765 1 1  22 ALA CB   C -13.477   5.451  -4.999 1.00 . A A .  22 ALA CB   1 1 
        2  2766 1 1  22 ALA H    H -12.155   3.740  -6.335 1.00 . A A .  22 ALA H    1 1 
        2  2767 1 1  22 ALA HA   H -11.429   5.766  -4.450 1.00 . A A .  22 ALA HA   1 1 
        2  2768 1 1  22 ALA HB1  H -14.108   4.613  -5.261 1.00 . A A .  22 ALA HB1  1 1 
        2  2769 1 1  22 ALA HB2  H -13.350   6.088  -5.860 1.00 . A A .  22 ALA HB2  1 1 
        2  2770 1 1  22 ALA HB3  H -13.936   6.010  -4.198 1.00 . A A .  22 ALA HB3  1 1 
        2  2771 1 1  22 ALA N    N -11.593   3.985  -5.571 1.00 . A A .  22 ALA N    1 1 
        2  2772 1 1  22 ALA O    O -11.973   4.805  -2.158 1.00 . A A .  22 ALA O    1 1 
        2  2773 1 1  23 ALA C    C -11.494   2.088  -1.218 1.00 . A A .  23 ALA C    1 1 
        2  2774 1 1  23 ALA CA   C -12.856   2.282  -1.889 1.00 . A A .  23 ALA CA   1 1 
        2  2775 1 1  23 ALA CB   C -13.491   0.916  -2.150 1.00 . A A .  23 ALA CB   1 1 
        2  2776 1 1  23 ALA H    H -12.917   2.556  -4.025 1.00 . A A .  23 ALA H    1 1 
        2  2777 1 1  23 ALA HA   H -13.499   2.857  -1.238 1.00 . A A .  23 ALA HA   1 1 
        2  2778 1 1  23 ALA HB1  H -12.956   0.422  -2.949 1.00 . A A .  23 ALA HB1  1 1 
        2  2779 1 1  23 ALA HB2  H -14.522   1.051  -2.437 1.00 . A A .  23 ALA HB2  1 1 
        2  2780 1 1  23 ALA HB3  H -13.440   0.316  -1.255 1.00 . A A .  23 ALA HB3  1 1 
        2  2781 1 1  23 ALA N    N -12.691   3.003  -3.183 1.00 . A A .  23 ALA N    1 1 
        2  2782 1 1  23 ALA O    O -11.353   2.249  -0.020 1.00 . A A .  23 ALA O    1 1 
        2  2783 1 1  24 VAL C    C  -8.628   2.843  -0.789 1.00 . A A .  24 VAL C    1 1 
        2  2784 1 1  24 VAL CA   C  -9.147   1.529  -1.381 1.00 . A A .  24 VAL CA   1 1 
        2  2785 1 1  24 VAL CB   C  -8.190   1.038  -2.470 1.00 . A A .  24 VAL CB   1 1 
        2  2786 1 1  24 VAL CG1  C  -6.777   0.936  -1.899 1.00 . A A .  24 VAL CG1  1 1 
        2  2787 1 1  24 VAL CG2  C  -8.644  -0.341  -2.966 1.00 . A A .  24 VAL CG2  1 1 
        2  2788 1 1  24 VAL H    H -10.627   1.614  -2.940 1.00 . A A .  24 VAL H    1 1 
        2  2789 1 1  24 VAL HA   H  -9.212   0.785  -0.603 1.00 . A A .  24 VAL HA   1 1 
        2  2790 1 1  24 VAL HB   H  -8.193   1.737  -3.295 1.00 . A A .  24 VAL HB   1 1 
        2  2791 1 1  24 VAL HG11 H  -6.163   0.350  -2.562 1.00 . A A .  24 VAL HG11 1 1 
        2  2792 1 1  24 VAL HG12 H  -6.813   0.461  -0.928 1.00 . A A .  24 VAL HG12 1 1 
        2  2793 1 1  24 VAL HG13 H  -6.357   1.927  -1.800 1.00 . A A .  24 VAL HG13 1 1 
        2  2794 1 1  24 VAL HG21 H  -7.909  -0.738  -3.649 1.00 . A A .  24 VAL HG21 1 1 
        2  2795 1 1  24 VAL HG22 H  -9.594  -0.248  -3.471 1.00 . A A .  24 VAL HG22 1 1 
        2  2796 1 1  24 VAL HG23 H  -8.750  -1.009  -2.124 1.00 . A A .  24 VAL HG23 1 1 
        2  2797 1 1  24 VAL N    N -10.493   1.741  -1.977 1.00 . A A .  24 VAL N    1 1 
        2  2798 1 1  24 VAL O    O  -8.138   2.882   0.323 1.00 . A A .  24 VAL O    1 1 
        2  2799 1 1  25 PHE C    C  -9.043   5.597   0.267 1.00 . A A .  25 PHE C    1 1 
        2  2800 1 1  25 PHE CA   C  -8.265   5.234  -0.997 1.00 . A A .  25 PHE CA   1 1 
        2  2801 1 1  25 PHE CB   C  -8.473   6.312  -2.063 1.00 . A A .  25 PHE CB   1 1 
        2  2802 1 1  25 PHE CD1  C  -6.637   7.972  -1.572 1.00 . A A .  25 PHE CD1  1 1 
        2  2803 1 1  25 PHE CD2  C  -8.922   8.553  -1.004 1.00 . A A .  25 PHE CD2  1 1 
        2  2804 1 1  25 PHE CE1  C  -6.201   9.210  -1.083 1.00 . A A .  25 PHE CE1  1 1 
        2  2805 1 1  25 PHE CE2  C  -8.486   9.789  -0.515 1.00 . A A .  25 PHE CE2  1 1 
        2  2806 1 1  25 PHE CG   C  -7.998   7.644  -1.534 1.00 . A A .  25 PHE CG   1 1 
        2  2807 1 1  25 PHE CZ   C  -7.126  10.118  -0.554 1.00 . A A .  25 PHE CZ   1 1 
        2  2808 1 1  25 PHE H    H  -9.148   3.867  -2.407 1.00 . A A .  25 PHE H    1 1 
        2  2809 1 1  25 PHE HA   H  -7.214   5.163  -0.760 1.00 . A A .  25 PHE HA   1 1 
        2  2810 1 1  25 PHE HB2  H  -7.906   6.056  -2.946 1.00 . A A .  25 PHE HB2  1 1 
        2  2811 1 1  25 PHE HB3  H  -9.521   6.375  -2.314 1.00 . A A .  25 PHE HB3  1 1 
        2  2812 1 1  25 PHE HD1  H  -5.924   7.271  -1.980 1.00 . A A .  25 PHE HD1  1 1 
        2  2813 1 1  25 PHE HD2  H  -9.971   8.299  -0.974 1.00 . A A .  25 PHE HD2  1 1 
        2  2814 1 1  25 PHE HE1  H  -5.152   9.462  -1.113 1.00 . A A .  25 PHE HE1  1 1 
        2  2815 1 1  25 PHE HE2  H  -9.200  10.489  -0.107 1.00 . A A .  25 PHE HE2  1 1 
        2  2816 1 1  25 PHE HZ   H  -6.790  11.072  -0.177 1.00 . A A .  25 PHE HZ   1 1 
        2  2817 1 1  25 PHE N    N  -8.743   3.920  -1.517 1.00 . A A .  25 PHE N    1 1 
        2  2818 1 1  25 PHE O    O  -8.482   6.060   1.240 1.00 . A A .  25 PHE O    1 1 
        2  2819 1 1  26 ALA C    C -10.521   5.065   2.691 1.00 . A A .  26 ALA C    1 1 
        2  2820 1 1  26 ALA CA   C -11.141   5.734   1.466 1.00 . A A .  26 ALA CA   1 1 
        2  2821 1 1  26 ALA CB   C -12.570   5.223   1.272 1.00 . A A .  26 ALA CB   1 1 
        2  2822 1 1  26 ALA H    H -10.768   5.022  -0.531 1.00 . A A .  26 ALA H    1 1 
        2  2823 1 1  26 ALA HA   H -11.152   6.805   1.605 1.00 . A A .  26 ALA HA   1 1 
        2  2824 1 1  26 ALA HB1  H -13.181   5.540   2.105 1.00 . A A .  26 ALA HB1  1 1 
        2  2825 1 1  26 ALA HB2  H -12.562   4.145   1.220 1.00 . A A .  26 ALA HB2  1 1 
        2  2826 1 1  26 ALA HB3  H -12.972   5.626   0.356 1.00 . A A .  26 ALA HB3  1 1 
        2  2827 1 1  26 ALA N    N -10.332   5.395   0.263 1.00 . A A .  26 ALA N    1 1 
        2  2828 1 1  26 ALA O    O -10.401   5.663   3.742 1.00 . A A .  26 ALA O    1 1 
        2  2829 1 1  27 LEU C    C  -8.194   3.860   4.099 1.00 . A A .  27 LEU C    1 1 
        2  2830 1 1  27 LEU CA   C  -9.485   3.133   3.713 1.00 . A A .  27 LEU CA   1 1 
        2  2831 1 1  27 LEU CB   C  -9.165   1.689   3.311 1.00 . A A .  27 LEU CB   1 1 
        2  2832 1 1  27 LEU CD1  C -10.158  -0.423   2.424 1.00 . A A .  27 LEU CD1  1 1 
        2  2833 1 1  27 LEU CD2  C -11.044   0.540   4.559 1.00 . A A .  27 LEU CD2  1 1 
        2  2834 1 1  27 LEU CG   C -10.463   0.876   3.171 1.00 . A A .  27 LEU CG   1 1 
        2  2835 1 1  27 LEU H    H -10.207   3.372   1.700 1.00 . A A .  27 LEU H    1 1 
        2  2836 1 1  27 LEU HA   H -10.162   3.138   4.552 1.00 . A A .  27 LEU HA   1 1 
        2  2837 1 1  27 LEU HB2  H  -8.647   1.697   2.361 1.00 . A A .  27 LEU HB2  1 1 
        2  2838 1 1  27 LEU HB3  H  -8.531   1.237   4.057 1.00 . A A .  27 LEU HB3  1 1 
        2  2839 1 1  27 LEU HD11 H  -9.444  -1.001   2.988 1.00 . A A .  27 LEU HD11 1 1 
        2  2840 1 1  27 LEU HD12 H  -9.748  -0.191   1.454 1.00 . A A .  27 LEU HD12 1 1 
        2  2841 1 1  27 LEU HD13 H -11.068  -0.991   2.304 1.00 . A A .  27 LEU HD13 1 1 
        2  2842 1 1  27 LEU HD21 H -10.246   0.319   5.252 1.00 . A A .  27 LEU HD21 1 1 
        2  2843 1 1  27 LEU HD22 H -11.697  -0.321   4.482 1.00 . A A .  27 LEU HD22 1 1 
        2  2844 1 1  27 LEU HD23 H -11.614   1.380   4.924 1.00 . A A .  27 LEU HD23 1 1 
        2  2845 1 1  27 LEU HG   H -11.184   1.451   2.606 1.00 . A A .  27 LEU HG   1 1 
        2  2846 1 1  27 LEU N    N -10.111   3.833   2.561 1.00 . A A .  27 LEU N    1 1 
        2  2847 1 1  27 LEU O    O  -7.900   4.052   5.262 1.00 . A A .  27 LEU O    1 1 
        2  2848 1 1  28 MET C    C  -6.442   6.326   4.091 1.00 . A A .  28 MET C    1 1 
        2  2849 1 1  28 MET CA   C  -6.149   4.977   3.429 1.00 . A A .  28 MET CA   1 1 
        2  2850 1 1  28 MET CB   C  -5.379   5.210   2.129 1.00 . A A .  28 MET CB   1 1 
        2  2851 1 1  28 MET CE   C  -3.458   2.459  -0.244 1.00 . A A .  28 MET CE   1 1 
        2  2852 1 1  28 MET CG   C  -4.764   3.893   1.657 1.00 . A A .  28 MET CG   1 1 
        2  2853 1 1  28 MET H    H  -7.679   4.099   2.196 1.00 . A A .  28 MET H    1 1 
        2  2854 1 1  28 MET HA   H  -5.551   4.374   4.096 1.00 . A A .  28 MET HA   1 1 
        2  2855 1 1  28 MET HB2  H  -6.056   5.582   1.373 1.00 . A A .  28 MET HB2  1 1 
        2  2856 1 1  28 MET HB3  H  -4.594   5.930   2.296 1.00 . A A .  28 MET HB3  1 1 
        2  2857 1 1  28 MET HE1  H  -3.092   1.961   0.644 1.00 . A A .  28 MET HE1  1 1 
        2  2858 1 1  28 MET HE2  H  -2.709   2.418  -1.021 1.00 . A A .  28 MET HE2  1 1 
        2  2859 1 1  28 MET HE3  H  -4.355   1.970  -0.585 1.00 . A A .  28 MET HE3  1 1 
        2  2860 1 1  28 MET HG2  H  -4.108   3.506   2.423 1.00 . A A .  28 MET HG2  1 1 
        2  2861 1 1  28 MET HG3  H  -5.549   3.178   1.459 1.00 . A A .  28 MET HG3  1 1 
        2  2862 1 1  28 MET N    N  -7.422   4.265   3.126 1.00 . A A .  28 MET N    1 1 
        2  2863 1 1  28 MET O    O  -5.764   6.727   5.017 1.00 . A A .  28 MET O    1 1 
        2  2864 1 1  28 MET SD   S  -3.819   4.188   0.142 1.00 . A A .  28 MET SD   1 1 
        2  2865 1 1  29 THR C    C  -8.792   8.184   5.344 1.00 . A A .  29 THR C    1 1 
        2  2866 1 1  29 THR CA   C  -7.755   8.364   4.236 1.00 . A A .  29 THR CA   1 1 
        2  2867 1 1  29 THR CB   C  -8.309   9.300   3.156 1.00 . A A .  29 THR CB   1 1 
        2  2868 1 1  29 THR CG2  C  -8.256  10.746   3.650 1.00 . A A .  29 THR CG2  1 1 
        2  2869 1 1  29 THR H    H  -7.971   6.702   2.878 1.00 . A A .  29 THR H    1 1 
        2  2870 1 1  29 THR HA   H  -6.856   8.797   4.658 1.00 . A A .  29 THR HA   1 1 
        2  2871 1 1  29 THR HB   H  -9.331   9.036   2.936 1.00 . A A .  29 THR HB   1 1 
        2  2872 1 1  29 THR HG1  H  -7.228  10.052   1.724 1.00 . A A .  29 THR HG1  1 1 
        2  2873 1 1  29 THR HG21 H  -8.756  10.819   4.605 1.00 . A A .  29 THR HG21 1 1 
        2  2874 1 1  29 THR HG22 H  -8.746  11.391   2.936 1.00 . A A .  29 THR HG22 1 1 
        2  2875 1 1  29 THR HG23 H  -7.225  11.052   3.761 1.00 . A A .  29 THR HG23 1 1 
        2  2876 1 1  29 THR N    N  -7.437   7.037   3.628 1.00 . A A .  29 THR N    1 1 
        2  2877 1 1  29 THR O    O  -9.832   8.811   5.349 1.00 . A A .  29 THR O    1 1 
        2  2878 1 1  29 THR OG1  O  -7.521   9.174   1.981 1.00 . A A .  29 THR OG1  1 1 
        2  2879 1 1  30 ASP C    C  -8.713   6.381   8.544 1.00 . A A .  30 ASP C    1 1 
        2  2880 1 1  30 ASP CA   C  -9.461   7.096   7.407 1.00 . A A .  30 ASP CA   1 1 
        2  2881 1 1  30 ASP CB   C -10.621   6.216   6.921 1.00 . A A .  30 ASP CB   1 1 
        2  2882 1 1  30 ASP CG   C -11.644   7.071   6.166 1.00 . A A .  30 ASP CG   1 1 
        2  2883 1 1  30 ASP H    H  -7.663   6.837   6.257 1.00 . A A .  30 ASP H    1 1 
        2  2884 1 1  30 ASP HA   H  -9.850   8.042   7.756 1.00 . A A .  30 ASP HA   1 1 
        2  2885 1 1  30 ASP HB2  H -10.238   5.450   6.263 1.00 . A A .  30 ASP HB2  1 1 
        2  2886 1 1  30 ASP HB3  H -11.103   5.754   7.769 1.00 . A A .  30 ASP HB3  1 1 
        2  2887 1 1  30 ASP N    N  -8.509   7.329   6.286 1.00 . A A .  30 ASP N    1 1 
        2  2888 1 1  30 ASP O    O  -8.663   5.167   8.588 1.00 . A A .  30 ASP O    1 1 
        2  2889 1 1  30 ASP OD1  O -11.901   8.180   6.604 1.00 . A A .  30 ASP OD1  1 1 
        2  2890 1 1  30 ASP OD2  O -12.155   6.599   5.164 1.00 . A A .  30 ASP OD2  1 1 
        2  2891 1 1  31 PRO C    C  -8.183   5.486  11.361 1.00 . A A .  31 PRO C    1 1 
        2  2892 1 1  31 PRO CA   C  -7.364   6.534  10.596 1.00 . A A .  31 PRO CA   1 1 
        2  2893 1 1  31 PRO CB   C  -7.062   7.746  11.496 1.00 . A A .  31 PRO CB   1 1 
        2  2894 1 1  31 PRO CD   C  -8.119   8.598   9.495 1.00 . A A .  31 PRO CD   1 1 
        2  2895 1 1  31 PRO CG   C  -7.085   8.926  10.575 1.00 . A A .  31 PRO CG   1 1 
        2  2896 1 1  31 PRO HA   H  -6.441   6.105  10.245 1.00 . A A .  31 PRO HA   1 1 
        2  2897 1 1  31 PRO HB2  H  -7.823   7.851  12.260 1.00 . A A .  31 PRO HB2  1 1 
        2  2898 1 1  31 PRO HB3  H  -6.087   7.649  11.949 1.00 . A A .  31 PRO HB3  1 1 
        2  2899 1 1  31 PRO HD2  H  -9.094   8.977   9.776 1.00 . A A .  31 PRO HD2  1 1 
        2  2900 1 1  31 PRO HD3  H  -7.815   8.996   8.541 1.00 . A A .  31 PRO HD3  1 1 
        2  2901 1 1  31 PRO HG2  H  -7.377   9.818  11.117 1.00 . A A .  31 PRO HG2  1 1 
        2  2902 1 1  31 PRO HG3  H  -6.116   9.067  10.120 1.00 . A A .  31 PRO HG3  1 1 
        2  2903 1 1  31 PRO N    N  -8.128   7.124   9.454 1.00 . A A .  31 PRO N    1 1 
        2  2904 1 1  31 PRO O    O  -7.669   4.468  11.779 1.00 . A A .  31 PRO O    1 1 
        2  2905 1 1  32 GLU C    C -10.437   3.469  11.474 1.00 . A A .  32 GLU C    1 1 
        2  2906 1 1  32 GLU CA   C -10.306   4.767  12.279 1.00 . A A .  32 GLU CA   1 1 
        2  2907 1 1  32 GLU CB   C -11.691   5.399  12.481 1.00 . A A .  32 GLU CB   1 1 
        2  2908 1 1  32 GLU CD   C -12.757   3.254  13.189 1.00 . A A .  32 GLU CD   1 1 
        2  2909 1 1  32 GLU CG   C -12.434   4.686  13.612 1.00 . A A .  32 GLU CG   1 1 
        2  2910 1 1  32 GLU H    H  -9.838   6.563  11.196 1.00 . A A .  32 GLU H    1 1 
        2  2911 1 1  32 GLU HA   H  -9.863   4.550  13.240 1.00 . A A .  32 GLU HA   1 1 
        2  2912 1 1  32 GLU HB2  H -11.570   6.442  12.733 1.00 . A A .  32 GLU HB2  1 1 
        2  2913 1 1  32 GLU HB3  H -12.262   5.315  11.569 1.00 . A A .  32 GLU HB3  1 1 
        2  2914 1 1  32 GLU HG2  H -11.817   4.674  14.499 1.00 . A A .  32 GLU HG2  1 1 
        2  2915 1 1  32 GLU HG3  H -13.354   5.212  13.824 1.00 . A A .  32 GLU HG3  1 1 
        2  2916 1 1  32 GLU N    N  -9.447   5.735  11.543 1.00 . A A .  32 GLU N    1 1 
        2  2917 1 1  32 GLU O    O -10.323   2.383  12.007 1.00 . A A .  32 GLU O    1 1 
        2  2918 1 1  32 GLU OE1  O -12.976   3.042  12.008 1.00 . A A .  32 GLU OE1  1 1 
        2  2919 1 1  32 GLU OE2  O -12.775   2.393  14.052 1.00 . A A .  32 GLU OE2  1 1 
        2  2920 1 1  33 LYS C    C  -9.484   1.598   9.302 1.00 . A A .  33 LYS C    1 1 
        2  2921 1 1  33 LYS CA   C -10.814   2.356   9.353 1.00 . A A .  33 LYS CA   1 1 
        2  2922 1 1  33 LYS CB   C -11.236   2.758   7.936 1.00 . A A .  33 LYS CB   1 1 
        2  2923 1 1  33 LYS CD   C -13.075   3.746   6.556 1.00 . A A .  33 LYS CD   1 1 
        2  2924 1 1  33 LYS CE   C -14.475   4.368   6.589 1.00 . A A .  33 LYS CE   1 1 
        2  2925 1 1  33 LYS CG   C -12.651   3.350   7.973 1.00 . A A .  33 LYS CG   1 1 
        2  2926 1 1  33 LYS H    H -10.762   4.463   9.788 1.00 . A A .  33 LYS H    1 1 
        2  2927 1 1  33 LYS HA   H -11.572   1.709   9.779 1.00 . A A .  33 LYS HA   1 1 
        2  2928 1 1  33 LYS HB2  H -10.545   3.495   7.552 1.00 . A A .  33 LYS HB2  1 1 
        2  2929 1 1  33 LYS HB3  H -11.228   1.889   7.296 1.00 . A A .  33 LYS HB3  1 1 
        2  2930 1 1  33 LYS HD2  H -12.373   4.460   6.156 1.00 . A A .  33 LYS HD2  1 1 
        2  2931 1 1  33 LYS HD3  H -13.093   2.869   5.928 1.00 . A A .  33 LYS HD3  1 1 
        2  2932 1 1  33 LYS HE2  H -15.182   3.644   6.966 1.00 . A A .  33 LYS HE2  1 1 
        2  2933 1 1  33 LYS HE3  H -14.468   5.235   7.232 1.00 . A A .  33 LYS HE3  1 1 
        2  2934 1 1  33 LYS HG2  H -13.338   2.612   8.362 1.00 . A A .  33 LYS HG2  1 1 
        2  2935 1 1  33 LYS HG3  H -12.662   4.222   8.607 1.00 . A A .  33 LYS HG3  1 1 
        2  2936 1 1  33 LYS HZ1  H -15.453   5.631   5.253 1.00 . A A .  33 LYS HZ1  1 1 
        2  2937 1 1  33 LYS HZ2  H -15.409   4.009   4.761 1.00 . A A .  33 LYS HZ2  1 1 
        2  2938 1 1  33 LYS HZ3  H -14.010   4.968   4.649 1.00 . A A .  33 LYS HZ3  1 1 
        2  2939 1 1  33 LYS N    N -10.674   3.577  10.195 1.00 . A A .  33 LYS N    1 1 
        2  2940 1 1  33 LYS NZ   N -14.866   4.775   5.209 1.00 . A A .  33 LYS NZ   1 1 
        2  2941 1 1  33 LYS O    O  -9.455   0.385   9.302 1.00 . A A .  33 LYS O    1 1 
        2  2942 1 1  34 ILE C    C  -6.874   0.749  10.458 1.00 . A A .  34 ILE C    1 1 
        2  2943 1 1  34 ILE CA   C  -7.074   1.568   9.180 1.00 . A A .  34 ILE CA   1 1 
        2  2944 1 1  34 ILE CB   C  -5.935   2.582   9.047 1.00 . A A .  34 ILE CB   1 1 
        2  2945 1 1  34 ILE CD1  C  -5.065   4.459   7.648 1.00 . A A .  34 ILE CD1  1 1 
        2  2946 1 1  34 ILE CG1  C  -6.026   3.271   7.683 1.00 . A A .  34 ILE CG1  1 1 
        2  2947 1 1  34 ILE CG2  C  -4.588   1.859   9.165 1.00 . A A .  34 ILE CG2  1 1 
        2  2948 1 1  34 ILE H    H  -8.403   3.267   9.235 1.00 . A A .  34 ILE H    1 1 
        2  2949 1 1  34 ILE HA   H  -7.068   0.912   8.327 1.00 . A A .  34 ILE HA   1 1 
        2  2950 1 1  34 ILE HB   H  -6.016   3.320   9.831 1.00 . A A .  34 ILE HB   1 1 
        2  2951 1 1  34 ILE HD11 H  -4.047   4.098   7.680 1.00 . A A .  34 ILE HD11 1 1 
        2  2952 1 1  34 ILE HD12 H  -5.249   5.093   8.502 1.00 . A A .  34 ILE HD12 1 1 
        2  2953 1 1  34 ILE HD13 H  -5.218   5.022   6.741 1.00 . A A .  34 ILE HD13 1 1 
        2  2954 1 1  34 ILE HG12 H  -5.761   2.567   6.905 1.00 . A A .  34 ILE HG12 1 1 
        2  2955 1 1  34 ILE HG13 H  -7.035   3.622   7.523 1.00 . A A .  34 ILE HG13 1 1 
        2  2956 1 1  34 ILE HG21 H  -3.796   2.501   8.807 1.00 . A A .  34 ILE HG21 1 1 
        2  2957 1 1  34 ILE HG22 H  -4.612   0.955   8.573 1.00 . A A .  34 ILE HG22 1 1 
        2  2958 1 1  34 ILE HG23 H  -4.407   1.604  10.199 1.00 . A A .  34 ILE HG23 1 1 
        2  2959 1 1  34 ILE N    N  -8.377   2.287   9.245 1.00 . A A .  34 ILE N    1 1 
        2  2960 1 1  34 ILE O    O  -6.505  -0.411  10.414 1.00 . A A .  34 ILE O    1 1 
        2  2961 1 1  35 LEU C    C  -8.022  -0.482  12.980 1.00 . A A .  35 LEU C    1 1 
        2  2962 1 1  35 LEU CA   C  -6.951   0.597  12.871 1.00 . A A .  35 LEU CA   1 1 
        2  2963 1 1  35 LEU CB   C  -7.090   1.573  14.042 1.00 . A A .  35 LEU CB   1 1 
        2  2964 1 1  35 LEU CD1  C  -6.243   3.690  15.060 1.00 . A A .  35 LEU CD1  1 1 
        2  2965 1 1  35 LEU CD2  C  -4.611   2.038  14.105 1.00 . A A .  35 LEU CD2  1 1 
        2  2966 1 1  35 LEU CG   C  -6.011   2.662  13.949 1.00 . A A .  35 LEU CG   1 1 
        2  2967 1 1  35 LEU H    H  -7.434   2.269  11.605 1.00 . A A .  35 LEU H    1 1 
        2  2968 1 1  35 LEU HA   H  -5.975   0.138  12.895 1.00 . A A .  35 LEU HA   1 1 
        2  2969 1 1  35 LEU HB2  H  -8.067   2.036  14.006 1.00 . A A .  35 LEU HB2  1 1 
        2  2970 1 1  35 LEU HB3  H  -6.980   1.038  14.972 1.00 . A A .  35 LEU HB3  1 1 
        2  2971 1 1  35 LEU HD11 H  -7.086   4.312  14.803 1.00 . A A .  35 LEU HD11 1 1 
        2  2972 1 1  35 LEU HD12 H  -5.361   4.305  15.171 1.00 . A A .  35 LEU HD12 1 1 
        2  2973 1 1  35 LEU HD13 H  -6.443   3.177  15.990 1.00 . A A .  35 LEU HD13 1 1 
        2  2974 1 1  35 LEU HD21 H  -3.916   2.788  14.459 1.00 . A A .  35 LEU HD21 1 1 
        2  2975 1 1  35 LEU HD22 H  -4.274   1.669  13.149 1.00 . A A .  35 LEU HD22 1 1 
        2  2976 1 1  35 LEU HD23 H  -4.649   1.224  14.814 1.00 . A A .  35 LEU HD23 1 1 
        2  2977 1 1  35 LEU HG   H  -6.082   3.153  12.989 1.00 . A A .  35 LEU HG   1 1 
        2  2978 1 1  35 LEU N    N  -7.128   1.338  11.593 1.00 . A A .  35 LEU N    1 1 
        2  2979 1 1  35 LEU O    O  -7.916  -1.398  13.775 1.00 . A A .  35 LEU O    1 1 
        2  2980 1 1  36 ARG C    C  -9.551  -2.765  11.842 1.00 . A A .  36 ARG C    1 1 
        2  2981 1 1  36 ARG CA   C -10.125  -1.409  12.238 1.00 . A A .  36 ARG CA   1 1 
        2  2982 1 1  36 ARG CB   C -11.248  -1.021  11.262 1.00 . A A .  36 ARG CB   1 1 
        2  2983 1 1  36 ARG CD   C -12.478  -3.116  10.537 1.00 . A A .  36 ARG CD   1 1 
        2  2984 1 1  36 ARG CG   C -12.501  -1.906  11.483 1.00 . A A .  36 ARG CG   1 1 
        2  2985 1 1  36 ARG CZ   C -13.832  -5.137  10.393 1.00 . A A .  36 ARG CZ   1 1 
        2  2986 1 1  36 ARG H    H  -9.111   0.355  11.552 1.00 . A A .  36 ARG H    1 1 
        2  2987 1 1  36 ARG HA   H -10.517  -1.461  13.242 1.00 . A A .  36 ARG HA   1 1 
        2  2988 1 1  36 ARG HB2  H -11.509   0.016  11.422 1.00 . A A .  36 ARG HB2  1 1 
        2  2989 1 1  36 ARG HB3  H -10.894  -1.144  10.248 1.00 . A A .  36 ARG HB3  1 1 
        2  2990 1 1  36 ARG HD2  H -12.344  -2.774   9.522 1.00 . A A .  36 ARG HD2  1 1 
        2  2991 1 1  36 ARG HD3  H -11.666  -3.771  10.806 1.00 . A A .  36 ARG HD3  1 1 
        2  2992 1 1  36 ARG HE   H -14.584  -3.374  10.919 1.00 . A A .  36 ARG HE   1 1 
        2  2993 1 1  36 ARG HG2  H -12.533  -2.256  12.505 1.00 . A A .  36 ARG HG2  1 1 
        2  2994 1 1  36 ARG HG3  H -13.388  -1.324  11.283 1.00 . A A .  36 ARG HG3  1 1 
        2  2995 1 1  36 ARG HH11 H -11.885  -5.304   9.947 1.00 . A A .  36 ARG HH11 1 1 
        2  2996 1 1  36 ARG HH12 H -12.807  -6.764   9.835 1.00 . A A .  36 ARG HH12 1 1 
        2  2997 1 1  36 ARG HH21 H -15.795  -5.278  10.773 1.00 . A A .  36 ARG HH21 1 1 
        2  2998 1 1  36 ARG HH22 H -15.013  -6.752  10.303 1.00 . A A .  36 ARG HH22 1 1 
        2  2999 1 1  36 ARG N    N  -9.049  -0.387  12.186 1.00 . A A .  36 ARG N    1 1 
        2  3000 1 1  36 ARG NE   N -13.773  -3.854  10.649 1.00 . A A .  36 ARG NE   1 1 
        2  3001 1 1  36 ARG NH1  N -12.757  -5.785  10.031 1.00 . A A .  36 ARG NH1  1 1 
        2  3002 1 1  36 ARG NH2  N -14.969  -5.772  10.498 1.00 . A A .  36 ARG NH2  1 1 
        2  3003 1 1  36 ARG O    O  -9.851  -3.769  12.459 1.00 . A A .  36 ARG O    1 1 
        2  3004 1 1  37 TRP C    C  -6.689  -4.231  10.818 1.00 . A A .  37 TRP C    1 1 
        2  3005 1 1  37 TRP CA   C  -8.152  -4.126  10.374 1.00 . A A .  37 TRP CA   1 1 
        2  3006 1 1  37 TRP CB   C  -8.261  -4.271   8.853 1.00 . A A .  37 TRP CB   1 1 
        2  3007 1 1  37 TRP CD1  C  -8.707  -1.982   7.896 1.00 . A A .  37 TRP CD1  1 1 
        2  3008 1 1  37 TRP CD2  C  -6.565  -2.619   7.657 1.00 . A A .  37 TRP CD2  1 1 
        2  3009 1 1  37 TRP CE2  C  -6.673  -1.334   7.075 1.00 . A A .  37 TRP CE2  1 1 
        2  3010 1 1  37 TRP CE3  C  -5.309  -3.250   7.640 1.00 . A A .  37 TRP CE3  1 1 
        2  3011 1 1  37 TRP CG   C  -7.868  -3.005   8.172 1.00 . A A .  37 TRP CG   1 1 
        2  3012 1 1  37 TRP CH2  C  -4.335  -1.340   6.486 1.00 . A A .  37 TRP CH2  1 1 
        2  3013 1 1  37 TRP CZ2  C  -5.577  -0.699   6.494 1.00 . A A .  37 TRP CZ2  1 1 
        2  3014 1 1  37 TRP CZ3  C  -4.201  -2.614   7.057 1.00 . A A .  37 TRP CZ3  1 1 
        2  3015 1 1  37 TRP H    H  -8.504  -1.988  10.328 1.00 . A A .  37 TRP H    1 1 
        2  3016 1 1  37 TRP HA   H  -8.709  -4.936  10.831 1.00 . A A .  37 TRP HA   1 1 
        2  3017 1 1  37 TRP HB2  H  -7.616  -5.069   8.523 1.00 . A A .  37 TRP HB2  1 1 
        2  3018 1 1  37 TRP HB3  H  -9.283  -4.510   8.598 1.00 . A A .  37 TRP HB3  1 1 
        2  3019 1 1  37 TRP HD1  H  -9.758  -1.945   8.142 1.00 . A A .  37 TRP HD1  1 1 
        2  3020 1 1  37 TRP HE1  H  -8.376  -0.140   6.933 1.00 . A A .  37 TRP HE1  1 1 
        2  3021 1 1  37 TRP HE3  H  -5.195  -4.231   8.077 1.00 . A A .  37 TRP HE3  1 1 
        2  3022 1 1  37 TRP HH2  H  -3.479  -0.855   6.040 1.00 . A A .  37 TRP HH2  1 1 
        2  3023 1 1  37 TRP HZ2  H  -5.686   0.282   6.056 1.00 . A A .  37 TRP HZ2  1 1 
        2  3024 1 1  37 TRP HZ3  H  -3.240  -3.107   7.050 1.00 . A A .  37 TRP HZ3  1 1 
        2  3025 1 1  37 TRP N    N  -8.733  -2.814  10.814 1.00 . A A .  37 TRP N    1 1 
        2  3026 1 1  37 TRP NE1  N  -8.000  -0.990   7.243 1.00 . A A .  37 TRP NE1  1 1 
        2  3027 1 1  37 TRP O    O  -5.918  -4.973  10.244 1.00 . A A .  37 TRP O    1 1 
        2  3028 1 1  38 MET C    C  -4.061  -2.461  11.728 1.00 . A A .  38 MET C    1 1 
        2  3029 1 1  38 MET CA   C  -4.931  -3.523  12.403 1.00 . A A .  38 MET CA   1 1 
        2  3030 1 1  38 MET CB   C  -4.283  -4.910  12.222 1.00 . A A .  38 MET CB   1 1 
        2  3031 1 1  38 MET CE   C  -3.116  -6.851  15.374 1.00 . A A .  38 MET CE   1 1 
        2  3032 1 1  38 MET CG   C  -3.177  -5.102  13.264 1.00 . A A .  38 MET CG   1 1 
        2  3033 1 1  38 MET H    H  -6.994  -2.924  12.276 1.00 . A A .  38 MET H    1 1 
        2  3034 1 1  38 MET HA   H  -4.984  -3.297  13.459 1.00 . A A .  38 MET HA   1 1 
        2  3035 1 1  38 MET HB2  H  -5.033  -5.675  12.346 1.00 . A A .  38 MET HB2  1 1 
        2  3036 1 1  38 MET HB3  H  -3.852  -4.986  11.234 1.00 . A A .  38 MET HB3  1 1 
        2  3037 1 1  38 MET HE1  H  -3.469  -7.160  16.349 1.00 . A A .  38 MET HE1  1 1 
        2  3038 1 1  38 MET HE2  H  -2.044  -6.702  15.406 1.00 . A A .  38 MET HE2  1 1 
        2  3039 1 1  38 MET HE3  H  -3.350  -7.615  14.650 1.00 . A A .  38 MET HE3  1 1 
        2  3040 1 1  38 MET HG2  H  -2.597  -5.979  13.013 1.00 . A A .  38 MET HG2  1 1 
        2  3041 1 1  38 MET HG3  H  -2.533  -4.235  13.264 1.00 . A A .  38 MET HG3  1 1 
        2  3042 1 1  38 MET N    N  -6.328  -3.497  11.847 1.00 . A A .  38 MET N    1 1 
        2  3043 1 1  38 MET O    O  -4.224  -2.153  10.565 1.00 . A A .  38 MET O    1 1 
        2  3044 1 1  38 MET SD   S  -3.924  -5.300  14.906 1.00 . A A .  38 MET SD   1 1 
        2  3045 1 1  39 GLY C    C  -1.143  -0.514  12.899 1.00 . A A .  39 GLY C    1 1 
        2  3046 1 1  39 GLY CA   C  -2.229  -0.866  11.879 1.00 . A A .  39 GLY CA   1 1 
        2  3047 1 1  39 GLY H    H  -3.016  -2.181  13.394 1.00 . A A .  39 GLY H    1 1 
        2  3048 1 1  39 GLY HA2  H  -1.771  -1.249  10.977 1.00 . A A .  39 GLY HA2  1 1 
        2  3049 1 1  39 GLY HA3  H  -2.802   0.019  11.647 1.00 . A A .  39 GLY HA3  1 1 
        2  3050 1 1  39 GLY N    N  -3.128  -1.908  12.458 1.00 . A A .  39 GLY N    1 1 
        2  3051 1 1  39 GLY O    O  -0.911  -1.240  13.845 1.00 . A A .  39 GLY O    1 1 
        2  3052 1 1  40 THR C    C   0.120   2.196  14.496 1.00 . A A .  40 THR C    1 1 
        2  3053 1 1  40 THR CA   C   0.609   1.011  13.660 1.00 . A A .  40 THR CA   1 1 
        2  3054 1 1  40 THR CB   C   1.846   1.417  12.862 1.00 . A A .  40 THR CB   1 1 
        2  3055 1 1  40 THR CG2  C   2.214   0.289  11.897 1.00 . A A .  40 THR CG2  1 1 
        2  3056 1 1  40 THR H    H  -0.679   1.157  11.936 1.00 . A A .  40 THR H    1 1 
        2  3057 1 1  40 THR HA   H   0.866   0.189  14.319 1.00 . A A .  40 THR HA   1 1 
        2  3058 1 1  40 THR HB   H   2.669   1.597  13.536 1.00 . A A .  40 THR HB   1 1 
        2  3059 1 1  40 THR HG1  H   1.556   2.377  11.197 1.00 . A A .  40 THR HG1  1 1 
        2  3060 1 1  40 THR HG21 H   3.207   0.461  11.506 1.00 . A A .  40 THR HG21 1 1 
        2  3061 1 1  40 THR HG22 H   1.506   0.267  11.084 1.00 . A A .  40 THR HG22 1 1 
        2  3062 1 1  40 THR HG23 H   2.192  -0.653  12.422 1.00 . A A .  40 THR HG23 1 1 
        2  3063 1 1  40 THR N    N  -0.472   0.594  12.710 1.00 . A A .  40 THR N    1 1 
        2  3064 1 1  40 THR O    O   0.762   3.226  14.566 1.00 . A A .  40 THR O    1 1 
        2  3065 1 1  40 THR OG1  O   1.563   2.600  12.131 1.00 . A A .  40 THR OG1  1 1 
        2  3066 1 1  41 GLU C    C  -1.823   4.396  15.160 1.00 . A A .  41 GLU C    1 1 
        2  3067 1 1  41 GLU CA   C  -1.600   3.125  15.978 1.00 . A A .  41 GLU CA   1 1 
        2  3068 1 1  41 GLU CB   C  -0.664   3.427  17.152 1.00 . A A .  41 GLU CB   1 1 
        2  3069 1 1  41 GLU CD   C   0.362   2.481  19.224 1.00 . A A .  41 GLU CD   1 1 
        2  3070 1 1  41 GLU CG   C  -0.640   2.226  18.096 1.00 . A A .  41 GLU CG   1 1 
        2  3071 1 1  41 GLU H    H  -1.496   1.198  15.032 1.00 . A A .  41 GLU H    1 1 
        2  3072 1 1  41 GLU HA   H  -2.550   2.790  16.367 1.00 . A A .  41 GLU HA   1 1 
        2  3073 1 1  41 GLU HB2  H   0.331   3.621  16.786 1.00 . A A .  41 GLU HB2  1 1 
        2  3074 1 1  41 GLU HB3  H  -1.026   4.294  17.686 1.00 . A A .  41 GLU HB3  1 1 
        2  3075 1 1  41 GLU HG2  H  -1.626   2.080  18.516 1.00 . A A .  41 GLU HG2  1 1 
        2  3076 1 1  41 GLU HG3  H  -0.346   1.344  17.549 1.00 . A A .  41 GLU HG3  1 1 
        2  3077 1 1  41 GLU N    N  -1.018   2.042  15.125 1.00 . A A .  41 GLU N    1 1 
        2  3078 1 1  41 GLU O    O  -1.013   4.769  14.335 1.00 . A A .  41 GLU O    1 1 
        2  3079 1 1  41 GLU OE1  O   0.965   3.540  19.224 1.00 . A A .  41 GLU OE1  1 1 
        2  3080 1 1  41 GLU OE2  O   0.506   1.611  20.067 1.00 . A A .  41 GLU OE2  1 1 
        2  3081 1 1  42 ALA C    C  -4.291   7.122  15.364 1.00 . A A .  42 ALA C    1 1 
        2  3082 1 1  42 ALA CA   C  -3.204   6.323  14.641 1.00 . A A .  42 ALA CA   1 1 
        2  3083 1 1  42 ALA CB   C  -3.667   5.983  13.225 1.00 . A A .  42 ALA CB   1 1 
        2  3084 1 1  42 ALA H    H  -3.556   4.748  16.067 1.00 . A A .  42 ALA H    1 1 
        2  3085 1 1  42 ALA HA   H  -2.310   6.916  14.593 1.00 . A A .  42 ALA HA   1 1 
        2  3086 1 1  42 ALA HB1  H  -2.974   5.285  12.779 1.00 . A A .  42 ALA HB1  1 1 
        2  3087 1 1  42 ALA HB2  H  -3.700   6.885  12.629 1.00 . A A .  42 ALA HB2  1 1 
        2  3088 1 1  42 ALA HB3  H  -4.651   5.539  13.262 1.00 . A A .  42 ALA HB3  1 1 
        2  3089 1 1  42 ALA N    N  -2.921   5.068  15.392 1.00 . A A .  42 ALA N    1 1 
        2  3090 1 1  42 ALA O    O  -5.177   6.569  15.985 1.00 . A A .  42 ALA O    1 1 
        2  3091 1 1  43 GLU C    C  -6.422   9.517  15.040 1.00 . A A .  43 GLU C    1 1 
        2  3092 1 1  43 GLU CA   C  -5.237   9.278  15.970 1.00 . A A .  43 GLU CA   1 1 
        2  3093 1 1  43 GLU CB   C  -4.605  10.621  16.338 1.00 . A A .  43 GLU CB   1 1 
        2  3094 1 1  43 GLU CD   C  -4.192   9.974  18.721 1.00 . A A .  43 GLU CD   1 1 
        2  3095 1 1  43 GLU CG   C  -3.533  10.404  17.407 1.00 . A A .  43 GLU CG   1 1 
        2  3096 1 1  43 GLU H    H  -3.496   8.841  14.783 1.00 . A A .  43 GLU H    1 1 
        2  3097 1 1  43 GLU HA   H  -5.581   8.785  16.866 1.00 . A A .  43 GLU HA   1 1 
        2  3098 1 1  43 GLU HB2  H  -4.155  11.059  15.459 1.00 . A A .  43 GLU HB2  1 1 
        2  3099 1 1  43 GLU HB3  H  -5.366  11.283  16.722 1.00 . A A .  43 GLU HB3  1 1 
        2  3100 1 1  43 GLU HG2  H  -2.850   9.633  17.078 1.00 . A A .  43 GLU HG2  1 1 
        2  3101 1 1  43 GLU HG3  H  -2.989  11.324  17.563 1.00 . A A .  43 GLU HG3  1 1 
        2  3102 1 1  43 GLU N    N  -4.222   8.421  15.288 1.00 . A A .  43 GLU N    1 1 
        2  3103 1 1  43 GLU O    O  -6.342   9.299  13.849 1.00 . A A .  43 GLU O    1 1 
        2  3104 1 1  43 GLU OE1  O  -5.408  10.050  18.806 1.00 . A A .  43 GLU OE1  1 1 
        2  3105 1 1  43 GLU OE2  O  -3.469   9.590  19.624 1.00 . A A .  43 GLU OE2  1 1 
        2  3106 1 1  44 VAL C    C  -9.331  11.584  15.132 1.00 . A A .  44 VAL C    1 1 
        2  3107 1 1  44 VAL CA   C  -8.739  10.226  14.754 1.00 . A A .  44 VAL CA   1 1 
        2  3108 1 1  44 VAL CB   C  -9.774   9.124  15.011 1.00 . A A .  44 VAL CB   1 1 
        2  3109 1 1  44 VAL CG1  C -10.352   9.265  16.423 1.00 . A A .  44 VAL CG1  1 1 
        2  3110 1 1  44 VAL CG2  C -10.905   9.249  13.989 1.00 . A A .  44 VAL CG2  1 1 
        2  3111 1 1  44 VAL H    H  -7.556  10.127  16.549 1.00 . A A .  44 VAL H    1 1 
        2  3112 1 1  44 VAL HA   H  -8.479  10.233  13.703 1.00 . A A .  44 VAL HA   1 1 
        2  3113 1 1  44 VAL HB   H  -9.301   8.156  14.910 1.00 . A A .  44 VAL HB   1 1 
        2  3114 1 1  44 VAL HG11 H  -9.547   9.393  17.131 1.00 . A A .  44 VAL HG11 1 1 
        2  3115 1 1  44 VAL HG12 H -10.912   8.375  16.672 1.00 . A A .  44 VAL HG12 1 1 
        2  3116 1 1  44 VAL HG13 H -11.007  10.122  16.462 1.00 . A A .  44 VAL HG13 1 1 
        2  3117 1 1  44 VAL HG21 H -11.623   8.459  14.149 1.00 . A A .  44 VAL HG21 1 1 
        2  3118 1 1  44 VAL HG22 H -10.499   9.171  12.991 1.00 . A A .  44 VAL HG22 1 1 
        2  3119 1 1  44 VAL HG23 H -11.389  10.207  14.108 1.00 . A A .  44 VAL HG23 1 1 
        2  3120 1 1  44 VAL N    N  -7.525   9.963  15.583 1.00 . A A .  44 VAL N    1 1 
        2  3121 1 1  44 VAL O    O  -9.314  11.984  16.280 1.00 . A A .  44 VAL O    1 1 
        2  3122 1 1  45 GLU C    C -11.300  14.077  13.281 1.00 . A A .  45 GLU C    1 1 
        2  3123 1 1  45 GLU CA   C -10.461  13.621  14.484 1.00 . A A .  45 GLU CA   1 1 
        2  3124 1 1  45 GLU CB   C  -9.339  14.640  14.759 1.00 . A A .  45 GLU CB   1 1 
        2  3125 1 1  45 GLU CD   C  -7.193  15.536  13.821 1.00 . A A .  45 GLU CD   1 1 
        2  3126 1 1  45 GLU CG   C  -8.106  14.309  13.906 1.00 . A A .  45 GLU CG   1 1 
        2  3127 1 1  45 GLU H    H  -9.871  11.954  13.260 1.00 . A A .  45 GLU H    1 1 
        2  3128 1 1  45 GLU HA   H -11.087  13.527  15.356 1.00 . A A .  45 GLU HA   1 1 
        2  3129 1 1  45 GLU HB2  H  -9.686  15.638  14.522 1.00 . A A .  45 GLU HB2  1 1 
        2  3130 1 1  45 GLU HB3  H  -9.067  14.599  15.804 1.00 . A A .  45 GLU HB3  1 1 
        2  3131 1 1  45 GLU HG2  H  -7.565  13.490  14.360 1.00 . A A .  45 GLU HG2  1 1 
        2  3132 1 1  45 GLU HG3  H  -8.418  14.026  12.911 1.00 . A A .  45 GLU HG3  1 1 
        2  3133 1 1  45 GLU N    N  -9.862  12.295  14.178 1.00 . A A .  45 GLU N    1 1 
        2  3134 1 1  45 GLU O    O -11.049  13.670  12.163 1.00 . A A .  45 GLU O    1 1 
        2  3135 1 1  45 GLU OE1  O  -7.338  16.417  14.654 1.00 . A A .  45 GLU OE1  1 1 
        2  3136 1 1  45 GLU OE2  O  -6.365  15.576  12.925 1.00 . A A .  45 GLU OE2  1 1 
        2  3137 1 1  46 PRO C    C -12.313  15.820  11.153 1.00 . A A .  46 PRO C    1 1 
        2  3138 1 1  46 PRO CA   C -13.133  15.441  12.389 1.00 . A A .  46 PRO CA   1 1 
        2  3139 1 1  46 PRO CB   C -13.784  16.691  12.992 1.00 . A A .  46 PRO CB   1 1 
        2  3140 1 1  46 PRO CD   C -12.697  15.473  14.803 1.00 . A A .  46 PRO CD   1 1 
        2  3141 1 1  46 PRO CG   C -13.859  16.424  14.464 1.00 . A A .  46 PRO CG   1 1 
        2  3142 1 1  46 PRO HA   H -13.894  14.723  12.135 1.00 . A A .  46 PRO HA   1 1 
        2  3143 1 1  46 PRO HB2  H -13.170  17.567  12.800 1.00 . A A .  46 PRO HB2  1 1 
        2  3144 1 1  46 PRO HB3  H -14.775  16.834  12.586 1.00 . A A .  46 PRO HB3  1 1 
        2  3145 1 1  46 PRO HD2  H -11.885  16.009  15.273 1.00 . A A .  46 PRO HD2  1 1 
        2  3146 1 1  46 PRO HD3  H -13.044  14.673  15.443 1.00 . A A .  46 PRO HD3  1 1 
        2  3147 1 1  46 PRO HG2  H -13.760  17.350  15.018 1.00 . A A .  46 PRO HG2  1 1 
        2  3148 1 1  46 PRO HG3  H -14.800  15.948  14.706 1.00 . A A .  46 PRO HG3  1 1 
        2  3149 1 1  46 PRO N    N -12.279  14.927  13.494 1.00 . A A .  46 PRO N    1 1 
        2  3150 1 1  46 PRO O    O -12.731  15.607  10.033 1.00 . A A .  46 PRO O    1 1 
        2  3151 1 1  47 GLU C    C  -9.240  15.674   9.936 1.00 . A A .  47 GLU C    1 1 
        2  3152 1 1  47 GLU CA   C -10.297  16.771  10.180 1.00 . A A .  47 GLU CA   1 1 
        2  3153 1 1  47 GLU CB   C  -9.586  18.092  10.494 1.00 . A A .  47 GLU CB   1 1 
        2  3154 1 1  47 GLU CD   C  -8.395  20.041   9.468 1.00 . A A .  47 GLU CD   1 1 
        2  3155 1 1  47 GLU CG   C  -8.999  18.662   9.200 1.00 . A A .  47 GLU CG   1 1 
        2  3156 1 1  47 GLU H    H -10.828  16.543  12.260 1.00 . A A .  47 GLU H    1 1 
        2  3157 1 1  47 GLU HA   H -10.917  16.907   9.309 1.00 . A A .  47 GLU HA   1 1 
        2  3158 1 1  47 GLU HB2  H -10.295  18.795  10.912 1.00 . A A .  47 GLU HB2  1 1 
        2  3159 1 1  47 GLU HB3  H  -8.790  17.920  11.204 1.00 . A A .  47 GLU HB3  1 1 
        2  3160 1 1  47 GLU HG2  H  -8.234  17.997   8.832 1.00 . A A .  47 GLU HG2  1 1 
        2  3161 1 1  47 GLU HG3  H  -9.781  18.754   8.460 1.00 . A A .  47 GLU HG3  1 1 
        2  3162 1 1  47 GLU N    N -11.147  16.381  11.346 1.00 . A A .  47 GLU N    1 1 
        2  3163 1 1  47 GLU O    O  -8.353  15.495  10.748 1.00 . A A .  47 GLU O    1 1 
        2  3164 1 1  47 GLU OE1  O  -7.300  20.090  10.002 1.00 . A A .  47 GLU OE1  1 1 
        2  3165 1 1  47 GLU OE2  O  -9.037  21.023   9.130 1.00 . A A .  47 GLU OE2  1 1 
        2  3166 1 1  48 PRO C    C  -6.865  14.331   8.691 1.00 . A A .  48 PRO C    1 1 
        2  3167 1 1  48 PRO CA   C  -8.321  13.859   8.543 1.00 . A A .  48 PRO CA   1 1 
        2  3168 1 1  48 PRO CB   C  -8.612  13.476   7.082 1.00 . A A .  48 PRO CB   1 1 
        2  3169 1 1  48 PRO CD   C -10.345  15.034   7.781 1.00 . A A .  48 PRO CD   1 1 
        2  3170 1 1  48 PRO CG   C -10.041  13.858   6.844 1.00 . A A .  48 PRO CG   1 1 
        2  3171 1 1  48 PRO HA   H  -8.499  13.008   9.181 1.00 . A A .  48 PRO HA   1 1 
        2  3172 1 1  48 PRO HB2  H  -7.961  14.025   6.409 1.00 . A A .  48 PRO HB2  1 1 
        2  3173 1 1  48 PRO HB3  H  -8.482  12.413   6.936 1.00 . A A .  48 PRO HB3  1 1 
        2  3174 1 1  48 PRO HD2  H -10.266  15.974   7.250 1.00 . A A .  48 PRO HD2  1 1 
        2  3175 1 1  48 PRO HD3  H -11.331  14.926   8.213 1.00 . A A .  48 PRO HD3  1 1 
        2  3176 1 1  48 PRO HG2  H -10.182  14.155   5.810 1.00 . A A .  48 PRO HG2  1 1 
        2  3177 1 1  48 PRO HG3  H -10.691  13.027   7.080 1.00 . A A .  48 PRO HG3  1 1 
        2  3178 1 1  48 PRO N    N  -9.315  14.940   8.839 1.00 . A A .  48 PRO N    1 1 
        2  3179 1 1  48 PRO O    O  -6.501  15.408   8.263 1.00 . A A .  48 PRO O    1 1 
        2  3180 1 1  49 GLY C    C  -4.116  13.327  10.827 1.00 . A A .  49 GLY C    1 1 
        2  3181 1 1  49 GLY CA   C  -4.600  13.895   9.493 1.00 . A A .  49 GLY CA   1 1 
        2  3182 1 1  49 GLY H    H  -6.361  12.659   9.637 1.00 . A A .  49 GLY H    1 1 
        2  3183 1 1  49 GLY HA2  H  -4.008  13.479   8.688 1.00 . A A .  49 GLY HA2  1 1 
        2  3184 1 1  49 GLY HA3  H  -4.496  14.970   9.504 1.00 . A A .  49 GLY HA3  1 1 
        2  3185 1 1  49 GLY N    N  -6.036  13.522   9.301 1.00 . A A .  49 GLY N    1 1 
        2  3186 1 1  49 GLY O    O  -3.018  12.819  10.937 1.00 . A A .  49 GLY O    1 1 
        2  3187 1 1  50 GLY C    C  -3.520  13.814  13.818 1.00 . A A .  50 GLY C    1 1 
        2  3188 1 1  50 GLY CA   C  -4.518  12.858  13.165 1.00 . A A .  50 GLY CA   1 1 
        2  3189 1 1  50 GLY H    H  -5.816  13.809  11.734 1.00 . A A .  50 GLY H    1 1 
        2  3190 1 1  50 GLY HA2  H  -5.388  12.754  13.797 1.00 . A A .  50 GLY HA2  1 1 
        2  3191 1 1  50 GLY HA3  H  -4.052  11.895  13.030 1.00 . A A .  50 GLY HA3  1 1 
        2  3192 1 1  50 GLY N    N  -4.932  13.402  11.843 1.00 . A A .  50 GLY N    1 1 
        2  3193 1 1  50 GLY O    O  -2.788  13.438  14.710 1.00 . A A .  50 GLY O    1 1 
        2  3194 1 1  51 LEU C    C  -1.101  15.506  13.877 1.00 . A A .  51 LEU C    1 1 
        2  3195 1 1  51 LEU CA   C  -2.538  16.038  13.959 1.00 . A A .  51 LEU CA   1 1 
        2  3196 1 1  51 LEU CB   C  -2.892  16.305  15.423 1.00 . A A .  51 LEU CB   1 1 
        2  3197 1 1  51 LEU CD1  C  -4.701  16.951  17.020 1.00 . A A .  51 LEU CD1  1 1 
        2  3198 1 1  51 LEU CD2  C  -4.645  17.967  14.726 1.00 . A A .  51 LEU CD2  1 1 
        2  3199 1 1  51 LEU CG   C  -4.370  16.697  15.546 1.00 . A A .  51 LEU CG   1 1 
        2  3200 1 1  51 LEU H    H  -4.095  15.317  12.656 1.00 . A A .  51 LEU H    1 1 
        2  3201 1 1  51 LEU HA   H  -2.603  16.960  13.403 1.00 . A A .  51 LEU HA   1 1 
        2  3202 1 1  51 LEU HB2  H  -2.707  15.413  16.005 1.00 . A A .  51 LEU HB2  1 1 
        2  3203 1 1  51 LEU HB3  H  -2.277  17.111  15.797 1.00 . A A .  51 LEU HB3  1 1 
        2  3204 1 1  51 LEU HD11 H  -4.679  16.018  17.560 1.00 . A A .  51 LEU HD11 1 1 
        2  3205 1 1  51 LEU HD12 H  -5.685  17.390  17.097 1.00 . A A .  51 LEU HD12 1 1 
        2  3206 1 1  51 LEU HD13 H  -3.972  17.627  17.441 1.00 . A A .  51 LEU HD13 1 1 
        2  3207 1 1  51 LEU HD21 H  -4.796  17.699  13.690 1.00 . A A .  51 LEU HD21 1 1 
        2  3208 1 1  51 LEU HD22 H  -3.806  18.643  14.804 1.00 . A A .  51 LEU HD22 1 1 
        2  3209 1 1  51 LEU HD23 H  -5.536  18.457  15.098 1.00 . A A .  51 LEU HD23 1 1 
        2  3210 1 1  51 LEU HG   H  -4.984  15.887  15.177 1.00 . A A .  51 LEU HG   1 1 
        2  3211 1 1  51 LEU N    N  -3.488  15.044  13.377 1.00 . A A .  51 LEU N    1 1 
        2  3212 1 1  51 LEU O    O  -0.332  15.900  13.025 1.00 . A A .  51 LEU O    1 1 
        2  3213 1 1  52 TYR C    C   0.816  13.054  13.616 1.00 . A A .  52 TYR C    1 1 
        2  3214 1 1  52 TYR CA   C   0.655  14.072  14.750 1.00 . A A .  52 TYR CA   1 1 
        2  3215 1 1  52 TYR CB   C   0.940  13.402  16.093 1.00 . A A .  52 TYR CB   1 1 
        2  3216 1 1  52 TYR CD1  C  -0.264  14.798  17.813 1.00 . A A .  52 TYR CD1  1 1 
        2  3217 1 1  52 TYR CD2  C   2.130  15.083  17.543 1.00 . A A .  52 TYR CD2  1 1 
        2  3218 1 1  52 TYR CE1  C  -0.265  15.774  18.817 1.00 . A A .  52 TYR CE1  1 1 
        2  3219 1 1  52 TYR CE2  C   2.129  16.058  18.547 1.00 . A A .  52 TYR CE2  1 1 
        2  3220 1 1  52 TYR CG   C   0.935  14.453  17.177 1.00 . A A .  52 TYR CG   1 1 
        2  3221 1 1  52 TYR CZ   C   0.930  16.404  19.184 1.00 . A A .  52 TYR CZ   1 1 
        2  3222 1 1  52 TYR H    H  -1.369  14.323  15.446 1.00 . A A .  52 TYR H    1 1 
        2  3223 1 1  52 TYR HA   H   1.355  14.882  14.602 1.00 . A A .  52 TYR HA   1 1 
        2  3224 1 1  52 TYR HB2  H   0.175  12.667  16.297 1.00 . A A .  52 TYR HB2  1 1 
        2  3225 1 1  52 TYR HB3  H   1.906  12.923  16.060 1.00 . A A .  52 TYR HB3  1 1 
        2  3226 1 1  52 TYR HD1  H  -1.185  14.312  17.531 1.00 . A A .  52 TYR HD1  1 1 
        2  3227 1 1  52 TYR HD2  H   3.053  14.816  17.050 1.00 . A A .  52 TYR HD2  1 1 
        2  3228 1 1  52 TYR HE1  H  -1.188  16.042  19.308 1.00 . A A .  52 TYR HE1  1 1 
        2  3229 1 1  52 TYR HE2  H   3.051  16.544  18.829 1.00 . A A .  52 TYR HE2  1 1 
        2  3230 1 1  52 TYR HH   H   0.988  18.224  19.754 1.00 . A A .  52 TYR HH   1 1 
        2  3231 1 1  52 TYR N    N  -0.732  14.622  14.762 1.00 . A A .  52 TYR N    1 1 
        2  3232 1 1  52 TYR O    O  -0.143  12.482  13.139 1.00 . A A .  52 TYR O    1 1 
        2  3233 1 1  52 TYR OH   O   0.929  17.364  20.174 1.00 . A A .  52 TYR OH   1 1 
        2  3234 1 1  53 LEU C    C   2.151  10.428  12.609 1.00 . A A .  53 LEU C    1 1 
        2  3235 1 1  53 LEU CA   C   2.269  11.859  12.075 1.00 . A A .  53 LEU CA   1 1 
        2  3236 1 1  53 LEU CB   C   3.683  12.092  11.528 1.00 . A A .  53 LEU CB   1 1 
        2  3237 1 1  53 LEU CD1  C   2.994  11.033   9.352 1.00 . A A .  53 LEU CD1  1 1 
        2  3238 1 1  53 LEU CD2  C   5.416  11.380   9.888 1.00 . A A .  53 LEU CD2  1 1 
        2  3239 1 1  53 LEU CG   C   4.042  11.039  10.472 1.00 . A A .  53 LEU CG   1 1 
        2  3240 1 1  53 LEU H    H   2.783  13.309  13.582 1.00 . A A .  53 LEU H    1 1 
        2  3241 1 1  53 LEU HA   H   1.545  12.017  11.291 1.00 . A A .  53 LEU HA   1 1 
        2  3242 1 1  53 LEU HB2  H   3.734  13.074  11.080 1.00 . A A .  53 LEU HB2  1 1 
        2  3243 1 1  53 LEU HB3  H   4.392  12.034  12.340 1.00 . A A .  53 LEU HB3  1 1 
        2  3244 1 1  53 LEU HD11 H   2.136  10.461   9.672 1.00 . A A .  53 LEU HD11 1 1 
        2  3245 1 1  53 LEU HD12 H   3.413  10.582   8.464 1.00 . A A .  53 LEU HD12 1 1 
        2  3246 1 1  53 LEU HD13 H   2.690  12.046   9.132 1.00 . A A .  53 LEU HD13 1 1 
        2  3247 1 1  53 LEU HD21 H   6.153  11.376  10.679 1.00 . A A .  53 LEU HD21 1 1 
        2  3248 1 1  53 LEU HD22 H   5.382  12.360   9.436 1.00 . A A .  53 LEU HD22 1 1 
        2  3249 1 1  53 LEU HD23 H   5.683  10.647   9.142 1.00 . A A .  53 LEU HD23 1 1 
        2  3250 1 1  53 LEU HG   H   4.082  10.062  10.933 1.00 . A A .  53 LEU HG   1 1 
        2  3251 1 1  53 LEU N    N   2.028  12.832  13.182 1.00 . A A .  53 LEU N    1 1 
        2  3252 1 1  53 LEU O    O   2.808  10.056  13.560 1.00 . A A .  53 LEU O    1 1 
        2  3253 1 1  54 VAL C    C   0.994   7.277  11.255 1.00 . A A .  54 VAL C    1 1 
        2  3254 1 1  54 VAL CA   C   1.146   8.207  12.463 1.00 . A A .  54 VAL CA   1 1 
        2  3255 1 1  54 VAL CB   C  -0.103   8.098  13.336 1.00 . A A .  54 VAL CB   1 1 
        2  3256 1 1  54 VAL CG1  C   0.097   8.907  14.620 1.00 . A A .  54 VAL CG1  1 1 
        2  3257 1 1  54 VAL CG2  C  -1.317   8.641  12.571 1.00 . A A .  54 VAL CG2  1 1 
        2  3258 1 1  54 VAL H    H   0.799   9.947  11.234 1.00 . A A .  54 VAL H    1 1 
        2  3259 1 1  54 VAL HA   H   2.009   7.900  13.039 1.00 . A A .  54 VAL HA   1 1 
        2  3260 1 1  54 VAL HB   H  -0.265   7.062  13.587 1.00 . A A .  54 VAL HB   1 1 
        2  3261 1 1  54 VAL HG11 H   0.965   8.537  15.146 1.00 . A A .  54 VAL HG11 1 1 
        2  3262 1 1  54 VAL HG12 H  -0.775   8.805  15.248 1.00 . A A .  54 VAL HG12 1 1 
        2  3263 1 1  54 VAL HG13 H   0.242   9.947  14.371 1.00 . A A .  54 VAL HG13 1 1 
        2  3264 1 1  54 VAL HG21 H  -1.628   7.917  11.830 1.00 . A A .  54 VAL HG21 1 1 
        2  3265 1 1  54 VAL HG22 H  -1.056   9.567  12.081 1.00 . A A .  54 VAL HG22 1 1 
        2  3266 1 1  54 VAL HG23 H  -2.129   8.820  13.260 1.00 . A A .  54 VAL HG23 1 1 
        2  3267 1 1  54 VAL N    N   1.315   9.621  12.000 1.00 . A A .  54 VAL N    1 1 
        2  3268 1 1  54 VAL O    O   0.666   7.715  10.173 1.00 . A A .  54 VAL O    1 1 
        2  3269 1 1  55 ASN C    C   1.215   5.570   8.964 1.00 . A A .  55 ASN C    1 1 
        2  3270 1 1  55 ASN CA   C   1.090   4.963  10.368 1.00 . A A .  55 ASN CA   1 1 
        2  3271 1 1  55 ASN CB   C  -0.257   4.251  10.505 1.00 . A A .  55 ASN CB   1 1 
        2  3272 1 1  55 ASN CG   C  -1.397   5.185  10.093 1.00 . A A .  55 ASN CG   1 1 
        2  3273 1 1  55 ASN H    H   1.461   5.692  12.363 1.00 . A A .  55 ASN H    1 1 
        2  3274 1 1  55 ASN HA   H   1.876   4.234  10.493 1.00 . A A .  55 ASN HA   1 1 
        2  3275 1 1  55 ASN HB2  H  -0.264   3.376   9.871 1.00 . A A .  55 ASN HB2  1 1 
        2  3276 1 1  55 ASN HB3  H  -0.397   3.948  11.533 1.00 . A A .  55 ASN HB3  1 1 
        2  3277 1 1  55 ASN HD21 H  -2.811   3.842  10.460 1.00 . A A .  55 ASN HD21 1 1 
        2  3278 1 1  55 ASN HD22 H  -3.368   5.341   9.894 1.00 . A A .  55 ASN HD22 1 1 
        2  3279 1 1  55 ASN N    N   1.219   5.993  11.460 1.00 . A A .  55 ASN N    1 1 
        2  3280 1 1  55 ASN ND2  N  -2.628   4.755  10.155 1.00 . A A .  55 ASN ND2  1 1 
        2  3281 1 1  55 ASN O    O   2.005   6.459   8.722 1.00 . A A .  55 ASN O    1 1 
        2  3282 1 1  55 ASN OD1  O  -1.172   6.317   9.711 1.00 . A A .  55 ASN OD1  1 1 
        2  3283 1 1  56 VAL C    C  -0.189   6.948   6.554 1.00 . A A .  56 VAL C    1 1 
        2  3284 1 1  56 VAL CA   C   0.509   5.589   6.638 1.00 . A A .  56 VAL CA   1 1 
        2  3285 1 1  56 VAL CB   C  -0.179   4.597   5.700 1.00 . A A .  56 VAL CB   1 1 
        2  3286 1 1  56 VAL CG1  C   0.578   3.267   5.735 1.00 . A A .  56 VAL CG1  1 1 
        2  3287 1 1  56 VAL CG2  C  -1.627   4.373   6.151 1.00 . A A .  56 VAL CG2  1 1 
        2  3288 1 1  56 VAL H    H  -0.172   4.344   8.256 1.00 . A A .  56 VAL H    1 1 
        2  3289 1 1  56 VAL HA   H   1.543   5.702   6.345 1.00 . A A .  56 VAL HA   1 1 
        2  3290 1 1  56 VAL HB   H  -0.169   4.989   4.692 1.00 . A A .  56 VAL HB   1 1 
        2  3291 1 1  56 VAL HG11 H   0.494   2.833   6.719 1.00 . A A .  56 VAL HG11 1 1 
        2  3292 1 1  56 VAL HG12 H   1.620   3.442   5.505 1.00 . A A .  56 VAL HG12 1 1 
        2  3293 1 1  56 VAL HG13 H   0.156   2.593   5.005 1.00 . A A .  56 VAL HG13 1 1 
        2  3294 1 1  56 VAL HG21 H  -2.021   3.488   5.675 1.00 . A A .  56 VAL HG21 1 1 
        2  3295 1 1  56 VAL HG22 H  -2.227   5.227   5.873 1.00 . A A .  56 VAL HG22 1 1 
        2  3296 1 1  56 VAL HG23 H  -1.657   4.248   7.223 1.00 . A A .  56 VAL HG23 1 1 
        2  3297 1 1  56 VAL N    N   0.445   5.071   8.036 1.00 . A A .  56 VAL N    1 1 
        2  3298 1 1  56 VAL O    O  -1.264   7.136   7.086 1.00 . A A .  56 VAL O    1 1 
        2  3299 1 1  57 THR C    C  -0.422   9.555   4.259 1.00 . A A .  57 THR C    1 1 
        2  3300 1 1  57 THR CA   C  -0.194   9.257   5.742 1.00 . A A .  57 THR CA   1 1 
        2  3301 1 1  57 THR CB   C   0.760  10.298   6.331 1.00 . A A .  57 THR CB   1 1 
        2  3302 1 1  57 THR CG2  C   0.182  11.698   6.126 1.00 . A A .  57 THR CG2  1 1 
        2  3303 1 1  57 THR H    H   1.283   7.708   5.460 1.00 . A A .  57 THR H    1 1 
        2  3304 1 1  57 THR HA   H  -1.141   9.301   6.264 1.00 . A A .  57 THR HA   1 1 
        2  3305 1 1  57 THR HB   H   1.718  10.233   5.837 1.00 . A A .  57 THR HB   1 1 
        2  3306 1 1  57 THR HG1  H   1.821   9.736   7.860 1.00 . A A .  57 THR HG1  1 1 
        2  3307 1 1  57 THR HG21 H   0.761  12.411   6.694 1.00 . A A .  57 THR HG21 1 1 
        2  3308 1 1  57 THR HG22 H  -0.843  11.714   6.461 1.00 . A A .  57 THR HG22 1 1 
        2  3309 1 1  57 THR HG23 H   0.223  11.954   5.077 1.00 . A A .  57 THR HG23 1 1 
        2  3310 1 1  57 THR N    N   0.418   7.894   5.880 1.00 . A A .  57 THR N    1 1 
        2  3311 1 1  57 THR O    O   0.467   9.406   3.446 1.00 . A A .  57 THR O    1 1 
        2  3312 1 1  57 THR OG1  O   0.925  10.048   7.717 1.00 . A A .  57 THR OG1  1 1 
        2  3313 1 1  58 GLY C    C  -2.026  11.790   2.280 1.00 . A A .  58 GLY C    1 1 
        2  3314 1 1  58 GLY CA   C  -1.920  10.278   2.469 1.00 . A A .  58 GLY CA   1 1 
        2  3315 1 1  58 GLY H    H  -2.313  10.079   4.578 1.00 . A A .  58 GLY H    1 1 
        2  3316 1 1  58 GLY HA2  H  -1.137   9.892   1.829 1.00 . A A .  58 GLY HA2  1 1 
        2  3317 1 1  58 GLY HA3  H  -2.860   9.820   2.200 1.00 . A A .  58 GLY HA3  1 1 
        2  3318 1 1  58 GLY N    N  -1.614   9.971   3.902 1.00 . A A .  58 GLY N    1 1 
        2  3319 1 1  58 GLY O    O  -1.122  12.531   2.605 1.00 . A A .  58 GLY O    1 1 
        2  3320 1 1  59 ALA C    C  -4.020  14.371   2.675 1.00 . A A .  59 ALA C    1 1 
        2  3321 1 1  59 ALA CA   C  -3.296  13.711   1.497 1.00 . A A .  59 ALA CA   1 1 
        2  3322 1 1  59 ALA CB   C  -4.127  13.902   0.234 1.00 . A A .  59 ALA CB   1 1 
        2  3323 1 1  59 ALA H    H  -3.831  11.626   1.475 1.00 . A A .  59 ALA H    1 1 
        2  3324 1 1  59 ALA HA   H  -2.330  14.179   1.362 1.00 . A A .  59 ALA HA   1 1 
        2  3325 1 1  59 ALA HB1  H  -3.649  13.389  -0.588 1.00 . A A .  59 ALA HB1  1 1 
        2  3326 1 1  59 ALA HB2  H  -4.205  14.954   0.008 1.00 . A A .  59 ALA HB2  1 1 
        2  3327 1 1  59 ALA HB3  H  -5.113  13.492   0.390 1.00 . A A .  59 ALA HB3  1 1 
        2  3328 1 1  59 ALA N    N  -3.122  12.248   1.739 1.00 . A A .  59 ALA N    1 1 
        2  3329 1 1  59 ALA O    O  -4.159  13.795   3.737 1.00 . A A .  59 ALA O    1 1 
        2  3330 1 1  60 ARG C    C  -4.300  16.369   4.819 1.00 . A A .  60 ARG C    1 1 
        2  3331 1 1  60 ARG CA   C  -5.184  16.321   3.571 1.00 . A A .  60 ARG CA   1 1 
        2  3332 1 1  60 ARG CB   C  -6.510  15.620   3.897 1.00 . A A .  60 ARG CB   1 1 
        2  3333 1 1  60 ARG CD   C  -8.777  15.024   3.007 1.00 . A A .  60 ARG CD   1 1 
        2  3334 1 1  60 ARG CG   C  -7.466  15.759   2.709 1.00 . A A .  60 ARG CG   1 1 
        2  3335 1 1  60 ARG CZ   C -10.869  14.593   1.860 1.00 . A A .  60 ARG CZ   1 1 
        2  3336 1 1  60 ARG H    H  -4.334  16.024   1.619 1.00 . A A .  60 ARG H    1 1 
        2  3337 1 1  60 ARG HA   H  -5.388  17.331   3.244 1.00 . A A .  60 ARG HA   1 1 
        2  3338 1 1  60 ARG HB2  H  -6.330  14.574   4.097 1.00 . A A .  60 ARG HB2  1 1 
        2  3339 1 1  60 ARG HB3  H  -6.954  16.081   4.766 1.00 . A A .  60 ARG HB3  1 1 
        2  3340 1 1  60 ARG HD2  H  -8.573  13.977   3.179 1.00 . A A .  60 ARG HD2  1 1 
        2  3341 1 1  60 ARG HD3  H  -9.241  15.451   3.883 1.00 . A A .  60 ARG HD3  1 1 
        2  3342 1 1  60 ARG HE   H  -9.418  15.687   1.059 1.00 . A A .  60 ARG HE   1 1 
        2  3343 1 1  60 ARG HG2  H  -7.674  16.805   2.535 1.00 . A A .  60 ARG HG2  1 1 
        2  3344 1 1  60 ARG HG3  H  -7.010  15.333   1.828 1.00 . A A .  60 ARG HG3  1 1 
        2  3345 1 1  60 ARG HH11 H -10.622  13.795   3.679 1.00 . A A .  60 ARG HH11 1 1 
        2  3346 1 1  60 ARG HH12 H -12.137  13.458   2.912 1.00 . A A .  60 ARG HH12 1 1 
        2  3347 1 1  60 ARG HH21 H -11.389  15.257   0.042 1.00 . A A .  60 ARG HH21 1 1 
        2  3348 1 1  60 ARG HH22 H -12.572  14.288   0.853 1.00 . A A .  60 ARG HH22 1 1 
        2  3349 1 1  60 ARG N    N  -4.471  15.586   2.485 1.00 . A A .  60 ARG N    1 1 
        2  3350 1 1  60 ARG NE   N  -9.695  15.165   1.840 1.00 . A A .  60 ARG NE   1 1 
        2  3351 1 1  60 ARG NH1  N -11.238  13.895   2.897 1.00 . A A .  60 ARG NH1  1 1 
        2  3352 1 1  60 ARG NH2  N -11.673  14.723   0.838 1.00 . A A .  60 ARG NH2  1 1 
        2  3353 1 1  60 ARG O    O  -4.693  16.877   5.850 1.00 . A A .  60 ARG O    1 1 
        2  3354 1 1  61 PHE C    C  -1.454  17.222   5.931 1.00 . A A .  61 PHE C    1 1 
        2  3355 1 1  61 PHE CA   C  -2.184  15.879   5.900 1.00 . A A .  61 PHE CA   1 1 
        2  3356 1 1  61 PHE CB   C  -1.165  14.748   5.766 1.00 . A A .  61 PHE CB   1 1 
        2  3357 1 1  61 PHE CD1  C  -0.543  14.393   8.179 1.00 . A A .  61 PHE CD1  1 1 
        2  3358 1 1  61 PHE CD2  C   1.115  15.332   6.680 1.00 . A A .  61 PHE CD2  1 1 
        2  3359 1 1  61 PHE CE1  C   0.372  14.459   9.235 1.00 . A A .  61 PHE CE1  1 1 
        2  3360 1 1  61 PHE CE2  C   2.032  15.397   7.736 1.00 . A A .  61 PHE CE2  1 1 
        2  3361 1 1  61 PHE CG   C  -0.173  14.830   6.903 1.00 . A A .  61 PHE CG   1 1 
        2  3362 1 1  61 PHE CZ   C   1.661  14.962   9.013 1.00 . A A .  61 PHE CZ   1 1 
        2  3363 1 1  61 PHE H    H  -2.801  15.462   3.884 1.00 . A A .  61 PHE H    1 1 
        2  3364 1 1  61 PHE HA   H  -2.749  15.750   6.812 1.00 . A A .  61 PHE HA   1 1 
        2  3365 1 1  61 PHE HB2  H  -1.676  13.798   5.801 1.00 . A A .  61 PHE HB2  1 1 
        2  3366 1 1  61 PHE HB3  H  -0.643  14.844   4.825 1.00 . A A .  61 PHE HB3  1 1 
        2  3367 1 1  61 PHE HD1  H  -1.537  14.008   8.349 1.00 . A A .  61 PHE HD1  1 1 
        2  3368 1 1  61 PHE HD2  H   1.402  15.670   5.695 1.00 . A A .  61 PHE HD2  1 1 
        2  3369 1 1  61 PHE HE1  H   0.086  14.124  10.221 1.00 . A A .  61 PHE HE1  1 1 
        2  3370 1 1  61 PHE HE2  H   3.026  15.786   7.566 1.00 . A A .  61 PHE HE2  1 1 
        2  3371 1 1  61 PHE HZ   H   2.368  15.011   9.828 1.00 . A A .  61 PHE HZ   1 1 
        2  3372 1 1  61 PHE N    N  -3.101  15.855   4.728 1.00 . A A .  61 PHE N    1 1 
        2  3373 1 1  61 PHE O    O  -1.674  18.041   6.802 1.00 . A A .  61 PHE O    1 1 
        2  3374 1 1  62 ALA C    C   1.053  18.765   3.701 1.00 . A A .  62 ALA C    1 1 
        2  3375 1 1  62 ALA CA   C   0.166  18.737   4.947 1.00 . A A .  62 ALA CA   1 1 
        2  3376 1 1  62 ALA CB   C   1.044  18.856   6.194 1.00 . A A .  62 ALA CB   1 1 
        2  3377 1 1  62 ALA H    H  -0.427  16.773   4.294 1.00 . A A .  62 ALA H    1 1 
        2  3378 1 1  62 ALA HA   H  -0.530  19.562   4.916 1.00 . A A .  62 ALA HA   1 1 
        2  3379 1 1  62 ALA HB1  H   0.424  19.074   7.051 1.00 . A A .  62 ALA HB1  1 1 
        2  3380 1 1  62 ALA HB2  H   1.760  19.650   6.055 1.00 . A A .  62 ALA HB2  1 1 
        2  3381 1 1  62 ALA HB3  H   1.566  17.924   6.354 1.00 . A A .  62 ALA HB3  1 1 
        2  3382 1 1  62 ALA N    N  -0.585  17.450   4.985 1.00 . A A .  62 ALA N    1 1 
        2  3383 1 1  62 ALA O    O   1.122  17.806   2.958 1.00 . A A .  62 ALA O    1 1 
        2  3384 1 1  63 ARG C    C   3.959  20.597   2.676 1.00 . A A .  63 ARG C    1 1 
        2  3385 1 1  63 ARG CA   C   2.628  19.959   2.270 1.00 . A A .  63 ARG CA   1 1 
        2  3386 1 1  63 ARG CB   C   1.954  20.820   1.200 1.00 . A A .  63 ARG CB   1 1 
        2  3387 1 1  63 ARG CD   C   0.019  20.961  -0.370 1.00 . A A .  63 ARG CD   1 1 
        2  3388 1 1  63 ARG CG   C   0.715  20.093   0.677 1.00 . A A .  63 ARG CG   1 1 
        2  3389 1 1  63 ARG CZ   C   0.570  21.894  -2.538 1.00 . A A .  63 ARG CZ   1 1 
        2  3390 1 1  63 ARG H    H   1.660  20.615   4.083 1.00 . A A .  63 ARG H    1 1 
        2  3391 1 1  63 ARG HA   H   2.818  18.975   1.864 1.00 . A A .  63 ARG HA   1 1 
        2  3392 1 1  63 ARG HB2  H   1.663  21.767   1.631 1.00 . A A .  63 ARG HB2  1 1 
        2  3393 1 1  63 ARG HB3  H   2.642  20.990   0.386 1.00 . A A .  63 ARG HB3  1 1 
        2  3394 1 1  63 ARG HD2  H  -0.901  20.486  -0.680 1.00 . A A .  63 ARG HD2  1 1 
        2  3395 1 1  63 ARG HD3  H  -0.200  21.931   0.052 1.00 . A A .  63 ARG HD3  1 1 
        2  3396 1 1  63 ARG HE   H   1.775  20.645  -1.574 1.00 . A A .  63 ARG HE   1 1 
        2  3397 1 1  63 ARG HG2  H   1.012  19.155   0.228 1.00 . A A .  63 ARG HG2  1 1 
        2  3398 1 1  63 ARG HG3  H   0.036  19.902   1.495 1.00 . A A .  63 ARG HG3  1 1 
        2  3399 1 1  63 ARG HH11 H  -1.181  22.421  -1.719 1.00 . A A .  63 ARG HH11 1 1 
        2  3400 1 1  63 ARG HH12 H  -0.837  23.118  -3.266 1.00 . A A .  63 ARG HH12 1 1 
        2  3401 1 1  63 ARG HH21 H   2.237  21.545  -3.590 1.00 . A A .  63 ARG HH21 1 1 
        2  3402 1 1  63 ARG HH22 H   1.099  22.624  -4.326 1.00 . A A .  63 ARG HH22 1 1 
        2  3403 1 1  63 ARG N    N   1.734  19.858   3.467 1.00 . A A .  63 ARG N    1 1 
        2  3404 1 1  63 ARG NE   N   0.919  21.121  -1.546 1.00 . A A .  63 ARG NE   1 1 
        2  3405 1 1  63 ARG NH1  N  -0.571  22.528  -2.504 1.00 . A A .  63 ARG NH1  1 1 
        2  3406 1 1  63 ARG NH2  N   1.364  22.032  -3.564 1.00 . A A .  63 ARG NH2  1 1 
        2  3407 1 1  63 ARG O    O   4.032  21.367   3.613 1.00 . A A .  63 ARG O    1 1 
        2  3408 1 1  64 GLY C    C   7.441  19.839   1.957 1.00 . A A .  64 GLY C    1 1 
        2  3409 1 1  64 GLY CA   C   6.353  20.854   2.316 1.00 . A A .  64 GLY CA   1 1 
        2  3410 1 1  64 GLY H    H   4.933  19.651   1.229 1.00 . A A .  64 GLY H    1 1 
        2  3411 1 1  64 GLY HA2  H   6.507  21.765   1.753 1.00 . A A .  64 GLY HA2  1 1 
        2  3412 1 1  64 GLY HA3  H   6.404  21.070   3.374 1.00 . A A .  64 GLY HA3  1 1 
        2  3413 1 1  64 GLY N    N   5.017  20.277   1.978 1.00 . A A .  64 GLY N    1 1 
        2  3414 1 1  64 GLY O    O   8.424  20.167   1.324 1.00 . A A .  64 GLY O    1 1 
        2  3415 1 1  65 SER C    C   7.688  16.610   0.972 1.00 . A A .  65 SER C    1 1 
        2  3416 1 1  65 SER CA   C   8.264  17.542   2.041 1.00 . A A .  65 SER CA   1 1 
        2  3417 1 1  65 SER CB   C   8.558  16.737   3.308 1.00 . A A .  65 SER CB   1 1 
        2  3418 1 1  65 SER H    H   6.451  18.375   2.855 1.00 . A A .  65 SER H    1 1 
        2  3419 1 1  65 SER HA   H   9.182  17.985   1.677 1.00 . A A .  65 SER HA   1 1 
        2  3420 1 1  65 SER HB2  H   9.281  15.968   3.089 1.00 . A A .  65 SER HB2  1 1 
        2  3421 1 1  65 SER HB3  H   8.954  17.396   4.069 1.00 . A A .  65 SER HB3  1 1 
        2  3422 1 1  65 SER HG   H   7.148  15.400   3.178 1.00 . A A .  65 SER HG   1 1 
        2  3423 1 1  65 SER N    N   7.260  18.605   2.352 1.00 . A A .  65 SER N    1 1 
        2  3424 1 1  65 SER O    O   8.316  15.659   0.557 1.00 . A A .  65 SER O    1 1 
        2  3425 1 1  65 SER OG   O   7.357  16.130   3.767 1.00 . A A .  65 SER OG   1 1 
        2  3426 1 1  66 PHE C    C   6.503  16.261  -1.867 1.00 . A A .  66 PHE C    1 1 
        2  3427 1 1  66 PHE CA   C   5.852  16.014  -0.504 1.00 . A A .  66 PHE CA   1 1 
        2  3428 1 1  66 PHE CB   C   4.360  16.349  -0.584 1.00 . A A .  66 PHE CB   1 1 
        2  3429 1 1  66 PHE CD1  C   3.778  16.360   1.866 1.00 . A A .  66 PHE CD1  1 1 
        2  3430 1 1  66 PHE CD2  C   2.866  14.607   0.463 1.00 . A A .  66 PHE CD2  1 1 
        2  3431 1 1  66 PHE CE1  C   3.126  15.812   2.975 1.00 . A A .  66 PHE CE1  1 1 
        2  3432 1 1  66 PHE CE2  C   2.214  14.057   1.571 1.00 . A A .  66 PHE CE2  1 1 
        2  3433 1 1  66 PHE CG   C   3.647  15.759   0.609 1.00 . A A .  66 PHE CG   1 1 
        2  3434 1 1  66 PHE CZ   C   2.344  14.660   2.829 1.00 . A A .  66 PHE CZ   1 1 
        2  3435 1 1  66 PHE H    H   6.001  17.650   0.889 1.00 . A A .  66 PHE H    1 1 
        2  3436 1 1  66 PHE HA   H   5.973  14.975  -0.234 1.00 . A A .  66 PHE HA   1 1 
        2  3437 1 1  66 PHE HB2  H   4.233  17.420  -0.585 1.00 . A A .  66 PHE HB2  1 1 
        2  3438 1 1  66 PHE HB3  H   3.944  15.937  -1.493 1.00 . A A .  66 PHE HB3  1 1 
        2  3439 1 1  66 PHE HD1  H   4.383  17.249   1.978 1.00 . A A .  66 PHE HD1  1 1 
        2  3440 1 1  66 PHE HD2  H   2.766  14.143  -0.508 1.00 . A A .  66 PHE HD2  1 1 
        2  3441 1 1  66 PHE HE1  H   3.226  16.278   3.945 1.00 . A A .  66 PHE HE1  1 1 
        2  3442 1 1  66 PHE HE2  H   1.611  13.168   1.458 1.00 . A A .  66 PHE HE2  1 1 
        2  3443 1 1  66 PHE HZ   H   1.842  14.236   3.685 1.00 . A A .  66 PHE HZ   1 1 
        2  3444 1 1  66 PHE N    N   6.489  16.878   0.532 1.00 . A A .  66 PHE N    1 1 
        2  3445 1 1  66 PHE O    O   6.906  17.362  -2.183 1.00 . A A .  66 PHE O    1 1 
        2  3446 1 1  67 ARG C    C   6.098  15.387  -5.086 1.00 . A A .  67 ARG C    1 1 
        2  3447 1 1  67 ARG CA   C   7.210  15.389  -4.035 1.00 . A A .  67 ARG CA   1 1 
        2  3448 1 1  67 ARG CB   C   8.156  14.213  -4.291 1.00 . A A .  67 ARG CB   1 1 
        2  3449 1 1  67 ARG CD   C  10.243  13.077  -3.510 1.00 . A A .  67 ARG CD   1 1 
        2  3450 1 1  67 ARG CG   C   9.356  14.313  -3.346 1.00 . A A .  67 ARG CG   1 1 
        2  3451 1 1  67 ARG CZ   C  11.511  12.026  -5.289 1.00 . A A .  67 ARG CZ   1 1 
        2  3452 1 1  67 ARG H    H   6.253  14.365  -2.398 1.00 . A A .  67 ARG H    1 1 
        2  3453 1 1  67 ARG HA   H   7.763  16.316  -4.097 1.00 . A A .  67 ARG HA   1 1 
        2  3454 1 1  67 ARG HB2  H   7.634  13.284  -4.112 1.00 . A A .  67 ARG HB2  1 1 
        2  3455 1 1  67 ARG HB3  H   8.502  14.241  -5.313 1.00 . A A .  67 ARG HB3  1 1 
        2  3456 1 1  67 ARG HD2  H  11.050  13.112  -2.791 1.00 . A A .  67 ARG HD2  1 1 
        2  3457 1 1  67 ARG HD3  H   9.655  12.186  -3.347 1.00 . A A .  67 ARG HD3  1 1 
        2  3458 1 1  67 ARG HE   H  10.658  13.807  -5.493 1.00 . A A .  67 ARG HE   1 1 
        2  3459 1 1  67 ARG HG2  H   9.928  15.199  -3.583 1.00 . A A .  67 ARG HG2  1 1 
        2  3460 1 1  67 ARG HG3  H   9.008  14.370  -2.325 1.00 . A A .  67 ARG HG3  1 1 
        2  3461 1 1  67 ARG HH11 H  11.325  11.026  -3.562 1.00 . A A .  67 ARG HH11 1 1 
        2  3462 1 1  67 ARG HH12 H  12.247  10.229  -4.794 1.00 . A A .  67 ARG HH12 1 1 
        2  3463 1 1  67 ARG HH21 H  11.863  12.784  -7.109 1.00 . A A .  67 ARG HH21 1 1 
        2  3464 1 1  67 ARG HH22 H  12.552  11.225  -6.799 1.00 . A A .  67 ARG HH22 1 1 
        2  3465 1 1  67 ARG N    N   6.597  15.239  -2.679 1.00 . A A .  67 ARG N    1 1 
        2  3466 1 1  67 ARG NE   N  10.811  13.052  -4.889 1.00 . A A .  67 ARG NE   1 1 
        2  3467 1 1  67 ARG NH1  N  11.709  11.016  -4.486 1.00 . A A .  67 ARG NH1  1 1 
        2  3468 1 1  67 ARG NH2  N  12.015  12.010  -6.493 1.00 . A A .  67 ARG NH2  1 1 
        2  3469 1 1  67 ARG O    O   6.202  16.023  -6.116 1.00 . A A .  67 ARG O    1 1 
        2  3470 1 1  68 GLU C    C   2.638  14.194  -5.074 1.00 . A A .  68 GLU C    1 1 
        2  3471 1 1  68 GLU CA   C   3.897  14.666  -5.798 1.00 . A A .  68 GLU CA   1 1 
        2  3472 1 1  68 GLU CB   C   4.220  13.697  -6.940 1.00 . A A .  68 GLU CB   1 1 
        2  3473 1 1  68 GLU CD   C   3.240  15.151  -8.730 1.00 . A A .  68 GLU CD   1 1 
        2  3474 1 1  68 GLU CG   C   3.142  13.795  -8.025 1.00 . A A .  68 GLU CG   1 1 
        2  3475 1 1  68 GLU H    H   4.957  14.193  -3.981 1.00 . A A .  68 GLU H    1 1 
        2  3476 1 1  68 GLU HA   H   3.736  15.657  -6.195 1.00 . A A .  68 GLU HA   1 1 
        2  3477 1 1  68 GLU HB2  H   5.180  13.946  -7.360 1.00 . A A .  68 GLU HB2  1 1 
        2  3478 1 1  68 GLU HB3  H   4.246  12.689  -6.557 1.00 . A A .  68 GLU HB3  1 1 
        2  3479 1 1  68 GLU HG2  H   3.286  13.004  -8.747 1.00 . A A .  68 GLU HG2  1 1 
        2  3480 1 1  68 GLU HG3  H   2.166  13.696  -7.576 1.00 . A A .  68 GLU HG3  1 1 
        2  3481 1 1  68 GLU N    N   5.025  14.691  -4.824 1.00 . A A .  68 GLU N    1 1 
        2  3482 1 1  68 GLU O    O   2.660  13.202  -4.373 1.00 . A A .  68 GLU O    1 1 
        2  3483 1 1  68 GLU OE1  O   4.198  15.862  -8.479 1.00 . A A .  68 GLU OE1  1 1 
        2  3484 1 1  68 GLU OE2  O   2.356  15.450  -9.516 1.00 . A A .  68 GLU OE2  1 1 
        2  3485 1 1  69 VAL C    C  -0.850  14.352  -5.587 1.00 . A A .  69 VAL C    1 1 
        2  3486 1 1  69 VAL CA   C   0.270  14.477  -4.553 1.00 . A A .  69 VAL CA   1 1 
        2  3487 1 1  69 VAL CB   C  -0.108  15.539  -3.514 1.00 . A A .  69 VAL CB   1 1 
        2  3488 1 1  69 VAL CG1  C  -1.519  15.271  -2.978 1.00 . A A .  69 VAL CG1  1 1 
        2  3489 1 1  69 VAL CG2  C   0.894  15.487  -2.359 1.00 . A A .  69 VAL CG2  1 1 
        2  3490 1 1  69 VAL H    H   1.548  15.688  -5.805 1.00 . A A .  69 VAL H    1 1 
        2  3491 1 1  69 VAL HA   H   0.401  13.524  -4.056 1.00 . A A .  69 VAL HA   1 1 
        2  3492 1 1  69 VAL HB   H  -0.079  16.516  -3.972 1.00 . A A .  69 VAL HB   1 1 
        2  3493 1 1  69 VAL HG11 H  -1.640  14.215  -2.785 1.00 . A A .  69 VAL HG11 1 1 
        2  3494 1 1  69 VAL HG12 H  -2.248  15.587  -3.711 1.00 . A A .  69 VAL HG12 1 1 
        2  3495 1 1  69 VAL HG13 H  -1.671  15.823  -2.061 1.00 . A A .  69 VAL HG13 1 1 
        2  3496 1 1  69 VAL HG21 H   0.877  14.504  -1.911 1.00 . A A .  69 VAL HG21 1 1 
        2  3497 1 1  69 VAL HG22 H   0.628  16.225  -1.618 1.00 . A A .  69 VAL HG22 1 1 
        2  3498 1 1  69 VAL HG23 H   1.885  15.692  -2.735 1.00 . A A .  69 VAL HG23 1 1 
        2  3499 1 1  69 VAL N    N   1.540  14.890  -5.235 1.00 . A A .  69 VAL N    1 1 
        2  3500 1 1  69 VAL O    O  -1.159  15.282  -6.305 1.00 . A A .  69 VAL O    1 1 
        2  3501 1 1  70 VAL C    C  -3.594  12.020  -5.934 1.00 . A A .  70 VAL C    1 1 
        2  3502 1 1  70 VAL CA   C  -2.602  12.996  -6.594 1.00 . A A .  70 VAL CA   1 1 
        2  3503 1 1  70 VAL CB   C  -2.072  12.392  -7.903 1.00 . A A .  70 VAL CB   1 1 
        2  3504 1 1  70 VAL CG1  C  -3.089  12.631  -9.024 1.00 . A A .  70 VAL CG1  1 1 
        2  3505 1 1  70 VAL CG2  C  -0.746  13.055  -8.279 1.00 . A A .  70 VAL CG2  1 1 
        2  3506 1 1  70 VAL H    H  -1.213  12.489  -5.036 1.00 . A A .  70 VAL H    1 1 
        2  3507 1 1  70 VAL HA   H  -3.086  13.939  -6.806 1.00 . A A .  70 VAL HA   1 1 
        2  3508 1 1  70 VAL HB   H  -1.920  11.327  -7.779 1.00 . A A .  70 VAL HB   1 1 
        2  3509 1 1  70 VAL HG11 H  -3.045  13.663  -9.337 1.00 . A A .  70 VAL HG11 1 1 
        2  3510 1 1  70 VAL HG12 H  -4.082  12.408  -8.663 1.00 . A A .  70 VAL HG12 1 1 
        2  3511 1 1  70 VAL HG13 H  -2.857  11.990  -9.863 1.00 . A A .  70 VAL HG13 1 1 
        2  3512 1 1  70 VAL HG21 H  -0.881  14.126  -8.333 1.00 . A A .  70 VAL HG21 1 1 
        2  3513 1 1  70 VAL HG22 H  -0.419  12.685  -9.238 1.00 . A A .  70 VAL HG22 1 1 
        2  3514 1 1  70 VAL HG23 H  -0.004  12.823  -7.530 1.00 . A A .  70 VAL HG23 1 1 
        2  3515 1 1  70 VAL N    N  -1.476  13.211  -5.642 1.00 . A A .  70 VAL N    1 1 
        2  3516 1 1  70 VAL O    O  -3.399  10.821  -5.980 1.00 . A A .  70 VAL O    1 1 
        2  3517 1 1  71 PRO C    C  -6.181  10.508  -5.489 1.00 . A A .  71 PRO C    1 1 
        2  3518 1 1  71 PRO CA   C  -5.640  11.646  -4.612 1.00 . A A .  71 PRO CA   1 1 
        2  3519 1 1  71 PRO CB   C  -6.768  12.620  -4.234 1.00 . A A .  71 PRO CB   1 1 
        2  3520 1 1  71 PRO CD   C  -4.973  13.948  -5.168 1.00 . A A .  71 PRO CD   1 1 
        2  3521 1 1  71 PRO CG   C  -6.112  13.961  -4.148 1.00 . A A .  71 PRO CG   1 1 
        2  3522 1 1  71 PRO HA   H  -5.208  11.240  -3.711 1.00 . A A .  71 PRO HA   1 1 
        2  3523 1 1  71 PRO HB2  H  -7.533  12.625  -5.003 1.00 . A A .  71 PRO HB2  1 1 
        2  3524 1 1  71 PRO HB3  H  -7.198  12.353  -3.281 1.00 . A A .  71 PRO HB3  1 1 
        2  3525 1 1  71 PRO HD2  H  -5.304  14.357  -6.114 1.00 . A A .  71 PRO HD2  1 1 
        2  3526 1 1  71 PRO HD3  H  -4.120  14.496  -4.795 1.00 . A A .  71 PRO HD3  1 1 
        2  3527 1 1  71 PRO HG2  H  -6.825  14.742  -4.387 1.00 . A A .  71 PRO HG2  1 1 
        2  3528 1 1  71 PRO HG3  H  -5.711  14.117  -3.157 1.00 . A A .  71 PRO HG3  1 1 
        2  3529 1 1  71 PRO N    N  -4.636  12.516  -5.305 1.00 . A A .  71 PRO N    1 1 
        2  3530 1 1  71 PRO O    O  -6.321  10.639  -6.690 1.00 . A A .  71 PRO O    1 1 
        2  3531 1 1  72 VAL C    C  -6.340   8.052  -6.965 1.00 . A A .  72 VAL C    1 1 
        2  3532 1 1  72 VAL CA   C  -7.016   8.199  -5.597 1.00 . A A .  72 VAL CA   1 1 
        2  3533 1 1  72 VAL CB   C  -8.547   8.308  -5.747 1.00 . A A .  72 VAL CB   1 1 
        2  3534 1 1  72 VAL CG1  C  -8.923   9.582  -6.518 1.00 . A A .  72 VAL CG1  1 1 
        2  3535 1 1  72 VAL CG2  C  -9.099   7.060  -6.480 1.00 . A A .  72 VAL CG2  1 1 
        2  3536 1 1  72 VAL H    H  -6.351   9.336  -3.898 1.00 . A A .  72 VAL H    1 1 
        2  3537 1 1  72 VAL HA   H  -6.792   7.317  -5.014 1.00 . A A .  72 VAL HA   1 1 
        2  3538 1 1  72 VAL HB   H  -8.985   8.361  -4.759 1.00 . A A .  72 VAL HB   1 1 
        2  3539 1 1  72 VAL HG11 H  -8.327   9.655  -7.414 1.00 . A A .  72 VAL HG11 1 1 
        2  3540 1 1  72 VAL HG12 H  -8.750  10.448  -5.896 1.00 . A A .  72 VAL HG12 1 1 
        2  3541 1 1  72 VAL HG13 H  -9.970   9.540  -6.788 1.00 . A A .  72 VAL HG13 1 1 
        2  3542 1 1  72 VAL HG21 H -10.063   6.798  -6.068 1.00 . A A .  72 VAL HG21 1 1 
        2  3543 1 1  72 VAL HG22 H  -8.422   6.227  -6.351 1.00 . A A .  72 VAL HG22 1 1 
        2  3544 1 1  72 VAL HG23 H  -9.210   7.267  -7.535 1.00 . A A .  72 VAL HG23 1 1 
        2  3545 1 1  72 VAL N    N  -6.483   9.390  -4.868 1.00 . A A .  72 VAL N    1 1 
        2  3546 1 1  72 VAL O    O  -6.970   7.738  -7.953 1.00 . A A .  72 VAL O    1 1 
        2  3547 1 1  73 HIS C    C  -2.859   7.775  -8.036 1.00 . A A .  73 HIS C    1 1 
        2  3548 1 1  73 HIS CA   C  -4.329   8.101  -8.322 1.00 . A A .  73 HIS CA   1 1 
        2  3549 1 1  73 HIS CB   C  -4.422   9.401  -9.129 1.00 . A A .  73 HIS CB   1 1 
        2  3550 1 1  73 HIS CD2  C  -3.010   9.421 -11.352 1.00 . A A .  73 HIS CD2  1 1 
        2  3551 1 1  73 HIS CE1  C  -4.415   8.362 -12.618 1.00 . A A .  73 HIS CE1  1 1 
        2  3552 1 1  73 HIS CG   C  -4.104   9.125 -10.575 1.00 . A A .  73 HIS CG   1 1 
        2  3553 1 1  73 HIS H    H  -4.555   8.492  -6.213 1.00 . A A .  73 HIS H    1 1 
        2  3554 1 1  73 HIS HA   H  -4.770   7.291  -8.888 1.00 . A A .  73 HIS HA   1 1 
        2  3555 1 1  73 HIS HB2  H  -5.423   9.799  -9.049 1.00 . A A .  73 HIS HB2  1 1 
        2  3556 1 1  73 HIS HB3  H  -3.718  10.118  -8.737 1.00 . A A .  73 HIS HB3  1 1 
        2  3557 1 1  73 HIS HD1  H  -5.866   8.104 -11.152 1.00 . A A .  73 HIS HD1  1 1 
        2  3558 1 1  73 HIS HD2  H  -2.130   9.946 -11.013 1.00 . A A .  73 HIS HD2  1 1 
        2  3559 1 1  73 HIS HE1  H  -4.873   7.880 -13.468 1.00 . A A .  73 HIS HE1  1 1 
        2  3560 1 1  73 HIS N    N  -5.051   8.255  -7.025 1.00 . A A .  73 HIS N    1 1 
        2  3561 1 1  73 HIS ND1  N  -4.986   8.450 -11.404 1.00 . A A .  73 HIS ND1  1 1 
        2  3562 1 1  73 HIS NE2  N  -3.209   8.937 -12.642 1.00 . A A .  73 HIS NE2  1 1 
        2  3563 1 1  73 HIS O    O  -2.418   6.656  -8.205 1.00 . A A .  73 HIS O    1 1 
        2  3564 1 1  74 ARG C    C  -0.232   9.341  -6.088 1.00 . A A .  74 ARG C    1 1 
        2  3565 1 1  74 ARG CA   C  -0.656   8.497  -7.289 1.00 . A A .  74 ARG CA   1 1 
        2  3566 1 1  74 ARG CB   C   0.199   8.870  -8.500 1.00 . A A .  74 ARG CB   1 1 
        2  3567 1 1  74 ARG CD   C   0.936   8.153 -10.774 1.00 . A A .  74 ARG CD   1 1 
        2  3568 1 1  74 ARG CG   C   0.043   7.804  -9.583 1.00 . A A .  74 ARG CG   1 1 
        2  3569 1 1  74 ARG CZ   C  -0.051   7.082 -12.725 1.00 . A A .  74 ARG CZ   1 1 
        2  3570 1 1  74 ARG H    H  -2.478   9.639  -7.465 1.00 . A A .  74 ARG H    1 1 
        2  3571 1 1  74 ARG HA   H  -0.508   7.449  -7.056 1.00 . A A .  74 ARG HA   1 1 
        2  3572 1 1  74 ARG HB2  H  -0.125   9.825  -8.885 1.00 . A A .  74 ARG HB2  1 1 
        2  3573 1 1  74 ARG HB3  H   1.237   8.933  -8.205 1.00 . A A .  74 ARG HB3  1 1 
        2  3574 1 1  74 ARG HD2  H   0.610   9.084 -11.212 1.00 . A A .  74 ARG HD2  1 1 
        2  3575 1 1  74 ARG HD3  H   1.958   8.256 -10.435 1.00 . A A .  74 ARG HD3  1 1 
        2  3576 1 1  74 ARG HE   H   1.495   6.315 -11.747 1.00 . A A .  74 ARG HE   1 1 
        2  3577 1 1  74 ARG HG2  H   0.329   6.841  -9.184 1.00 . A A .  74 ARG HG2  1 1 
        2  3578 1 1  74 ARG HG3  H  -0.987   7.768  -9.907 1.00 . A A .  74 ARG HG3  1 1 
        2  3579 1 1  74 ARG HH11 H  -0.877   8.806 -12.120 1.00 . A A .  74 ARG HH11 1 1 
        2  3580 1 1  74 ARG HH12 H  -1.598   8.078 -13.514 1.00 . A A .  74 ARG HH12 1 1 
        2  3581 1 1  74 ARG HH21 H   0.549   5.358 -13.549 1.00 . A A .  74 ARG HH21 1 1 
        2  3582 1 1  74 ARG HH22 H  -0.798   6.129 -14.318 1.00 . A A .  74 ARG HH22 1 1 
        2  3583 1 1  74 ARG N    N  -2.099   8.745  -7.597 1.00 . A A .  74 ARG N    1 1 
        2  3584 1 1  74 ARG NE   N   0.858   7.059 -11.787 1.00 . A A .  74 ARG NE   1 1 
        2  3585 1 1  74 ARG NH1  N  -0.909   8.065 -12.790 1.00 . A A .  74 ARG NH1  1 1 
        2  3586 1 1  74 ARG NH2  N  -0.104   6.113 -13.599 1.00 . A A .  74 ARG NH2  1 1 
        2  3587 1 1  74 ARG O    O  -0.638  10.476  -5.940 1.00 . A A .  74 ARG O    1 1 
        2  3588 1 1  75 LEU C    C   2.556   9.340  -3.846 1.00 . A A .  75 LEU C    1 1 
        2  3589 1 1  75 LEU CA   C   1.052   9.553  -4.024 1.00 . A A .  75 LEU CA   1 1 
        2  3590 1 1  75 LEU CB   C   0.321   9.029  -2.784 1.00 . A A .  75 LEU CB   1 1 
        2  3591 1 1  75 LEU CD1  C  -1.915   8.547  -1.782 1.00 . A A .  75 LEU CD1  1 1 
        2  3592 1 1  75 LEU CD2  C  -1.494  10.779  -2.830 1.00 . A A .  75 LEU CD2  1 1 
        2  3593 1 1  75 LEU CG   C  -1.189   9.274  -2.914 1.00 . A A .  75 LEU CG   1 1 
        2  3594 1 1  75 LEU H    H   0.898   7.875  -5.369 1.00 . A A .  75 LEU H    1 1 
        2  3595 1 1  75 LEU HA   H   0.855  10.608  -4.145 1.00 . A A .  75 LEU HA   1 1 
        2  3596 1 1  75 LEU HB2  H   0.503   7.969  -2.687 1.00 . A A .  75 LEU HB2  1 1 
        2  3597 1 1  75 LEU HB3  H   0.694   9.534  -1.905 1.00 . A A .  75 LEU HB3  1 1 
        2  3598 1 1  75 LEU HD11 H  -2.963   8.804  -1.804 1.00 . A A .  75 LEU HD11 1 1 
        2  3599 1 1  75 LEU HD12 H  -1.490   8.844  -0.834 1.00 . A A .  75 LEU HD12 1 1 
        2  3600 1 1  75 LEU HD13 H  -1.803   7.481  -1.909 1.00 . A A .  75 LEU HD13 1 1 
        2  3601 1 1  75 LEU HD21 H  -1.316  11.235  -3.789 1.00 . A A .  75 LEU HD21 1 1 
        2  3602 1 1  75 LEU HD22 H  -0.861  11.242  -2.087 1.00 . A A .  75 LEU HD22 1 1 
        2  3603 1 1  75 LEU HD23 H  -2.531  10.925  -2.556 1.00 . A A .  75 LEU HD23 1 1 
        2  3604 1 1  75 LEU HG   H  -1.532   8.890  -3.864 1.00 . A A .  75 LEU HG   1 1 
        2  3605 1 1  75 LEU N    N   0.587   8.792  -5.226 1.00 . A A .  75 LEU N    1 1 
        2  3606 1 1  75 LEU O    O   3.059   8.245  -3.980 1.00 . A A .  75 LEU O    1 1 
        2  3607 1 1  76 ALA C    C   5.208  11.256  -2.294 1.00 . A A .  76 ALA C    1 1 
        2  3608 1 1  76 ALA CA   C   4.756  10.244  -3.346 1.00 . A A .  76 ALA CA   1 1 
        2  3609 1 1  76 ALA CB   C   5.471  10.530  -4.669 1.00 . A A .  76 ALA CB   1 1 
        2  3610 1 1  76 ALA H    H   2.857  11.261  -3.437 1.00 . A A .  76 ALA H    1 1 
        2  3611 1 1  76 ALA HA   H   4.993   9.242  -3.013 1.00 . A A .  76 ALA HA   1 1 
        2  3612 1 1  76 ALA HB1  H   6.501  10.210  -4.599 1.00 . A A .  76 ALA HB1  1 1 
        2  3613 1 1  76 ALA HB2  H   5.437  11.589  -4.872 1.00 . A A .  76 ALA HB2  1 1 
        2  3614 1 1  76 ALA HB3  H   4.980   9.994  -5.468 1.00 . A A .  76 ALA HB3  1 1 
        2  3615 1 1  76 ALA N    N   3.282  10.383  -3.541 1.00 . A A .  76 ALA N    1 1 
        2  3616 1 1  76 ALA O    O   4.945  12.437  -2.407 1.00 . A A .  76 ALA O    1 1 
        2  3617 1 1  77 TYR C    C   7.522  11.166   0.549 1.00 . A A .  77 TYR C    1 1 
        2  3618 1 1  77 TYR CA   C   6.340  11.763  -0.215 1.00 . A A .  77 TYR CA   1 1 
        2  3619 1 1  77 TYR CB   C   5.193  12.049   0.756 1.00 . A A .  77 TYR CB   1 1 
        2  3620 1 1  77 TYR CD1  C   5.274  10.305   2.579 1.00 . A A .  77 TYR CD1  1 1 
        2  3621 1 1  77 TYR CD2  C   3.678  10.037   0.773 1.00 . A A .  77 TYR CD2  1 1 
        2  3622 1 1  77 TYR CE1  C   4.812   9.118   3.163 1.00 . A A .  77 TYR CE1  1 1 
        2  3623 1 1  77 TYR CE2  C   3.214   8.852   1.359 1.00 . A A .  77 TYR CE2  1 1 
        2  3624 1 1  77 TYR CG   C   4.706  10.763   1.383 1.00 . A A .  77 TYR CG   1 1 
        2  3625 1 1  77 TYR CZ   C   3.782   8.393   2.552 1.00 . A A .  77 TYR CZ   1 1 
        2  3626 1 1  77 TYR H    H   6.085   9.855  -1.188 1.00 . A A .  77 TYR H    1 1 
        2  3627 1 1  77 TYR HA   H   6.650  12.688  -0.678 1.00 . A A .  77 TYR HA   1 1 
        2  3628 1 1  77 TYR HB2  H   5.538  12.716   1.533 1.00 . A A .  77 TYR HB2  1 1 
        2  3629 1 1  77 TYR HB3  H   4.381  12.512   0.220 1.00 . A A .  77 TYR HB3  1 1 
        2  3630 1 1  77 TYR HD1  H   6.068  10.865   3.049 1.00 . A A .  77 TYR HD1  1 1 
        2  3631 1 1  77 TYR HD2  H   3.240  10.390  -0.148 1.00 . A A .  77 TYR HD2  1 1 
        2  3632 1 1  77 TYR HE1  H   5.250   8.764   4.085 1.00 . A A .  77 TYR HE1  1 1 
        2  3633 1 1  77 TYR HE2  H   2.421   8.292   0.887 1.00 . A A .  77 TYR HE2  1 1 
        2  3634 1 1  77 TYR HH   H   2.702   6.819   2.524 1.00 . A A .  77 TYR HH   1 1 
        2  3635 1 1  77 TYR N    N   5.882  10.812  -1.268 1.00 . A A .  77 TYR N    1 1 
        2  3636 1 1  77 TYR O    O   7.764   9.978   0.509 1.00 . A A .  77 TYR O    1 1 
        2  3637 1 1  77 TYR OH   O   3.324   7.227   3.131 1.00 . A A .  77 TYR OH   1 1 
        2  3638 1 1  78 SER C    C   9.450  12.184   3.392 1.00 . A A .  78 SER C    1 1 
        2  3639 1 1  78 SER CA   C   9.435  11.493   2.027 1.00 . A A .  78 SER CA   1 1 
        2  3640 1 1  78 SER CB   C  10.719  11.836   1.271 1.00 . A A .  78 SER CB   1 1 
        2  3641 1 1  78 SER H    H   8.039  12.945   1.261 1.00 . A A .  78 SER H    1 1 
        2  3642 1 1  78 SER HA   H   9.369  10.422   2.165 1.00 . A A .  78 SER HA   1 1 
        2  3643 1 1  78 SER HB2  H  10.699  11.378   0.296 1.00 . A A .  78 SER HB2  1 1 
        2  3644 1 1  78 SER HB3  H  10.794  12.911   1.160 1.00 . A A .  78 SER HB3  1 1 
        2  3645 1 1  78 SER HG   H  12.352  12.095   2.292 1.00 . A A .  78 SER HG   1 1 
        2  3646 1 1  78 SER N    N   8.259  11.990   1.247 1.00 . A A .  78 SER N    1 1 
        2  3647 1 1  78 SER O    O   9.123  13.347   3.506 1.00 . A A .  78 SER O    1 1 
        2  3648 1 1  78 SER OG   O  11.836  11.342   1.997 1.00 . A A .  78 SER OG   1 1 
        2  3649 1 1  79 PHE C    C  10.920  11.448   6.645 1.00 . A A .  79 PHE C    1 1 
        2  3650 1 1  79 PHE CA   C   9.846  12.125   5.786 1.00 . A A .  79 PHE CA   1 1 
        2  3651 1 1  79 PHE CB   C   8.476  11.971   6.447 1.00 . A A .  79 PHE CB   1 1 
        2  3652 1 1  79 PHE CD1  C   8.377  14.115   7.766 1.00 . A A .  79 PHE CD1  1 1 
        2  3653 1 1  79 PHE CD2  C   8.555  12.017   8.969 1.00 . A A .  79 PHE CD2  1 1 
        2  3654 1 1  79 PHE CE1  C   8.373  14.812   8.980 1.00 . A A .  79 PHE CE1  1 1 
        2  3655 1 1  79 PHE CE2  C   8.552  12.714  10.183 1.00 . A A .  79 PHE CE2  1 1 
        2  3656 1 1  79 PHE CG   C   8.468  12.718   7.760 1.00 . A A .  79 PHE CG   1 1 
        2  3657 1 1  79 PHE CZ   C   8.459  14.111  10.188 1.00 . A A .  79 PHE CZ   1 1 
        2  3658 1 1  79 PHE H    H  10.079  10.544   4.329 1.00 . A A .  79 PHE H    1 1 
        2  3659 1 1  79 PHE HA   H  10.080  13.176   5.687 1.00 . A A .  79 PHE HA   1 1 
        2  3660 1 1  79 PHE HB2  H   7.716  12.378   5.797 1.00 . A A .  79 PHE HB2  1 1 
        2  3661 1 1  79 PHE HB3  H   8.274  10.924   6.624 1.00 . A A .  79 PHE HB3  1 1 
        2  3662 1 1  79 PHE HD1  H   8.309  14.656   6.833 1.00 . A A .  79 PHE HD1  1 1 
        2  3663 1 1  79 PHE HD2  H   8.625  10.939   8.964 1.00 . A A .  79 PHE HD2  1 1 
        2  3664 1 1  79 PHE HE1  H   8.302  15.889   8.984 1.00 . A A .  79 PHE HE1  1 1 
        2  3665 1 1  79 PHE HE2  H   8.619  12.173  11.115 1.00 . A A .  79 PHE HE2  1 1 
        2  3666 1 1  79 PHE HZ   H   8.457  14.648  11.125 1.00 . A A .  79 PHE HZ   1 1 
        2  3667 1 1  79 PHE N    N   9.820  11.486   4.433 1.00 . A A .  79 PHE N    1 1 
        2  3668 1 1  79 PHE O    O  10.952  10.242   6.778 1.00 . A A .  79 PHE O    1 1 
        2  3669 1 1  80 GLY C    C  12.475  11.538   9.528 1.00 . A A .  80 GLY C    1 1 
        2  3670 1 1  80 GLY CA   C  12.901  11.620   8.058 1.00 . A A .  80 GLY CA   1 1 
        2  3671 1 1  80 GLY H    H  11.773  13.189   7.091 1.00 . A A .  80 GLY H    1 1 
        2  3672 1 1  80 GLY HA2  H  13.127  10.625   7.699 1.00 . A A .  80 GLY HA2  1 1 
        2  3673 1 1  80 GLY HA3  H  13.785  12.234   7.982 1.00 . A A .  80 GLY HA3  1 1 
        2  3674 1 1  80 GLY N    N  11.812  12.218   7.221 1.00 . A A .  80 GLY N    1 1 
        2  3675 1 1  80 GLY O    O  11.352  11.838   9.882 1.00 . A A .  80 GLY O    1 1 
        2  3676 1 1  81 TRP C    C  12.923  12.380  12.477 1.00 . A A .  81 TRP C    1 1 
        2  3677 1 1  81 TRP CA   C  13.044  10.994  11.833 1.00 . A A .  81 TRP CA   1 1 
        2  3678 1 1  81 TRP CB   C  14.166  10.223  12.537 1.00 . A A .  81 TRP CB   1 1 
        2  3679 1 1  81 TRP CD1  C  16.398  10.718  11.447 1.00 . A A .  81 TRP CD1  1 1 
        2  3680 1 1  81 TRP CD2  C  15.981  12.060  13.206 1.00 . A A .  81 TRP CD2  1 1 
        2  3681 1 1  81 TRP CE2  C  17.249  12.437  12.697 1.00 . A A .  81 TRP CE2  1 1 
        2  3682 1 1  81 TRP CE3  C  15.484  12.757  14.321 1.00 . A A .  81 TRP CE3  1 1 
        2  3683 1 1  81 TRP CG   C  15.461  10.963  12.393 1.00 . A A .  81 TRP CG   1 1 
        2  3684 1 1  81 TRP CH2  C  17.485  14.146  14.384 1.00 . A A .  81 TRP CH2  1 1 
        2  3685 1 1  81 TRP CZ2  C  17.995  13.466  13.275 1.00 . A A .  81 TRP CZ2  1 1 
        2  3686 1 1  81 TRP CZ3  C  16.232  13.794  14.905 1.00 . A A .  81 TRP CZ3  1 1 
        2  3687 1 1  81 TRP H    H  14.265  10.875  10.064 1.00 . A A .  81 TRP H    1 1 
        2  3688 1 1  81 TRP HA   H  12.113  10.459  11.949 1.00 . A A .  81 TRP HA   1 1 
        2  3689 1 1  81 TRP HB2  H  13.927  10.117  13.585 1.00 . A A .  81 TRP HB2  1 1 
        2  3690 1 1  81 TRP HB3  H  14.262   9.243  12.091 1.00 . A A .  81 TRP HB3  1 1 
        2  3691 1 1  81 TRP HD1  H  16.329   9.964  10.677 1.00 . A A .  81 TRP HD1  1 1 
        2  3692 1 1  81 TRP HE1  H  18.266  11.619  11.074 1.00 . A A .  81 TRP HE1  1 1 
        2  3693 1 1  81 TRP HE3  H  14.521  12.494  14.732 1.00 . A A .  81 TRP HE3  1 1 
        2  3694 1 1  81 TRP HH2  H  18.054  14.945  14.837 1.00 . A A .  81 TRP HH2  1 1 
        2  3695 1 1  81 TRP HZ2  H  18.959  13.733  12.869 1.00 . A A .  81 TRP HZ2  1 1 
        2  3696 1 1  81 TRP HZ3  H  15.839  14.323  15.762 1.00 . A A .  81 TRP HZ3  1 1 
        2  3697 1 1  81 TRP N    N  13.372  11.121  10.382 1.00 . A A .  81 TRP N    1 1 
        2  3698 1 1  81 TRP NE1  N  17.457  11.590  11.628 1.00 . A A .  81 TRP NE1  1 1 
        2  3699 1 1  81 TRP O    O  13.703  13.272  12.210 1.00 . A A .  81 TRP O    1 1 
        2  3700 1 1  82 ASP C    C  11.250  13.614  15.442 1.00 . A A .  82 ASP C    1 1 
        2  3701 1 1  82 ASP CA   C  11.765  13.869  14.024 1.00 . A A .  82 ASP CA   1 1 
        2  3702 1 1  82 ASP CB   C  10.755  14.723  13.243 1.00 . A A .  82 ASP CB   1 1 
        2  3703 1 1  82 ASP CG   C  11.434  15.342  12.014 1.00 . A A .  82 ASP CG   1 1 
        2  3704 1 1  82 ASP H    H  11.346  11.814  13.536 1.00 . A A .  82 ASP H    1 1 
        2  3705 1 1  82 ASP HA   H  12.710  14.388  14.083 1.00 . A A .  82 ASP HA   1 1 
        2  3706 1 1  82 ASP HB2  H   9.935  14.099  12.919 1.00 . A A .  82 ASP HB2  1 1 
        2  3707 1 1  82 ASP HB3  H  10.378  15.511  13.878 1.00 . A A .  82 ASP HB3  1 1 
        2  3708 1 1  82 ASP N    N  11.953  12.555  13.335 1.00 . A A .  82 ASP N    1 1 
        2  3709 1 1  82 ASP O    O  10.097  13.847  15.750 1.00 . A A .  82 ASP O    1 1 
        2  3710 1 1  82 ASP OD1  O  12.652  15.390  11.991 1.00 . A A .  82 ASP OD1  1 1 
        2  3711 1 1  82 ASP OD2  O  10.720  15.761  11.118 1.00 . A A .  82 ASP OD2  1 1 
        2  3712 1 1  83 GLY C    C  11.077  11.451  17.804 1.00 . A A .  83 GLY C    1 1 
        2  3713 1 1  83 GLY CA   C  11.679  12.854  17.709 1.00 . A A .  83 GLY CA   1 1 
        2  3714 1 1  83 GLY H    H  13.024  12.947  16.032 1.00 . A A .  83 GLY H    1 1 
        2  3715 1 1  83 GLY HA2  H  12.538  12.922  18.362 1.00 . A A .  83 GLY HA2  1 1 
        2  3716 1 1  83 GLY HA3  H  10.940  13.579  18.016 1.00 . A A .  83 GLY HA3  1 1 
        2  3717 1 1  83 GLY N    N  12.102  13.132  16.307 1.00 . A A .  83 GLY N    1 1 
        2  3718 1 1  83 GLY O    O  10.880  10.925  18.880 1.00 . A A .  83 GLY O    1 1 
        2  3719 1 1  84 SER C    C  11.263   8.411  16.822 1.00 . A A .  84 SER C    1 1 
        2  3720 1 1  84 SER CA   C  10.165   9.475  16.722 1.00 . A A .  84 SER CA   1 1 
        2  3721 1 1  84 SER CB   C   9.346   9.262  15.450 1.00 . A A .  84 SER CB   1 1 
        2  3722 1 1  84 SER H    H  10.930  11.286  15.829 1.00 . A A .  84 SER H    1 1 
        2  3723 1 1  84 SER HA   H   9.513   9.394  17.580 1.00 . A A .  84 SER HA   1 1 
        2  3724 1 1  84 SER HB2  H   9.884   9.651  14.603 1.00 . A A .  84 SER HB2  1 1 
        2  3725 1 1  84 SER HB3  H   9.168   8.203  15.307 1.00 . A A .  84 SER HB3  1 1 
        2  3726 1 1  84 SER HG   H   7.667   9.927  14.728 1.00 . A A .  84 SER HG   1 1 
        2  3727 1 1  84 SER N    N  10.770  10.842  16.688 1.00 . A A .  84 SER N    1 1 
        2  3728 1 1  84 SER O    O  12.405   8.646  16.484 1.00 . A A .  84 SER O    1 1 
        2  3729 1 1  84 SER OG   O   8.111   9.951  15.578 1.00 . A A .  84 SER OG   1 1 
        2  3730 1 1  85 GLU C    C  12.534   5.849  16.049 1.00 . A A .  85 GLU C    1 1 
        2  3731 1 1  85 GLU CA   C  11.924   6.150  17.421 1.00 . A A .  85 GLU CA   1 1 
        2  3732 1 1  85 GLU CB   C  11.246   4.892  17.977 1.00 . A A .  85 GLU CB   1 1 
        2  3733 1 1  85 GLU CD   C   9.342   5.827  19.343 1.00 . A A .  85 GLU CD   1 1 
        2  3734 1 1  85 GLU CG   C  10.721   5.156  19.401 1.00 . A A .  85 GLU CG   1 1 
        2  3735 1 1  85 GLU H    H   9.989   7.081  17.555 1.00 . A A .  85 GLU H    1 1 
        2  3736 1 1  85 GLU HA   H  12.706   6.464  18.097 1.00 . A A .  85 GLU HA   1 1 
        2  3737 1 1  85 GLU HB2  H  10.426   4.607  17.334 1.00 . A A .  85 GLU HB2  1 1 
        2  3738 1 1  85 GLU HB3  H  11.964   4.082  18.010 1.00 . A A .  85 GLU HB3  1 1 
        2  3739 1 1  85 GLU HG2  H  10.638   4.218  19.933 1.00 . A A .  85 GLU HG2  1 1 
        2  3740 1 1  85 GLU HG3  H  11.406   5.802  19.925 1.00 . A A .  85 GLU HG3  1 1 
        2  3741 1 1  85 GLU N    N  10.916   7.241  17.289 1.00 . A A .  85 GLU N    1 1 
        2  3742 1 1  85 GLU O    O  12.155   4.902  15.389 1.00 . A A .  85 GLU O    1 1 
        2  3743 1 1  85 GLU OE1  O   8.893   6.131  18.252 1.00 . A A .  85 GLU OE1  1 1 
        2  3744 1 1  85 GLU OE2  O   8.754   6.011  20.396 1.00 . A A .  85 GLU OE2  1 1 
        2  3745 1 1  86 VAL C    C  13.218   5.859  13.280 1.00 . A A .  86 VAL C    1 1 
        2  3746 1 1  86 VAL CA   C  14.167   6.476  14.311 1.00 . A A .  86 VAL CA   1 1 
        2  3747 1 1  86 VAL CB   C  15.413   5.588  14.493 1.00 . A A .  86 VAL CB   1 1 
        2  3748 1 1  86 VAL CG1  C  16.571   6.441  15.015 1.00 . A A .  86 VAL CG1  1 1 
        2  3749 1 1  86 VAL CG2  C  15.122   4.473  15.502 1.00 . A A .  86 VAL CG2  1 1 
        2  3750 1 1  86 VAL H    H  13.755   7.404  16.210 1.00 . A A .  86 VAL H    1 1 
        2  3751 1 1  86 VAL HA   H  14.477   7.447  13.946 1.00 . A A .  86 VAL HA   1 1 
        2  3752 1 1  86 VAL HB   H  15.692   5.153  13.542 1.00 . A A .  86 VAL HB   1 1 
        2  3753 1 1  86 VAL HG11 H  16.289   6.886  15.958 1.00 . A A .  86 VAL HG11 1 1 
        2  3754 1 1  86 VAL HG12 H  16.791   7.223  14.303 1.00 . A A .  86 VAL HG12 1 1 
        2  3755 1 1  86 VAL HG13 H  17.443   5.823  15.154 1.00 . A A .  86 VAL HG13 1 1 
        2  3756 1 1  86 VAL HG21 H  14.268   3.900  15.174 1.00 . A A .  86 VAL HG21 1 1 
        2  3757 1 1  86 VAL HG22 H  14.918   4.906  16.469 1.00 . A A .  86 VAL HG22 1 1 
        2  3758 1 1  86 VAL HG23 H  15.984   3.824  15.576 1.00 . A A .  86 VAL HG23 1 1 
        2  3759 1 1  86 VAL N    N  13.483   6.658  15.635 1.00 . A A .  86 VAL N    1 1 
        2  3760 1 1  86 VAL O    O  13.141   4.655  13.140 1.00 . A A .  86 VAL O    1 1 
        2  3761 1 1  87 VAL C    C  10.965   4.849  11.847 1.00 . A A .  87 VAL C    1 1 
        2  3762 1 1  87 VAL CA   C  11.541   6.233  11.512 1.00 . A A .  87 VAL CA   1 1 
        2  3763 1 1  87 VAL CB   C  12.248   6.199  10.148 1.00 . A A .  87 VAL CB   1 1 
        2  3764 1 1  87 VAL CG1  C  12.448   7.633   9.644 1.00 . A A .  87 VAL CG1  1 1 
        2  3765 1 1  87 VAL CG2  C  13.617   5.523  10.279 1.00 . A A .  87 VAL CG2  1 1 
        2  3766 1 1  87 VAL H    H  12.612   7.661  12.714 1.00 . A A .  87 VAL H    1 1 
        2  3767 1 1  87 VAL HA   H  10.727   6.940  11.456 1.00 . A A .  87 VAL HA   1 1 
        2  3768 1 1  87 VAL HB   H  11.641   5.655   9.441 1.00 . A A .  87 VAL HB   1 1 
        2  3769 1 1  87 VAL HG11 H  13.109   8.161  10.315 1.00 . A A .  87 VAL HG11 1 1 
        2  3770 1 1  87 VAL HG12 H  11.496   8.140   9.608 1.00 . A A .  87 VAL HG12 1 1 
        2  3771 1 1  87 VAL HG13 H  12.882   7.610   8.656 1.00 . A A .  87 VAL HG13 1 1 
        2  3772 1 1  87 VAL HG21 H  13.517   4.605  10.837 1.00 . A A .  87 VAL HG21 1 1 
        2  3773 1 1  87 VAL HG22 H  14.298   6.185  10.792 1.00 . A A .  87 VAL HG22 1 1 
        2  3774 1 1  87 VAL HG23 H  14.004   5.304   9.295 1.00 . A A .  87 VAL HG23 1 1 
        2  3775 1 1  87 VAL N    N  12.505   6.699  12.563 1.00 . A A .  87 VAL N    1 1 
        2  3776 1 1  87 VAL O    O  11.332   3.857  11.255 1.00 . A A .  87 VAL O    1 1 
        2  3777 1 1  88 PRO C    C   8.767   2.775  11.999 1.00 . A A .  88 PRO C    1 1 
        2  3778 1 1  88 PRO CA   C   9.407   3.510  13.192 1.00 . A A .  88 PRO CA   1 1 
        2  3779 1 1  88 PRO CB   C   8.347   3.893  14.252 1.00 . A A .  88 PRO CB   1 1 
        2  3780 1 1  88 PRO CD   C   9.553   5.941  13.569 1.00 . A A .  88 PRO CD   1 1 
        2  3781 1 1  88 PRO CG   C   8.607   5.334  14.624 1.00 . A A .  88 PRO CG   1 1 
        2  3782 1 1  88 PRO HA   H  10.147   2.869  13.647 1.00 . A A .  88 PRO HA   1 1 
        2  3783 1 1  88 PRO HB2  H   7.346   3.778  13.850 1.00 . A A .  88 PRO HB2  1 1 
        2  3784 1 1  88 PRO HB3  H   8.453   3.262  15.127 1.00 . A A .  88 PRO HB3  1 1 
        2  3785 1 1  88 PRO HD2  H   9.014   6.630  12.934 1.00 . A A .  88 PRO HD2  1 1 
        2  3786 1 1  88 PRO HD3  H  10.381   6.445  14.046 1.00 . A A .  88 PRO HD3  1 1 
        2  3787 1 1  88 PRO HG2  H   7.673   5.885  14.644 1.00 . A A .  88 PRO HG2  1 1 
        2  3788 1 1  88 PRO HG3  H   9.075   5.386  15.599 1.00 . A A .  88 PRO HG3  1 1 
        2  3789 1 1  88 PRO N    N  10.049   4.792  12.791 1.00 . A A .  88 PRO N    1 1 
        2  3790 1 1  88 PRO O    O   8.920   1.579  11.862 1.00 . A A .  88 PRO O    1 1 
        2  3791 1 1  89 PRO C    C   8.393   2.722   8.791 1.00 . A A .  89 PRO C    1 1 
        2  3792 1 1  89 PRO CA   C   7.414   2.836   9.959 1.00 . A A .  89 PRO CA   1 1 
        2  3793 1 1  89 PRO CB   C   6.258   3.783   9.633 1.00 . A A .  89 PRO CB   1 1 
        2  3794 1 1  89 PRO CD   C   7.787   4.924  11.164 1.00 . A A .  89 PRO CD   1 1 
        2  3795 1 1  89 PRO CG   C   6.731   5.142  10.061 1.00 . A A .  89 PRO CG   1 1 
        2  3796 1 1  89 PRO HA   H   7.028   1.865  10.221 1.00 . A A .  89 PRO HA   1 1 
        2  3797 1 1  89 PRO HB2  H   6.043   3.768   8.569 1.00 . A A .  89 PRO HB2  1 1 
        2  3798 1 1  89 PRO HB3  H   5.378   3.504  10.193 1.00 . A A .  89 PRO HB3  1 1 
        2  3799 1 1  89 PRO HD2  H   8.682   5.483  10.931 1.00 . A A .  89 PRO HD2  1 1 
        2  3800 1 1  89 PRO HD3  H   7.397   5.216  12.121 1.00 . A A .  89 PRO HD3  1 1 
        2  3801 1 1  89 PRO HG2  H   7.171   5.663   9.218 1.00 . A A .  89 PRO HG2  1 1 
        2  3802 1 1  89 PRO HG3  H   5.906   5.719  10.456 1.00 . A A .  89 PRO HG3  1 1 
        2  3803 1 1  89 PRO N    N   8.057   3.470  11.135 1.00 . A A .  89 PRO N    1 1 
        2  3804 1 1  89 PRO O    O   8.109   2.110   7.782 1.00 . A A .  89 PRO O    1 1 
        2  3805 1 1  90 GLY C    C  10.462   4.561   7.015 1.00 . A A .  90 GLY C    1 1 
        2  3806 1 1  90 GLY CA   C  10.560   3.275   7.833 1.00 . A A .  90 GLY CA   1 1 
        2  3807 1 1  90 GLY H    H   9.743   3.815   9.748 1.00 . A A .  90 GLY H    1 1 
        2  3808 1 1  90 GLY HA2  H  11.548   3.200   8.266 1.00 . A A .  90 GLY HA2  1 1 
        2  3809 1 1  90 GLY HA3  H  10.380   2.423   7.191 1.00 . A A .  90 GLY HA3  1 1 
        2  3810 1 1  90 GLY N    N   9.546   3.323   8.924 1.00 . A A .  90 GLY N    1 1 
        2  3811 1 1  90 GLY O    O  11.440   5.020   6.460 1.00 . A A .  90 GLY O    1 1 
        2  3812 1 1  91 SER C    C   9.999   6.465   4.961 1.00 . A A .  91 SER C    1 1 
        2  3813 1 1  91 SER CA   C   9.085   6.424   6.189 1.00 . A A .  91 SER CA   1 1 
        2  3814 1 1  91 SER CB   C   9.403   7.610   7.100 1.00 . A A .  91 SER CB   1 1 
        2  3815 1 1  91 SER H    H   8.525   4.751   7.431 1.00 . A A .  91 SER H    1 1 
        2  3816 1 1  91 SER HA   H   8.056   6.491   5.870 1.00 . A A .  91 SER HA   1 1 
        2  3817 1 1  91 SER HB2  H   9.201   8.531   6.580 1.00 . A A .  91 SER HB2  1 1 
        2  3818 1 1  91 SER HB3  H   8.788   7.556   7.988 1.00 . A A .  91 SER HB3  1 1 
        2  3819 1 1  91 SER HG   H  10.976   6.679   7.765 1.00 . A A .  91 SER HG   1 1 
        2  3820 1 1  91 SER N    N   9.285   5.149   6.956 1.00 . A A .  91 SER N    1 1 
        2  3821 1 1  91 SER O    O   9.647   5.998   3.896 1.00 . A A .  91 SER O    1 1 
        2  3822 1 1  91 SER OG   O  10.777   7.567   7.457 1.00 . A A .  91 SER OG   1 1 
        2  3823 1 1  92 SER C    C  11.398   7.573   2.720 1.00 . A A .  92 SER C    1 1 
        2  3824 1 1  92 SER CA   C  12.129   7.078   3.969 1.00 . A A .  92 SER CA   1 1 
        2  3825 1 1  92 SER CB   C  12.704   5.686   3.716 1.00 . A A .  92 SER CB   1 1 
        2  3826 1 1  92 SER H    H  11.438   7.370   5.983 1.00 . A A .  92 SER H    1 1 
        2  3827 1 1  92 SER HA   H  12.932   7.757   4.211 1.00 . A A .  92 SER HA   1 1 
        2  3828 1 1  92 SER HB2  H  11.913   4.955   3.749 1.00 . A A .  92 SER HB2  1 1 
        2  3829 1 1  92 SER HB3  H  13.169   5.664   2.742 1.00 . A A .  92 SER HB3  1 1 
        2  3830 1 1  92 SER HG   H  13.457   4.518   5.080 1.00 . A A .  92 SER HG   1 1 
        2  3831 1 1  92 SER N    N  11.176   7.009   5.112 1.00 . A A .  92 SER N    1 1 
        2  3832 1 1  92 SER O    O  10.956   8.703   2.665 1.00 . A A .  92 SER O    1 1 
        2  3833 1 1  92 SER OG   O  13.664   5.384   4.720 1.00 . A A .  92 SER OG   1 1 
        2  3834 1 1  93 LEU C    C   9.358   6.228   0.242 1.00 . A A .  93 LEU C    1 1 
        2  3835 1 1  93 LEU CA   C  10.559   7.143   0.464 1.00 . A A .  93 LEU CA   1 1 
        2  3836 1 1  93 LEU CB   C  11.515   7.014  -0.723 1.00 . A A .  93 LEU CB   1 1 
        2  3837 1 1  93 LEU CD1  C  10.603   9.083  -1.858 1.00 . A A .  93 LEU CD1  1 1 
        2  3838 1 1  93 LEU CD2  C  11.796   7.306  -3.182 1.00 . A A .  93 LEU CD2  1 1 
        2  3839 1 1  93 LEU CG   C  10.863   7.570  -1.996 1.00 . A A .  93 LEU CG   1 1 
        2  3840 1 1  93 LEU H    H  11.632   5.826   1.793 1.00 . A A .  93 LEU H    1 1 
        2  3841 1 1  93 LEU HA   H  10.216   8.165   0.544 1.00 . A A .  93 LEU HA   1 1 
        2  3842 1 1  93 LEU HB2  H  12.420   7.565  -0.514 1.00 . A A .  93 LEU HB2  1 1 
        2  3843 1 1  93 LEU HB3  H  11.757   5.972  -0.874 1.00 . A A .  93 LEU HB3  1 1 
        2  3844 1 1  93 LEU HD11 H  10.614   9.548  -2.834 1.00 . A A .  93 LEU HD11 1 1 
        2  3845 1 1  93 LEU HD12 H  11.371   9.531  -1.240 1.00 . A A .  93 LEU HD12 1 1 
        2  3846 1 1  93 LEU HD13 H   9.636   9.241  -1.401 1.00 . A A .  93 LEU HD13 1 1 
        2  3847 1 1  93 LEU HD21 H  11.384   7.759  -4.073 1.00 . A A .  93 LEU HD21 1 1 
        2  3848 1 1  93 LEU HD22 H  11.897   6.242  -3.331 1.00 . A A .  93 LEU HD22 1 1 
        2  3849 1 1  93 LEU HD23 H  12.766   7.735  -2.977 1.00 . A A .  93 LEU HD23 1 1 
        2  3850 1 1  93 LEU HG   H   9.923   7.064  -2.164 1.00 . A A .  93 LEU HG   1 1 
        2  3851 1 1  93 LEU N    N  11.267   6.734   1.719 1.00 . A A .  93 LEU N    1 1 
        2  3852 1 1  93 LEU O    O   9.499   5.025   0.127 1.00 . A A .  93 LEU O    1 1 
        2  3853 1 1  94 VAL C    C   6.285   6.420  -1.349 1.00 . A A .  94 VAL C    1 1 
        2  3854 1 1  94 VAL CA   C   6.947   5.983  -0.043 1.00 . A A .  94 VAL CA   1 1 
        2  3855 1 1  94 VAL CB   C   5.982   6.211   1.125 1.00 . A A .  94 VAL CB   1 1 
        2  3856 1 1  94 VAL CG1  C   4.610   5.611   0.797 1.00 . A A .  94 VAL CG1  1 1 
        2  3857 1 1  94 VAL CG2  C   6.546   5.539   2.378 1.00 . A A .  94 VAL CG2  1 1 
        2  3858 1 1  94 VAL H    H   8.110   7.768   0.268 1.00 . A A .  94 VAL H    1 1 
        2  3859 1 1  94 VAL HA   H   7.192   4.929  -0.105 1.00 . A A .  94 VAL HA   1 1 
        2  3860 1 1  94 VAL HB   H   5.878   7.272   1.300 1.00 . A A .  94 VAL HB   1 1 
        2  3861 1 1  94 VAL HG11 H   4.089   6.263   0.108 1.00 . A A .  94 VAL HG11 1 1 
        2  3862 1 1  94 VAL HG12 H   4.031   5.509   1.702 1.00 . A A .  94 VAL HG12 1 1 
        2  3863 1 1  94 VAL HG13 H   4.740   4.641   0.342 1.00 . A A .  94 VAL HG13 1 1 
        2  3864 1 1  94 VAL HG21 H   7.532   5.928   2.582 1.00 . A A .  94 VAL HG21 1 1 
        2  3865 1 1  94 VAL HG22 H   6.607   4.472   2.216 1.00 . A A .  94 VAL HG22 1 1 
        2  3866 1 1  94 VAL HG23 H   5.898   5.739   3.217 1.00 . A A .  94 VAL HG23 1 1 
        2  3867 1 1  94 VAL N    N   8.183   6.796   0.174 1.00 . A A .  94 VAL N    1 1 
        2  3868 1 1  94 VAL O    O   6.072   7.591  -1.590 1.00 . A A .  94 VAL O    1 1 
        2  3869 1 1  95 GLU C    C   4.200   4.777  -3.743 1.00 . A A .  95 GLU C    1 1 
        2  3870 1 1  95 GLU CA   C   5.283   5.814  -3.482 1.00 . A A .  95 GLU CA   1 1 
        2  3871 1 1  95 GLU CB   C   6.310   5.779  -4.612 1.00 . A A .  95 GLU CB   1 1 
        2  3872 1 1  95 GLU CD   C   8.342   6.881  -5.554 1.00 . A A .  95 GLU CD   1 1 
        2  3873 1 1  95 GLU CG   C   7.268   6.959  -4.468 1.00 . A A .  95 GLU CG   1 1 
        2  3874 1 1  95 GLU H    H   6.126   4.545  -1.962 1.00 . A A .  95 GLU H    1 1 
        2  3875 1 1  95 GLU HA   H   4.835   6.799  -3.428 1.00 . A A .  95 GLU HA   1 1 
        2  3876 1 1  95 GLU HB2  H   6.867   4.854  -4.561 1.00 . A A .  95 GLU HB2  1 1 
        2  3877 1 1  95 GLU HB3  H   5.804   5.841  -5.564 1.00 . A A .  95 GLU HB3  1 1 
        2  3878 1 1  95 GLU HG2  H   6.717   7.883  -4.572 1.00 . A A .  95 GLU HG2  1 1 
        2  3879 1 1  95 GLU HG3  H   7.737   6.929  -3.496 1.00 . A A .  95 GLU HG3  1 1 
        2  3880 1 1  95 GLU N    N   5.948   5.481  -2.188 1.00 . A A .  95 GLU N    1 1 
        2  3881 1 1  95 GLU O    O   4.431   3.589  -3.631 1.00 . A A .  95 GLU O    1 1 
        2  3882 1 1  95 GLU OE1  O   8.304   5.941  -6.330 1.00 . A A .  95 GLU OE1  1 1 
        2  3883 1 1  95 GLU OE2  O   9.185   7.762  -5.590 1.00 . A A .  95 GLU OE2  1 1 
        2  3884 1 1  96 ILE C    C   1.252   4.580  -5.685 1.00 . A A .  96 ILE C    1 1 
        2  3885 1 1  96 ILE CA   C   1.897   4.251  -4.345 1.00 . A A .  96 ILE CA   1 1 
        2  3886 1 1  96 ILE CB   C   0.848   4.368  -3.241 1.00 . A A .  96 ILE CB   1 1 
        2  3887 1 1  96 ILE CD1  C   0.510   4.283  -0.763 1.00 . A A .  96 ILE CD1  1 1 
        2  3888 1 1  96 ILE CG1  C   1.486   3.983  -1.903 1.00 . A A .  96 ILE CG1  1 1 
        2  3889 1 1  96 ILE CG2  C  -0.316   3.424  -3.551 1.00 . A A .  96 ILE CG2  1 1 
        2  3890 1 1  96 ILE H    H   2.853   6.176  -4.157 1.00 . A A .  96 ILE H    1 1 
        2  3891 1 1  96 ILE HA   H   2.271   3.236  -4.375 1.00 . A A .  96 ILE HA   1 1 
        2  3892 1 1  96 ILE HB   H   0.486   5.384  -3.193 1.00 . A A .  96 ILE HB   1 1 
        2  3893 1 1  96 ILE HD11 H  -0.371   3.670  -0.875 1.00 . A A .  96 ILE HD11 1 1 
        2  3894 1 1  96 ILE HD12 H   0.231   5.326  -0.793 1.00 . A A .  96 ILE HD12 1 1 
        2  3895 1 1  96 ILE HD13 H   0.985   4.063   0.182 1.00 . A A .  96 ILE HD13 1 1 
        2  3896 1 1  96 ILE HG12 H   1.726   2.930  -1.909 1.00 . A A .  96 ILE HG12 1 1 
        2  3897 1 1  96 ILE HG13 H   2.390   4.555  -1.760 1.00 . A A .  96 ILE HG13 1 1 
        2  3898 1 1  96 ILE HG21 H  -0.878   3.810  -4.388 1.00 . A A .  96 ILE HG21 1 1 
        2  3899 1 1  96 ILE HG22 H  -0.961   3.349  -2.689 1.00 . A A .  96 ILE HG22 1 1 
        2  3900 1 1  96 ILE HG23 H   0.071   2.446  -3.799 1.00 . A A .  96 ILE HG23 1 1 
        2  3901 1 1  96 ILE N    N   3.014   5.211  -4.082 1.00 . A A .  96 ILE N    1 1 
        2  3902 1 1  96 ILE O    O   0.948   5.720  -5.972 1.00 . A A .  96 ILE O    1 1 
        2  3903 1 1  97 ASP C    C  -0.793   2.888  -7.991 1.00 . A A .  97 ASP C    1 1 
        2  3904 1 1  97 ASP CA   C   0.405   3.824  -7.844 1.00 . A A .  97 ASP CA   1 1 
        2  3905 1 1  97 ASP CB   C   1.425   3.528  -8.945 1.00 . A A .  97 ASP CB   1 1 
        2  3906 1 1  97 ASP CG   C   2.493   4.623  -8.953 1.00 . A A .  97 ASP CG   1 1 
        2  3907 1 1  97 ASP H    H   1.295   2.675  -6.247 1.00 . A A .  97 ASP H    1 1 
        2  3908 1 1  97 ASP HA   H   0.072   4.849  -7.928 1.00 . A A .  97 ASP HA   1 1 
        2  3909 1 1  97 ASP HB2  H   1.890   2.570  -8.755 1.00 . A A .  97 ASP HB2  1 1 
        2  3910 1 1  97 ASP HB3  H   0.928   3.505  -9.901 1.00 . A A .  97 ASP HB3  1 1 
        2  3911 1 1  97 ASP N    N   1.040   3.586  -6.509 1.00 . A A .  97 ASP N    1 1 
        2  3912 1 1  97 ASP O    O  -0.715   1.720  -7.678 1.00 . A A .  97 ASP O    1 1 
        2  3913 1 1  97 ASP OD1  O   2.258   5.656  -8.348 1.00 . A A .  97 ASP OD1  1 1 
        2  3914 1 1  97 ASP OD2  O   3.527   4.409  -9.563 1.00 . A A .  97 ASP OD2  1 1 
        2  3915 1 1  98 LEU C    C  -3.386   2.329 -10.111 1.00 . A A .  98 LEU C    1 1 
        2  3916 1 1  98 LEU CA   C  -3.122   2.544  -8.625 1.00 . A A .  98 LEU CA   1 1 
        2  3917 1 1  98 LEU CB   C  -4.321   3.252  -7.994 1.00 . A A .  98 LEU CB   1 1 
        2  3918 1 1  98 LEU CD1  C  -5.219   4.293  -5.909 1.00 . A A .  98 LEU CD1  1 1 
        2  3919 1 1  98 LEU CD2  C  -3.749   2.267  -5.749 1.00 . A A .  98 LEU CD2  1 1 
        2  3920 1 1  98 LEU CG   C  -4.021   3.567  -6.524 1.00 . A A .  98 LEU CG   1 1 
        2  3921 1 1  98 LEU H    H  -1.940   4.347  -8.699 1.00 . A A .  98 LEU H    1 1 
        2  3922 1 1  98 LEU HA   H  -2.983   1.583  -8.149 1.00 . A A .  98 LEU HA   1 1 
        2  3923 1 1  98 LEU HB2  H  -4.512   4.173  -8.527 1.00 . A A .  98 LEU HB2  1 1 
        2  3924 1 1  98 LEU HB3  H  -5.189   2.616  -8.055 1.00 . A A .  98 LEU HB3  1 1 
        2  3925 1 1  98 LEU HD11 H  -6.083   3.645  -5.932 1.00 . A A .  98 LEU HD11 1 1 
        2  3926 1 1  98 LEU HD12 H  -5.426   5.189  -6.476 1.00 . A A .  98 LEU HD12 1 1 
        2  3927 1 1  98 LEU HD13 H  -4.993   4.557  -4.887 1.00 . A A .  98 LEU HD13 1 1 
        2  3928 1 1  98 LEU HD21 H  -3.921   2.431  -4.693 1.00 . A A .  98 LEU HD21 1 1 
        2  3929 1 1  98 LEU HD22 H  -2.722   1.967  -5.897 1.00 . A A .  98 LEU HD22 1 1 
        2  3930 1 1  98 LEU HD23 H  -4.408   1.486  -6.101 1.00 . A A .  98 LEU HD23 1 1 
        2  3931 1 1  98 LEU HG   H  -3.151   4.207  -6.468 1.00 . A A .  98 LEU HG   1 1 
        2  3932 1 1  98 LEU N    N  -1.904   3.397  -8.460 1.00 . A A .  98 LEU N    1 1 
        2  3933 1 1  98 LEU O    O  -3.416   3.264 -10.884 1.00 . A A .  98 LEU O    1 1 
        2  3934 1 1  99 ILE C    C  -5.129  -0.007 -12.068 1.00 . A A .  99 ILE C    1 1 
        2  3935 1 1  99 ILE CA   C  -3.837   0.795 -11.955 1.00 . A A .  99 ILE CA   1 1 
        2  3936 1 1  99 ILE CB   C  -2.669  -0.010 -12.518 1.00 . A A .  99 ILE CB   1 1 
        2  3937 1 1  99 ILE CD1  C  -0.182   0.006 -12.789 1.00 . A A .  99 ILE CD1  1 1 
        2  3938 1 1  99 ILE CG1  C  -1.410   0.860 -12.480 1.00 . A A .  99 ILE CG1  1 1 
        2  3939 1 1  99 ILE CG2  C  -2.972  -0.417 -13.962 1.00 . A A .  99 ILE CG2  1 1 
        2  3940 1 1  99 ILE H    H  -3.541   0.365  -9.864 1.00 . A A .  99 ILE H    1 1 
        2  3941 1 1  99 ILE HA   H  -3.942   1.713 -12.520 1.00 . A A .  99 ILE HA   1 1 
        2  3942 1 1  99 ILE HB   H  -2.517  -0.894 -11.918 1.00 . A A .  99 ILE HB   1 1 
        2  3943 1 1  99 ILE HD11 H  -0.129  -0.814 -12.087 1.00 . A A .  99 ILE HD11 1 1 
        2  3944 1 1  99 ILE HD12 H   0.709   0.611 -12.703 1.00 . A A .  99 ILE HD12 1 1 
        2  3945 1 1  99 ILE HD13 H  -0.258  -0.385 -13.792 1.00 . A A .  99 ILE HD13 1 1 
        2  3946 1 1  99 ILE HG12 H  -1.495   1.648 -13.215 1.00 . A A .  99 ILE HG12 1 1 
        2  3947 1 1  99 ILE HG13 H  -1.305   1.296 -11.497 1.00 . A A .  99 ILE HG13 1 1 
        2  3948 1 1  99 ILE HG21 H  -2.060  -0.727 -14.449 1.00 . A A .  99 ILE HG21 1 1 
        2  3949 1 1  99 ILE HG22 H  -3.397   0.422 -14.493 1.00 . A A .  99 ILE HG22 1 1 
        2  3950 1 1  99 ILE HG23 H  -3.676  -1.237 -13.963 1.00 . A A .  99 ILE HG23 1 1 
        2  3951 1 1  99 ILE N    N  -3.573   1.098 -10.515 1.00 . A A .  99 ILE N    1 1 
        2  3952 1 1  99 ILE O    O  -5.324  -0.997 -11.388 1.00 . A A .  99 ILE O    1 1 
        2  3953 1 1 100 GLU C    C  -7.206  -1.381 -14.124 1.00 . A A . 100 GLU C    1 1 
        2  3954 1 1 100 GLU CA   C  -7.323  -0.289 -13.063 1.00 . A A . 100 GLU CA   1 1 
        2  3955 1 1 100 GLU CB   C  -8.395   0.716 -13.482 1.00 . A A . 100 GLU CB   1 1 
        2  3956 1 1 100 GLU CD   C  -9.242   0.978 -11.139 1.00 . A A . 100 GLU CD   1 1 
        2  3957 1 1 100 GLU CG   C  -8.642   1.709 -12.342 1.00 . A A . 100 GLU CG   1 1 
        2  3958 1 1 100 GLU H    H  -5.850   1.235 -13.435 1.00 . A A . 100 GLU H    1 1 
        2  3959 1 1 100 GLU HA   H  -7.603  -0.742 -12.121 1.00 . A A . 100 GLU HA   1 1 
        2  3960 1 1 100 GLU HB2  H  -8.060   1.250 -14.359 1.00 . A A . 100 GLU HB2  1 1 
        2  3961 1 1 100 GLU HB3  H  -9.312   0.193 -13.707 1.00 . A A . 100 GLU HB3  1 1 
        2  3962 1 1 100 GLU HG2  H  -7.705   2.164 -12.055 1.00 . A A . 100 GLU HG2  1 1 
        2  3963 1 1 100 GLU HG3  H  -9.326   2.474 -12.674 1.00 . A A . 100 GLU HG3  1 1 
        2  3964 1 1 100 GLU N    N  -6.025   0.425 -12.909 1.00 . A A . 100 GLU N    1 1 
        2  3965 1 1 100 GLU O    O  -6.635  -1.184 -15.176 1.00 . A A . 100 GLU O    1 1 
        2  3966 1 1 100 GLU OE1  O -10.226   0.280 -11.327 1.00 . A A . 100 GLU OE1  1 1 
        2  3967 1 1 100 GLU OE2  O  -8.707   1.126 -10.053 1.00 . A A . 100 GLU OE2  1 1 
        2  3968 1 1 101 GLN C    C  -9.072  -4.346 -14.866 1.00 . A A . 101 GLN C    1 1 
        2  3969 1 1 101 GLN CA   C  -7.706  -3.656 -14.836 1.00 . A A . 101 GLN CA   1 1 
        2  3970 1 1 101 GLN CB   C  -6.612  -4.647 -14.427 1.00 . A A . 101 GLN CB   1 1 
        2  3971 1 1 101 GLN CD   C  -4.140  -4.932 -14.149 1.00 . A A . 101 GLN CD   1 1 
        2  3972 1 1 101 GLN CG   C  -5.243  -3.991 -14.634 1.00 . A A . 101 GLN CG   1 1 
        2  3973 1 1 101 GLN H    H  -8.218  -2.662 -12.997 1.00 . A A . 101 GLN H    1 1 
        2  3974 1 1 101 GLN HA   H  -7.488  -3.272 -15.823 1.00 . A A . 101 GLN HA   1 1 
        2  3975 1 1 101 GLN HB2  H  -6.735  -4.911 -13.387 1.00 . A A . 101 GLN HB2  1 1 
        2  3976 1 1 101 GLN HB3  H  -6.681  -5.535 -15.037 1.00 . A A . 101 GLN HB3  1 1 
        2  3977 1 1 101 GLN HE21 H  -2.679  -3.631 -14.504 1.00 . A A . 101 GLN HE21 1 1 
        2  3978 1 1 101 GLN HE22 H  -2.183  -5.123 -13.865 1.00 . A A . 101 GLN HE22 1 1 
        2  3979 1 1 101 GLN HG2  H  -5.102  -3.783 -15.686 1.00 . A A . 101 GLN HG2  1 1 
        2  3980 1 1 101 GLN HG3  H  -5.198  -3.068 -14.078 1.00 . A A . 101 GLN HG3  1 1 
        2  3981 1 1 101 GLN N    N  -7.757  -2.536 -13.854 1.00 . A A . 101 GLN N    1 1 
        2  3982 1 1 101 GLN NE2  N  -2.898  -4.530 -14.175 1.00 . A A . 101 GLN NE2  1 1 
        2  3983 1 1 101 GLN O    O  -9.182  -5.530 -15.115 1.00 . A A . 101 GLN O    1 1 
        2  3984 1 1 101 GLN OE1  O  -4.409  -6.045 -13.742 1.00 . A A . 101 GLN OE1  1 1 
        2  3985 1 1 102 GLY C    C -11.784  -4.928 -13.351 1.00 . A A . 102 GLY C    1 1 
        2  3986 1 1 102 GLY CA   C -11.490  -4.171 -14.649 1.00 . A A . 102 GLY CA   1 1 
        2  3987 1 1 102 GLY H    H  -9.994  -2.641 -14.436 1.00 . A A . 102 GLY H    1 1 
        2  3988 1 1 102 GLY HA2  H -12.210  -3.374 -14.768 1.00 . A A . 102 GLY HA2  1 1 
        2  3989 1 1 102 GLY HA3  H -11.574  -4.853 -15.482 1.00 . A A . 102 GLY HA3  1 1 
        2  3990 1 1 102 GLY N    N -10.116  -3.595 -14.623 1.00 . A A . 102 GLY N    1 1 
        2  3991 1 1 102 GLY O    O -10.890  -5.279 -12.608 1.00 . A A . 102 GLY O    1 1 
        2  3992 1 1 103 GLY C    C -12.610  -5.490 -10.659 1.00 . A A . 103 GLY C    1 1 
        2  3993 1 1 103 GLY CA   C -13.435  -5.944 -11.861 1.00 . A A . 103 GLY CA   1 1 
        2  3994 1 1 103 GLY H    H -13.733  -4.902 -13.723 1.00 . A A . 103 GLY H    1 1 
        2  3995 1 1 103 GLY HA2  H -14.482  -5.766 -11.659 1.00 . A A . 103 GLY HA2  1 1 
        2  3996 1 1 103 GLY HA3  H -13.279  -7.001 -12.021 1.00 . A A . 103 GLY HA3  1 1 
        2  3997 1 1 103 GLY N    N -13.040  -5.192 -13.092 1.00 . A A . 103 GLY N    1 1 
        2  3998 1 1 103 GLY O    O -12.938  -4.526  -9.995 1.00 . A A . 103 GLY O    1 1 
        2  3999 1 1 104 GLY C    C  -9.745  -4.690  -9.577 1.00 . A A . 104 GLY C    1 1 
        2  4000 1 1 104 GLY CA   C -10.707  -5.807  -9.187 1.00 . A A . 104 GLY CA   1 1 
        2  4001 1 1 104 GLY H    H -11.306  -6.969 -10.901 1.00 . A A . 104 GLY H    1 1 
        2  4002 1 1 104 GLY HA2  H -11.345  -5.462  -8.387 1.00 . A A . 104 GLY HA2  1 1 
        2  4003 1 1 104 GLY HA3  H -10.143  -6.664  -8.854 1.00 . A A . 104 GLY HA3  1 1 
        2  4004 1 1 104 GLY N    N -11.547  -6.188 -10.359 1.00 . A A . 104 GLY N    1 1 
        2  4005 1 1 104 GLY O    O  -9.673  -4.291 -10.722 1.00 . A A . 104 GLY O    1 1 
        2  4006 1 1 105 THR C    C  -6.634  -3.527  -8.478 1.00 . A A . 105 THR C    1 1 
        2  4007 1 1 105 THR CA   C  -8.031  -3.081  -8.904 1.00 . A A . 105 THR CA   1 1 
        2  4008 1 1 105 THR CB   C  -8.439  -1.839  -8.108 1.00 . A A . 105 THR CB   1 1 
        2  4009 1 1 105 THR CG2  C  -7.401  -0.735  -8.315 1.00 . A A . 105 THR CG2  1 1 
        2  4010 1 1 105 THR H    H  -9.091  -4.529  -7.712 1.00 . A A . 105 THR H    1 1 
        2  4011 1 1 105 THR HA   H  -8.024  -2.843  -9.961 1.00 . A A . 105 THR HA   1 1 
        2  4012 1 1 105 THR HB   H  -8.493  -2.084  -7.058 1.00 . A A . 105 THR HB   1 1 
        2  4013 1 1 105 THR HG1  H -10.284  -1.311  -7.792 1.00 . A A . 105 THR HG1  1 1 
        2  4014 1 1 105 THR HG21 H  -7.186  -0.636  -9.367 1.00 . A A . 105 THR HG21 1 1 
        2  4015 1 1 105 THR HG22 H  -6.496  -0.990  -7.784 1.00 . A A . 105 THR HG22 1 1 
        2  4016 1 1 105 THR HG23 H  -7.789   0.199  -7.936 1.00 . A A . 105 THR HG23 1 1 
        2  4017 1 1 105 THR N    N  -9.005  -4.182  -8.625 1.00 . A A . 105 THR N    1 1 
        2  4018 1 1 105 THR O    O  -6.435  -4.015  -7.383 1.00 . A A . 105 THR O    1 1 
        2  4019 1 1 105 THR OG1  O  -9.710  -1.387  -8.557 1.00 . A A . 105 THR OG1  1 1 
        2  4020 1 1 106 LEU C    C  -3.600  -2.644  -8.210 1.00 . A A . 106 LEU C    1 1 
        2  4021 1 1 106 LEU CA   C  -4.274  -3.774  -8.981 1.00 . A A . 106 LEU CA   1 1 
        2  4022 1 1 106 LEU CB   C  -3.490  -4.053 -10.267 1.00 . A A . 106 LEU CB   1 1 
        2  4023 1 1 106 LEU CD1  C  -1.918  -5.534  -8.961 1.00 . A A . 106 LEU CD1  1 1 
        2  4024 1 1 106 LEU CD2  C  -1.294  -4.712 -11.248 1.00 . A A . 106 LEU CD2  1 1 
        2  4025 1 1 106 LEU CG   C  -2.018  -4.358  -9.946 1.00 . A A . 106 LEU CG   1 1 
        2  4026 1 1 106 LEU H    H  -5.846  -2.965 -10.211 1.00 . A A . 106 LEU H    1 1 
        2  4027 1 1 106 LEU HA   H  -4.301  -4.666  -8.370 1.00 . A A . 106 LEU HA   1 1 
        2  4028 1 1 106 LEU HB2  H  -3.927  -4.900 -10.775 1.00 . A A . 106 LEU HB2  1 1 
        2  4029 1 1 106 LEU HB3  H  -3.540  -3.186 -10.908 1.00 . A A . 106 LEU HB3  1 1 
        2  4030 1 1 106 LEU HD11 H  -2.681  -6.266  -9.188 1.00 . A A . 106 LEU HD11 1 1 
        2  4031 1 1 106 LEU HD12 H  -2.059  -5.170  -7.954 1.00 . A A . 106 LEU HD12 1 1 
        2  4032 1 1 106 LEU HD13 H  -0.944  -5.994  -9.040 1.00 . A A . 106 LEU HD13 1 1 
        2  4033 1 1 106 LEU HD21 H  -1.215  -3.829 -11.866 1.00 . A A . 106 LEU HD21 1 1 
        2  4034 1 1 106 LEU HD22 H  -1.854  -5.470 -11.775 1.00 . A A . 106 LEU HD22 1 1 
        2  4035 1 1 106 LEU HD23 H  -0.306  -5.084 -11.022 1.00 . A A . 106 LEU HD23 1 1 
        2  4036 1 1 106 LEU HG   H  -1.554  -3.486  -9.510 1.00 . A A . 106 LEU HG   1 1 
        2  4037 1 1 106 LEU N    N  -5.662  -3.362  -9.333 1.00 . A A . 106 LEU N    1 1 
        2  4038 1 1 106 LEU O    O  -3.589  -1.510  -8.645 1.00 . A A . 106 LEU O    1 1 
        2  4039 1 1 107 LEU C    C  -0.843  -2.201  -6.228 1.00 . A A . 107 LEU C    1 1 
        2  4040 1 1 107 LEU CA   C  -2.337  -1.898  -6.262 1.00 . A A . 107 LEU CA   1 1 
        2  4041 1 1 107 LEU CB   C  -2.902  -1.916  -4.834 1.00 . A A . 107 LEU CB   1 1 
        2  4042 1 1 107 LEU CD1  C  -3.391  -0.153  -3.091 1.00 . A A . 107 LEU CD1  1 1 
        2  4043 1 1 107 LEU CD2  C  -1.162  -1.261  -3.110 1.00 . A A . 107 LEU CD2  1 1 
        2  4044 1 1 107 LEU CG   C  -2.309  -0.749  -3.995 1.00 . A A . 107 LEU CG   1 1 
        2  4045 1 1 107 LEU H    H  -3.047  -3.873  -6.752 1.00 . A A . 107 LEU H    1 1 
        2  4046 1 1 107 LEU HA   H  -2.493  -0.920  -6.698 1.00 . A A . 107 LEU HA   1 1 
        2  4047 1 1 107 LEU HB2  H  -3.979  -1.818  -4.889 1.00 . A A . 107 LEU HB2  1 1 
        2  4048 1 1 107 LEU HB3  H  -2.660  -2.861  -4.368 1.00 . A A . 107 LEU HB3  1 1 
        2  4049 1 1 107 LEU HD11 H  -4.146   0.317  -3.703 1.00 . A A . 107 LEU HD11 1 1 
        2  4050 1 1 107 LEU HD12 H  -2.950   0.582  -2.436 1.00 . A A . 107 LEU HD12 1 1 
        2  4051 1 1 107 LEU HD13 H  -3.842  -0.937  -2.503 1.00 . A A . 107 LEU HD13 1 1 
        2  4052 1 1 107 LEU HD21 H  -1.533  -2.041  -2.461 1.00 . A A . 107 LEU HD21 1 1 
        2  4053 1 1 107 LEU HD22 H  -0.780  -0.446  -2.512 1.00 . A A . 107 LEU HD22 1 1 
        2  4054 1 1 107 LEU HD23 H  -0.372  -1.654  -3.730 1.00 . A A . 107 LEU HD23 1 1 
        2  4055 1 1 107 LEU HG   H  -1.934   0.027  -4.651 1.00 . A A . 107 LEU HG   1 1 
        2  4056 1 1 107 LEU N    N  -3.028  -2.947  -7.073 1.00 . A A . 107 LEU N    1 1 
        2  4057 1 1 107 LEU O    O  -0.423  -3.258  -5.802 1.00 . A A . 107 LEU O    1 1 
        2  4058 1 1 108 ARG C    C   2.051  -0.669  -5.532 1.00 . A A . 108 ARG C    1 1 
        2  4059 1 1 108 ARG CA   C   1.444  -1.484  -6.666 1.00 . A A . 108 ARG CA   1 1 
        2  4060 1 1 108 ARG CB   C   2.029  -1.019  -7.998 1.00 . A A . 108 ARG CB   1 1 
        2  4061 1 1 108 ARG CD   C   2.178  -1.529 -10.436 1.00 . A A . 108 ARG CD   1 1 
        2  4062 1 1 108 ARG CG   C   1.615  -1.996  -9.096 1.00 . A A . 108 ARG CG   1 1 
        2  4063 1 1 108 ARG CZ   C   2.440  -3.561 -11.740 1.00 . A A . 108 ARG CZ   1 1 
        2  4064 1 1 108 ARG H    H  -0.403  -0.431  -7.007 1.00 . A A . 108 ARG H    1 1 
        2  4065 1 1 108 ARG HA   H   1.674  -2.533  -6.522 1.00 . A A . 108 ARG HA   1 1 
        2  4066 1 1 108 ARG HB2  H   1.653  -0.033  -8.231 1.00 . A A . 108 ARG HB2  1 1 
        2  4067 1 1 108 ARG HB3  H   3.106  -0.987  -7.930 1.00 . A A . 108 ARG HB3  1 1 
        2  4068 1 1 108 ARG HD2  H   1.803  -0.542 -10.658 1.00 . A A . 108 ARG HD2  1 1 
        2  4069 1 1 108 ARG HD3  H   3.257  -1.502 -10.386 1.00 . A A . 108 ARG HD3  1 1 
        2  4070 1 1 108 ARG HE   H   0.939  -2.294 -12.022 1.00 . A A . 108 ARG HE   1 1 
        2  4071 1 1 108 ARG HG2  H   2.002  -2.977  -8.863 1.00 . A A . 108 ARG HG2  1 1 
        2  4072 1 1 108 ARG HG3  H   0.539  -2.038  -9.152 1.00 . A A . 108 ARG HG3  1 1 
        2  4073 1 1 108 ARG HH11 H   3.816  -3.189 -10.330 1.00 . A A . 108 ARG HH11 1 1 
        2  4074 1 1 108 ARG HH12 H   4.045  -4.647 -11.236 1.00 . A A . 108 ARG HH12 1 1 
        2  4075 1 1 108 ARG HH21 H   1.225  -4.194 -13.201 1.00 . A A . 108 ARG HH21 1 1 
        2  4076 1 1 108 ARG HH22 H   2.581  -5.215 -12.858 1.00 . A A . 108 ARG HH22 1 1 
        2  4077 1 1 108 ARG N    N  -0.035  -1.275  -6.673 1.00 . A A . 108 ARG N    1 1 
        2  4078 1 1 108 ARG NE   N   1.747  -2.480 -11.501 1.00 . A A . 108 ARG NE   1 1 
        2  4079 1 1 108 ARG NH1  N   3.517  -3.819 -11.047 1.00 . A A . 108 ARG NH1  1 1 
        2  4080 1 1 108 ARG NH2  N   2.052  -4.389 -12.672 1.00 . A A . 108 ARG NH2  1 1 
        2  4081 1 1 108 ARG O    O   1.769   0.505  -5.383 1.00 . A A . 108 ARG O    1 1 
        2  4082 1 1 109 LEU C    C   5.030  -0.503  -3.839 1.00 . A A . 109 LEU C    1 1 
        2  4083 1 1 109 LEU CA   C   3.524  -0.563  -3.595 1.00 . A A . 109 LEU CA   1 1 
        2  4084 1 1 109 LEU CB   C   3.259  -1.331  -2.292 1.00 . A A . 109 LEU CB   1 1 
        2  4085 1 1 109 LEU CD1  C   2.279   0.376  -0.711 1.00 . A A . 109 LEU CD1  1 1 
        2  4086 1 1 109 LEU CD2  C   3.989  -1.259   0.119 1.00 . A A . 109 LEU CD2  1 1 
        2  4087 1 1 109 LEU CG   C   3.546  -0.414  -1.081 1.00 . A A . 109 LEU CG   1 1 
        2  4088 1 1 109 LEU H    H   3.090  -2.232  -4.885 1.00 . A A . 109 LEU H    1 1 
        2  4089 1 1 109 LEU HA   H   3.129   0.443  -3.509 1.00 . A A . 109 LEU HA   1 1 
        2  4090 1 1 109 LEU HB2  H   2.227  -1.657  -2.271 1.00 . A A . 109 LEU HB2  1 1 
        2  4091 1 1 109 LEU HB3  H   3.906  -2.197  -2.252 1.00 . A A . 109 LEU HB3  1 1 
        2  4092 1 1 109 LEU HD11 H   2.559   1.272  -0.178 1.00 . A A . 109 LEU HD11 1 1 
        2  4093 1 1 109 LEU HD12 H   1.639  -0.230  -0.084 1.00 . A A . 109 LEU HD12 1 1 
        2  4094 1 1 109 LEU HD13 H   1.746   0.644  -1.610 1.00 . A A . 109 LEU HD13 1 1 
        2  4095 1 1 109 LEU HD21 H   3.228  -1.990   0.345 1.00 . A A . 109 LEU HD21 1 1 
        2  4096 1 1 109 LEU HD22 H   4.138  -0.615   0.971 1.00 . A A . 109 LEU HD22 1 1 
        2  4097 1 1 109 LEU HD23 H   4.914  -1.763  -0.119 1.00 . A A . 109 LEU HD23 1 1 
        2  4098 1 1 109 LEU HG   H   4.332   0.286  -1.332 1.00 . A A . 109 LEU HG   1 1 
        2  4099 1 1 109 LEU N    N   2.883  -1.286  -4.734 1.00 . A A . 109 LEU N    1 1 
        2  4100 1 1 109 LEU O    O   5.670  -1.514  -4.046 1.00 . A A . 109 LEU O    1 1 
        2  4101 1 1 110 THR C    C   7.684   1.543  -2.850 1.00 . A A . 110 THR C    1 1 
        2  4102 1 1 110 THR CA   C   7.071   0.817  -4.042 1.00 . A A . 110 THR CA   1 1 
        2  4103 1 1 110 THR CB   C   7.311   1.637  -5.311 1.00 . A A . 110 THR CB   1 1 
        2  4104 1 1 110 THR CG2  C   8.812   1.843  -5.517 1.00 . A A . 110 THR CG2  1 1 
        2  4105 1 1 110 THR H    H   5.056   1.468  -3.644 1.00 . A A . 110 THR H    1 1 
        2  4106 1 1 110 THR HA   H   7.538  -0.155  -4.149 1.00 . A A . 110 THR HA   1 1 
        2  4107 1 1 110 THR HB   H   6.832   2.600  -5.211 1.00 . A A . 110 THR HB   1 1 
        2  4108 1 1 110 THR HG1  H   7.250   1.215  -7.208 1.00 . A A . 110 THR HG1  1 1 
        2  4109 1 1 110 THR HG21 H   9.166   2.611  -4.845 1.00 . A A . 110 THR HG21 1 1 
        2  4110 1 1 110 THR HG22 H   8.997   2.146  -6.537 1.00 . A A . 110 THR HG22 1 1 
        2  4111 1 1 110 THR HG23 H   9.336   0.921  -5.315 1.00 . A A . 110 THR HG23 1 1 
        2  4112 1 1 110 THR N    N   5.599   0.672  -3.817 1.00 . A A . 110 THR N    1 1 
        2  4113 1 1 110 THR O    O   7.230   2.599  -2.461 1.00 . A A . 110 THR O    1 1 
        2  4114 1 1 110 THR OG1  O   6.763   0.948  -6.425 1.00 . A A . 110 THR OG1  1 1 
        2  4115 1 1 111 HIS C    C  10.874   1.576  -1.249 1.00 . A A . 111 HIS C    1 1 
        2  4116 1 1 111 HIS CA   C   9.357   1.643  -1.086 1.00 . A A . 111 HIS CA   1 1 
        2  4117 1 1 111 HIS CB   C   8.956   0.904   0.192 1.00 . A A . 111 HIS CB   1 1 
        2  4118 1 1 111 HIS CD2  C  10.562   1.922   2.004 1.00 . A A . 111 HIS CD2  1 1 
        2  4119 1 1 111 HIS CE1  C   9.105   3.111   3.079 1.00 . A A . 111 HIS CE1  1 1 
        2  4120 1 1 111 HIS CG   C   9.352   1.725   1.386 1.00 . A A . 111 HIS CG   1 1 
        2  4121 1 1 111 HIS H    H   9.056   0.130  -2.594 1.00 . A A . 111 HIS H    1 1 
        2  4122 1 1 111 HIS HA   H   9.050   2.679  -1.015 1.00 . A A . 111 HIS HA   1 1 
        2  4123 1 1 111 HIS HB2  H   7.887   0.750   0.198 1.00 . A A . 111 HIS HB2  1 1 
        2  4124 1 1 111 HIS HB3  H   9.460  -0.049   0.228 1.00 . A A . 111 HIS HB3  1 1 
        2  4125 1 1 111 HIS HD1  H   7.479   2.570   1.898 1.00 . A A . 111 HIS HD1  1 1 
        2  4126 1 1 111 HIS HD2  H  11.494   1.468   1.703 1.00 . A A . 111 HIS HD2  1 1 
        2  4127 1 1 111 HIS HE1  H   8.646   3.780   3.792 1.00 . A A . 111 HIS HE1  1 1 
        2  4128 1 1 111 HIS N    N   8.709   0.987  -2.264 1.00 . A A . 111 HIS N    1 1 
        2  4129 1 1 111 HIS ND1  N   8.437   2.492   2.089 1.00 . A A . 111 HIS ND1  1 1 
        2  4130 1 1 111 HIS NE2  N  10.403   2.796   3.073 1.00 . A A . 111 HIS NE2  1 1 
        2  4131 1 1 111 HIS O    O  11.414   0.580  -1.684 1.00 . A A . 111 HIS O    1 1 
        2  4132 1 1 112 SER C    C  13.676   3.309   0.186 1.00 . A A . 112 SER C    1 1 
        2  4133 1 1 112 SER CA   C  13.059   2.631  -1.039 1.00 . A A . 112 SER CA   1 1 
        2  4134 1 1 112 SER CB   C  13.453   3.405  -2.295 1.00 . A A . 112 SER CB   1 1 
        2  4135 1 1 112 SER H    H  11.108   3.427  -0.557 1.00 . A A . 112 SER H    1 1 
        2  4136 1 1 112 SER HA   H  13.429   1.617  -1.110 1.00 . A A . 112 SER HA   1 1 
        2  4137 1 1 112 SER HB2  H  14.436   3.101  -2.618 1.00 . A A . 112 SER HB2  1 1 
        2  4138 1 1 112 SER HB3  H  12.738   3.200  -3.081 1.00 . A A . 112 SER HB3  1 1 
        2  4139 1 1 112 SER HG   H  14.145   5.206  -2.543 1.00 . A A . 112 SER HG   1 1 
        2  4140 1 1 112 SER N    N  11.568   2.631  -0.904 1.00 . A A . 112 SER N    1 1 
        2  4141 1 1 112 SER O    O  13.034   4.089   0.862 1.00 . A A . 112 SER O    1 1 
        2  4142 1 1 112 SER OG   O  13.467   4.796  -2.001 1.00 . A A . 112 SER OG   1 1 
        2  4143 1 1 113 GLY C    C  15.918   2.557   2.696 1.00 . A A . 113 GLY C    1 1 
        2  4144 1 1 113 GLY CA   C  15.607   3.635   1.652 1.00 . A A . 113 GLY CA   1 1 
        2  4145 1 1 113 GLY H    H  15.413   2.383  -0.095 1.00 . A A . 113 GLY H    1 1 
        2  4146 1 1 113 GLY HA2  H  16.531   4.091   1.328 1.00 . A A . 113 GLY HA2  1 1 
        2  4147 1 1 113 GLY HA3  H  14.978   4.388   2.098 1.00 . A A . 113 GLY HA3  1 1 
        2  4148 1 1 113 GLY N    N  14.922   3.015   0.472 1.00 . A A . 113 GLY N    1 1 
        2  4149 1 1 113 GLY O    O  16.724   1.677   2.474 1.00 . A A . 113 GLY O    1 1 
        2  4150 1 1 114 LEU C    C  17.057   1.477   5.127 1.00 . A A . 114 LEU C    1 1 
        2  4151 1 1 114 LEU CA   C  15.547   1.611   4.898 1.00 . A A . 114 LEU CA   1 1 
        2  4152 1 1 114 LEU CB   C  14.969   0.255   4.480 1.00 . A A . 114 LEU CB   1 1 
        2  4153 1 1 114 LEU CD1  C  12.913  -0.906   3.638 1.00 . A A . 114 LEU CD1  1 1 
        2  4154 1 1 114 LEU CD2  C  12.720   1.326   4.752 1.00 . A A . 114 LEU CD2  1 1 
        2  4155 1 1 114 LEU CG   C  13.591   0.454   3.840 1.00 . A A . 114 LEU CG   1 1 
        2  4156 1 1 114 LEU H    H  14.643   3.345   3.996 1.00 . A A . 114 LEU H    1 1 
        2  4157 1 1 114 LEU HA   H  15.076   1.928   5.818 1.00 . A A . 114 LEU HA   1 1 
        2  4158 1 1 114 LEU HB2  H  15.632  -0.218   3.770 1.00 . A A . 114 LEU HB2  1 1 
        2  4159 1 1 114 LEU HB3  H  14.867  -0.375   5.352 1.00 . A A . 114 LEU HB3  1 1 
        2  4160 1 1 114 LEU HD11 H  13.632  -1.617   3.257 1.00 . A A . 114 LEU HD11 1 1 
        2  4161 1 1 114 LEU HD12 H  12.102  -0.803   2.933 1.00 . A A . 114 LEU HD12 1 1 
        2  4162 1 1 114 LEU HD13 H  12.525  -1.259   4.582 1.00 . A A . 114 LEU HD13 1 1 
        2  4163 1 1 114 LEU HD21 H  11.687   1.249   4.447 1.00 . A A . 114 LEU HD21 1 1 
        2  4164 1 1 114 LEU HD22 H  13.041   2.354   4.678 1.00 . A A . 114 LEU HD22 1 1 
        2  4165 1 1 114 LEU HD23 H  12.820   0.989   5.773 1.00 . A A . 114 LEU HD23 1 1 
        2  4166 1 1 114 LEU HG   H  13.708   0.940   2.881 1.00 . A A . 114 LEU HG   1 1 
        2  4167 1 1 114 LEU N    N  15.286   2.623   3.837 1.00 . A A . 114 LEU N    1 1 
        2  4168 1 1 114 LEU O    O  17.676   0.525   4.692 1.00 . A A . 114 LEU O    1 1 
        2  4169 1 1 115 PRO C    C  19.494   1.157   6.923 1.00 . A A . 115 PRO C    1 1 
        2  4170 1 1 115 PRO CA   C  19.096   2.412   6.137 1.00 . A A . 115 PRO CA   1 1 
        2  4171 1 1 115 PRO CB   C  19.298   3.679   6.997 1.00 . A A . 115 PRO CB   1 1 
        2  4172 1 1 115 PRO CD   C  16.971   3.613   6.369 1.00 . A A . 115 PRO CD   1 1 
        2  4173 1 1 115 PRO CG   C  18.133   4.558   6.668 1.00 . A A . 115 PRO CG   1 1 
        2  4174 1 1 115 PRO HA   H  19.677   2.489   5.233 1.00 . A A . 115 PRO HA   1 1 
        2  4175 1 1 115 PRO HB2  H  19.297   3.429   8.051 1.00 . A A . 115 PRO HB2  1 1 
        2  4176 1 1 115 PRO HB3  H  20.222   4.174   6.730 1.00 . A A . 115 PRO HB3  1 1 
        2  4177 1 1 115 PRO HD2  H  16.435   3.369   7.277 1.00 . A A . 115 PRO HD2  1 1 
        2  4178 1 1 115 PRO HD3  H  16.308   4.040   5.636 1.00 . A A . 115 PRO HD3  1 1 
        2  4179 1 1 115 PRO HG2  H  17.894   5.193   7.513 1.00 . A A . 115 PRO HG2  1 1 
        2  4180 1 1 115 PRO HG3  H  18.346   5.158   5.798 1.00 . A A . 115 PRO HG3  1 1 
        2  4181 1 1 115 PRO N    N  17.638   2.420   5.821 1.00 . A A . 115 PRO N    1 1 
        2  4182 1 1 115 PRO O    O  20.643   0.765   6.939 1.00 . A A . 115 PRO O    1 1 
        2  4183 1 1 116 SER C    C  18.298  -1.928   7.682 1.00 . A A . 116 SER C    1 1 
        2  4184 1 1 116 SER CA   C  18.853  -0.688   8.386 1.00 . A A . 116 SER CA   1 1 
        2  4185 1 1 116 SER CB   C  18.194  -0.553   9.757 1.00 . A A . 116 SER CB   1 1 
        2  4186 1 1 116 SER H    H  17.630   0.881   7.555 1.00 . A A . 116 SER H    1 1 
        2  4187 1 1 116 SER HA   H  19.923  -0.796   8.515 1.00 . A A . 116 SER HA   1 1 
        2  4188 1 1 116 SER HB2  H  18.201  -1.506  10.259 1.00 . A A . 116 SER HB2  1 1 
        2  4189 1 1 116 SER HB3  H  18.742   0.168  10.348 1.00 . A A . 116 SER HB3  1 1 
        2  4190 1 1 116 SER HG   H  16.270  -0.842   9.854 1.00 . A A . 116 SER HG   1 1 
        2  4191 1 1 116 SER N    N  18.547   0.536   7.582 1.00 . A A . 116 SER N    1 1 
        2  4192 1 1 116 SER O    O  17.173  -1.951   7.222 1.00 . A A . 116 SER O    1 1 
        2  4193 1 1 116 SER OG   O  16.848  -0.122   9.589 1.00 . A A . 116 SER OG   1 1 
        2  4194 1 1 117 ALA C    C  17.537  -4.877   7.765 1.00 . A A . 117 ALA C    1 1 
        2  4195 1 1 117 ALA CA   C  18.642  -4.215   6.940 1.00 . A A . 117 ALA CA   1 1 
        2  4196 1 1 117 ALA CB   C  19.833  -5.167   6.824 1.00 . A A . 117 ALA CB   1 1 
        2  4197 1 1 117 ALA H    H  19.988  -2.911   7.986 1.00 . A A . 117 ALA H    1 1 
        2  4198 1 1 117 ALA HA   H  18.268  -3.989   5.952 1.00 . A A . 117 ALA HA   1 1 
        2  4199 1 1 117 ALA HB1  H  19.579  -5.986   6.169 1.00 . A A . 117 ALA HB1  1 1 
        2  4200 1 1 117 ALA HB2  H  20.083  -5.549   7.803 1.00 . A A . 117 ALA HB2  1 1 
        2  4201 1 1 117 ALA HB3  H  20.681  -4.632   6.420 1.00 . A A . 117 ALA HB3  1 1 
        2  4202 1 1 117 ALA N    N  19.089  -2.960   7.603 1.00 . A A . 117 ALA N    1 1 
        2  4203 1 1 117 ALA O    O  16.622  -5.472   7.228 1.00 . A A . 117 ALA O    1 1 
        2  4204 1 1 118 GLU C    C  15.209  -4.853   9.565 1.00 . A A . 118 GLU C    1 1 
        2  4205 1 1 118 GLU CA   C  16.581  -5.420   9.924 1.00 . A A . 118 GLU CA   1 1 
        2  4206 1 1 118 GLU CB   C  16.891  -5.117  11.391 1.00 . A A . 118 GLU CB   1 1 
        2  4207 1 1 118 GLU CD   C  16.233  -5.576  13.753 1.00 . A A . 118 GLU CD   1 1 
        2  4208 1 1 118 GLU CG   C  15.889  -5.847  12.287 1.00 . A A . 118 GLU CG   1 1 
        2  4209 1 1 118 GLU H    H  18.369  -4.307   9.475 1.00 . A A . 118 GLU H    1 1 
        2  4210 1 1 118 GLU HA   H  16.584  -6.488   9.766 1.00 . A A . 118 GLU HA   1 1 
        2  4211 1 1 118 GLU HB2  H  17.892  -5.450  11.622 1.00 . A A . 118 GLU HB2  1 1 
        2  4212 1 1 118 GLU HB3  H  16.816  -4.055  11.564 1.00 . A A . 118 GLU HB3  1 1 
        2  4213 1 1 118 GLU HG2  H  14.891  -5.491  12.078 1.00 . A A . 118 GLU HG2  1 1 
        2  4214 1 1 118 GLU HG3  H  15.943  -6.908  12.097 1.00 . A A . 118 GLU HG3  1 1 
        2  4215 1 1 118 GLU N    N  17.619  -4.787   9.064 1.00 . A A . 118 GLU N    1 1 
        2  4216 1 1 118 GLU O    O  14.237  -5.576   9.462 1.00 . A A . 118 GLU O    1 1 
        2  4217 1 1 118 GLU OE1  O  17.040  -4.696  13.997 1.00 . A A . 118 GLU OE1  1 1 
        2  4218 1 1 118 GLU OE2  O  15.684  -6.255  14.606 1.00 . A A . 118 GLU OE2  1 1 
        2  4219 1 1 119 GLN C    C  13.374  -3.466   7.635 1.00 . A A . 119 GLN C    1 1 
        2  4220 1 1 119 GLN CA   C  13.812  -2.960   9.012 1.00 . A A . 119 GLN CA   1 1 
        2  4221 1 1 119 GLN CB   C  13.955  -1.438   8.989 1.00 . A A . 119 GLN CB   1 1 
        2  4222 1 1 119 GLN CD   C  12.725   0.719   8.820 1.00 . A A . 119 GLN CD   1 1 
        2  4223 1 1 119 GLN CG   C  12.607  -0.796   8.668 1.00 . A A . 119 GLN CG   1 1 
        2  4224 1 1 119 GLN H    H  15.917  -3.005   9.451 1.00 . A A . 119 GLN H    1 1 
        2  4225 1 1 119 GLN HA   H  13.072  -3.241   9.748 1.00 . A A . 119 GLN HA   1 1 
        2  4226 1 1 119 GLN HB2  H  14.294  -1.097   9.956 1.00 . A A . 119 GLN HB2  1 1 
        2  4227 1 1 119 GLN HB3  H  14.675  -1.155   8.235 1.00 . A A . 119 GLN HB3  1 1 
        2  4228 1 1 119 GLN HE21 H  11.377   0.821  10.275 1.00 . A A . 119 GLN HE21 1 1 
        2  4229 1 1 119 GLN HE22 H  12.066   2.303   9.818 1.00 . A A . 119 GLN HE22 1 1 
        2  4230 1 1 119 GLN HG2  H  12.324  -1.038   7.654 1.00 . A A . 119 GLN HG2  1 1 
        2  4231 1 1 119 GLN HG3  H  11.858  -1.168   9.352 1.00 . A A . 119 GLN HG3  1 1 
        2  4232 1 1 119 GLN N    N  15.119  -3.569   9.368 1.00 . A A . 119 GLN N    1 1 
        2  4233 1 1 119 GLN NE2  N  11.995   1.332   9.712 1.00 . A A . 119 GLN NE2  1 1 
        2  4234 1 1 119 GLN O    O  12.204  -3.679   7.385 1.00 . A A . 119 GLN O    1 1 
        2  4235 1 1 119 GLN OE1  O  13.497   1.353   8.127 1.00 . A A . 119 GLN OE1  1 1 
        2  4236 1 1 120 CYS C    C  13.201  -5.486   5.501 1.00 . A A . 120 CYS C    1 1 
        2  4237 1 1 120 CYS CA   C  13.950  -4.155   5.381 1.00 . A A . 120 CYS CA   1 1 
        2  4238 1 1 120 CYS CB   C  15.240  -4.337   4.564 1.00 . A A . 120 CYS CB   1 1 
        2  4239 1 1 120 CYS H    H  15.244  -3.482   6.965 1.00 . A A . 120 CYS H    1 1 
        2  4240 1 1 120 CYS HA   H  13.314  -3.433   4.896 1.00 . A A . 120 CYS HA   1 1 
        2  4241 1 1 120 CYS HB2  H  15.999  -3.670   4.949 1.00 . A A . 120 CYS HB2  1 1 
        2  4242 1 1 120 CYS HB3  H  15.593  -5.357   4.643 1.00 . A A . 120 CYS HB3  1 1 
        2  4243 1 1 120 CYS HG   H  15.593  -3.308   2.542 1.00 . A A . 120 CYS HG   1 1 
        2  4244 1 1 120 CYS N    N  14.307  -3.660   6.741 1.00 . A A . 120 CYS N    1 1 
        2  4245 1 1 120 CYS O    O  12.176  -5.691   4.881 1.00 . A A . 120 CYS O    1 1 
        2  4246 1 1 120 CYS SG   S  14.925  -3.937   2.826 1.00 . A A . 120 CYS SG   1 1 
        2  4247 1 1 121 ALA C    C  11.666  -7.481   7.139 1.00 . A A . 121 ALA C    1 1 
        2  4248 1 1 121 ALA CA   C  13.020  -7.698   6.462 1.00 . A A . 121 ALA CA   1 1 
        2  4249 1 1 121 ALA CB   C  13.891  -8.607   7.327 1.00 . A A . 121 ALA CB   1 1 
        2  4250 1 1 121 ALA H    H  14.528  -6.199   6.792 1.00 . A A . 121 ALA H    1 1 
        2  4251 1 1 121 ALA HA   H  12.871  -8.153   5.494 1.00 . A A . 121 ALA HA   1 1 
        2  4252 1 1 121 ALA HB1  H  14.127  -8.105   8.253 1.00 . A A . 121 ALA HB1  1 1 
        2  4253 1 1 121 ALA HB2  H  14.804  -8.835   6.798 1.00 . A A . 121 ALA HB2  1 1 
        2  4254 1 1 121 ALA HB3  H  13.359  -9.523   7.538 1.00 . A A . 121 ALA HB3  1 1 
        2  4255 1 1 121 ALA N    N  13.703  -6.387   6.296 1.00 . A A . 121 ALA N    1 1 
        2  4256 1 1 121 ALA O    O  10.684  -8.114   6.802 1.00 . A A . 121 ALA O    1 1 
        2  4257 1 1 122 GLY C    C   9.315  -5.711   7.814 1.00 . A A . 122 GLY C    1 1 
        2  4258 1 1 122 GLY CA   C  10.313  -6.333   8.791 1.00 . A A . 122 GLY CA   1 1 
        2  4259 1 1 122 GLY H    H  12.406  -6.090   8.348 1.00 . A A . 122 GLY H    1 1 
        2  4260 1 1 122 GLY HA2  H   9.916  -7.267   9.165 1.00 . A A . 122 GLY HA2  1 1 
        2  4261 1 1 122 GLY HA3  H  10.478  -5.657   9.614 1.00 . A A . 122 GLY HA3  1 1 
        2  4262 1 1 122 GLY N    N  11.604  -6.591   8.093 1.00 . A A . 122 GLY N    1 1 
        2  4263 1 1 122 GLY O    O   8.133  -5.991   7.856 1.00 . A A . 122 GLY O    1 1 
        2  4264 1 1 123 HIS C    C   8.309  -5.273   5.006 1.00 . A A . 123 HIS C    1 1 
        2  4265 1 1 123 HIS CA   C   8.864  -4.210   5.961 1.00 . A A . 123 HIS CA   1 1 
        2  4266 1 1 123 HIS CB   C   9.661  -3.156   5.163 1.00 . A A . 123 HIS CB   1 1 
        2  4267 1 1 123 HIS CD2  C   9.781  -1.380   7.104 1.00 . A A . 123 HIS CD2  1 1 
        2  4268 1 1 123 HIS CE1  C   9.164   0.358   5.968 1.00 . A A . 123 HIS CE1  1 1 
        2  4269 1 1 123 HIS CG   C   9.552  -1.803   5.816 1.00 . A A . 123 HIS CG   1 1 
        2  4270 1 1 123 HIS H    H  10.736  -4.646   6.927 1.00 . A A . 123 HIS H    1 1 
        2  4271 1 1 123 HIS HA   H   8.044  -3.739   6.488 1.00 . A A . 123 HIS HA   1 1 
        2  4272 1 1 123 HIS HB2  H  10.699  -3.450   5.131 1.00 . A A . 123 HIS HB2  1 1 
        2  4273 1 1 123 HIS HB3  H   9.279  -3.090   4.151 1.00 . A A . 123 HIS HB3  1 1 
        2  4274 1 1 123 HIS HD1  H   8.926  -0.644   4.161 1.00 . A A . 123 HIS HD1  1 1 
        2  4275 1 1 123 HIS HD2  H  10.107  -2.011   7.918 1.00 . A A . 123 HIS HD2  1 1 
        2  4276 1 1 123 HIS HE1  H   8.900   1.370   5.694 1.00 . A A . 123 HIS HE1  1 1 
        2  4277 1 1 123 HIS N    N   9.782  -4.861   6.939 1.00 . A A . 123 HIS N    1 1 
        2  4278 1 1 123 HIS ND1  N   9.159  -0.678   5.113 1.00 . A A . 123 HIS ND1  1 1 
        2  4279 1 1 123 HIS NE2  N   9.534  -0.014   7.196 1.00 . A A . 123 HIS NE2  1 1 
        2  4280 1 1 123 HIS O    O   7.135  -5.290   4.694 1.00 . A A . 123 HIS O    1 1 
        2  4281 1 1 124 GLU C    C   7.539  -8.002   4.239 1.00 . A A . 124 GLU C    1 1 
        2  4282 1 1 124 GLU CA   C   8.674  -7.205   3.596 1.00 . A A . 124 GLU CA   1 1 
        2  4283 1 1 124 GLU CB   C   9.844  -8.137   3.280 1.00 . A A . 124 GLU CB   1 1 
        2  4284 1 1 124 GLU CD   C  10.603 -10.078   1.917 1.00 . A A . 124 GLU CD   1 1 
        2  4285 1 1 124 GLU CG   C   9.407  -9.197   2.273 1.00 . A A . 124 GLU CG   1 1 
        2  4286 1 1 124 GLU H    H  10.090  -6.121   4.800 1.00 . A A . 124 GLU H    1 1 
        2  4287 1 1 124 GLU HA   H   8.323  -6.746   2.684 1.00 . A A . 124 GLU HA   1 1 
        2  4288 1 1 124 GLU HB2  H  10.658  -7.562   2.864 1.00 . A A . 124 GLU HB2  1 1 
        2  4289 1 1 124 GLU HB3  H  10.174  -8.622   4.188 1.00 . A A . 124 GLU HB3  1 1 
        2  4290 1 1 124 GLU HG2  H   8.629  -9.808   2.708 1.00 . A A . 124 GLU HG2  1 1 
        2  4291 1 1 124 GLU HG3  H   9.037  -8.716   1.382 1.00 . A A . 124 GLU HG3  1 1 
        2  4292 1 1 124 GLU N    N   9.145  -6.154   4.538 1.00 . A A . 124 GLU N    1 1 
        2  4293 1 1 124 GLU O    O   6.490  -8.190   3.653 1.00 . A A . 124 GLU O    1 1 
        2  4294 1 1 124 GLU OE1  O  11.716  -9.678   2.216 1.00 . A A . 124 GLU OE1  1 1 
        2  4295 1 1 124 GLU OE2  O  10.387 -11.137   1.353 1.00 . A A . 124 GLU OE2  1 1 
        2  4296 1 1 125 GLU C    C   5.534  -8.325   6.532 1.00 . A A . 125 GLU C    1 1 
        2  4297 1 1 125 GLU CA   C   6.678  -9.256   6.120 1.00 . A A . 125 GLU CA   1 1 
        2  4298 1 1 125 GLU CB   C   7.276  -9.923   7.360 1.00 . A A . 125 GLU CB   1 1 
        2  4299 1 1 125 GLU CD   C   6.121 -12.110   7.027 1.00 . A A . 125 GLU CD   1 1 
        2  4300 1 1 125 GLU CG   C   6.266 -10.905   7.958 1.00 . A A . 125 GLU CG   1 1 
        2  4301 1 1 125 GLU H    H   8.592  -8.307   5.889 1.00 . A A . 125 GLU H    1 1 
        2  4302 1 1 125 GLU HA   H   6.300 -10.014   5.449 1.00 . A A . 125 GLU HA   1 1 
        2  4303 1 1 125 GLU HB2  H   8.172 -10.454   7.082 1.00 . A A . 125 GLU HB2  1 1 
        2  4304 1 1 125 GLU HB3  H   7.518  -9.167   8.093 1.00 . A A . 125 GLU HB3  1 1 
        2  4305 1 1 125 GLU HG2  H   6.617 -11.236   8.925 1.00 . A A . 125 GLU HG2  1 1 
        2  4306 1 1 125 GLU HG3  H   5.309 -10.419   8.067 1.00 . A A . 125 GLU HG3  1 1 
        2  4307 1 1 125 GLU N    N   7.739  -8.472   5.435 1.00 . A A . 125 GLU N    1 1 
        2  4308 1 1 125 GLU O    O   4.379  -8.703   6.521 1.00 . A A . 125 GLU O    1 1 
        2  4309 1 1 125 GLU OE1  O   6.889 -12.204   6.084 1.00 . A A . 125 GLU OE1  1 1 
        2  4310 1 1 125 GLU OE2  O   5.246 -12.924   7.276 1.00 . A A . 125 GLU OE2  1 1 
        2  4311 1 1 126 GLY C    C   3.850  -5.837   6.171 1.00 . A A . 126 GLY C    1 1 
        2  4312 1 1 126 GLY CA   C   4.779  -6.166   7.341 1.00 . A A . 126 GLY CA   1 1 
        2  4313 1 1 126 GLY H    H   6.784  -6.832   6.922 1.00 . A A . 126 GLY H    1 1 
        2  4314 1 1 126 GLY HA2  H   4.205  -6.614   8.139 1.00 . A A . 126 GLY HA2  1 1 
        2  4315 1 1 126 GLY HA3  H   5.234  -5.254   7.698 1.00 . A A . 126 GLY HA3  1 1 
        2  4316 1 1 126 GLY N    N   5.847  -7.113   6.911 1.00 . A A . 126 GLY N    1 1 
        2  4317 1 1 126 GLY O    O   2.643  -5.915   6.290 1.00 . A A . 126 GLY O    1 1 
        2  4318 1 1 127 TRP C    C   2.746  -6.367   3.435 1.00 . A A . 127 TRP C    1 1 
        2  4319 1 1 127 TRP CA   C   3.529  -5.130   3.874 1.00 . A A . 127 TRP CA   1 1 
        2  4320 1 1 127 TRP CB   C   4.401  -4.638   2.715 1.00 . A A . 127 TRP CB   1 1 
        2  4321 1 1 127 TRP CD1  C   6.174  -2.892   3.172 1.00 . A A . 127 TRP CD1  1 1 
        2  4322 1 1 127 TRP CD2  C   4.095  -2.034   3.152 1.00 . A A . 127 TRP CD2  1 1 
        2  4323 1 1 127 TRP CE2  C   4.975  -0.957   3.410 1.00 . A A . 127 TRP CE2  1 1 
        2  4324 1 1 127 TRP CE3  C   2.716  -1.763   3.084 1.00 . A A . 127 TRP CE3  1 1 
        2  4325 1 1 127 TRP CG   C   4.881  -3.250   2.999 1.00 . A A . 127 TRP CG   1 1 
        2  4326 1 1 127 TRP CH2  C   3.130   0.595   3.530 1.00 . A A . 127 TRP CH2  1 1 
        2  4327 1 1 127 TRP CZ2  C   4.505   0.343   3.601 1.00 . A A . 127 TRP CZ2  1 1 
        2  4328 1 1 127 TRP CZ3  C   2.239  -0.457   3.275 1.00 . A A . 127 TRP CZ3  1 1 
        2  4329 1 1 127 TRP H    H   5.369  -5.405   4.963 1.00 . A A . 127 TRP H    1 1 
        2  4330 1 1 127 TRP HA   H   2.835  -4.353   4.158 1.00 . A A . 127 TRP HA   1 1 
        2  4331 1 1 127 TRP HB2  H   5.252  -5.295   2.602 1.00 . A A . 127 TRP HB2  1 1 
        2  4332 1 1 127 TRP HB3  H   3.824  -4.640   1.802 1.00 . A A . 127 TRP HB3  1 1 
        2  4333 1 1 127 TRP HD1  H   7.023  -3.556   3.123 1.00 . A A . 127 TRP HD1  1 1 
        2  4334 1 1 127 TRP HE1  H   7.051  -1.018   3.570 1.00 . A A . 127 TRP HE1  1 1 
        2  4335 1 1 127 TRP HE3  H   2.021  -2.564   2.888 1.00 . A A . 127 TRP HE3  1 1 
        2  4336 1 1 127 TRP HH2  H   2.758   1.598   3.676 1.00 . A A . 127 TRP HH2  1 1 
        2  4337 1 1 127 TRP HZ2  H   5.195   1.149   3.797 1.00 . A A . 127 TRP HZ2  1 1 
        2  4338 1 1 127 TRP HZ3  H   1.178  -0.260   3.222 1.00 . A A . 127 TRP HZ3  1 1 
        2  4339 1 1 127 TRP N    N   4.395  -5.468   5.041 1.00 . A A . 127 TRP N    1 1 
        2  4340 1 1 127 TRP NE1  N   6.231  -1.530   3.413 1.00 . A A . 127 TRP NE1  1 1 
        2  4341 1 1 127 TRP O    O   1.577  -6.286   3.108 1.00 . A A . 127 TRP O    1 1 
        2  4342 1 1 128 ALA C    C   1.480  -8.996   3.934 1.00 . A A . 128 ALA C    1 1 
        2  4343 1 1 128 ALA CA   C   2.659  -8.741   2.995 1.00 . A A . 128 ALA CA   1 1 
        2  4344 1 1 128 ALA CB   C   3.625  -9.925   3.053 1.00 . A A . 128 ALA CB   1 1 
        2  4345 1 1 128 ALA H    H   4.316  -7.554   3.685 1.00 . A A . 128 ALA H    1 1 
        2  4346 1 1 128 ALA HA   H   2.297  -8.620   1.985 1.00 . A A . 128 ALA HA   1 1 
        2  4347 1 1 128 ALA HB1  H   3.806 -10.188   4.085 1.00 . A A . 128 ALA HB1  1 1 
        2  4348 1 1 128 ALA HB2  H   4.557  -9.650   2.584 1.00 . A A . 128 ALA HB2  1 1 
        2  4349 1 1 128 ALA HB3  H   3.196 -10.769   2.535 1.00 . A A . 128 ALA HB3  1 1 
        2  4350 1 1 128 ALA N    N   3.373  -7.508   3.419 1.00 . A A . 128 ALA N    1 1 
        2  4351 1 1 128 ALA O    O   0.389  -9.315   3.505 1.00 . A A . 128 ALA O    1 1 
        2  4352 1 1 129 HIS C    C  -0.476  -7.994   6.014 1.00 . A A . 129 HIS C    1 1 
        2  4353 1 1 129 HIS CA   C   0.591  -9.078   6.182 1.00 . A A . 129 HIS CA   1 1 
        2  4354 1 1 129 HIS CB   C   1.161  -9.018   7.600 1.00 . A A . 129 HIS CB   1 1 
        2  4355 1 1 129 HIS CD2  C  -0.527  -8.695   9.581 1.00 . A A . 129 HIS CD2  1 1 
        2  4356 1 1 129 HIS CE1  C  -1.355 -10.696   9.618 1.00 . A A . 129 HIS CE1  1 1 
        2  4357 1 1 129 HIS CG   C   0.099  -9.403   8.587 1.00 . A A . 129 HIS CG   1 1 
        2  4358 1 1 129 HIS H    H   2.580  -8.589   5.532 1.00 . A A . 129 HIS H    1 1 
        2  4359 1 1 129 HIS HA   H   0.151 -10.049   6.011 1.00 . A A . 129 HIS HA   1 1 
        2  4360 1 1 129 HIS HB2  H   1.993  -9.702   7.682 1.00 . A A . 129 HIS HB2  1 1 
        2  4361 1 1 129 HIS HB3  H   1.500  -8.014   7.808 1.00 . A A . 129 HIS HB3  1 1 
        2  4362 1 1 129 HIS HD1  H  -0.210 -11.425   8.041 1.00 . A A . 129 HIS HD1  1 1 
        2  4363 1 1 129 HIS HD2  H  -0.338  -7.659   9.821 1.00 . A A . 129 HIS HD2  1 1 
        2  4364 1 1 129 HIS HE1  H  -1.941 -11.563   9.885 1.00 . A A . 129 HIS HE1  1 1 
        2  4365 1 1 129 HIS N    N   1.693  -8.850   5.210 1.00 . A A . 129 HIS N    1 1 
        2  4366 1 1 129 HIS ND1  N  -0.445 -10.677   8.628 1.00 . A A . 129 HIS ND1  1 1 
        2  4367 1 1 129 HIS NE2  N  -1.445  -9.514  10.232 1.00 . A A . 129 HIS NE2  1 1 
        2  4368 1 1 129 HIS O    O  -1.659  -8.268   5.986 1.00 . A A . 129 HIS O    1 1 
        2  4369 1 1 130 TYR C    C  -1.810  -5.808   4.453 1.00 . A A . 130 TYR C    1 1 
        2  4370 1 1 130 TYR CA   C  -1.024  -5.639   5.755 1.00 . A A . 130 TYR CA   1 1 
        2  4371 1 1 130 TYR CB   C  -0.243  -4.312   5.732 1.00 . A A . 130 TYR CB   1 1 
        2  4372 1 1 130 TYR CD1  C   0.540  -4.691   8.113 1.00 . A A . 130 TYR CD1  1 1 
        2  4373 1 1 130 TYR CD2  C  -0.327  -2.509   7.501 1.00 . A A . 130 TYR CD2  1 1 
        2  4374 1 1 130 TYR CE1  C   0.751  -4.237   9.420 1.00 . A A . 130 TYR CE1  1 1 
        2  4375 1 1 130 TYR CE2  C  -0.112  -2.057   8.808 1.00 . A A . 130 TYR CE2  1 1 
        2  4376 1 1 130 TYR CG   C  -0.001  -3.826   7.150 1.00 . A A . 130 TYR CG   1 1 
        2  4377 1 1 130 TYR CZ   C   0.426  -2.922   9.768 1.00 . A A . 130 TYR CZ   1 1 
        2  4378 1 1 130 TYR H    H   0.903  -6.574   5.945 1.00 . A A . 130 TYR H    1 1 
        2  4379 1 1 130 TYR HA   H  -1.714  -5.641   6.587 1.00 . A A . 130 TYR HA   1 1 
        2  4380 1 1 130 TYR HB2  H   0.708  -4.471   5.244 1.00 . A A . 130 TYR HB2  1 1 
        2  4381 1 1 130 TYR HB3  H  -0.804  -3.566   5.185 1.00 . A A . 130 TYR HB3  1 1 
        2  4382 1 1 130 TYR HD1  H   0.794  -5.704   7.852 1.00 . A A . 130 TYR HD1  1 1 
        2  4383 1 1 130 TYR HD2  H  -0.743  -1.839   6.762 1.00 . A A . 130 TYR HD2  1 1 
        2  4384 1 1 130 TYR HE1  H   1.170  -4.903  10.162 1.00 . A A . 130 TYR HE1  1 1 
        2  4385 1 1 130 TYR HE2  H  -0.363  -1.042   9.076 1.00 . A A . 130 TYR HE2  1 1 
        2  4386 1 1 130 TYR HH   H  -0.081  -2.823  11.605 1.00 . A A . 130 TYR HH   1 1 
        2  4387 1 1 130 TYR N    N  -0.058  -6.763   5.912 1.00 . A A . 130 TYR N    1 1 
        2  4388 1 1 130 TYR O    O  -3.017  -5.663   4.421 1.00 . A A . 130 TYR O    1 1 
        2  4389 1 1 130 TYR OH   O   0.631  -2.480  11.059 1.00 . A A . 130 TYR OH   1 1 
        2  4390 1 1 131 LEU C    C  -2.811  -7.461   2.182 1.00 . A A . 131 LEU C    1 1 
        2  4391 1 1 131 LEU CA   C  -1.843  -6.282   2.083 1.00 . A A . 131 LEU CA   1 1 
        2  4392 1 1 131 LEU CB   C  -0.811  -6.547   0.983 1.00 . A A . 131 LEU CB   1 1 
        2  4393 1 1 131 LEU CD1  C   1.232  -5.643  -0.126 1.00 . A A . 131 LEU CD1  1 1 
        2  4394 1 1 131 LEU CD2  C  -0.844  -4.236  -0.054 1.00 . A A . 131 LEU CD2  1 1 
        2  4395 1 1 131 LEU CG   C   0.005  -5.274   0.709 1.00 . A A . 131 LEU CG   1 1 
        2  4396 1 1 131 LEU H    H  -0.166  -6.219   3.426 1.00 . A A . 131 LEU H    1 1 
        2  4397 1 1 131 LEU HA   H  -2.397  -5.386   1.852 1.00 . A A . 131 LEU HA   1 1 
        2  4398 1 1 131 LEU HB2  H  -0.145  -7.334   1.307 1.00 . A A . 131 LEU HB2  1 1 
        2  4399 1 1 131 LEU HB3  H  -1.315  -6.858   0.080 1.00 . A A . 131 LEU HB3  1 1 
        2  4400 1 1 131 LEU HD11 H   0.921  -6.211  -0.988 1.00 . A A . 131 LEU HD11 1 1 
        2  4401 1 1 131 LEU HD12 H   1.908  -6.235   0.472 1.00 . A A . 131 LEU HD12 1 1 
        2  4402 1 1 131 LEU HD13 H   1.731  -4.741  -0.451 1.00 . A A . 131 LEU HD13 1 1 
        2  4403 1 1 131 LEU HD21 H  -1.437  -3.668   0.647 1.00 . A A . 131 LEU HD21 1 1 
        2  4404 1 1 131 LEU HD22 H  -1.497  -4.735  -0.756 1.00 . A A . 131 LEU HD22 1 1 
        2  4405 1 1 131 LEU HD23 H  -0.194  -3.560  -0.594 1.00 . A A . 131 LEU HD23 1 1 
        2  4406 1 1 131 LEU HG   H   0.330  -4.850   1.651 1.00 . A A . 131 LEU HG   1 1 
        2  4407 1 1 131 LEU N    N  -1.139  -6.110   3.380 1.00 . A A . 131 LEU N    1 1 
        2  4408 1 1 131 LEU O    O  -3.918  -7.406   1.683 1.00 . A A . 131 LEU O    1 1 
        2  4409 1 1 132 GLY C    C  -4.588  -9.288   3.692 1.00 . A A . 132 GLY C    1 1 
        2  4410 1 1 132 GLY CA   C  -3.324  -9.700   2.938 1.00 . A A . 132 GLY CA   1 1 
        2  4411 1 1 132 GLY H    H  -1.515  -8.559   3.217 1.00 . A A . 132 GLY H    1 1 
        2  4412 1 1 132 GLY HA2  H  -3.590 -10.046   1.949 1.00 . A A . 132 GLY HA2  1 1 
        2  4413 1 1 132 GLY HA3  H  -2.828 -10.492   3.476 1.00 . A A . 132 GLY HA3  1 1 
        2  4414 1 1 132 GLY N    N  -2.411  -8.528   2.819 1.00 . A A . 132 GLY N    1 1 
        2  4415 1 1 132 GLY O    O  -5.692  -9.540   3.249 1.00 . A A . 132 GLY O    1 1 
        2  4416 1 1 133 ARG C    C  -6.416  -7.172   4.792 1.00 . A A . 133 ARG C    1 1 
        2  4417 1 1 133 ARG CA   C  -5.646  -8.224   5.594 1.00 . A A . 133 ARG CA   1 1 
        2  4418 1 1 133 ARG CB   C  -5.207  -7.622   6.929 1.00 . A A . 133 ARG CB   1 1 
        2  4419 1 1 133 ARG CD   C  -4.142  -8.112   9.132 1.00 . A A . 133 ARG CD   1 1 
        2  4420 1 1 133 ARG CG   C  -4.673  -8.730   7.838 1.00 . A A . 133 ARG CG   1 1 
        2  4421 1 1 133 ARG CZ   C  -6.003  -8.115  10.698 1.00 . A A . 133 ARG CZ   1 1 
        2  4422 1 1 133 ARG H    H  -3.547  -8.453   5.165 1.00 . A A . 133 ARG H    1 1 
        2  4423 1 1 133 ARG HA   H  -6.282  -9.078   5.775 1.00 . A A . 133 ARG HA   1 1 
        2  4424 1 1 133 ARG HB2  H  -4.429  -6.891   6.755 1.00 . A A . 133 ARG HB2  1 1 
        2  4425 1 1 133 ARG HB3  H  -6.051  -7.144   7.405 1.00 . A A . 133 ARG HB3  1 1 
        2  4426 1 1 133 ARG HD2  H  -3.713  -8.884   9.753 1.00 . A A . 133 ARG HD2  1 1 
        2  4427 1 1 133 ARG HD3  H  -3.382  -7.384   8.892 1.00 . A A . 133 ARG HD3  1 1 
        2  4428 1 1 133 ARG HE   H  -5.430  -6.487   9.716 1.00 . A A . 133 ARG HE   1 1 
        2  4429 1 1 133 ARG HG2  H  -5.469  -9.425   8.069 1.00 . A A . 133 ARG HG2  1 1 
        2  4430 1 1 133 ARG HG3  H  -3.873  -9.253   7.336 1.00 . A A . 133 ARG HG3  1 1 
        2  4431 1 1 133 ARG HH11 H  -5.051  -9.854  10.401 1.00 . A A . 133 ARG HH11 1 1 
        2  4432 1 1 133 ARG HH12 H  -6.358  -9.900  11.535 1.00 . A A . 133 ARG HH12 1 1 
        2  4433 1 1 133 ARG HH21 H  -7.138  -6.540  11.191 1.00 . A A . 133 ARG HH21 1 1 
        2  4434 1 1 133 ARG HH22 H  -7.538  -8.030  11.980 1.00 . A A . 133 ARG HH22 1 1 
        2  4435 1 1 133 ARG N    N  -4.443  -8.651   4.823 1.00 . A A . 133 ARG N    1 1 
        2  4436 1 1 133 ARG NE   N  -5.258  -7.441   9.861 1.00 . A A . 133 ARG NE   1 1 
        2  4437 1 1 133 ARG NH1  N  -5.788  -9.389  10.892 1.00 . A A . 133 ARG NH1  1 1 
        2  4438 1 1 133 ARG NH2  N  -6.969  -7.515  11.339 1.00 . A A . 133 ARG NH2  1 1 
        2  4439 1 1 133 ARG O    O  -7.630  -7.179   4.748 1.00 . A A . 133 ARG O    1 1 
        2  4440 1 1 134 LEU C    C  -7.179  -5.871   2.221 1.00 . A A . 134 LEU C    1 1 
        2  4441 1 1 134 LEU CA   C  -6.403  -5.214   3.363 1.00 . A A . 134 LEU CA   1 1 
        2  4442 1 1 134 LEU CB   C  -5.354  -4.252   2.793 1.00 . A A . 134 LEU CB   1 1 
        2  4443 1 1 134 LEU CD1  C  -7.022  -2.356   2.828 1.00 . A A . 134 LEU CD1  1 1 
        2  4444 1 1 134 LEU CD2  C  -4.948  -2.211   1.419 1.00 . A A . 134 LEU CD2  1 1 
        2  4445 1 1 134 LEU CG   C  -6.029  -3.150   1.962 1.00 . A A . 134 LEU CG   1 1 
        2  4446 1 1 134 LEU H    H  -4.739  -6.285   4.211 1.00 . A A . 134 LEU H    1 1 
        2  4447 1 1 134 LEU HA   H  -7.085  -4.674   4.000 1.00 . A A . 134 LEU HA   1 1 
        2  4448 1 1 134 LEU HB2  H  -4.806  -3.800   3.606 1.00 . A A . 134 LEU HB2  1 1 
        2  4449 1 1 134 LEU HB3  H  -4.670  -4.803   2.163 1.00 . A A . 134 LEU HB3  1 1 
        2  4450 1 1 134 LEU HD11 H  -7.157  -1.365   2.416 1.00 . A A . 134 LEU HD11 1 1 
        2  4451 1 1 134 LEU HD12 H  -6.645  -2.275   3.839 1.00 . A A . 134 LEU HD12 1 1 
        2  4452 1 1 134 LEU HD13 H  -7.975  -2.866   2.842 1.00 . A A . 134 LEU HD13 1 1 
        2  4453 1 1 134 LEU HD21 H  -5.405  -1.456   0.799 1.00 . A A . 134 LEU HD21 1 1 
        2  4454 1 1 134 LEU HD22 H  -4.240  -2.778   0.832 1.00 . A A . 134 LEU HD22 1 1 
        2  4455 1 1 134 LEU HD23 H  -4.433  -1.738   2.243 1.00 . A A . 134 LEU HD23 1 1 
        2  4456 1 1 134 LEU HG   H  -6.558  -3.599   1.134 1.00 . A A . 134 LEU HG   1 1 
        2  4457 1 1 134 LEU N    N  -5.717  -6.269   4.160 1.00 . A A . 134 LEU N    1 1 
        2  4458 1 1 134 LEU O    O  -8.299  -5.501   1.924 1.00 . A A . 134 LEU O    1 1 
        2  4459 1 1 135 THR C    C  -8.568  -8.181   0.971 1.00 . A A . 135 THR C    1 1 
        2  4460 1 1 135 THR CA   C  -7.286  -7.525   0.455 1.00 . A A . 135 THR CA   1 1 
        2  4461 1 1 135 THR CB   C  -6.361  -8.597  -0.127 1.00 . A A . 135 THR CB   1 1 
        2  4462 1 1 135 THR CG2  C  -7.086  -9.354  -1.239 1.00 . A A . 135 THR CG2  1 1 
        2  4463 1 1 135 THR H    H  -5.689  -7.121   1.837 1.00 . A A . 135 THR H    1 1 
        2  4464 1 1 135 THR HA   H  -7.531  -6.806  -0.311 1.00 . A A . 135 THR HA   1 1 
        2  4465 1 1 135 THR HB   H  -6.077  -9.292   0.650 1.00 . A A . 135 THR HB   1 1 
        2  4466 1 1 135 THR HG1  H  -4.470  -8.595  -0.579 1.00 . A A . 135 THR HG1  1 1 
        2  4467 1 1 135 THR HG21 H  -7.799 -10.039  -0.803 1.00 . A A . 135 THR HG21 1 1 
        2  4468 1 1 135 THR HG22 H  -6.366  -9.908  -1.822 1.00 . A A . 135 THR HG22 1 1 
        2  4469 1 1 135 THR HG23 H  -7.603  -8.652  -1.874 1.00 . A A . 135 THR HG23 1 1 
        2  4470 1 1 135 THR N    N  -6.591  -6.842   1.579 1.00 . A A . 135 THR N    1 1 
        2  4471 1 1 135 THR O    O  -9.610  -8.101   0.350 1.00 . A A . 135 THR O    1 1 
        2  4472 1 1 135 THR OG1  O  -5.199  -7.975  -0.656 1.00 . A A . 135 THR OG1  1 1 
        2  4473 1 1 136 GLU C    C -10.787  -8.460   2.961 1.00 . A A . 136 GLU C    1 1 
        2  4474 1 1 136 GLU CA   C  -9.705  -9.499   2.656 1.00 . A A . 136 GLU CA   1 1 
        2  4475 1 1 136 GLU CB   C  -9.322 -10.225   3.950 1.00 . A A . 136 GLU CB   1 1 
        2  4476 1 1 136 GLU CD   C  -9.119 -12.452   2.822 1.00 . A A . 136 GLU CD   1 1 
        2  4477 1 1 136 GLU CG   C  -8.375 -11.389   3.635 1.00 . A A . 136 GLU CG   1 1 
        2  4478 1 1 136 GLU H    H  -7.645  -8.884   2.578 1.00 . A A . 136 GLU H    1 1 
        2  4479 1 1 136 GLU HA   H -10.084 -10.213   1.940 1.00 . A A . 136 GLU HA   1 1 
        2  4480 1 1 136 GLU HB2  H  -8.827  -9.532   4.615 1.00 . A A . 136 GLU HB2  1 1 
        2  4481 1 1 136 GLU HB3  H -10.212 -10.607   4.425 1.00 . A A . 136 GLU HB3  1 1 
        2  4482 1 1 136 GLU HG2  H  -7.534 -11.024   3.065 1.00 . A A . 136 GLU HG2  1 1 
        2  4483 1 1 136 GLU HG3  H  -8.024 -11.825   4.557 1.00 . A A . 136 GLU HG3  1 1 
        2  4484 1 1 136 GLU N    N  -8.496  -8.831   2.097 1.00 . A A . 136 GLU N    1 1 
        2  4485 1 1 136 GLU O    O -11.952  -8.674   2.694 1.00 . A A . 136 GLU O    1 1 
        2  4486 1 1 136 GLU OE1  O -10.337 -12.467   2.877 1.00 . A A . 136 GLU OE1  1 1 
        2  4487 1 1 136 GLU OE2  O  -8.456 -13.234   2.159 1.00 . A A . 136 GLU OE2  1 1 
        2  4488 1 1 137 VAL C    C -12.082  -5.803   2.547 1.00 . A A . 137 VAL C    1 1 
        2  4489 1 1 137 VAL CA   C -11.437  -6.301   3.843 1.00 . A A . 137 VAL CA   1 1 
        2  4490 1 1 137 VAL CB   C -10.755  -5.134   4.567 1.00 . A A . 137 VAL CB   1 1 
        2  4491 1 1 137 VAL CG1  C -11.750  -3.987   4.757 1.00 . A A . 137 VAL CG1  1 1 
        2  4492 1 1 137 VAL CG2  C -10.262  -5.604   5.935 1.00 . A A . 137 VAL CG2  1 1 
        2  4493 1 1 137 VAL H    H  -9.474  -7.184   3.734 1.00 . A A . 137 VAL H    1 1 
        2  4494 1 1 137 VAL HA   H -12.196  -6.728   4.482 1.00 . A A . 137 VAL HA   1 1 
        2  4495 1 1 137 VAL HB   H  -9.917  -4.787   3.979 1.00 . A A . 137 VAL HB   1 1 
        2  4496 1 1 137 VAL HG11 H -11.358  -3.282   5.480 1.00 . A A . 137 VAL HG11 1 1 
        2  4497 1 1 137 VAL HG12 H -12.684  -4.385   5.116 1.00 . A A . 137 VAL HG12 1 1 
        2  4498 1 1 137 VAL HG13 H -11.910  -3.486   3.814 1.00 . A A . 137 VAL HG13 1 1 
        2  4499 1 1 137 VAL HG21 H -11.101  -5.689   6.612 1.00 . A A . 137 VAL HG21 1 1 
        2  4500 1 1 137 VAL HG22 H  -9.556  -4.888   6.325 1.00 . A A . 137 VAL HG22 1 1 
        2  4501 1 1 137 VAL HG23 H  -9.782  -6.566   5.835 1.00 . A A . 137 VAL HG23 1 1 
        2  4502 1 1 137 VAL N    N -10.417  -7.341   3.521 1.00 . A A . 137 VAL N    1 1 
        2  4503 1 1 137 VAL O    O -13.290  -5.695   2.446 1.00 . A A . 137 VAL O    1 1 
        2  4504 1 1 138 ALA C    C -12.605  -6.137  -0.435 1.00 . A A . 138 ALA C    1 1 
        2  4505 1 1 138 ALA CA   C -11.850  -5.008   0.267 1.00 . A A . 138 ALA CA   1 1 
        2  4506 1 1 138 ALA CB   C -10.712  -4.521  -0.630 1.00 . A A . 138 ALA CB   1 1 
        2  4507 1 1 138 ALA H    H -10.319  -5.598   1.660 1.00 . A A . 138 ALA H    1 1 
        2  4508 1 1 138 ALA HA   H -12.530  -4.191   0.462 1.00 . A A . 138 ALA HA   1 1 
        2  4509 1 1 138 ALA HB1  H -11.118  -3.932  -1.439 1.00 . A A . 138 ALA HB1  1 1 
        2  4510 1 1 138 ALA HB2  H -10.181  -5.371  -1.032 1.00 . A A . 138 ALA HB2  1 1 
        2  4511 1 1 138 ALA HB3  H -10.033  -3.915  -0.048 1.00 . A A . 138 ALA HB3  1 1 
        2  4512 1 1 138 ALA N    N -11.288  -5.500   1.557 1.00 . A A . 138 ALA N    1 1 
        2  4513 1 1 138 ALA O    O -13.639  -5.925  -1.037 1.00 . A A . 138 ALA O    1 1 
        2  4514 1 1 139 ALA C    C -13.574  -9.267   0.016 1.00 . A A . 139 ALA C    1 1 
        2  4515 1 1 139 ALA CA   C -12.767  -8.493  -1.024 1.00 . A A . 139 ALA CA   1 1 
        2  4516 1 1 139 ALA CB   C -11.705  -9.410  -1.636 1.00 . A A . 139 ALA CB   1 1 
        2  4517 1 1 139 ALA H    H -11.258  -7.478   0.127 1.00 . A A . 139 ALA H    1 1 
        2  4518 1 1 139 ALA HA   H -13.430  -8.141  -1.803 1.00 . A A . 139 ALA HA   1 1 
        2  4519 1 1 139 ALA HB1  H -11.072  -9.803  -0.853 1.00 . A A . 139 ALA HB1  1 1 
        2  4520 1 1 139 ALA HB2  H -11.104  -8.848  -2.336 1.00 . A A . 139 ALA HB2  1 1 
        2  4521 1 1 139 ALA HB3  H -12.186 -10.228  -2.153 1.00 . A A . 139 ALA HB3  1 1 
        2  4522 1 1 139 ALA N    N -12.093  -7.337  -0.364 1.00 . A A . 139 ALA N    1 1 
        2  4523 1 1 139 ALA O    O -13.869 -10.432  -0.155 1.00 . A A . 139 ALA O    1 1 
        2  4524 1 1 140 GLY C    C -15.551  -8.319   2.950 1.00 . A A . 140 GLY C    1 1 
        2  4525 1 1 140 GLY CA   C -14.716  -9.330   2.159 1.00 . A A . 140 GLY CA   1 1 
        2  4526 1 1 140 GLY H    H -13.679  -7.687   1.217 1.00 . A A . 140 GLY H    1 1 
        2  4527 1 1 140 GLY HA2  H -15.375 -10.055   1.700 1.00 . A A . 140 GLY HA2  1 1 
        2  4528 1 1 140 GLY HA3  H -14.038  -9.836   2.831 1.00 . A A . 140 GLY HA3  1 1 
        2  4529 1 1 140 GLY N    N -13.931  -8.628   1.100 1.00 . A A . 140 GLY N    1 1 
        2  4530 1 1 140 GLY O    O -16.198  -7.457   2.388 1.00 . A A . 140 GLY O    1 1 
        2  4531 1 1 141 ARG C    C -16.216  -6.057   4.594 1.00 . A A . 141 ARG C    1 1 
        2  4532 1 1 141 ARG CA   C -16.348  -7.494   5.101 1.00 . A A . 141 ARG CA   1 1 
        2  4533 1 1 141 ARG CB   C -15.847  -7.572   6.542 1.00 . A A . 141 ARG CB   1 1 
        2  4534 1 1 141 ARG CD   C -15.586  -9.066   8.524 1.00 . A A . 141 ARG CD   1 1 
        2  4535 1 1 141 ARG CG   C -16.147  -8.961   7.106 1.00 . A A . 141 ARG CG   1 1 
        2  4536 1 1 141 ARG CZ   C -17.400  -8.400  10.000 1.00 . A A . 141 ARG CZ   1 1 
        2  4537 1 1 141 ARG H    H -15.024  -9.140   4.676 1.00 . A A . 141 ARG H    1 1 
        2  4538 1 1 141 ARG HA   H -17.386  -7.788   5.072 1.00 . A A . 141 ARG HA   1 1 
        2  4539 1 1 141 ARG HB2  H -14.781  -7.395   6.562 1.00 . A A . 141 ARG HB2  1 1 
        2  4540 1 1 141 ARG HB3  H -16.349  -6.825   7.140 1.00 . A A . 141 ARG HB3  1 1 
        2  4541 1 1 141 ARG HD2  H -15.742 -10.067   8.901 1.00 . A A . 141 ARG HD2  1 1 
        2  4542 1 1 141 ARG HD3  H -14.527  -8.851   8.508 1.00 . A A . 141 ARG HD3  1 1 
        2  4543 1 1 141 ARG HE   H -15.894  -7.191   9.539 1.00 . A A . 141 ARG HE   1 1 
        2  4544 1 1 141 ARG HG2  H -17.216  -9.120   7.126 1.00 . A A . 141 ARG HG2  1 1 
        2  4545 1 1 141 ARG HG3  H -15.683  -9.710   6.481 1.00 . A A . 141 ARG HG3  1 1 
        2  4546 1 1 141 ARG HH11 H -17.478 -10.248   9.232 1.00 . A A . 141 ARG HH11 1 1 
        2  4547 1 1 141 ARG HH12 H -18.783  -9.820  10.284 1.00 . A A . 141 ARG HH12 1 1 
        2  4548 1 1 141 ARG HH21 H -17.593  -6.625  10.911 1.00 . A A . 141 ARG HH21 1 1 
        2  4549 1 1 141 ARG HH22 H -18.851  -7.773  11.230 1.00 . A A . 141 ARG HH22 1 1 
        2  4550 1 1 141 ARG N    N -15.549  -8.429   4.253 1.00 . A A . 141 ARG N    1 1 
        2  4551 1 1 141 ARG NE   N -16.281  -8.082   9.405 1.00 . A A . 141 ARG NE   1 1 
        2  4552 1 1 141 ARG NH1  N -17.927  -9.581   9.825 1.00 . A A . 141 ARG NH1  1 1 
        2  4553 1 1 141 ARG NH2  N -17.995  -7.532  10.774 1.00 . A A . 141 ARG NH2  1 1 
        2  4554 1 1 141 ARG O    O -15.356  -5.746   3.793 1.00 . A A . 141 ARG O    1 1 
        2  4555 1 1 142 ASP C    C -17.137  -2.824   5.824 1.00 . A A . 142 ASP C    1 1 
        2  4556 1 1 142 ASP CA   C -17.038  -3.750   4.605 1.00 . A A . 142 ASP CA   1 1 
        2  4557 1 1 142 ASP CB   C -18.233  -3.482   3.686 1.00 . A A . 142 ASP CB   1 1 
        2  4558 1 1 142 ASP CG   C -18.166  -2.048   3.158 1.00 . A A . 142 ASP CG   1 1 
        2  4559 1 1 142 ASP H    H -17.763  -5.467   5.691 1.00 . A A . 142 ASP H    1 1 
        2  4560 1 1 142 ASP HA   H -16.121  -3.548   4.066 1.00 . A A . 142 ASP HA   1 1 
        2  4561 1 1 142 ASP HB2  H -18.209  -4.174   2.856 1.00 . A A . 142 ASP HB2  1 1 
        2  4562 1 1 142 ASP HB3  H -19.149  -3.615   4.241 1.00 . A A . 142 ASP HB3  1 1 
        2  4563 1 1 142 ASP N    N -17.079  -5.180   5.051 1.00 . A A . 142 ASP N    1 1 
        2  4564 1 1 142 ASP O    O -18.195  -2.313   6.136 1.00 . A A . 142 ASP O    1 1 
        2  4565 1 1 142 ASP OD1  O -17.881  -1.159   3.945 1.00 . A A . 142 ASP OD1  1 1 
        2  4566 1 1 142 ASP OD2  O -18.399  -1.862   1.975 1.00 . A A . 142 ASP OD2  1 1 
        2  4567 1 1 143 PRO C    C -16.518  -0.289   7.399 1.00 . A A . 143 PRO C    1 1 
        2  4568 1 1 143 PRO CA   C -16.011  -1.708   7.707 1.00 . A A . 143 PRO CA   1 1 
        2  4569 1 1 143 PRO CB   C -14.520  -1.677   8.104 1.00 . A A . 143 PRO CB   1 1 
        2  4570 1 1 143 PRO CD   C -14.723  -3.176   6.211 1.00 . A A . 143 PRO CD   1 1 
        2  4571 1 1 143 PRO CG   C -13.912  -2.897   7.478 1.00 . A A . 143 PRO CG   1 1 
        2  4572 1 1 143 PRO HA   H -16.589  -2.144   8.507 1.00 . A A . 143 PRO HA   1 1 
        2  4573 1 1 143 PRO HB2  H -14.045  -0.782   7.716 1.00 . A A . 143 PRO HB2  1 1 
        2  4574 1 1 143 PRO HB3  H -14.413  -1.719   9.178 1.00 . A A . 143 PRO HB3  1 1 
        2  4575 1 1 143 PRO HD2  H -14.272  -2.687   5.357 1.00 . A A . 143 PRO HD2  1 1 
        2  4576 1 1 143 PRO HD3  H -14.811  -4.239   6.040 1.00 . A A . 143 PRO HD3  1 1 
        2  4577 1 1 143 PRO HG2  H -12.873  -2.710   7.226 1.00 . A A . 143 PRO HG2  1 1 
        2  4578 1 1 143 PRO HG3  H -13.982  -3.741   8.149 1.00 . A A . 143 PRO HG3  1 1 
        2  4579 1 1 143 PRO N    N -16.044  -2.599   6.503 1.00 . A A . 143 PRO N    1 1 
        2  4580 1 1 143 PRO O    O -16.283   0.246   6.335 1.00 . A A . 143 PRO O    1 1 
        2  4581 1 1 144 GLY C    C -18.566   1.748   6.832 1.00 . A A . 144 GLY C    1 1 
        2  4582 1 1 144 GLY CA   C -17.708   1.709   8.099 1.00 . A A . 144 GLY CA   1 1 
        2  4583 1 1 144 GLY H    H -17.371  -0.123   9.186 1.00 . A A . 144 GLY H    1 1 
        2  4584 1 1 144 GLY HA2  H -18.306   2.017   8.947 1.00 . A A . 144 GLY HA2  1 1 
        2  4585 1 1 144 GLY HA3  H -16.873   2.382   7.985 1.00 . A A . 144 GLY HA3  1 1 
        2  4586 1 1 144 GLY N    N -17.199   0.326   8.330 1.00 . A A . 144 GLY N    1 1 
        2  4587 1 1 144 GLY O    O -18.714   0.759   6.142 1.00 . A A . 144 GLY O    1 1 
        2  4588 1 1 145 PRO C    C -19.188   3.023   4.025 1.00 . A A . 145 PRO C    1 1 
        2  4589 1 1 145 PRO CA   C -19.992   3.078   5.325 1.00 . A A . 145 PRO CA   1 1 
        2  4590 1 1 145 PRO CB   C -20.619   4.467   5.535 1.00 . A A . 145 PRO CB   1 1 
        2  4591 1 1 145 PRO CD   C -18.997   4.142   7.303 1.00 . A A . 145 PRO CD   1 1 
        2  4592 1 1 145 PRO CG   C -19.651   5.201   6.409 1.00 . A A . 145 PRO CG   1 1 
        2  4593 1 1 145 PRO HA   H -20.769   2.331   5.308 1.00 . A A . 145 PRO HA   1 1 
        2  4594 1 1 145 PRO HB2  H -20.741   4.980   4.587 1.00 . A A . 145 PRO HB2  1 1 
        2  4595 1 1 145 PRO HB3  H -21.574   4.377   6.034 1.00 . A A . 145 PRO HB3  1 1 
        2  4596 1 1 145 PRO HD2  H -17.956   4.380   7.472 1.00 . A A . 145 PRO HD2  1 1 
        2  4597 1 1 145 PRO HD3  H -19.524   4.054   8.242 1.00 . A A . 145 PRO HD3  1 1 
        2  4598 1 1 145 PRO HG2  H -18.902   5.696   5.803 1.00 . A A . 145 PRO HG2  1 1 
        2  4599 1 1 145 PRO HG3  H -20.171   5.925   7.020 1.00 . A A . 145 PRO HG3  1 1 
        2  4600 1 1 145 PRO N    N -19.129   2.893   6.530 1.00 . A A . 145 PRO N    1 1 
        2  4601 1 1 145 PRO O    O -17.992   3.236   4.014 1.00 . A A . 145 PRO O    1 1 
        2  4602 1 1 146 ASP C    C -19.935   3.430   0.561 1.00 . A A . 146 ASP C    1 1 
        2  4603 1 1 146 ASP CA   C -19.136   2.655   1.613 1.00 . A A . 146 ASP CA   1 1 
        2  4604 1 1 146 ASP CB   C -19.024   1.189   1.186 1.00 . A A . 146 ASP CB   1 1 
        2  4605 1 1 146 ASP CG   C -20.405   0.535   1.235 1.00 . A A . 146 ASP CG   1 1 
        2  4606 1 1 146 ASP H    H -20.806   2.565   2.972 1.00 . A A . 146 ASP H    1 1 
        2  4607 1 1 146 ASP HA   H -18.145   3.082   1.691 1.00 . A A . 146 ASP HA   1 1 
        2  4608 1 1 146 ASP HB2  H -18.637   1.136   0.181 1.00 . A A . 146 ASP HB2  1 1 
        2  4609 1 1 146 ASP HB3  H -18.357   0.669   1.858 1.00 . A A . 146 ASP HB3  1 1 
        2  4610 1 1 146 ASP N    N -19.841   2.733   2.928 1.00 . A A . 146 ASP N    1 1 
        2  4611 1 1 146 ASP O    O -20.606   2.851  -0.270 1.00 . A A . 146 ASP O    1 1 
        2  4612 1 1 146 ASP OD1  O -20.931   0.387   2.325 1.00 . A A . 146 ASP OD1  1 1 
        2  4613 1 1 146 ASP OD2  O -20.913   0.191   0.180 1.00 . A A . 146 ASP OD2  1 1 
        2  4614 1 1 147 PRO C    C -20.229   5.246  -1.818 1.00 . A A . 147 PRO C    1 1 
        2  4615 1 1 147 PRO CA   C -20.574   5.611  -0.373 1.00 . A A . 147 PRO CA   1 1 
        2  4616 1 1 147 PRO CB   C -20.078   7.030  -0.028 1.00 . A A . 147 PRO CB   1 1 
        2  4617 1 1 147 PRO CD   C -19.072   5.522   1.563 1.00 . A A . 147 PRO CD   1 1 
        2  4618 1 1 147 PRO CG   C -19.613   6.941   1.390 1.00 . A A . 147 PRO CG   1 1 
        2  4619 1 1 147 PRO HA   H -21.640   5.548  -0.213 1.00 . A A . 147 PRO HA   1 1 
        2  4620 1 1 147 PRO HB2  H -19.258   7.313  -0.677 1.00 . A A . 147 PRO HB2  1 1 
        2  4621 1 1 147 PRO HB3  H -20.886   7.744  -0.111 1.00 . A A . 147 PRO HB3  1 1 
        2  4622 1 1 147 PRO HD2  H -18.017   5.486   1.320 1.00 . A A . 147 PRO HD2  1 1 
        2  4623 1 1 147 PRO HD3  H -19.245   5.165   2.565 1.00 . A A . 147 PRO HD3  1 1 
        2  4624 1 1 147 PRO HG2  H -18.832   7.670   1.574 1.00 . A A . 147 PRO HG2  1 1 
        2  4625 1 1 147 PRO HG3  H -20.439   7.102   2.068 1.00 . A A . 147 PRO HG3  1 1 
        2  4626 1 1 147 PRO N    N -19.855   4.735   0.596 1.00 . A A . 147 PRO N    1 1 
        2  4627 1 1 147 PRO O    O -21.060   5.300  -2.701 1.00 . A A . 147 PRO O    1 1 
        2  4628 1 1 148 PHE C    C -18.939   5.657  -4.386 1.00 . A A . 148 PHE C    1 1 
        2  4629 1 1 148 PHE CA   C -18.578   4.511  -3.436 1.00 . A A . 148 PHE CA   1 1 
        2  4630 1 1 148 PHE CB   C -19.293   3.212  -3.863 1.00 . A A . 148 PHE CB   1 1 
        2  4631 1 1 148 PHE CD1  C -17.834   1.966  -2.215 1.00 . A A . 148 PHE CD1  1 1 
        2  4632 1 1 148 PHE CD2  C -18.289   0.945  -4.368 1.00 . A A . 148 PHE CD2  1 1 
        2  4633 1 1 148 PHE CE1  C -17.052   0.860  -1.858 1.00 . A A . 148 PHE CE1  1 1 
        2  4634 1 1 148 PHE CE2  C -17.506  -0.159  -4.009 1.00 . A A . 148 PHE CE2  1 1 
        2  4635 1 1 148 PHE CG   C -18.454   2.009  -3.471 1.00 . A A . 148 PHE CG   1 1 
        2  4636 1 1 148 PHE CZ   C -16.888  -0.201  -2.753 1.00 . A A . 148 PHE CZ   1 1 
        2  4637 1 1 148 PHE H    H -18.347   4.848  -1.324 1.00 . A A . 148 PHE H    1 1 
        2  4638 1 1 148 PHE HA   H -17.507   4.365  -3.454 1.00 . A A . 148 PHE HA   1 1 
        2  4639 1 1 148 PHE HB2  H -20.253   3.154  -3.370 1.00 . A A . 148 PHE HB2  1 1 
        2  4640 1 1 148 PHE HB3  H -19.441   3.209  -4.935 1.00 . A A . 148 PHE HB3  1 1 
        2  4641 1 1 148 PHE HD1  H -17.960   2.784  -1.522 1.00 . A A . 148 PHE HD1  1 1 
        2  4642 1 1 148 PHE HD2  H -18.767   0.976  -5.336 1.00 . A A . 148 PHE HD2  1 1 
        2  4643 1 1 148 PHE HE1  H -16.574   0.830  -0.889 1.00 . A A . 148 PHE HE1  1 1 
        2  4644 1 1 148 PHE HE2  H -17.379  -0.979  -4.699 1.00 . A A . 148 PHE HE2  1 1 
        2  4645 1 1 148 PHE HZ   H -16.284  -1.052  -2.476 1.00 . A A . 148 PHE HZ   1 1 
        2  4646 1 1 148 PHE N    N -18.998   4.878  -2.057 1.00 . A A . 148 PHE N    1 1 
        2  4647 1 1 148 PHE O    O -18.798   5.545  -5.588 1.00 . A A . 148 PHE O    1 1 
        2  4648 1 1 149 TYR C    C -18.490   8.407  -5.447 1.00 . A A . 149 TYR C    1 1 
        2  4649 1 1 149 TYR CA   C -19.742   7.913  -4.716 1.00 . A A . 149 TYR CA   1 1 
        2  4650 1 1 149 TYR CB   C -20.309   9.032  -3.844 1.00 . A A . 149 TYR CB   1 1 
        2  4651 1 1 149 TYR CD1  C -21.718  10.267  -5.522 1.00 . A A . 149 TYR CD1  1 1 
        2  4652 1 1 149 TYR CD2  C -19.716  11.338  -4.668 1.00 . A A . 149 TYR CD2  1 1 
        2  4653 1 1 149 TYR CE1  C -21.978  11.390  -6.316 1.00 . A A . 149 TYR CE1  1 1 
        2  4654 1 1 149 TYR CE2  C -19.976  12.460  -5.462 1.00 . A A . 149 TYR CE2  1 1 
        2  4655 1 1 149 TYR CG   C -20.586  10.242  -4.699 1.00 . A A . 149 TYR CG   1 1 
        2  4656 1 1 149 TYR CZ   C -21.107  12.486  -6.286 1.00 . A A . 149 TYR CZ   1 1 
        2  4657 1 1 149 TYR H    H -19.481   6.828  -2.882 1.00 . A A . 149 TYR H    1 1 
        2  4658 1 1 149 TYR HA   H -20.485   7.610  -5.439 1.00 . A A . 149 TYR HA   1 1 
        2  4659 1 1 149 TYR HB2  H -21.226   8.697  -3.383 1.00 . A A . 149 TYR HB2  1 1 
        2  4660 1 1 149 TYR HB3  H -19.593   9.287  -3.077 1.00 . A A . 149 TYR HB3  1 1 
        2  4661 1 1 149 TYR HD1  H -22.389   9.422  -5.545 1.00 . A A . 149 TYR HD1  1 1 
        2  4662 1 1 149 TYR HD2  H -18.844  11.317  -4.032 1.00 . A A . 149 TYR HD2  1 1 
        2  4663 1 1 149 TYR HE1  H -22.851  11.410  -6.953 1.00 . A A . 149 TYR HE1  1 1 
        2  4664 1 1 149 TYR HE2  H -19.305  13.305  -5.439 1.00 . A A . 149 TYR HE2  1 1 
        2  4665 1 1 149 TYR HH   H -20.634  14.204  -6.964 1.00 . A A . 149 TYR HH   1 1 
        2  4666 1 1 149 TYR N    N -19.386   6.758  -3.854 1.00 . A A . 149 TYR N    1 1 
        2  4667 1 1 149 TYR O    O -18.529   8.717  -6.619 1.00 . A A . 149 TYR O    1 1 
        2  4668 1 1 149 TYR OH   O -21.365  13.591  -7.068 1.00 . A A . 149 TYR OH   1 1 
        2  4669 1 1 150 GLY C    C -16.072  10.501  -5.318 1.00 . A A . 150 GLY C    1 1 
        2  4670 1 1 150 GLY CA   C -16.126   8.975  -5.410 1.00 . A A . 150 GLY CA   1 1 
        2  4671 1 1 150 GLY H    H -17.373   8.244  -3.809 1.00 . A A . 150 GLY H    1 1 
        2  4672 1 1 150 GLY HA2  H -15.269   8.550  -4.908 1.00 . A A . 150 GLY HA2  1 1 
        2  4673 1 1 150 GLY HA3  H -16.116   8.682  -6.450 1.00 . A A . 150 GLY HA3  1 1 
        2  4674 1 1 150 GLY N    N -17.380   8.491  -4.758 1.00 . A A . 150 GLY N    1 1 
        2  4675 1 1 150 GLY O    O -16.209  11.195  -6.305 1.00 . A A . 150 GLY O    1 1 
        2  4676 1 1 151 ARG C    C -14.521  13.046  -4.581 1.00 . A A . 151 ARG C    1 1 
        2  4677 1 1 151 ARG CA   C -15.829  12.512  -3.988 1.00 . A A . 151 ARG CA   1 1 
        2  4678 1 1 151 ARG CB   C -15.901  12.870  -2.501 1.00 . A A . 151 ARG CB   1 1 
        2  4679 1 1 151 ARG CD   C -17.362  12.844  -0.471 1.00 . A A . 151 ARG CD   1 1 
        2  4680 1 1 151 ARG CG   C -17.286  12.506  -1.961 1.00 . A A . 151 ARG CG   1 1 
        2  4681 1 1 151 ARG CZ   C -16.354  12.057   1.585 1.00 . A A . 151 ARG CZ   1 1 
        2  4682 1 1 151 ARG H    H -15.778  10.453  -3.354 1.00 . A A . 151 ARG H    1 1 
        2  4683 1 1 151 ARG HA   H -16.666  12.956  -4.506 1.00 . A A . 151 ARG HA   1 1 
        2  4684 1 1 151 ARG HB2  H -15.145  12.315  -1.962 1.00 . A A . 151 ARG HB2  1 1 
        2  4685 1 1 151 ARG HB3  H -15.732  13.928  -2.375 1.00 . A A . 151 ARG HB3  1 1 
        2  4686 1 1 151 ARG HD2  H -17.038  13.862  -0.316 1.00 . A A . 151 ARG HD2  1 1 
        2  4687 1 1 151 ARG HD3  H -18.381  12.734  -0.130 1.00 . A A . 151 ARG HD3  1 1 
        2  4688 1 1 151 ARG HE   H -15.999  11.202  -0.172 1.00 . A A . 151 ARG HE   1 1 
        2  4689 1 1 151 ARG HG2  H -18.037  13.066  -2.498 1.00 . A A . 151 ARG HG2  1 1 
        2  4690 1 1 151 ARG HG3  H -17.460  11.450  -2.097 1.00 . A A . 151 ARG HG3  1 1 
        2  4691 1 1 151 ARG HH11 H -17.577  13.640   1.694 1.00 . A A . 151 ARG HH11 1 1 
        2  4692 1 1 151 ARG HH12 H -16.891  13.120   3.196 1.00 . A A . 151 ARG HH12 1 1 
        2  4693 1 1 151 ARG HH21 H -15.100  10.508   1.783 1.00 . A A . 151 ARG HH21 1 1 
        2  4694 1 1 151 ARG HH22 H -15.489  11.347   3.246 1.00 . A A . 151 ARG HH22 1 1 
        2  4695 1 1 151 ARG N    N -15.881  11.029  -4.139 1.00 . A A . 151 ARG N    1 1 
        2  4696 1 1 151 ARG NE   N -16.481  11.917   0.294 1.00 . A A . 151 ARG NE   1 1 
        2  4697 1 1 151 ARG NH1  N -16.991  13.014   2.206 1.00 . A A . 151 ARG NH1  1 1 
        2  4698 1 1 151 ARG NH2  N -15.588  11.241   2.258 1.00 . A A . 151 ARG NH2  1 1 
        2  4699 1 1 151 ARG O    O -13.466  12.475  -4.391 1.00 . A A . 151 ARG O    1 1 
        2  4700 1 1 152 ARG C    C -13.379  16.246  -5.766 1.00 . A A . 152 ARG C    1 1 
        2  4701 1 1 152 ARG CA   C -13.347  14.724  -5.909 1.00 . A A . 152 ARG CA   1 1 
        2  4702 1 1 152 ARG CB   C -13.281  14.351  -7.392 1.00 . A A . 152 ARG CB   1 1 
        2  4703 1 1 152 ARG CD   C -11.893  14.469  -9.465 1.00 . A A . 152 ARG CD   1 1 
        2  4704 1 1 152 ARG CG   C -11.978  14.880  -7.996 1.00 . A A . 152 ARG CG   1 1 
        2  4705 1 1 152 ARG CZ   C -13.141  14.897 -11.497 1.00 . A A . 152 ARG CZ   1 1 
        2  4706 1 1 152 ARG H    H -15.448  14.582  -5.437 1.00 . A A . 152 ARG H    1 1 
        2  4707 1 1 152 ARG HA   H -12.469  14.341  -5.406 1.00 . A A . 152 ARG HA   1 1 
        2  4708 1 1 152 ARG HB2  H -13.312  13.275  -7.492 1.00 . A A . 152 ARG HB2  1 1 
        2  4709 1 1 152 ARG HB3  H -14.120  14.786  -7.913 1.00 . A A . 152 ARG HB3  1 1 
        2  4710 1 1 152 ARG HD2  H -10.935  14.762  -9.868 1.00 . A A . 152 ARG HD2  1 1 
        2  4711 1 1 152 ARG HD3  H -12.007  13.398  -9.546 1.00 . A A . 152 ARG HD3  1 1 
        2  4712 1 1 152 ARG HE   H -13.588  15.764  -9.768 1.00 . A A . 152 ARG HE   1 1 
        2  4713 1 1 152 ARG HG2  H -11.960  15.959  -7.926 1.00 . A A . 152 ARG HG2  1 1 
        2  4714 1 1 152 ARG HG3  H -11.137  14.470  -7.459 1.00 . A A . 152 ARG HG3  1 1 
        2  4715 1 1 152 ARG HH11 H -11.585  13.640 -11.603 1.00 . A A . 152 ARG HH11 1 1 
        2  4716 1 1 152 ARG HH12 H -12.447  13.892 -13.084 1.00 . A A . 152 ARG HH12 1 1 
        2  4717 1 1 152 ARG HH21 H -14.727  16.105 -11.690 1.00 . A A . 152 ARG HH21 1 1 
        2  4718 1 1 152 ARG HH22 H -14.227  15.287 -13.132 1.00 . A A . 152 ARG HH22 1 1 
        2  4719 1 1 152 ARG N    N -14.583  14.140  -5.298 1.00 . A A . 152 ARG N    1 1 
        2  4720 1 1 152 ARG NE   N -12.984  15.142 -10.226 1.00 . A A . 152 ARG NE   1 1 
        2  4721 1 1 152 ARG NH1  N -12.327  14.079 -12.109 1.00 . A A . 152 ARG NH1  1 1 
        2  4722 1 1 152 ARG NH2  N -14.107  15.475 -12.158 1.00 . A A . 152 ARG NH2  1 1 
        2  4723 1 1 152 ARG O    O -14.378  16.887  -6.023 1.00 . A A . 152 ARG O    1 1 
        2  4724 1 1 153 LEU C    C -11.834  18.958  -6.516 1.00 . A A . 153 LEU C    1 1 
        2  4725 1 1 153 LEU CA   C -12.237  18.310  -5.190 1.00 . A A . 153 LEU CA   1 1 
        2  4726 1 1 153 LEU CB   C -11.198  18.657  -4.118 1.00 . A A . 153 LEU CB   1 1 
        2  4727 1 1 153 LEU CD1  C -12.887  19.449  -2.399 1.00 . A A . 153 LEU CD1  1 1 
        2  4728 1 1 153 LEU CD2  C -12.346  16.996  -2.633 1.00 . A A . 153 LEU CD2  1 1 
        2  4729 1 1 153 LEU CG   C -11.780  18.421  -2.716 1.00 . A A . 153 LEU CG   1 1 
        2  4730 1 1 153 LEU H    H -11.492  16.291  -5.154 1.00 . A A . 153 LEU H    1 1 
        2  4731 1 1 153 LEU HA   H -13.206  18.678  -4.887 1.00 . A A . 153 LEU HA   1 1 
        2  4732 1 1 153 LEU HB2  H -10.331  18.025  -4.253 1.00 . A A . 153 LEU HB2  1 1 
        2  4733 1 1 153 LEU HB3  H -10.903  19.691  -4.216 1.00 . A A . 153 LEU HB3  1 1 
        2  4734 1 1 153 LEU HD11 H -12.897  19.640  -1.337 1.00 . A A . 153 LEU HD11 1 1 
        2  4735 1 1 153 LEU HD12 H -13.853  19.062  -2.699 1.00 . A A . 153 LEU HD12 1 1 
        2  4736 1 1 153 LEU HD13 H -12.694  20.375  -2.925 1.00 . A A . 153 LEU HD13 1 1 
        2  4737 1 1 153 LEU HD21 H -11.650  16.305  -3.088 1.00 . A A . 153 LEU HD21 1 1 
        2  4738 1 1 153 LEU HD22 H -13.289  16.953  -3.156 1.00 . A A . 153 LEU HD22 1 1 
        2  4739 1 1 153 LEU HD23 H -12.494  16.727  -1.599 1.00 . A A . 153 LEU HD23 1 1 
        2  4740 1 1 153 LEU HG   H -10.989  18.528  -1.987 1.00 . A A . 153 LEU HG   1 1 
        2  4741 1 1 153 LEU N    N -12.285  16.830  -5.355 1.00 . A A . 153 LEU N    1 1 
        2  4742 1 1 153 LEU O    O -12.644  19.137  -7.403 1.00 . A A . 153 LEU O    1 1 
        2  4743 1 1 154 GLU C    C  -9.034  19.077  -8.561 1.00 . A A . 154 GLU C    1 1 
        2  4744 1 1 154 GLU CA   C -10.085  19.969  -7.900 1.00 . A A . 154 GLU CA   1 1 
        2  4745 1 1 154 GLU CB   C  -9.473  21.329  -7.554 1.00 . A A . 154 GLU CB   1 1 
        2  4746 1 1 154 GLU CD   C  -8.022  22.591  -5.970 1.00 . A A . 154 GLU CD   1 1 
        2  4747 1 1 154 GLU CG   C  -8.551  21.206  -6.335 1.00 . A A . 154 GLU CG   1 1 
        2  4748 1 1 154 GLU H    H  -9.956  19.161  -5.906 1.00 . A A . 154 GLU H    1 1 
        2  4749 1 1 154 GLU HA   H -10.903  20.116  -8.593 1.00 . A A . 154 GLU HA   1 1 
        2  4750 1 1 154 GLU HB2  H  -8.904  21.692  -8.397 1.00 . A A . 154 GLU HB2  1 1 
        2  4751 1 1 154 GLU HB3  H -10.265  22.028  -7.330 1.00 . A A . 154 GLU HB3  1 1 
        2  4752 1 1 154 GLU HG2  H  -9.102  20.799  -5.500 1.00 . A A . 154 GLU HG2  1 1 
        2  4753 1 1 154 GLU HG3  H  -7.720  20.558  -6.572 1.00 . A A . 154 GLU HG3  1 1 
        2  4754 1 1 154 GLU N    N -10.580  19.318  -6.645 1.00 . A A . 154 GLU N    1 1 
        2  4755 1 1 154 GLU O    O  -8.048  18.700  -7.958 1.00 . A A . 154 GLU O    1 1 
        2  4756 1 1 154 GLU OE1  O  -8.786  23.536  -6.065 1.00 . A A . 154 GLU OE1  1 1 
        2  4757 1 1 154 GLU OE2  O  -6.864  22.684  -5.600 1.00 . A A . 154 GLU OE2  1 1 
        2  4758 1 1 155 HIS C    C  -7.257  18.738 -11.268 1.00 . A A . 155 HIS C    1 1 
        2  4759 1 1 155 HIS CA   C  -8.267  17.863 -10.522 1.00 . A A . 155 HIS CA   1 1 
        2  4760 1 1 155 HIS CB   C  -9.025  16.989 -11.523 1.00 . A A . 155 HIS CB   1 1 
        2  4761 1 1 155 HIS CD2  C  -9.222  18.166 -13.865 1.00 . A A . 155 HIS CD2  1 1 
        2  4762 1 1 155 HIS CE1  C -11.095  19.205 -13.539 1.00 . A A . 155 HIS CE1  1 1 
        2  4763 1 1 155 HIS CG   C  -9.634  17.856 -12.593 1.00 . A A . 155 HIS CG   1 1 
        2  4764 1 1 155 HIS H    H -10.045  19.049 -10.266 1.00 . A A . 155 HIS H    1 1 
        2  4765 1 1 155 HIS HA   H  -7.747  17.230  -9.816 1.00 . A A . 155 HIS HA   1 1 
        2  4766 1 1 155 HIS HB2  H  -8.344  16.283 -11.975 1.00 . A A . 155 HIS HB2  1 1 
        2  4767 1 1 155 HIS HB3  H  -9.809  16.453 -11.009 1.00 . A A . 155 HIS HB3  1 1 
        2  4768 1 1 155 HIS HD1  H -11.380  18.520 -11.596 1.00 . A A . 155 HIS HD1  1 1 
        2  4769 1 1 155 HIS HD2  H  -8.317  17.807 -14.331 1.00 . A A . 155 HIS HD2  1 1 
        2  4770 1 1 155 HIS HE1  H -11.970  19.821 -13.687 1.00 . A A . 155 HIS HE1  1 1 
        2  4771 1 1 155 HIS N    N  -9.241  18.734  -9.802 1.00 . A A . 155 HIS N    1 1 
        2  4772 1 1 155 HIS ND1  N -10.830  18.530 -12.407 1.00 . A A . 155 HIS ND1  1 1 
        2  4773 1 1 155 HIS NE2  N -10.147  19.019 -14.462 1.00 . A A . 155 HIS NE2  1 1 
        2  4774 1 1 155 HIS O    O  -6.184  18.292 -11.622 1.00 . A A . 155 HIS O    1 1 
        2  4775 1 1 156 HIS C    C  -6.591  22.239 -11.505 1.00 . A A . 156 HIS C    1 1 
        2  4776 1 1 156 HIS CA   C  -6.669  20.900 -12.237 1.00 . A A . 156 HIS CA   1 1 
        2  4777 1 1 156 HIS CB   C  -7.189  21.128 -13.655 1.00 . A A . 156 HIS CB   1 1 
        2  4778 1 1 156 HIS CD2  C  -6.155  23.148 -14.979 1.00 . A A . 156 HIS CD2  1 1 
        2  4779 1 1 156 HIS CE1  C  -4.241  22.256 -15.467 1.00 . A A . 156 HIS CE1  1 1 
        2  4780 1 1 156 HIS CG   C  -6.157  21.883 -14.445 1.00 . A A . 156 HIS CG   1 1 
        2  4781 1 1 156 HIS H    H  -8.472  20.308 -11.213 1.00 . A A . 156 HIS H    1 1 
        2  4782 1 1 156 HIS HA   H  -5.678  20.467 -12.284 1.00 . A A . 156 HIS HA   1 1 
        2  4783 1 1 156 HIS HB2  H  -7.380  20.176 -14.127 1.00 . A A . 156 HIS HB2  1 1 
        2  4784 1 1 156 HIS HB3  H  -8.103  21.702 -13.616 1.00 . A A . 156 HIS HB3  1 1 
        2  4785 1 1 156 HIS HD1  H  -4.616  20.434 -14.534 1.00 . A A . 156 HIS HD1  1 1 
        2  4786 1 1 156 HIS HD2  H  -6.969  23.854 -14.908 1.00 . A A . 156 HIS HD2  1 1 
        2  4787 1 1 156 HIS HE1  H  -3.243  22.106 -15.851 1.00 . A A . 156 HIS HE1  1 1 
        2  4788 1 1 156 HIS N    N  -7.598  19.979 -11.509 1.00 . A A . 156 HIS N    1 1 
        2  4789 1 1 156 HIS ND1  N  -4.928  21.331 -14.770 1.00 . A A . 156 HIS ND1  1 1 
        2  4790 1 1 156 HIS NE2  N  -4.944  23.382 -15.622 1.00 . A A . 156 HIS NE2  1 1 
        2  4791 1 1 156 HIS O    O  -7.591  22.875 -11.233 1.00 . A A . 156 HIS O    1 1 
        2  4792 1 1 157 HIS C    C  -3.834  24.508 -10.779 1.00 . A A . 157 HIS C    1 1 
        2  4793 1 1 157 HIS CA   C  -5.233  23.972 -10.483 1.00 . A A . 157 HIS CA   1 1 
        2  4794 1 1 157 HIS CB   C  -5.388  23.754  -8.977 1.00 . A A . 157 HIS CB   1 1 
        2  4795 1 1 157 HIS CD2  C  -4.341  25.572  -7.391 1.00 . A A . 157 HIS CD2  1 1 
        2  4796 1 1 157 HIS CE1  C  -5.845  27.112  -7.641 1.00 . A A . 157 HIS CE1  1 1 
        2  4797 1 1 157 HIS CG   C  -5.280  25.075  -8.261 1.00 . A A . 157 HIS CG   1 1 
        2  4798 1 1 157 HIS H    H  -4.617  22.140 -11.427 1.00 . A A . 157 HIS H    1 1 
        2  4799 1 1 157 HIS HA   H  -5.974  24.678 -10.828 1.00 . A A . 157 HIS HA   1 1 
        2  4800 1 1 157 HIS HB2  H  -6.351  23.314  -8.774 1.00 . A A . 157 HIS HB2  1 1 
        2  4801 1 1 157 HIS HB3  H  -4.607  23.094  -8.627 1.00 . A A . 157 HIS HB3  1 1 
        2  4802 1 1 157 HIS HD1  H  -7.037  26.030  -8.959 1.00 . A A . 157 HIS HD1  1 1 
        2  4803 1 1 157 HIS HD2  H  -3.460  25.045  -7.059 1.00 . A A . 157 HIS HD2  1 1 
        2  4804 1 1 157 HIS HE1  H  -6.393  28.037  -7.557 1.00 . A A . 157 HIS HE1  1 1 
        2  4805 1 1 157 HIS N    N  -5.404  22.673 -11.192 1.00 . A A . 157 HIS N    1 1 
        2  4806 1 1 157 HIS ND1  N  -6.231  26.073  -8.404 1.00 . A A . 157 HIS ND1  1 1 
        2  4807 1 1 157 HIS NE2  N  -4.700  26.859  -7.002 1.00 . A A . 157 HIS NE2  1 1 
        2  4808 1 1 157 HIS O    O  -3.488  25.613 -10.409 1.00 . A A . 157 HIS O    1 1 
        2  4809 1 1 158 HIS C    C  -1.641  25.193 -12.883 1.00 . A A . 158 HIS C    1 1 
        2  4810 1 1 158 HIS CA   C  -1.634  24.166 -11.744 1.00 . A A . 158 HIS CA   1 1 
        2  4811 1 1 158 HIS CB   C  -0.796  22.951 -12.155 1.00 . A A . 158 HIS CB   1 1 
        2  4812 1 1 158 HIS CD2  C   1.712  23.350 -11.479 1.00 . A A . 158 HIS CD2  1 1 
        2  4813 1 1 158 HIS CE1  C   2.417  24.168 -13.357 1.00 . A A . 158 HIS CE1  1 1 
        2  4814 1 1 158 HIS CG   C   0.637  23.370 -12.333 1.00 . A A . 158 HIS CG   1 1 
        2  4815 1 1 158 HIS H    H  -3.325  22.833 -11.709 1.00 . A A . 158 HIS H    1 1 
        2  4816 1 1 158 HIS HA   H  -1.199  24.615 -10.865 1.00 . A A . 158 HIS HA   1 1 
        2  4817 1 1 158 HIS HB2  H  -0.857  22.194 -11.386 1.00 . A A . 158 HIS HB2  1 1 
        2  4818 1 1 158 HIS HB3  H  -1.172  22.551 -13.084 1.00 . A A . 158 HIS HB3  1 1 
        2  4819 1 1 158 HIS HD1  H   0.588  24.045 -14.339 1.00 . A A . 158 HIS HD1  1 1 
        2  4820 1 1 158 HIS HD2  H   1.690  22.996 -10.458 1.00 . A A . 158 HIS HD2  1 1 
        2  4821 1 1 158 HIS HE1  H   3.051  24.589 -14.123 1.00 . A A . 158 HIS HE1  1 1 
        2  4822 1 1 158 HIS N    N  -3.022  23.724 -11.432 1.00 . A A . 158 HIS N    1 1 
        2  4823 1 1 158 HIS ND1  N   1.110  23.896 -13.524 1.00 . A A . 158 HIS ND1  1 1 
        2  4824 1 1 158 HIS NE2  N   2.836  23.854 -12.128 1.00 . A A . 158 HIS NE2  1 1 
        2  4825 1 1 158 HIS O    O  -2.351  25.054 -13.860 1.00 . A A . 158 HIS O    1 1 
        2  4826 1 1 159 HIS C    C  -2.175  27.690 -14.239 1.00 . A A . 159 HIS C    1 1 
        2  4827 1 1 159 HIS CA   C  -0.767  27.269 -13.818 1.00 . A A . 159 HIS CA   1 1 
        2  4828 1 1 159 HIS CB   C  -0.009  26.724 -15.034 1.00 . A A . 159 HIS CB   1 1 
        2  4829 1 1 159 HIS CD2  C  -0.630  27.880 -17.315 1.00 . A A . 159 HIS CD2  1 1 
        2  4830 1 1 159 HIS CE1  C   0.632  29.632 -17.134 1.00 . A A . 159 HIS CE1  1 1 
        2  4831 1 1 159 HIS CG   C   0.028  27.774 -16.114 1.00 . A A . 159 HIS CG   1 1 
        2  4832 1 1 159 HIS H    H  -0.275  26.297 -11.960 1.00 . A A . 159 HIS H    1 1 
        2  4833 1 1 159 HIS HA   H  -0.242  28.129 -13.431 1.00 . A A . 159 HIS HA   1 1 
        2  4834 1 1 159 HIS HB2  H   0.999  26.470 -14.745 1.00 . A A . 159 HIS HB2  1 1 
        2  4835 1 1 159 HIS HB3  H  -0.510  25.842 -15.407 1.00 . A A . 159 HIS HB3  1 1 
        2  4836 1 1 159 HIS HD1  H   1.425  29.128 -15.278 1.00 . A A . 159 HIS HD1  1 1 
        2  4837 1 1 159 HIS HD2  H  -1.338  27.160 -17.704 1.00 . A A . 159 HIS HD2  1 1 
        2  4838 1 1 159 HIS HE1  H   1.124  30.570 -17.337 1.00 . A A . 159 HIS HE1  1 1 
        2  4839 1 1 159 HIS N    N  -0.839  26.218 -12.758 1.00 . A A . 159 HIS N    1 1 
        2  4840 1 1 159 HIS ND1  N   0.827  28.902 -16.020 1.00 . A A . 159 HIS ND1  1 1 
        2  4841 1 1 159 HIS NE2  N  -0.248  29.054 -17.957 1.00 . A A . 159 HIS NE2  1 1 
        2  4842 1 1 159 HIS O    O  -2.809  27.050 -15.054 1.00 . A A . 159 HIS O    1 1 
        2  4843 1 1 160 HIS C    C  -4.061  30.790 -13.929 1.00 . A A . 160 HIS C    1 1 
        2  4844 1 1 160 HIS CA   C  -4.028  29.264 -14.051 1.00 . A A . 160 HIS CA   1 1 
        2  4845 1 1 160 HIS CB   C  -5.067  28.642 -13.110 1.00 . A A . 160 HIS CB   1 1 
        2  4846 1 1 160 HIS CD2  C  -5.604  30.181 -11.046 1.00 . A A . 160 HIS CD2  1 1 
        2  4847 1 1 160 HIS CE1  C  -4.088  29.433  -9.690 1.00 . A A . 160 HIS CE1  1 1 
        2  4848 1 1 160 HIS CG   C  -4.913  29.204 -11.721 1.00 . A A . 160 HIS CG   1 1 
        2  4849 1 1 160 HIS H    H  -2.126  29.274 -13.041 1.00 . A A . 160 HIS H    1 1 
        2  4850 1 1 160 HIS HA   H  -4.255  28.984 -15.073 1.00 . A A . 160 HIS HA   1 1 
        2  4851 1 1 160 HIS HB2  H  -6.059  28.863 -13.479 1.00 . A A . 160 HIS HB2  1 1 
        2  4852 1 1 160 HIS HB3  H  -4.929  27.572 -13.082 1.00 . A A . 160 HIS HB3  1 1 
        2  4853 1 1 160 HIS HD1  H  -3.286  28.045 -11.018 1.00 . A A . 160 HIS HD1  1 1 
        2  4854 1 1 160 HIS HD2  H  -6.425  30.753 -11.448 1.00 . A A . 160 HIS HD2  1 1 
        2  4855 1 1 160 HIS HE1  H  -3.475  29.280  -8.814 1.00 . A A . 160 HIS HE1  1 1 
        2  4856 1 1 160 HIS N    N  -2.664  28.774 -13.690 1.00 . A A . 160 HIS N    1 1 
        2  4857 1 1 160 HIS ND1  N  -3.949  28.743 -10.838 1.00 . A A . 160 HIS ND1  1 1 
        2  4858 1 1 160 HIS NE2  N  -5.080  30.323  -9.763 1.00 . A A . 160 HIS NE2  1 1 
        2  4859 1 1 160 HIS O    O  -3.695  31.287 -12.876 1.00 . A A . 160 HIS O    1 1 
        2  4860 1 1 160 HIS OXT  O  -4.445  31.435 -14.889 1.00 . A A . 160 HIS OXT  1 1 
        3  4861 1 1   1 MET C    C  15.999   5.356 -23.107 1.00 . A A .   1 MET C    1 1 
        3  4862 1 1   1 MET CA   C  15.896   5.361 -24.633 1.00 . A A .   1 MET CA   1 1 
        3  4863 1 1   1 MET CB   C  14.613   6.077 -25.067 1.00 . A A .   1 MET CB   1 1 
        3  4864 1 1   1 MET CE   C  15.423   8.705 -26.571 1.00 . A A .   1 MET CE   1 1 
        3  4865 1 1   1 MET CG   C  14.539   6.126 -26.598 1.00 . A A .   1 MET CG   1 1 
        3  4866 1 1   1 MET H1   H  16.701   3.448 -24.773 1.00 . A A .   1 MET H1   1 1 
        3  4867 1 1   1 MET H2   H  15.848   3.944 -26.156 1.00 . A A .   1 MET H2   1 1 
        3  4868 1 1   1 MET H3   H  15.007   3.484 -24.752 1.00 . A A .   1 MET H3   1 1 
        3  4869 1 1   1 MET HA   H  16.754   5.866 -25.048 1.00 . A A .   1 MET HA   1 1 
        3  4870 1 1   1 MET HB2  H  13.755   5.542 -24.683 1.00 . A A .   1 MET HB2  1 1 
        3  4871 1 1   1 MET HB3  H  14.612   7.084 -24.677 1.00 . A A .   1 MET HB3  1 1 
        3  4872 1 1   1 MET HE1  H  15.889   8.842 -25.605 1.00 . A A .   1 MET HE1  1 1 
        3  4873 1 1   1 MET HE2  H  14.348   8.736 -26.465 1.00 . A A .   1 MET HE2  1 1 
        3  4874 1 1   1 MET HE3  H  15.739   9.494 -27.234 1.00 . A A .   1 MET HE3  1 1 
        3  4875 1 1   1 MET HG2  H  14.597   5.122 -26.990 1.00 . A A .   1 MET HG2  1 1 
        3  4876 1 1   1 MET HG3  H  13.604   6.573 -26.900 1.00 . A A .   1 MET HG3  1 1 
        3  4877 1 1   1 MET N    N  15.861   3.954 -25.116 1.00 . A A .   1 MET N    1 1 
        3  4878 1 1   1 MET O    O  15.334   6.108 -22.423 1.00 . A A .   1 MET O    1 1 
        3  4879 1 1   1 MET SD   S  15.917   7.103 -27.255 1.00 . A A .   1 MET SD   1 1 
        3  4880 1 1   2 GLU C    C  17.600   5.721 -20.566 1.00 . A A .   2 GLU C    1 1 
        3  4881 1 1   2 GLU CA   C  16.982   4.427 -21.093 1.00 . A A .   2 GLU CA   1 1 
        3  4882 1 1   2 GLU CB   C  17.881   3.242 -20.731 1.00 . A A .   2 GLU CB   1 1 
        3  4883 1 1   2 GLU CD   C  20.110   2.176 -21.101 1.00 . A A .   2 GLU CD   1 1 
        3  4884 1 1   2 GLU CG   C  19.244   3.400 -21.411 1.00 . A A .   2 GLU CG   1 1 
        3  4885 1 1   2 GLU H    H  17.351   3.902 -23.148 1.00 . A A .   2 GLU H    1 1 
        3  4886 1 1   2 GLU HA   H  16.011   4.286 -20.644 1.00 . A A .   2 GLU HA   1 1 
        3  4887 1 1   2 GLU HB2  H  18.018   3.211 -19.659 1.00 . A A .   2 GLU HB2  1 1 
        3  4888 1 1   2 GLU HB3  H  17.420   2.325 -21.063 1.00 . A A .   2 GLU HB3  1 1 
        3  4889 1 1   2 GLU HG2  H  19.106   3.482 -22.480 1.00 . A A .   2 GLU HG2  1 1 
        3  4890 1 1   2 GLU HG3  H  19.733   4.287 -21.040 1.00 . A A .   2 GLU HG3  1 1 
        3  4891 1 1   2 GLU N    N  16.830   4.502 -22.571 1.00 . A A .   2 GLU N    1 1 
        3  4892 1 1   2 GLU O    O  18.489   6.290 -21.166 1.00 . A A .   2 GLU O    1 1 
        3  4893 1 1   2 GLU OE1  O  19.568   1.084 -21.076 1.00 . A A .   2 GLU OE1  1 1 
        3  4894 1 1   2 GLU OE2  O  21.299   2.353 -20.895 1.00 . A A .   2 GLU OE2  1 1 
        3  4895 1 1   3 LYS C    C  17.471   7.436 -17.343 1.00 . A A .   3 LYS C    1 1 
        3  4896 1 1   3 LYS CA   C  17.693   7.437 -18.859 1.00 . A A .   3 LYS CA   1 1 
        3  4897 1 1   3 LYS CB   C  16.995   8.644 -19.490 1.00 . A A .   3 LYS CB   1 1 
        3  4898 1 1   3 LYS CD   C  16.978  11.134 -19.656 1.00 . A A .   3 LYS CD   1 1 
        3  4899 1 1   3 LYS CE   C  17.621  12.425 -19.147 1.00 . A A .   3 LYS CE   1 1 
        3  4900 1 1   3 LYS CG   C  17.619   9.934 -18.957 1.00 . A A .   3 LYS CG   1 1 
        3  4901 1 1   3 LYS H    H  16.421   5.706 -18.969 1.00 . A A .   3 LYS H    1 1 
        3  4902 1 1   3 LYS HA   H  18.753   7.488 -19.062 1.00 . A A .   3 LYS HA   1 1 
        3  4903 1 1   3 LYS HB2  H  17.111   8.602 -20.563 1.00 . A A .   3 LYS HB2  1 1 
        3  4904 1 1   3 LYS HB3  H  15.944   8.623 -19.241 1.00 . A A .   3 LYS HB3  1 1 
        3  4905 1 1   3 LYS HD2  H  17.130  11.051 -20.722 1.00 . A A .   3 LYS HD2  1 1 
        3  4906 1 1   3 LYS HD3  H  15.920  11.151 -19.443 1.00 . A A .   3 LYS HD3  1 1 
        3  4907 1 1   3 LYS HE2  H  18.695  12.355 -19.245 1.00 . A A .   3 LYS HE2  1 1 
        3  4908 1 1   3 LYS HE3  H  17.259  13.260 -19.728 1.00 . A A .   3 LYS HE3  1 1 
        3  4909 1 1   3 LYS HG2  H  17.449  10.003 -17.892 1.00 . A A .   3 LYS HG2  1 1 
        3  4910 1 1   3 LYS HG3  H  18.680   9.929 -19.154 1.00 . A A .   3 LYS HG3  1 1 
        3  4911 1 1   3 LYS HZ1  H  17.137  13.636 -17.524 1.00 . A A .   3 LYS HZ1  1 1 
        3  4912 1 1   3 LYS HZ2  H  18.027  12.252 -17.111 1.00 . A A .   3 LYS HZ2  1 1 
        3  4913 1 1   3 LYS HZ3  H  16.378  12.116 -17.504 1.00 . A A .   3 LYS HZ3  1 1 
        3  4914 1 1   3 LYS N    N  17.136   6.184 -19.438 1.00 . A A .   3 LYS N    1 1 
        3  4915 1 1   3 LYS NZ   N  17.263  12.622 -17.713 1.00 . A A .   3 LYS NZ   1 1 
        3  4916 1 1   3 LYS O    O  16.363   7.573 -16.867 1.00 . A A .   3 LYS O    1 1 
        3  4917 1 1   4 ALA C    C  17.502   6.127 -14.645 1.00 . A A .   4 ALA C    1 1 
        3  4918 1 1   4 ALA CA   C  18.406   7.276 -15.102 1.00 . A A .   4 ALA CA   1 1 
        3  4919 1 1   4 ALA CB   C  17.818   8.605 -14.623 1.00 . A A .   4 ALA CB   1 1 
        3  4920 1 1   4 ALA H    H  19.406   7.178 -17.007 1.00 . A A .   4 ALA H    1 1 
        3  4921 1 1   4 ALA HA   H  19.386   7.146 -14.672 1.00 . A A .   4 ALA HA   1 1 
        3  4922 1 1   4 ALA HB1  H  18.285   9.419 -15.157 1.00 . A A .   4 ALA HB1  1 1 
        3  4923 1 1   4 ALA HB2  H  18.005   8.715 -13.566 1.00 . A A .   4 ALA HB2  1 1 
        3  4924 1 1   4 ALA HB3  H  16.754   8.618 -14.803 1.00 . A A .   4 ALA HB3  1 1 
        3  4925 1 1   4 ALA N    N  18.525   7.285 -16.590 1.00 . A A .   4 ALA N    1 1 
        3  4926 1 1   4 ALA O    O  16.402   5.952 -15.133 1.00 . A A .   4 ALA O    1 1 
        3  4927 1 1   5 MET C    C  17.577   3.844 -11.771 1.00 . A A .   5 MET C    1 1 
        3  4928 1 1   5 MET CA   C  17.132   4.217 -13.193 1.00 . A A .   5 MET CA   1 1 
        3  4929 1 1   5 MET CB   C  17.308   3.008 -14.117 1.00 . A A .   5 MET CB   1 1 
        3  4930 1 1   5 MET CE   C  16.298  -0.858 -13.319 1.00 . A A .   5 MET CE   1 1 
        3  4931 1 1   5 MET CG   C  16.423   1.829 -13.638 1.00 . A A .   5 MET CG   1 1 
        3  4932 1 1   5 MET H    H  18.843   5.512 -13.315 1.00 . A A .   5 MET H    1 1 
        3  4933 1 1   5 MET HA   H  16.091   4.508 -13.176 1.00 . A A .   5 MET HA   1 1 
        3  4934 1 1   5 MET HB2  H  17.024   3.292 -15.122 1.00 . A A .   5 MET HB2  1 1 
        3  4935 1 1   5 MET HB3  H  18.346   2.708 -14.115 1.00 . A A .   5 MET HB3  1 1 
        3  4936 1 1   5 MET HE1  H  16.580  -1.726 -12.740 1.00 . A A .   5 MET HE1  1 1 
        3  4937 1 1   5 MET HE2  H  16.316  -1.099 -14.373 1.00 . A A .   5 MET HE2  1 1 
        3  4938 1 1   5 MET HE3  H  15.302  -0.552 -13.041 1.00 . A A .   5 MET HE3  1 1 
        3  4939 1 1   5 MET HG2  H  15.750   2.161 -12.860 1.00 . A A .   5 MET HG2  1 1 
        3  4940 1 1   5 MET HG3  H  15.843   1.454 -14.469 1.00 . A A .   5 MET HG3  1 1 
        3  4941 1 1   5 MET N    N  17.958   5.348 -13.698 1.00 . A A .   5 MET N    1 1 
        3  4942 1 1   5 MET O    O  17.904   2.708 -11.496 1.00 . A A .   5 MET O    1 1 
        3  4943 1 1   5 MET SD   S  17.459   0.490 -12.989 1.00 . A A .   5 MET SD   1 1 
        3  4944 1 1   6 PRO C    C  16.953   3.778  -8.657 1.00 . A A .   6 PRO C    1 1 
        3  4945 1 1   6 PRO CA   C  17.987   4.586  -9.454 1.00 . A A .   6 PRO CA   1 1 
        3  4946 1 1   6 PRO CB   C  18.110   6.014  -8.900 1.00 . A A .   6 PRO CB   1 1 
        3  4947 1 1   6 PRO CD   C  17.200   6.204 -11.125 1.00 . A A .   6 PRO CD   1 1 
        3  4948 1 1   6 PRO CG   C  17.156   6.816  -9.723 1.00 . A A .   6 PRO CG   1 1 
        3  4949 1 1   6 PRO HA   H  18.948   4.100  -9.410 1.00 . A A .   6 PRO HA   1 1 
        3  4950 1 1   6 PRO HB2  H  17.830   6.044  -7.852 1.00 . A A .   6 PRO HB2  1 1 
        3  4951 1 1   6 PRO HB3  H  19.114   6.386  -9.032 1.00 . A A .   6 PRO HB3  1 1 
        3  4952 1 1   6 PRO HD2  H  16.227   6.259 -11.596 1.00 . A A .   6 PRO HD2  1 1 
        3  4953 1 1   6 PRO HD3  H  17.948   6.693 -11.729 1.00 . A A .   6 PRO HD3  1 1 
        3  4954 1 1   6 PRO HG2  H  16.156   6.744  -9.311 1.00 . A A .   6 PRO HG2  1 1 
        3  4955 1 1   6 PRO HG3  H  17.469   7.849  -9.766 1.00 . A A .   6 PRO HG3  1 1 
        3  4956 1 1   6 PRO N    N  17.583   4.802 -10.877 1.00 . A A .   6 PRO N    1 1 
        3  4957 1 1   6 PRO O    O  15.772   3.804  -8.939 1.00 . A A .   6 PRO O    1 1 
        3  4958 1 1   7 GLU C    C  17.257   1.681  -5.646 1.00 . A A .   7 GLU C    1 1 
        3  4959 1 1   7 GLU CA   C  16.464   2.281  -6.809 1.00 . A A .   7 GLU CA   1 1 
        3  4960 1 1   7 GLU CB   C  15.820   1.173  -7.650 1.00 . A A .   7 GLU CB   1 1 
        3  4961 1 1   7 GLU CD   C  16.239  -0.650  -9.302 1.00 . A A .   7 GLU CD   1 1 
        3  4962 1 1   7 GLU CG   C  16.896   0.432  -8.443 1.00 . A A .   7 GLU CG   1 1 
        3  4963 1 1   7 GLU H    H  18.354   3.088  -7.437 1.00 . A A .   7 GLU H    1 1 
        3  4964 1 1   7 GLU HA   H  15.694   2.931  -6.418 1.00 . A A .   7 GLU HA   1 1 
        3  4965 1 1   7 GLU HB2  H  15.310   0.479  -7.000 1.00 . A A .   7 GLU HB2  1 1 
        3  4966 1 1   7 GLU HB3  H  15.110   1.611  -8.337 1.00 . A A .   7 GLU HB3  1 1 
        3  4967 1 1   7 GLU HG2  H  17.419   1.131  -9.079 1.00 . A A .   7 GLU HG2  1 1 
        3  4968 1 1   7 GLU HG3  H  17.595  -0.028  -7.759 1.00 . A A .   7 GLU HG3  1 1 
        3  4969 1 1   7 GLU N    N  17.397   3.079  -7.652 1.00 . A A .   7 GLU N    1 1 
        3  4970 1 1   7 GLU O    O  17.316   0.481  -5.470 1.00 . A A .   7 GLU O    1 1 
        3  4971 1 1   7 GLU OE1  O  15.167  -0.391  -9.827 1.00 . A A .   7 GLU OE1  1 1 
        3  4972 1 1   7 GLU OE2  O  16.816  -1.717  -9.419 1.00 . A A .   7 GLU OE2  1 1 
        3  4973 1 1   8 SER C    C  17.759   1.494  -2.614 1.00 . A A .   8 SER C    1 1 
        3  4974 1 1   8 SER CA   C  18.687   2.019  -3.708 1.00 . A A .   8 SER CA   1 1 
        3  4975 1 1   8 SER CB   C  19.532   3.165  -3.151 1.00 . A A .   8 SER CB   1 1 
        3  4976 1 1   8 SER H    H  17.821   3.484  -5.028 1.00 . A A .   8 SER H    1 1 
        3  4977 1 1   8 SER HA   H  19.335   1.225  -4.044 1.00 . A A .   8 SER HA   1 1 
        3  4978 1 1   8 SER HB2  H  18.897   3.867  -2.635 1.00 . A A .   8 SER HB2  1 1 
        3  4979 1 1   8 SER HB3  H  20.263   2.770  -2.460 1.00 . A A .   8 SER HB3  1 1 
        3  4980 1 1   8 SER HG   H  19.560   4.447  -4.616 1.00 . A A .   8 SER HG   1 1 
        3  4981 1 1   8 SER N    N  17.879   2.520  -4.857 1.00 . A A .   8 SER N    1 1 
        3  4982 1 1   8 SER O    O  16.804   2.144  -2.238 1.00 . A A .   8 SER O    1 1 
        3  4983 1 1   8 SER OG   O  20.186   3.830  -4.224 1.00 . A A .   8 SER OG   1 1 
        3  4984 1 1   9 PHE C    C  15.723   0.049  -1.257 1.00 . A A .   9 PHE C    1 1 
        3  4985 1 1   9 PHE CA   C  17.200  -0.285  -1.021 1.00 . A A .   9 PHE CA   1 1 
        3  4986 1 1   9 PHE CB   C  17.644   0.256   0.340 1.00 . A A .   9 PHE CB   1 1 
        3  4987 1 1   9 PHE CD1  C  19.185  -1.524   1.248 1.00 . A A .   9 PHE CD1  1 1 
        3  4988 1 1   9 PHE CD2  C  20.155   0.512   0.357 1.00 . A A .   9 PHE CD2  1 1 
        3  4989 1 1   9 PHE CE1  C  20.466  -2.007   1.540 1.00 . A A .   9 PHE CE1  1 1 
        3  4990 1 1   9 PHE CE2  C  21.437   0.029   0.649 1.00 . A A .   9 PHE CE2  1 1 
        3  4991 1 1   9 PHE CG   C  19.028  -0.263   0.656 1.00 . A A .   9 PHE CG   1 1 
        3  4992 1 1   9 PHE CZ   C  21.592  -1.231   1.240 1.00 . A A .   9 PHE CZ   1 1 
        3  4993 1 1   9 PHE H    H  18.829  -0.168  -2.426 1.00 . A A .   9 PHE H    1 1 
        3  4994 1 1   9 PHE HA   H  17.326  -1.357  -1.034 1.00 . A A .   9 PHE HA   1 1 
        3  4995 1 1   9 PHE HB2  H  17.662   1.336   0.312 1.00 . A A .   9 PHE HB2  1 1 
        3  4996 1 1   9 PHE HB3  H  16.954  -0.074   1.102 1.00 . A A .   9 PHE HB3  1 1 
        3  4997 1 1   9 PHE HD1  H  18.316  -2.123   1.480 1.00 . A A .   9 PHE HD1  1 1 
        3  4998 1 1   9 PHE HD2  H  20.035   1.483  -0.099 1.00 . A A .   9 PHE HD2  1 1 
        3  4999 1 1   9 PHE HE1  H  20.586  -2.979   1.995 1.00 . A A .   9 PHE HE1  1 1 
        3  5000 1 1   9 PHE HE2  H  22.306   0.627   0.418 1.00 . A A .   9 PHE HE2  1 1 
        3  5001 1 1   9 PHE HZ   H  22.581  -1.604   1.465 1.00 . A A .   9 PHE HZ   1 1 
        3  5002 1 1   9 PHE N    N  18.047   0.321  -2.100 1.00 . A A .   9 PHE N    1 1 
        3  5003 1 1   9 PHE O    O  15.164   0.912  -0.610 1.00 . A A .   9 PHE O    1 1 
        3  5004 1 1  10 VAL C    C  12.870  -1.668  -2.424 1.00 . A A .  10 VAL C    1 1 
        3  5005 1 1  10 VAL CA   C  13.651  -0.357  -2.492 1.00 . A A .  10 VAL CA   1 1 
        3  5006 1 1  10 VAL CB   C  13.527   0.245  -3.896 1.00 . A A .  10 VAL CB   1 1 
        3  5007 1 1  10 VAL CG1  C  12.051   0.326  -4.295 1.00 . A A .  10 VAL CG1  1 1 
        3  5008 1 1  10 VAL CG2  C  14.134   1.652  -3.901 1.00 . A A .  10 VAL CG2  1 1 
        3  5009 1 1  10 VAL H    H  15.573  -1.313  -2.698 1.00 . A A .  10 VAL H    1 1 
        3  5010 1 1  10 VAL HA   H  13.239   0.331  -1.768 1.00 . A A .  10 VAL HA   1 1 
        3  5011 1 1  10 VAL HB   H  14.057  -0.379  -4.602 1.00 . A A .  10 VAL HB   1 1 
        3  5012 1 1  10 VAL HG11 H  11.681  -0.664  -4.516 1.00 . A A .  10 VAL HG11 1 1 
        3  5013 1 1  10 VAL HG12 H  11.950   0.952  -5.170 1.00 . A A .  10 VAL HG12 1 1 
        3  5014 1 1  10 VAL HG13 H  11.483   0.751  -3.481 1.00 . A A .  10 VAL HG13 1 1 
        3  5015 1 1  10 VAL HG21 H  13.831   2.171  -4.799 1.00 . A A .  10 VAL HG21 1 1 
        3  5016 1 1  10 VAL HG22 H  15.212   1.578  -3.875 1.00 . A A .  10 VAL HG22 1 1 
        3  5017 1 1  10 VAL HG23 H  13.790   2.199  -3.037 1.00 . A A .  10 VAL HG23 1 1 
        3  5018 1 1  10 VAL N    N  15.092  -0.628  -2.188 1.00 . A A .  10 VAL N    1 1 
        3  5019 1 1  10 VAL O    O  13.316  -2.694  -2.899 1.00 . A A .  10 VAL O    1 1 
        3  5020 1 1  11 VAL C    C   9.595  -2.689  -2.535 1.00 . A A .  11 VAL C    1 1 
        3  5021 1 1  11 VAL CA   C  10.866  -2.864  -1.706 1.00 . A A .  11 VAL CA   1 1 
        3  5022 1 1  11 VAL CB   C  10.499  -3.063  -0.232 1.00 . A A .  11 VAL CB   1 1 
        3  5023 1 1  11 VAL CG1  C   9.411  -4.133  -0.100 1.00 . A A .  11 VAL CG1  1 1 
        3  5024 1 1  11 VAL CG2  C  11.744  -3.504   0.536 1.00 . A A .  11 VAL CG2  1 1 
        3  5025 1 1  11 VAL H    H  11.380  -0.789  -1.454 1.00 . A A .  11 VAL H    1 1 
        3  5026 1 1  11 VAL HA   H  11.410  -3.730  -2.059 1.00 . A A .  11 VAL HA   1 1 
        3  5027 1 1  11 VAL HB   H  10.135  -2.128   0.175 1.00 . A A .  11 VAL HB   1 1 
        3  5028 1 1  11 VAL HG11 H   9.339  -4.447   0.929 1.00 . A A .  11 VAL HG11 1 1 
        3  5029 1 1  11 VAL HG12 H   9.666  -4.981  -0.720 1.00 . A A .  11 VAL HG12 1 1 
        3  5030 1 1  11 VAL HG13 H   8.463  -3.725  -0.420 1.00 . A A .  11 VAL HG13 1 1 
        3  5031 1 1  11 VAL HG21 H  12.052  -4.478   0.191 1.00 . A A .  11 VAL HG21 1 1 
        3  5032 1 1  11 VAL HG22 H  11.518  -3.550   1.591 1.00 . A A .  11 VAL HG22 1 1 
        3  5033 1 1  11 VAL HG23 H  12.540  -2.793   0.369 1.00 . A A .  11 VAL HG23 1 1 
        3  5034 1 1  11 VAL N    N  11.706  -1.634  -1.829 1.00 . A A .  11 VAL N    1 1 
        3  5035 1 1  11 VAL O    O   8.935  -1.671  -2.467 1.00 . A A .  11 VAL O    1 1 
        3  5036 1 1  12 ARG C    C   7.059  -4.716  -3.779 1.00 . A A .  12 ARG C    1 1 
        3  5037 1 1  12 ARG CA   C   8.025  -3.601  -4.173 1.00 . A A .  12 ARG CA   1 1 
        3  5038 1 1  12 ARG CB   C   8.423  -3.761  -5.639 1.00 . A A .  12 ARG CB   1 1 
        3  5039 1 1  12 ARG CD   C   9.614  -2.673  -7.549 1.00 . A A .  12 ARG CD   1 1 
        3  5040 1 1  12 ARG CG   C   9.232  -2.539  -6.075 1.00 . A A .  12 ARG CG   1 1 
        3  5041 1 1  12 ARG CZ   C  11.806  -3.704  -7.346 1.00 . A A .  12 ARG CZ   1 1 
        3  5042 1 1  12 ARG H    H   9.811  -4.487  -3.353 1.00 . A A .  12 ARG H    1 1 
        3  5043 1 1  12 ARG HA   H   7.536  -2.646  -4.039 1.00 . A A .  12 ARG HA   1 1 
        3  5044 1 1  12 ARG HB2  H   9.025  -4.653  -5.754 1.00 . A A .  12 ARG HB2  1 1 
        3  5045 1 1  12 ARG HB3  H   7.535  -3.842  -6.248 1.00 . A A .  12 ARG HB3  1 1 
        3  5046 1 1  12 ARG HD2  H   8.725  -2.853  -8.134 1.00 . A A .  12 ARG HD2  1 1 
        3  5047 1 1  12 ARG HD3  H  10.086  -1.760  -7.882 1.00 . A A .  12 ARG HD3  1 1 
        3  5048 1 1  12 ARG HE   H  10.244  -4.649  -8.126 1.00 . A A .  12 ARG HE   1 1 
        3  5049 1 1  12 ARG HG2  H   8.635  -1.649  -5.937 1.00 . A A .  12 ARG HG2  1 1 
        3  5050 1 1  12 ARG HG3  H  10.127  -2.468  -5.476 1.00 . A A .  12 ARG HG3  1 1 
        3  5051 1 1  12 ARG HH11 H  11.607  -1.828  -6.670 1.00 . A A .  12 ARG HH11 1 1 
        3  5052 1 1  12 ARG HH12 H  13.187  -2.517  -6.514 1.00 . A A .  12 ARG HH12 1 1 
        3  5053 1 1  12 ARG HH21 H  12.299  -5.552  -7.933 1.00 . A A .  12 ARG HH21 1 1 
        3  5054 1 1  12 ARG HH22 H  13.580  -4.623  -7.229 1.00 . A A .  12 ARG HH22 1 1 
        3  5055 1 1  12 ARG N    N   9.253  -3.681  -3.322 1.00 . A A .  12 ARG N    1 1 
        3  5056 1 1  12 ARG NE   N  10.559  -3.814  -7.722 1.00 . A A .  12 ARG NE   1 1 
        3  5057 1 1  12 ARG NH1  N  12.233  -2.596  -6.802 1.00 . A A .  12 ARG NH1  1 1 
        3  5058 1 1  12 ARG NH2  N  12.625  -4.703  -7.516 1.00 . A A .  12 ARG NH2  1 1 
        3  5059 1 1  12 ARG O    O   7.455  -5.843  -3.550 1.00 . A A .  12 ARG O    1 1 
        3  5060 1 1  13 ARG C    C   3.524  -5.265  -4.167 1.00 . A A .  13 ARG C    1 1 
        3  5061 1 1  13 ARG CA   C   4.781  -5.446  -3.319 1.00 . A A .  13 ARG CA   1 1 
        3  5062 1 1  13 ARG CB   C   4.442  -5.299  -1.815 1.00 . A A .  13 ARG CB   1 1 
        3  5063 1 1  13 ARG CD   C   6.255  -6.910  -1.089 1.00 . A A .  13 ARG CD   1 1 
        3  5064 1 1  13 ARG CG   C   4.742  -6.614  -1.072 1.00 . A A .  13 ARG CG   1 1 
        3  5065 1 1  13 ARG CZ   C   6.218  -9.126  -2.081 1.00 . A A .  13 ARG CZ   1 1 
        3  5066 1 1  13 ARG H    H   5.496  -3.496  -3.885 1.00 . A A .  13 ARG H    1 1 
        3  5067 1 1  13 ARG HA   H   5.186  -6.430  -3.515 1.00 . A A .  13 ARG HA   1 1 
        3  5068 1 1  13 ARG HB2  H   5.039  -4.504  -1.391 1.00 . A A .  13 ARG HB2  1 1 
        3  5069 1 1  13 ARG HB3  H   3.395  -5.055  -1.687 1.00 . A A .  13 ARG HB3  1 1 
        3  5070 1 1  13 ARG HD2  H   6.814  -5.998  -1.249 1.00 . A A .  13 ARG HD2  1 1 
        3  5071 1 1  13 ARG HD3  H   6.548  -7.345  -0.145 1.00 . A A .  13 ARG HD3  1 1 
        3  5072 1 1  13 ARG HE   H   7.030  -7.560  -2.990 1.00 . A A .  13 ARG HE   1 1 
        3  5073 1 1  13 ARG HG2  H   4.399  -6.527  -0.053 1.00 . A A .  13 ARG HG2  1 1 
        3  5074 1 1  13 ARG HG3  H   4.215  -7.423  -1.559 1.00 . A A .  13 ARG HG3  1 1 
        3  5075 1 1  13 ARG HH11 H   5.343  -8.897  -0.293 1.00 . A A .  13 ARG HH11 1 1 
        3  5076 1 1  13 ARG HH12 H   5.315 -10.502  -0.942 1.00 . A A .  13 ARG HH12 1 1 
        3  5077 1 1  13 ARG HH21 H   6.997  -9.644  -3.850 1.00 . A A .  13 ARG HH21 1 1 
        3  5078 1 1  13 ARG HH22 H   6.252 -10.926  -2.955 1.00 . A A .  13 ARG HH22 1 1 
        3  5079 1 1  13 ARG N    N   5.789  -4.411  -3.700 1.00 . A A .  13 ARG N    1 1 
        3  5080 1 1  13 ARG NE   N   6.561  -7.871  -2.188 1.00 . A A .  13 ARG NE   1 1 
        3  5081 1 1  13 ARG NH1  N   5.575  -9.540  -1.023 1.00 . A A .  13 ARG NH1  1 1 
        3  5082 1 1  13 ARG NH2  N   6.512  -9.964  -3.037 1.00 . A A .  13 ARG NH2  1 1 
        3  5083 1 1  13 ARG O    O   3.213  -4.177  -4.613 1.00 . A A .  13 ARG O    1 1 
        3  5084 1 1  14 GLU C    C   0.461  -7.098  -4.557 1.00 . A A .  14 GLU C    1 1 
        3  5085 1 1  14 GLU CA   C   1.549  -6.239  -5.195 1.00 . A A .  14 GLU CA   1 1 
        3  5086 1 1  14 GLU CB   C   1.831  -6.739  -6.609 1.00 . A A .  14 GLU CB   1 1 
        3  5087 1 1  14 GLU CD   C   3.082  -6.260  -8.716 1.00 . A A .  14 GLU CD   1 1 
        3  5088 1 1  14 GLU CG   C   2.750  -5.745  -7.316 1.00 . A A .  14 GLU CG   1 1 
        3  5089 1 1  14 GLU H    H   3.072  -7.191  -4.007 1.00 . A A .  14 GLU H    1 1 
        3  5090 1 1  14 GLU HA   H   1.209  -5.215  -5.239 1.00 . A A .  14 GLU HA   1 1 
        3  5091 1 1  14 GLU HB2  H   2.312  -7.707  -6.561 1.00 . A A .  14 GLU HB2  1 1 
        3  5092 1 1  14 GLU HB3  H   0.904  -6.824  -7.154 1.00 . A A .  14 GLU HB3  1 1 
        3  5093 1 1  14 GLU HG2  H   2.252  -4.788  -7.391 1.00 . A A .  14 GLU HG2  1 1 
        3  5094 1 1  14 GLU HG3  H   3.663  -5.633  -6.751 1.00 . A A .  14 GLU HG3  1 1 
        3  5095 1 1  14 GLU N    N   2.797  -6.327  -4.384 1.00 . A A .  14 GLU N    1 1 
        3  5096 1 1  14 GLU O    O   0.734  -8.074  -3.886 1.00 . A A .  14 GLU O    1 1 
        3  5097 1 1  14 GLU OE1  O   2.577  -7.311  -9.072 1.00 . A A .  14 GLU OE1  1 1 
        3  5098 1 1  14 GLU OE2  O   3.832  -5.593  -9.408 1.00 . A A .  14 GLU OE2  1 1 
        3  5099 1 1  15 ALA C    C  -3.159  -7.253  -4.998 1.00 . A A .  15 ALA C    1 1 
        3  5100 1 1  15 ALA CA   C  -1.896  -7.524  -4.184 1.00 . A A .  15 ALA CA   1 1 
        3  5101 1 1  15 ALA CB   C  -2.122  -7.106  -2.729 1.00 . A A .  15 ALA CB   1 1 
        3  5102 1 1  15 ALA H    H  -0.964  -5.948  -5.313 1.00 . A A .  15 ALA H    1 1 
        3  5103 1 1  15 ALA HA   H  -1.659  -8.577  -4.226 1.00 . A A .  15 ALA HA   1 1 
        3  5104 1 1  15 ALA HB1  H  -1.247  -7.346  -2.145 1.00 . A A .  15 ALA HB1  1 1 
        3  5105 1 1  15 ALA HB2  H  -2.976  -7.633  -2.333 1.00 . A A .  15 ALA HB2  1 1 
        3  5106 1 1  15 ALA HB3  H  -2.301  -6.042  -2.684 1.00 . A A .  15 ALA HB3  1 1 
        3  5107 1 1  15 ALA N    N  -0.774  -6.739  -4.765 1.00 . A A .  15 ALA N    1 1 
        3  5108 1 1  15 ALA O    O  -3.299  -6.209  -5.604 1.00 . A A .  15 ALA O    1 1 
        3  5109 1 1  16 HIS C    C  -6.502  -7.693  -4.875 1.00 . A A .  16 HIS C    1 1 
        3  5110 1 1  16 HIS CA   C  -5.335  -7.992  -5.813 1.00 . A A .  16 HIS CA   1 1 
        3  5111 1 1  16 HIS CB   C  -5.628  -9.271  -6.596 1.00 . A A .  16 HIS CB   1 1 
        3  5112 1 1  16 HIS CD2  C  -3.552 -10.382  -7.763 1.00 . A A .  16 HIS CD2  1 1 
        3  5113 1 1  16 HIS CE1  C  -3.410  -9.056  -9.471 1.00 . A A .  16 HIS CE1  1 1 
        3  5114 1 1  16 HIS CG   C  -4.564  -9.461  -7.638 1.00 . A A .  16 HIS CG   1 1 
        3  5115 1 1  16 HIS H    H  -3.935  -9.022  -4.535 1.00 . A A .  16 HIS H    1 1 
        3  5116 1 1  16 HIS HA   H  -5.218  -7.173  -6.507 1.00 . A A .  16 HIS HA   1 1 
        3  5117 1 1  16 HIS HB2  H  -5.630 -10.114  -5.921 1.00 . A A .  16 HIS HB2  1 1 
        3  5118 1 1  16 HIS HB3  H  -6.591  -9.188  -7.075 1.00 . A A .  16 HIS HB3  1 1 
        3  5119 1 1  16 HIS HD1  H  -5.028  -7.859  -8.943 1.00 . A A .  16 HIS HD1  1 1 
        3  5120 1 1  16 HIS HD2  H  -3.350 -11.183  -7.069 1.00 . A A .  16 HIS HD2  1 1 
        3  5121 1 1  16 HIS HE1  H  -3.087  -8.594 -10.392 1.00 . A A .  16 HIS HE1  1 1 
        3  5122 1 1  16 HIS N    N  -4.077  -8.185  -5.027 1.00 . A A .  16 HIS N    1 1 
        3  5123 1 1  16 HIS ND1  N  -4.454  -8.626  -8.738 1.00 . A A .  16 HIS ND1  1 1 
        3  5124 1 1  16 HIS NE2  N  -2.825 -10.124  -8.922 1.00 . A A .  16 HIS NE2  1 1 
        3  5125 1 1  16 HIS O    O  -6.824  -8.472  -3.997 1.00 . A A .  16 HIS O    1 1 
        3  5126 1 1  17 LEU C    C  -9.560  -6.128  -5.071 1.00 . A A .  17 LEU C    1 1 
        3  5127 1 1  17 LEU CA   C  -8.306  -6.184  -4.205 1.00 . A A .  17 LEU CA   1 1 
        3  5128 1 1  17 LEU CB   C  -8.051  -4.809  -3.575 1.00 . A A .  17 LEU CB   1 1 
        3  5129 1 1  17 LEU CD1  C  -5.539  -4.596  -3.329 1.00 . A A .  17 LEU CD1  1 1 
        3  5130 1 1  17 LEU CD2  C  -7.035  -3.842  -1.482 1.00 . A A .  17 LEU CD2  1 1 
        3  5131 1 1  17 LEU CG   C  -6.856  -4.882  -2.593 1.00 . A A .  17 LEU CG   1 1 
        3  5132 1 1  17 LEU H    H  -6.861  -5.964  -5.784 1.00 . A A .  17 LEU H    1 1 
        3  5133 1 1  17 LEU HA   H  -8.451  -6.916  -3.423 1.00 . A A .  17 LEU HA   1 1 
        3  5134 1 1  17 LEU HB2  H  -7.839  -4.092  -4.360 1.00 . A A .  17 LEU HB2  1 1 
        3  5135 1 1  17 LEU HB3  H  -8.939  -4.499  -3.044 1.00 . A A .  17 LEU HB3  1 1 
        3  5136 1 1  17 LEU HD11 H  -5.602  -3.640  -3.827 1.00 . A A .  17 LEU HD11 1 1 
        3  5137 1 1  17 LEU HD12 H  -5.353  -5.369  -4.057 1.00 . A A .  17 LEU HD12 1 1 
        3  5138 1 1  17 LEU HD13 H  -4.729  -4.576  -2.615 1.00 . A A .  17 LEU HD13 1 1 
        3  5139 1 1  17 LEU HD21 H  -7.852  -4.138  -0.841 1.00 . A A .  17 LEU HD21 1 1 
        3  5140 1 1  17 LEU HD22 H  -7.252  -2.879  -1.919 1.00 . A A .  17 LEU HD22 1 1 
        3  5141 1 1  17 LEU HD23 H  -6.126  -3.778  -0.901 1.00 . A A .  17 LEU HD23 1 1 
        3  5142 1 1  17 LEU HG   H  -6.806  -5.867  -2.152 1.00 . A A .  17 LEU HG   1 1 
        3  5143 1 1  17 LEU N    N  -7.145  -6.566  -5.064 1.00 . A A .  17 LEU N    1 1 
        3  5144 1 1  17 LEU O    O  -9.573  -5.533  -6.129 1.00 . A A .  17 LEU O    1 1 
        3  5145 1 1  18 ALA C    C -12.681  -5.494  -5.124 1.00 . A A .  18 ALA C    1 1 
        3  5146 1 1  18 ALA CA   C -11.869  -6.756  -5.427 1.00 . A A .  18 ALA CA   1 1 
        3  5147 1 1  18 ALA CB   C -12.679  -7.999  -5.062 1.00 . A A .  18 ALA CB   1 1 
        3  5148 1 1  18 ALA H    H -10.578  -7.233  -3.780 1.00 . A A .  18 ALA H    1 1 
        3  5149 1 1  18 ALA HA   H -11.630  -6.786  -6.480 1.00 . A A .  18 ALA HA   1 1 
        3  5150 1 1  18 ALA HB1  H -13.420  -8.184  -5.824 1.00 . A A .  18 ALA HB1  1 1 
        3  5151 1 1  18 ALA HB2  H -13.168  -7.846  -4.112 1.00 . A A .  18 ALA HB2  1 1 
        3  5152 1 1  18 ALA HB3  H -12.015  -8.850  -4.991 1.00 . A A .  18 ALA HB3  1 1 
        3  5153 1 1  18 ALA N    N -10.615  -6.754  -4.632 1.00 . A A .  18 ALA N    1 1 
        3  5154 1 1  18 ALA O    O -13.619  -5.515  -4.355 1.00 . A A .  18 ALA O    1 1 
        3  5155 1 1  19 ALA C    C -12.438  -2.009  -6.331 1.00 . A A .  19 ALA C    1 1 
        3  5156 1 1  19 ALA CA   C -13.080  -3.131  -5.498 1.00 . A A .  19 ALA CA   1 1 
        3  5157 1 1  19 ALA CB   C -13.028  -2.770  -4.003 1.00 . A A .  19 ALA CB   1 1 
        3  5158 1 1  19 ALA H    H -11.571  -4.405  -6.356 1.00 . A A .  19 ALA H    1 1 
        3  5159 1 1  19 ALA HA   H -14.105  -3.275  -5.802 1.00 . A A .  19 ALA HA   1 1 
        3  5160 1 1  19 ALA HB1  H -13.125  -1.700  -3.878 1.00 . A A .  19 ALA HB1  1 1 
        3  5161 1 1  19 ALA HB2  H -12.087  -3.096  -3.585 1.00 . A A .  19 ALA HB2  1 1 
        3  5162 1 1  19 ALA HB3  H -13.839  -3.262  -3.483 1.00 . A A .  19 ALA HB3  1 1 
        3  5163 1 1  19 ALA N    N -12.328  -4.396  -5.734 1.00 . A A .  19 ALA N    1 1 
        3  5164 1 1  19 ALA O    O -11.261  -2.053  -6.629 1.00 . A A .  19 ALA O    1 1 
        3  5165 1 1  20 PRO C    C -11.596   0.917  -6.752 1.00 . A A .  20 PRO C    1 1 
        3  5166 1 1  20 PRO CA   C -12.683   0.134  -7.511 1.00 . A A .  20 PRO CA   1 1 
        3  5167 1 1  20 PRO CB   C -13.928   1.014  -7.763 1.00 . A A .  20 PRO CB   1 1 
        3  5168 1 1  20 PRO CD   C -14.634  -0.867  -6.404 1.00 . A A .  20 PRO CD   1 1 
        3  5169 1 1  20 PRO CG   C -14.934   0.596  -6.732 1.00 . A A .  20 PRO CG   1 1 
        3  5170 1 1  20 PRO HA   H -12.295  -0.227  -8.450 1.00 . A A .  20 PRO HA   1 1 
        3  5171 1 1  20 PRO HB2  H -13.685   2.065  -7.652 1.00 . A A .  20 PRO HB2  1 1 
        3  5172 1 1  20 PRO HB3  H -14.321   0.830  -8.753 1.00 . A A .  20 PRO HB3  1 1 
        3  5173 1 1  20 PRO HD2  H -14.827  -1.071  -5.358 1.00 . A A .  20 PRO HD2  1 1 
        3  5174 1 1  20 PRO HD3  H -15.212  -1.526  -7.033 1.00 . A A .  20 PRO HD3  1 1 
        3  5175 1 1  20 PRO HG2  H -14.831   1.206  -5.841 1.00 . A A .  20 PRO HG2  1 1 
        3  5176 1 1  20 PRO HG3  H -15.937   0.682  -7.125 1.00 . A A .  20 PRO HG3  1 1 
        3  5177 1 1  20 PRO N    N -13.201  -1.011  -6.705 1.00 . A A .  20 PRO N    1 1 
        3  5178 1 1  20 PRO O    O -11.492   0.830  -5.544 1.00 . A A .  20 PRO O    1 1 
        3  5179 1 1  21 PRO C    C -10.274   3.595  -5.942 1.00 . A A .  21 PRO C    1 1 
        3  5180 1 1  21 PRO CA   C  -9.705   2.482  -6.830 1.00 . A A .  21 PRO CA   1 1 
        3  5181 1 1  21 PRO CB   C  -8.931   3.062  -8.032 1.00 . A A .  21 PRO CB   1 1 
        3  5182 1 1  21 PRO CD   C -10.843   1.850  -8.915 1.00 . A A .  21 PRO CD   1 1 
        3  5183 1 1  21 PRO CG   C  -9.897   3.026  -9.178 1.00 . A A .  21 PRO CG   1 1 
        3  5184 1 1  21 PRO HA   H  -9.052   1.845  -6.251 1.00 . A A .  21 PRO HA   1 1 
        3  5185 1 1  21 PRO HB2  H  -8.617   4.079  -7.828 1.00 . A A .  21 PRO HB2  1 1 
        3  5186 1 1  21 PRO HB3  H  -8.072   2.446  -8.255 1.00 . A A .  21 PRO HB3  1 1 
        3  5187 1 1  21 PRO HD2  H -11.848   2.091  -9.235 1.00 . A A .  21 PRO HD2  1 1 
        3  5188 1 1  21 PRO HD3  H -10.491   0.956  -9.408 1.00 . A A .  21 PRO HD3  1 1 
        3  5189 1 1  21 PRO HG2  H -10.457   3.953  -9.220 1.00 . A A .  21 PRO HG2  1 1 
        3  5190 1 1  21 PRO HG3  H  -9.371   2.869 -10.108 1.00 . A A .  21 PRO HG3  1 1 
        3  5191 1 1  21 PRO N    N -10.793   1.674  -7.455 1.00 . A A .  21 PRO N    1 1 
        3  5192 1 1  21 PRO O    O  -9.633   4.062  -5.022 1.00 . A A .  21 PRO O    1 1 
        3  5193 1 1  22 ALA C    C -12.274   4.618  -3.957 1.00 . A A .  22 ALA C    1 1 
        3  5194 1 1  22 ALA CA   C -12.099   5.095  -5.402 1.00 . A A .  22 ALA CA   1 1 
        3  5195 1 1  22 ALA CB   C -13.467   5.435  -5.992 1.00 . A A .  22 ALA CB   1 1 
        3  5196 1 1  22 ALA H    H -11.971   3.624  -6.965 1.00 . A A .  22 ALA H    1 1 
        3  5197 1 1  22 ALA HA   H -11.471   5.974  -5.419 1.00 . A A .  22 ALA HA   1 1 
        3  5198 1 1  22 ALA HB1  H -14.061   4.536  -6.063 1.00 . A A .  22 ALA HB1  1 1 
        3  5199 1 1  22 ALA HB2  H -13.336   5.859  -6.977 1.00 . A A .  22 ALA HB2  1 1 
        3  5200 1 1  22 ALA HB3  H -13.967   6.148  -5.356 1.00 . A A .  22 ALA HB3  1 1 
        3  5201 1 1  22 ALA N    N -11.476   4.017  -6.217 1.00 . A A .  22 ALA N    1 1 
        3  5202 1 1  22 ALA O    O -11.941   5.313  -3.018 1.00 . A A .  22 ALA O    1 1 
        3  5203 1 1  23 ALA C    C -11.630   2.638  -1.753 1.00 . A A .  23 ALA C    1 1 
        3  5204 1 1  23 ALA CA   C -12.993   2.911  -2.394 1.00 . A A .  23 ALA CA   1 1 
        3  5205 1 1  23 ALA CB   C -13.793   1.611  -2.463 1.00 . A A .  23 ALA CB   1 1 
        3  5206 1 1  23 ALA H    H -13.057   2.893  -4.544 1.00 . A A .  23 ALA H    1 1 
        3  5207 1 1  23 ALA HA   H -13.532   3.636  -1.803 1.00 . A A .  23 ALA HA   1 1 
        3  5208 1 1  23 ALA HB1  H -13.214   0.861  -2.981 1.00 . A A .  23 ALA HB1  1 1 
        3  5209 1 1  23 ALA HB2  H -14.714   1.786  -2.998 1.00 . A A .  23 ALA HB2  1 1 
        3  5210 1 1  23 ALA HB3  H -14.014   1.270  -1.462 1.00 . A A .  23 ALA HB3  1 1 
        3  5211 1 1  23 ALA N    N -12.795   3.437  -3.774 1.00 . A A .  23 ALA N    1 1 
        3  5212 1 1  23 ALA O    O -11.417   2.891  -0.584 1.00 . A A .  23 ALA O    1 1 
        3  5213 1 1  24 VAL C    C  -8.669   3.130  -1.562 1.00 . A A .  24 VAL C    1 1 
        3  5214 1 1  24 VAL CA   C  -9.353   1.824  -1.968 1.00 . A A .  24 VAL CA   1 1 
        3  5215 1 1  24 VAL CB   C  -8.515   1.138  -3.049 1.00 . A A .  24 VAL CB   1 1 
        3  5216 1 1  24 VAL CG1  C  -7.081   0.952  -2.550 1.00 . A A .  24 VAL CG1  1 1 
        3  5217 1 1  24 VAL CG2  C  -9.122  -0.225  -3.383 1.00 . A A .  24 VAL CG2  1 1 
        3  5218 1 1  24 VAL H    H -10.904   1.925  -3.455 1.00 . A A .  24 VAL H    1 1 
        3  5219 1 1  24 VAL HA   H  -9.441   1.174  -1.109 1.00 . A A .  24 VAL HA   1 1 
        3  5220 1 1  24 VAL HB   H  -8.507   1.757  -3.934 1.00 . A A .  24 VAL HB   1 1 
        3  5221 1 1  24 VAL HG11 H  -6.574   1.905  -2.550 1.00 . A A .  24 VAL HG11 1 1 
        3  5222 1 1  24 VAL HG12 H  -6.561   0.266  -3.199 1.00 . A A .  24 VAL HG12 1 1 
        3  5223 1 1  24 VAL HG13 H  -7.098   0.555  -1.544 1.00 . A A .  24 VAL HG13 1 1 
        3  5224 1 1  24 VAL HG21 H -10.155  -0.098  -3.674 1.00 . A A .  24 VAL HG21 1 1 
        3  5225 1 1  24 VAL HG22 H  -9.068  -0.867  -2.518 1.00 . A A .  24 VAL HG22 1 1 
        3  5226 1 1  24 VAL HG23 H  -8.572  -0.670  -4.198 1.00 . A A .  24 VAL HG23 1 1 
        3  5227 1 1  24 VAL N    N -10.707   2.120  -2.516 1.00 . A A .  24 VAL N    1 1 
        3  5228 1 1  24 VAL O    O  -8.066   3.231  -0.512 1.00 . A A .  24 VAL O    1 1 
        3  5229 1 1  25 PHE C    C  -8.689   6.008  -0.798 1.00 . A A .  25 PHE C    1 1 
        3  5230 1 1  25 PHE CA   C  -8.096   5.423  -2.083 1.00 . A A .  25 PHE CA   1 1 
        3  5231 1 1  25 PHE CB   C  -8.325   6.398  -3.236 1.00 . A A .  25 PHE CB   1 1 
        3  5232 1 1  25 PHE CD1  C  -6.238   7.785  -3.023 1.00 . A A .  25 PHE CD1  1 1 
        3  5233 1 1  25 PHE CD2  C  -8.375   8.813  -2.514 1.00 . A A .  25 PHE CD2  1 1 
        3  5234 1 1  25 PHE CE1  C  -5.587   8.985  -2.720 1.00 . A A .  25 PHE CE1  1 1 
        3  5235 1 1  25 PHE CE2  C  -7.723  10.015  -2.212 1.00 . A A .  25 PHE CE2  1 1 
        3  5236 1 1  25 PHE CG   C  -7.630   7.699  -2.921 1.00 . A A .  25 PHE CG   1 1 
        3  5237 1 1  25 PHE CZ   C  -6.329  10.100  -2.313 1.00 . A A .  25 PHE CZ   1 1 
        3  5238 1 1  25 PHE H    H  -9.231   4.014  -3.244 1.00 . A A .  25 PHE H    1 1 
        3  5239 1 1  25 PHE HA   H  -7.034   5.268  -1.949 1.00 . A A .  25 PHE HA   1 1 
        3  5240 1 1  25 PHE HB2  H  -7.919   5.980  -4.147 1.00 . A A .  25 PHE HB2  1 1 
        3  5241 1 1  25 PHE HB3  H  -9.383   6.572  -3.359 1.00 . A A .  25 PHE HB3  1 1 
        3  5242 1 1  25 PHE HD1  H  -5.666   6.925  -3.338 1.00 . A A .  25 PHE HD1  1 1 
        3  5243 1 1  25 PHE HD2  H  -9.449   8.746  -2.436 1.00 . A A .  25 PHE HD2  1 1 
        3  5244 1 1  25 PHE HE1  H  -4.512   9.051  -2.799 1.00 . A A .  25 PHE HE1  1 1 
        3  5245 1 1  25 PHE HE2  H  -8.297  10.875  -1.898 1.00 . A A .  25 PHE HE2  1 1 
        3  5246 1 1  25 PHE HZ   H  -5.827  11.027  -2.078 1.00 . A A .  25 PHE HZ   1 1 
        3  5247 1 1  25 PHE N    N  -8.749   4.124  -2.397 1.00 . A A .  25 PHE N    1 1 
        3  5248 1 1  25 PHE O    O  -7.977   6.491   0.059 1.00 . A A .  25 PHE O    1 1 
        3  5249 1 1  26 ALA C    C -10.041   5.838   1.801 1.00 . A A .  26 ALA C    1 1 
        3  5250 1 1  26 ALA CA   C -10.610   6.543   0.570 1.00 . A A .  26 ALA CA   1 1 
        3  5251 1 1  26 ALA CB   C -12.121   6.317   0.519 1.00 . A A .  26 ALA CB   1 1 
        3  5252 1 1  26 ALA H    H -10.547   5.593  -1.361 1.00 . A A .  26 ALA H    1 1 
        3  5253 1 1  26 ALA HA   H -10.406   7.603   0.630 1.00 . A A .  26 ALA HA   1 1 
        3  5254 1 1  26 ALA HB1  H -12.586   6.800   1.366 1.00 . A A .  26 ALA HB1  1 1 
        3  5255 1 1  26 ALA HB2  H -12.327   5.257   0.551 1.00 . A A .  26 ALA HB2  1 1 
        3  5256 1 1  26 ALA HB3  H -12.517   6.732  -0.396 1.00 . A A .  26 ALA HB3  1 1 
        3  5257 1 1  26 ALA N    N  -9.985   5.978  -0.658 1.00 . A A .  26 ALA N    1 1 
        3  5258 1 1  26 ALA O    O  -9.686   6.463   2.777 1.00 . A A .  26 ALA O    1 1 
        3  5259 1 1  27 LEU C    C  -7.945   4.173   3.146 1.00 . A A .  27 LEU C    1 1 
        3  5260 1 1  27 LEU CA   C  -9.405   3.778   2.916 1.00 . A A .  27 LEU CA   1 1 
        3  5261 1 1  27 LEU CB   C  -9.494   2.280   2.621 1.00 . A A .  27 LEU CB   1 1 
        3  5262 1 1  27 LEU CD1  C -11.061   0.416   2.034 1.00 . A A .  27 LEU CD1  1 1 
        3  5263 1 1  27 LEU CD2  C -11.583   1.890   4.004 1.00 . A A .  27 LEU CD2  1 1 
        3  5264 1 1  27 LEU CG   C -10.969   1.841   2.588 1.00 . A A .  27 LEU CG   1 1 
        3  5265 1 1  27 LEU H    H -10.239   4.058   0.954 1.00 . A A .  27 LEU H    1 1 
        3  5266 1 1  27 LEU HA   H  -9.978   4.009   3.799 1.00 . A A .  27 LEU HA   1 1 
        3  5267 1 1  27 LEU HB2  H  -9.042   2.082   1.658 1.00 . A A .  27 LEU HB2  1 1 
        3  5268 1 1  27 LEU HB3  H  -8.969   1.728   3.383 1.00 . A A .  27 LEU HB3  1 1 
        3  5269 1 1  27 LEU HD11 H -10.636  -0.276   2.744 1.00 . A A .  27 LEU HD11 1 1 
        3  5270 1 1  27 LEU HD12 H -10.515   0.356   1.103 1.00 . A A .  27 LEU HD12 1 1 
        3  5271 1 1  27 LEU HD13 H -12.096   0.164   1.860 1.00 . A A .  27 LEU HD13 1 1 
        3  5272 1 1  27 LEU HD21 H -11.946   2.886   4.205 1.00 . A A .  27 LEU HD21 1 1 
        3  5273 1 1  27 LEU HD22 H -10.838   1.623   4.740 1.00 . A A .  27 LEU HD22 1 1 
        3  5274 1 1  27 LEU HD23 H -12.410   1.196   4.065 1.00 . A A .  27 LEU HD23 1 1 
        3  5275 1 1  27 LEU HG   H -11.519   2.508   1.938 1.00 . A A .  27 LEU HG   1 1 
        3  5276 1 1  27 LEU N    N  -9.948   4.539   1.756 1.00 . A A .  27 LEU N    1 1 
        3  5277 1 1  27 LEU O    O  -7.486   4.274   4.266 1.00 . A A .  27 LEU O    1 1 
        3  5278 1 1  28 MET C    C  -5.670   6.235   2.633 1.00 . A A .  28 MET C    1 1 
        3  5279 1 1  28 MET CA   C  -5.776   4.761   2.256 1.00 . A A .  28 MET CA   1 1 
        3  5280 1 1  28 MET CB   C  -5.053   4.526   0.935 1.00 . A A .  28 MET CB   1 1 
        3  5281 1 1  28 MET CE   C  -2.391   2.479   1.014 1.00 . A A .  28 MET CE   1 1 
        3  5282 1 1  28 MET CG   C  -5.031   3.026   0.631 1.00 . A A .  28 MET CG   1 1 
        3  5283 1 1  28 MET H    H  -7.590   4.288   1.199 1.00 . A A .  28 MET H    1 1 
        3  5284 1 1  28 MET HA   H  -5.326   4.157   3.028 1.00 . A A .  28 MET HA   1 1 
        3  5285 1 1  28 MET HB2  H  -5.572   5.049   0.145 1.00 . A A .  28 MET HB2  1 1 
        3  5286 1 1  28 MET HB3  H  -4.045   4.896   1.010 1.00 . A A .  28 MET HB3  1 1 
        3  5287 1 1  28 MET HE1  H  -2.119   1.617   0.421 1.00 . A A .  28 MET HE1  1 1 
        3  5288 1 1  28 MET HE2  H  -1.633   2.661   1.762 1.00 . A A .  28 MET HE2  1 1 
        3  5289 1 1  28 MET HE3  H  -2.473   3.341   0.371 1.00 . A A .  28 MET HE3  1 1 
        3  5290 1 1  28 MET HG2  H  -6.035   2.633   0.691 1.00 . A A .  28 MET HG2  1 1 
        3  5291 1 1  28 MET HG3  H  -4.644   2.868  -0.363 1.00 . A A .  28 MET HG3  1 1 
        3  5292 1 1  28 MET N    N  -7.207   4.382   2.096 1.00 . A A .  28 MET N    1 1 
        3  5293 1 1  28 MET O    O  -4.607   6.720   2.962 1.00 . A A .  28 MET O    1 1 
        3  5294 1 1  28 MET SD   S  -3.980   2.168   1.829 1.00 . A A .  28 MET SD   1 1 
        3  5295 1 1  29 THR C    C  -7.669   8.642   4.137 1.00 . A A .  29 THR C    1 1 
        3  5296 1 1  29 THR CA   C  -6.742   8.406   2.950 1.00 . A A .  29 THR CA   1 1 
        3  5297 1 1  29 THR CB   C  -7.216   9.240   1.760 1.00 . A A .  29 THR CB   1 1 
        3  5298 1 1  29 THR CG2  C  -7.055  10.727   2.084 1.00 . A A .  29 THR CG2  1 1 
        3  5299 1 1  29 THR H    H  -7.612   6.534   2.325 1.00 . A A .  29 THR H    1 1 
        3  5300 1 1  29 THR HA   H  -5.741   8.710   3.222 1.00 . A A .  29 THR HA   1 1 
        3  5301 1 1  29 THR HB   H  -8.253   9.028   1.558 1.00 . A A .  29 THR HB   1 1 
        3  5302 1 1  29 THR HG1  H  -6.119   8.011   0.726 1.00 . A A .  29 THR HG1  1 1 
        3  5303 1 1  29 THR HG21 H  -6.058  10.909   2.459 1.00 . A A .  29 THR HG21 1 1 
        3  5304 1 1  29 THR HG22 H  -7.778  11.013   2.833 1.00 . A A .  29 THR HG22 1 1 
        3  5305 1 1  29 THR HG23 H  -7.213  11.310   1.190 1.00 . A A .  29 THR HG23 1 1 
        3  5306 1 1  29 THR N    N  -6.767   6.954   2.591 1.00 . A A .  29 THR N    1 1 
        3  5307 1 1  29 THR O    O  -8.754   9.165   4.001 1.00 . A A .  29 THR O    1 1 
        3  5308 1 1  29 THR OG1  O  -6.433   8.913   0.621 1.00 . A A .  29 THR OG1  1 1 
        3  5309 1 1  30 ASP C    C  -7.393   7.706   7.692 1.00 . A A .  30 ASP C    1 1 
        3  5310 1 1  30 ASP CA   C  -8.049   8.480   6.527 1.00 . A A .  30 ASP CA   1 1 
        3  5311 1 1  30 ASP CB   C  -9.492   7.973   6.314 1.00 . A A .  30 ASP CB   1 1 
        3  5312 1 1  30 ASP CG   C  -9.493   6.757   5.393 1.00 . A A .  30 ASP CG   1 1 
        3  5313 1 1  30 ASP H    H  -6.340   7.865   5.380 1.00 . A A .  30 ASP H    1 1 
        3  5314 1 1  30 ASP HA   H  -8.073   9.534   6.733 1.00 . A A .  30 ASP HA   1 1 
        3  5315 1 1  30 ASP HB2  H  -9.924   7.695   7.266 1.00 . A A .  30 ASP HB2  1 1 
        3  5316 1 1  30 ASP HB3  H -10.089   8.755   5.870 1.00 . A A .  30 ASP HB3  1 1 
        3  5317 1 1  30 ASP N    N  -7.230   8.273   5.305 1.00 . A A .  30 ASP N    1 1 
        3  5318 1 1  30 ASP O    O  -7.232   6.504   7.610 1.00 . A A .  30 ASP O    1 1 
        3  5319 1 1  30 ASP OD1  O  -8.433   6.204   5.170 1.00 . A A .  30 ASP OD1  1 1 
        3  5320 1 1  30 ASP OD2  O -10.563   6.390   4.936 1.00 . A A .  30 ASP OD2  1 1 
        3  5321 1 1  31 PRO C    C  -7.364   6.845  10.714 1.00 . A A .  31 PRO C    1 1 
        3  5322 1 1  31 PRO CA   C  -6.358   7.690   9.927 1.00 . A A .  31 PRO CA   1 1 
        3  5323 1 1  31 PRO CB   C  -5.814   8.850  10.778 1.00 . A A .  31 PRO CB   1 1 
        3  5324 1 1  31 PRO CD   C  -7.153   9.818   9.000 1.00 . A A .  31 PRO CD   1 1 
        3  5325 1 1  31 PRO CG   C  -6.687  10.019  10.445 1.00 . A A .  31 PRO CG   1 1 
        3  5326 1 1  31 PRO HA   H  -5.538   7.072   9.593 1.00 . A A .  31 PRO HA   1 1 
        3  5327 1 1  31 PRO HB2  H  -5.877   8.615  11.836 1.00 . A A .  31 PRO HB2  1 1 
        3  5328 1 1  31 PRO HB3  H  -4.790   9.066  10.507 1.00 . A A .  31 PRO HB3  1 1 
        3  5329 1 1  31 PRO HD2  H  -8.189  10.115   8.901 1.00 . A A .  31 PRO HD2  1 1 
        3  5330 1 1  31 PRO HD3  H  -6.529  10.369   8.312 1.00 . A A .  31 PRO HD3  1 1 
        3  5331 1 1  31 PRO HG2  H  -7.542  10.044  11.112 1.00 . A A .  31 PRO HG2  1 1 
        3  5332 1 1  31 PRO HG3  H  -6.131  10.941  10.523 1.00 . A A .  31 PRO HG3  1 1 
        3  5333 1 1  31 PRO N    N  -7.007   8.368   8.765 1.00 . A A .  31 PRO N    1 1 
        3  5334 1 1  31 PRO O    O  -7.000   6.024  11.530 1.00 . A A .  31 PRO O    1 1 
        3  5335 1 1  32 GLU C    C  -9.949   4.953  10.506 1.00 . A A .  32 GLU C    1 1 
        3  5336 1 1  32 GLU CA   C  -9.675   6.290  11.208 1.00 . A A .  32 GLU CA   1 1 
        3  5337 1 1  32 GLU CB   C -10.961   7.117  11.231 1.00 . A A .  32 GLU CB   1 1 
        3  5338 1 1  32 GLU CD   C -13.280   7.256  12.154 1.00 . A A .  32 GLU CD   1 1 
        3  5339 1 1  32 GLU CG   C -12.017   6.396  12.068 1.00 . A A .  32 GLU CG   1 1 
        3  5340 1 1  32 GLU H    H  -8.890   7.737   9.822 1.00 . A A .  32 GLU H    1 1 
        3  5341 1 1  32 GLU HA   H  -9.351   6.107  12.222 1.00 . A A .  32 GLU HA   1 1 
        3  5342 1 1  32 GLU HB2  H -10.757   8.088  11.658 1.00 . A A .  32 GLU HB2  1 1 
        3  5343 1 1  32 GLU HB3  H -11.328   7.239  10.221 1.00 . A A .  32 GLU HB3  1 1 
        3  5344 1 1  32 GLU HG2  H -12.258   5.449  11.607 1.00 . A A .  32 GLU HG2  1 1 
        3  5345 1 1  32 GLU HG3  H -11.633   6.224  13.061 1.00 . A A .  32 GLU HG3  1 1 
        3  5346 1 1  32 GLU N    N  -8.627   7.060  10.478 1.00 . A A .  32 GLU N    1 1 
        3  5347 1 1  32 GLU O    O  -9.942   3.906  11.121 1.00 . A A .  32 GLU O    1 1 
        3  5348 1 1  32 GLU OE1  O -13.362   8.227  11.420 1.00 . A A .  32 GLU OE1  1 1 
        3  5349 1 1  32 GLU OE2  O -14.142   6.929  12.951 1.00 . A A .  32 GLU OE2  1 1 
        3  5350 1 1  33 LYS C    C  -9.283   2.826   8.458 1.00 . A A .  33 LYS C    1 1 
        3  5351 1 1  33 LYS CA   C -10.517   3.728   8.481 1.00 . A A .  33 LYS CA   1 1 
        3  5352 1 1  33 LYS CB   C -10.905   4.072   7.045 1.00 . A A .  33 LYS CB   1 1 
        3  5353 1 1  33 LYS CD   C -13.315   4.407   7.699 1.00 . A A .  33 LYS CD   1 1 
        3  5354 1 1  33 LYS CE   C -14.583   5.159   7.285 1.00 . A A .  33 LYS CE   1 1 
        3  5355 1 1  33 LYS CG   C -12.094   5.044   7.030 1.00 . A A .  33 LYS CG   1 1 
        3  5356 1 1  33 LYS H    H -10.232   5.845   8.757 1.00 . A A .  33 LYS H    1 1 
        3  5357 1 1  33 LYS HA   H -11.325   3.204   8.963 1.00 . A A .  33 LYS HA   1 1 
        3  5358 1 1  33 LYS HB2  H -10.062   4.524   6.549 1.00 . A A .  33 LYS HB2  1 1 
        3  5359 1 1  33 LYS HB3  H -11.182   3.167   6.526 1.00 . A A .  33 LYS HB3  1 1 
        3  5360 1 1  33 LYS HD2  H -13.393   3.373   7.401 1.00 . A A .  33 LYS HD2  1 1 
        3  5361 1 1  33 LYS HD3  H -13.210   4.468   8.771 1.00 . A A .  33 LYS HD3  1 1 
        3  5362 1 1  33 LYS HE2  H -14.535   6.175   7.645 1.00 . A A .  33 LYS HE2  1 1 
        3  5363 1 1  33 LYS HE3  H -14.664   5.161   6.209 1.00 . A A .  33 LYS HE3  1 1 
        3  5364 1 1  33 LYS HG2  H -11.822   5.945   7.564 1.00 . A A .  33 LYS HG2  1 1 
        3  5365 1 1  33 LYS HG3  H -12.333   5.293   6.009 1.00 . A A .  33 LYS HG3  1 1 
        3  5366 1 1  33 LYS HZ1  H -16.613   5.062   7.732 1.00 . A A .  33 LYS HZ1  1 1 
        3  5367 1 1  33 LYS HZ2  H -15.614   4.330   8.891 1.00 . A A .  33 LYS HZ2  1 1 
        3  5368 1 1  33 LYS HZ3  H -15.900   3.554   7.407 1.00 . A A .  33 LYS HZ3  1 1 
        3  5369 1 1  33 LYS N    N -10.215   4.987   9.228 1.00 . A A .  33 LYS N    1 1 
        3  5370 1 1  33 LYS NZ   N -15.767   4.475   7.872 1.00 . A A .  33 LYS NZ   1 1 
        3  5371 1 1  33 LYS O    O  -9.379   1.623   8.584 1.00 . A A .  33 LYS O    1 1 
        3  5372 1 1  34 ILE C    C  -6.844   1.645   9.454 1.00 . A A .  34 ILE C    1 1 
        3  5373 1 1  34 ILE CA   C  -6.890   2.571   8.231 1.00 . A A .  34 ILE CA   1 1 
        3  5374 1 1  34 ILE CB   C  -5.670   3.507   8.234 1.00 . A A .  34 ILE CB   1 1 
        3  5375 1 1  34 ILE CD1  C  -4.516   5.311   6.939 1.00 . A A .  34 ILE CD1  1 1 
        3  5376 1 1  34 ILE CG1  C  -5.525   4.161   6.856 1.00 . A A .  34 ILE CG1  1 1 
        3  5377 1 1  34 ILE CG2  C  -4.396   2.722   8.563 1.00 . A A .  34 ILE CG2  1 1 
        3  5378 1 1  34 ILE H    H  -8.072   4.368   8.167 1.00 . A A .  34 ILE H    1 1 
        3  5379 1 1  34 ILE HA   H  -6.890   1.980   7.330 1.00 . A A .  34 ILE HA   1 1 
        3  5380 1 1  34 ILE HB   H  -5.818   4.275   8.980 1.00 . A A .  34 ILE HB   1 1 
        3  5381 1 1  34 ILE HD11 H  -4.321   5.691   5.948 1.00 . A A .  34 ILE HD11 1 1 
        3  5382 1 1  34 ILE HD12 H  -3.595   4.950   7.375 1.00 . A A .  34 ILE HD12 1 1 
        3  5383 1 1  34 ILE HD13 H  -4.919   6.100   7.555 1.00 . A A .  34 ILE HD13 1 1 
        3  5384 1 1  34 ILE HG12 H  -5.175   3.425   6.144 1.00 . A A .  34 ILE HG12 1 1 
        3  5385 1 1  34 ILE HG13 H  -6.482   4.545   6.534 1.00 . A A .  34 ILE HG13 1 1 
        3  5386 1 1  34 ILE HG21 H  -4.402   1.786   8.023 1.00 . A A .  34 ILE HG21 1 1 
        3  5387 1 1  34 ILE HG22 H  -4.362   2.524   9.624 1.00 . A A .  34 ILE HG22 1 1 
        3  5388 1 1  34 ILE HG23 H  -3.530   3.299   8.276 1.00 . A A .  34 ILE HG23 1 1 
        3  5389 1 1  34 ILE N    N  -8.127   3.396   8.279 1.00 . A A .  34 ILE N    1 1 
        3  5390 1 1  34 ILE O    O  -6.253   0.583   9.419 1.00 . A A .  34 ILE O    1 1 
        3  5391 1 1  35 LEU C    C  -8.119  -0.144  11.467 1.00 . A A .  35 LEU C    1 1 
        3  5392 1 1  35 LEU CA   C  -7.437   1.196  11.757 1.00 . A A .  35 LEU CA   1 1 
        3  5393 1 1  35 LEU CB   C  -8.193   1.922  12.870 1.00 . A A .  35 LEU CB   1 1 
        3  5394 1 1  35 LEU CD1  C  -8.343   4.024  14.215 1.00 . A A .  35 LEU CD1  1 1 
        3  5395 1 1  35 LEU CD2  C  -6.087   3.093  13.624 1.00 . A A .  35 LEU CD2  1 1 
        3  5396 1 1  35 LEU CG   C  -7.538   3.282  13.144 1.00 . A A .  35 LEU CG   1 1 
        3  5397 1 1  35 LEU H    H  -7.923   2.904  10.540 1.00 . A A .  35 LEU H    1 1 
        3  5398 1 1  35 LEU HA   H  -6.418   1.022  12.063 1.00 . A A .  35 LEU HA   1 1 
        3  5399 1 1  35 LEU HB2  H  -9.220   2.073  12.565 1.00 . A A .  35 LEU HB2  1 1 
        3  5400 1 1  35 LEU HB3  H  -8.170   1.326  13.769 1.00 . A A .  35 LEU HB3  1 1 
        3  5401 1 1  35 LEU HD11 H  -9.397   3.947  13.993 1.00 . A A .  35 LEU HD11 1 1 
        3  5402 1 1  35 LEU HD12 H  -8.053   5.066  14.225 1.00 . A A .  35 LEU HD12 1 1 
        3  5403 1 1  35 LEU HD13 H  -8.144   3.587  15.183 1.00 . A A .  35 LEU HD13 1 1 
        3  5404 1 1  35 LEU HD21 H  -5.436   2.990  12.770 1.00 . A A .  35 LEU HD21 1 1 
        3  5405 1 1  35 LEU HD22 H  -6.017   2.207  14.238 1.00 . A A .  35 LEU HD22 1 1 
        3  5406 1 1  35 LEU HD23 H  -5.777   3.953  14.201 1.00 . A A .  35 LEU HD23 1 1 
        3  5407 1 1  35 LEU HG   H  -7.541   3.862  12.233 1.00 . A A .  35 LEU HG   1 1 
        3  5408 1 1  35 LEU N    N  -7.456   2.041  10.531 1.00 . A A .  35 LEU N    1 1 
        3  5409 1 1  35 LEU O    O  -7.898  -1.124  12.149 1.00 . A A .  35 LEU O    1 1 
        3  5410 1 1  36 ARG C    C  -8.632  -2.549   9.738 1.00 . A A .  36 ARG C    1 1 
        3  5411 1 1  36 ARG CA   C  -9.645  -1.469  10.132 1.00 . A A .  36 ARG CA   1 1 
        3  5412 1 1  36 ARG CB   C -10.604  -1.238   8.961 1.00 . A A .  36 ARG CB   1 1 
        3  5413 1 1  36 ARG CD   C -12.744  -0.173   8.236 1.00 . A A .  36 ARG CD   1 1 
        3  5414 1 1  36 ARG CG   C -11.805  -0.411   9.424 1.00 . A A .  36 ARG CG   1 1 
        3  5415 1 1  36 ARG CZ   C -15.017   0.639   7.956 1.00 . A A .  36 ARG CZ   1 1 
        3  5416 1 1  36 ARG H    H  -9.114   0.607   9.924 1.00 . A A .  36 ARG H    1 1 
        3  5417 1 1  36 ARG HA   H -10.206  -1.801  10.992 1.00 . A A .  36 ARG HA   1 1 
        3  5418 1 1  36 ARG HB2  H -10.086  -0.709   8.174 1.00 . A A .  36 ARG HB2  1 1 
        3  5419 1 1  36 ARG HB3  H -10.947  -2.191   8.587 1.00 . A A .  36 ARG HB3  1 1 
        3  5420 1 1  36 ARG HD2  H -12.226   0.393   7.476 1.00 . A A .  36 ARG HD2  1 1 
        3  5421 1 1  36 ARG HD3  H -13.056  -1.124   7.826 1.00 . A A .  36 ARG HD3  1 1 
        3  5422 1 1  36 ARG HE   H -13.920   1.053   9.558 1.00 . A A .  36 ARG HE   1 1 
        3  5423 1 1  36 ARG HG2  H -12.333  -0.944  10.201 1.00 . A A .  36 ARG HG2  1 1 
        3  5424 1 1  36 ARG HG3  H -11.464   0.540   9.805 1.00 . A A .  36 ARG HG3  1 1 
        3  5425 1 1  36 ARG HH11 H -14.255  -0.488   6.485 1.00 . A A .  36 ARG HH11 1 1 
        3  5426 1 1  36 ARG HH12 H -15.880   0.064   6.243 1.00 . A A .  36 ARG HH12 1 1 
        3  5427 1 1  36 ARG HH21 H -16.035   1.773   9.253 1.00 . A A .  36 ARG HH21 1 1 
        3  5428 1 1  36 ARG HH22 H -16.886   1.341   7.808 1.00 . A A .  36 ARG HH22 1 1 
        3  5429 1 1  36 ARG N    N  -8.947  -0.194  10.462 1.00 . A A .  36 ARG N    1 1 
        3  5430 1 1  36 ARG NE   N -13.939   0.589   8.696 1.00 . A A .  36 ARG NE   1 1 
        3  5431 1 1  36 ARG NH1  N -15.053   0.022   6.805 1.00 . A A .  36 ARG NH1  1 1 
        3  5432 1 1  36 ARG NH2  N -16.060   1.302   8.371 1.00 . A A .  36 ARG NH2  1 1 
        3  5433 1 1  36 ARG O    O  -8.762  -3.692  10.129 1.00 . A A .  36 ARG O    1 1 
        3  5434 1 1  37 TRP C    C  -5.299  -3.003   9.263 1.00 . A A .  37 TRP C    1 1 
        3  5435 1 1  37 TRP CA   C  -6.620  -3.223   8.524 1.00 . A A .  37 TRP CA   1 1 
        3  5436 1 1  37 TRP CB   C  -6.390  -3.110   7.009 1.00 . A A .  37 TRP CB   1 1 
        3  5437 1 1  37 TRP CD1  C  -6.329  -0.592   6.738 1.00 . A A .  37 TRP CD1  1 1 
        3  5438 1 1  37 TRP CD2  C  -4.389  -1.571   6.159 1.00 . A A .  37 TRP CD2  1 1 
        3  5439 1 1  37 TRP CE2  C  -4.221  -0.181   5.951 1.00 . A A .  37 TRP CE2  1 1 
        3  5440 1 1  37 TRP CE3  C  -3.306  -2.420   5.863 1.00 . A A .  37 TRP CE3  1 1 
        3  5441 1 1  37 TRP CG   C  -5.737  -1.806   6.663 1.00 . A A .  37 TRP CG   1 1 
        3  5442 1 1  37 TRP CH2  C  -1.958  -0.506   5.182 1.00 . A A .  37 TRP CH2  1 1 
        3  5443 1 1  37 TRP CZ2  C  -3.023   0.349   5.472 1.00 . A A .  37 TRP CZ2  1 1 
        3  5444 1 1  37 TRP CZ3  C  -2.098  -1.888   5.380 1.00 . A A .  37 TRP CZ3  1 1 
        3  5445 1 1  37 TRP H    H  -7.552  -1.275   8.648 1.00 . A A .  37 TRP H    1 1 
        3  5446 1 1  37 TRP HA   H  -6.982  -4.219   8.744 1.00 . A A .  37 TRP HA   1 1 
        3  5447 1 1  37 TRP HB2  H  -5.757  -3.920   6.684 1.00 . A A .  37 TRP HB2  1 1 
        3  5448 1 1  37 TRP HB3  H  -7.341  -3.176   6.499 1.00 . A A .  37 TRP HB3  1 1 
        3  5449 1 1  37 TRP HD1  H  -7.338  -0.406   7.074 1.00 . A A .  37 TRP HD1  1 1 
        3  5450 1 1  37 TRP HE1  H  -5.608   1.333   6.280 1.00 . A A .  37 TRP HE1  1 1 
        3  5451 1 1  37 TRP HE3  H  -3.403  -3.486   6.012 1.00 . A A .  37 TRP HE3  1 1 
        3  5452 1 1  37 TRP HH2  H  -1.027  -0.105   4.811 1.00 . A A .  37 TRP HH2  1 1 
        3  5453 1 1  37 TRP HZ2  H  -2.923   1.415   5.319 1.00 . A A .  37 TRP HZ2  1 1 
        3  5454 1 1  37 TRP HZ3  H  -1.273  -2.547   5.154 1.00 . A A .  37 TRP HZ3  1 1 
        3  5455 1 1  37 TRP N    N  -7.632  -2.203   8.958 1.00 . A A .  37 TRP N    1 1 
        3  5456 1 1  37 TRP NE1  N  -5.429   0.371   6.319 1.00 . A A .  37 TRP NE1  1 1 
        3  5457 1 1  37 TRP O    O  -4.268  -3.489   8.847 1.00 . A A .  37 TRP O    1 1 
        3  5458 1 1  38 MET C    C  -4.291  -2.077  12.621 1.00 . A A .  38 MET C    1 1 
        3  5459 1 1  38 MET CA   C  -4.040  -2.038  11.112 1.00 . A A .  38 MET CA   1 1 
        3  5460 1 1  38 MET CB   C  -3.475  -0.664  10.741 1.00 . A A .  38 MET CB   1 1 
        3  5461 1 1  38 MET CE   C  -0.594  -1.225   9.685 1.00 . A A .  38 MET CE   1 1 
        3  5462 1 1  38 MET CG   C  -3.205  -0.592   9.234 1.00 . A A .  38 MET CG   1 1 
        3  5463 1 1  38 MET H    H  -6.156  -1.893  10.682 1.00 . A A .  38 MET H    1 1 
        3  5464 1 1  38 MET HA   H  -3.317  -2.803  10.864 1.00 . A A .  38 MET HA   1 1 
        3  5465 1 1  38 MET HB2  H  -4.185   0.102  11.015 1.00 . A A .  38 MET HB2  1 1 
        3  5466 1 1  38 MET HB3  H  -2.551  -0.505  11.275 1.00 . A A .  38 MET HB3  1 1 
        3  5467 1 1  38 MET HE1  H   0.319  -1.445   9.151 1.00 . A A .  38 MET HE1  1 1 
        3  5468 1 1  38 MET HE2  H  -0.567  -1.691  10.661 1.00 . A A .  38 MET HE2  1 1 
        3  5469 1 1  38 MET HE3  H  -0.688  -0.157   9.804 1.00 . A A .  38 MET HE3  1 1 
        3  5470 1 1  38 MET HG2  H  -4.127  -0.747   8.699 1.00 . A A .  38 MET HG2  1 1 
        3  5471 1 1  38 MET HG3  H  -2.809   0.382   8.991 1.00 . A A .  38 MET HG3  1 1 
        3  5472 1 1  38 MET N    N  -5.314  -2.278  10.360 1.00 . A A .  38 MET N    1 1 
        3  5473 1 1  38 MET O    O  -5.286  -2.588  13.092 1.00 . A A .  38 MET O    1 1 
        3  5474 1 1  38 MET SD   S  -2.008  -1.864   8.754 1.00 . A A .  38 MET SD   1 1 
        3  5475 1 1  39 GLY C    C  -4.664  -0.692  15.312 1.00 . A A .  39 GLY C    1 1 
        3  5476 1 1  39 GLY CA   C  -3.489  -1.559  14.860 1.00 . A A .  39 GLY CA   1 1 
        3  5477 1 1  39 GLY H    H  -2.564  -1.165  12.961 1.00 . A A .  39 GLY H    1 1 
        3  5478 1 1  39 GLY HA2  H  -3.642  -2.572  15.199 1.00 . A A .  39 GLY HA2  1 1 
        3  5479 1 1  39 GLY HA3  H  -2.580  -1.171  15.290 1.00 . A A .  39 GLY HA3  1 1 
        3  5480 1 1  39 GLY N    N  -3.363  -1.552  13.376 1.00 . A A .  39 GLY N    1 1 
        3  5481 1 1  39 GLY O    O  -5.317  -0.036  14.523 1.00 . A A .  39 GLY O    1 1 
        3  5482 1 1  40 THR C    C  -5.539   1.539  17.441 1.00 . A A .  40 THR C    1 1 
        3  5483 1 1  40 THR CA   C  -6.049   0.130  17.132 1.00 . A A .  40 THR CA   1 1 
        3  5484 1 1  40 THR CB   C  -6.561  -0.518  18.417 1.00 . A A .  40 THR CB   1 1 
        3  5485 1 1  40 THR CG2  C  -6.857  -1.995  18.157 1.00 . A A .  40 THR CG2  1 1 
        3  5486 1 1  40 THR H    H  -4.380  -1.221  17.202 1.00 . A A .  40 THR H    1 1 
        3  5487 1 1  40 THR HA   H  -6.849   0.183  16.407 1.00 . A A .  40 THR HA   1 1 
        3  5488 1 1  40 THR HB   H  -7.464  -0.024  18.739 1.00 . A A .  40 THR HB   1 1 
        3  5489 1 1  40 THR HG1  H  -5.697  -1.127  20.050 1.00 . A A .  40 THR HG1  1 1 
        3  5490 1 1  40 THR HG21 H  -7.325  -2.429  19.028 1.00 . A A .  40 THR HG21 1 1 
        3  5491 1 1  40 THR HG22 H  -5.933  -2.514  17.948 1.00 . A A .  40 THR HG22 1 1 
        3  5492 1 1  40 THR HG23 H  -7.520  -2.086  17.309 1.00 . A A .  40 THR HG23 1 1 
        3  5493 1 1  40 THR N    N  -4.926  -0.684  16.592 1.00 . A A .  40 THR N    1 1 
        3  5494 1 1  40 THR O    O  -6.274   2.388  17.902 1.00 . A A .  40 THR O    1 1 
        3  5495 1 1  40 THR OG1  O  -5.569  -0.406  19.428 1.00 . A A .  40 THR OG1  1 1 
        3  5496 1 1  41 GLU C    C  -2.779   3.531  16.300 1.00 . A A .  41 GLU C    1 1 
        3  5497 1 1  41 GLU CA   C  -3.710   3.150  17.445 1.00 . A A .  41 GLU CA   1 1 
        3  5498 1 1  41 GLU CB   C  -2.928   3.127  18.760 1.00 . A A .  41 GLU CB   1 1 
        3  5499 1 1  41 GLU CD   C  -3.135   2.856  21.236 1.00 . A A .  41 GLU CD   1 1 
        3  5500 1 1  41 GLU CG   C  -3.908   2.969  19.922 1.00 . A A .  41 GLU CG   1 1 
        3  5501 1 1  41 GLU H    H  -3.710   1.096  16.803 1.00 . A A .  41 GLU H    1 1 
        3  5502 1 1  41 GLU HA   H  -4.505   3.880  17.512 1.00 . A A .  41 GLU HA   1 1 
        3  5503 1 1  41 GLU HB2  H  -2.235   2.295  18.754 1.00 . A A .  41 GLU HB2  1 1 
        3  5504 1 1  41 GLU HB3  H  -2.383   4.050  18.874 1.00 . A A .  41 GLU HB3  1 1 
        3  5505 1 1  41 GLU HG2  H  -4.560   3.828  19.958 1.00 . A A .  41 GLU HG2  1 1 
        3  5506 1 1  41 GLU HG3  H  -4.498   2.075  19.777 1.00 . A A .  41 GLU HG3  1 1 
        3  5507 1 1  41 GLU N    N  -4.282   1.796  17.180 1.00 . A A .  41 GLU N    1 1 
        3  5508 1 1  41 GLU O    O  -1.924   2.766  15.898 1.00 . A A .  41 GLU O    1 1 
        3  5509 1 1  41 GLU OE1  O  -1.919   2.930  21.195 1.00 . A A .  41 GLU OE1  1 1 
        3  5510 1 1  41 GLU OE2  O  -3.775   2.701  22.263 1.00 . A A .  41 GLU OE2  1 1 
        3  5511 1 1  42 ALA C    C  -2.055   6.656  14.559 1.00 . A A .  42 ALA C    1 1 
        3  5512 1 1  42 ALA CA   C  -2.061   5.137  14.645 1.00 . A A .  42 ALA CA   1 1 
        3  5513 1 1  42 ALA CB   C  -2.584   4.562  13.328 1.00 . A A .  42 ALA CB   1 1 
        3  5514 1 1  42 ALA H    H  -3.632   5.311  16.105 1.00 . A A .  42 ALA H    1 1 
        3  5515 1 1  42 ALA HA   H  -1.056   4.786  14.819 1.00 . A A .  42 ALA HA   1 1 
        3  5516 1 1  42 ALA HB1  H  -2.706   3.493  13.423 1.00 . A A .  42 ALA HB1  1 1 
        3  5517 1 1  42 ALA HB2  H  -1.879   4.776  12.539 1.00 . A A .  42 ALA HB2  1 1 
        3  5518 1 1  42 ALA HB3  H  -3.537   5.013  13.092 1.00 . A A .  42 ALA HB3  1 1 
        3  5519 1 1  42 ALA N    N  -2.936   4.709  15.767 1.00 . A A .  42 ALA N    1 1 
        3  5520 1 1  42 ALA O    O  -3.000   7.314  14.951 1.00 . A A .  42 ALA O    1 1 
        3  5521 1 1  43 GLU C    C  -0.425   9.034  12.507 1.00 . A A .  43 GLU C    1 1 
        3  5522 1 1  43 GLU CA   C  -0.895   8.695  13.917 1.00 . A A .  43 GLU CA   1 1 
        3  5523 1 1  43 GLU CB   C   0.107   9.239  14.944 1.00 . A A .  43 GLU CB   1 1 
        3  5524 1 1  43 GLU CD   C   1.337   7.067  15.253 1.00 . A A .  43 GLU CD   1 1 
        3  5525 1 1  43 GLU CG   C   1.462   8.528  14.808 1.00 . A A .  43 GLU CG   1 1 
        3  5526 1 1  43 GLU H    H  -0.253   6.651  13.741 1.00 . A A .  43 GLU H    1 1 
        3  5527 1 1  43 GLU HA   H  -1.860   9.151  14.082 1.00 . A A .  43 GLU HA   1 1 
        3  5528 1 1  43 GLU HB2  H   0.243  10.296  14.780 1.00 . A A .  43 GLU HB2  1 1 
        3  5529 1 1  43 GLU HB3  H  -0.280   9.077  15.938 1.00 . A A .  43 GLU HB3  1 1 
        3  5530 1 1  43 GLU HG2  H   1.789   8.563  13.778 1.00 . A A .  43 GLU HG2  1 1 
        3  5531 1 1  43 GLU HG3  H   2.190   9.027  15.430 1.00 . A A .  43 GLU HG3  1 1 
        3  5532 1 1  43 GLU N    N  -0.995   7.214  14.047 1.00 . A A .  43 GLU N    1 1 
        3  5533 1 1  43 GLU O    O   0.317   8.286  11.898 1.00 . A A .  43 GLU O    1 1 
        3  5534 1 1  43 GLU OE1  O   0.515   6.799  16.113 1.00 . A A .  43 GLU OE1  1 1 
        3  5535 1 1  43 GLU OE2  O   2.059   6.243  14.718 1.00 . A A .  43 GLU OE2  1 1 
        3  5536 1 1  44 VAL C    C   0.169  11.951  10.649 1.00 . A A .  44 VAL C    1 1 
        3  5537 1 1  44 VAL CA   C  -0.442  10.554  10.602 1.00 . A A .  44 VAL CA   1 1 
        3  5538 1 1  44 VAL CB   C  -1.663  10.552   9.678 1.00 . A A .  44 VAL CB   1 1 
        3  5539 1 1  44 VAL CG1  C  -2.114   9.110   9.444 1.00 . A A .  44 VAL CG1  1 1 
        3  5540 1 1  44 VAL CG2  C  -2.809  11.343  10.319 1.00 . A A .  44 VAL CG2  1 1 
        3  5541 1 1  44 VAL H    H  -1.454  10.731  12.496 1.00 . A A .  44 VAL H    1 1 
        3  5542 1 1  44 VAL HA   H   0.294   9.864  10.214 1.00 . A A .  44 VAL HA   1 1 
        3  5543 1 1  44 VAL HB   H  -1.399  11.003   8.732 1.00 . A A .  44 VAL HB   1 1 
        3  5544 1 1  44 VAL HG11 H  -3.016   9.105   8.851 1.00 . A A .  44 VAL HG11 1 1 
        3  5545 1 1  44 VAL HG12 H  -2.305   8.634  10.394 1.00 . A A .  44 VAL HG12 1 1 
        3  5546 1 1  44 VAL HG13 H  -1.337   8.572   8.921 1.00 . A A .  44 VAL HG13 1 1 
        3  5547 1 1  44 VAL HG21 H  -3.707  11.215   9.730 1.00 . A A .  44 VAL HG21 1 1 
        3  5548 1 1  44 VAL HG22 H  -2.549  12.391  10.352 1.00 . A A .  44 VAL HG22 1 1 
        3  5549 1 1  44 VAL HG23 H  -2.985  10.983  11.321 1.00 . A A .  44 VAL HG23 1 1 
        3  5550 1 1  44 VAL N    N  -0.853  10.151  11.980 1.00 . A A .  44 VAL N    1 1 
        3  5551 1 1  44 VAL O    O  -0.365  12.861  11.253 1.00 . A A .  44 VAL O    1 1 
        3  5552 1 1  45 GLU C    C   3.140  13.377   9.028 1.00 . A A .  45 GLU C    1 1 
        3  5553 1 1  45 GLU CA   C   1.967  13.441  10.007 1.00 . A A .  45 GLU CA   1 1 
        3  5554 1 1  45 GLU CB   C   2.500  13.769  11.407 1.00 . A A .  45 GLU CB   1 1 
        3  5555 1 1  45 GLU CD   C   3.880  15.452  12.662 1.00 . A A .  45 GLU CD   1 1 
        3  5556 1 1  45 GLU CG   C   2.993  15.222  11.435 1.00 . A A .  45 GLU CG   1 1 
        3  5557 1 1  45 GLU H    H   1.699  11.362   9.539 1.00 . A A .  45 GLU H    1 1 
        3  5558 1 1  45 GLU HA   H   1.266  14.203   9.704 1.00 . A A .  45 GLU HA   1 1 
        3  5559 1 1  45 GLU HB2  H   1.709  13.640  12.133 1.00 . A A .  45 GLU HB2  1 1 
        3  5560 1 1  45 GLU HB3  H   3.317  13.106  11.643 1.00 . A A .  45 GLU HB3  1 1 
        3  5561 1 1  45 GLU HG2  H   3.562  15.430  10.542 1.00 . A A .  45 GLU HG2  1 1 
        3  5562 1 1  45 GLU HG3  H   2.143  15.887  11.481 1.00 . A A .  45 GLU HG3  1 1 
        3  5563 1 1  45 GLU N    N   1.293  12.118  10.017 1.00 . A A .  45 GLU N    1 1 
        3  5564 1 1  45 GLU O    O   4.260  13.115   9.418 1.00 . A A .  45 GLU O    1 1 
        3  5565 1 1  45 GLU OE1  O   4.389  14.480  13.197 1.00 . A A .  45 GLU OE1  1 1 
        3  5566 1 1  45 GLU OE2  O   4.037  16.599  13.045 1.00 . A A .  45 GLU OE2  1 1 
        3  5567 1 1  46 PRO C    C   5.145  14.471   7.129 1.00 . A A .  46 PRO C    1 1 
        3  5568 1 1  46 PRO CA   C   3.963  13.582   6.731 1.00 . A A .  46 PRO CA   1 1 
        3  5569 1 1  46 PRO CB   C   3.272  14.131   5.468 1.00 . A A .  46 PRO CB   1 1 
        3  5570 1 1  46 PRO CD   C   1.578  13.939   7.189 1.00 . A A .  46 PRO CD   1 1 
        3  5571 1 1  46 PRO CG   C   1.812  13.874   5.678 1.00 . A A .  46 PRO CG   1 1 
        3  5572 1 1  46 PRO HA   H   4.293  12.570   6.559 1.00 . A A .  46 PRO HA   1 1 
        3  5573 1 1  46 PRO HB2  H   3.456  15.196   5.367 1.00 . A A .  46 PRO HB2  1 1 
        3  5574 1 1  46 PRO HB3  H   3.620  13.608   4.589 1.00 . A A .  46 PRO HB3  1 1 
        3  5575 1 1  46 PRO HD2  H   1.270  14.936   7.481 1.00 . A A .  46 PRO HD2  1 1 
        3  5576 1 1  46 PRO HD3  H   0.846  13.208   7.499 1.00 . A A .  46 PRO HD3  1 1 
        3  5577 1 1  46 PRO HG2  H   1.224  14.631   5.174 1.00 . A A .  46 PRO HG2  1 1 
        3  5578 1 1  46 PRO HG3  H   1.547  12.894   5.312 1.00 . A A .  46 PRO HG3  1 1 
        3  5579 1 1  46 PRO N    N   2.893  13.616   7.766 1.00 . A A .  46 PRO N    1 1 
        3  5580 1 1  46 PRO O    O   6.289  14.176   6.842 1.00 . A A .  46 PRO O    1 1 
        3  5581 1 1  47 GLU C    C   6.610  15.989   9.496 1.00 . A A .  47 GLU C    1 1 
        3  5582 1 1  47 GLU CA   C   5.955  16.493   8.195 1.00 . A A .  47 GLU CA   1 1 
        3  5583 1 1  47 GLU CB   C   5.350  17.885   8.422 1.00 . A A .  47 GLU CB   1 1 
        3  5584 1 1  47 GLU CD   C   6.537  19.102   6.588 1.00 . A A .  47 GLU CD   1 1 
        3  5585 1 1  47 GLU CG   C   5.178  18.596   7.075 1.00 . A A .  47 GLU CG   1 1 
        3  5586 1 1  47 GLU H    H   3.934  15.781   7.993 1.00 . A A .  47 GLU H    1 1 
        3  5587 1 1  47 GLU HA   H   6.691  16.540   7.408 1.00 . A A .  47 GLU HA   1 1 
        3  5588 1 1  47 GLU HB2  H   4.385  17.781   8.898 1.00 . A A .  47 GLU HB2  1 1 
        3  5589 1 1  47 GLU HB3  H   6.000  18.467   9.055 1.00 . A A .  47 GLU HB3  1 1 
        3  5590 1 1  47 GLU HG2  H   4.770  17.904   6.351 1.00 . A A .  47 GLU HG2  1 1 
        3  5591 1 1  47 GLU HG3  H   4.505  19.432   7.193 1.00 . A A .  47 GLU HG3  1 1 
        3  5592 1 1  47 GLU N    N   4.867  15.564   7.782 1.00 . A A .  47 GLU N    1 1 
        3  5593 1 1  47 GLU O    O   5.981  15.322  10.294 1.00 . A A .  47 GLU O    1 1 
        3  5594 1 1  47 GLU OE1  O   7.125  19.917   7.280 1.00 . A A .  47 GLU OE1  1 1 
        3  5595 1 1  47 GLU OE2  O   6.967  18.665   5.533 1.00 . A A .  47 GLU OE2  1 1 
        3  5596 1 1  48 PRO C    C   8.119  16.550  12.207 1.00 . A A .  48 PRO C    1 1 
        3  5597 1 1  48 PRO CA   C   8.629  15.882  10.922 1.00 . A A .  48 PRO CA   1 1 
        3  5598 1 1  48 PRO CB   C  10.075  16.308  10.611 1.00 . A A .  48 PRO CB   1 1 
        3  5599 1 1  48 PRO CD   C   8.715  17.113   8.800 1.00 . A A .  48 PRO CD   1 1 
        3  5600 1 1  48 PRO CG   C   9.934  17.446   9.657 1.00 . A A .  48 PRO CG   1 1 
        3  5601 1 1  48 PRO HA   H   8.588  14.810  11.027 1.00 . A A .  48 PRO HA   1 1 
        3  5602 1 1  48 PRO HB2  H  10.586  16.624  11.512 1.00 . A A .  48 PRO HB2  1 1 
        3  5603 1 1  48 PRO HB3  H  10.614  15.498  10.139 1.00 . A A .  48 PRO HB3  1 1 
        3  5604 1 1  48 PRO HD2  H   8.207  18.016   8.497 1.00 . A A .  48 PRO HD2  1 1 
        3  5605 1 1  48 PRO HD3  H   9.002  16.528   7.939 1.00 . A A .  48 PRO HD3  1 1 
        3  5606 1 1  48 PRO HG2  H   9.773  18.369  10.200 1.00 . A A .  48 PRO HG2  1 1 
        3  5607 1 1  48 PRO HG3  H  10.810  17.528   9.031 1.00 . A A .  48 PRO HG3  1 1 
        3  5608 1 1  48 PRO N    N   7.869  16.307   9.702 1.00 . A A .  48 PRO N    1 1 
        3  5609 1 1  48 PRO O    O   7.699  17.691  12.210 1.00 . A A .  48 PRO O    1 1 
        3  5610 1 1  49 GLY C    C   7.193  15.259  15.485 1.00 . A A .  49 GLY C    1 1 
        3  5611 1 1  49 GLY CA   C   7.693  16.405  14.603 1.00 . A A .  49 GLY CA   1 1 
        3  5612 1 1  49 GLY H    H   8.511  14.923  13.273 1.00 . A A .  49 GLY H    1 1 
        3  5613 1 1  49 GLY HA2  H   8.513  16.912  15.093 1.00 . A A .  49 GLY HA2  1 1 
        3  5614 1 1  49 GLY HA3  H   6.886  17.100  14.429 1.00 . A A .  49 GLY HA3  1 1 
        3  5615 1 1  49 GLY N    N   8.163  15.839  13.303 1.00 . A A .  49 GLY N    1 1 
        3  5616 1 1  49 GLY O    O   7.280  15.306  16.694 1.00 . A A .  49 GLY O    1 1 
        3  5617 1 1  50 GLY C    C   5.158  13.507  16.697 1.00 . A A .  50 GLY C    1 1 
        3  5618 1 1  50 GLY CA   C   6.187  13.052  15.661 1.00 . A A .  50 GLY CA   1 1 
        3  5619 1 1  50 GLY H    H   6.636  14.205  13.897 1.00 . A A .  50 GLY H    1 1 
        3  5620 1 1  50 GLY HA2  H   5.726  12.343  14.987 1.00 . A A .  50 GLY HA2  1 1 
        3  5621 1 1  50 GLY HA3  H   7.016  12.583  16.164 1.00 . A A .  50 GLY HA3  1 1 
        3  5622 1 1  50 GLY N    N   6.683  14.221  14.877 1.00 . A A .  50 GLY N    1 1 
        3  5623 1 1  50 GLY O    O   5.498  13.876  17.803 1.00 . A A .  50 GLY O    1 1 
        3  5624 1 1  51 LEU C    C   2.628  12.827  18.365 1.00 . A A .  51 LEU C    1 1 
        3  5625 1 1  51 LEU CA   C   2.850  13.912  17.310 1.00 . A A .  51 LEU CA   1 1 
        3  5626 1 1  51 LEU CB   C   1.545  14.166  16.550 1.00 . A A .  51 LEU CB   1 1 
        3  5627 1 1  51 LEU CD1  C   0.472  15.472  14.703 1.00 . A A .  51 LEU CD1  1 1 
        3  5628 1 1  51 LEU CD2  C   2.105  16.608  16.241 1.00 . A A .  51 LEU CD2  1 1 
        3  5629 1 1  51 LEU CG   C   1.753  15.289  15.524 1.00 . A A .  51 LEU CG   1 1 
        3  5630 1 1  51 LEU H    H   3.648  13.180  15.451 1.00 . A A .  51 LEU H    1 1 
        3  5631 1 1  51 LEU HA   H   3.164  14.817  17.802 1.00 . A A .  51 LEU HA   1 1 
        3  5632 1 1  51 LEU HB2  H   1.247  13.262  16.037 1.00 . A A .  51 LEU HB2  1 1 
        3  5633 1 1  51 LEU HB3  H   0.772  14.454  17.246 1.00 . A A .  51 LEU HB3  1 1 
        3  5634 1 1  51 LEU HD11 H  -0.277  15.963  15.307 1.00 . A A .  51 LEU HD11 1 1 
        3  5635 1 1  51 LEU HD12 H   0.104  14.507  14.387 1.00 . A A .  51 LEU HD12 1 1 
        3  5636 1 1  51 LEU HD13 H   0.686  16.078  13.834 1.00 . A A .  51 LEU HD13 1 1 
        3  5637 1 1  51 LEU HD21 H   3.169  16.649  16.419 1.00 . A A .  51 LEU HD21 1 1 
        3  5638 1 1  51 LEU HD22 H   1.579  16.665  17.182 1.00 . A A .  51 LEU HD22 1 1 
        3  5639 1 1  51 LEU HD23 H   1.820  17.447  15.620 1.00 . A A .  51 LEU HD23 1 1 
        3  5640 1 1  51 LEU HG   H   2.560  15.015  14.862 1.00 . A A .  51 LEU HG   1 1 
        3  5641 1 1  51 LEU N    N   3.902  13.480  16.349 1.00 . A A .  51 LEU N    1 1 
        3  5642 1 1  51 LEU O    O   2.733  11.646  18.097 1.00 . A A .  51 LEU O    1 1 
        3  5643 1 1  52 TYR C    C   0.646  11.718  20.553 1.00 . A A .  52 TYR C    1 1 
        3  5644 1 1  52 TYR CA   C   2.079  12.248  20.657 1.00 . A A .  52 TYR CA   1 1 
        3  5645 1 1  52 TYR CB   C   2.267  12.962  21.997 1.00 . A A .  52 TYR CB   1 1 
        3  5646 1 1  52 TYR CD1  C   2.865  11.011  23.473 1.00 . A A .  52 TYR CD1  1 1 
        3  5647 1 1  52 TYR CD2  C   0.763  12.158  23.855 1.00 . A A .  52 TYR CD2  1 1 
        3  5648 1 1  52 TYR CE1  C   2.581  10.140  24.531 1.00 . A A .  52 TYR CE1  1 1 
        3  5649 1 1  52 TYR CE2  C   0.478  11.286  24.912 1.00 . A A .  52 TYR CE2  1 1 
        3  5650 1 1  52 TYR CG   C   1.957  12.020  23.134 1.00 . A A .  52 TYR CG   1 1 
        3  5651 1 1  52 TYR CZ   C   1.387  10.277  25.251 1.00 . A A .  52 TYR CZ   1 1 
        3  5652 1 1  52 TYR H    H   2.237  14.188  19.750 1.00 . A A .  52 TYR H    1 1 
        3  5653 1 1  52 TYR HA   H   2.780  11.432  20.576 1.00 . A A .  52 TYR HA   1 1 
        3  5654 1 1  52 TYR HB2  H   3.290  13.301  22.080 1.00 . A A .  52 TYR HB2  1 1 
        3  5655 1 1  52 TYR HB3  H   1.604  13.815  22.043 1.00 . A A .  52 TYR HB3  1 1 
        3  5656 1 1  52 TYR HD1  H   3.785  10.907  22.918 1.00 . A A .  52 TYR HD1  1 1 
        3  5657 1 1  52 TYR HD2  H   0.062  12.938  23.595 1.00 . A A .  52 TYR HD2  1 1 
        3  5658 1 1  52 TYR HE1  H   3.282   9.362  24.792 1.00 . A A .  52 TYR HE1  1 1 
        3  5659 1 1  52 TYR HE2  H  -0.443  11.393  25.467 1.00 . A A .  52 TYR HE2  1 1 
        3  5660 1 1  52 TYR HH   H   1.929   9.231  26.752 1.00 . A A .  52 TYR HH   1 1 
        3  5661 1 1  52 TYR N    N   2.317  13.229  19.564 1.00 . A A .  52 TYR N    1 1 
        3  5662 1 1  52 TYR O    O   0.275  10.763  21.206 1.00 . A A .  52 TYR O    1 1 
        3  5663 1 1  52 TYR OH   O   1.108   9.417  26.291 1.00 . A A .  52 TYR OH   1 1 
        3  5664 1 1  53 LEU C    C  -1.635  10.603  18.759 1.00 . A A .  53 LEU C    1 1 
        3  5665 1 1  53 LEU CA   C  -1.577  11.885  19.593 1.00 . A A .  53 LEU CA   1 1 
        3  5666 1 1  53 LEU CB   C  -2.390  12.982  18.898 1.00 . A A .  53 LEU CB   1 1 
        3  5667 1 1  53 LEU CD1  C  -3.093  15.384  18.980 1.00 . A A .  53 LEU CD1  1 1 
        3  5668 1 1  53 LEU CD2  C  -2.994  14.053  21.100 1.00 . A A .  53 LEU CD2  1 1 
        3  5669 1 1  53 LEU CG   C  -2.341  14.277  19.726 1.00 . A A .  53 LEU CG   1 1 
        3  5670 1 1  53 LEU H    H   0.156  13.111  19.225 1.00 . A A .  53 LEU H    1 1 
        3  5671 1 1  53 LEU HA   H  -1.992  11.689  20.566 1.00 . A A .  53 LEU HA   1 1 
        3  5672 1 1  53 LEU HB2  H  -1.976  13.170  17.917 1.00 . A A .  53 LEU HB2  1 1 
        3  5673 1 1  53 LEU HB3  H  -3.415  12.662  18.799 1.00 . A A .  53 LEU HB3  1 1 
        3  5674 1 1  53 LEU HD11 H  -2.873  16.338  19.436 1.00 . A A .  53 LEU HD11 1 1 
        3  5675 1 1  53 LEU HD12 H  -4.155  15.196  19.033 1.00 . A A .  53 LEU HD12 1 1 
        3  5676 1 1  53 LEU HD13 H  -2.781  15.400  17.946 1.00 . A A .  53 LEU HD13 1 1 
        3  5677 1 1  53 LEU HD21 H  -3.856  13.411  20.993 1.00 . A A .  53 LEU HD21 1 1 
        3  5678 1 1  53 LEU HD22 H  -3.303  15.003  21.514 1.00 . A A .  53 LEU HD22 1 1 
        3  5679 1 1  53 LEU HD23 H  -2.283  13.594  21.769 1.00 . A A .  53 LEU HD23 1 1 
        3  5680 1 1  53 LEU HG   H  -1.309  14.574  19.859 1.00 . A A .  53 LEU HG   1 1 
        3  5681 1 1  53 LEU N    N  -0.164  12.337  19.737 1.00 . A A .  53 LEU N    1 1 
        3  5682 1 1  53 LEU O    O  -0.830  10.388  17.875 1.00 . A A .  53 LEU O    1 1 
        3  5683 1 1  54 VAL C    C  -4.198   8.252  17.913 1.00 . A A .  54 VAL C    1 1 
        3  5684 1 1  54 VAL CA   C  -2.730   8.470  18.271 1.00 . A A .  54 VAL CA   1 1 
        3  5685 1 1  54 VAL CB   C  -2.242   7.299  19.125 1.00 . A A .  54 VAL CB   1 1 
        3  5686 1 1  54 VAL CG1  C  -0.749   7.461  19.408 1.00 . A A .  54 VAL CG1  1 1 
        3  5687 1 1  54 VAL CG2  C  -3.010   7.271  20.450 1.00 . A A .  54 VAL CG2  1 1 
        3  5688 1 1  54 VAL H    H  -3.229   9.955  19.756 1.00 . A A .  54 VAL H    1 1 
        3  5689 1 1  54 VAL HA   H  -2.146   8.519  17.362 1.00 . A A .  54 VAL HA   1 1 
        3  5690 1 1  54 VAL HB   H  -2.408   6.375  18.593 1.00 . A A .  54 VAL HB   1 1 
        3  5691 1 1  54 VAL HG11 H  -0.420   6.670  20.067 1.00 . A A .  54 VAL HG11 1 1 
        3  5692 1 1  54 VAL HG12 H  -0.574   8.417  19.879 1.00 . A A .  54 VAL HG12 1 1 
        3  5693 1 1  54 VAL HG13 H  -0.201   7.410  18.480 1.00 . A A .  54 VAL HG13 1 1 
        3  5694 1 1  54 VAL HG21 H  -4.040   7.006  20.263 1.00 . A A .  54 VAL HG21 1 1 
        3  5695 1 1  54 VAL HG22 H  -2.966   8.244  20.915 1.00 . A A .  54 VAL HG22 1 1 
        3  5696 1 1  54 VAL HG23 H  -2.564   6.537  21.108 1.00 . A A .  54 VAL HG23 1 1 
        3  5697 1 1  54 VAL N    N  -2.592   9.750  19.038 1.00 . A A .  54 VAL N    1 1 
        3  5698 1 1  54 VAL O    O  -5.075   8.847  18.501 1.00 . A A .  54 VAL O    1 1 
        3  5699 1 1  55 ASN C    C  -6.572   8.438  16.162 1.00 . A A .  55 ASN C    1 1 
        3  5700 1 1  55 ASN CA   C  -5.875   7.124  16.544 1.00 . A A .  55 ASN CA   1 1 
        3  5701 1 1  55 ASN CB   C  -6.615   6.451  17.708 1.00 . A A .  55 ASN CB   1 1 
        3  5702 1 1  55 ASN CG   C  -8.078   6.207  17.330 1.00 . A A .  55 ASN CG   1 1 
        3  5703 1 1  55 ASN H    H  -3.728   6.933  16.502 1.00 . A A .  55 ASN H    1 1 
        3  5704 1 1  55 ASN HA   H  -5.875   6.461  15.690 1.00 . A A .  55 ASN HA   1 1 
        3  5705 1 1  55 ASN HB2  H  -6.144   5.506  17.933 1.00 . A A .  55 ASN HB2  1 1 
        3  5706 1 1  55 ASN HB3  H  -6.576   7.084  18.579 1.00 . A A .  55 ASN HB3  1 1 
        3  5707 1 1  55 ASN HD21 H  -8.151   4.433  18.219 1.00 . A A .  55 ASN HD21 1 1 
        3  5708 1 1  55 ASN HD22 H  -9.592   4.928  17.470 1.00 . A A .  55 ASN HD22 1 1 
        3  5709 1 1  55 ASN N    N  -4.464   7.400  16.953 1.00 . A A .  55 ASN N    1 1 
        3  5710 1 1  55 ASN ND2  N  -8.655   5.098  17.702 1.00 . A A .  55 ASN ND2  1 1 
        3  5711 1 1  55 ASN O    O  -6.740   8.747  15.001 1.00 . A A .  55 ASN O    1 1 
        3  5712 1 1  55 ASN OD1  O  -8.702   7.030  16.692 1.00 . A A .  55 ASN OD1  1 1 
        3  5713 1 1  56 VAL C    C  -8.916  10.298  16.031 1.00 . A A .  56 VAL C    1 1 
        3  5714 1 1  56 VAL CA   C  -7.643  10.514  16.854 1.00 . A A .  56 VAL CA   1 1 
        3  5715 1 1  56 VAL CB   C  -6.687  11.442  16.100 1.00 . A A .  56 VAL CB   1 1 
        3  5716 1 1  56 VAL CG1  C  -7.230  12.872  16.138 1.00 . A A .  56 VAL CG1  1 1 
        3  5717 1 1  56 VAL CG2  C  -5.314  11.410  16.775 1.00 . A A .  56 VAL CG2  1 1 
        3  5718 1 1  56 VAL H    H  -6.808   8.941  18.062 1.00 . A A .  56 VAL H    1 1 
        3  5719 1 1  56 VAL HA   H  -7.910  10.974  17.792 1.00 . A A .  56 VAL HA   1 1 
        3  5720 1 1  56 VAL HB   H  -6.594  11.116  15.074 1.00 . A A .  56 VAL HB   1 1 
        3  5721 1 1  56 VAL HG11 H  -7.252  13.220  17.161 1.00 . A A .  56 VAL HG11 1 1 
        3  5722 1 1  56 VAL HG12 H  -8.228  12.889  15.732 1.00 . A A .  56 VAL HG12 1 1 
        3  5723 1 1  56 VAL HG13 H  -6.592  13.518  15.553 1.00 . A A .  56 VAL HG13 1 1 
        3  5724 1 1  56 VAL HG21 H  -4.716  12.237  16.422 1.00 . A A .  56 VAL HG21 1 1 
        3  5725 1 1  56 VAL HG22 H  -4.817  10.480  16.540 1.00 . A A .  56 VAL HG22 1 1 
        3  5726 1 1  56 VAL HG23 H  -5.438  11.489  17.847 1.00 . A A .  56 VAL HG23 1 1 
        3  5727 1 1  56 VAL N    N  -6.967   9.212  17.135 1.00 . A A .  56 VAL N    1 1 
        3  5728 1 1  56 VAL O    O  -8.915   9.641  15.007 1.00 . A A .  56 VAL O    1 1 
        3  5729 1 1  57 THR C    C -11.580  12.008  14.967 1.00 . A A .  57 THR C    1 1 
        3  5730 1 1  57 THR CA   C -11.307  10.720  15.751 1.00 . A A .  57 THR CA   1 1 
        3  5731 1 1  57 THR CB   C -12.424  10.495  16.772 1.00 . A A .  57 THR CB   1 1 
        3  5732 1 1  57 THR CG2  C -12.060   9.317  17.681 1.00 . A A .  57 THR CG2  1 1 
        3  5733 1 1  57 THR H    H  -9.975  11.387  17.306 1.00 . A A .  57 THR H    1 1 
        3  5734 1 1  57 THR HA   H -11.263   9.882  15.071 1.00 . A A .  57 THR HA   1 1 
        3  5735 1 1  57 THR HB   H -13.347  10.277  16.259 1.00 . A A .  57 THR HB   1 1 
        3  5736 1 1  57 THR HG1  H -12.237  11.480  18.437 1.00 . A A .  57 THR HG1  1 1 
        3  5737 1 1  57 THR HG21 H -11.964   8.418  17.089 1.00 . A A .  57 THR HG21 1 1 
        3  5738 1 1  57 THR HG22 H -12.834   9.179  18.421 1.00 . A A .  57 THR HG22 1 1 
        3  5739 1 1  57 THR HG23 H -11.122   9.521  18.179 1.00 . A A .  57 THR HG23 1 1 
        3  5740 1 1  57 THR N    N -10.009  10.862  16.481 1.00 . A A .  57 THR N    1 1 
        3  5741 1 1  57 THR O    O -12.519  12.095  14.202 1.00 . A A .  57 THR O    1 1 
        3  5742 1 1  57 THR OG1  O -12.582  11.667  17.561 1.00 . A A .  57 THR OG1  1 1 
        3  5743 1 1  58 GLY C    C -10.225  14.232  13.072 1.00 . A A .  58 GLY C    1 1 
        3  5744 1 1  58 GLY CA   C -10.954  14.297  14.420 1.00 . A A .  58 GLY CA   1 1 
        3  5745 1 1  58 GLY H    H -10.008  12.914  15.773 1.00 . A A .  58 GLY H    1 1 
        3  5746 1 1  58 GLY HA2  H -12.009  14.464  14.254 1.00 . A A .  58 GLY HA2  1 1 
        3  5747 1 1  58 GLY HA3  H -10.548  15.108  15.003 1.00 . A A .  58 GLY HA3  1 1 
        3  5748 1 1  58 GLY N    N -10.757  13.010  15.152 1.00 . A A .  58 GLY N    1 1 
        3  5749 1 1  58 GLY O    O -10.435  15.047  12.200 1.00 . A A .  58 GLY O    1 1 
        3  5750 1 1  59 ALA C    C  -8.108  14.463  11.126 1.00 . A A .  59 ALA C    1 1 
        3  5751 1 1  59 ALA CA   C  -8.628  13.108  11.614 1.00 . A A .  59 ALA CA   1 1 
        3  5752 1 1  59 ALA CB   C  -9.553  12.521  10.549 1.00 . A A .  59 ALA CB   1 1 
        3  5753 1 1  59 ALA H    H  -9.229  12.608  13.622 1.00 . A A .  59 ALA H    1 1 
        3  5754 1 1  59 ALA HA   H  -7.793  12.441  11.765 1.00 . A A .  59 ALA HA   1 1 
        3  5755 1 1  59 ALA HB1  H  -8.971  12.253   9.680 1.00 . A A .  59 ALA HB1  1 1 
        3  5756 1 1  59 ALA HB2  H -10.296  13.256  10.274 1.00 . A A .  59 ALA HB2  1 1 
        3  5757 1 1  59 ALA HB3  H -10.043  11.642  10.940 1.00 . A A .  59 ALA HB3  1 1 
        3  5758 1 1  59 ALA N    N  -9.375  13.256  12.903 1.00 . A A .  59 ALA N    1 1 
        3  5759 1 1  59 ALA O    O  -7.840  15.353  11.907 1.00 . A A .  59 ALA O    1 1 
        3  5760 1 1  60 ARG C    C  -6.301  16.438  10.102 1.00 . A A .  60 ARG C    1 1 
        3  5761 1 1  60 ARG CA   C  -7.443  15.892   9.246 1.00 . A A .  60 ARG CA   1 1 
        3  5762 1 1  60 ARG CB   C  -8.566  16.930   9.196 1.00 . A A .  60 ARG CB   1 1 
        3  5763 1 1  60 ARG CD   C -10.725  17.573   8.121 1.00 . A A .  60 ARG CD   1 1 
        3  5764 1 1  60 ARG CG   C  -9.599  16.536   8.138 1.00 . A A .  60 ARG CG   1 1 
        3  5765 1 1  60 ARG CZ   C -12.630  18.064   6.698 1.00 . A A .  60 ARG CZ   1 1 
        3  5766 1 1  60 ARG H    H  -8.179  13.867   9.231 1.00 . A A .  60 ARG H    1 1 
        3  5767 1 1  60 ARG HA   H  -7.082  15.708   8.243 1.00 . A A .  60 ARG HA   1 1 
        3  5768 1 1  60 ARG HB2  H  -9.042  16.985  10.163 1.00 . A A .  60 ARG HB2  1 1 
        3  5769 1 1  60 ARG HB3  H  -8.148  17.894   8.947 1.00 . A A .  60 ARG HB3  1 1 
        3  5770 1 1  60 ARG HD2  H -11.192  17.613   9.095 1.00 . A A .  60 ARG HD2  1 1 
        3  5771 1 1  60 ARG HD3  H -10.316  18.544   7.878 1.00 . A A .  60 ARG HD3  1 1 
        3  5772 1 1  60 ARG HE   H -11.750  16.284   6.732 1.00 . A A .  60 ARG HE   1 1 
        3  5773 1 1  60 ARG HG2  H  -9.125  16.499   7.168 1.00 . A A .  60 ARG HG2  1 1 
        3  5774 1 1  60 ARG HG3  H -10.009  15.566   8.378 1.00 . A A .  60 ARG HG3  1 1 
        3  5775 1 1  60 ARG HH11 H -11.921  19.549   7.840 1.00 . A A .  60 ARG HH11 1 1 
        3  5776 1 1  60 ARG HH12 H -13.295  19.946   6.864 1.00 . A A .  60 ARG HH12 1 1 
        3  5777 1 1  60 ARG HH21 H -13.545  16.789   5.457 1.00 . A A .  60 ARG HH21 1 1 
        3  5778 1 1  60 ARG HH22 H -14.214  18.386   5.516 1.00 . A A .  60 ARG HH22 1 1 
        3  5779 1 1  60 ARG N    N  -7.958  14.610   9.828 1.00 . A A .  60 ARG N    1 1 
        3  5780 1 1  60 ARG NE   N -11.741  17.193   7.099 1.00 . A A .  60 ARG NE   1 1 
        3  5781 1 1  60 ARG NH1  N -12.613  19.281   7.173 1.00 . A A .  60 ARG NH1  1 1 
        3  5782 1 1  60 ARG NH2  N -13.533  17.719   5.822 1.00 . A A .  60 ARG NH2  1 1 
        3  5783 1 1  60 ARG O    O  -5.147  16.144   9.869 1.00 . A A .  60 ARG O    1 1 
        3  5784 1 1  61 PHE C    C  -4.610  18.676  11.175 1.00 . A A .  61 PHE C    1 1 
        3  5785 1 1  61 PHE CA   C  -5.578  17.812  11.983 1.00 . A A .  61 PHE CA   1 1 
        3  5786 1 1  61 PHE CB   C  -4.792  16.694  12.672 1.00 . A A .  61 PHE CB   1 1 
        3  5787 1 1  61 PHE CD1  C  -4.469  17.529  15.025 1.00 . A A .  61 PHE CD1  1 1 
        3  5788 1 1  61 PHE CD2  C  -2.587  17.597  13.499 1.00 . A A .  61 PHE CD2  1 1 
        3  5789 1 1  61 PHE CE1  C  -3.668  18.079  16.035 1.00 . A A .  61 PHE CE1  1 1 
        3  5790 1 1  61 PHE CE2  C  -1.787  18.147  14.507 1.00 . A A .  61 PHE CE2  1 1 
        3  5791 1 1  61 PHE CG   C  -3.928  17.288  13.758 1.00 . A A .  61 PHE CG   1 1 
        3  5792 1 1  61 PHE CZ   C  -2.329  18.389  15.776 1.00 . A A .  61 PHE CZ   1 1 
        3  5793 1 1  61 PHE H    H  -7.567  17.449  11.245 1.00 . A A .  61 PHE H    1 1 
        3  5794 1 1  61 PHE HA   H  -6.058  18.426  12.734 1.00 . A A .  61 PHE HA   1 1 
        3  5795 1 1  61 PHE HB2  H  -5.479  15.982  13.105 1.00 . A A .  61 PHE HB2  1 1 
        3  5796 1 1  61 PHE HB3  H  -4.163  16.196  11.953 1.00 . A A .  61 PHE HB3  1 1 
        3  5797 1 1  61 PHE HD1  H  -5.503  17.292  15.226 1.00 . A A .  61 PHE HD1  1 1 
        3  5798 1 1  61 PHE HD2  H  -2.170  17.411  12.519 1.00 . A A .  61 PHE HD2  1 1 
        3  5799 1 1  61 PHE HE1  H  -4.086  18.265  17.013 1.00 . A A .  61 PHE HE1  1 1 
        3  5800 1 1  61 PHE HE2  H  -0.752  18.386  14.307 1.00 . A A .  61 PHE HE2  1 1 
        3  5801 1 1  61 PHE HZ   H  -1.712  18.812  16.554 1.00 . A A .  61 PHE HZ   1 1 
        3  5802 1 1  61 PHE N    N  -6.624  17.232  11.088 1.00 . A A .  61 PHE N    1 1 
        3  5803 1 1  61 PHE O    O  -4.597  19.885  11.298 1.00 . A A .  61 PHE O    1 1 
        3  5804 1 1  62 ALA C    C  -3.301  19.031   8.132 1.00 . A A .  62 ALA C    1 1 
        3  5805 1 1  62 ALA CA   C  -2.797  18.852   9.564 1.00 . A A .  62 ALA CA   1 1 
        3  5806 1 1  62 ALA CB   C  -1.467  18.103   9.544 1.00 . A A .  62 ALA CB   1 1 
        3  5807 1 1  62 ALA H    H  -3.805  17.090  10.291 1.00 . A A .  62 ALA H    1 1 
        3  5808 1 1  62 ALA HA   H  -2.647  19.823  10.012 1.00 . A A .  62 ALA HA   1 1 
        3  5809 1 1  62 ALA HB1  H  -0.799  18.576   8.841 1.00 . A A .  62 ALA HB1  1 1 
        3  5810 1 1  62 ALA HB2  H  -1.633  17.076   9.248 1.00 . A A .  62 ALA HB2  1 1 
        3  5811 1 1  62 ALA HB3  H  -1.028  18.126  10.531 1.00 . A A .  62 ALA HB3  1 1 
        3  5812 1 1  62 ALA N    N  -3.785  18.066  10.365 1.00 . A A .  62 ALA N    1 1 
        3  5813 1 1  62 ALA O    O  -3.973  18.179   7.583 1.00 . A A .  62 ALA O    1 1 
        3  5814 1 1  63 ARG C    C  -2.322  21.154   5.372 1.00 . A A .  63 ARG C    1 1 
        3  5815 1 1  63 ARG CA   C  -3.424  20.409   6.124 1.00 . A A .  63 ARG CA   1 1 
        3  5816 1 1  63 ARG CB   C  -4.692  21.272   6.152 1.00 . A A .  63 ARG CB   1 1 
        3  5817 1 1  63 ARG CD   C  -6.474  22.331   4.744 1.00 . A A .  63 ARG CD   1 1 
        3  5818 1 1  63 ARG CG   C  -5.189  21.499   4.720 1.00 . A A .  63 ARG CG   1 1 
        3  5819 1 1  63 ARG CZ   C  -8.782  22.024   5.427 1.00 . A A .  63 ARG CZ   1 1 
        3  5820 1 1  63 ARG H    H  -2.436  20.810   7.995 1.00 . A A .  63 ARG H    1 1 
        3  5821 1 1  63 ARG HA   H  -3.635  19.477   5.622 1.00 . A A .  63 ARG HA   1 1 
        3  5822 1 1  63 ARG HB2  H  -5.454  20.766   6.727 1.00 . A A .  63 ARG HB2  1 1 
        3  5823 1 1  63 ARG HB3  H  -4.466  22.223   6.610 1.00 . A A .  63 ARG HB3  1 1 
        3  5824 1 1  63 ARG HD2  H  -6.319  23.212   5.351 1.00 . A A .  63 ARG HD2  1 1 
        3  5825 1 1  63 ARG HD3  H  -6.727  22.629   3.738 1.00 . A A .  63 ARG HD3  1 1 
        3  5826 1 1  63 ARG HE   H  -7.409  20.601   5.616 1.00 . A A .  63 ARG HE   1 1 
        3  5827 1 1  63 ARG HG2  H  -4.433  22.024   4.155 1.00 . A A .  63 ARG HG2  1 1 
        3  5828 1 1  63 ARG HG3  H  -5.389  20.546   4.254 1.00 . A A .  63 ARG HG3  1 1 
        3  5829 1 1  63 ARG HH11 H  -8.283  23.795   4.635 1.00 . A A .  63 ARG HH11 1 1 
        3  5830 1 1  63 ARG HH12 H  -9.939  23.627   5.110 1.00 . A A .  63 ARG HH12 1 1 
        3  5831 1 1  63 ARG HH21 H  -9.566  20.369   6.234 1.00 . A A .  63 ARG HH21 1 1 
        3  5832 1 1  63 ARG HH22 H -10.666  21.689   6.015 1.00 . A A .  63 ARG HH22 1 1 
        3  5833 1 1  63 ARG N    N  -2.979  20.144   7.525 1.00 . A A .  63 ARG N    1 1 
        3  5834 1 1  63 ARG NE   N  -7.581  21.520   5.319 1.00 . A A .  63 ARG NE   1 1 
        3  5835 1 1  63 ARG NH1  N  -9.019  23.244   5.026 1.00 . A A .  63 ARG NH1  1 1 
        3  5836 1 1  63 ARG NH2  N  -9.746  21.305   5.930 1.00 . A A .  63 ARG NH2  1 1 
        3  5837 1 1  63 ARG O    O  -1.571  21.918   5.944 1.00 . A A .  63 ARG O    1 1 
        3  5838 1 1  64 GLY C    C   0.145  20.876   3.397 1.00 . A A .  64 GLY C    1 1 
        3  5839 1 1  64 GLY CA   C  -1.175  21.639   3.286 1.00 . A A .  64 GLY CA   1 1 
        3  5840 1 1  64 GLY H    H  -2.842  20.324   3.645 1.00 . A A .  64 GLY H    1 1 
        3  5841 1 1  64 GLY HA2  H  -1.482  21.680   2.251 1.00 . A A .  64 GLY HA2  1 1 
        3  5842 1 1  64 GLY HA3  H  -1.040  22.641   3.662 1.00 . A A .  64 GLY HA3  1 1 
        3  5843 1 1  64 GLY N    N  -2.224  20.941   4.086 1.00 . A A .  64 GLY N    1 1 
        3  5844 1 1  64 GLY O    O   1.160  21.293   2.879 1.00 . A A .  64 GLY O    1 1 
        3  5845 1 1  65 SER C    C   1.490  17.940   3.084 1.00 . A A .  65 SER C    1 1 
        3  5846 1 1  65 SER CA   C   1.389  18.960   4.219 1.00 . A A .  65 SER CA   1 1 
        3  5847 1 1  65 SER CB   C   1.347  18.218   5.553 1.00 . A A .  65 SER CB   1 1 
        3  5848 1 1  65 SER H    H  -0.694  19.439   4.478 1.00 . A A .  65 SER H    1 1 
        3  5849 1 1  65 SER HA   H   2.248  19.615   4.199 1.00 . A A .  65 SER HA   1 1 
        3  5850 1 1  65 SER HB2  H   0.637  17.409   5.495 1.00 . A A .  65 SER HB2  1 1 
        3  5851 1 1  65 SER HB3  H   2.328  17.816   5.770 1.00 . A A .  65 SER HB3  1 1 
        3  5852 1 1  65 SER HG   H   1.547  19.000   7.321 1.00 . A A .  65 SER HG   1 1 
        3  5853 1 1  65 SER N    N   0.136  19.758   4.068 1.00 . A A .  65 SER N    1 1 
        3  5854 1 1  65 SER O    O   1.161  18.223   1.949 1.00 . A A .  65 SER O    1 1 
        3  5855 1 1  65 SER OG   O   0.951  19.117   6.579 1.00 . A A .  65 SER OG   1 1 
        3  5856 1 1  66 PHE C    C   2.974  16.143   1.222 1.00 . A A .  66 PHE C    1 1 
        3  5857 1 1  66 PHE CA   C   2.074  15.680   2.368 1.00 . A A .  66 PHE CA   1 1 
        3  5858 1 1  66 PHE CB   C   0.692  15.306   1.816 1.00 . A A .  66 PHE CB   1 1 
        3  5859 1 1  66 PHE CD1  C  -0.058  13.296   3.134 1.00 . A A .  66 PHE CD1  1 1 
        3  5860 1 1  66 PHE CD2  C  -0.967  15.468   3.703 1.00 . A A .  66 PHE CD2  1 1 
        3  5861 1 1  66 PHE CE1  C  -0.821  12.708   4.149 1.00 . A A .  66 PHE CE1  1 1 
        3  5862 1 1  66 PHE CE2  C  -1.731  14.882   4.721 1.00 . A A .  66 PHE CE2  1 1 
        3  5863 1 1  66 PHE CG   C  -0.131  14.675   2.911 1.00 . A A .  66 PHE CG   1 1 
        3  5864 1 1  66 PHE CZ   C  -1.657  13.501   4.943 1.00 . A A .  66 PHE CZ   1 1 
        3  5865 1 1  66 PHE H    H   2.194  16.565   4.323 1.00 . A A .  66 PHE H    1 1 
        3  5866 1 1  66 PHE HA   H   2.515  14.809   2.829 1.00 . A A .  66 PHE HA   1 1 
        3  5867 1 1  66 PHE HB2  H   0.190  16.189   1.453 1.00 . A A .  66 PHE HB2  1 1 
        3  5868 1 1  66 PHE HB3  H   0.810  14.602   1.007 1.00 . A A .  66 PHE HB3  1 1 
        3  5869 1 1  66 PHE HD1  H   0.585  12.685   2.521 1.00 . A A .  66 PHE HD1  1 1 
        3  5870 1 1  66 PHE HD2  H  -1.024  16.533   3.532 1.00 . A A .  66 PHE HD2  1 1 
        3  5871 1 1  66 PHE HE1  H  -0.763  11.643   4.320 1.00 . A A .  66 PHE HE1  1 1 
        3  5872 1 1  66 PHE HE2  H  -2.375  15.493   5.332 1.00 . A A .  66 PHE HE2  1 1 
        3  5873 1 1  66 PHE HZ   H  -2.245  13.049   5.727 1.00 . A A .  66 PHE HZ   1 1 
        3  5874 1 1  66 PHE N    N   1.942  16.753   3.396 1.00 . A A .  66 PHE N    1 1 
        3  5875 1 1  66 PHE O    O   3.082  17.316   0.929 1.00 . A A .  66 PHE O    1 1 
        3  5876 1 1  67 ARG C    C   3.704  15.654  -1.845 1.00 . A A .  67 ARG C    1 1 
        3  5877 1 1  67 ARG CA   C   4.524  15.571  -0.556 1.00 . A A .  67 ARG CA   1 1 
        3  5878 1 1  67 ARG CB   C   5.589  14.484  -0.703 1.00 . A A .  67 ARG CB   1 1 
        3  5879 1 1  67 ARG CD   C   7.776  13.892  -1.754 1.00 . A A .  67 ARG CD   1 1 
        3  5880 1 1  67 ARG CG   C   6.705  14.974  -1.626 1.00 . A A .  67 ARG CG   1 1 
        3  5881 1 1  67 ARG CZ   C   8.944  14.361  -3.836 1.00 . A A .  67 ARG CZ   1 1 
        3  5882 1 1  67 ARG H    H   3.519  14.277   0.835 1.00 . A A .  67 ARG H    1 1 
        3  5883 1 1  67 ARG HA   H   4.998  16.523  -0.364 1.00 . A A .  67 ARG HA   1 1 
        3  5884 1 1  67 ARG HB2  H   6.000  14.254   0.270 1.00 . A A .  67 ARG HB2  1 1 
        3  5885 1 1  67 ARG HB3  H   5.141  13.596  -1.122 1.00 . A A .  67 ARG HB3  1 1 
        3  5886 1 1  67 ARG HD2  H   8.110  13.600  -0.768 1.00 . A A .  67 ARG HD2  1 1 
        3  5887 1 1  67 ARG HD3  H   7.364  13.031  -2.260 1.00 . A A .  67 ARG HD3  1 1 
        3  5888 1 1  67 ARG HE   H   9.686  14.839  -2.057 1.00 . A A .  67 ARG HE   1 1 
        3  5889 1 1  67 ARG HG2  H   6.295  15.192  -2.600 1.00 . A A .  67 ARG HG2  1 1 
        3  5890 1 1  67 ARG HG3  H   7.146  15.869  -1.215 1.00 . A A .  67 ARG HG3  1 1 
        3  5891 1 1  67 ARG HH11 H   7.164  13.450  -3.973 1.00 . A A .  67 ARG HH11 1 1 
        3  5892 1 1  67 ARG HH12 H   7.961  13.766  -5.477 1.00 . A A .  67 ARG HH12 1 1 
        3  5893 1 1  67 ARG HH21 H  10.723  15.259  -4.012 1.00 . A A .  67 ARG HH21 1 1 
        3  5894 1 1  67 ARG HH22 H   9.971  14.790  -5.500 1.00 . A A .  67 ARG HH22 1 1 
        3  5895 1 1  67 ARG N    N   3.624  15.216   0.575 1.00 . A A .  67 ARG N    1 1 
        3  5896 1 1  67 ARG NE   N   8.930  14.429  -2.529 1.00 . A A .  67 ARG NE   1 1 
        3  5897 1 1  67 ARG NH1  N   7.944  13.816  -4.478 1.00 . A A .  67 ARG NH1  1 1 
        3  5898 1 1  67 ARG NH2  N   9.958  14.840  -4.501 1.00 . A A .  67 ARG NH2  1 1 
        3  5899 1 1  67 ARG O    O   3.660  16.673  -2.500 1.00 . A A .  67 ARG O    1 1 
        3  5900 1 1  68 GLU C    C   0.997  13.708  -3.262 1.00 . A A .  68 GLU C    1 1 
        3  5901 1 1  68 GLU CA   C   2.228  14.588  -3.455 1.00 . A A .  68 GLU CA   1 1 
        3  5902 1 1  68 GLU CB   C   3.060  14.051  -4.623 1.00 . A A .  68 GLU CB   1 1 
        3  5903 1 1  68 GLU CD   C   4.940  14.569  -6.190 1.00 . A A .  68 GLU CD   1 1 
        3  5904 1 1  68 GLU CG   C   4.056  15.121  -5.071 1.00 . A A .  68 GLU CG   1 1 
        3  5905 1 1  68 GLU H    H   3.100  13.771  -1.661 1.00 . A A .  68 GLU H    1 1 
        3  5906 1 1  68 GLU HA   H   1.909  15.595  -3.677 1.00 . A A .  68 GLU HA   1 1 
        3  5907 1 1  68 GLU HB2  H   3.600  13.168  -4.305 1.00 . A A .  68 GLU HB2  1 1 
        3  5908 1 1  68 GLU HB3  H   2.411  13.797  -5.445 1.00 . A A .  68 GLU HB3  1 1 
        3  5909 1 1  68 GLU HG2  H   3.515  15.982  -5.434 1.00 . A A .  68 GLU HG2  1 1 
        3  5910 1 1  68 GLU HG3  H   4.674  15.410  -4.239 1.00 . A A .  68 GLU HG3  1 1 
        3  5911 1 1  68 GLU N    N   3.051  14.582  -2.208 1.00 . A A .  68 GLU N    1 1 
        3  5912 1 1  68 GLU O    O   1.092  12.584  -2.812 1.00 . A A .  68 GLU O    1 1 
        3  5913 1 1  68 GLU OE1  O   4.730  13.431  -6.578 1.00 . A A .  68 GLU OE1  1 1 
        3  5914 1 1  68 GLU OE2  O   5.812  15.293  -6.638 1.00 . A A .  68 GLU OE2  1 1 
        3  5915 1 1  69 VAL C    C  -2.168  13.431  -4.798 1.00 . A A .  69 VAL C    1 1 
        3  5916 1 1  69 VAL CA   C  -1.417  13.425  -3.467 1.00 . A A .  69 VAL CA   1 1 
        3  5917 1 1  69 VAL CB   C  -2.298  14.052  -2.378 1.00 . A A .  69 VAL CB   1 1 
        3  5918 1 1  69 VAL CG1  C  -3.692  13.411  -2.398 1.00 . A A .  69 VAL CG1  1 1 
        3  5919 1 1  69 VAL CG2  C  -1.648  13.822  -1.012 1.00 . A A .  69 VAL CG2  1 1 
        3  5920 1 1  69 VAL H    H  -0.197  15.127  -3.976 1.00 . A A .  69 VAL H    1 1 
        3  5921 1 1  69 VAL HA   H  -1.188  12.404  -3.197 1.00 . A A .  69 VAL HA   1 1 
        3  5922 1 1  69 VAL HB   H  -2.390  15.114  -2.560 1.00 . A A .  69 VAL HB   1 1 
        3  5923 1 1  69 VAL HG11 H  -4.193  13.601  -1.459 1.00 . A A .  69 VAL HG11 1 1 
        3  5924 1 1  69 VAL HG12 H  -3.597  12.345  -2.546 1.00 . A A .  69 VAL HG12 1 1 
        3  5925 1 1  69 VAL HG13 H  -4.271  13.835  -3.204 1.00 . A A .  69 VAL HG13 1 1 
        3  5926 1 1  69 VAL HG21 H  -2.324  14.140  -0.235 1.00 . A A .  69 VAL HG21 1 1 
        3  5927 1 1  69 VAL HG22 H  -0.732  14.391  -0.949 1.00 . A A .  69 VAL HG22 1 1 
        3  5928 1 1  69 VAL HG23 H  -1.427  12.771  -0.893 1.00 . A A .  69 VAL HG23 1 1 
        3  5929 1 1  69 VAL N    N  -0.159  14.217  -3.610 1.00 . A A .  69 VAL N    1 1 
        3  5930 1 1  69 VAL O    O  -2.376  14.463  -5.404 1.00 . A A .  69 VAL O    1 1 
        3  5931 1 1  70 VAL C    C  -4.400  11.077  -6.385 1.00 . A A .  70 VAL C    1 1 
        3  5932 1 1  70 VAL CA   C  -3.357  12.201  -6.524 1.00 . A A .  70 VAL CA   1 1 
        3  5933 1 1  70 VAL CB   C  -2.407  11.880  -7.686 1.00 . A A .  70 VAL CB   1 1 
        3  5934 1 1  70 VAL CG1  C  -3.062  12.296  -9.013 1.00 . A A .  70 VAL CG1  1 1 
        3  5935 1 1  70 VAL CG2  C  -1.099  12.653  -7.497 1.00 . A A .  70 VAL CG2  1 1 
        3  5936 1 1  70 VAL H    H  -2.426  11.465  -4.729 1.00 . A A .  70 VAL H    1 1 
        3  5937 1 1  70 VAL HA   H  -3.844  13.146  -6.717 1.00 . A A .  70 VAL HA   1 1 
        3  5938 1 1  70 VAL HB   H  -2.199  10.818  -7.704 1.00 . A A .  70 VAL HB   1 1 
        3  5939 1 1  70 VAL HG11 H  -2.563  11.800  -9.832 1.00 . A A .  70 VAL HG11 1 1 
        3  5940 1 1  70 VAL HG12 H  -2.982  13.366  -9.136 1.00 . A A .  70 VAL HG12 1 1 
        3  5941 1 1  70 VAL HG13 H  -4.107  12.015  -9.004 1.00 . A A .  70 VAL HG13 1 1 
        3  5942 1 1  70 VAL HG21 H  -1.317  13.707  -7.402 1.00 . A A .  70 VAL HG21 1 1 
        3  5943 1 1  70 VAL HG22 H  -0.460  12.493  -8.352 1.00 . A A .  70 VAL HG22 1 1 
        3  5944 1 1  70 VAL HG23 H  -0.602  12.306  -6.603 1.00 . A A .  70 VAL HG23 1 1 
        3  5945 1 1  70 VAL N    N  -2.595  12.282  -5.245 1.00 . A A .  70 VAL N    1 1 
        3  5946 1 1  70 VAL O    O  -4.079   9.919  -6.556 1.00 . A A .  70 VAL O    1 1 
        3  5947 1 1  71 PRO C    C  -6.844   9.437  -7.090 1.00 . A A .  71 PRO C    1 1 
        3  5948 1 1  71 PRO CA   C  -6.713  10.386  -5.894 1.00 . A A .  71 PRO CA   1 1 
        3  5949 1 1  71 PRO CB   C  -7.985  11.231  -5.730 1.00 . A A .  71 PRO CB   1 1 
        3  5950 1 1  71 PRO CD   C  -6.133  12.769  -5.810 1.00 . A A .  71 PRO CD   1 1 
        3  5951 1 1  71 PRO CG   C  -7.506  12.536  -5.188 1.00 . A A .  71 PRO CG   1 1 
        3  5952 1 1  71 PRO HA   H  -6.546   9.818  -4.992 1.00 . A A .  71 PRO HA   1 1 
        3  5953 1 1  71 PRO HB2  H  -8.465  11.380  -6.692 1.00 . A A .  71 PRO HB2  1 1 
        3  5954 1 1  71 PRO HB3  H  -8.668  10.765  -5.038 1.00 . A A .  71 PRO HB3  1 1 
        3  5955 1 1  71 PRO HD2  H  -6.221  13.322  -6.734 1.00 . A A .  71 PRO HD2  1 1 
        3  5956 1 1  71 PRO HD3  H  -5.484  13.281  -5.116 1.00 . A A .  71 PRO HD3  1 1 
        3  5957 1 1  71 PRO HG2  H  -8.186  13.331  -5.463 1.00 . A A .  71 PRO HG2  1 1 
        3  5958 1 1  71 PRO HG3  H  -7.411  12.478  -4.114 1.00 . A A .  71 PRO HG3  1 1 
        3  5959 1 1  71 PRO N    N  -5.629  11.404  -6.063 1.00 . A A .  71 PRO N    1 1 
        3  5960 1 1  71 PRO O    O  -6.523   9.784  -8.207 1.00 . A A .  71 PRO O    1 1 
        3  5961 1 1  72 VAL C    C  -6.374   7.331  -8.956 1.00 . A A .  72 VAL C    1 1 
        3  5962 1 1  72 VAL CA   C  -7.483   7.206  -7.907 1.00 . A A .  72 VAL CA   1 1 
        3  5963 1 1  72 VAL CB   C  -8.860   7.365  -8.562 1.00 . A A .  72 VAL CB   1 1 
        3  5964 1 1  72 VAL CG1  C  -9.943   7.088  -7.518 1.00 . A A .  72 VAL CG1  1 1 
        3  5965 1 1  72 VAL CG2  C  -9.038   8.789  -9.102 1.00 . A A .  72 VAL CG2  1 1 
        3  5966 1 1  72 VAL H    H  -7.551   8.006  -5.911 1.00 . A A .  72 VAL H    1 1 
        3  5967 1 1  72 VAL HA   H  -7.423   6.227  -7.457 1.00 . A A .  72 VAL HA   1 1 
        3  5968 1 1  72 VAL HB   H  -8.954   6.655  -9.370 1.00 . A A .  72 VAL HB   1 1 
        3  5969 1 1  72 VAL HG11 H -10.905   7.392  -7.903 1.00 . A A .  72 VAL HG11 1 1 
        3  5970 1 1  72 VAL HG12 H  -9.725   7.644  -6.617 1.00 . A A .  72 VAL HG12 1 1 
        3  5971 1 1  72 VAL HG13 H  -9.963   6.032  -7.291 1.00 . A A .  72 VAL HG13 1 1 
        3  5972 1 1  72 VAL HG21 H  -9.151   9.477  -8.277 1.00 . A A .  72 VAL HG21 1 1 
        3  5973 1 1  72 VAL HG22 H  -9.921   8.829  -9.722 1.00 . A A .  72 VAL HG22 1 1 
        3  5974 1 1  72 VAL HG23 H  -8.176   9.065  -9.689 1.00 . A A .  72 VAL HG23 1 1 
        3  5975 1 1  72 VAL N    N  -7.312   8.237  -6.833 1.00 . A A .  72 VAL N    1 1 
        3  5976 1 1  72 VAL O    O  -6.614   7.255 -10.145 1.00 . A A .  72 VAL O    1 1 
        3  5977 1 1  73 HIS C    C  -2.711   7.258  -8.778 1.00 . A A .  73 HIS C    1 1 
        3  5978 1 1  73 HIS CA   C  -4.020   7.632  -9.474 1.00 . A A .  73 HIS CA   1 1 
        3  5979 1 1  73 HIS CB   C  -3.923   9.071  -9.980 1.00 . A A .  73 HIS CB   1 1 
        3  5980 1 1  73 HIS CD2  C  -2.810   9.150 -12.359 1.00 . A A .  73 HIS CD2  1 1 
        3  5981 1 1  73 HIS CE1  C  -0.745   9.354 -11.736 1.00 . A A .  73 HIS CE1  1 1 
        3  5982 1 1  73 HIS CG   C  -2.808   9.168 -10.986 1.00 . A A .  73 HIS CG   1 1 
        3  5983 1 1  73 HIS H    H  -4.987   7.562  -7.552 1.00 . A A .  73 HIS H    1 1 
        3  5984 1 1  73 HIS HA   H  -4.180   6.966 -10.309 1.00 . A A .  73 HIS HA   1 1 
        3  5985 1 1  73 HIS HB2  H  -4.856   9.354 -10.443 1.00 . A A .  73 HIS HB2  1 1 
        3  5986 1 1  73 HIS HB3  H  -3.715   9.729  -9.152 1.00 . A A .  73 HIS HB3  1 1 
        3  5987 1 1  73 HIS HD1  H  -1.139   9.343  -9.694 1.00 . A A .  73 HIS HD1  1 1 
        3  5988 1 1  73 HIS HD2  H  -3.689   9.056 -12.979 1.00 . A A .  73 HIS HD2  1 1 
        3  5989 1 1  73 HIS HE1  H   0.331   9.455 -11.753 1.00 . A A .  73 HIS HE1  1 1 
        3  5990 1 1  73 HIS N    N  -5.155   7.510  -8.516 1.00 . A A .  73 HIS N    1 1 
        3  5991 1 1  73 HIS ND1  N  -1.481   9.299 -10.612 1.00 . A A .  73 HIS ND1  1 1 
        3  5992 1 1  73 HIS NE2  N  -1.506   9.267 -12.831 1.00 . A A .  73 HIS NE2  1 1 
        3  5993 1 1  73 HIS O    O  -2.223   6.154  -8.906 1.00 . A A .  73 HIS O    1 1 
        3  5994 1 1  74 ARG C    C  -0.811   8.594  -6.001 1.00 . A A .  74 ARG C    1 1 
        3  5995 1 1  74 ARG CA   C  -0.839   7.885  -7.354 1.00 . A A .  74 ARG CA   1 1 
        3  5996 1 1  74 ARG CB   C   0.323   8.386  -8.216 1.00 . A A .  74 ARG CB   1 1 
        3  5997 1 1  74 ARG CD   C   2.813   8.459  -8.448 1.00 . A A .  74 ARG CD   1 1 
        3  5998 1 1  74 ARG CG   C   1.653   8.028  -7.546 1.00 . A A .  74 ARG CG   1 1 
        3  5999 1 1  74 ARG CZ   C   3.676  10.535  -9.368 1.00 . A A .  74 ARG CZ   1 1 
        3  6000 1 1  74 ARG H    H  -2.537   9.064  -7.969 1.00 . A A .  74 ARG H    1 1 
        3  6001 1 1  74 ARG HA   H  -0.740   6.820  -7.199 1.00 . A A .  74 ARG HA   1 1 
        3  6002 1 1  74 ARG HB2  H   0.273   7.917  -9.189 1.00 . A A .  74 ARG HB2  1 1 
        3  6003 1 1  74 ARG HB3  H   0.253   9.457  -8.329 1.00 . A A .  74 ARG HB3  1 1 
        3  6004 1 1  74 ARG HD2  H   3.745   8.121  -8.022 1.00 . A A .  74 ARG HD2  1 1 
        3  6005 1 1  74 ARG HD3  H   2.686   8.024  -9.429 1.00 . A A .  74 ARG HD3  1 1 
        3  6006 1 1  74 ARG HE   H   2.207  10.484  -8.031 1.00 . A A .  74 ARG HE   1 1 
        3  6007 1 1  74 ARG HG2  H   1.726   8.542  -6.598 1.00 . A A .  74 ARG HG2  1 1 
        3  6008 1 1  74 ARG HG3  H   1.702   6.963  -7.383 1.00 . A A .  74 ARG HG3  1 1 
        3  6009 1 1  74 ARG HH11 H   4.498   8.825 -10.007 1.00 . A A .  74 ARG HH11 1 1 
        3  6010 1 1  74 ARG HH12 H   5.152  10.274 -10.694 1.00 . A A .  74 ARG HH12 1 1 
        3  6011 1 1  74 ARG HH21 H   3.052  12.383  -8.917 1.00 . A A .  74 ARG HH21 1 1 
        3  6012 1 1  74 ARG HH22 H   4.335  12.287 -10.078 1.00 . A A .  74 ARG HH22 1 1 
        3  6013 1 1  74 ARG N    N  -2.128   8.177  -8.052 1.00 . A A .  74 ARG N    1 1 
        3  6014 1 1  74 ARG NE   N   2.830   9.946  -8.563 1.00 . A A .  74 ARG NE   1 1 
        3  6015 1 1  74 ARG NH1  N   4.506   9.822 -10.078 1.00 . A A .  74 ARG NH1  1 1 
        3  6016 1 1  74 ARG NH2  N   3.689  11.836  -9.462 1.00 . A A .  74 ARG NH2  1 1 
        3  6017 1 1  74 ARG O    O  -1.441   9.616  -5.808 1.00 . A A .  74 ARG O    1 1 
        3  6018 1 1  75 LEU C    C   1.428   8.554  -3.173 1.00 . A A .  75 LEU C    1 1 
        3  6019 1 1  75 LEU CA   C   0.003   8.687  -3.709 1.00 . A A .  75 LEU CA   1 1 
        3  6020 1 1  75 LEU CB   C  -0.979   7.979  -2.766 1.00 . A A .  75 LEU CB   1 1 
        3  6021 1 1  75 LEU CD1  C  -0.990  10.029  -1.301 1.00 . A A .  75 LEU CD1  1 1 
        3  6022 1 1  75 LEU CD2  C  -1.866   7.843  -0.436 1.00 . A A .  75 LEU CD2  1 1 
        3  6023 1 1  75 LEU CG   C  -0.813   8.503  -1.330 1.00 . A A .  75 LEU CG   1 1 
        3  6024 1 1  75 LEU H    H   0.416   7.230  -5.244 1.00 . A A .  75 LEU H    1 1 
        3  6025 1 1  75 LEU HA   H  -0.255   9.734  -3.779 1.00 . A A .  75 LEU HA   1 1 
        3  6026 1 1  75 LEU HB2  H  -1.989   8.166  -3.100 1.00 . A A .  75 LEU HB2  1 1 
        3  6027 1 1  75 LEU HB3  H  -0.788   6.916  -2.782 1.00 . A A .  75 LEU HB3  1 1 
        3  6028 1 1  75 LEU HD11 H  -1.769  10.320  -1.991 1.00 . A A .  75 LEU HD11 1 1 
        3  6029 1 1  75 LEU HD12 H  -0.061  10.502  -1.586 1.00 . A A .  75 LEU HD12 1 1 
        3  6030 1 1  75 LEU HD13 H  -1.258  10.344  -0.302 1.00 . A A .  75 LEU HD13 1 1 
        3  6031 1 1  75 LEU HD21 H  -1.815   8.270   0.554 1.00 . A A .  75 LEU HD21 1 1 
        3  6032 1 1  75 LEU HD22 H  -1.674   6.780  -0.379 1.00 . A A .  75 LEU HD22 1 1 
        3  6033 1 1  75 LEU HD23 H  -2.849   8.008  -0.850 1.00 . A A .  75 LEU HD23 1 1 
        3  6034 1 1  75 LEU HG   H   0.172   8.250  -0.966 1.00 . A A .  75 LEU HG   1 1 
        3  6035 1 1  75 LEU N    N  -0.081   8.056  -5.061 1.00 . A A .  75 LEU N    1 1 
        3  6036 1 1  75 LEU O    O   2.023   7.495  -3.218 1.00 . A A .  75 LEU O    1 1 
        3  6037 1 1  76 ALA C    C   3.504  10.510  -0.918 1.00 . A A .  76 ALA C    1 1 
        3  6038 1 1  76 ALA CA   C   3.370   9.548  -2.099 1.00 . A A .  76 ALA CA   1 1 
        3  6039 1 1  76 ALA CB   C   4.376   9.934  -3.184 1.00 . A A .  76 ALA CB   1 1 
        3  6040 1 1  76 ALA H    H   1.485  10.464  -2.617 1.00 . A A .  76 ALA H    1 1 
        3  6041 1 1  76 ALA HA   H   3.572   8.546  -1.759 1.00 . A A .  76 ALA HA   1 1 
        3  6042 1 1  76 ALA HB1  H   4.344   9.206  -3.981 1.00 . A A .  76 ALA HB1  1 1 
        3  6043 1 1  76 ALA HB2  H   5.368   9.960  -2.760 1.00 . A A .  76 ALA HB2  1 1 
        3  6044 1 1  76 ALA HB3  H   4.128  10.910  -3.578 1.00 . A A .  76 ALA HB3  1 1 
        3  6045 1 1  76 ALA N    N   1.984   9.620  -2.651 1.00 . A A .  76 ALA N    1 1 
        3  6046 1 1  76 ALA O    O   3.019  11.624  -0.951 1.00 . A A .  76 ALA O    1 1 
        3  6047 1 1  77 TYR C    C   5.436  10.399   2.215 1.00 . A A .  77 TYR C    1 1 
        3  6048 1 1  77 TYR CA   C   4.346  10.971   1.309 1.00 . A A .  77 TYR CA   1 1 
        3  6049 1 1  77 TYR CB   C   3.031  11.061   2.081 1.00 . A A .  77 TYR CB   1 1 
        3  6050 1 1  77 TYR CD1  C   1.746   8.956   1.589 1.00 . A A .  77 TYR CD1  1 1 
        3  6051 1 1  77 TYR CD2  C   2.967   9.112   3.678 1.00 . A A .  77 TYR CD2  1 1 
        3  6052 1 1  77 TYR CE1  C   1.315   7.671   1.936 1.00 . A A .  77 TYR CE1  1 1 
        3  6053 1 1  77 TYR CE2  C   2.534   7.826   4.027 1.00 . A A .  77 TYR CE2  1 1 
        3  6054 1 1  77 TYR CG   C   2.572   9.676   2.460 1.00 . A A .  77 TYR CG   1 1 
        3  6055 1 1  77 TYR CZ   C   1.708   7.106   3.154 1.00 . A A .  77 TYR CZ   1 1 
        3  6056 1 1  77 TYR H    H   4.554   9.185   0.124 1.00 . A A .  77 TYR H    1 1 
        3  6057 1 1  77 TYR HA   H   4.639  11.957   0.977 1.00 . A A .  77 TYR HA   1 1 
        3  6058 1 1  77 TYR HB2  H   3.178  11.650   2.973 1.00 . A A .  77 TYR HB2  1 1 
        3  6059 1 1  77 TYR HB3  H   2.285  11.529   1.457 1.00 . A A .  77 TYR HB3  1 1 
        3  6060 1 1  77 TYR HD1  H   1.442   9.392   0.649 1.00 . A A .  77 TYR HD1  1 1 
        3  6061 1 1  77 TYR HD2  H   3.603   9.668   4.350 1.00 . A A .  77 TYR HD2  1 1 
        3  6062 1 1  77 TYR HE1  H   0.678   7.116   1.263 1.00 . A A .  77 TYR HE1  1 1 
        3  6063 1 1  77 TYR HE2  H   2.838   7.390   4.966 1.00 . A A .  77 TYR HE2  1 1 
        3  6064 1 1  77 TYR HH   H   1.400   5.270   2.733 1.00 . A A .  77 TYR HH   1 1 
        3  6065 1 1  77 TYR N    N   4.168  10.087   0.123 1.00 . A A .  77 TYR N    1 1 
        3  6066 1 1  77 TYR O    O   5.721   9.217   2.189 1.00 . A A .  77 TYR O    1 1 
        3  6067 1 1  77 TYR OH   O   1.282   5.838   3.497 1.00 . A A .  77 TYR OH   1 1 
        3  6068 1 1  78 SER C    C   6.499  10.126   5.187 1.00 . A A .  78 SER C    1 1 
        3  6069 1 1  78 SER CA   C   7.120  10.735   3.926 1.00 . A A .  78 SER CA   1 1 
        3  6070 1 1  78 SER CB   C   8.014  11.908   4.314 1.00 . A A .  78 SER CB   1 1 
        3  6071 1 1  78 SER H    H   5.801  12.175   3.019 1.00 . A A .  78 SER H    1 1 
        3  6072 1 1  78 SER HA   H   7.710   9.987   3.418 1.00 . A A .  78 SER HA   1 1 
        3  6073 1 1  78 SER HB2  H   8.659  11.619   5.125 1.00 . A A .  78 SER HB2  1 1 
        3  6074 1 1  78 SER HB3  H   8.614  12.201   3.463 1.00 . A A .  78 SER HB3  1 1 
        3  6075 1 1  78 SER HG   H   7.336  13.721   4.119 1.00 . A A .  78 SER HG   1 1 
        3  6076 1 1  78 SER N    N   6.046  11.226   3.016 1.00 . A A .  78 SER N    1 1 
        3  6077 1 1  78 SER O    O   5.429  10.513   5.612 1.00 . A A .  78 SER O    1 1 
        3  6078 1 1  78 SER OG   O   7.198  12.995   4.732 1.00 . A A .  78 SER OG   1 1 
        3  6079 1 1  79 PHE C    C   7.693   7.536   7.530 1.00 . A A .  79 PHE C    1 1 
        3  6080 1 1  79 PHE CA   C   6.654   8.541   7.030 1.00 . A A .  79 PHE CA   1 1 
        3  6081 1 1  79 PHE CB   C   5.346   7.806   6.719 1.00 . A A .  79 PHE CB   1 1 
        3  6082 1 1  79 PHE CD1  C   4.426   7.710   9.065 1.00 . A A .  79 PHE CD1  1 1 
        3  6083 1 1  79 PHE CD2  C   4.963   5.629   7.940 1.00 . A A .  79 PHE CD2  1 1 
        3  6084 1 1  79 PHE CE1  C   4.014   6.992  10.193 1.00 . A A .  79 PHE CE1  1 1 
        3  6085 1 1  79 PHE CE2  C   4.552   4.912   9.068 1.00 . A A .  79 PHE CE2  1 1 
        3  6086 1 1  79 PHE CG   C   4.902   7.029   7.938 1.00 . A A .  79 PHE CG   1 1 
        3  6087 1 1  79 PHE CZ   C   4.077   5.594  10.196 1.00 . A A .  79 PHE CZ   1 1 
        3  6088 1 1  79 PHE H    H   8.043   8.903   5.427 1.00 . A A .  79 PHE H    1 1 
        3  6089 1 1  79 PHE HA   H   6.481   9.293   7.786 1.00 . A A .  79 PHE HA   1 1 
        3  6090 1 1  79 PHE HB2  H   4.583   8.521   6.454 1.00 . A A .  79 PHE HB2  1 1 
        3  6091 1 1  79 PHE HB3  H   5.503   7.127   5.894 1.00 . A A .  79 PHE HB3  1 1 
        3  6092 1 1  79 PHE HD1  H   4.378   8.788   9.062 1.00 . A A .  79 PHE HD1  1 1 
        3  6093 1 1  79 PHE HD2  H   5.330   5.103   7.070 1.00 . A A .  79 PHE HD2  1 1 
        3  6094 1 1  79 PHE HE1  H   3.649   7.519  11.063 1.00 . A A .  79 PHE HE1  1 1 
        3  6095 1 1  79 PHE HE2  H   4.601   3.833   9.070 1.00 . A A .  79 PHE HE2  1 1 
        3  6096 1 1  79 PHE HZ   H   3.760   5.041  11.067 1.00 . A A .  79 PHE HZ   1 1 
        3  6097 1 1  79 PHE N    N   7.178   9.186   5.791 1.00 . A A .  79 PHE N    1 1 
        3  6098 1 1  79 PHE O    O   8.181   7.627   8.638 1.00 . A A .  79 PHE O    1 1 
        3  6099 1 1  80 GLY C    C   8.488   4.698   8.244 1.00 . A A .  80 GLY C    1 1 
        3  6100 1 1  80 GLY CA   C   9.049   5.567   7.119 1.00 . A A .  80 GLY CA   1 1 
        3  6101 1 1  80 GLY H    H   7.632   6.532   5.819 1.00 . A A .  80 GLY H    1 1 
        3  6102 1 1  80 GLY HA2  H   9.293   4.942   6.271 1.00 . A A .  80 GLY HA2  1 1 
        3  6103 1 1  80 GLY HA3  H   9.938   6.068   7.465 1.00 . A A .  80 GLY HA3  1 1 
        3  6104 1 1  80 GLY N    N   8.037   6.581   6.711 1.00 . A A .  80 GLY N    1 1 
        3  6105 1 1  80 GLY O    O   7.317   4.369   8.258 1.00 . A A .  80 GLY O    1 1 
        3  6106 1 1  81 TRP C    C   8.742   4.329  11.592 1.00 . A A .  81 TRP C    1 1 
        3  6107 1 1  81 TRP CA   C   8.836   3.473  10.326 1.00 . A A .  81 TRP CA   1 1 
        3  6108 1 1  81 TRP CB   C   9.815   2.319  10.543 1.00 . A A .  81 TRP CB   1 1 
        3  6109 1 1  81 TRP CD1  C   9.720   1.105  12.755 1.00 . A A .  81 TRP CD1  1 1 
        3  6110 1 1  81 TRP CD2  C   8.022   0.554  11.388 1.00 . A A .  81 TRP CD2  1 1 
        3  6111 1 1  81 TRP CE2  C   7.841  -0.188  12.578 1.00 . A A .  81 TRP CE2  1 1 
        3  6112 1 1  81 TRP CE3  C   7.080   0.388  10.354 1.00 . A A .  81 TRP CE3  1 1 
        3  6113 1 1  81 TRP CG   C   9.223   1.366  11.525 1.00 . A A .  81 TRP CG   1 1 
        3  6114 1 1  81 TRP CH2  C   5.839  -1.212  11.704 1.00 . A A .  81 TRP CH2  1 1 
        3  6115 1 1  81 TRP CZ2  C   6.764  -1.061  12.740 1.00 . A A .  81 TRP CZ2  1 1 
        3  6116 1 1  81 TRP CZ3  C   5.997  -0.490  10.512 1.00 . A A .  81 TRP CZ3  1 1 
        3  6117 1 1  81 TRP H    H  10.254   4.603   9.159 1.00 . A A .  81 TRP H    1 1 
        3  6118 1 1  81 TRP HA   H   7.857   3.071  10.101 1.00 . A A .  81 TRP HA   1 1 
        3  6119 1 1  81 TRP HB2  H   9.987   1.811   9.605 1.00 . A A .  81 TRP HB2  1 1 
        3  6120 1 1  81 TRP HB3  H  10.750   2.701  10.926 1.00 . A A .  81 TRP HB3  1 1 
        3  6121 1 1  81 TRP HD1  H  10.612   1.544  13.178 1.00 . A A .  81 TRP HD1  1 1 
        3  6122 1 1  81 TRP HE1  H   9.041  -0.175  14.283 1.00 . A A .  81 TRP HE1  1 1 
        3  6123 1 1  81 TRP HE3  H   7.195   0.938   9.431 1.00 . A A .  81 TRP HE3  1 1 
        3  6124 1 1  81 TRP HH2  H   5.004  -1.885  11.820 1.00 . A A .  81 TRP HH2  1 1 
        3  6125 1 1  81 TRP HZ2  H   6.647  -1.614  13.659 1.00 . A A .  81 TRP HZ2  1 1 
        3  6126 1 1  81 TRP HZ3  H   5.280  -0.609   9.713 1.00 . A A .  81 TRP HZ3  1 1 
        3  6127 1 1  81 TRP N    N   9.314   4.324   9.193 1.00 . A A .  81 TRP N    1 1 
        3  6128 1 1  81 TRP NE1  N   8.902   0.183  13.382 1.00 . A A .  81 TRP NE1  1 1 
        3  6129 1 1  81 TRP O    O   9.706   4.930  12.025 1.00 . A A .  81 TRP O    1 1 
        3  6130 1 1  82 ASP C    C   8.168   4.651  14.570 1.00 . A A .  82 ASP C    1 1 
        3  6131 1 1  82 ASP CA   C   7.377   5.226  13.394 1.00 . A A .  82 ASP CA   1 1 
        3  6132 1 1  82 ASP CB   C   5.889   5.253  13.737 1.00 . A A .  82 ASP CB   1 1 
        3  6133 1 1  82 ASP CG   C   5.648   6.186  14.924 1.00 . A A .  82 ASP CG   1 1 
        3  6134 1 1  82 ASP H    H   6.816   3.912  11.786 1.00 . A A .  82 ASP H    1 1 
        3  6135 1 1  82 ASP HA   H   7.715   6.231  13.199 1.00 . A A .  82 ASP HA   1 1 
        3  6136 1 1  82 ASP HB2  H   5.334   5.609  12.880 1.00 . A A .  82 ASP HB2  1 1 
        3  6137 1 1  82 ASP HB3  H   5.559   4.258  13.989 1.00 . A A .  82 ASP HB3  1 1 
        3  6138 1 1  82 ASP N    N   7.575   4.397  12.171 1.00 . A A .  82 ASP N    1 1 
        3  6139 1 1  82 ASP O    O   8.266   3.453  14.748 1.00 . A A .  82 ASP O    1 1 
        3  6140 1 1  82 ASP OD1  O   6.620   6.643  15.504 1.00 . A A .  82 ASP OD1  1 1 
        3  6141 1 1  82 ASP OD2  O   4.494   6.431  15.233 1.00 . A A .  82 ASP OD2  1 1 
        3  6142 1 1  83 GLY C    C  10.982   4.914  16.139 1.00 . A A .  83 GLY C    1 1 
        3  6143 1 1  83 GLY CA   C   9.521   5.042  16.553 1.00 . A A .  83 GLY CA   1 1 
        3  6144 1 1  83 GLY H    H   8.634   6.471  15.211 1.00 . A A .  83 GLY H    1 1 
        3  6145 1 1  83 GLY HA2  H   9.433   5.763  17.355 1.00 . A A .  83 GLY HA2  1 1 
        3  6146 1 1  83 GLY HA3  H   9.157   4.083  16.886 1.00 . A A .  83 GLY HA3  1 1 
        3  6147 1 1  83 GLY N    N   8.730   5.510  15.380 1.00 . A A .  83 GLY N    1 1 
        3  6148 1 1  83 GLY O    O  11.806   4.414  16.879 1.00 . A A .  83 GLY O    1 1 
        3  6149 1 1  84 SER C    C  13.241   6.702  14.186 1.00 . A A .  84 SER C    1 1 
        3  6150 1 1  84 SER CA   C  12.719   5.291  14.457 1.00 . A A .  84 SER CA   1 1 
        3  6151 1 1  84 SER CB   C  12.747   4.477  13.166 1.00 . A A .  84 SER CB   1 1 
        3  6152 1 1  84 SER H    H  10.619   5.769  14.381 1.00 . A A .  84 SER H    1 1 
        3  6153 1 1  84 SER HA   H  13.349   4.815  15.194 1.00 . A A .  84 SER HA   1 1 
        3  6154 1 1  84 SER HB2  H  12.093   4.926  12.436 1.00 . A A .  84 SER HB2  1 1 
        3  6155 1 1  84 SER HB3  H  13.757   4.455  12.779 1.00 . A A .  84 SER HB3  1 1 
        3  6156 1 1  84 SER HG   H  11.868   3.163  14.300 1.00 . A A .  84 SER HG   1 1 
        3  6157 1 1  84 SER N    N  11.308   5.369  14.953 1.00 . A A .  84 SER N    1 1 
        3  6158 1 1  84 SER O    O  12.700   7.433  13.378 1.00 . A A .  84 SER O    1 1 
        3  6159 1 1  84 SER OG   O  12.303   3.156  13.442 1.00 . A A .  84 SER OG   1 1 
        3  6160 1 1  85 GLU C    C  16.113   8.327  13.765 1.00 . A A .  85 GLU C    1 1 
        3  6161 1 1  85 GLU CA   C  14.875   8.446  14.656 1.00 . A A .  85 GLU CA   1 1 
        3  6162 1 1  85 GLU CB   C  15.281   9.019  16.018 1.00 . A A .  85 GLU CB   1 1 
        3  6163 1 1  85 GLU CD   C  13.133  10.287  16.258 1.00 . A A .  85 GLU CD   1 1 
        3  6164 1 1  85 GLU CG   C  14.034   9.221  16.886 1.00 . A A .  85 GLU CG   1 1 
        3  6165 1 1  85 GLU H    H  14.707   6.474  15.501 1.00 . A A .  85 GLU H    1 1 
        3  6166 1 1  85 GLU HA   H  14.153   9.099  14.186 1.00 . A A .  85 GLU HA   1 1 
        3  6167 1 1  85 GLU HB2  H  15.952   8.330  16.509 1.00 . A A .  85 GLU HB2  1 1 
        3  6168 1 1  85 GLU HB3  H  15.777   9.967  15.876 1.00 . A A .  85 GLU HB3  1 1 
        3  6169 1 1  85 GLU HG2  H  13.492   8.290  16.963 1.00 . A A .  85 GLU HG2  1 1 
        3  6170 1 1  85 GLU HG3  H  14.335   9.544  17.873 1.00 . A A .  85 GLU HG3  1 1 
        3  6171 1 1  85 GLU N    N  14.292   7.087  14.858 1.00 . A A .  85 GLU N    1 1 
        3  6172 1 1  85 GLU O    O  16.587   9.296  13.207 1.00 . A A .  85 GLU O    1 1 
        3  6173 1 1  85 GLU OE1  O  13.628  11.048  15.445 1.00 . A A .  85 GLU OE1  1 1 
        3  6174 1 1  85 GLU OE2  O  11.964  10.324  16.606 1.00 . A A .  85 GLU OE2  1 1 
        3  6175 1 1  86 VAL C    C  17.431   7.022  11.302 1.00 . A A .  86 VAL C    1 1 
        3  6176 1 1  86 VAL CA   C  17.846   6.957  12.772 1.00 . A A .  86 VAL CA   1 1 
        3  6177 1 1  86 VAL CB   C  18.496   5.602  13.071 1.00 . A A .  86 VAL CB   1 1 
        3  6178 1 1  86 VAL CG1  C  18.912   5.553  14.543 1.00 . A A .  86 VAL CG1  1 1 
        3  6179 1 1  86 VAL CG2  C  17.501   4.473  12.791 1.00 . A A .  86 VAL CG2  1 1 
        3  6180 1 1  86 VAL H    H  16.245   6.371  14.087 1.00 . A A .  86 VAL H    1 1 
        3  6181 1 1  86 VAL HA   H  18.552   7.745  12.979 1.00 . A A .  86 VAL HA   1 1 
        3  6182 1 1  86 VAL HB   H  19.370   5.477  12.447 1.00 . A A .  86 VAL HB   1 1 
        3  6183 1 1  86 VAL HG11 H  18.037   5.650  15.167 1.00 . A A .  86 VAL HG11 1 1 
        3  6184 1 1  86 VAL HG12 H  19.595   6.363  14.750 1.00 . A A .  86 VAL HG12 1 1 
        3  6185 1 1  86 VAL HG13 H  19.399   4.611  14.748 1.00 . A A .  86 VAL HG13 1 1 
        3  6186 1 1  86 VAL HG21 H  17.887   3.546  13.189 1.00 . A A .  86 VAL HG21 1 1 
        3  6187 1 1  86 VAL HG22 H  17.359   4.375  11.726 1.00 . A A .  86 VAL HG22 1 1 
        3  6188 1 1  86 VAL HG23 H  16.556   4.701  13.261 1.00 . A A .  86 VAL HG23 1 1 
        3  6189 1 1  86 VAL N    N  16.641   7.140  13.628 1.00 . A A .  86 VAL N    1 1 
        3  6190 1 1  86 VAL O    O  18.126   6.547  10.428 1.00 . A A .  86 VAL O    1 1 
        3  6191 1 1  87 VAL C    C  15.197   9.117   9.378 1.00 . A A .  87 VAL C    1 1 
        3  6192 1 1  87 VAL CA   C  15.823   7.733   9.605 1.00 . A A .  87 VAL CA   1 1 
        3  6193 1 1  87 VAL CB   C  14.766   6.658   9.338 1.00 . A A .  87 VAL CB   1 1 
        3  6194 1 1  87 VAL CG1  C  14.454   6.604   7.841 1.00 . A A .  87 VAL CG1  1 1 
        3  6195 1 1  87 VAL CG2  C  15.290   5.296   9.798 1.00 . A A .  87 VAL CG2  1 1 
        3  6196 1 1  87 VAL H    H  15.754   8.000  11.746 1.00 . A A .  87 VAL H    1 1 
        3  6197 1 1  87 VAL HA   H  16.651   7.601   8.924 1.00 . A A .  87 VAL HA   1 1 
        3  6198 1 1  87 VAL HB   H  13.863   6.901   9.883 1.00 . A A .  87 VAL HB   1 1 
        3  6199 1 1  87 VAL HG11 H  13.966   7.519   7.541 1.00 . A A .  87 VAL HG11 1 1 
        3  6200 1 1  87 VAL HG12 H  13.803   5.766   7.640 1.00 . A A .  87 VAL HG12 1 1 
        3  6201 1 1  87 VAL HG13 H  15.373   6.487   7.287 1.00 . A A .  87 VAL HG13 1 1 
        3  6202 1 1  87 VAL HG21 H  14.653   4.515   9.407 1.00 . A A .  87 VAL HG21 1 1 
        3  6203 1 1  87 VAL HG22 H  15.286   5.253  10.878 1.00 . A A .  87 VAL HG22 1 1 
        3  6204 1 1  87 VAL HG23 H  16.296   5.155   9.436 1.00 . A A .  87 VAL HG23 1 1 
        3  6205 1 1  87 VAL N    N  16.295   7.620  11.021 1.00 . A A .  87 VAL N    1 1 
        3  6206 1 1  87 VAL O    O  14.007   9.232   9.159 1.00 . A A .  87 VAL O    1 1 
        3  6207 1 1  88 PRO C    C  14.840  11.723   7.830 1.00 . A A .  88 PRO C    1 1 
        3  6208 1 1  88 PRO CA   C  15.493  11.555   9.216 1.00 . A A .  88 PRO CA   1 1 
        3  6209 1 1  88 PRO CB   C  16.751  12.442   9.344 1.00 . A A .  88 PRO CB   1 1 
        3  6210 1 1  88 PRO CD   C  17.439  10.128   9.682 1.00 . A A .  88 PRO CD   1 1 
        3  6211 1 1  88 PRO CG   C  17.793  11.584  10.002 1.00 . A A .  88 PRO CG   1 1 
        3  6212 1 1  88 PRO HA   H  14.789  11.802   9.994 1.00 . A A .  88 PRO HA   1 1 
        3  6213 1 1  88 PRO HB2  H  17.090  12.763   8.364 1.00 . A A .  88 PRO HB2  1 1 
        3  6214 1 1  88 PRO HB3  H  16.540  13.304   9.961 1.00 . A A .  88 PRO HB3  1 1 
        3  6215 1 1  88 PRO HD2  H  17.972   9.791   8.802 1.00 . A A .  88 PRO HD2  1 1 
        3  6216 1 1  88 PRO HD3  H  17.656   9.494  10.524 1.00 . A A .  88 PRO HD3  1 1 
        3  6217 1 1  88 PRO HG2  H  18.774  11.823   9.606 1.00 . A A .  88 PRO HG2  1 1 
        3  6218 1 1  88 PRO HG3  H  17.783  11.734  11.071 1.00 . A A .  88 PRO HG3  1 1 
        3  6219 1 1  88 PRO N    N  15.991  10.161   9.426 1.00 . A A .  88 PRO N    1 1 
        3  6220 1 1  88 PRO O    O  14.750  10.779   7.074 1.00 . A A .  88 PRO O    1 1 
        3  6221 1 1  89 PRO C    C  14.683  12.933   4.990 1.00 . A A .  89 PRO C    1 1 
        3  6222 1 1  89 PRO CA   C  13.744  13.191   6.180 1.00 . A A .  89 PRO CA   1 1 
        3  6223 1 1  89 PRO CB   C  13.357  14.683   6.261 1.00 . A A .  89 PRO CB   1 1 
        3  6224 1 1  89 PRO CD   C  14.442  14.125   8.335 1.00 . A A .  89 PRO CD   1 1 
        3  6225 1 1  89 PRO CG   C  13.352  14.999   7.722 1.00 . A A .  89 PRO CG   1 1 
        3  6226 1 1  89 PRO HA   H  12.854  12.593   6.075 1.00 . A A .  89 PRO HA   1 1 
        3  6227 1 1  89 PRO HB2  H  14.089  15.296   5.746 1.00 . A A .  89 PRO HB2  1 1 
        3  6228 1 1  89 PRO HB3  H  12.374  14.844   5.842 1.00 . A A .  89 PRO HB3  1 1 
        3  6229 1 1  89 PRO HD2  H  15.406  14.611   8.258 1.00 . A A .  89 PRO HD2  1 1 
        3  6230 1 1  89 PRO HD3  H  14.209  13.894   9.360 1.00 . A A .  89 PRO HD3  1 1 
        3  6231 1 1  89 PRO HG2  H  13.571  16.047   7.881 1.00 . A A .  89 PRO HG2  1 1 
        3  6232 1 1  89 PRO HG3  H  12.396  14.744   8.157 1.00 . A A .  89 PRO HG3  1 1 
        3  6233 1 1  89 PRO N    N  14.393  12.912   7.501 1.00 . A A .  89 PRO N    1 1 
        3  6234 1 1  89 PRO O    O  15.874  13.159   5.062 1.00 . A A .  89 PRO O    1 1 
        3  6235 1 1  90 GLY C    C  15.557  10.768   2.803 1.00 . A A .  90 GLY C    1 1 
        3  6236 1 1  90 GLY CA   C  14.986  12.183   2.698 1.00 . A A .  90 GLY CA   1 1 
        3  6237 1 1  90 GLY H    H  13.181  12.288   3.865 1.00 . A A .  90 GLY H    1 1 
        3  6238 1 1  90 GLY HA2  H  14.379  12.263   1.807 1.00 . A A .  90 GLY HA2  1 1 
        3  6239 1 1  90 GLY HA3  H  15.798  12.894   2.646 1.00 . A A .  90 GLY HA3  1 1 
        3  6240 1 1  90 GLY N    N  14.145  12.461   3.897 1.00 . A A .  90 GLY N    1 1 
        3  6241 1 1  90 GLY O    O  15.822  10.117   1.815 1.00 . A A .  90 GLY O    1 1 
        3  6242 1 1  91 SER C    C  15.308   7.893   3.623 1.00 . A A .  91 SER C    1 1 
        3  6243 1 1  91 SER CA   C  16.284   8.921   4.196 1.00 . A A .  91 SER CA   1 1 
        3  6244 1 1  91 SER CB   C  16.474   8.668   5.687 1.00 . A A .  91 SER CB   1 1 
        3  6245 1 1  91 SER H    H  15.515  10.834   4.784 1.00 . A A .  91 SER H    1 1 
        3  6246 1 1  91 SER HA   H  17.236   8.836   3.691 1.00 . A A .  91 SER HA   1 1 
        3  6247 1 1  91 SER HB2  H  17.140   9.407   6.098 1.00 . A A .  91 SER HB2  1 1 
        3  6248 1 1  91 SER HB3  H  15.515   8.732   6.185 1.00 . A A .  91 SER HB3  1 1 
        3  6249 1 1  91 SER HG   H  17.023   6.929   5.025 1.00 . A A .  91 SER HG   1 1 
        3  6250 1 1  91 SER N    N  15.740  10.290   4.003 1.00 . A A .  91 SER N    1 1 
        3  6251 1 1  91 SER O    O  15.707   6.923   3.010 1.00 . A A .  91 SER O    1 1 
        3  6252 1 1  91 SER OG   O  17.032   7.377   5.873 1.00 . A A .  91 SER OG   1 1 
        3  6253 1 1  92 SER C    C  11.832   7.863   2.723 1.00 . A A .  92 SER C    1 1 
        3  6254 1 1  92 SER CA   C  13.023   7.112   3.304 1.00 . A A .  92 SER CA   1 1 
        3  6255 1 1  92 SER CB   C  12.539   6.224   4.451 1.00 . A A .  92 SER CB   1 1 
        3  6256 1 1  92 SER H    H  13.729   8.874   4.332 1.00 . A A .  92 SER H    1 1 
        3  6257 1 1  92 SER HA   H  13.464   6.496   2.535 1.00 . A A .  92 SER HA   1 1 
        3  6258 1 1  92 SER HB2  H  11.704   5.632   4.119 1.00 . A A .  92 SER HB2  1 1 
        3  6259 1 1  92 SER HB3  H  13.343   5.569   4.762 1.00 . A A .  92 SER HB3  1 1 
        3  6260 1 1  92 SER HG   H  11.185   7.203   5.448 1.00 . A A .  92 SER HG   1 1 
        3  6261 1 1  92 SER N    N  14.030   8.088   3.829 1.00 . A A .  92 SER N    1 1 
        3  6262 1 1  92 SER O    O  11.531   8.975   3.114 1.00 . A A .  92 SER O    1 1 
        3  6263 1 1  92 SER OG   O  12.128   7.042   5.538 1.00 . A A .  92 SER OG   1 1 
        3  6264 1 1  93 LEU C    C   8.944   6.854   0.780 1.00 . A A .  93 LEU C    1 1 
        3  6265 1 1  93 LEU CA   C   9.956   7.921   1.187 1.00 . A A .  93 LEU CA   1 1 
        3  6266 1 1  93 LEU CB   C  10.384   8.731  -0.045 1.00 . A A .  93 LEU CB   1 1 
        3  6267 1 1  93 LEU CD1  C   8.432  10.298   0.300 1.00 . A A .  93 LEU CD1  1 1 
        3  6268 1 1  93 LEU CD2  C   9.608  10.193  -1.921 1.00 . A A .  93 LEU CD2  1 1 
        3  6269 1 1  93 LEU CG   C   9.155   9.381  -0.703 1.00 . A A .  93 LEU CG   1 1 
        3  6270 1 1  93 LEU H    H  11.403   6.358   1.504 1.00 . A A .  93 LEU H    1 1 
        3  6271 1 1  93 LEU HA   H   9.503   8.581   1.914 1.00 . A A .  93 LEU HA   1 1 
        3  6272 1 1  93 LEU HB2  H  11.078   9.502   0.260 1.00 . A A .  93 LEU HB2  1 1 
        3  6273 1 1  93 LEU HB3  H  10.867   8.075  -0.754 1.00 . A A .  93 LEU HB3  1 1 
        3  6274 1 1  93 LEU HD11 H   9.153  10.768   0.953 1.00 . A A .  93 LEU HD11 1 1 
        3  6275 1 1  93 LEU HD12 H   7.743   9.712   0.890 1.00 . A A .  93 LEU HD12 1 1 
        3  6276 1 1  93 LEU HD13 H   7.880  11.060  -0.234 1.00 . A A .  93 LEU HD13 1 1 
        3  6277 1 1  93 LEU HD21 H   9.958   9.520  -2.691 1.00 . A A .  93 LEU HD21 1 1 
        3  6278 1 1  93 LEU HD22 H  10.408  10.859  -1.634 1.00 . A A .  93 LEU HD22 1 1 
        3  6279 1 1  93 LEU HD23 H   8.776  10.770  -2.298 1.00 . A A .  93 LEU HD23 1 1 
        3  6280 1 1  93 LEU HG   H   8.472   8.609  -1.028 1.00 . A A .  93 LEU HG   1 1 
        3  6281 1 1  93 LEU N    N  11.142   7.258   1.796 1.00 . A A .  93 LEU N    1 1 
        3  6282 1 1  93 LEU O    O   9.268   5.897   0.104 1.00 . A A .  93 LEU O    1 1 
        3  6283 1 1  94 VAL C    C   5.993   6.406  -0.480 1.00 . A A .  94 VAL C    1 1 
        3  6284 1 1  94 VAL CA   C   6.669   6.010   0.835 1.00 . A A .  94 VAL CA   1 1 
        3  6285 1 1  94 VAL CB   C   5.624   5.962   1.945 1.00 . A A .  94 VAL CB   1 1 
        3  6286 1 1  94 VAL CG1  C   4.653   4.814   1.678 1.00 . A A .  94 VAL CG1  1 1 
        3  6287 1 1  94 VAL CG2  C   6.329   5.738   3.282 1.00 . A A .  94 VAL CG2  1 1 
        3  6288 1 1  94 VAL H    H   7.478   7.790   1.736 1.00 . A A .  94 VAL H    1 1 
        3  6289 1 1  94 VAL HA   H   7.118   5.035   0.726 1.00 . A A .  94 VAL HA   1 1 
        3  6290 1 1  94 VAL HB   H   5.082   6.898   1.971 1.00 . A A .  94 VAL HB   1 1 
        3  6291 1 1  94 VAL HG11 H   3.984   4.705   2.519 1.00 . A A .  94 VAL HG11 1 1 
        3  6292 1 1  94 VAL HG12 H   5.208   3.898   1.540 1.00 . A A .  94 VAL HG12 1 1 
        3  6293 1 1  94 VAL HG13 H   4.080   5.026   0.786 1.00 . A A .  94 VAL HG13 1 1 
        3  6294 1 1  94 VAL HG21 H   6.981   4.882   3.205 1.00 . A A .  94 VAL HG21 1 1 
        3  6295 1 1  94 VAL HG22 H   5.592   5.562   4.051 1.00 . A A .  94 VAL HG22 1 1 
        3  6296 1 1  94 VAL HG23 H   6.911   6.613   3.534 1.00 . A A .  94 VAL HG23 1 1 
        3  6297 1 1  94 VAL N    N   7.715   7.010   1.190 1.00 . A A .  94 VAL N    1 1 
        3  6298 1 1  94 VAL O    O   5.605   7.542  -0.673 1.00 . A A .  94 VAL O    1 1 
        3  6299 1 1  95 GLU C    C   4.223   4.631  -3.030 1.00 . A A .  95 GLU C    1 1 
        3  6300 1 1  95 GLU CA   C   5.184   5.765  -2.690 1.00 . A A .  95 GLU CA   1 1 
        3  6301 1 1  95 GLU CB   C   6.247   5.887  -3.780 1.00 . A A .  95 GLU CB   1 1 
        3  6302 1 1  95 GLU CD   C   8.170   7.256  -4.595 1.00 . A A .  95 GLU CD   1 1 
        3  6303 1 1  95 GLU CG   C   7.049   7.169  -3.560 1.00 . A A .  95 GLU CG   1 1 
        3  6304 1 1  95 GLU H    H   6.160   4.561  -1.195 1.00 . A A .  95 GLU H    1 1 
        3  6305 1 1  95 GLU HA   H   4.630   6.688  -2.626 1.00 . A A .  95 GLU HA   1 1 
        3  6306 1 1  95 GLU HB2  H   6.912   5.036  -3.732 1.00 . A A .  95 GLU HB2  1 1 
        3  6307 1 1  95 GLU HB3  H   5.772   5.921  -4.749 1.00 . A A .  95 GLU HB3  1 1 
        3  6308 1 1  95 GLU HG2  H   6.395   8.024  -3.664 1.00 . A A .  95 GLU HG2  1 1 
        3  6309 1 1  95 GLU HG3  H   7.476   7.161  -2.570 1.00 . A A .  95 GLU HG3  1 1 
        3  6310 1 1  95 GLU N    N   5.843   5.471  -1.382 1.00 . A A .  95 GLU N    1 1 
        3  6311 1 1  95 GLU O    O   4.511   3.473  -2.794 1.00 . A A .  95 GLU O    1 1 
        3  6312 1 1  95 GLU OE1  O   8.275   6.348  -5.402 1.00 . A A .  95 GLU OE1  1 1 
        3  6313 1 1  95 GLU OE2  O   8.905   8.230  -4.564 1.00 . A A .  95 GLU OE2  1 1 
        3  6314 1 1  96 ILE C    C   1.542   4.172  -5.336 1.00 . A A .  96 ILE C    1 1 
        3  6315 1 1  96 ILE CA   C   2.076   3.903  -3.932 1.00 . A A .  96 ILE CA   1 1 
        3  6316 1 1  96 ILE CB   C   0.923   3.942  -2.930 1.00 . A A .  96 ILE CB   1 1 
        3  6317 1 1  96 ILE CD1  C   0.365   3.830  -0.496 1.00 . A A .  96 ILE CD1  1 1 
        3  6318 1 1  96 ILE CG1  C   1.460   3.607  -1.537 1.00 . A A .  96 ILE CG1  1 1 
        3  6319 1 1  96 ILE CG2  C  -0.135   2.912  -3.335 1.00 . A A .  96 ILE CG2  1 1 
        3  6320 1 1  96 ILE H    H   2.873   5.897  -3.747 1.00 . A A .  96 ILE H    1 1 
        3  6321 1 1  96 ILE HA   H   2.538   2.926  -3.910 1.00 . A A .  96 ILE HA   1 1 
        3  6322 1 1  96 ILE HB   H   0.483   4.930  -2.923 1.00 . A A .  96 ILE HB   1 1 
        3  6323 1 1  96 ILE HD11 H   0.797   3.803   0.494 1.00 . A A .  96 ILE HD11 1 1 
        3  6324 1 1  96 ILE HD12 H  -0.376   3.051  -0.585 1.00 . A A .  96 ILE HD12 1 1 
        3  6325 1 1  96 ILE HD13 H  -0.100   4.791  -0.659 1.00 . A A .  96 ILE HD13 1 1 
        3  6326 1 1  96 ILE HG12 H   1.775   2.577  -1.514 1.00 . A A .  96 ILE HG12 1 1 
        3  6327 1 1  96 ILE HG13 H   2.301   4.245  -1.312 1.00 . A A .  96 ILE HG13 1 1 
        3  6328 1 1  96 ILE HG21 H   0.341   1.958  -3.506 1.00 . A A .  96 ILE HG21 1 1 
        3  6329 1 1  96 ILE HG22 H  -0.625   3.236  -4.241 1.00 . A A .  96 ILE HG22 1 1 
        3  6330 1 1  96 ILE HG23 H  -0.865   2.815  -2.547 1.00 . A A .  96 ILE HG23 1 1 
        3  6331 1 1  96 ILE N    N   3.078   4.954  -3.576 1.00 . A A .  96 ILE N    1 1 
        3  6332 1 1  96 ILE O    O   1.323   5.305  -5.717 1.00 . A A .  96 ILE O    1 1 
        3  6333 1 1  97 ASP C    C  -0.438   2.449  -7.694 1.00 . A A .  97 ASP C    1 1 
        3  6334 1 1  97 ASP CA   C   0.814   3.309  -7.504 1.00 . A A .  97 ASP CA   1 1 
        3  6335 1 1  97 ASP CB   C   1.892   2.870  -8.495 1.00 . A A .  97 ASP CB   1 1 
        3  6336 1 1  97 ASP CG   C   1.367   3.028  -9.920 1.00 . A A .  97 ASP CG   1 1 
        3  6337 1 1  97 ASP H    H   1.524   2.233  -5.773 1.00 . A A .  97 ASP H    1 1 
        3  6338 1 1  97 ASP HA   H   0.563   4.344  -7.684 1.00 . A A .  97 ASP HA   1 1 
        3  6339 1 1  97 ASP HB2  H   2.773   3.483  -8.362 1.00 . A A .  97 ASP HB2  1 1 
        3  6340 1 1  97 ASP HB3  H   2.146   1.835  -8.316 1.00 . A A .  97 ASP HB3  1 1 
        3  6341 1 1  97 ASP N    N   1.333   3.136  -6.110 1.00 . A A .  97 ASP N    1 1 
        3  6342 1 1  97 ASP O    O  -0.414   1.250  -7.499 1.00 . A A .  97 ASP O    1 1 
        3  6343 1 1  97 ASP OD1  O   0.326   3.642 -10.082 1.00 . A A .  97 ASP OD1  1 1 
        3  6344 1 1  97 ASP OD2  O   2.016   2.534 -10.826 1.00 . A A .  97 ASP OD2  1 1 
        3  6345 1 1  98 LEU C    C  -3.008   2.063  -9.773 1.00 . A A .  98 LEU C    1 1 
        3  6346 1 1  98 LEU CA   C  -2.801   2.288  -8.279 1.00 . A A .  98 LEU CA   1 1 
        3  6347 1 1  98 LEU CB   C  -3.976   3.094  -7.724 1.00 . A A .  98 LEU CB   1 1 
        3  6348 1 1  98 LEU CD1  C  -4.889   4.255  -5.708 1.00 . A A .  98 LEU CD1  1 1 
        3  6349 1 1  98 LEU CD2  C  -3.455   2.213  -5.426 1.00 . A A .  98 LEU CD2  1 1 
        3  6350 1 1  98 LEU CG   C  -3.694   3.478  -6.267 1.00 . A A .  98 LEU CG   1 1 
        3  6351 1 1  98 LEU H    H  -1.527   4.025  -8.220 1.00 . A A .  98 LEU H    1 1 
        3  6352 1 1  98 LEU HA   H  -2.748   1.332  -7.780 1.00 . A A .  98 LEU HA   1 1 
        3  6353 1 1  98 LEU HB2  H  -4.107   3.991  -8.313 1.00 . A A .  98 LEU HB2  1 1 
        3  6354 1 1  98 LEU HB3  H  -4.875   2.500  -7.770 1.00 . A A .  98 LEU HB3  1 1 
        3  6355 1 1  98 LEU HD11 H  -5.802   3.736  -5.954 1.00 . A A .  98 LEU HD11 1 1 
        3  6356 1 1  98 LEU HD12 H  -4.909   5.246  -6.140 1.00 . A A .  98 LEU HD12 1 1 
        3  6357 1 1  98 LEU HD13 H  -4.796   4.334  -4.635 1.00 . A A .  98 LEU HD13 1 1 
        3  6358 1 1  98 LEU HD21 H  -2.433   1.884  -5.556 1.00 . A A .  98 LEU HD21 1 1 
        3  6359 1 1  98 LEU HD22 H  -4.127   1.431  -5.745 1.00 . A A .  98 LEU HD22 1 1 
        3  6360 1 1  98 LEU HD23 H  -3.626   2.432  -4.382 1.00 . A A .  98 LEU HD23 1 1 
        3  6361 1 1  98 LEU HG   H  -2.815   4.107  -6.233 1.00 . A A .  98 LEU HG   1 1 
        3  6362 1 1  98 LEU N    N  -1.534   3.056  -8.073 1.00 . A A .  98 LEU N    1 1 
        3  6363 1 1  98 LEU O    O  -2.891   2.977 -10.566 1.00 . A A .  98 LEU O    1 1 
        3  6364 1 1  99 ILE C    C  -4.905  -0.070 -11.807 1.00 . A A .  99 ILE C    1 1 
        3  6365 1 1  99 ILE CA   C  -3.521   0.545 -11.615 1.00 . A A .  99 ILE CA   1 1 
        3  6366 1 1  99 ILE CB   C  -2.447  -0.443 -12.086 1.00 . A A .  99 ILE CB   1 1 
        3  6367 1 1  99 ILE CD1  C  -0.425  -0.195 -10.576 1.00 . A A .  99 ILE CD1  1 1 
        3  6368 1 1  99 ILE CG1  C  -1.039   0.193 -11.929 1.00 . A A .  99 ILE CG1  1 1 
        3  6369 1 1  99 ILE CG2  C  -2.703  -0.792 -13.559 1.00 . A A .  99 ILE CG2  1 1 
        3  6370 1 1  99 ILE H    H  -3.392   0.131  -9.504 1.00 . A A .  99 ILE H    1 1 
        3  6371 1 1  99 ILE HA   H  -3.454   1.449 -12.205 1.00 . A A .  99 ILE HA   1 1 
        3  6372 1 1  99 ILE HB   H  -2.511  -1.348 -11.494 1.00 . A A .  99 ILE HB   1 1 
        3  6373 1 1  99 ILE HD11 H  -0.032  -1.200 -10.635 1.00 . A A .  99 ILE HD11 1 1 
        3  6374 1 1  99 ILE HD12 H  -1.180  -0.149  -9.807 1.00 . A A .  99 ILE HD12 1 1 
        3  6375 1 1  99 ILE HD13 H   0.375   0.488 -10.334 1.00 . A A .  99 ILE HD13 1 1 
        3  6376 1 1  99 ILE HG12 H  -0.389  -0.157 -12.720 1.00 . A A .  99 ILE HG12 1 1 
        3  6377 1 1  99 ILE HG13 H  -1.113   1.271 -11.987 1.00 . A A .  99 ILE HG13 1 1 
        3  6378 1 1  99 ILE HG21 H  -2.823   0.118 -14.129 1.00 . A A .  99 ILE HG21 1 1 
        3  6379 1 1  99 ILE HG22 H  -3.600  -1.386 -13.637 1.00 . A A .  99 ILE HG22 1 1 
        3  6380 1 1  99 ILE HG23 H  -1.866  -1.352 -13.947 1.00 . A A .  99 ILE HG23 1 1 
        3  6381 1 1  99 ILE N    N  -3.311   0.850 -10.167 1.00 . A A .  99 ILE N    1 1 
        3  6382 1 1  99 ILE O    O  -5.287  -1.003 -11.126 1.00 . A A .  99 ILE O    1 1 
        3  6383 1 1 100 GLU C    C  -6.941  -1.367 -13.798 1.00 . A A . 100 GLU C    1 1 
        3  6384 1 1 100 GLU CA   C  -7.029  -0.084 -12.971 1.00 . A A . 100 GLU CA   1 1 
        3  6385 1 1 100 GLU CB   C  -7.852   0.965 -13.729 1.00 . A A . 100 GLU CB   1 1 
        3  6386 1 1 100 GLU CD   C  -9.686  -0.649 -14.267 1.00 . A A . 100 GLU CD   1 1 
        3  6387 1 1 100 GLU CG   C  -9.347   0.669 -13.568 1.00 . A A . 100 GLU CG   1 1 
        3  6388 1 1 100 GLU H    H  -5.333   1.208 -13.263 1.00 . A A . 100 GLU H    1 1 
        3  6389 1 1 100 GLU HA   H  -7.498  -0.299 -12.024 1.00 . A A . 100 GLU HA   1 1 
        3  6390 1 1 100 GLU HB2  H  -7.636   1.944 -13.329 1.00 . A A . 100 GLU HB2  1 1 
        3  6391 1 1 100 GLU HB3  H  -7.593   0.942 -14.778 1.00 . A A . 100 GLU HB3  1 1 
        3  6392 1 1 100 GLU HG2  H  -9.590   0.595 -12.519 1.00 . A A . 100 GLU HG2  1 1 
        3  6393 1 1 100 GLU HG3  H  -9.918   1.467 -14.016 1.00 . A A . 100 GLU HG3  1 1 
        3  6394 1 1 100 GLU N    N  -5.662   0.454 -12.729 1.00 . A A . 100 GLU N    1 1 
        3  6395 1 1 100 GLU O    O  -6.206  -1.447 -14.762 1.00 . A A . 100 GLU O    1 1 
        3  6396 1 1 100 GLU OE1  O  -9.061  -0.942 -15.273 1.00 . A A . 100 GLU OE1  1 1 
        3  6397 1 1 100 GLU OE2  O -10.568  -1.342 -13.786 1.00 . A A . 100 GLU OE2  1 1 
        3  6398 1 1 101 GLN C    C  -9.053  -4.286 -14.225 1.00 . A A . 101 GLN C    1 1 
        3  6399 1 1 101 GLN CA   C  -7.660  -3.655 -14.198 1.00 . A A . 101 GLN CA   1 1 
        3  6400 1 1 101 GLN CB   C  -6.672  -4.621 -13.545 1.00 . A A . 101 GLN CB   1 1 
        3  6401 1 1 101 GLN CD   C  -4.250  -5.111 -13.181 1.00 . A A . 101 GLN CD   1 1 
        3  6402 1 1 101 GLN CG   C  -5.245  -4.141 -13.814 1.00 . A A . 101 GLN CG   1 1 
        3  6403 1 1 101 GLN H    H  -8.280  -2.285 -12.653 1.00 . A A . 101 GLN H    1 1 
        3  6404 1 1 101 GLN HA   H  -7.346  -3.461 -15.215 1.00 . A A . 101 GLN HA   1 1 
        3  6405 1 1 101 GLN HB2  H  -6.848  -4.650 -12.479 1.00 . A A . 101 GLN HB2  1 1 
        3  6406 1 1 101 GLN HB3  H  -6.803  -5.607 -13.960 1.00 . A A . 101 GLN HB3  1 1 
        3  6407 1 1 101 GLN HE21 H  -2.663  -4.058 -13.743 1.00 . A A . 101 GLN HE21 1 1 
        3  6408 1 1 101 GLN HE22 H  -2.323  -5.477 -12.877 1.00 . A A . 101 GLN HE22 1 1 
        3  6409 1 1 101 GLN HG2  H  -5.077  -4.094 -14.880 1.00 . A A . 101 GLN HG2  1 1 
        3  6410 1 1 101 GLN HG3  H  -5.109  -3.159 -13.387 1.00 . A A . 101 GLN HG3  1 1 
        3  6411 1 1 101 GLN N    N  -7.692  -2.373 -13.432 1.00 . A A . 101 GLN N    1 1 
        3  6412 1 1 101 GLN NE2  N  -2.973  -4.861 -13.272 1.00 . A A . 101 GLN NE2  1 1 
        3  6413 1 1 101 GLN O    O  -9.910  -3.967 -13.425 1.00 . A A . 101 GLN O    1 1 
        3  6414 1 1 101 GLN OE1  O  -4.634  -6.105 -12.602 1.00 . A A . 101 GLN OE1  1 1 
        3  6415 1 1 102 GLY C    C -10.920  -6.595 -13.969 1.00 . A A . 102 GLY C    1 1 
        3  6416 1 1 102 GLY CA   C -10.612  -5.835 -15.258 1.00 . A A . 102 GLY CA   1 1 
        3  6417 1 1 102 GLY H    H  -8.570  -5.406 -15.787 1.00 . A A . 102 GLY H    1 1 
        3  6418 1 1 102 GLY HA2  H -11.372  -5.088 -15.431 1.00 . A A . 102 GLY HA2  1 1 
        3  6419 1 1 102 GLY HA3  H -10.597  -6.532 -16.083 1.00 . A A . 102 GLY HA3  1 1 
        3  6420 1 1 102 GLY N    N  -9.279  -5.175 -15.152 1.00 . A A . 102 GLY N    1 1 
        3  6421 1 1 102 GLY O    O -12.033  -6.589 -13.488 1.00 . A A . 102 GLY O    1 1 
        3  6422 1 1 103 GLY C    C  -9.964  -7.126 -10.936 1.00 . A A . 103 GLY C    1 1 
        3  6423 1 1 103 GLY CA   C -10.193  -8.027 -12.151 1.00 . A A . 103 GLY CA   1 1 
        3  6424 1 1 103 GLY H    H  -9.053  -7.259 -13.811 1.00 . A A . 103 GLY H    1 1 
        3  6425 1 1 103 GLY HA2  H -11.213  -8.388 -12.142 1.00 . A A . 103 GLY HA2  1 1 
        3  6426 1 1 103 GLY HA3  H  -9.514  -8.865 -12.103 1.00 . A A . 103 GLY HA3  1 1 
        3  6427 1 1 103 GLY N    N  -9.945  -7.260 -13.407 1.00 . A A . 103 GLY N    1 1 
        3  6428 1 1 103 GLY O    O  -8.871  -7.031 -10.415 1.00 . A A . 103 GLY O    1 1 
        3  6429 1 1 104 GLY C    C  -9.831  -4.500  -9.534 1.00 . A A . 104 GLY C    1 1 
        3  6430 1 1 104 GLY CA   C -10.860  -5.601  -9.278 1.00 . A A . 104 GLY CA   1 1 
        3  6431 1 1 104 GLY H    H -11.871  -6.582 -10.902 1.00 . A A . 104 GLY H    1 1 
        3  6432 1 1 104 GLY HA2  H -11.815  -5.150  -9.055 1.00 . A A . 104 GLY HA2  1 1 
        3  6433 1 1 104 GLY HA3  H -10.539  -6.194  -8.438 1.00 . A A . 104 GLY HA3  1 1 
        3  6434 1 1 104 GLY N    N -10.995  -6.479 -10.472 1.00 . A A . 104 GLY N    1 1 
        3  6435 1 1 104 GLY O    O  -9.746  -3.952 -10.614 1.00 . A A . 104 GLY O    1 1 
        3  6436 1 1 105 THR C    C  -6.669  -3.620  -8.216 1.00 . A A . 105 THR C    1 1 
        3  6437 1 1 105 THR CA   C  -8.025  -3.095  -8.678 1.00 . A A . 105 THR CA   1 1 
        3  6438 1 1 105 THR CB   C  -8.428  -1.896  -7.821 1.00 . A A . 105 THR CB   1 1 
        3  6439 1 1 105 THR CG2  C  -7.348  -0.819  -7.910 1.00 . A A . 105 THR CG2  1 1 
        3  6440 1 1 105 THR H    H  -9.154  -4.627  -7.670 1.00 . A A . 105 THR H    1 1 
        3  6441 1 1 105 THR HA   H  -7.948  -2.786  -9.711 1.00 . A A . 105 THR HA   1 1 
        3  6442 1 1 105 THR HB   H  -8.540  -2.206  -6.793 1.00 . A A . 105 THR HB   1 1 
        3  6443 1 1 105 THR HG1  H  -9.604  -1.309  -9.254 1.00 . A A . 105 THR HG1  1 1 
        3  6444 1 1 105 THR HG21 H  -7.095  -0.650  -8.946 1.00 . A A . 105 THR HG21 1 1 
        3  6445 1 1 105 THR HG22 H  -6.469  -1.145  -7.373 1.00 . A A . 105 THR HG22 1 1 
        3  6446 1 1 105 THR HG23 H  -7.717   0.097  -7.476 1.00 . A A . 105 THR HG23 1 1 
        3  6447 1 1 105 THR N    N  -9.055  -4.168  -8.532 1.00 . A A . 105 THR N    1 1 
        3  6448 1 1 105 THR O    O  -6.545  -4.209  -7.162 1.00 . A A . 105 THR O    1 1 
        3  6449 1 1 105 THR OG1  O  -9.661  -1.377  -8.298 1.00 . A A . 105 THR OG1  1 1 
        3  6450 1 1 106 LEU C    C  -3.595  -2.808  -7.801 1.00 . A A . 106 LEU C    1 1 
        3  6451 1 1 106 LEU CA   C  -4.294  -3.889  -8.613 1.00 . A A . 106 LEU CA   1 1 
        3  6452 1 1 106 LEU CB   C  -3.483  -4.201  -9.875 1.00 . A A . 106 LEU CB   1 1 
        3  6453 1 1 106 LEU CD1  C  -2.004  -5.694  -8.479 1.00 . A A . 106 LEU CD1  1 1 
        3  6454 1 1 106 LEU CD2  C  -1.288  -4.983 -10.771 1.00 . A A . 106 LEU CD2  1 1 
        3  6455 1 1 106 LEU CG   C  -2.033  -4.550  -9.504 1.00 . A A . 106 LEU CG   1 1 
        3  6456 1 1 106 LEU H    H  -5.772  -2.925  -9.847 1.00 . A A . 106 LEU H    1 1 
        3  6457 1 1 106 LEU HA   H  -4.387  -4.783  -8.013 1.00 . A A . 106 LEU HA   1 1 
        3  6458 1 1 106 LEU HB2  H  -3.934  -5.037 -10.387 1.00 . A A . 106 LEU HB2  1 1 
        3  6459 1 1 106 LEU HB3  H  -3.488  -3.338 -10.524 1.00 . A A . 106 LEU HB3  1 1 
        3  6460 1 1 106 LEU HD11 H  -1.042  -6.186  -8.509 1.00 . A A . 106 LEU HD11 1 1 
        3  6461 1 1 106 LEU HD12 H  -2.781  -6.409  -8.709 1.00 . A A . 106 LEU HD12 1 1 
        3  6462 1 1 106 LEU HD13 H  -2.168  -5.290  -7.490 1.00 . A A . 106 LEU HD13 1 1 
        3  6463 1 1 106 LEU HD21 H  -1.421  -4.236 -11.539 1.00 . A A . 106 LEU HD21 1 1 
        3  6464 1 1 106 LEU HD22 H  -1.682  -5.927 -11.114 1.00 . A A . 106 LEU HD22 1 1 
        3  6465 1 1 106 LEU HD23 H  -0.235  -5.089 -10.552 1.00 . A A . 106 LEU HD23 1 1 
        3  6466 1 1 106 LEU HG   H  -1.546  -3.682  -9.085 1.00 . A A . 106 LEU HG   1 1 
        3  6467 1 1 106 LEU N    N  -5.648  -3.408  -9.000 1.00 . A A . 106 LEU N    1 1 
        3  6468 1 1 106 LEU O    O  -3.503  -1.670  -8.217 1.00 . A A . 106 LEU O    1 1 
        3  6469 1 1 107 LEU C    C  -0.923  -2.504  -5.697 1.00 . A A . 107 LEU C    1 1 
        3  6470 1 1 107 LEU CA   C  -2.409  -2.163  -5.778 1.00 . A A . 107 LEU CA   1 1 
        3  6471 1 1 107 LEU CB   C  -3.032  -2.219  -4.380 1.00 . A A . 107 LEU CB   1 1 
        3  6472 1 1 107 LEU CD1  C  -3.352  -0.512  -2.542 1.00 . A A . 107 LEU CD1  1 1 
        3  6473 1 1 107 LEU CD2  C  -1.322  -1.970  -2.522 1.00 . A A . 107 LEU CD2  1 1 
        3  6474 1 1 107 LEU CG   C  -2.318  -1.222  -3.425 1.00 . A A . 107 LEU CG   1 1 
        3  6475 1 1 107 LEU H    H  -3.200  -4.085  -6.336 1.00 . A A . 107 LEU H    1 1 
        3  6476 1 1 107 LEU HA   H  -2.524  -1.166  -6.177 1.00 . A A . 107 LEU HA   1 1 
        3  6477 1 1 107 LEU HB2  H  -4.081  -1.968  -4.462 1.00 . A A . 107 LEU HB2  1 1 
        3  6478 1 1 107 LEU HB3  H  -2.942  -3.226  -3.994 1.00 . A A . 107 LEU HB3  1 1 
        3  6479 1 1 107 LEU HD11 H  -2.845   0.005  -1.741 1.00 . A A . 107 LEU HD11 1 1 
        3  6480 1 1 107 LEU HD12 H  -4.034  -1.239  -2.128 1.00 . A A . 107 LEU HD12 1 1 
        3  6481 1 1 107 LEU HD13 H  -3.903   0.201  -3.139 1.00 . A A . 107 LEU HD13 1 1 
        3  6482 1 1 107 LEU HD21 H  -0.776  -2.696  -3.107 1.00 . A A . 107 LEU HD21 1 1 
        3  6483 1 1 107 LEU HD22 H  -1.857  -2.477  -1.732 1.00 . A A . 107 LEU HD22 1 1 
        3  6484 1 1 107 LEU HD23 H  -0.629  -1.264  -2.091 1.00 . A A . 107 LEU HD23 1 1 
        3  6485 1 1 107 LEU HG   H  -1.785  -0.479  -4.004 1.00 . A A . 107 LEU HG   1 1 
        3  6486 1 1 107 LEU N    N  -3.104  -3.158  -6.644 1.00 . A A . 107 LEU N    1 1 
        3  6487 1 1 107 LEU O    O  -0.546  -3.606  -5.350 1.00 . A A . 107 LEU O    1 1 
        3  6488 1 1 108 ARG C    C   1.983  -0.917  -4.845 1.00 . A A . 108 ARG C    1 1 
        3  6489 1 1 108 ARG CA   C   1.399  -1.785  -5.954 1.00 . A A . 108 ARG CA   1 1 
        3  6490 1 1 108 ARG CB   C   2.029  -1.399  -7.294 1.00 . A A . 108 ARG CB   1 1 
        3  6491 1 1 108 ARG CD   C   4.153  -1.358  -8.614 1.00 . A A . 108 ARG CD   1 1 
        3  6492 1 1 108 ARG CG   C   3.530  -1.697  -7.258 1.00 . A A . 108 ARG CG   1 1 
        3  6493 1 1 108 ARG CZ   C   3.977  -2.166 -10.896 1.00 . A A . 108 ARG CZ   1 1 
        3  6494 1 1 108 ARG H    H  -0.418  -0.675  -6.280 1.00 . A A . 108 ARG H    1 1 
        3  6495 1 1 108 ARG HA   H   1.610  -2.824  -5.742 1.00 . A A . 108 ARG HA   1 1 
        3  6496 1 1 108 ARG HB2  H   1.564  -1.971  -8.084 1.00 . A A . 108 ARG HB2  1 1 
        3  6497 1 1 108 ARG HB3  H   1.874  -0.345  -7.474 1.00 . A A . 108 ARG HB3  1 1 
        3  6498 1 1 108 ARG HD2  H   3.894  -0.346  -8.888 1.00 . A A . 108 ARG HD2  1 1 
        3  6499 1 1 108 ARG HD3  H   5.227  -1.450  -8.549 1.00 . A A . 108 ARG HD3  1 1 
        3  6500 1 1 108 ARG HE   H   3.035  -3.032  -9.378 1.00 . A A . 108 ARG HE   1 1 
        3  6501 1 1 108 ARG HG2  H   3.997  -1.097  -6.489 1.00 . A A . 108 ARG HG2  1 1 
        3  6502 1 1 108 ARG HG3  H   3.684  -2.743  -7.042 1.00 . A A . 108 ARG HG3  1 1 
        3  6503 1 1 108 ARG HH11 H   5.115  -0.549 -10.574 1.00 . A A . 108 ARG HH11 1 1 
        3  6504 1 1 108 ARG HH12 H   5.030  -1.091 -12.217 1.00 . A A . 108 ARG HH12 1 1 
        3  6505 1 1 108 ARG HH21 H   2.918  -3.748 -11.514 1.00 . A A . 108 ARG HH21 1 1 
        3  6506 1 1 108 ARG HH22 H   3.788  -2.900 -12.749 1.00 . A A . 108 ARG HH22 1 1 
        3  6507 1 1 108 ARG N    N  -0.078  -1.555  -6.010 1.00 . A A . 108 ARG N    1 1 
        3  6508 1 1 108 ARG NE   N   3.633  -2.302  -9.644 1.00 . A A . 108 ARG NE   1 1 
        3  6509 1 1 108 ARG NH1  N   4.770  -1.192 -11.256 1.00 . A A . 108 ARG NH1  1 1 
        3  6510 1 1 108 ARG NH2  N   3.526  -3.002 -11.789 1.00 . A A . 108 ARG NH2  1 1 
        3  6511 1 1 108 ARG O    O   1.667   0.252  -4.734 1.00 . A A . 108 ARG O    1 1 
        3  6512 1 1 109 LEU C    C   4.898  -0.421  -3.200 1.00 . A A . 109 LEU C    1 1 
        3  6513 1 1 109 LEU CA   C   3.425  -0.693  -2.901 1.00 . A A . 109 LEU CA   1 1 
        3  6514 1 1 109 LEU CB   C   3.325  -1.507  -1.608 1.00 . A A . 109 LEU CB   1 1 
        3  6515 1 1 109 LEU CD1  C   2.366   0.095   0.095 1.00 . A A . 109 LEU CD1  1 1 
        3  6516 1 1 109 LEU CD2  C   4.229  -1.449   0.743 1.00 . A A . 109 LEU CD2  1 1 
        3  6517 1 1 109 LEU CG   C   3.645  -0.605  -0.395 1.00 . A A . 109 LEU CG   1 1 
        3  6518 1 1 109 LEU H    H   3.055  -2.425  -4.127 1.00 . A A . 109 LEU H    1 1 
        3  6519 1 1 109 LEU HA   H   2.906   0.245  -2.775 1.00 . A A . 109 LEU HA   1 1 
        3  6520 1 1 109 LEU HB2  H   2.323  -1.907  -1.516 1.00 . A A . 109 LEU HB2  1 1 
        3  6521 1 1 109 LEU HB3  H   4.030  -2.325  -1.650 1.00 . A A . 109 LEU HB3  1 1 
        3  6522 1 1 109 LEU HD11 H   2.634   0.972   0.663 1.00 . A A . 109 LEU HD11 1 1 
        3  6523 1 1 109 LEU HD12 H   1.798  -0.581   0.720 1.00 . A A . 109 LEU HD12 1 1 
        3  6524 1 1 109 LEU HD13 H   1.763   0.384  -0.752 1.00 . A A . 109 LEU HD13 1 1 
        3  6525 1 1 109 LEU HD21 H   5.175  -1.866   0.429 1.00 . A A . 109 LEU HD21 1 1 
        3  6526 1 1 109 LEU HD22 H   3.546  -2.249   0.986 1.00 . A A . 109 LEU HD22 1 1 
        3  6527 1 1 109 LEU HD23 H   4.380  -0.825   1.611 1.00 . A A . 109 LEU HD23 1 1 
        3  6528 1 1 109 LEU HG   H   4.368   0.148  -0.685 1.00 . A A . 109 LEU HG   1 1 
        3  6529 1 1 109 LEU N    N   2.824  -1.479  -4.019 1.00 . A A . 109 LEU N    1 1 
        3  6530 1 1 109 LEU O    O   5.665  -1.328  -3.455 1.00 . A A . 109 LEU O    1 1 
        3  6531 1 1 110 THR C    C   7.284   1.909  -2.205 1.00 . A A . 110 THR C    1 1 
        3  6532 1 1 110 THR CA   C   6.719   1.189  -3.428 1.00 . A A . 110 THR CA   1 1 
        3  6533 1 1 110 THR CB   C   6.780   2.113  -4.645 1.00 . A A . 110 THR CB   1 1 
        3  6534 1 1 110 THR CG2  C   8.215   2.592  -4.856 1.00 . A A . 110 THR CG2  1 1 
        3  6535 1 1 110 THR H    H   4.649   1.529  -2.940 1.00 . A A . 110 THR H    1 1 
        3  6536 1 1 110 THR HA   H   7.306   0.302  -3.620 1.00 . A A . 110 THR HA   1 1 
        3  6537 1 1 110 THR HB   H   6.138   2.965  -4.482 1.00 . A A . 110 THR HB   1 1 
        3  6538 1 1 110 THR HG1  H   5.400   1.581  -5.912 1.00 . A A . 110 THR HG1  1 1 
        3  6539 1 1 110 THR HG21 H   8.889   1.751  -4.786 1.00 . A A . 110 THR HG21 1 1 
        3  6540 1 1 110 THR HG22 H   8.466   3.318  -4.097 1.00 . A A . 110 THR HG22 1 1 
        3  6541 1 1 110 THR HG23 H   8.304   3.045  -5.831 1.00 . A A . 110 THR HG23 1 1 
        3  6542 1 1 110 THR N    N   5.293   0.824  -3.159 1.00 . A A . 110 THR N    1 1 
        3  6543 1 1 110 THR O    O   6.741   2.896  -1.749 1.00 . A A . 110 THR O    1 1 
        3  6544 1 1 110 THR OG1  O   6.337   1.404  -5.793 1.00 . A A . 110 THR OG1  1 1 
        3  6545 1 1 111 HIS C    C  10.496   2.128  -0.654 1.00 . A A . 111 HIS C    1 1 
        3  6546 1 1 111 HIS CA   C   8.983   2.058  -0.464 1.00 . A A . 111 HIS CA   1 1 
        3  6547 1 1 111 HIS CB   C   8.660   1.214   0.766 1.00 . A A . 111 HIS CB   1 1 
        3  6548 1 1 111 HIS CD2  C   8.247   2.554   2.985 1.00 . A A . 111 HIS CD2  1 1 
        3  6549 1 1 111 HIS CE1  C  10.313   2.905   3.529 1.00 . A A . 111 HIS CE1  1 1 
        3  6550 1 1 111 HIS CG   C   9.020   1.976   2.009 1.00 . A A . 111 HIS CG   1 1 
        3  6551 1 1 111 HIS H    H   8.781   0.616  -2.053 1.00 . A A . 111 HIS H    1 1 
        3  6552 1 1 111 HIS HA   H   8.593   3.058  -0.331 1.00 . A A . 111 HIS HA   1 1 
        3  6553 1 1 111 HIS HB2  H   7.603   0.985   0.777 1.00 . A A . 111 HIS HB2  1 1 
        3  6554 1 1 111 HIS HB3  H   9.225   0.293   0.732 1.00 . A A . 111 HIS HB3  1 1 
        3  6555 1 1 111 HIS HD1  H  11.133   1.929   1.885 1.00 . A A . 111 HIS HD1  1 1 
        3  6556 1 1 111 HIS HD2  H   7.167   2.551   3.006 1.00 . A A . 111 HIS HD2  1 1 
        3  6557 1 1 111 HIS HE1  H  11.198   3.231   4.055 1.00 . A A . 111 HIS HE1  1 1 
        3  6558 1 1 111 HIS N    N   8.369   1.418  -1.667 1.00 . A A . 111 HIS N    1 1 
        3  6559 1 1 111 HIS ND1  N  10.334   2.213   2.376 1.00 . A A . 111 HIS ND1  1 1 
        3  6560 1 1 111 HIS NE2  N   9.065   3.140   3.945 1.00 . A A . 111 HIS NE2  1 1 
        3  6561 1 1 111 HIS O    O  11.105   1.202  -1.153 1.00 . A A . 111 HIS O    1 1 
        3  6562 1 1 112 SER C    C  13.215   3.777   0.906 1.00 . A A . 112 SER C    1 1 
        3  6563 1 1 112 SER CA   C  12.595   3.359  -0.425 1.00 . A A . 112 SER CA   1 1 
        3  6564 1 1 112 SER CB   C  12.888   4.433  -1.467 1.00 . A A . 112 SER CB   1 1 
        3  6565 1 1 112 SER H    H  10.594   3.954   0.131 1.00 . A A . 112 SER H    1 1 
        3  6566 1 1 112 SER HA   H  13.030   2.422  -0.741 1.00 . A A . 112 SER HA   1 1 
        3  6567 1 1 112 SER HB2  H  12.471   5.372  -1.145 1.00 . A A . 112 SER HB2  1 1 
        3  6568 1 1 112 SER HB3  H  13.959   4.536  -1.582 1.00 . A A . 112 SER HB3  1 1 
        3  6569 1 1 112 SER HG   H  11.364   4.273  -2.664 1.00 . A A . 112 SER HG   1 1 
        3  6570 1 1 112 SER N    N  11.112   3.219  -0.265 1.00 . A A . 112 SER N    1 1 
        3  6571 1 1 112 SER O    O  12.581   4.415   1.722 1.00 . A A . 112 SER O    1 1 
        3  6572 1 1 112 SER OG   O  12.300   4.061  -2.705 1.00 . A A . 112 SER OG   1 1 
        3  6573 1 1 113 GLY C    C  15.700   2.539   3.071 1.00 . A A . 113 GLY C    1 1 
        3  6574 1 1 113 GLY CA   C  15.152   3.797   2.399 1.00 . A A . 113 GLY CA   1 1 
        3  6575 1 1 113 GLY H    H  14.946   2.914   0.444 1.00 . A A . 113 GLY H    1 1 
        3  6576 1 1 113 GLY HA2  H  15.968   4.469   2.174 1.00 . A A . 113 GLY HA2  1 1 
        3  6577 1 1 113 GLY HA3  H  14.463   4.287   3.072 1.00 . A A . 113 GLY HA3  1 1 
        3  6578 1 1 113 GLY N    N  14.460   3.425   1.126 1.00 . A A . 113 GLY N    1 1 
        3  6579 1 1 113 GLY O    O  16.480   1.808   2.496 1.00 . A A . 113 GLY O    1 1 
        3  6580 1 1 114 LEU C    C  17.275   0.861   4.771 1.00 . A A . 114 LEU C    1 1 
        3  6581 1 1 114 LEU CA   C  15.779   1.088   5.038 1.00 . A A . 114 LEU CA   1 1 
        3  6582 1 1 114 LEU CB   C  14.986  -0.147   4.605 1.00 . A A . 114 LEU CB   1 1 
        3  6583 1 1 114 LEU CD1  C  12.692  -1.081   4.298 1.00 . A A . 114 LEU CD1  1 1 
        3  6584 1 1 114 LEU CD2  C  13.036   0.872   5.814 1.00 . A A . 114 LEU CD2  1 1 
        3  6585 1 1 114 LEU CG   C  13.496   0.200   4.514 1.00 . A A . 114 LEU CG   1 1 
        3  6586 1 1 114 LEU H    H  14.667   2.905   4.722 1.00 . A A . 114 LEU H    1 1 
        3  6587 1 1 114 LEU HA   H  15.620   1.243   6.091 1.00 . A A . 114 LEU HA   1 1 
        3  6588 1 1 114 LEU HB2  H  15.338  -0.484   3.641 1.00 . A A . 114 LEU HB2  1 1 
        3  6589 1 1 114 LEU HB3  H  15.124  -0.934   5.333 1.00 . A A . 114 LEU HB3  1 1 
        3  6590 1 1 114 LEU HD11 H  13.114  -1.633   3.471 1.00 . A A . 114 LEU HD11 1 1 
        3  6591 1 1 114 LEU HD12 H  11.667  -0.829   4.076 1.00 . A A . 114 LEU HD12 1 1 
        3  6592 1 1 114 LEU HD13 H  12.730  -1.685   5.193 1.00 . A A . 114 LEU HD13 1 1 
        3  6593 1 1 114 LEU HD21 H  13.429   0.328   6.660 1.00 . A A . 114 LEU HD21 1 1 
        3  6594 1 1 114 LEU HD22 H  11.956   0.872   5.857 1.00 . A A . 114 LEU HD22 1 1 
        3  6595 1 1 114 LEU HD23 H  13.396   1.890   5.840 1.00 . A A . 114 LEU HD23 1 1 
        3  6596 1 1 114 LEU HG   H  13.335   0.869   3.682 1.00 . A A . 114 LEU HG   1 1 
        3  6597 1 1 114 LEU N    N  15.295   2.291   4.291 1.00 . A A . 114 LEU N    1 1 
        3  6598 1 1 114 LEU O    O  17.642   0.085   3.910 1.00 . A A . 114 LEU O    1 1 
        3  6599 1 1 115 PRO C    C  20.144   0.142   6.030 1.00 . A A . 115 PRO C    1 1 
        3  6600 1 1 115 PRO CA   C  19.607   1.393   5.329 1.00 . A A . 115 PRO CA   1 1 
        3  6601 1 1 115 PRO CB   C  20.165   2.674   5.960 1.00 . A A . 115 PRO CB   1 1 
        3  6602 1 1 115 PRO CD   C  17.808   2.496   6.572 1.00 . A A . 115 PRO CD   1 1 
        3  6603 1 1 115 PRO CG   C  19.171   3.054   7.017 1.00 . A A . 115 PRO CG   1 1 
        3  6604 1 1 115 PRO HA   H  19.859   1.367   4.280 1.00 . A A . 115 PRO HA   1 1 
        3  6605 1 1 115 PRO HB2  H  21.140   2.488   6.398 1.00 . A A . 115 PRO HB2  1 1 
        3  6606 1 1 115 PRO HB3  H  20.233   3.457   5.218 1.00 . A A . 115 PRO HB3  1 1 
        3  6607 1 1 115 PRO HD2  H  17.323   1.994   7.400 1.00 . A A . 115 PRO HD2  1 1 
        3  6608 1 1 115 PRO HD3  H  17.177   3.281   6.182 1.00 . A A . 115 PRO HD3  1 1 
        3  6609 1 1 115 PRO HG2  H  19.461   2.621   7.968 1.00 . A A . 115 PRO HG2  1 1 
        3  6610 1 1 115 PRO HG3  H  19.112   4.130   7.108 1.00 . A A . 115 PRO HG3  1 1 
        3  6611 1 1 115 PRO N    N  18.136   1.531   5.500 1.00 . A A . 115 PRO N    1 1 
        3  6612 1 1 115 PRO O    O  21.339  -0.037   6.162 1.00 . A A . 115 PRO O    1 1 
        3  6613 1 1 116 SER C    C  19.046  -3.192   6.550 1.00 . A A . 116 SER C    1 1 
        3  6614 1 1 116 SER CA   C  19.712  -1.969   7.186 1.00 . A A . 116 SER CA   1 1 
        3  6615 1 1 116 SER CB   C  19.316  -1.884   8.660 1.00 . A A . 116 SER CB   1 1 
        3  6616 1 1 116 SER H    H  18.307  -0.550   6.367 1.00 . A A . 116 SER H    1 1 
        3  6617 1 1 116 SER HA   H  20.786  -2.076   7.111 1.00 . A A . 116 SER HA   1 1 
        3  6618 1 1 116 SER HB2  H  18.283  -1.585   8.742 1.00 . A A . 116 SER HB2  1 1 
        3  6619 1 1 116 SER HB3  H  19.446  -2.853   9.122 1.00 . A A . 116 SER HB3  1 1 
        3  6620 1 1 116 SER HG   H  20.087  -0.103   8.807 1.00 . A A . 116 SER HG   1 1 
        3  6621 1 1 116 SER N    N  19.265  -0.722   6.486 1.00 . A A . 116 SER N    1 1 
        3  6622 1 1 116 SER O    O  17.921  -3.138   6.090 1.00 . A A . 116 SER O    1 1 
        3  6623 1 1 116 SER OG   O  20.134  -0.920   9.310 1.00 . A A . 116 SER OG   1 1 
        3  6624 1 1 117 ALA C    C  18.044  -6.073   6.790 1.00 . A A . 117 ALA C    1 1 
        3  6625 1 1 117 ALA CA   C  19.190  -5.540   5.924 1.00 . A A . 117 ALA CA   1 1 
        3  6626 1 1 117 ALA CB   C  20.302  -6.586   5.857 1.00 . A A . 117 ALA CB   1 1 
        3  6627 1 1 117 ALA H    H  20.648  -4.300   6.902 1.00 . A A . 117 ALA H    1 1 
        3  6628 1 1 117 ALA HA   H  18.827  -5.334   4.929 1.00 . A A . 117 ALA HA   1 1 
        3  6629 1 1 117 ALA HB1  H  20.732  -6.713   6.839 1.00 . A A . 117 ALA HB1  1 1 
        3  6630 1 1 117 ALA HB2  H  21.066  -6.252   5.171 1.00 . A A . 117 ALA HB2  1 1 
        3  6631 1 1 117 ALA HB3  H  19.894  -7.524   5.516 1.00 . A A . 117 ALA HB3  1 1 
        3  6632 1 1 117 ALA N    N  19.745  -4.293   6.524 1.00 . A A . 117 ALA N    1 1 
        3  6633 1 1 117 ALA O    O  17.068  -6.599   6.295 1.00 . A A . 117 ALA O    1 1 
        3  6634 1 1 118 GLU C    C  15.821  -5.658   8.776 1.00 . A A . 118 GLU C    1 1 
        3  6635 1 1 118 GLU CA   C  17.102  -6.468   8.988 1.00 . A A . 118 GLU CA   1 1 
        3  6636 1 1 118 GLU CB   C  17.561  -6.323  10.445 1.00 . A A . 118 GLU CB   1 1 
        3  6637 1 1 118 GLU CD   C  20.072  -6.518  10.278 1.00 . A A . 118 GLU CD   1 1 
        3  6638 1 1 118 GLU CG   C  18.781  -7.227  10.709 1.00 . A A . 118 GLU CG   1 1 
        3  6639 1 1 118 GLU H    H  18.968  -5.538   8.458 1.00 . A A . 118 GLU H    1 1 
        3  6640 1 1 118 GLU HA   H  16.912  -7.507   8.769 1.00 . A A . 118 GLU HA   1 1 
        3  6641 1 1 118 GLU HB2  H  17.821  -5.293  10.636 1.00 . A A . 118 GLU HB2  1 1 
        3  6642 1 1 118 GLU HB3  H  16.753  -6.614  11.098 1.00 . A A . 118 GLU HB3  1 1 
        3  6643 1 1 118 GLU HG2  H  18.832  -7.451  11.767 1.00 . A A . 118 GLU HG2  1 1 
        3  6644 1 1 118 GLU HG3  H  18.684  -8.148  10.155 1.00 . A A . 118 GLU HG3  1 1 
        3  6645 1 1 118 GLU N    N  18.168  -5.955   8.081 1.00 . A A . 118 GLU N    1 1 
        3  6646 1 1 118 GLU O    O  14.733  -6.196   8.741 1.00 . A A . 118 GLU O    1 1 
        3  6647 1 1 118 GLU OE1  O  19.978  -5.437   9.723 1.00 . A A . 118 GLU OE1  1 1 
        3  6648 1 1 118 GLU OE2  O  21.134  -7.065  10.525 1.00 . A A . 118 GLU OE2  1 1 
        3  6649 1 1 119 GLN C    C  14.092  -3.865   7.077 1.00 . A A . 119 GLN C    1 1 
        3  6650 1 1 119 GLN CA   C  14.736  -3.522   8.427 1.00 . A A . 119 GLN CA   1 1 
        3  6651 1 1 119 GLN CB   C  15.154  -2.051   8.430 1.00 . A A . 119 GLN CB   1 1 
        3  6652 1 1 119 GLN CD   C  14.568  -1.727  10.840 1.00 . A A . 119 GLN CD   1 1 
        3  6653 1 1 119 GLN CG   C  15.695  -1.667   9.809 1.00 . A A . 119 GLN CG   1 1 
        3  6654 1 1 119 GLN H    H  16.829  -3.955   8.669 1.00 . A A . 119 GLN H    1 1 
        3  6655 1 1 119 GLN HA   H  14.026  -3.699   9.220 1.00 . A A . 119 GLN HA   1 1 
        3  6656 1 1 119 GLN HB2  H  15.922  -1.895   7.685 1.00 . A A . 119 GLN HB2  1 1 
        3  6657 1 1 119 GLN HB3  H  14.299  -1.435   8.198 1.00 . A A . 119 GLN HB3  1 1 
        3  6658 1 1 119 GLN HE21 H  15.584  -2.877  12.101 1.00 . A A . 119 GLN HE21 1 1 
        3  6659 1 1 119 GLN HE22 H  14.021  -2.452  12.606 1.00 . A A . 119 GLN HE22 1 1 
        3  6660 1 1 119 GLN HG2  H  16.480  -2.358  10.094 1.00 . A A . 119 GLN HG2  1 1 
        3  6661 1 1 119 GLN HG3  H  16.095  -0.667   9.773 1.00 . A A . 119 GLN HG3  1 1 
        3  6662 1 1 119 GLN N    N  15.942  -4.370   8.636 1.00 . A A . 119 GLN N    1 1 
        3  6663 1 1 119 GLN NE2  N  14.739  -2.409  11.940 1.00 . A A . 119 GLN NE2  1 1 
        3  6664 1 1 119 GLN O    O  12.887  -3.892   6.942 1.00 . A A . 119 GLN O    1 1 
        3  6665 1 1 119 GLN OE1  O  13.521  -1.146  10.644 1.00 . A A . 119 GLN OE1  1 1 
        3  6666 1 1 120 CYS C    C  13.595  -5.791   4.819 1.00 . A A . 120 CYS C    1 1 
        3  6667 1 1 120 CYS CA   C  14.334  -4.457   4.732 1.00 . A A . 120 CYS CA   1 1 
        3  6668 1 1 120 CYS CB   C  15.502  -4.605   3.754 1.00 . A A . 120 CYS CB   1 1 
        3  6669 1 1 120 CYS H    H  15.861  -4.092   6.206 1.00 . A A . 120 CYS H    1 1 
        3  6670 1 1 120 CYS HA   H  13.669  -3.681   4.399 1.00 . A A . 120 CYS HA   1 1 
        3  6671 1 1 120 CYS HB2  H  16.197  -5.339   4.140 1.00 . A A . 120 CYS HB2  1 1 
        3  6672 1 1 120 CYS HB3  H  15.133  -4.930   2.794 1.00 . A A . 120 CYS HB3  1 1 
        3  6673 1 1 120 CYS HG   H  15.764  -2.420   3.106 1.00 . A A . 120 CYS HG   1 1 
        3  6674 1 1 120 CYS N    N  14.890  -4.122   6.076 1.00 . A A . 120 CYS N    1 1 
        3  6675 1 1 120 CYS O    O  12.521  -5.978   4.279 1.00 . A A . 120 CYS O    1 1 
        3  6676 1 1 120 CYS SG   S  16.350  -3.016   3.575 1.00 . A A . 120 CYS SG   1 1 
        3  6677 1 1 121 ALA C    C  12.345  -8.084   6.460 1.00 . A A . 121 ALA C    1 1 
        3  6678 1 1 121 ALA CA   C  13.665  -8.083   5.671 1.00 . A A . 121 ALA CA   1 1 
        3  6679 1 1 121 ALA CB   C  14.709  -8.862   6.463 1.00 . A A . 121 ALA CB   1 1 
        3  6680 1 1 121 ALA H    H  15.077  -6.498   5.885 1.00 . A A . 121 ALA H    1 1 
        3  6681 1 1 121 ALA HA   H  13.522  -8.552   4.710 1.00 . A A . 121 ALA HA   1 1 
        3  6682 1 1 121 ALA HB1  H  14.876  -8.367   7.408 1.00 . A A . 121 ALA HB1  1 1 
        3  6683 1 1 121 ALA HB2  H  15.636  -8.885   5.907 1.00 . A A . 121 ALA HB2  1 1 
        3  6684 1 1 121 ALA HB3  H  14.364  -9.868   6.636 1.00 . A A . 121 ALA HB3  1 1 
        3  6685 1 1 121 ALA N    N  14.210  -6.711   5.492 1.00 . A A . 121 ALA N    1 1 
        3  6686 1 1 121 ALA O    O  11.373  -8.698   6.058 1.00 . A A . 121 ALA O    1 1 
        3  6687 1 1 122 GLY C    C   9.973  -6.621   7.767 1.00 . A A . 122 GLY C    1 1 
        3  6688 1 1 122 GLY CA   C  11.084  -7.429   8.438 1.00 . A A . 122 GLY CA   1 1 
        3  6689 1 1 122 GLY H    H  13.122  -6.975   7.904 1.00 . A A . 122 GLY H    1 1 
        3  6690 1 1 122 GLY HA2  H  10.748  -8.445   8.588 1.00 . A A . 122 GLY HA2  1 1 
        3  6691 1 1 122 GLY HA3  H  11.312  -6.986   9.397 1.00 . A A . 122 GLY HA3  1 1 
        3  6692 1 1 122 GLY N    N  12.319  -7.439   7.594 1.00 . A A . 122 GLY N    1 1 
        3  6693 1 1 122 GLY O    O   8.817  -6.991   7.797 1.00 . A A . 122 GLY O    1 1 
        3  6694 1 1 123 HIS C    C   8.693  -5.428   5.317 1.00 . A A . 123 HIS C    1 1 
        3  6695 1 1 123 HIS CA   C   9.282  -4.674   6.511 1.00 . A A . 123 HIS CA   1 1 
        3  6696 1 1 123 HIS CB   C   9.940  -3.386   6.019 1.00 . A A . 123 HIS CB   1 1 
        3  6697 1 1 123 HIS CD2  C  10.050  -1.143   7.381 1.00 . A A . 123 HIS CD2  1 1 
        3  6698 1 1 123 HIS CE1  C  10.947  -1.918   9.197 1.00 . A A . 123 HIS CE1  1 1 
        3  6699 1 1 123 HIS CG   C  10.237  -2.489   7.189 1.00 . A A . 123 HIS CG   1 1 
        3  6700 1 1 123 HIS H    H  11.250  -5.230   7.170 1.00 . A A . 123 HIS H    1 1 
        3  6701 1 1 123 HIS HA   H   8.497  -4.435   7.213 1.00 . A A . 123 HIS HA   1 1 
        3  6702 1 1 123 HIS HB2  H  10.863  -3.630   5.512 1.00 . A A . 123 HIS HB2  1 1 
        3  6703 1 1 123 HIS HB3  H   9.277  -2.880   5.335 1.00 . A A . 123 HIS HB3  1 1 
        3  6704 1 1 123 HIS HD1  H  11.072  -3.890   8.543 1.00 . A A . 123 HIS HD1  1 1 
        3  6705 1 1 123 HIS HD2  H   9.624  -0.464   6.658 1.00 . A A . 123 HIS HD2  1 1 
        3  6706 1 1 123 HIS HE1  H  11.365  -1.989  10.190 1.00 . A A . 123 HIS HE1  1 1 
        3  6707 1 1 123 HIS N    N  10.314  -5.515   7.174 1.00 . A A . 123 HIS N    1 1 
        3  6708 1 1 123 HIS ND1  N  10.809  -2.964   8.359 1.00 . A A . 123 HIS ND1  1 1 
        3  6709 1 1 123 HIS NE2  N  10.499  -0.785   8.650 1.00 . A A . 123 HIS NE2  1 1 
        3  6710 1 1 123 HIS O    O   7.497  -5.442   5.106 1.00 . A A . 123 HIS O    1 1 
        3  6711 1 1 124 GLU C    C   8.005  -7.845   3.791 1.00 . A A . 124 GLU C    1 1 
        3  6712 1 1 124 GLU CA   C   9.026  -6.797   3.345 1.00 . A A . 124 GLU CA   1 1 
        3  6713 1 1 124 GLU CB   C  10.211  -7.495   2.673 1.00 . A A . 124 GLU CB   1 1 
        3  6714 1 1 124 GLU CD   C  10.941  -8.852   0.708 1.00 . A A . 124 GLU CD   1 1 
        3  6715 1 1 124 GLU CG   C   9.742  -8.199   1.398 1.00 . A A . 124 GLU CG   1 1 
        3  6716 1 1 124 GLU H    H  10.488  -6.022   4.722 1.00 . A A . 124 GLU H    1 1 
        3  6717 1 1 124 GLU HA   H   8.566  -6.111   2.649 1.00 . A A . 124 GLU HA   1 1 
        3  6718 1 1 124 GLU HB2  H  10.963  -6.760   2.425 1.00 . A A . 124 GLU HB2  1 1 
        3  6719 1 1 124 GLU HB3  H  10.628  -8.224   3.351 1.00 . A A . 124 GLU HB3  1 1 
        3  6720 1 1 124 GLU HG2  H   9.015  -8.955   1.653 1.00 . A A . 124 GLU HG2  1 1 
        3  6721 1 1 124 GLU HG3  H   9.294  -7.477   0.731 1.00 . A A . 124 GLU HG3  1 1 
        3  6722 1 1 124 GLU N    N   9.527  -6.051   4.532 1.00 . A A . 124 GLU N    1 1 
        3  6723 1 1 124 GLU O    O   6.916  -7.935   3.258 1.00 . A A . 124 GLU O    1 1 
        3  6724 1 1 124 GLU OE1  O  11.991  -8.923   1.328 1.00 . A A . 124 GLU OE1  1 1 
        3  6725 1 1 124 GLU OE2  O  10.791  -9.269  -0.428 1.00 . A A . 124 GLU OE2  1 1 
        3  6726 1 1 125 GLU C    C   6.225  -8.984   5.967 1.00 . A A . 125 GLU C    1 1 
        3  6727 1 1 125 GLU CA   C   7.398  -9.670   5.263 1.00 . A A . 125 GLU CA   1 1 
        3  6728 1 1 125 GLU CB   C   8.130 -10.578   6.253 1.00 . A A . 125 GLU CB   1 1 
        3  6729 1 1 125 GLU CD   C   7.106 -12.709   5.440 1.00 . A A . 125 GLU CD   1 1 
        3  6730 1 1 125 GLU CG   C   7.242 -11.765   6.635 1.00 . A A . 125 GLU CG   1 1 
        3  6731 1 1 125 GLU H    H   9.226  -8.537   5.190 1.00 . A A . 125 GLU H    1 1 
        3  6732 1 1 125 GLU HA   H   7.034 -10.254   4.430 1.00 . A A . 125 GLU HA   1 1 
        3  6733 1 1 125 GLU HB2  H   9.040 -10.941   5.799 1.00 . A A . 125 GLU HB2  1 1 
        3  6734 1 1 125 GLU HB3  H   8.375 -10.014   7.141 1.00 . A A . 125 GLU HB3  1 1 
        3  6735 1 1 125 GLU HG2  H   7.692 -12.294   7.463 1.00 . A A . 125 GLU HG2  1 1 
        3  6736 1 1 125 GLU HG3  H   6.265 -11.407   6.924 1.00 . A A . 125 GLU HG3  1 1 
        3  6737 1 1 125 GLU N    N   8.345  -8.631   4.772 1.00 . A A . 125 GLU N    1 1 
        3  6738 1 1 125 GLU O    O   5.096  -9.424   5.888 1.00 . A A . 125 GLU O    1 1 
        3  6739 1 1 125 GLU OE1  O   7.783 -12.484   4.451 1.00 . A A . 125 GLU OE1  1 1 
        3  6740 1 1 125 GLU OE2  O   6.329 -13.644   5.536 1.00 . A A . 125 GLU OE2  1 1 
        3  6741 1 1 126 GLY C    C   4.398  -6.629   6.371 1.00 . A A . 126 GLY C    1 1 
        3  6742 1 1 126 GLY CA   C   5.402  -7.194   7.379 1.00 . A A . 126 GLY CA   1 1 
        3  6743 1 1 126 GLY H    H   7.413  -7.579   6.712 1.00 . A A . 126 GLY H    1 1 
        3  6744 1 1 126 GLY HA2  H   4.900  -7.882   8.045 1.00 . A A . 126 GLY HA2  1 1 
        3  6745 1 1 126 GLY HA3  H   5.824  -6.382   7.953 1.00 . A A . 126 GLY HA3  1 1 
        3  6746 1 1 126 GLY N    N   6.492  -7.911   6.660 1.00 . A A . 126 GLY N    1 1 
        3  6747 1 1 126 GLY O    O   3.206  -6.822   6.496 1.00 . A A . 126 GLY O    1 1 
        3  6748 1 1 127 TRP C    C   3.088  -6.475   3.749 1.00 . A A . 127 TRP C    1 1 
        3  6749 1 1 127 TRP CA   C   3.949  -5.362   4.352 1.00 . A A . 127 TRP CA   1 1 
        3  6750 1 1 127 TRP CB   C   4.771  -4.700   3.236 1.00 . A A . 127 TRP CB   1 1 
        3  6751 1 1 127 TRP CD1  C   6.598  -3.040   3.800 1.00 . A A . 127 TRP CD1  1 1 
        3  6752 1 1 127 TRP CD2  C   4.536  -2.188   4.082 1.00 . A A . 127 TRP CD2  1 1 
        3  6753 1 1 127 TRP CE2  C   5.450  -1.166   4.430 1.00 . A A . 127 TRP CE2  1 1 
        3  6754 1 1 127 TRP CE3  C   3.160  -1.907   4.174 1.00 . A A . 127 TRP CE3  1 1 
        3  6755 1 1 127 TRP CG   C   5.289  -3.371   3.688 1.00 . A A . 127 TRP CG   1 1 
        3  6756 1 1 127 TRP CH2  C   3.645   0.353   4.936 1.00 . A A . 127 TRP CH2  1 1 
        3  6757 1 1 127 TRP CZ2  C   5.016   0.092   4.851 1.00 . A A . 127 TRP CZ2  1 1 
        3  6758 1 1 127 TRP CZ3  C   2.719  -0.644   4.597 1.00 . A A . 127 TRP CZ3  1 1 
        3  6759 1 1 127 TRP H    H   5.840  -5.800   5.285 1.00 . A A . 127 TRP H    1 1 
        3  6760 1 1 127 TRP HA   H   3.312  -4.628   4.818 1.00 . A A . 127 TRP HA   1 1 
        3  6761 1 1 127 TRP HB2  H   5.604  -5.338   2.983 1.00 . A A . 127 TRP HB2  1 1 
        3  6762 1 1 127 TRP HB3  H   4.149  -4.562   2.363 1.00 . A A . 127 TRP HB3  1 1 
        3  6763 1 1 127 TRP HD1  H   7.431  -3.689   3.576 1.00 . A A . 127 TRP HD1  1 1 
        3  6764 1 1 127 TRP HE1  H   7.531  -1.251   4.404 1.00 . A A . 127 TRP HE1  1 1 
        3  6765 1 1 127 TRP HE3  H   2.439  -2.667   3.914 1.00 . A A . 127 TRP HE3  1 1 
        3  6766 1 1 127 TRP HH2  H   3.300   1.324   5.260 1.00 . A A . 127 TRP HH2  1 1 
        3  6767 1 1 127 TRP HZ2  H   5.732   0.856   5.111 1.00 . A A . 127 TRP HZ2  1 1 
        3  6768 1 1 127 TRP HZ3  H   1.662  -0.439   4.663 1.00 . A A . 127 TRP HZ3  1 1 
        3  6769 1 1 127 TRP N    N   4.874  -5.939   5.368 1.00 . A A . 127 TRP N    1 1 
        3  6770 1 1 127 TRP NE1  N   6.694  -1.733   4.240 1.00 . A A . 127 TRP NE1  1 1 
        3  6771 1 1 127 TRP O    O   1.910  -6.301   3.515 1.00 . A A . 127 TRP O    1 1 
        3  6772 1 1 128 ALA C    C   1.756  -9.123   3.870 1.00 . A A . 128 ALA C    1 1 
        3  6773 1 1 128 ALA CA   C   2.878  -8.729   2.907 1.00 . A A . 128 ALA CA   1 1 
        3  6774 1 1 128 ALA CB   C   3.804  -9.923   2.682 1.00 . A A . 128 ALA CB   1 1 
        3  6775 1 1 128 ALA H    H   4.618  -7.735   3.690 1.00 . A A . 128 ALA H    1 1 
        3  6776 1 1 128 ALA HA   H   2.454  -8.417   1.963 1.00 . A A . 128 ALA HA   1 1 
        3  6777 1 1 128 ALA HB1  H   4.045 -10.375   3.632 1.00 . A A . 128 ALA HB1  1 1 
        3  6778 1 1 128 ALA HB2  H   4.713  -9.585   2.206 1.00 . A A . 128 ALA HB2  1 1 
        3  6779 1 1 128 ALA HB3  H   3.313 -10.647   2.051 1.00 . A A . 128 ALA HB3  1 1 
        3  6780 1 1 128 ALA N    N   3.665  -7.614   3.497 1.00 . A A . 128 ALA N    1 1 
        3  6781 1 1 128 ALA O    O   0.652  -9.429   3.465 1.00 . A A . 128 ALA O    1 1 
        3  6782 1 1 129 HIS C    C  -0.060  -8.368   6.222 1.00 . A A . 129 HIS C    1 1 
        3  6783 1 1 129 HIS CA   C   0.991  -9.480   6.142 1.00 . A A . 129 HIS CA   1 1 
        3  6784 1 1 129 HIS CB   C   1.656  -9.643   7.507 1.00 . A A . 129 HIS CB   1 1 
        3  6785 1 1 129 HIS CD2  C   0.035  -9.247   9.534 1.00 . A A . 129 HIS CD2  1 1 
        3  6786 1 1 129 HIS CE1  C  -0.809 -11.239   9.657 1.00 . A A . 129 HIS CE1  1 1 
        3  6787 1 1 129 HIS CG   C   0.623  -9.991   8.541 1.00 . A A . 129 HIS CG   1 1 
        3  6788 1 1 129 HIS H    H   2.929  -8.863   5.446 1.00 . A A . 129 HIS H    1 1 
        3  6789 1 1 129 HIS HA   H   0.519 -10.408   5.855 1.00 . A A . 129 HIS HA   1 1 
        3  6790 1 1 129 HIS HB2  H   2.393 -10.431   7.455 1.00 . A A . 129 HIS HB2  1 1 
        3  6791 1 1 129 HIS HB3  H   2.139  -8.716   7.782 1.00 . A A . 129 HIS HB3  1 1 
        3  6792 1 1 129 HIS HD1  H   0.280 -12.027   8.068 1.00 . A A . 129 HIS HD1  1 1 
        3  6793 1 1 129 HIS HD2  H   0.243  -8.207   9.738 1.00 . A A . 129 HIS HD2  1 1 
        3  6794 1 1 129 HIS HE1  H  -1.394 -12.092   9.968 1.00 . A A . 129 HIS HE1  1 1 
        3  6795 1 1 129 HIS N    N   2.032  -9.116   5.144 1.00 . A A . 129 HIS N    1 1 
        3  6796 1 1 129 HIS ND1  N   0.069 -11.257   8.637 1.00 . A A . 129 HIS ND1  1 1 
        3  6797 1 1 129 HIS NE2  N  -0.868 -10.038  10.237 1.00 . A A . 129 HIS NE2  1 1 
        3  6798 1 1 129 HIS O    O  -1.246  -8.607   6.125 1.00 . A A . 129 HIS O    1 1 
        3  6799 1 1 130 TYR C    C  -1.336  -5.858   5.191 1.00 . A A . 130 TYR C    1 1 
        3  6800 1 1 130 TYR CA   C  -0.566  -6.008   6.505 1.00 . A A . 130 TYR CA   1 1 
        3  6801 1 1 130 TYR CB   C   0.219  -4.725   6.789 1.00 . A A . 130 TYR CB   1 1 
        3  6802 1 1 130 TYR CD1  C   0.310  -5.088   9.294 1.00 . A A . 130 TYR CD1  1 1 
        3  6803 1 1 130 TYR CD2  C   2.392  -4.782   8.085 1.00 . A A . 130 TYR CD2  1 1 
        3  6804 1 1 130 TYR CE1  C   1.027  -5.222  10.489 1.00 . A A . 130 TYR CE1  1 1 
        3  6805 1 1 130 TYR CE2  C   3.107  -4.918   9.281 1.00 . A A . 130 TYR CE2  1 1 
        3  6806 1 1 130 TYR CG   C   0.992  -4.869   8.087 1.00 . A A . 130 TYR CG   1 1 
        3  6807 1 1 130 TYR CZ   C   2.424  -5.139  10.483 1.00 . A A . 130 TYR CZ   1 1 
        3  6808 1 1 130 TYR H    H   1.345  -6.994   6.482 1.00 . A A . 130 TYR H    1 1 
        3  6809 1 1 130 TYR HA   H  -1.264  -6.192   7.306 1.00 . A A . 130 TYR HA   1 1 
        3  6810 1 1 130 TYR HB2  H   0.906  -4.542   5.975 1.00 . A A . 130 TYR HB2  1 1 
        3  6811 1 1 130 TYR HB3  H  -0.466  -3.897   6.872 1.00 . A A . 130 TYR HB3  1 1 
        3  6812 1 1 130 TYR HD1  H  -0.767  -5.151   9.304 1.00 . A A . 130 TYR HD1  1 1 
        3  6813 1 1 130 TYR HD2  H   2.922  -4.608   7.160 1.00 . A A . 130 TYR HD2  1 1 
        3  6814 1 1 130 TYR HE1  H   0.501  -5.392  11.416 1.00 . A A . 130 TYR HE1  1 1 
        3  6815 1 1 130 TYR HE2  H   4.185  -4.852   9.278 1.00 . A A . 130 TYR HE2  1 1 
        3  6816 1 1 130 TYR HH   H   2.622  -5.842  12.246 1.00 . A A . 130 TYR HH   1 1 
        3  6817 1 1 130 TYR N    N   0.382  -7.153   6.403 1.00 . A A . 130 TYR N    1 1 
        3  6818 1 1 130 TYR O    O  -2.515  -5.562   5.181 1.00 . A A . 130 TYR O    1 1 
        3  6819 1 1 130 TYR OH   O   3.127  -5.273  11.662 1.00 . A A . 130 TYR OH   1 1 
        3  6820 1 1 131 LEU C    C  -2.493  -6.976   2.714 1.00 . A A . 131 LEU C    1 1 
        3  6821 1 1 131 LEU CA   C  -1.372  -5.940   2.772 1.00 . A A . 131 LEU CA   1 1 
        3  6822 1 1 131 LEU CB   C  -0.364  -6.207   1.646 1.00 . A A . 131 LEU CB   1 1 
        3  6823 1 1 131 LEU CD1  C   1.761  -5.359   0.626 1.00 . A A . 131 LEU CD1  1 1 
        3  6824 1 1 131 LEU CD2  C  -0.282  -3.925   0.550 1.00 . A A . 131 LEU CD2  1 1 
        3  6825 1 1 131 LEU CG   C   0.496  -4.955   1.389 1.00 . A A . 131 LEU CG   1 1 
        3  6826 1 1 131 LEU H    H   0.267  -6.307   4.116 1.00 . A A . 131 LEU H    1 1 
        3  6827 1 1 131 LEU HA   H  -1.788  -4.952   2.673 1.00 . A A . 131 LEU HA   1 1 
        3  6828 1 1 131 LEU HB2  H   0.278  -7.026   1.940 1.00 . A A . 131 LEU HB2  1 1 
        3  6829 1 1 131 LEU HB3  H  -0.891  -6.476   0.745 1.00 . A A . 131 LEU HB3  1 1 
        3  6830 1 1 131 LEU HD11 H   2.363  -4.482   0.439 1.00 . A A . 131 LEU HD11 1 1 
        3  6831 1 1 131 LEU HD12 H   1.485  -5.813  -0.314 1.00 . A A . 131 LEU HD12 1 1 
        3  6832 1 1 131 LEU HD13 H   2.329  -6.064   1.214 1.00 . A A . 131 LEU HD13 1 1 
        3  6833 1 1 131 LEU HD21 H   0.408  -3.202   0.140 1.00 . A A . 131 LEU HD21 1 1 
        3  6834 1 1 131 LEU HD22 H  -1.001  -3.414   1.172 1.00 . A A . 131 LEU HD22 1 1 
        3  6835 1 1 131 LEU HD23 H  -0.797  -4.422  -0.257 1.00 . A A . 131 LEU HD23 1 1 
        3  6836 1 1 131 LEU HG   H   0.775  -4.513   2.337 1.00 . A A . 131 LEU HG   1 1 
        3  6837 1 1 131 LEU N    N  -0.681  -6.065   4.085 1.00 . A A . 131 LEU N    1 1 
        3  6838 1 1 131 LEU O    O  -3.570  -6.719   2.217 1.00 . A A . 131 LEU O    1 1 
        3  6839 1 1 132 GLY C    C  -4.516  -8.730   3.963 1.00 . A A . 132 GLY C    1 1 
        3  6840 1 1 132 GLY CA   C  -3.285  -9.210   3.188 1.00 . A A . 132 GLY CA   1 1 
        3  6841 1 1 132 GLY H    H  -1.363  -8.338   3.609 1.00 . A A . 132 GLY H    1 1 
        3  6842 1 1 132 GLY HA2  H  -3.557  -9.416   2.163 1.00 . A A . 132 GLY HA2  1 1 
        3  6843 1 1 132 GLY HA3  H  -2.900 -10.107   3.649 1.00 . A A . 132 GLY HA3  1 1 
        3  6844 1 1 132 GLY N    N  -2.241  -8.151   3.215 1.00 . A A . 132 GLY N    1 1 
        3  6845 1 1 132 GLY O    O  -5.638  -8.940   3.551 1.00 . A A . 132 GLY O    1 1 
        3  6846 1 1 133 ARG C    C  -6.235  -6.536   5.064 1.00 . A A . 133 ARG C    1 1 
        3  6847 1 1 133 ARG CA   C  -5.473  -7.586   5.876 1.00 . A A . 133 ARG CA   1 1 
        3  6848 1 1 133 ARG CB   C  -4.960  -6.949   7.184 1.00 . A A . 133 ARG CB   1 1 
        3  6849 1 1 133 ARG CD   C  -3.496  -8.829   7.956 1.00 . A A . 133 ARG CD   1 1 
        3  6850 1 1 133 ARG CG   C  -4.750  -8.016   8.266 1.00 . A A . 133 ARG CG   1 1 
        3  6851 1 1 133 ARG CZ   C  -3.980 -10.972   8.982 1.00 . A A . 133 ARG CZ   1 1 
        3  6852 1 1 133 ARG H    H  -3.397  -7.922   5.393 1.00 . A A . 133 ARG H    1 1 
        3  6853 1 1 133 ARG HA   H  -6.133  -8.409   6.101 1.00 . A A . 133 ARG HA   1 1 
        3  6854 1 1 133 ARG HB2  H  -4.019  -6.453   6.988 1.00 . A A . 133 ARG HB2  1 1 
        3  6855 1 1 133 ARG HB3  H  -5.675  -6.221   7.538 1.00 . A A . 133 ARG HB3  1 1 
        3  6856 1 1 133 ARG HD2  H  -3.602  -9.314   6.997 1.00 . A A . 133 ARG HD2  1 1 
        3  6857 1 1 133 ARG HD3  H  -2.642  -8.170   7.935 1.00 . A A . 133 ARG HD3  1 1 
        3  6858 1 1 133 ARG HE   H  -2.654  -9.700   9.732 1.00 . A A . 133 ARG HE   1 1 
        3  6859 1 1 133 ARG HG2  H  -4.628  -7.527   9.221 1.00 . A A . 133 ARG HG2  1 1 
        3  6860 1 1 133 ARG HG3  H  -5.605  -8.674   8.309 1.00 . A A . 133 ARG HG3  1 1 
        3  6861 1 1 133 ARG HH11 H  -4.992 -10.498   7.318 1.00 . A A . 133 ARG HH11 1 1 
        3  6862 1 1 133 ARG HH12 H  -5.366 -12.043   8.010 1.00 . A A . 133 ARG HH12 1 1 
        3  6863 1 1 133 ARG HH21 H  -3.131 -11.704  10.637 1.00 . A A . 133 ARG HH21 1 1 
        3  6864 1 1 133 ARG HH22 H  -4.313 -12.724   9.888 1.00 . A A . 133 ARG HH22 1 1 
        3  6865 1 1 133 ARG N    N  -4.312  -8.085   5.079 1.00 . A A . 133 ARG N    1 1 
        3  6866 1 1 133 ARG NE   N  -3.299  -9.857   9.013 1.00 . A A . 133 ARG NE   1 1 
        3  6867 1 1 133 ARG NH1  N  -4.847 -11.187   8.028 1.00 . A A . 133 ARG NH1  1 1 
        3  6868 1 1 133 ARG NH2  N  -3.794 -11.869   9.906 1.00 . A A . 133 ARG NH2  1 1 
        3  6869 1 1 133 ARG O    O  -7.447  -6.494   5.068 1.00 . A A . 133 ARG O    1 1 
        3  6870 1 1 134 LEU C    C  -7.084  -5.283   2.507 1.00 . A A . 134 LEU C    1 1 
        3  6871 1 1 134 LEU CA   C  -6.215  -4.629   3.584 1.00 . A A . 134 LEU CA   1 1 
        3  6872 1 1 134 LEU CB   C  -5.158  -3.735   2.925 1.00 . A A . 134 LEU CB   1 1 
        3  6873 1 1 134 LEU CD1  C  -6.736  -1.767   2.995 1.00 . A A . 134 LEU CD1  1 1 
        3  6874 1 1 134 LEU CD2  C  -4.748  -1.755   1.459 1.00 . A A . 134 LEU CD2  1 1 
        3  6875 1 1 134 LEU CG   C  -5.832  -2.630   2.099 1.00 . A A . 134 LEU CG   1 1 
        3  6876 1 1 134 LEU H    H  -4.554  -5.727   4.397 1.00 . A A . 134 LEU H    1 1 
        3  6877 1 1 134 LEU HA   H  -6.834  -4.038   4.239 1.00 . A A . 134 LEU HA   1 1 
        3  6878 1 1 134 LEU HB2  H  -4.544  -3.287   3.692 1.00 . A A . 134 LEU HB2  1 1 
        3  6879 1 1 134 LEU HB3  H  -4.537  -4.337   2.277 1.00 . A A . 134 LEU HB3  1 1 
        3  6880 1 1 134 LEU HD11 H  -6.857  -0.788   2.557 1.00 . A A . 134 LEU HD11 1 1 
        3  6881 1 1 134 LEU HD12 H  -6.293  -1.668   3.977 1.00 . A A . 134 LEU HD12 1 1 
        3  6882 1 1 134 LEU HD13 H  -7.706  -2.238   3.086 1.00 . A A . 134 LEU HD13 1 1 
        3  6883 1 1 134 LEU HD21 H  -4.176  -1.266   2.233 1.00 . A A . 134 LEU HD21 1 1 
        3  6884 1 1 134 LEU HD22 H  -5.212  -1.011   0.828 1.00 . A A . 134 LEU HD22 1 1 
        3  6885 1 1 134 LEU HD23 H  -4.092  -2.373   0.864 1.00 . A A . 134 LEU HD23 1 1 
        3  6886 1 1 134 LEU HG   H  -6.431  -3.081   1.321 1.00 . A A . 134 LEU HG   1 1 
        3  6887 1 1 134 LEU N    N  -5.532  -5.683   4.380 1.00 . A A . 134 LEU N    1 1 
        3  6888 1 1 134 LEU O    O  -8.184  -4.847   2.231 1.00 . A A . 134 LEU O    1 1 
        3  6889 1 1 135 THR C    C  -8.683  -7.550   1.398 1.00 . A A . 135 THR C    1 1 
        3  6890 1 1 135 THR CA   C  -7.372  -7.004   0.824 1.00 . A A . 135 THR CA   1 1 
        3  6891 1 1 135 THR CB   C  -6.540  -8.154   0.259 1.00 . A A . 135 THR CB   1 1 
        3  6892 1 1 135 THR CG2  C  -7.354  -8.909  -0.789 1.00 . A A . 135 THR CG2  1 1 
        3  6893 1 1 135 THR H    H  -5.699  -6.646   2.128 1.00 . A A . 135 THR H    1 1 
        3  6894 1 1 135 THR HA   H  -7.591  -6.300   0.035 1.00 . A A . 135 THR HA   1 1 
        3  6895 1 1 135 THR HB   H  -6.272  -8.830   1.057 1.00 . A A . 135 THR HB   1 1 
        3  6896 1 1 135 THR HG1  H  -5.601  -6.854  -0.844 1.00 . A A . 135 THR HG1  1 1 
        3  6897 1 1 135 THR HG21 H  -8.118  -9.495  -0.298 1.00 . A A . 135 THR HG21 1 1 
        3  6898 1 1 135 THR HG22 H  -6.703  -9.563  -1.347 1.00 . A A . 135 THR HG22 1 1 
        3  6899 1 1 135 THR HG23 H  -7.819  -8.202  -1.461 1.00 . A A . 135 THR HG23 1 1 
        3  6900 1 1 135 THR N    N  -6.592  -6.318   1.892 1.00 . A A . 135 THR N    1 1 
        3  6901 1 1 135 THR O    O  -9.728  -7.447   0.788 1.00 . A A . 135 THR O    1 1 
        3  6902 1 1 135 THR OG1  O  -5.359  -7.633  -0.338 1.00 . A A . 135 THR OG1  1 1 
        3  6903 1 1 136 GLU C    C -10.884  -7.574   3.431 1.00 . A A . 136 GLU C    1 1 
        3  6904 1 1 136 GLU CA   C  -9.880  -8.703   3.162 1.00 . A A . 136 GLU CA   1 1 
        3  6905 1 1 136 GLU CB   C  -9.532  -9.407   4.476 1.00 . A A . 136 GLU CB   1 1 
        3  6906 1 1 136 GLU CD   C  -8.307 -11.340   5.492 1.00 . A A . 136 GLU CD   1 1 
        3  6907 1 1 136 GLU CG   C  -8.695 -10.656   4.180 1.00 . A A . 136 GLU CG   1 1 
        3  6908 1 1 136 GLU H    H  -7.783  -8.223   3.034 1.00 . A A . 136 GLU H    1 1 
        3  6909 1 1 136 GLU HA   H -10.316  -9.416   2.480 1.00 . A A . 136 GLU HA   1 1 
        3  6910 1 1 136 GLU HB2  H  -8.964  -8.734   5.105 1.00 . A A . 136 GLU HB2  1 1 
        3  6911 1 1 136 GLU HB3  H -10.439  -9.695   4.983 1.00 . A A . 136 GLU HB3  1 1 
        3  6912 1 1 136 GLU HG2  H  -9.272 -11.340   3.575 1.00 . A A . 136 GLU HG2  1 1 
        3  6913 1 1 136 GLU HG3  H  -7.799 -10.371   3.647 1.00 . A A . 136 GLU HG3  1 1 
        3  6914 1 1 136 GLU N    N  -8.637  -8.141   2.560 1.00 . A A . 136 GLU N    1 1 
        3  6915 1 1 136 GLU O    O -12.078  -7.755   3.311 1.00 . A A . 136 GLU O    1 1 
        3  6916 1 1 136 GLU OE1  O  -8.782 -10.906   6.528 1.00 . A A . 136 GLU OE1  1 1 
        3  6917 1 1 136 GLU OE2  O  -7.546 -12.292   5.439 1.00 . A A . 136 GLU OE2  1 1 
        3  6918 1 1 137 VAL C    C -12.060  -4.878   2.771 1.00 . A A . 137 VAL C    1 1 
        3  6919 1 1 137 VAL CA   C -11.338  -5.275   4.063 1.00 . A A . 137 VAL CA   1 1 
        3  6920 1 1 137 VAL CB   C -10.531  -4.077   4.582 1.00 . A A . 137 VAL CB   1 1 
        3  6921 1 1 137 VAL CG1  C -11.431  -2.840   4.668 1.00 . A A . 137 VAL CG1  1 1 
        3  6922 1 1 137 VAL CG2  C  -9.966  -4.394   5.971 1.00 . A A . 137 VAL CG2  1 1 
        3  6923 1 1 137 VAL H    H  -9.443  -6.286   3.881 1.00 . A A . 137 VAL H    1 1 
        3  6924 1 1 137 VAL HA   H -12.065  -5.571   4.805 1.00 . A A . 137 VAL HA   1 1 
        3  6925 1 1 137 VAL HB   H  -9.716  -3.877   3.900 1.00 . A A . 137 VAL HB   1 1 
        3  6926 1 1 137 VAL HG11 H -10.947  -2.085   5.268 1.00 . A A . 137 VAL HG11 1 1 
        3  6927 1 1 137 VAL HG12 H -12.373  -3.111   5.121 1.00 . A A . 137 VAL HG12 1 1 
        3  6928 1 1 137 VAL HG13 H -11.606  -2.454   3.676 1.00 . A A . 137 VAL HG13 1 1 
        3  6929 1 1 137 VAL HG21 H  -9.118  -5.054   5.870 1.00 . A A . 137 VAL HG21 1 1 
        3  6930 1 1 137 VAL HG22 H -10.724  -4.874   6.571 1.00 . A A . 137 VAL HG22 1 1 
        3  6931 1 1 137 VAL HG23 H  -9.654  -3.479   6.451 1.00 . A A . 137 VAL HG23 1 1 
        3  6932 1 1 137 VAL N    N -10.409  -6.412   3.791 1.00 . A A . 137 VAL N    1 1 
        3  6933 1 1 137 VAL O    O -13.249  -4.625   2.763 1.00 . A A . 137 VAL O    1 1 
        3  6934 1 1 138 ALA C    C -13.047  -5.415  -0.004 1.00 . A A . 138 ALA C    1 1 
        3  6935 1 1 138 ALA CA   C -11.977  -4.396   0.395 1.00 . A A . 138 ALA CA   1 1 
        3  6936 1 1 138 ALA CB   C -10.906  -4.331  -0.690 1.00 . A A . 138 ALA CB   1 1 
        3  6937 1 1 138 ALA H    H -10.385  -4.992   1.715 1.00 . A A . 138 ALA H    1 1 
        3  6938 1 1 138 ALA HA   H -12.434  -3.424   0.507 1.00 . A A . 138 ALA HA   1 1 
        3  6939 1 1 138 ALA HB1  H -10.308  -5.231  -0.660 1.00 . A A . 138 ALA HB1  1 1 
        3  6940 1 1 138 ALA HB2  H -10.273  -3.474  -0.518 1.00 . A A . 138 ALA HB2  1 1 
        3  6941 1 1 138 ALA HB3  H -11.377  -4.244  -1.657 1.00 . A A . 138 ALA HB3  1 1 
        3  6942 1 1 138 ALA N    N -11.345  -4.799   1.683 1.00 . A A . 138 ALA N    1 1 
        3  6943 1 1 138 ALA O    O -14.087  -5.060  -0.520 1.00 . A A . 138 ALA O    1 1 
        3  6944 1 1 139 ALA C    C -14.339  -8.364   1.154 1.00 . A A . 139 ALA C    1 1 
        3  6945 1 1 139 ALA CA   C -13.787  -7.738  -0.131 1.00 . A A . 139 ALA CA   1 1 
        3  6946 1 1 139 ALA CB   C -13.093  -8.812  -0.977 1.00 . A A . 139 ALA CB   1 1 
        3  6947 1 1 139 ALA H    H -11.945  -6.934   0.646 1.00 . A A . 139 ALA H    1 1 
        3  6948 1 1 139 ALA HA   H -14.605  -7.312  -0.698 1.00 . A A . 139 ALA HA   1 1 
        3  6949 1 1 139 ALA HB1  H -12.440  -9.402  -0.352 1.00 . A A . 139 ALA HB1  1 1 
        3  6950 1 1 139 ALA HB2  H -12.515  -8.336  -1.756 1.00 . A A . 139 ALA HB2  1 1 
        3  6951 1 1 139 ALA HB3  H -13.837  -9.454  -1.425 1.00 . A A . 139 ALA HB3  1 1 
        3  6952 1 1 139 ALA N    N -12.795  -6.678   0.229 1.00 . A A . 139 ALA N    1 1 
        3  6953 1 1 139 ALA O    O -14.835  -9.472   1.150 1.00 . A A . 139 ALA O    1 1 
        3  6954 1 1 140 GLY C    C -14.666  -7.174   4.639 1.00 . A A . 140 GLY C    1 1 
        3  6955 1 1 140 GLY CA   C -14.776  -8.222   3.531 1.00 . A A . 140 GLY CA   1 1 
        3  6956 1 1 140 GLY H    H -13.854  -6.773   2.249 1.00 . A A . 140 GLY H    1 1 
        3  6957 1 1 140 GLY HA2  H -15.812  -8.502   3.400 1.00 . A A . 140 GLY HA2  1 1 
        3  6958 1 1 140 GLY HA3  H -14.198  -9.091   3.802 1.00 . A A . 140 GLY HA3  1 1 
        3  6959 1 1 140 GLY N    N -14.257  -7.663   2.257 1.00 . A A . 140 GLY N    1 1 
        3  6960 1 1 140 GLY O    O -14.442  -6.006   4.389 1.00 . A A . 140 GLY O    1 1 
        3  6961 1 1 141 ARG C    C -14.094  -7.336   8.221 1.00 . A A . 141 ARG C    1 1 
        3  6962 1 1 141 ARG CA   C -14.743  -6.641   7.020 1.00 . A A . 141 ARG CA   1 1 
        3  6963 1 1 141 ARG CB   C -16.148  -6.170   7.403 1.00 . A A . 141 ARG CB   1 1 
        3  6964 1 1 141 ARG CD   C -18.079  -4.735   6.705 1.00 . A A . 141 ARG CD   1 1 
        3  6965 1 1 141 ARG CG   C -16.677  -5.221   6.325 1.00 . A A . 141 ARG CG   1 1 
        3  6966 1 1 141 ARG CZ   C -20.295  -5.696   6.933 1.00 . A A . 141 ARG CZ   1 1 
        3  6967 1 1 141 ARG H    H -15.005  -8.536   6.027 1.00 . A A . 141 ARG H    1 1 
        3  6968 1 1 141 ARG HA   H -14.144  -5.785   6.740 1.00 . A A . 141 ARG HA   1 1 
        3  6969 1 1 141 ARG HB2  H -16.803  -7.027   7.484 1.00 . A A . 141 ARG HB2  1 1 
        3  6970 1 1 141 ARG HB3  H -16.109  -5.653   8.348 1.00 . A A . 141 ARG HB3  1 1 
        3  6971 1 1 141 ARG HD2  H -18.064  -4.345   7.713 1.00 . A A . 141 ARG HD2  1 1 
        3  6972 1 1 141 ARG HD3  H -18.385  -3.957   6.023 1.00 . A A . 141 ARG HD3  1 1 
        3  6973 1 1 141 ARG HE   H -18.723  -6.756   6.341 1.00 . A A . 141 ARG HE   1 1 
        3  6974 1 1 141 ARG HG2  H -16.012  -4.376   6.235 1.00 . A A . 141 ARG HG2  1 1 
        3  6975 1 1 141 ARG HG3  H -16.725  -5.744   5.380 1.00 . A A . 141 ARG HG3  1 1 
        3  6976 1 1 141 ARG HH11 H -20.084  -3.752   7.368 1.00 . A A . 141 ARG HH11 1 1 
        3  6977 1 1 141 ARG HH12 H -21.683  -4.391   7.547 1.00 . A A . 141 ARG HH12 1 1 
        3  6978 1 1 141 ARG HH21 H -20.802  -7.597   6.570 1.00 . A A . 141 ARG HH21 1 1 
        3  6979 1 1 141 ARG HH22 H -22.090  -6.566   7.097 1.00 . A A . 141 ARG HH22 1 1 
        3  6980 1 1 141 ARG N    N -14.827  -7.590   5.866 1.00 . A A . 141 ARG N    1 1 
        3  6981 1 1 141 ARG NE   N -19.036  -5.871   6.626 1.00 . A A . 141 ARG NE   1 1 
        3  6982 1 1 141 ARG NH1  N -20.720  -4.521   7.311 1.00 . A A . 141 ARG NH1  1 1 
        3  6983 1 1 141 ARG NH2  N -21.128  -6.698   6.860 1.00 . A A . 141 ARG NH2  1 1 
        3  6984 1 1 141 ARG O    O -14.023  -8.546   8.286 1.00 . A A . 141 ARG O    1 1 
        3  6985 1 1 142 ASP C    C -12.050  -8.315   9.979 1.00 . A A . 142 ASP C    1 1 
        3  6986 1 1 142 ASP CA   C -12.955  -7.145  10.376 1.00 . A A . 142 ASP CA   1 1 
        3  6987 1 1 142 ASP CB   C -14.016  -7.622  11.379 1.00 . A A . 142 ASP CB   1 1 
        3  6988 1 1 142 ASP CG   C -15.038  -8.517  10.676 1.00 . A A . 142 ASP CG   1 1 
        3  6989 1 1 142 ASP H    H -13.684  -5.592   9.074 1.00 . A A . 142 ASP H    1 1 
        3  6990 1 1 142 ASP HA   H -12.350  -6.380  10.843 1.00 . A A . 142 ASP HA   1 1 
        3  6991 1 1 142 ASP HB2  H -13.534  -8.180  12.169 1.00 . A A . 142 ASP HB2  1 1 
        3  6992 1 1 142 ASP HB3  H -14.521  -6.765  11.801 1.00 . A A . 142 ASP HB3  1 1 
        3  6993 1 1 142 ASP N    N -13.614  -6.565   9.165 1.00 . A A . 142 ASP N    1 1 
        3  6994 1 1 142 ASP O    O -12.326  -9.456  10.296 1.00 . A A . 142 ASP O    1 1 
        3  6995 1 1 142 ASP OD1  O -15.968  -7.978  10.099 1.00 . A A . 142 ASP OD1  1 1 
        3  6996 1 1 142 ASP OD2  O -14.874  -9.725  10.732 1.00 . A A . 142 ASP OD2  1 1 
        3  6997 1 1 143 PRO C    C  -9.511  -9.906  10.051 1.00 . A A . 143 PRO C    1 1 
        3  6998 1 1 143 PRO CA   C  -9.994  -9.070   8.866 1.00 . A A . 143 PRO CA   1 1 
        3  6999 1 1 143 PRO CB   C  -8.834  -8.259   8.258 1.00 . A A . 143 PRO CB   1 1 
        3  7000 1 1 143 PRO CD   C -10.553  -6.684   8.876 1.00 . A A . 143 PRO CD   1 1 
        3  7001 1 1 143 PRO CG   C  -9.447  -6.957   7.856 1.00 . A A . 143 PRO CG   1 1 
        3  7002 1 1 143 PRO HA   H -10.432  -9.707   8.113 1.00 . A A . 143 PRO HA   1 1 
        3  7003 1 1 143 PRO HB2  H  -8.054  -8.096   8.994 1.00 . A A . 143 PRO HB2  1 1 
        3  7004 1 1 143 PRO HB3  H  -8.430  -8.762   7.393 1.00 . A A . 143 PRO HB3  1 1 
        3  7005 1 1 143 PRO HD2  H -10.166  -6.119   9.714 1.00 . A A . 143 PRO HD2  1 1 
        3  7006 1 1 143 PRO HD3  H -11.379  -6.166   8.415 1.00 . A A . 143 PRO HD3  1 1 
        3  7007 1 1 143 PRO HG2  H  -8.704  -6.170   7.885 1.00 . A A . 143 PRO HG2  1 1 
        3  7008 1 1 143 PRO HG3  H  -9.874  -7.034   6.868 1.00 . A A . 143 PRO HG3  1 1 
        3  7009 1 1 143 PRO N    N -10.968  -8.029   9.301 1.00 . A A . 143 PRO N    1 1 
        3  7010 1 1 143 PRO O    O  -9.314 -11.100   9.948 1.00 . A A . 143 PRO O    1 1 
        3  7011 1 1 144 GLY C    C  -8.094  -9.079  13.320 1.00 . A A . 144 GLY C    1 1 
        3  7012 1 1 144 GLY CA   C  -8.846 -10.029  12.378 1.00 . A A . 144 GLY CA   1 1 
        3  7013 1 1 144 GLY H    H  -9.482  -8.316  11.243 1.00 . A A . 144 GLY H    1 1 
        3  7014 1 1 144 GLY HA2  H  -9.702 -10.449  12.894 1.00 . A A . 144 GLY HA2  1 1 
        3  7015 1 1 144 GLY HA3  H  -8.191 -10.822  12.063 1.00 . A A . 144 GLY HA3  1 1 
        3  7016 1 1 144 GLY N    N  -9.317  -9.281  11.182 1.00 . A A . 144 GLY N    1 1 
        3  7017 1 1 144 GLY O    O  -8.253  -7.875  13.251 1.00 . A A . 144 GLY O    1 1 
        3  7018 1 1 145 PRO C    C  -5.256  -8.179  14.569 1.00 . A A . 145 PRO C    1 1 
        3  7019 1 1 145 PRO CA   C  -6.508  -8.808  15.187 1.00 . A A . 145 PRO CA   1 1 
        3  7020 1 1 145 PRO CB   C  -6.133  -9.830  16.272 1.00 . A A . 145 PRO CB   1 1 
        3  7021 1 1 145 PRO CD   C  -7.028 -11.061  14.360 1.00 . A A . 145 PRO CD   1 1 
        3  7022 1 1 145 PRO CG   C  -6.075 -11.153  15.565 1.00 . A A . 145 PRO CG   1 1 
        3  7023 1 1 145 PRO HA   H  -7.133  -8.043  15.616 1.00 . A A . 145 PRO HA   1 1 
        3  7024 1 1 145 PRO HB2  H  -5.169  -9.588  16.706 1.00 . A A . 145 PRO HB2  1 1 
        3  7025 1 1 145 PRO HB3  H  -6.892  -9.856  17.041 1.00 . A A . 145 PRO HB3  1 1 
        3  7026 1 1 145 PRO HD2  H  -6.550 -11.460  13.476 1.00 . A A . 145 PRO HD2  1 1 
        3  7027 1 1 145 PRO HD3  H  -7.953 -11.584  14.558 1.00 . A A . 145 PRO HD3  1 1 
        3  7028 1 1 145 PRO HG2  H  -5.063 -11.347  15.226 1.00 . A A . 145 PRO HG2  1 1 
        3  7029 1 1 145 PRO HG3  H  -6.397 -11.946  16.224 1.00 . A A . 145 PRO HG3  1 1 
        3  7030 1 1 145 PRO N    N  -7.287  -9.617  14.204 1.00 . A A . 145 PRO N    1 1 
        3  7031 1 1 145 PRO O    O  -5.120  -8.103  13.364 1.00 . A A . 145 PRO O    1 1 
        3  7032 1 1 146 ASP C    C  -1.862  -7.825  15.482 1.00 . A A . 146 ASP C    1 1 
        3  7033 1 1 146 ASP CA   C  -3.078  -7.099  14.879 1.00 . A A . 146 ASP CA   1 1 
        3  7034 1 1 146 ASP CB   C  -3.050  -5.617  15.277 1.00 . A A . 146 ASP CB   1 1 
        3  7035 1 1 146 ASP CG   C  -3.468  -5.453  16.740 1.00 . A A . 146 ASP CG   1 1 
        3  7036 1 1 146 ASP H    H  -4.478  -7.805  16.363 1.00 . A A . 146 ASP H    1 1 
        3  7037 1 1 146 ASP HA   H  -3.039  -7.173  13.802 1.00 . A A . 146 ASP HA   1 1 
        3  7038 1 1 146 ASP HB2  H  -2.050  -5.230  15.145 1.00 . A A . 146 ASP HB2  1 1 
        3  7039 1 1 146 ASP HB3  H  -3.733  -5.066  14.648 1.00 . A A . 146 ASP HB3  1 1 
        3  7040 1 1 146 ASP N    N  -4.339  -7.727  15.395 1.00 . A A . 146 ASP N    1 1 
        3  7041 1 1 146 ASP O    O  -1.284  -7.375  16.451 1.00 . A A . 146 ASP O    1 1 
        3  7042 1 1 146 ASP OD1  O  -3.265  -6.381  17.504 1.00 . A A . 146 ASP OD1  1 1 
        3  7043 1 1 146 ASP OD2  O  -3.983  -4.396  17.071 1.00 . A A . 146 ASP OD2  1 1 
        3  7044 1 1 147 PRO C    C   1.008  -8.980  15.257 1.00 . A A . 147 PRO C    1 1 
        3  7045 1 1 147 PRO CA   C  -0.312  -9.750  15.381 1.00 . A A . 147 PRO CA   1 1 
        3  7046 1 1 147 PRO CB   C  -0.300 -11.000  14.469 1.00 . A A . 147 PRO CB   1 1 
        3  7047 1 1 147 PRO CD   C  -2.116  -9.568  13.735 1.00 . A A . 147 PRO CD   1 1 
        3  7048 1 1 147 PRO CG   C  -1.632 -11.017  13.783 1.00 . A A . 147 PRO CG   1 1 
        3  7049 1 1 147 PRO HA   H  -0.466 -10.051  16.405 1.00 . A A . 147 PRO HA   1 1 
        3  7050 1 1 147 PRO HB2  H   0.499 -10.928  13.736 1.00 . A A . 147 PRO HB2  1 1 
        3  7051 1 1 147 PRO HB3  H  -0.175 -11.897  15.061 1.00 . A A . 147 PRO HB3  1 1 
        3  7052 1 1 147 PRO HD2  H  -1.790  -9.087  12.822 1.00 . A A . 147 PRO HD2  1 1 
        3  7053 1 1 147 PRO HD3  H  -3.188  -9.523  13.826 1.00 . A A . 147 PRO HD3  1 1 
        3  7054 1 1 147 PRO HG2  H  -1.530 -11.411  12.778 1.00 . A A . 147 PRO HG2  1 1 
        3  7055 1 1 147 PRO HG3  H  -2.335 -11.616  14.344 1.00 . A A . 147 PRO HG3  1 1 
        3  7056 1 1 147 PRO N    N  -1.479  -8.945  14.904 1.00 . A A . 147 PRO N    1 1 
        3  7057 1 1 147 PRO O    O   1.127  -8.077  14.461 1.00 . A A . 147 PRO O    1 1 
        3  7058 1 1 148 PHE C    C   3.166  -7.215  16.488 1.00 . A A . 148 PHE C    1 1 
        3  7059 1 1 148 PHE CA   C   3.317  -8.657  15.999 1.00 . A A . 148 PHE CA   1 1 
        3  7060 1 1 148 PHE CB   C   3.863  -8.660  14.563 1.00 . A A . 148 PHE CB   1 1 
        3  7061 1 1 148 PHE CD1  C   6.285  -9.275  14.877 1.00 . A A . 148 PHE CD1  1 1 
        3  7062 1 1 148 PHE CD2  C   5.728  -6.987  14.294 1.00 . A A . 148 PHE CD2  1 1 
        3  7063 1 1 148 PHE CE1  C   7.644  -8.941  14.887 1.00 . A A . 148 PHE CE1  1 1 
        3  7064 1 1 148 PHE CE2  C   7.086  -6.653  14.305 1.00 . A A . 148 PHE CE2  1 1 
        3  7065 1 1 148 PHE CG   C   5.327  -8.298  14.581 1.00 . A A . 148 PHE CG   1 1 
        3  7066 1 1 148 PHE CZ   C   8.044  -7.630  14.602 1.00 . A A . 148 PHE CZ   1 1 
        3  7067 1 1 148 PHE H    H   1.851 -10.081  16.678 1.00 . A A . 148 PHE H    1 1 
        3  7068 1 1 148 PHE HA   H   4.008  -9.179  16.645 1.00 . A A . 148 PHE HA   1 1 
        3  7069 1 1 148 PHE HB2  H   3.737  -9.643  14.132 1.00 . A A . 148 PHE HB2  1 1 
        3  7070 1 1 148 PHE HB3  H   3.329  -7.937  13.968 1.00 . A A . 148 PHE HB3  1 1 
        3  7071 1 1 148 PHE HD1  H   5.974 -10.286  15.097 1.00 . A A . 148 PHE HD1  1 1 
        3  7072 1 1 148 PHE HD2  H   4.987  -6.235  14.066 1.00 . A A . 148 PHE HD2  1 1 
        3  7073 1 1 148 PHE HE1  H   8.382  -9.694  15.116 1.00 . A A . 148 PHE HE1  1 1 
        3  7074 1 1 148 PHE HE2  H   7.395  -5.643  14.084 1.00 . A A . 148 PHE HE2  1 1 
        3  7075 1 1 148 PHE HZ   H   9.092  -7.372  14.610 1.00 . A A . 148 PHE HZ   1 1 
        3  7076 1 1 148 PHE N    N   1.988  -9.343  16.046 1.00 . A A . 148 PHE N    1 1 
        3  7077 1 1 148 PHE O    O   3.760  -6.819  17.472 1.00 . A A . 148 PHE O    1 1 
        3  7078 1 1 149 TYR C    C   1.581  -4.974  17.639 1.00 . A A . 149 TYR C    1 1 
        3  7079 1 1 149 TYR CA   C   2.189  -5.015  16.236 1.00 . A A . 149 TYR CA   1 1 
        3  7080 1 1 149 TYR CB   C   1.233  -4.332  15.256 1.00 . A A . 149 TYR CB   1 1 
        3  7081 1 1 149 TYR CD1  C   1.885  -1.907  15.468 1.00 . A A . 149 TYR CD1  1 1 
        3  7082 1 1 149 TYR CD2  C  -0.233  -2.629  16.403 1.00 . A A . 149 TYR CD2  1 1 
        3  7083 1 1 149 TYR CE1  C   1.628  -0.600  15.896 1.00 . A A . 149 TYR CE1  1 1 
        3  7084 1 1 149 TYR CE2  C  -0.489  -1.322  16.831 1.00 . A A . 149 TYR CE2  1 1 
        3  7085 1 1 149 TYR CG   C   0.955  -2.922  15.721 1.00 . A A . 149 TYR CG   1 1 
        3  7086 1 1 149 TYR CZ   C   0.442  -0.306  16.578 1.00 . A A . 149 TYR CZ   1 1 
        3  7087 1 1 149 TYR H    H   1.913  -6.767  15.024 1.00 . A A . 149 TYR H    1 1 
        3  7088 1 1 149 TYR HA   H   3.137  -4.502  16.234 1.00 . A A . 149 TYR HA   1 1 
        3  7089 1 1 149 TYR HB2  H   1.684  -4.306  14.274 1.00 . A A . 149 TYR HB2  1 1 
        3  7090 1 1 149 TYR HB3  H   0.308  -4.885  15.212 1.00 . A A . 149 TYR HB3  1 1 
        3  7091 1 1 149 TYR HD1  H   2.801  -2.134  14.942 1.00 . A A . 149 TYR HD1  1 1 
        3  7092 1 1 149 TYR HD2  H  -0.952  -3.412  16.596 1.00 . A A . 149 TYR HD2  1 1 
        3  7093 1 1 149 TYR HE1  H   2.346   0.182  15.702 1.00 . A A . 149 TYR HE1  1 1 
        3  7094 1 1 149 TYR HE2  H  -1.406  -1.095  17.356 1.00 . A A . 149 TYR HE2  1 1 
        3  7095 1 1 149 TYR HH   H   0.481   1.055  17.915 1.00 . A A . 149 TYR HH   1 1 
        3  7096 1 1 149 TYR N    N   2.381  -6.428  15.813 1.00 . A A . 149 TYR N    1 1 
        3  7097 1 1 149 TYR O    O   1.986  -4.202  18.485 1.00 . A A . 149 TYR O    1 1 
        3  7098 1 1 149 TYR OH   O   0.189   0.982  17.003 1.00 . A A . 149 TYR OH   1 1 
        3  7099 1 1 150 GLY C    C   0.944  -6.105  20.328 1.00 . A A . 150 GLY C    1 1 
        3  7100 1 1 150 GLY CA   C  -0.067  -5.788  19.225 1.00 . A A . 150 GLY CA   1 1 
        3  7101 1 1 150 GLY H    H   0.270  -6.393  17.187 1.00 . A A . 150 GLY H    1 1 
        3  7102 1 1 150 GLY HA2  H  -0.499  -4.814  19.406 1.00 . A A . 150 GLY HA2  1 1 
        3  7103 1 1 150 GLY HA3  H  -0.848  -6.532  19.237 1.00 . A A . 150 GLY HA3  1 1 
        3  7104 1 1 150 GLY N    N   0.591  -5.788  17.889 1.00 . A A . 150 GLY N    1 1 
        3  7105 1 1 150 GLY O    O   2.090  -6.418  20.074 1.00 . A A . 150 GLY O    1 1 
        3  7106 1 1 151 ARG C    C   1.738  -7.818  22.711 1.00 . A A . 151 ARG C    1 1 
        3  7107 1 1 151 ARG CA   C   1.423  -6.322  22.697 1.00 . A A . 151 ARG CA   1 1 
        3  7108 1 1 151 ARG CB   C   0.732  -5.913  24.005 1.00 . A A . 151 ARG CB   1 1 
        3  7109 1 1 151 ARG CD   C  -1.297  -6.235  25.448 1.00 . A A . 151 ARG CD   1 1 
        3  7110 1 1 151 ARG CG   C  -0.576  -6.699  24.175 1.00 . A A . 151 ARG CG   1 1 
        3  7111 1 1 151 ARG CZ   C  -3.494  -6.591  26.430 1.00 . A A . 151 ARG CZ   1 1 
        3  7112 1 1 151 ARG H    H  -0.416  -5.775  21.736 1.00 . A A . 151 ARG H    1 1 
        3  7113 1 1 151 ARG HA   H   2.340  -5.763  22.582 1.00 . A A . 151 ARG HA   1 1 
        3  7114 1 1 151 ARG HB2  H   1.388  -6.120  24.838 1.00 . A A . 151 ARG HB2  1 1 
        3  7115 1 1 151 ARG HB3  H   0.511  -4.857  23.976 1.00 . A A . 151 ARG HB3  1 1 
        3  7116 1 1 151 ARG HD2  H  -0.661  -6.403  26.304 1.00 . A A . 151 ARG HD2  1 1 
        3  7117 1 1 151 ARG HD3  H  -1.522  -5.181  25.369 1.00 . A A . 151 ARG HD3  1 1 
        3  7118 1 1 151 ARG HE   H  -2.707  -7.824  25.088 1.00 . A A . 151 ARG HE   1 1 
        3  7119 1 1 151 ARG HG2  H  -1.211  -6.528  23.319 1.00 . A A . 151 ARG HG2  1 1 
        3  7120 1 1 151 ARG HG3  H  -0.356  -7.754  24.256 1.00 . A A . 151 ARG HG3  1 1 
        3  7121 1 1 151 ARG HH11 H  -2.462  -4.993  27.056 1.00 . A A . 151 ARG HH11 1 1 
        3  7122 1 1 151 ARG HH12 H  -4.028  -5.197  27.765 1.00 . A A . 151 ARG HH12 1 1 
        3  7123 1 1 151 ARG HH21 H  -4.747  -8.095  26.009 1.00 . A A . 151 ARG HH21 1 1 
        3  7124 1 1 151 ARG HH22 H  -5.320  -6.948  27.175 1.00 . A A . 151 ARG HH22 1 1 
        3  7125 1 1 151 ARG N    N   0.514  -6.027  21.560 1.00 . A A . 151 ARG N    1 1 
        3  7126 1 1 151 ARG NE   N  -2.565  -7.006  25.609 1.00 . A A . 151 ARG NE   1 1 
        3  7127 1 1 151 ARG NH1  N  -3.312  -5.510  27.139 1.00 . A A . 151 ARG NH1  1 1 
        3  7128 1 1 151 ARG NH2  N  -4.607  -7.264  26.547 1.00 . A A . 151 ARG NH2  1 1 
        3  7129 1 1 151 ARG O    O   2.610  -8.268  23.423 1.00 . A A . 151 ARG O    1 1 
        3  7130 1 1 152 ARG C    C   1.069 -10.664  23.246 1.00 . A A . 152 ARG C    1 1 
        3  7131 1 1 152 ARG CA   C   1.284 -10.056  21.863 1.00 . A A . 152 ARG CA   1 1 
        3  7132 1 1 152 ARG CB   C   2.727 -10.323  21.413 1.00 . A A . 152 ARG CB   1 1 
        3  7133 1 1 152 ARG CD   C   4.311 -12.062  20.562 1.00 . A A . 152 ARG CD   1 1 
        3  7134 1 1 152 ARG CG   C   2.874 -11.796  21.021 1.00 . A A . 152 ARG CG   1 1 
        3  7135 1 1 152 ARG CZ   C   6.527 -12.030  21.560 1.00 . A A . 152 ARG CZ   1 1 
        3  7136 1 1 152 ARG H    H   0.341  -8.191  21.349 1.00 . A A . 152 ARG H    1 1 
        3  7137 1 1 152 ARG HA   H   0.601 -10.510  21.160 1.00 . A A . 152 ARG HA   1 1 
        3  7138 1 1 152 ARG HB2  H   2.963  -9.698  20.566 1.00 . A A . 152 ARG HB2  1 1 
        3  7139 1 1 152 ARG HB3  H   3.404 -10.104  22.224 1.00 . A A . 152 ARG HB3  1 1 
        3  7140 1 1 152 ARG HD2  H   4.381 -13.060  20.155 1.00 . A A . 152 ARG HD2  1 1 
        3  7141 1 1 152 ARG HD3  H   4.587 -11.343  19.805 1.00 . A A . 152 ARG HD3  1 1 
        3  7142 1 1 152 ARG HE   H   4.869 -11.783  22.624 1.00 . A A . 152 ARG HE   1 1 
        3  7143 1 1 152 ARG HG2  H   2.647 -12.419  21.873 1.00 . A A . 152 ARG HG2  1 1 
        3  7144 1 1 152 ARG HG3  H   2.193 -12.024  20.214 1.00 . A A . 152 ARG HG3  1 1 
        3  7145 1 1 152 ARG HH11 H   6.414 -12.282  19.577 1.00 . A A . 152 ARG HH11 1 1 
        3  7146 1 1 152 ARG HH12 H   8.012 -12.291  20.243 1.00 . A A . 152 ARG HH12 1 1 
        3  7147 1 1 152 ARG HH21 H   6.947 -11.796  23.504 1.00 . A A . 152 ARG HH21 1 1 
        3  7148 1 1 152 ARG HH22 H   8.315 -12.017  22.463 1.00 . A A . 152 ARG HH22 1 1 
        3  7149 1 1 152 ARG N    N   1.035  -8.585  21.916 1.00 . A A . 152 ARG N    1 1 
        3  7150 1 1 152 ARG NE   N   5.234 -11.932  21.727 1.00 . A A . 152 ARG NE   1 1 
        3  7151 1 1 152 ARG NH1  N   7.021 -12.216  20.365 1.00 . A A . 152 ARG NH1  1 1 
        3  7152 1 1 152 ARG NH2  N   7.325 -11.941  22.588 1.00 . A A . 152 ARG NH2  1 1 
        3  7153 1 1 152 ARG O    O   0.087 -11.334  23.495 1.00 . A A . 152 ARG O    1 1 
        3  7154 1 1 153 LEU C    C   2.326  -9.982  26.554 1.00 . A A . 153 LEU C    1 1 
        3  7155 1 1 153 LEU CA   C   1.861 -11.010  25.519 1.00 . A A . 153 LEU CA   1 1 
        3  7156 1 1 153 LEU CB   C   2.735 -12.267  25.628 1.00 . A A . 153 LEU CB   1 1 
        3  7157 1 1 153 LEU CD1  C   1.172 -14.075  26.415 1.00 . A A . 153 LEU CD1  1 1 
        3  7158 1 1 153 LEU CD2  C   3.470 -13.916  27.386 1.00 . A A . 153 LEU CD2  1 1 
        3  7159 1 1 153 LEU CG   C   2.285 -13.111  26.839 1.00 . A A . 153 LEU CG   1 1 
        3  7160 1 1 153 LEU H    H   2.776  -9.903  23.917 1.00 . A A . 153 LEU H    1 1 
        3  7161 1 1 153 LEU HA   H   0.830 -11.268  25.717 1.00 . A A . 153 LEU HA   1 1 
        3  7162 1 1 153 LEU HB2  H   2.640 -12.845  24.719 1.00 . A A . 153 LEU HB2  1 1 
        3  7163 1 1 153 LEU HB3  H   3.771 -11.973  25.753 1.00 . A A . 153 LEU HB3  1 1 
        3  7164 1 1 153 LEU HD11 H   0.321 -13.513  26.061 1.00 . A A . 153 LEU HD11 1 1 
        3  7165 1 1 153 LEU HD12 H   0.878 -14.679  27.260 1.00 . A A . 153 LEU HD12 1 1 
        3  7166 1 1 153 LEU HD13 H   1.533 -14.715  25.625 1.00 . A A . 153 LEU HD13 1 1 
        3  7167 1 1 153 LEU HD21 H   3.898 -14.511  26.594 1.00 . A A . 153 LEU HD21 1 1 
        3  7168 1 1 153 LEU HD22 H   3.128 -14.561  28.181 1.00 . A A . 153 LEU HD22 1 1 
        3  7169 1 1 153 LEU HD23 H   4.218 -13.236  27.771 1.00 . A A . 153 LEU HD23 1 1 
        3  7170 1 1 153 LEU HG   H   1.909 -12.458  27.618 1.00 . A A . 153 LEU HG   1 1 
        3  7171 1 1 153 LEU N    N   1.990 -10.442  24.147 1.00 . A A . 153 LEU N    1 1 
        3  7172 1 1 153 LEU O    O   1.915  -8.840  26.538 1.00 . A A . 153 LEU O    1 1 
        3  7173 1 1 154 GLU C    C   2.475  -8.892  29.267 1.00 . A A . 154 GLU C    1 1 
        3  7174 1 1 154 GLU CA   C   3.672  -9.471  28.513 1.00 . A A . 154 GLU CA   1 1 
        3  7175 1 1 154 GLU CB   C   4.507  -8.354  27.875 1.00 . A A . 154 GLU CB   1 1 
        3  7176 1 1 154 GLU CD   C   6.595  -7.862  26.589 1.00 . A A . 154 GLU CD   1 1 
        3  7177 1 1 154 GLU CG   C   5.797  -8.950  27.307 1.00 . A A . 154 GLU CG   1 1 
        3  7178 1 1 154 GLU H    H   3.475 -11.328  27.451 1.00 . A A . 154 GLU H    1 1 
        3  7179 1 1 154 GLU HA   H   4.289 -10.026  29.204 1.00 . A A . 154 GLU HA   1 1 
        3  7180 1 1 154 GLU HB2  H   3.947  -7.886  27.078 1.00 . A A . 154 GLU HB2  1 1 
        3  7181 1 1 154 GLU HB3  H   4.753  -7.615  28.621 1.00 . A A . 154 GLU HB3  1 1 
        3  7182 1 1 154 GLU HG2  H   6.388  -9.359  28.114 1.00 . A A . 154 GLU HG2  1 1 
        3  7183 1 1 154 GLU HG3  H   5.554  -9.736  26.608 1.00 . A A . 154 GLU HG3  1 1 
        3  7184 1 1 154 GLU N    N   3.173 -10.396  27.461 1.00 . A A . 154 GLU N    1 1 
        3  7185 1 1 154 GLU O    O   2.481  -7.756  29.693 1.00 . A A . 154 GLU O    1 1 
        3  7186 1 1 154 GLU OE1  O   6.129  -6.736  26.555 1.00 . A A . 154 GLU OE1  1 1 
        3  7187 1 1 154 GLU OE2  O   7.662  -8.175  26.083 1.00 . A A . 154 GLU OE2  1 1 
        3  7188 1 1 155 HIS C    C   0.541  -8.958  31.615 1.00 . A A . 155 HIS C    1 1 
        3  7189 1 1 155 HIS CA   C   0.226  -9.186  30.136 1.00 . A A . 155 HIS CA   1 1 
        3  7190 1 1 155 HIS CB   C  -0.888 -10.229  30.016 1.00 . A A . 155 HIS CB   1 1 
        3  7191 1 1 155 HIS CD2  C  -0.940 -11.517  27.729 1.00 . A A . 155 HIS CD2  1 1 
        3  7192 1 1 155 HIS CE1  C  -2.016 -10.044  26.559 1.00 . A A . 155 HIS CE1  1 1 
        3  7193 1 1 155 HIS CG   C  -1.204 -10.461  28.566 1.00 . A A . 155 HIS CG   1 1 
        3  7194 1 1 155 HIS H    H   1.457 -10.588  29.064 1.00 . A A . 155 HIS H    1 1 
        3  7195 1 1 155 HIS HA   H  -0.101  -8.260  29.691 1.00 . A A . 155 HIS HA   1 1 
        3  7196 1 1 155 HIS HB2  H  -0.564 -11.155  30.468 1.00 . A A . 155 HIS HB2  1 1 
        3  7197 1 1 155 HIS HB3  H  -1.770  -9.869  30.523 1.00 . A A . 155 HIS HB3  1 1 
        3  7198 1 1 155 HIS HD1  H  -2.223  -8.663  28.103 1.00 . A A . 155 HIS HD1  1 1 
        3  7199 1 1 155 HIS HD2  H  -0.413 -12.417  28.010 1.00 . A A . 155 HIS HD2  1 1 
        3  7200 1 1 155 HIS HE1  H  -2.513  -9.540  25.745 1.00 . A A . 155 HIS HE1  1 1 
        3  7201 1 1 155 HIS N    N   1.439  -9.676  29.425 1.00 . A A . 155 HIS N    1 1 
        3  7202 1 1 155 HIS ND1  N  -1.890  -9.533  27.798 1.00 . A A . 155 HIS ND1  1 1 
        3  7203 1 1 155 HIS NE2  N  -1.454 -11.252  26.463 1.00 . A A . 155 HIS NE2  1 1 
        3  7204 1 1 155 HIS O    O   1.217  -9.745  32.249 1.00 . A A . 155 HIS O    1 1 
        3  7205 1 1 156 HIS C    C  -0.906  -8.006  34.449 1.00 . A A . 156 HIS C    1 1 
        3  7206 1 1 156 HIS CA   C   0.305  -7.583  33.609 1.00 . A A . 156 HIS CA   1 1 
        3  7207 1 1 156 HIS CB   C   0.549  -6.081  33.761 1.00 . A A . 156 HIS CB   1 1 
        3  7208 1 1 156 HIS CD2  C   2.060  -4.970  31.917 1.00 . A A . 156 HIS CD2  1 1 
        3  7209 1 1 156 HIS CE1  C   3.985  -5.668  32.625 1.00 . A A . 156 HIS CE1  1 1 
        3  7210 1 1 156 HIS CG   C   1.820  -5.717  33.044 1.00 . A A . 156 HIS CG   1 1 
        3  7211 1 1 156 HIS H    H  -0.496  -7.264  31.637 1.00 . A A . 156 HIS H    1 1 
        3  7212 1 1 156 HIS HA   H   1.181  -8.120  33.948 1.00 . A A . 156 HIS HA   1 1 
        3  7213 1 1 156 HIS HB2  H  -0.279  -5.536  33.331 1.00 . A A . 156 HIS HB2  1 1 
        3  7214 1 1 156 HIS HB3  H   0.641  -5.834  34.808 1.00 . A A . 156 HIS HB3  1 1 
        3  7215 1 1 156 HIS HD1  H   3.239  -6.713  34.262 1.00 . A A . 156 HIS HD1  1 1 
        3  7216 1 1 156 HIS HD2  H   1.303  -4.480  31.321 1.00 . A A . 156 HIS HD2  1 1 
        3  7217 1 1 156 HIS HE1  H   5.047  -5.847  32.715 1.00 . A A . 156 HIS HE1  1 1 
        3  7218 1 1 156 HIS N    N   0.047  -7.882  32.170 1.00 . A A . 156 HIS N    1 1 
        3  7219 1 1 156 HIS ND1  N   3.064  -6.152  33.479 1.00 . A A . 156 HIS ND1  1 1 
        3  7220 1 1 156 HIS NE2  N   3.427  -4.940  31.655 1.00 . A A . 156 HIS NE2  1 1 
        3  7221 1 1 156 HIS O    O  -1.892  -7.304  34.547 1.00 . A A . 156 HIS O    1 1 
        3  7222 1 1 157 HIS C    C  -3.276  -9.587  35.183 1.00 . A A . 157 HIS C    1 1 
        3  7223 1 1 157 HIS CA   C  -1.932  -9.668  35.916 1.00 . A A . 157 HIS CA   1 1 
        3  7224 1 1 157 HIS CB   C  -2.008  -8.852  37.204 1.00 . A A . 157 HIS CB   1 1 
        3  7225 1 1 157 HIS CD2  C  -4.274  -9.179  38.495 1.00 . A A . 157 HIS CD2  1 1 
        3  7226 1 1 157 HIS CE1  C  -3.765 -10.991  39.570 1.00 . A A . 157 HIS CE1  1 1 
        3  7227 1 1 157 HIS CG   C  -2.989  -9.503  38.141 1.00 . A A . 157 HIS CG   1 1 
        3  7228 1 1 157 HIS H    H  -0.005  -9.692  34.962 1.00 . A A . 157 HIS H    1 1 
        3  7229 1 1 157 HIS HA   H  -1.733 -10.700  36.165 1.00 . A A . 157 HIS HA   1 1 
        3  7230 1 1 157 HIS HB2  H  -1.033  -8.820  37.669 1.00 . A A . 157 HIS HB2  1 1 
        3  7231 1 1 157 HIS HB3  H  -2.336  -7.849  36.979 1.00 . A A . 157 HIS HB3  1 1 
        3  7232 1 1 157 HIS HD1  H  -1.839 -11.156  38.801 1.00 . A A . 157 HIS HD1  1 1 
        3  7233 1 1 157 HIS HD2  H  -4.826  -8.326  38.127 1.00 . A A . 157 HIS HD2  1 1 
        3  7234 1 1 157 HIS HE1  H  -3.819 -11.855  40.217 1.00 . A A . 157 HIS HE1  1 1 
        3  7235 1 1 157 HIS N    N  -0.819  -9.156  35.060 1.00 . A A . 157 HIS N    1 1 
        3  7236 1 1 157 HIS ND1  N  -2.686 -10.664  38.837 1.00 . A A . 157 HIS ND1  1 1 
        3  7237 1 1 157 HIS NE2  N  -4.763 -10.119  39.399 1.00 . A A . 157 HIS NE2  1 1 
        3  7238 1 1 157 HIS O    O  -3.363  -9.152  34.051 1.00 . A A . 157 HIS O    1 1 
        3  7239 1 1 158 HIS C    C  -6.215  -8.565  35.172 1.00 . A A . 158 HIS C    1 1 
        3  7240 1 1 158 HIS CA   C  -5.674  -9.995  35.198 1.00 . A A . 158 HIS CA   1 1 
        3  7241 1 1 158 HIS CB   C  -6.621 -10.888  35.999 1.00 . A A . 158 HIS CB   1 1 
        3  7242 1 1 158 HIS CD2  C  -6.598 -13.315  34.991 1.00 . A A . 158 HIS CD2  1 1 
        3  7243 1 1 158 HIS CE1  C  -5.072 -14.175  36.268 1.00 . A A . 158 HIS CE1  1 1 
        3  7244 1 1 158 HIS CG   C  -6.194 -12.324  35.851 1.00 . A A . 158 HIS CG   1 1 
        3  7245 1 1 158 HIS H    H  -4.226 -10.375  36.739 1.00 . A A . 158 HIS H    1 1 
        3  7246 1 1 158 HIS HA   H  -5.601 -10.368  34.187 1.00 . A A . 158 HIS HA   1 1 
        3  7247 1 1 158 HIS HB2  H  -6.583 -10.607  37.043 1.00 . A A . 158 HIS HB2  1 1 
        3  7248 1 1 158 HIS HB3  H  -7.628 -10.771  35.630 1.00 . A A . 158 HIS HB3  1 1 
        3  7249 1 1 158 HIS HD1  H  -4.729 -12.447  37.376 1.00 . A A . 158 HIS HD1  1 1 
        3  7250 1 1 158 HIS HD2  H  -7.350 -13.205  34.224 1.00 . A A . 158 HIS HD2  1 1 
        3  7251 1 1 158 HIS HE1  H  -4.380 -14.868  36.719 1.00 . A A . 158 HIS HE1  1 1 
        3  7252 1 1 158 HIS N    N  -4.328 -10.021  35.831 1.00 . A A . 158 HIS N    1 1 
        3  7253 1 1 158 HIS ND1  N  -5.221 -12.894  36.656 1.00 . A A . 158 HIS ND1  1 1 
        3  7254 1 1 158 HIS NE2  N  -5.889 -14.483  35.257 1.00 . A A . 158 HIS NE2  1 1 
        3  7255 1 1 158 HIS O    O  -6.126  -7.836  36.141 1.00 . A A . 158 HIS O    1 1 
        3  7256 1 1 159 HIS C    C  -8.736  -6.711  34.501 1.00 . A A . 159 HIS C    1 1 
        3  7257 1 1 159 HIS CA   C  -7.304  -6.772  33.955 1.00 . A A . 159 HIS CA   1 1 
        3  7258 1 1 159 HIS CB   C  -7.294  -6.351  32.485 1.00 . A A . 159 HIS CB   1 1 
        3  7259 1 1 159 HIS CD2  C  -8.841  -4.328  31.844 1.00 . A A . 159 HIS CD2  1 1 
        3  7260 1 1 159 HIS CE1  C  -7.594  -2.727  32.601 1.00 . A A . 159 HIS CE1  1 1 
        3  7261 1 1 159 HIS CG   C  -7.720  -4.914  32.373 1.00 . A A . 159 HIS CG   1 1 
        3  7262 1 1 159 HIS H    H  -6.818  -8.761  33.292 1.00 . A A . 159 HIS H    1 1 
        3  7263 1 1 159 HIS HA   H  -6.679  -6.096  34.521 1.00 . A A . 159 HIS HA   1 1 
        3  7264 1 1 159 HIS HB2  H  -6.297  -6.463  32.087 1.00 . A A . 159 HIS HB2  1 1 
        3  7265 1 1 159 HIS HB3  H  -7.978  -6.973  31.927 1.00 . A A . 159 HIS HB3  1 1 
        3  7266 1 1 159 HIS HD1  H  -6.065  -3.960  33.291 1.00 . A A . 159 HIS HD1  1 1 
        3  7267 1 1 159 HIS HD2  H  -9.661  -4.858  31.383 1.00 . A A . 159 HIS HD2  1 1 
        3  7268 1 1 159 HIS HE1  H  -7.222  -1.747  32.866 1.00 . A A . 159 HIS HE1  1 1 
        3  7269 1 1 159 HIS N    N  -6.766  -8.157  34.063 1.00 . A A . 159 HIS N    1 1 
        3  7270 1 1 159 HIS ND1  N  -6.937  -3.875  32.851 1.00 . A A . 159 HIS ND1  1 1 
        3  7271 1 1 159 HIS NE2  N  -8.759  -2.945  31.988 1.00 . A A . 159 HIS NE2  1 1 
        3  7272 1 1 159 HIS O    O  -9.595  -7.478  34.114 1.00 . A A . 159 HIS O    1 1 
        3  7273 1 1 160 HIS C    C -10.858  -7.013  36.470 1.00 . A A . 160 HIS C    1 1 
        3  7274 1 1 160 HIS CA   C -10.355  -5.654  35.981 1.00 . A A . 160 HIS CA   1 1 
        3  7275 1 1 160 HIS CB   C -11.315  -5.099  34.925 1.00 . A A . 160 HIS CB   1 1 
        3  7276 1 1 160 HIS CD2  C -13.016  -3.526  36.167 1.00 . A A . 160 HIS CD2  1 1 
        3  7277 1 1 160 HIS CE1  C -14.663  -4.923  36.348 1.00 . A A . 160 HIS CE1  1 1 
        3  7278 1 1 160 HIS CG   C -12.606  -4.702  35.586 1.00 . A A . 160 HIS CG   1 1 
        3  7279 1 1 160 HIS H    H  -8.275  -5.189  35.683 1.00 . A A . 160 HIS H    1 1 
        3  7280 1 1 160 HIS HA   H -10.312  -4.968  36.817 1.00 . A A . 160 HIS HA   1 1 
        3  7281 1 1 160 HIS HB2  H -10.871  -4.234  34.454 1.00 . A A . 160 HIS HB2  1 1 
        3  7282 1 1 160 HIS HB3  H -11.510  -5.856  34.181 1.00 . A A . 160 HIS HB3  1 1 
        3  7283 1 1 160 HIS HD1  H -13.702  -6.505  35.398 1.00 . A A . 160 HIS HD1  1 1 
        3  7284 1 1 160 HIS HD2  H -12.421  -2.628  36.241 1.00 . A A . 160 HIS HD2  1 1 
        3  7285 1 1 160 HIS HE1  H -15.622  -5.357  36.586 1.00 . A A . 160 HIS HE1  1 1 
        3  7286 1 1 160 HIS N    N  -8.989  -5.794  35.395 1.00 . A A . 160 HIS N    1 1 
        3  7287 1 1 160 HIS ND1  N -13.673  -5.577  35.714 1.00 . A A . 160 HIS ND1  1 1 
        3  7288 1 1 160 HIS NE2  N -14.315  -3.667  36.647 1.00 . A A . 160 HIS NE2  1 1 
        3  7289 1 1 160 HIS O    O -10.153  -7.640  37.245 1.00 . A A . 160 HIS O    1 1 
        3  7290 1 1 160 HIS OXT  O -11.941  -7.401  36.068 1.00 . A A . 160 HIS OXT  1 1 
        4  7291 1 1   1 MET C    C  34.400   2.136   7.582 1.00 . A A .   1 MET C    1 1 
        4  7292 1 1   1 MET CA   C  35.835   1.818   7.169 1.00 . A A .   1 MET CA   1 1 
        4  7293 1 1   1 MET CB   C  36.207   2.668   5.954 1.00 . A A .   1 MET CB   1 1 
        4  7294 1 1   1 MET CE   C  37.284   2.686   2.958 1.00 . A A .   1 MET CE   1 1 
        4  7295 1 1   1 MET CG   C  37.697   2.505   5.652 1.00 . A A .   1 MET CG   1 1 
        4  7296 1 1   1 MET H1   H  36.378  -0.143   7.618 1.00 . A A .   1 MET H1   1 1 
        4  7297 1 1   1 MET H2   H  36.550   0.266   5.978 1.00 . A A .   1 MET H2   1 1 
        4  7298 1 1   1 MET H3   H  35.005  -0.014   6.628 1.00 . A A .   1 MET H3   1 1 
        4  7299 1 1   1 MET HA   H  36.505   2.047   7.986 1.00 . A A .   1 MET HA   1 1 
        4  7300 1 1   1 MET HB2  H  35.627   2.345   5.102 1.00 . A A .   1 MET HB2  1 1 
        4  7301 1 1   1 MET HB3  H  35.994   3.706   6.163 1.00 . A A .   1 MET HB3  1 1 
        4  7302 1 1   1 MET HE1  H  36.249   3.000   2.935 1.00 . A A .   1 MET HE1  1 1 
        4  7303 1 1   1 MET HE2  H  37.340   1.624   3.145 1.00 . A A .   1 MET HE2  1 1 
        4  7304 1 1   1 MET HE3  H  37.742   2.903   2.007 1.00 . A A .   1 MET HE3  1 1 
        4  7305 1 1   1 MET HG2  H  38.273   2.777   6.525 1.00 . A A .   1 MET HG2  1 1 
        4  7306 1 1   1 MET HG3  H  37.903   1.478   5.395 1.00 . A A .   1 MET HG3  1 1 
        4  7307 1 1   1 MET N    N  35.950   0.373   6.822 1.00 . A A .   1 MET N    1 1 
        4  7308 1 1   1 MET O    O  33.476   1.407   7.278 1.00 . A A .   1 MET O    1 1 
        4  7309 1 1   1 MET SD   S  38.155   3.582   4.269 1.00 . A A .   1 MET SD   1 1 
        4  7310 1 1   2 GLU C    C  32.136   4.367   7.564 1.00 . A A .   2 GLU C    1 1 
        4  7311 1 1   2 GLU CA   C  32.835   3.615   8.700 1.00 . A A .   2 GLU CA   1 1 
        4  7312 1 1   2 GLU CB   C  32.932   4.518   9.934 1.00 . A A .   2 GLU CB   1 1 
        4  7313 1 1   2 GLU CD   C  33.914   6.628  10.844 1.00 . A A .   2 GLU CD   1 1 
        4  7314 1 1   2 GLU CG   C  33.736   5.774   9.588 1.00 . A A .   2 GLU CG   1 1 
        4  7315 1 1   2 GLU H    H  34.970   3.800   8.494 1.00 . A A .   2 GLU H    1 1 
        4  7316 1 1   2 GLU HA   H  32.269   2.727   8.946 1.00 . A A .   2 GLU HA   1 1 
        4  7317 1 1   2 GLU HB2  H  31.938   4.800  10.250 1.00 . A A .   2 GLU HB2  1 1 
        4  7318 1 1   2 GLU HB3  H  33.426   3.984  10.732 1.00 . A A .   2 GLU HB3  1 1 
        4  7319 1 1   2 GLU HG2  H  34.704   5.487   9.205 1.00 . A A .   2 GLU HG2  1 1 
        4  7320 1 1   2 GLU HG3  H  33.209   6.348   8.840 1.00 . A A .   2 GLU HG3  1 1 
        4  7321 1 1   2 GLU N    N  34.208   3.228   8.267 1.00 . A A .   2 GLU N    1 1 
        4  7322 1 1   2 GLU O    O  30.989   4.751   7.675 1.00 . A A .   2 GLU O    1 1 
        4  7323 1 1   2 GLU OE1  O  34.159   6.059  11.894 1.00 . A A .   2 GLU OE1  1 1 
        4  7324 1 1   2 GLU OE2  O  33.804   7.838  10.732 1.00 . A A .   2 GLU OE2  1 1 
        4  7325 1 1   3 LYS C    C  31.420   4.334   4.461 1.00 . A A .   3 LYS C    1 1 
        4  7326 1 1   3 LYS CA   C  32.212   5.317   5.330 1.00 . A A .   3 LYS CA   1 1 
        4  7327 1 1   3 LYS CB   C  33.324   5.961   4.497 1.00 . A A .   3 LYS CB   1 1 
        4  7328 1 1   3 LYS CD   C  33.826   7.472   2.575 1.00 . A A .   3 LYS CD   1 1 
        4  7329 1 1   3 LYS CE   C  33.211   8.300   1.446 1.00 . A A .   3 LYS CE   1 1 
        4  7330 1 1   3 LYS CG   C  32.713   6.771   3.356 1.00 . A A .   3 LYS CG   1 1 
        4  7331 1 1   3 LYS H    H  33.751   4.268   6.413 1.00 . A A .   3 LYS H    1 1 
        4  7332 1 1   3 LYS HA   H  31.550   6.087   5.701 1.00 . A A .   3 LYS HA   1 1 
        4  7333 1 1   3 LYS HB2  H  33.914   6.612   5.125 1.00 . A A .   3 LYS HB2  1 1 
        4  7334 1 1   3 LYS HB3  H  33.957   5.187   4.085 1.00 . A A .   3 LYS HB3  1 1 
        4  7335 1 1   3 LYS HD2  H  34.377   8.125   3.242 1.00 . A A .   3 LYS HD2  1 1 
        4  7336 1 1   3 LYS HD3  H  34.494   6.736   2.160 1.00 . A A .   3 LYS HD3  1 1 
        4  7337 1 1   3 LYS HE2  H  32.675   7.646   0.774 1.00 . A A .   3 LYS HE2  1 1 
        4  7338 1 1   3 LYS HE3  H  32.528   9.026   1.861 1.00 . A A .   3 LYS HE3  1 1 
        4  7339 1 1   3 LYS HG2  H  32.170   6.112   2.697 1.00 . A A .   3 LYS HG2  1 1 
        4  7340 1 1   3 LYS HG3  H  32.039   7.511   3.763 1.00 . A A .   3 LYS HG3  1 1 
        4  7341 1 1   3 LYS HZ1  H  34.822   8.318   0.123 1.00 . A A .   3 LYS HZ1  1 1 
        4  7342 1 1   3 LYS HZ2  H  34.938   9.463   1.368 1.00 . A A .   3 LYS HZ2  1 1 
        4  7343 1 1   3 LYS HZ3  H  33.867   9.723   0.075 1.00 . A A .   3 LYS HZ3  1 1 
        4  7344 1 1   3 LYS N    N  32.826   4.586   6.476 1.00 . A A .   3 LYS N    1 1 
        4  7345 1 1   3 LYS NZ   N  34.291   9.004   0.697 1.00 . A A .   3 LYS NZ   1 1 
        4  7346 1 1   3 LYS O    O  31.980   3.577   3.695 1.00 . A A .   3 LYS O    1 1 
        4  7347 1 1   4 ALA C    C  28.683   4.167   2.569 1.00 . A A .   4 ALA C    1 1 
        4  7348 1 1   4 ALA CA   C  29.267   3.413   3.765 1.00 . A A .   4 ALA CA   1 1 
        4  7349 1 1   4 ALA CB   C  28.127   2.873   4.631 1.00 . A A .   4 ALA CB   1 1 
        4  7350 1 1   4 ALA H    H  29.689   4.965   5.203 1.00 . A A .   4 ALA H    1 1 
        4  7351 1 1   4 ALA HA   H  29.867   2.584   3.408 1.00 . A A .   4 ALA HA   1 1 
        4  7352 1 1   4 ALA HB1  H  27.486   3.687   4.928 1.00 . A A .   4 ALA HB1  1 1 
        4  7353 1 1   4 ALA HB2  H  28.536   2.396   5.510 1.00 . A A .   4 ALA HB2  1 1 
        4  7354 1 1   4 ALA HB3  H  27.554   2.152   4.066 1.00 . A A .   4 ALA HB3  1 1 
        4  7355 1 1   4 ALA N    N  30.115   4.341   4.578 1.00 . A A .   4 ALA N    1 1 
        4  7356 1 1   4 ALA O    O  28.431   5.353   2.632 1.00 . A A .   4 ALA O    1 1 
        4  7357 1 1   5 MET C    C  26.374   4.274   0.412 1.00 . A A .   5 MET C    1 1 
        4  7358 1 1   5 MET CA   C  27.903   4.161   0.270 1.00 . A A .   5 MET CA   1 1 
        4  7359 1 1   5 MET CB   C  28.252   3.315  -0.969 1.00 . A A .   5 MET CB   1 1 
        4  7360 1 1   5 MET CE   C  31.783   3.293  -3.079 1.00 . A A .   5 MET CE   1 1 
        4  7361 1 1   5 MET CG   C  29.630   3.717  -1.497 1.00 . A A .   5 MET CG   1 1 
        4  7362 1 1   5 MET H    H  28.681   2.530   1.448 1.00 . A A .   5 MET H    1 1 
        4  7363 1 1   5 MET HA   H  28.334   5.142   0.177 1.00 . A A .   5 MET HA   1 1 
        4  7364 1 1   5 MET HB2  H  28.267   2.271  -0.693 1.00 . A A .   5 MET HB2  1 1 
        4  7365 1 1   5 MET HB3  H  27.515   3.469  -1.743 1.00 . A A .   5 MET HB3  1 1 
        4  7366 1 1   5 MET HE1  H  32.507   3.060  -2.309 1.00 . A A .   5 MET HE1  1 1 
        4  7367 1 1   5 MET HE2  H  31.633   4.363  -3.127 1.00 . A A .   5 MET HE2  1 1 
        4  7368 1 1   5 MET HE3  H  32.145   2.939  -4.030 1.00 . A A .   5 MET HE3  1 1 
        4  7369 1 1   5 MET HG2  H  29.563   4.680  -1.981 1.00 . A A .   5 MET HG2  1 1 
        4  7370 1 1   5 MET HG3  H  30.327   3.779  -0.673 1.00 . A A .   5 MET HG3  1 1 
        4  7371 1 1   5 MET N    N  28.468   3.487   1.477 1.00 . A A .   5 MET N    1 1 
        4  7372 1 1   5 MET O    O  25.767   3.520   1.145 1.00 . A A .   5 MET O    1 1 
        4  7373 1 1   5 MET SD   S  30.212   2.486  -2.687 1.00 . A A .   5 MET SD   1 1 
        4  7374 1 1   6 PRO C    C  23.527   4.026  -0.362 1.00 . A A .   6 PRO C    1 1 
        4  7375 1 1   6 PRO CA   C  24.268   5.362  -0.240 1.00 . A A .   6 PRO CA   1 1 
        4  7376 1 1   6 PRO CB   C  23.952   6.255  -1.453 1.00 . A A .   6 PRO CB   1 1 
        4  7377 1 1   6 PRO CD   C  26.378   6.178  -1.203 1.00 . A A .   6 PRO CD   1 1 
        4  7378 1 1   6 PRO CG   C  25.205   7.033  -1.715 1.00 . A A .   6 PRO CG   1 1 
        4  7379 1 1   6 PRO HA   H  23.986   5.862   0.663 1.00 . A A .   6 PRO HA   1 1 
        4  7380 1 1   6 PRO HB2  H  23.700   5.648  -2.318 1.00 . A A .   6 PRO HB2  1 1 
        4  7381 1 1   6 PRO HB3  H  23.138   6.927  -1.223 1.00 . A A .   6 PRO HB3  1 1 
        4  7382 1 1   6 PRO HD2  H  26.877   5.684  -2.026 1.00 . A A .   6 PRO HD2  1 1 
        4  7383 1 1   6 PRO HD3  H  27.074   6.797  -0.655 1.00 . A A .   6 PRO HD3  1 1 
        4  7384 1 1   6 PRO HG2  H  25.314   7.220  -2.779 1.00 . A A .   6 PRO HG2  1 1 
        4  7385 1 1   6 PRO HG3  H  25.179   7.972  -1.179 1.00 . A A .   6 PRO HG3  1 1 
        4  7386 1 1   6 PRO N    N  25.749   5.191  -0.298 1.00 . A A .   6 PRO N    1 1 
        4  7387 1 1   6 PRO O    O  22.552   3.785   0.321 1.00 . A A .   6 PRO O    1 1 
        4  7388 1 1   7 GLU C    C  21.828   1.947  -1.338 1.00 . A A .   7 GLU C    1 1 
        4  7389 1 1   7 GLU CA   C  23.353   1.826  -1.419 1.00 . A A .   7 GLU CA   1 1 
        4  7390 1 1   7 GLU CB   C  23.835   0.861  -0.334 1.00 . A A .   7 GLU CB   1 1 
        4  7391 1 1   7 GLU CD   C  25.802  -0.365   0.591 1.00 . A A .   7 GLU CD   1 1 
        4  7392 1 1   7 GLU CG   C  25.319   0.550  -0.536 1.00 . A A .   7 GLU CG   1 1 
        4  7393 1 1   7 GLU H    H  24.792   3.403  -1.747 1.00 . A A .   7 GLU H    1 1 
        4  7394 1 1   7 GLU HA   H  23.627   1.436  -2.388 1.00 . A A .   7 GLU HA   1 1 
        4  7395 1 1   7 GLU HB2  H  23.689   1.313   0.636 1.00 . A A .   7 GLU HB2  1 1 
        4  7396 1 1   7 GLU HB3  H  23.266  -0.056  -0.392 1.00 . A A .   7 GLU HB3  1 1 
        4  7397 1 1   7 GLU HG2  H  25.458   0.054  -1.486 1.00 . A A .   7 GLU HG2  1 1 
        4  7398 1 1   7 GLU HG3  H  25.888   1.467  -0.521 1.00 . A A .   7 GLU HG3  1 1 
        4  7399 1 1   7 GLU N    N  23.999   3.166  -1.224 1.00 . A A .   7 GLU N    1 1 
        4  7400 1 1   7 GLU O    O  21.155   2.169  -2.325 1.00 . A A .   7 GLU O    1 1 
        4  7401 1 1   7 GLU OE1  O  24.986  -0.723   1.425 1.00 . A A .   7 GLU OE1  1 1 
        4  7402 1 1   7 GLU OE2  O  26.977  -0.691   0.604 1.00 . A A .   7 GLU OE2  1 1 
        4  7403 1 1   8 SER C    C  19.121   0.784  -0.768 1.00 . A A .   8 SER C    1 1 
        4  7404 1 1   8 SER CA   C  19.809   1.900   0.019 1.00 . A A .   8 SER CA   1 1 
        4  7405 1 1   8 SER CB   C  19.324   3.262  -0.483 1.00 . A A .   8 SER CB   1 1 
        4  7406 1 1   8 SER H    H  21.858   1.619   0.619 1.00 . A A .   8 SER H    1 1 
        4  7407 1 1   8 SER HA   H  19.570   1.797   1.069 1.00 . A A .   8 SER HA   1 1 
        4  7408 1 1   8 SER HB2  H  18.462   3.576   0.083 1.00 . A A .   8 SER HB2  1 1 
        4  7409 1 1   8 SER HB3  H  20.115   3.990  -0.361 1.00 . A A .   8 SER HB3  1 1 
        4  7410 1 1   8 SER HG   H  18.054   2.869  -1.901 1.00 . A A .   8 SER HG   1 1 
        4  7411 1 1   8 SER N    N  21.286   1.800  -0.157 1.00 . A A .   8 SER N    1 1 
        4  7412 1 1   8 SER O    O  19.348   0.605  -1.949 1.00 . A A .   8 SER O    1 1 
        4  7413 1 1   8 SER OG   O  18.968   3.157  -1.855 1.00 . A A .   8 SER OG   1 1 
        4  7414 1 1   9 PHE C    C  16.140  -0.636  -1.155 1.00 . A A .   9 PHE C    1 1 
        4  7415 1 1   9 PHE CA   C  17.554  -1.087  -0.790 1.00 . A A .   9 PHE CA   1 1 
        4  7416 1 1   9 PHE CB   C  17.475  -2.285   0.158 1.00 . A A .   9 PHE CB   1 1 
        4  7417 1 1   9 PHE CD1  C  19.220  -3.881  -0.699 1.00 . A A .   9 PHE CD1  1 1 
        4  7418 1 1   9 PHE CD2  C  19.706  -2.588   1.293 1.00 . A A .   9 PHE CD2  1 1 
        4  7419 1 1   9 PHE CE1  C  20.480  -4.483  -0.617 1.00 . A A .   9 PHE CE1  1 1 
        4  7420 1 1   9 PHE CE2  C  20.967  -3.188   1.374 1.00 . A A .   9 PHE CE2  1 1 
        4  7421 1 1   9 PHE CG   C  18.833  -2.934   0.256 1.00 . A A .   9 PHE CG   1 1 
        4  7422 1 1   9 PHE CZ   C  21.354  -4.136   0.419 1.00 . A A .   9 PHE CZ   1 1 
        4  7423 1 1   9 PHE H    H  18.119   0.203   0.839 1.00 . A A .   9 PHE H    1 1 
        4  7424 1 1   9 PHE HA   H  18.082  -1.376  -1.690 1.00 . A A .   9 PHE HA   1 1 
        4  7425 1 1   9 PHE HB2  H  17.166  -1.948   1.137 1.00 . A A .   9 PHE HB2  1 1 
        4  7426 1 1   9 PHE HB3  H  16.759  -3.001  -0.219 1.00 . A A .   9 PHE HB3  1 1 
        4  7427 1 1   9 PHE HD1  H  18.544  -4.147  -1.499 1.00 . A A .   9 PHE HD1  1 1 
        4  7428 1 1   9 PHE HD2  H  19.406  -1.857   2.029 1.00 . A A .   9 PHE HD2  1 1 
        4  7429 1 1   9 PHE HE1  H  20.778  -5.214  -1.354 1.00 . A A .   9 PHE HE1  1 1 
        4  7430 1 1   9 PHE HE2  H  21.642  -2.921   2.174 1.00 . A A .   9 PHE HE2  1 1 
        4  7431 1 1   9 PHE HZ   H  22.328  -4.599   0.482 1.00 . A A .   9 PHE HZ   1 1 
        4  7432 1 1   9 PHE N    N  18.277   0.032  -0.111 1.00 . A A .   9 PHE N    1 1 
        4  7433 1 1   9 PHE O    O  15.576   0.237  -0.526 1.00 . A A .   9 PHE O    1 1 
        4  7434 1 1  10 VAL C    C  13.275  -2.075  -2.480 1.00 . A A .  10 VAL C    1 1 
        4  7435 1 1  10 VAL CA   C  14.184  -0.853  -2.610 1.00 . A A .  10 VAL CA   1 1 
        4  7436 1 1  10 VAL CB   C  14.224  -0.398  -4.075 1.00 . A A .  10 VAL CB   1 1 
        4  7437 1 1  10 VAL CG1  C  12.798  -0.270  -4.622 1.00 . A A .  10 VAL CG1  1 1 
        4  7438 1 1  10 VAL CG2  C  14.927   0.957  -4.162 1.00 . A A .  10 VAL CG2  1 1 
        4  7439 1 1  10 VAL H    H  16.054  -1.926  -2.657 1.00 . A A .  10 VAL H    1 1 
        4  7440 1 1  10 VAL HA   H  13.798  -0.050  -1.996 1.00 . A A .  10 VAL HA   1 1 
        4  7441 1 1  10 VAL HB   H  14.768  -1.126  -4.659 1.00 . A A .  10 VAL HB   1 1 
        4  7442 1 1  10 VAL HG11 H  12.812   0.301  -5.539 1.00 . A A .  10 VAL HG11 1 1 
        4  7443 1 1  10 VAL HG12 H  12.177   0.230  -3.894 1.00 . A A .  10 VAL HG12 1 1 
        4  7444 1 1  10 VAL HG13 H  12.400  -1.255  -4.817 1.00 . A A .  10 VAL HG13 1 1 
        4  7445 1 1  10 VAL HG21 H  14.412   1.669  -3.537 1.00 . A A .  10 VAL HG21 1 1 
        4  7446 1 1  10 VAL HG22 H  14.919   1.303  -5.187 1.00 . A A .  10 VAL HG22 1 1 
        4  7447 1 1  10 VAL HG23 H  15.948   0.854  -3.825 1.00 . A A .  10 VAL HG23 1 1 
        4  7448 1 1  10 VAL N    N  15.568  -1.228  -2.172 1.00 . A A .  10 VAL N    1 1 
        4  7449 1 1  10 VAL O    O  13.632  -3.172  -2.863 1.00 . A A .  10 VAL O    1 1 
        4  7450 1 1  11 VAL C    C   9.914  -2.769  -2.640 1.00 . A A .  11 VAL C    1 1 
        4  7451 1 1  11 VAL CA   C  11.139  -3.022  -1.764 1.00 . A A .  11 VAL CA   1 1 
        4  7452 1 1  11 VAL CB   C  10.708  -3.096  -0.293 1.00 . A A .  11 VAL CB   1 1 
        4  7453 1 1  11 VAL CG1  C   9.526  -4.060  -0.139 1.00 . A A .  11 VAL CG1  1 1 
        4  7454 1 1  11 VAL CG2  C  11.882  -3.592   0.550 1.00 . A A .  11 VAL CG2  1 1 
        4  7455 1 1  11 VAL H    H  11.845  -0.990  -1.639 1.00 . A A .  11 VAL H    1 1 
        4  7456 1 1  11 VAL HA   H  11.602  -3.957  -2.051 1.00 . A A .  11 VAL HA   1 1 
        4  7457 1 1  11 VAL HB   H  10.413  -2.113   0.042 1.00 . A A .  11 VAL HB   1 1 
        4  7458 1 1  11 VAL HG11 H   8.624  -3.584  -0.497 1.00 . A A .  11 VAL HG11 1 1 
        4  7459 1 1  11 VAL HG12 H   9.403  -4.321   0.903 1.00 . A A .  11 VAL HG12 1 1 
        4  7460 1 1  11 VAL HG13 H   9.712  -4.955  -0.714 1.00 . A A .  11 VAL HG13 1 1 
        4  7461 1 1  11 VAL HG21 H  12.131  -4.604   0.264 1.00 . A A .  11 VAL HG21 1 1 
        4  7462 1 1  11 VAL HG22 H  11.613  -3.570   1.597 1.00 . A A .  11 VAL HG22 1 1 
        4  7463 1 1  11 VAL HG23 H  12.737  -2.953   0.384 1.00 . A A .  11 VAL HG23 1 1 
        4  7464 1 1  11 VAL N    N  12.100  -1.887  -1.938 1.00 . A A .  11 VAL N    1 1 
        4  7465 1 1  11 VAL O    O   9.352  -1.693  -2.639 1.00 . A A .  11 VAL O    1 1 
        4  7466 1 1  12 ARG C    C   7.287  -4.693  -3.901 1.00 . A A .  12 ARG C    1 1 
        4  7467 1 1  12 ARG CA   C   8.297  -3.610  -4.266 1.00 . A A .  12 ARG CA   1 1 
        4  7468 1 1  12 ARG CB   C   8.725  -3.774  -5.727 1.00 . A A .  12 ARG CB   1 1 
        4  7469 1 1  12 ARG CD   C  10.010  -2.714  -7.595 1.00 . A A .  12 ARG CD   1 1 
        4  7470 1 1  12 ARG CG   C   9.544  -2.555  -6.148 1.00 . A A .  12 ARG CG   1 1 
        4  7471 1 1  12 ARG CZ   C  11.401  -1.470  -9.138 1.00 . A A .  12 ARG CZ   1 1 
        4  7472 1 1  12 ARG H    H   9.972  -4.617  -3.354 1.00 . A A .  12 ARG H    1 1 
        4  7473 1 1  12 ARG HA   H   7.845  -2.637  -4.130 1.00 . A A .  12 ARG HA   1 1 
        4  7474 1 1  12 ARG HB2  H   9.325  -4.666  -5.828 1.00 . A A .  12 ARG HB2  1 1 
        4  7475 1 1  12 ARG HB3  H   7.850  -3.853  -6.356 1.00 . A A .  12 ARG HB3  1 1 
        4  7476 1 1  12 ARG HD2  H  10.637  -3.588  -7.679 1.00 . A A .  12 ARG HD2  1 1 
        4  7477 1 1  12 ARG HD3  H   9.151  -2.822  -8.241 1.00 . A A .  12 ARG HD3  1 1 
        4  7478 1 1  12 ARG HE   H  10.823  -0.732  -7.391 1.00 . A A .  12 ARG HE   1 1 
        4  7479 1 1  12 ARG HG2  H   8.935  -1.668  -6.062 1.00 . A A .  12 ARG HG2  1 1 
        4  7480 1 1  12 ARG HG3  H  10.405  -2.462  -5.504 1.00 . A A .  12 ARG HG3  1 1 
        4  7481 1 1  12 ARG HH11 H  10.832  -3.313  -9.675 1.00 . A A .  12 ARG HH11 1 1 
        4  7482 1 1  12 ARG HH12 H  11.825  -2.472 -10.818 1.00 . A A .  12 ARG HH12 1 1 
        4  7483 1 1  12 ARG HH21 H  12.117   0.380  -8.865 1.00 . A A .  12 ARG HH21 1 1 
        4  7484 1 1  12 ARG HH22 H  12.553  -0.380 -10.359 1.00 . A A .  12 ARG HH22 1 1 
        4  7485 1 1  12 ARG N    N   9.496  -3.760  -3.383 1.00 . A A .  12 ARG N    1 1 
        4  7486 1 1  12 ARG NE   N  10.782  -1.505  -7.992 1.00 . A A .  12 ARG NE   1 1 
        4  7487 1 1  12 ARG NH1  N  11.349  -2.499  -9.939 1.00 . A A .  12 ARG NH1  1 1 
        4  7488 1 1  12 ARG NH2  N  12.076  -0.407  -9.481 1.00 . A A .  12 ARG NH2  1 1 
        4  7489 1 1  12 ARG O    O   7.637  -5.845  -3.739 1.00 . A A .  12 ARG O    1 1 
        4  7490 1 1  13 ARG C    C   3.746  -5.137  -4.240 1.00 . A A .  13 ARG C    1 1 
        4  7491 1 1  13 ARG CA   C   4.995  -5.344  -3.379 1.00 . A A .  13 ARG CA   1 1 
        4  7492 1 1  13 ARG CB   C   4.653  -5.174  -1.877 1.00 . A A .  13 ARG CB   1 1 
        4  7493 1 1  13 ARG CD   C   6.158  -7.024  -1.030 1.00 . A A .  13 ARG CD   1 1 
        4  7494 1 1  13 ARG CG   C   4.697  -6.538  -1.170 1.00 . A A .  13 ARG CG   1 1 
        4  7495 1 1  13 ARG CZ   C   6.118  -9.447  -0.755 1.00 . A A .  13 ARG CZ   1 1 
        4  7496 1 1  13 ARG H    H   5.780  -3.397  -3.879 1.00 . A A .  13 ARG H    1 1 
        4  7497 1 1  13 ARG HA   H   5.375  -6.342  -3.559 1.00 . A A .  13 ARG HA   1 1 
        4  7498 1 1  13 ARG HB2  H   5.379  -4.519  -1.422 1.00 . A A .  13 ARG HB2  1 1 
        4  7499 1 1  13 ARG HB3  H   3.667  -4.745  -1.762 1.00 . A A .  13 ARG HB3  1 1 
        4  7500 1 1  13 ARG HD2  H   6.820  -6.385  -1.600 1.00 . A A .  13 ARG HD2  1 1 
        4  7501 1 1  13 ARG HD3  H   6.457  -7.002   0.008 1.00 . A A .  13 ARG HD3  1 1 
        4  7502 1 1  13 ARG HE   H   6.445  -8.567  -2.505 1.00 . A A .  13 ARG HE   1 1 
        4  7503 1 1  13 ARG HG2  H   4.249  -6.443  -0.192 1.00 . A A .  13 ARG HG2  1 1 
        4  7504 1 1  13 ARG HG3  H   4.137  -7.256  -1.749 1.00 . A A .  13 ARG HG3  1 1 
        4  7505 1 1  13 ARG HH11 H   5.723  -8.348   0.874 1.00 . A A .  13 ARG HH11 1 1 
        4  7506 1 1  13 ARG HH12 H   5.734 -10.063   1.112 1.00 . A A .  13 ARG HH12 1 1 
        4  7507 1 1  13 ARG HH21 H   6.447 -10.794  -2.200 1.00 . A A .  13 ARG HH21 1 1 
        4  7508 1 1  13 ARG HH22 H   6.141 -11.445  -0.624 1.00 . A A .  13 ARG HH22 1 1 
        4  7509 1 1  13 ARG N    N   6.035  -4.334  -3.755 1.00 . A A .  13 ARG N    1 1 
        4  7510 1 1  13 ARG NE   N   6.258  -8.420  -1.553 1.00 . A A .  13 ARG NE   1 1 
        4  7511 1 1  13 ARG NH1  N   5.835  -9.272   0.508 1.00 . A A .  13 ARG NH1  1 1 
        4  7512 1 1  13 ARG NH2  N   6.244 -10.657  -1.229 1.00 . A A .  13 ARG NH2  1 1 
        4  7513 1 1  13 ARG O    O   3.457  -4.047  -4.693 1.00 . A A .  13 ARG O    1 1 
        4  7514 1 1  14 GLU C    C   0.652  -6.869  -4.577 1.00 . A A .  14 GLU C    1 1 
        4  7515 1 1  14 GLU CA   C   1.768  -6.102  -5.286 1.00 . A A .  14 GLU CA   1 1 
        4  7516 1 1  14 GLU CB   C   2.028  -6.732  -6.655 1.00 . A A .  14 GLU CB   1 1 
        4  7517 1 1  14 GLU CD   C   3.333  -6.530  -8.774 1.00 . A A .  14 GLU CD   1 1 
        4  7518 1 1  14 GLU CG   C   3.004  -5.856  -7.442 1.00 . A A .  14 GLU CG   1 1 
        4  7519 1 1  14 GLU H    H   3.273  -7.053  -4.078 1.00 . A A .  14 GLU H    1 1 
        4  7520 1 1  14 GLU HA   H   1.471  -5.069  -5.412 1.00 . A A .  14 GLU HA   1 1 
        4  7521 1 1  14 GLU HB2  H   2.454  -7.715  -6.522 1.00 . A A .  14 GLU HB2  1 1 
        4  7522 1 1  14 GLU HB3  H   1.103  -6.814  -7.201 1.00 . A A .  14 GLU HB3  1 1 
        4  7523 1 1  14 GLU HG2  H   2.554  -4.892  -7.626 1.00 . A A .  14 GLU HG2  1 1 
        4  7524 1 1  14 GLU HG3  H   3.912  -5.727  -6.872 1.00 . A A .  14 GLU HG3  1 1 
        4  7525 1 1  14 GLU N    N   3.008  -6.191  -4.462 1.00 . A A .  14 GLU N    1 1 
        4  7526 1 1  14 GLU O    O   0.894  -7.847  -3.899 1.00 . A A .  14 GLU O    1 1 
        4  7527 1 1  14 GLU OE1  O   2.795  -7.596  -9.024 1.00 . A A .  14 GLU OE1  1 1 
        4  7528 1 1  14 GLU OE2  O   4.116  -5.969  -9.522 1.00 . A A .  14 GLU OE2  1 1 
        4  7529 1 1  15 ALA C    C  -2.943  -7.039  -4.926 1.00 . A A .  15 ALA C    1 1 
        4  7530 1 1  15 ALA CA   C  -1.699  -7.140  -4.049 1.00 . A A .  15 ALA CA   1 1 
        4  7531 1 1  15 ALA CB   C  -1.972  -6.483  -2.695 1.00 . A A .  15 ALA CB   1 1 
        4  7532 1 1  15 ALA H    H  -0.742  -5.641  -5.271 1.00 . A A .  15 ALA H    1 1 
        4  7533 1 1  15 ALA HA   H  -1.448  -8.183  -3.900 1.00 . A A .  15 ALA HA   1 1 
        4  7534 1 1  15 ALA HB1  H  -2.875  -6.897  -2.268 1.00 . A A .  15 ALA HB1  1 1 
        4  7535 1 1  15 ALA HB2  H  -2.092  -5.417  -2.829 1.00 . A A .  15 ALA HB2  1 1 
        4  7536 1 1  15 ALA HB3  H  -1.141  -6.669  -2.030 1.00 . A A .  15 ALA HB3  1 1 
        4  7537 1 1  15 ALA N    N  -0.567  -6.434  -4.721 1.00 . A A .  15 ALA N    1 1 
        4  7538 1 1  15 ALA O    O  -3.189  -6.032  -5.561 1.00 . A A .  15 ALA O    1 1 
        4  7539 1 1  16 HIS C    C  -6.168  -7.768  -4.891 1.00 . A A .  16 HIS C    1 1 
        4  7540 1 1  16 HIS CA   C  -4.974  -8.054  -5.800 1.00 . A A .  16 HIS CA   1 1 
        4  7541 1 1  16 HIS CB   C  -5.155  -9.417  -6.469 1.00 . A A .  16 HIS CB   1 1 
        4  7542 1 1  16 HIS CD2  C  -7.625 -10.061  -7.073 1.00 . A A .  16 HIS CD2  1 1 
        4  7543 1 1  16 HIS CE1  C  -7.818  -8.900  -8.892 1.00 . A A .  16 HIS CE1  1 1 
        4  7544 1 1  16 HIS CG   C  -6.428  -9.418  -7.262 1.00 . A A .  16 HIS CG   1 1 
        4  7545 1 1  16 HIS H    H  -3.515  -8.875  -4.442 1.00 . A A .  16 HIS H    1 1 
        4  7546 1 1  16 HIS HA   H  -4.903  -7.285  -6.558 1.00 . A A .  16 HIS HA   1 1 
        4  7547 1 1  16 HIS HB2  H  -4.319  -9.608  -7.127 1.00 . A A .  16 HIS HB2  1 1 
        4  7548 1 1  16 HIS HB3  H  -5.201 -10.185  -5.714 1.00 . A A .  16 HIS HB3  1 1 
        4  7549 1 1  16 HIS HD1  H  -5.893  -8.107  -8.838 1.00 . A A .  16 HIS HD1  1 1 
        4  7550 1 1  16 HIS HD2  H  -7.853 -10.722  -6.250 1.00 . A A .  16 HIS HD2  1 1 
        4  7551 1 1  16 HIS HE1  H  -8.214  -8.455  -9.793 1.00 . A A .  16 HIS HE1  1 1 
        4  7552 1 1  16 HIS N    N  -3.734  -8.077  -4.967 1.00 . A A .  16 HIS N    1 1 
        4  7553 1 1  16 HIS ND1  N  -6.573  -8.683  -8.428 1.00 . A A .  16 HIS ND1  1 1 
        4  7554 1 1  16 HIS NE2  N  -8.502  -9.733  -8.103 1.00 . A A .  16 HIS NE2  1 1 
        4  7555 1 1  16 HIS O    O  -6.494  -8.551  -4.022 1.00 . A A .  16 HIS O    1 1 
        4  7556 1 1  17 LEU C    C  -9.271  -6.336  -5.054 1.00 . A A .  17 LEU C    1 1 
        4  7557 1 1  17 LEU CA   C  -7.992  -6.291  -4.221 1.00 . A A .  17 LEU CA   1 1 
        4  7558 1 1  17 LEU CB   C  -7.800  -4.878  -3.654 1.00 . A A .  17 LEU CB   1 1 
        4  7559 1 1  17 LEU CD1  C  -5.308  -4.440  -3.535 1.00 . A A .  17 LEU CD1  1 1 
        4  7560 1 1  17 LEU CD2  C  -6.765  -3.823  -1.608 1.00 . A A .  17 LEU CD2  1 1 
        4  7561 1 1  17 LEU CG   C  -6.553  -4.842  -2.733 1.00 . A A .  17 LEU CG   1 1 
        4  7562 1 1  17 LEU H    H  -6.528  -6.032  -5.786 1.00 . A A .  17 LEU H    1 1 
        4  7563 1 1  17 LEU HA   H  -8.083  -6.989  -3.401 1.00 . A A .  17 LEU HA   1 1 
        4  7564 1 1  17 LEU HB2  H  -7.675  -4.181  -4.471 1.00 . A A .  17 LEU HB2  1 1 
        4  7565 1 1  17 LEU HB3  H  -8.679  -4.606  -3.086 1.00 . A A .  17 LEU HB3  1 1 
        4  7566 1 1  17 LEU HD11 H  -5.116  -5.175  -4.300 1.00 . A A .  17 LEU HD11 1 1 
        4  7567 1 1  17 LEU HD12 H  -4.458  -4.381  -2.872 1.00 . A A .  17 LEU HD12 1 1 
        4  7568 1 1  17 LEU HD13 H  -5.474  -3.477  -3.994 1.00 . A A .  17 LEU HD13 1 1 
        4  7569 1 1  17 LEU HD21 H  -5.870  -3.762  -1.006 1.00 . A A .  17 LEU HD21 1 1 
        4  7570 1 1  17 LEU HD22 H  -7.593  -4.138  -0.990 1.00 . A A .  17 LEU HD22 1 1 
        4  7571 1 1  17 LEU HD23 H  -6.980  -2.856  -2.034 1.00 . A A .  17 LEU HD23 1 1 
        4  7572 1 1  17 LEU HG   H  -6.391  -5.821  -2.297 1.00 . A A .  17 LEU HG   1 1 
        4  7573 1 1  17 LEU N    N  -6.817  -6.647  -5.079 1.00 . A A .  17 LEU N    1 1 
        4  7574 1 1  17 LEU O    O  -9.334  -5.817  -6.149 1.00 . A A .  17 LEU O    1 1 
        4  7575 1 1  18 ALA C    C -12.414  -5.808  -5.028 1.00 . A A .  18 ALA C    1 1 
        4  7576 1 1  18 ALA CA   C -11.572  -7.060  -5.290 1.00 . A A .  18 ALA CA   1 1 
        4  7577 1 1  18 ALA CB   C -12.336  -8.298  -4.816 1.00 . A A .  18 ALA CB   1 1 
        4  7578 1 1  18 ALA H    H -10.210  -7.379  -3.654 1.00 . A A .  18 ALA H    1 1 
        4  7579 1 1  18 ALA HA   H -11.370  -7.146  -6.347 1.00 . A A .  18 ALA HA   1 1 
        4  7580 1 1  18 ALA HB1  H -12.652  -8.154  -3.793 1.00 . A A .  18 ALA HB1  1 1 
        4  7581 1 1  18 ALA HB2  H -11.692  -9.164  -4.874 1.00 . A A .  18 ALA HB2  1 1 
        4  7582 1 1  18 ALA HB3  H -13.202  -8.452  -5.442 1.00 . A A .  18 ALA HB3  1 1 
        4  7583 1 1  18 ALA N    N -10.290  -6.965  -4.538 1.00 . A A .  18 ALA N    1 1 
        4  7584 1 1  18 ALA O    O -13.431  -5.863  -4.365 1.00 . A A .  18 ALA O    1 1 
        4  7585 1 1  19 ALA C    C -12.136  -2.286  -6.134 1.00 . A A .  19 ALA C    1 1 
        4  7586 1 1  19 ALA CA   C -12.786  -3.432  -5.338 1.00 . A A .  19 ALA CA   1 1 
        4  7587 1 1  19 ALA CB   C -12.798  -3.086  -3.841 1.00 . A A .  19 ALA CB   1 1 
        4  7588 1 1  19 ALA H    H -11.180  -4.662  -6.085 1.00 . A A .  19 ALA H    1 1 
        4  7589 1 1  19 ALA HA   H -13.797  -3.591  -5.680 1.00 . A A .  19 ALA HA   1 1 
        4  7590 1 1  19 ALA HB1  H -13.603  -3.618  -3.355 1.00 . A A .  19 ALA HB1  1 1 
        4  7591 1 1  19 ALA HB2  H -12.940  -2.022  -3.710 1.00 . A A .  19 ALA HB2  1 1 
        4  7592 1 1  19 ALA HB3  H -11.858  -3.378  -3.400 1.00 . A A .  19 ALA HB3  1 1 
        4  7593 1 1  19 ALA N    N -12.003  -4.684  -5.550 1.00 . A A .  19 ALA N    1 1 
        4  7594 1 1  19 ALA O    O -10.945  -2.291  -6.371 1.00 . A A .  19 ALA O    1 1 
        4  7595 1 1  20 PRO C    C -11.436   0.728  -6.502 1.00 . A A .  20 PRO C    1 1 
        4  7596 1 1  20 PRO CA   C -12.399  -0.144  -7.326 1.00 . A A .  20 PRO CA   1 1 
        4  7597 1 1  20 PRO CB   C -13.674   0.643  -7.693 1.00 . A A .  20 PRO CB   1 1 
        4  7598 1 1  20 PRO CD   C -14.364  -1.210  -6.304 1.00 . A A .  20 PRO CD   1 1 
        4  7599 1 1  20 PRO CG   C -14.697   0.230  -6.680 1.00 . A A .  20 PRO CG   1 1 
        4  7600 1 1  20 PRO HA   H -11.913  -0.488  -8.224 1.00 . A A .  20 PRO HA   1 1 
        4  7601 1 1  20 PRO HB2  H -13.496   1.711  -7.637 1.00 . A A .  20 PRO HB2  1 1 
        4  7602 1 1  20 PRO HB3  H -14.008   0.373  -8.685 1.00 . A A .  20 PRO HB3  1 1 
        4  7603 1 1  20 PRO HD2  H -14.597  -1.398  -5.263 1.00 . A A .  20 PRO HD2  1 1 
        4  7604 1 1  20 PRO HD3  H -14.893  -1.904  -6.940 1.00 . A A .  20 PRO HD3  1 1 
        4  7605 1 1  20 PRO HG2  H -14.634   0.869  -5.806 1.00 . A A .  20 PRO HG2  1 1 
        4  7606 1 1  20 PRO HG3  H -15.690   0.277  -7.102 1.00 . A A .  20 PRO HG3  1 1 
        4  7607 1 1  20 PRO N    N -12.914  -1.311  -6.541 1.00 . A A .  20 PRO N    1 1 
        4  7608 1 1  20 PRO O    O -11.404   0.649  -5.291 1.00 . A A .  20 PRO O    1 1 
        4  7609 1 1  21 PRO C    C -10.414   3.460  -5.557 1.00 . A A .  21 PRO C    1 1 
        4  7610 1 1  21 PRO CA   C  -9.696   2.467  -6.479 1.00 . A A .  21 PRO CA   1 1 
        4  7611 1 1  21 PRO CB   C  -8.975   3.191  -7.637 1.00 . A A .  21 PRO CB   1 1 
        4  7612 1 1  21 PRO CD   C -10.633   1.728  -8.625 1.00 . A A .  21 PRO CD   1 1 
        4  7613 1 1  21 PRO CG   C  -9.881   3.044  -8.822 1.00 . A A .  21 PRO CG   1 1 
        4  7614 1 1  21 PRO HA   H  -8.985   1.888  -5.912 1.00 . A A .  21 PRO HA   1 1 
        4  7615 1 1  21 PRO HB2  H  -8.825   4.238  -7.400 1.00 . A A .  21 PRO HB2  1 1 
        4  7616 1 1  21 PRO HB3  H  -8.024   2.718  -7.839 1.00 . A A .  21 PRO HB3  1 1 
        4  7617 1 1  21 PRO HD2  H -11.635   1.798  -9.025 1.00 . A A .  21 PRO HD2  1 1 
        4  7618 1 1  21 PRO HD3  H -10.096   0.910  -9.081 1.00 . A A .  21 PRO HD3  1 1 
        4  7619 1 1  21 PRO HG2  H -10.579   3.873  -8.863 1.00 . A A .  21 PRO HG2  1 1 
        4  7620 1 1  21 PRO HG3  H  -9.304   3.002  -9.736 1.00 . A A .  21 PRO HG3  1 1 
        4  7621 1 1  21 PRO N    N -10.666   1.560  -7.161 1.00 . A A .  21 PRO N    1 1 
        4  7622 1 1  21 PRO O    O  -9.861   3.931  -4.582 1.00 . A A .  21 PRO O    1 1 
        4  7623 1 1  22 ALA C    C -12.582   4.121  -3.612 1.00 . A A .  22 ALA C    1 1 
        4  7624 1 1  22 ALA CA   C -12.407   4.720  -5.007 1.00 . A A .  22 ALA CA   1 1 
        4  7625 1 1  22 ALA CB   C -13.782   4.964  -5.634 1.00 . A A .  22 ALA CB   1 1 
        4  7626 1 1  22 ALA H    H -12.067   3.372  -6.650 1.00 . A A .  22 ALA H    1 1 
        4  7627 1 1  22 ALA HA   H -11.873   5.654  -4.933 1.00 . A A .  22 ALA HA   1 1 
        4  7628 1 1  22 ALA HB1  H -14.334   5.674  -5.035 1.00 . A A .  22 ALA HB1  1 1 
        4  7629 1 1  22 ALA HB2  H -14.326   4.032  -5.678 1.00 . A A .  22 ALA HB2  1 1 
        4  7630 1 1  22 ALA HB3  H -13.659   5.357  -6.633 1.00 . A A .  22 ALA HB3  1 1 
        4  7631 1 1  22 ALA N    N -11.644   3.770  -5.860 1.00 . A A .  22 ALA N    1 1 
        4  7632 1 1  22 ALA O    O -12.426   4.792  -2.611 1.00 . A A .  22 ALA O    1 1 
        4  7633 1 1  23 ALA C    C -11.755   2.173  -1.464 1.00 . A A .  23 ALA C    1 1 
        4  7634 1 1  23 ALA CA   C -13.089   2.209  -2.212 1.00 . A A .  23 ALA CA   1 1 
        4  7635 1 1  23 ALA CB   C -13.602   0.783  -2.414 1.00 . A A .  23 ALA CB   1 1 
        4  7636 1 1  23 ALA H    H -13.021   2.335  -4.361 1.00 . A A .  23 ALA H    1 1 
        4  7637 1 1  23 ALA HA   H -13.807   2.772  -1.635 1.00 . A A .  23 ALA HA   1 1 
        4  7638 1 1  23 ALA HB1  H -14.613   0.814  -2.797 1.00 . A A .  23 ALA HB1  1 1 
        4  7639 1 1  23 ALA HB2  H -13.591   0.256  -1.471 1.00 . A A .  23 ALA HB2  1 1 
        4  7640 1 1  23 ALA HB3  H -12.967   0.270  -3.121 1.00 . A A .  23 ALA HB3  1 1 
        4  7641 1 1  23 ALA N    N -12.903   2.857  -3.540 1.00 . A A .  23 ALA N    1 1 
        4  7642 1 1  23 ALA O    O -11.679   2.499  -0.294 1.00 . A A .  23 ALA O    1 1 
        4  7643 1 1  24 VAL C    C  -8.962   3.138  -1.041 1.00 . A A .  24 VAL C    1 1 
        4  7644 1 1  24 VAL CA   C  -9.374   1.724  -1.454 1.00 . A A .  24 VAL CA   1 1 
        4  7645 1 1  24 VAL CB   C  -8.340   1.151  -2.426 1.00 . A A .  24 VAL CB   1 1 
        4  7646 1 1  24 VAL CG1  C  -6.947   1.222  -1.794 1.00 . A A .  24 VAL CG1  1 1 
        4  7647 1 1  24 VAL CG2  C  -8.689  -0.308  -2.742 1.00 . A A .  24 VAL CG2  1 1 
        4  7648 1 1  24 VAL H    H -10.786   1.522  -3.070 1.00 . A A .  24 VAL H    1 1 
        4  7649 1 1  24 VAL HA   H  -9.438   1.095  -0.579 1.00 . A A .  24 VAL HA   1 1 
        4  7650 1 1  24 VAL HB   H  -8.347   1.729  -3.338 1.00 . A A .  24 VAL HB   1 1 
        4  7651 1 1  24 VAL HG11 H  -7.002   0.892  -0.767 1.00 . A A .  24 VAL HG11 1 1 
        4  7652 1 1  24 VAL HG12 H  -6.590   2.239  -1.827 1.00 . A A .  24 VAL HG12 1 1 
        4  7653 1 1  24 VAL HG13 H  -6.270   0.583  -2.340 1.00 . A A .  24 VAL HG13 1 1 
        4  7654 1 1  24 VAL HG21 H  -9.662  -0.352  -3.208 1.00 . A A .  24 VAL HG21 1 1 
        4  7655 1 1  24 VAL HG22 H  -8.702  -0.880  -1.828 1.00 . A A .  24 VAL HG22 1 1 
        4  7656 1 1  24 VAL HG23 H  -7.949  -0.719  -3.416 1.00 . A A .  24 VAL HG23 1 1 
        4  7657 1 1  24 VAL N    N -10.703   1.780  -2.127 1.00 . A A .  24 VAL N    1 1 
        4  7658 1 1  24 VAL O    O  -8.535   3.375   0.071 1.00 . A A .  24 VAL O    1 1 
        4  7659 1 1  25 PHE C    C  -9.593   5.994  -0.471 1.00 . A A .  25 PHE C    1 1 
        4  7660 1 1  25 PHE CA   C  -8.725   5.483  -1.621 1.00 . A A .  25 PHE CA   1 1 
        4  7661 1 1  25 PHE CB   C  -8.942   6.350  -2.862 1.00 . A A .  25 PHE CB   1 1 
        4  7662 1 1  25 PHE CD1  C  -7.191   8.103  -2.402 1.00 . A A .  25 PHE CD1  1 1 
        4  7663 1 1  25 PHE CD2  C  -9.522   8.771  -2.448 1.00 . A A .  25 PHE CD2  1 1 
        4  7664 1 1  25 PHE CE1  C  -6.819   9.425  -2.125 1.00 . A A .  25 PHE CE1  1 1 
        4  7665 1 1  25 PHE CE2  C  -9.150  10.091  -2.172 1.00 . A A .  25 PHE CE2  1 1 
        4  7666 1 1  25 PHE CG   C  -8.543   7.776  -2.561 1.00 . A A .  25 PHE CG   1 1 
        4  7667 1 1  25 PHE CZ   C  -7.798  10.418  -2.014 1.00 . A A .  25 PHE CZ   1 1 
        4  7668 1 1  25 PHE H    H  -9.449   3.854  -2.823 1.00 . A A .  25 PHE H    1 1 
        4  7669 1 1  25 PHE HA   H  -7.686   5.524  -1.330 1.00 . A A .  25 PHE HA   1 1 
        4  7670 1 1  25 PHE HB2  H  -8.336   5.973  -3.674 1.00 . A A .  25 PHE HB2  1 1 
        4  7671 1 1  25 PHE HB3  H  -9.984   6.318  -3.147 1.00 . A A .  25 PHE HB3  1 1 
        4  7672 1 1  25 PHE HD1  H  -6.437   7.336  -2.488 1.00 . A A .  25 PHE HD1  1 1 
        4  7673 1 1  25 PHE HD2  H -10.565   8.519  -2.570 1.00 . A A .  25 PHE HD2  1 1 
        4  7674 1 1  25 PHE HE1  H  -5.776   9.678  -2.003 1.00 . A A .  25 PHE HE1  1 1 
        4  7675 1 1  25 PHE HE2  H  -9.905  10.857  -2.085 1.00 . A A .  25 PHE HE2  1 1 
        4  7676 1 1  25 PHE HZ   H  -7.512  11.438  -1.803 1.00 . A A .  25 PHE HZ   1 1 
        4  7677 1 1  25 PHE N    N  -9.097   4.076  -1.936 1.00 . A A .  25 PHE N    1 1 
        4  7678 1 1  25 PHE O    O  -9.118   6.642   0.442 1.00 . A A .  25 PHE O    1 1 
        4  7679 1 1  26 ALA C    C -11.268   5.705   1.922 1.00 . A A .  26 ALA C    1 1 
        4  7680 1 1  26 ALA CA   C -11.775   6.189   0.562 1.00 . A A .  26 ALA CA   1 1 
        4  7681 1 1  26 ALA CB   C -13.177   5.628   0.316 1.00 . A A .  26 ALA CB   1 1 
        4  7682 1 1  26 ALA H    H -11.224   5.195  -1.267 1.00 . A A .  26 ALA H    1 1 
        4  7683 1 1  26 ALA HA   H -11.814   7.268   0.554 1.00 . A A .  26 ALA HA   1 1 
        4  7684 1 1  26 ALA HB1  H -13.839   5.945   1.109 1.00 . A A .  26 ALA HB1  1 1 
        4  7685 1 1  26 ALA HB2  H -13.134   4.550   0.295 1.00 . A A .  26 ALA HB2  1 1 
        4  7686 1 1  26 ALA HB3  H -13.551   5.991  -0.631 1.00 . A A .  26 ALA HB3  1 1 
        4  7687 1 1  26 ALA N    N -10.865   5.714  -0.516 1.00 . A A .  26 ALA N    1 1 
        4  7688 1 1  26 ALA O    O -11.265   6.442   2.889 1.00 . A A .  26 ALA O    1 1 
        4  7689 1 1  27 LEU C    C  -9.097   4.736   3.729 1.00 . A A .  27 LEU C    1 1 
        4  7690 1 1  27 LEU CA   C -10.339   3.948   3.303 1.00 . A A .  27 LEU CA   1 1 
        4  7691 1 1  27 LEU CB   C  -9.977   2.469   3.137 1.00 . A A .  27 LEU CB   1 1 
        4  7692 1 1  27 LEU CD1  C -10.855   0.236   2.455 1.00 . A A .  27 LEU CD1  1 1 
        4  7693 1 1  27 LEU CD2  C -12.066   1.543   4.226 1.00 . A A .  27 LEU CD2  1 1 
        4  7694 1 1  27 LEU CG   C -11.251   1.640   2.919 1.00 . A A .  27 LEU CG   1 1 
        4  7695 1 1  27 LEU H    H -10.855   3.900   1.212 1.00 . A A .  27 LEU H    1 1 
        4  7696 1 1  27 LEU HA   H -11.103   4.054   4.056 1.00 . A A .  27 LEU HA   1 1 
        4  7697 1 1  27 LEU HB2  H  -9.329   2.358   2.282 1.00 . A A .  27 LEU HB2  1 1 
        4  7698 1 1  27 LEU HB3  H  -9.466   2.121   4.020 1.00 . A A .  27 LEU HB3  1 1 
        4  7699 1 1  27 LEU HD11 H -11.740  -0.374   2.360 1.00 . A A .  27 LEU HD11 1 1 
        4  7700 1 1  27 LEU HD12 H -10.188  -0.205   3.180 1.00 . A A .  27 LEU HD12 1 1 
        4  7701 1 1  27 LEU HD13 H -10.357   0.301   1.498 1.00 . A A .  27 LEU HD13 1 1 
        4  7702 1 1  27 LEU HD21 H -12.682   0.654   4.206 1.00 . A A .  27 LEU HD21 1 1 
        4  7703 1 1  27 LEU HD22 H -12.701   2.411   4.319 1.00 . A A .  27 LEU HD22 1 1 
        4  7704 1 1  27 LEU HD23 H -11.401   1.493   5.074 1.00 . A A .  27 LEU HD23 1 1 
        4  7705 1 1  27 LEU HG   H -11.854   2.110   2.152 1.00 . A A .  27 LEU HG   1 1 
        4  7706 1 1  27 LEU N    N -10.842   4.477   2.004 1.00 . A A .  27 LEU N    1 1 
        4  7707 1 1  27 LEU O    O  -8.945   5.096   4.881 1.00 . A A .  27 LEU O    1 1 
        4  7708 1 1  28 MET C    C  -7.350   7.205   3.547 1.00 . A A .  28 MET C    1 1 
        4  7709 1 1  28 MET CA   C  -6.979   5.770   3.161 1.00 . A A .  28 MET CA   1 1 
        4  7710 1 1  28 MET CB   C  -6.036   5.795   1.956 1.00 . A A .  28 MET CB   1 1 
        4  7711 1 1  28 MET CE   C  -4.112   2.651   0.139 1.00 . A A .  28 MET CE   1 1 
        4  7712 1 1  28 MET CG   C  -5.474   4.395   1.717 1.00 . A A .  28 MET CG   1 1 
        4  7713 1 1  28 MET H    H  -8.355   4.705   1.889 1.00 . A A .  28 MET H    1 1 
        4  7714 1 1  28 MET HA   H  -6.484   5.290   3.993 1.00 . A A .  28 MET HA   1 1 
        4  7715 1 1  28 MET HB2  H  -6.578   6.122   1.081 1.00 . A A .  28 MET HB2  1 1 
        4  7716 1 1  28 MET HB3  H  -5.221   6.478   2.151 1.00 . A A .  28 MET HB3  1 1 
        4  7717 1 1  28 MET HE1  H  -5.069   2.181  -0.042 1.00 . A A .  28 MET HE1  1 1 
        4  7718 1 1  28 MET HE2  H  -3.678   2.258   1.048 1.00 . A A .  28 MET HE2  1 1 
        4  7719 1 1  28 MET HE3  H  -3.452   2.449  -0.689 1.00 . A A .  28 MET HE3  1 1 
        4  7720 1 1  28 MET HG2  H  -4.943   4.064   2.597 1.00 . A A .  28 MET HG2  1 1 
        4  7721 1 1  28 MET HG3  H  -6.286   3.712   1.508 1.00 . A A .  28 MET HG3  1 1 
        4  7722 1 1  28 MET N    N  -8.211   5.006   2.810 1.00 . A A .  28 MET N    1 1 
        4  7723 1 1  28 MET O    O  -6.779   7.781   4.452 1.00 . A A .  28 MET O    1 1 
        4  7724 1 1  28 MET SD   S  -4.342   4.437   0.307 1.00 . A A .  28 MET SD   1 1 
        4  7725 1 1  29 THR C    C  -9.659   9.190   4.369 1.00 . A A .  29 THR C    1 1 
        4  7726 1 1  29 THR CA   C  -8.699   9.190   3.178 1.00 . A A .  29 THR CA   1 1 
        4  7727 1 1  29 THR CB   C  -9.386   9.812   1.953 1.00 . A A .  29 THR CB   1 1 
        4  7728 1 1  29 THR CG2  C  -9.353  11.339   2.061 1.00 . A A .  29 THR CG2  1 1 
        4  7729 1 1  29 THR H    H  -8.737   7.308   2.130 1.00 . A A .  29 THR H    1 1 
        4  7730 1 1  29 THR HA   H  -7.818   9.765   3.429 1.00 . A A .  29 THR HA   1 1 
        4  7731 1 1  29 THR HB   H -10.412   9.480   1.906 1.00 . A A .  29 THR HB   1 1 
        4  7732 1 1  29 THR HG1  H  -9.176   8.658   0.402 1.00 . A A .  29 THR HG1  1 1 
        4  7733 1 1  29 THR HG21 H  -8.330  11.669   2.166 1.00 . A A .  29 THR HG21 1 1 
        4  7734 1 1  29 THR HG22 H  -9.924  11.651   2.923 1.00 . A A .  29 THR HG22 1 1 
        4  7735 1 1  29 THR HG23 H  -9.781  11.773   1.168 1.00 . A A .  29 THR HG23 1 1 
        4  7736 1 1  29 THR N    N  -8.295   7.789   2.860 1.00 . A A .  29 THR N    1 1 
        4  7737 1 1  29 THR O    O -10.141  10.224   4.789 1.00 . A A .  29 THR O    1 1 
        4  7738 1 1  29 THR OG1  O  -8.703   9.405   0.776 1.00 . A A .  29 THR OG1  1 1 
        4  7739 1 1  30 ASP C    C -10.122   7.335   7.278 1.00 . A A .  30 ASP C    1 1 
        4  7740 1 1  30 ASP CA   C -10.876   7.934   6.081 1.00 . A A .  30 ASP CA   1 1 
        4  7741 1 1  30 ASP CB   C -12.045   7.022   5.709 1.00 . A A .  30 ASP CB   1 1 
        4  7742 1 1  30 ASP CG   C -13.015   7.783   4.801 1.00 . A A .  30 ASP CG   1 1 
        4  7743 1 1  30 ASP H    H  -9.537   7.218   4.544 1.00 . A A .  30 ASP H    1 1 
        4  7744 1 1  30 ASP HA   H -11.259   8.912   6.344 1.00 . A A .  30 ASP HA   1 1 
        4  7745 1 1  30 ASP HB2  H -11.669   6.152   5.189 1.00 . A A .  30 ASP HB2  1 1 
        4  7746 1 1  30 ASP HB3  H -12.562   6.709   6.605 1.00 . A A .  30 ASP HB3  1 1 
        4  7747 1 1  30 ASP N    N  -9.942   8.033   4.911 1.00 . A A .  30 ASP N    1 1 
        4  7748 1 1  30 ASP O    O -10.159   6.142   7.503 1.00 . A A .  30 ASP O    1 1 
        4  7749 1 1  30 ASP OD1  O -12.610   8.793   4.251 1.00 . A A .  30 ASP OD1  1 1 
        4  7750 1 1  30 ASP OD2  O -14.148   7.347   4.677 1.00 . A A .  30 ASP OD2  1 1 
        4  7751 1 1  31 PRO C    C  -9.512   6.853  10.178 1.00 . A A .  31 PRO C    1 1 
        4  7752 1 1  31 PRO CA   C  -8.661   7.695   9.222 1.00 . A A .  31 PRO CA   1 1 
        4  7753 1 1  31 PRO CB   C  -8.208   9.005   9.895 1.00 . A A .  31 PRO CB   1 1 
        4  7754 1 1  31 PRO CD   C  -9.333   9.611   7.844 1.00 . A A .  31 PRO CD   1 1 
        4  7755 1 1  31 PRO CG   C  -8.214  10.024   8.798 1.00 . A A .  31 PRO CG   1 1 
        4  7756 1 1  31 PRO HA   H  -7.798   7.137   8.902 1.00 . A A .  31 PRO HA   1 1 
        4  7757 1 1  31 PRO HB2  H  -8.901   9.289  10.678 1.00 . A A .  31 PRO HB2  1 1 
        4  7758 1 1  31 PRO HB3  H  -7.211   8.898  10.298 1.00 . A A .  31 PRO HB3  1 1 
        4  7759 1 1  31 PRO HD2  H -10.261  10.100   8.111 1.00 . A A .  31 PRO HD2  1 1 
        4  7760 1 1  31 PRO HD3  H  -9.065   9.832   6.824 1.00 . A A .  31 PRO HD3  1 1 
        4  7761 1 1  31 PRO HG2  H  -8.410  11.010   9.202 1.00 . A A .  31 PRO HG2  1 1 
        4  7762 1 1  31 PRO HG3  H  -7.271  10.017   8.273 1.00 . A A .  31 PRO HG3  1 1 
        4  7763 1 1  31 PRO N    N  -9.439   8.156   8.036 1.00 . A A .  31 PRO N    1 1 
        4  7764 1 1  31 PRO O    O  -9.048   5.887  10.755 1.00 . A A .  31 PRO O    1 1 
        4  7765 1 1  32 GLU C    C -11.869   5.046  10.703 1.00 . A A .  32 GLU C    1 1 
        4  7766 1 1  32 GLU CA   C -11.638   6.453  11.267 1.00 . A A .  32 GLU CA   1 1 
        4  7767 1 1  32 GLU CB   C -12.973   7.190  11.383 1.00 . A A .  32 GLU CB   1 1 
        4  7768 1 1  32 GLU CD   C -13.224   6.846  13.841 1.00 . A A .  32 GLU CD   1 1 
        4  7769 1 1  32 GLU CG   C -13.832   6.543  12.470 1.00 . A A .  32 GLU CG   1 1 
        4  7770 1 1  32 GLU H    H -11.097   8.001   9.875 1.00 . A A .  32 GLU H    1 1 
        4  7771 1 1  32 GLU HA   H -11.179   6.379  12.240 1.00 . A A .  32 GLU HA   1 1 
        4  7772 1 1  32 GLU HB2  H -12.790   8.225  11.637 1.00 . A A .  32 GLU HB2  1 1 
        4  7773 1 1  32 GLU HB3  H -13.494   7.140  10.439 1.00 . A A .  32 GLU HB3  1 1 
        4  7774 1 1  32 GLU HG2  H -14.834   6.944  12.421 1.00 . A A .  32 GLU HG2  1 1 
        4  7775 1 1  32 GLU HG3  H -13.862   5.477  12.320 1.00 . A A .  32 GLU HG3  1 1 
        4  7776 1 1  32 GLU N    N -10.750   7.217  10.350 1.00 . A A .  32 GLU N    1 1 
        4  7777 1 1  32 GLU O    O -11.849   4.067  11.421 1.00 . A A .  32 GLU O    1 1 
        4  7778 1 1  32 GLU OE1  O -12.291   7.632  13.895 1.00 . A A .  32 GLU OE1  1 1 
        4  7779 1 1  32 GLU OE2  O -13.703   6.290  14.815 1.00 . A A .  32 GLU OE2  1 1 
        4  7780 1 1  33 LYS C    C -11.059   2.748   8.925 1.00 . A A .  33 LYS C    1 1 
        4  7781 1 1  33 LYS CA   C -12.322   3.605   8.805 1.00 . A A .  33 LYS CA   1 1 
        4  7782 1 1  33 LYS CB   C -12.704   3.771   7.331 1.00 . A A .  33 LYS CB   1 1 
        4  7783 1 1  33 LYS CD   C -14.504   4.520   5.763 1.00 . A A .  33 LYS CD   1 1 
        4  7784 1 1  33 LYS CE   C -15.867   5.210   5.662 1.00 . A A .  33 LYS CE   1 1 
        4  7785 1 1  33 LYS CG   C -14.111   4.370   7.234 1.00 . A A .  33 LYS CG   1 1 
        4  7786 1 1  33 LYS H    H -12.100   5.749   8.862 1.00 . A A .  33 LYS H    1 1 
        4  7787 1 1  33 LYS HA   H -13.130   3.113   9.327 1.00 . A A .  33 LYS HA   1 1 
        4  7788 1 1  33 LYS HB2  H -11.998   4.431   6.847 1.00 . A A .  33 LYS HB2  1 1 
        4  7789 1 1  33 LYS HB3  H -12.691   2.809   6.843 1.00 . A A .  33 LYS HB3  1 1 
        4  7790 1 1  33 LYS HD2  H -13.761   5.109   5.252 1.00 . A A .  33 LYS HD2  1 1 
        4  7791 1 1  33 LYS HD3  H -14.563   3.542   5.307 1.00 . A A .  33 LYS HD3  1 1 
        4  7792 1 1  33 LYS HE2  H -15.844   6.136   6.216 1.00 . A A .  33 LYS HE2  1 1 
        4  7793 1 1  33 LYS HE3  H -16.088   5.416   4.624 1.00 . A A .  33 LYS HE3  1 1 
        4  7794 1 1  33 LYS HG2  H -14.814   3.716   7.731 1.00 . A A .  33 LYS HG2  1 1 
        4  7795 1 1  33 LYS HG3  H -14.122   5.339   7.708 1.00 . A A .  33 LYS HG3  1 1 
        4  7796 1 1  33 LYS HZ1  H -16.487   3.654   6.898 1.00 . A A .  33 LYS HZ1  1 1 
        4  7797 1 1  33 LYS HZ2  H -17.370   3.784   5.457 1.00 . A A .  33 LYS HZ2  1 1 
        4  7798 1 1  33 LYS HZ3  H -17.634   4.894   6.715 1.00 . A A .  33 LYS HZ3  1 1 
        4  7799 1 1  33 LYS N    N -12.088   4.943   9.420 1.00 . A A .  33 LYS N    1 1 
        4  7800 1 1  33 LYS NZ   N -16.919   4.318   6.226 1.00 . A A .  33 LYS NZ   1 1 
        4  7801 1 1  33 LYS O    O -11.127   1.541   9.038 1.00 . A A .  33 LYS O    1 1 
        4  7802 1 1  34 ILE C    C  -8.591   1.852  10.339 1.00 . A A .  34 ILE C    1 1 
        4  7803 1 1  34 ILE CA   C  -8.641   2.571   8.990 1.00 . A A .  34 ILE CA   1 1 
        4  7804 1 1  34 ILE CB   C  -7.435   3.511   8.869 1.00 . A A .  34 ILE CB   1 1 
        4  7805 1 1  34 ILE CD1  C  -6.283   5.154   7.331 1.00 . A A .  34 ILE CD1  1 1 
        4  7806 1 1  34 ILE CG1  C  -7.385   4.087   7.447 1.00 . A A .  34 ILE CG1  1 1 
        4  7807 1 1  34 ILE CG2  C  -6.144   2.731   9.157 1.00 . A A .  34 ILE CG2  1 1 
        4  7808 1 1  34 ILE H    H  -9.869   4.333   8.791 1.00 . A A .  34 ILE H    1 1 
        4  7809 1 1  34 ILE HA   H  -8.608   1.844   8.196 1.00 . A A .  34 ILE HA   1 1 
        4  7810 1 1  34 ILE HB   H  -7.536   4.315   9.583 1.00 . A A .  34 ILE HB   1 1 
        4  7811 1 1  34 ILE HD11 H  -5.364   4.682   7.013 1.00 . A A .  34 ILE HD11 1 1 
        4  7812 1 1  34 ILE HD12 H  -6.128   5.635   8.286 1.00 . A A .  34 ILE HD12 1 1 
        4  7813 1 1  34 ILE HD13 H  -6.576   5.894   6.602 1.00 . A A .  34 ILE HD13 1 1 
        4  7814 1 1  34 ILE HG12 H  -7.187   3.292   6.746 1.00 . A A .  34 ILE HG12 1 1 
        4  7815 1 1  34 ILE HG13 H  -8.339   4.539   7.214 1.00 . A A .  34 ILE HG13 1 1 
        4  7816 1 1  34 ILE HG21 H  -5.289   3.321   8.864 1.00 . A A .  34 ILE HG21 1 1 
        4  7817 1 1  34 ILE HG22 H  -6.151   1.806   8.600 1.00 . A A .  34 ILE HG22 1 1 
        4  7818 1 1  34 ILE HG23 H  -6.082   2.512  10.213 1.00 . A A .  34 ILE HG23 1 1 
        4  7819 1 1  34 ILE N    N  -9.905   3.359   8.892 1.00 . A A .  34 ILE N    1 1 
        4  7820 1 1  34 ILE O    O  -8.207   0.701  10.427 1.00 . A A .  34 ILE O    1 1 
        4  7821 1 1  35 LEU C    C  -9.785   0.628  12.741 1.00 . A A .  35 LEU C    1 1 
        4  7822 1 1  35 LEU CA   C  -8.916   1.887  12.737 1.00 . A A .  35 LEU CA   1 1 
        4  7823 1 1  35 LEU CB   C  -9.443   2.879  13.775 1.00 . A A .  35 LEU CB   1 1 
        4  7824 1 1  35 LEU CD1  C  -9.208   5.185  14.702 1.00 . A A .  35 LEU CD1  1 1 
        4  7825 1 1  35 LEU CD2  C  -7.159   3.903  14.034 1.00 . A A .  35 LEU CD2  1 1 
        4  7826 1 1  35 LEU CG   C  -8.635   4.180  13.700 1.00 . A A .  35 LEU CG   1 1 
        4  7827 1 1  35 LEU H    H  -9.251   3.455  11.298 1.00 . A A .  35 LEU H    1 1 
        4  7828 1 1  35 LEU HA   H  -7.901   1.619  12.978 1.00 . A A .  35 LEU HA   1 1 
        4  7829 1 1  35 LEU HB2  H -10.484   3.089  13.573 1.00 . A A .  35 LEU HB2  1 1 
        4  7830 1 1  35 LEU HB3  H  -9.346   2.454  14.763 1.00 . A A .  35 LEU HB3  1 1 
        4  7831 1 1  35 LEU HD11 H  -9.295   4.717  15.671 1.00 . A A .  35 LEU HD11 1 1 
        4  7832 1 1  35 LEU HD12 H -10.184   5.507  14.370 1.00 . A A .  35 LEU HD12 1 1 
        4  7833 1 1  35 LEU HD13 H  -8.551   6.037  14.771 1.00 . A A .  35 LEU HD13 1 1 
        4  7834 1 1  35 LEU HD21 H  -6.685   4.811  14.378 1.00 . A A .  35 LEU HD21 1 1 
        4  7835 1 1  35 LEU HD22 H  -6.649   3.551  13.148 1.00 . A A .  35 LEU HD22 1 1 
        4  7836 1 1  35 LEU HD23 H  -7.098   3.151  14.808 1.00 . A A .  35 LEU HD23 1 1 
        4  7837 1 1  35 LEU HG   H  -8.710   4.590  12.702 1.00 . A A .  35 LEU HG   1 1 
        4  7838 1 1  35 LEU N    N  -8.959   2.524  11.392 1.00 . A A .  35 LEU N    1 1 
        4  7839 1 1  35 LEU O    O  -9.720  -0.180  13.648 1.00 . A A .  35 LEU O    1 1 
        4  7840 1 1  36 ARG C    C -10.600  -2.016  11.542 1.00 . A A .  36 ARG C    1 1 
        4  7841 1 1  36 ARG CA   C -11.467  -0.760  11.680 1.00 . A A .  36 ARG CA   1 1 
        4  7842 1 1  36 ARG CB   C -12.408  -0.651  10.477 1.00 . A A .  36 ARG CB   1 1 
        4  7843 1 1  36 ARG CD   C -14.319  -1.710   9.273 1.00 . A A .  36 ARG CD   1 1 
        4  7844 1 1  36 ARG CG   C -13.373  -1.837  10.468 1.00 . A A .  36 ARG CG   1 1 
        4  7845 1 1  36 ARG CZ   C -14.133  -1.681   6.859 1.00 . A A .  36 ARG CZ   1 1 
        4  7846 1 1  36 ARG H    H -10.632   1.113  11.012 1.00 . A A .  36 ARG H    1 1 
        4  7847 1 1  36 ARG HA   H -12.051  -0.824  12.586 1.00 . A A .  36 ARG HA   1 1 
        4  7848 1 1  36 ARG HB2  H -12.970   0.269  10.541 1.00 . A A .  36 ARG HB2  1 1 
        4  7849 1 1  36 ARG HB3  H -11.826  -0.657   9.566 1.00 . A A .  36 ARG HB3  1 1 
        4  7850 1 1  36 ARG HD2  H -15.065  -2.490   9.320 1.00 . A A .  36 ARG HD2  1 1 
        4  7851 1 1  36 ARG HD3  H -14.803  -0.746   9.296 1.00 . A A .  36 ARG HD3  1 1 
        4  7852 1 1  36 ARG HE   H -12.583  -2.050   8.043 1.00 . A A .  36 ARG HE   1 1 
        4  7853 1 1  36 ARG HG2  H -12.813  -2.758  10.390 1.00 . A A .  36 ARG HG2  1 1 
        4  7854 1 1  36 ARG HG3  H -13.948  -1.840  11.380 1.00 . A A .  36 ARG HG3  1 1 
        4  7855 1 1  36 ARG HH11 H -15.934  -1.327   7.662 1.00 . A A .  36 ARG HH11 1 1 
        4  7856 1 1  36 ARG HH12 H -15.863  -1.286   5.931 1.00 . A A .  36 ARG HH12 1 1 
        4  7857 1 1  36 ARG HH21 H -12.472  -2.000   5.787 1.00 . A A .  36 ARG HH21 1 1 
        4  7858 1 1  36 ARG HH22 H -13.903  -1.667   4.872 1.00 . A A .  36 ARG HH22 1 1 
        4  7859 1 1  36 ARG N    N -10.597   0.450  11.734 1.00 . A A .  36 ARG N    1 1 
        4  7860 1 1  36 ARG NE   N -13.541  -1.844   8.010 1.00 . A A .  36 ARG NE   1 1 
        4  7861 1 1  36 ARG NH1  N -15.410  -1.410   6.814 1.00 . A A .  36 ARG NH1  1 1 
        4  7862 1 1  36 ARG NH2  N -13.450  -1.791   5.753 1.00 . A A .  36 ARG NH2  1 1 
        4  7863 1 1  36 ARG O    O -10.842  -3.016  12.189 1.00 . A A .  36 ARG O    1 1 
        4  7864 1 1  37 TRP C    C  -7.320  -2.884  11.083 1.00 . A A .  37 TRP C    1 1 
        4  7865 1 1  37 TRP CA   C  -8.707  -3.167  10.500 1.00 . A A .  37 TRP CA   1 1 
        4  7866 1 1  37 TRP CB   C  -8.595  -3.479   9.002 1.00 . A A .  37 TRP CB   1 1 
        4  7867 1 1  37 TRP CD1  C  -9.006  -1.248   7.884 1.00 . A A .  37 TRP CD1  1 1 
        4  7868 1 1  37 TRP CD2  C  -6.863  -1.914   7.720 1.00 . A A .  37 TRP CD2  1 1 
        4  7869 1 1  37 TRP CE2  C  -6.953  -0.667   7.056 1.00 . A A .  37 TRP CE2  1 1 
        4  7870 1 1  37 TRP CE3  C  -5.612  -2.554   7.763 1.00 . A A .  37 TRP CE3  1 1 
        4  7871 1 1  37 TRP CG   C  -8.180  -2.257   8.243 1.00 . A A .  37 TRP CG   1 1 
        4  7872 1 1  37 TRP CH2  C  -4.604  -0.728   6.504 1.00 . A A .  37 TRP CH2  1 1 
        4  7873 1 1  37 TRP CZ2  C  -5.840  -0.078   6.454 1.00 . A A .  37 TRP CZ2  1 1 
        4  7874 1 1  37 TRP CZ3  C  -4.491  -1.963   7.157 1.00 . A A .  37 TRP CZ3  1 1 
        4  7875 1 1  37 TRP H    H  -9.428  -1.155  10.186 1.00 . A A .  37 TRP H    1 1 
        4  7876 1 1  37 TRP HA   H  -9.128  -4.028  11.005 1.00 . A A .  37 TRP HA   1 1 
        4  7877 1 1  37 TRP HB2  H  -7.861  -4.257   8.853 1.00 . A A .  37 TRP HB2  1 1 
        4  7878 1 1  37 TRP HB3  H  -9.553  -3.817   8.639 1.00 . A A .  37 TRP HB3  1 1 
        4  7879 1 1  37 TRP HD1  H -10.060  -1.187   8.111 1.00 . A A .  37 TRP HD1  1 1 
        4  7880 1 1  37 TRP HE1  H  -8.640   0.529   6.812 1.00 . A A .  37 TRP HE1  1 1 
        4  7881 1 1  37 TRP HE3  H  -5.512  -3.505   8.264 1.00 . A A .  37 TRP HE3  1 1 
        4  7882 1 1  37 TRP HH2  H  -3.738  -0.280   6.042 1.00 . A A .  37 TRP HH2  1 1 
        4  7883 1 1  37 TRP HZ2  H  -5.934   0.874   5.951 1.00 . A A .  37 TRP HZ2  1 1 
        4  7884 1 1  37 TRP HZ3  H  -3.534  -2.463   7.197 1.00 . A A .  37 TRP HZ3  1 1 
        4  7885 1 1  37 TRP N    N  -9.596  -1.973  10.697 1.00 . A A .  37 TRP N    1 1 
        4  7886 1 1  37 TRP NE1  N  -8.278  -0.304   7.182 1.00 . A A .  37 TRP NE1  1 1 
        4  7887 1 1  37 TRP O    O  -6.308  -3.243  10.515 1.00 . A A .  37 TRP O    1 1 
        4  7888 1 1  38 MET C    C  -6.162  -1.917  14.394 1.00 . A A .  38 MET C    1 1 
        4  7889 1 1  38 MET CA   C  -5.961  -1.951  12.878 1.00 . A A .  38 MET CA   1 1 
        4  7890 1 1  38 MET CB   C  -5.452  -0.587  12.409 1.00 . A A .  38 MET CB   1 1 
        4  7891 1 1  38 MET CE   C  -1.788  -0.133  11.318 1.00 . A A .  38 MET CE   1 1 
        4  7892 1 1  38 MET CG   C  -4.014  -0.380  12.895 1.00 . A A .  38 MET CG   1 1 
        4  7893 1 1  38 MET H    H  -8.106  -1.985  12.666 1.00 . A A .  38 MET H    1 1 
        4  7894 1 1  38 MET HA   H  -5.239  -2.715  12.625 1.00 . A A .  38 MET HA   1 1 
        4  7895 1 1  38 MET HB2  H  -5.479  -0.545  11.331 1.00 . A A .  38 MET HB2  1 1 
        4  7896 1 1  38 MET HB3  H  -6.080   0.187  12.817 1.00 . A A .  38 MET HB3  1 1 
        4  7897 1 1  38 MET HE1  H  -2.329   0.502  10.630 1.00 . A A .  38 MET HE1  1 1 
        4  7898 1 1  38 MET HE2  H  -0.945  -0.586  10.814 1.00 . A A .  38 MET HE2  1 1 
        4  7899 1 1  38 MET HE3  H  -1.432   0.459  12.146 1.00 . A A .  38 MET HE3  1 1 
        4  7900 1 1  38 MET HG2  H  -3.742   0.657  12.771 1.00 . A A .  38 MET HG2  1 1 
        4  7901 1 1  38 MET HG3  H  -3.944  -0.645  13.939 1.00 . A A .  38 MET HG3  1 1 
        4  7902 1 1  38 MET N    N  -7.273  -2.252  12.225 1.00 . A A .  38 MET N    1 1 
        4  7903 1 1  38 MET O    O  -5.507  -2.625  15.133 1.00 . A A .  38 MET O    1 1 
        4  7904 1 1  38 MET SD   S  -2.893  -1.435  11.931 1.00 . A A .  38 MET SD   1 1 
        4  7905 1 1  39 GLY C    C  -6.280  -0.096  16.977 1.00 . A A .  39 GLY C    1 1 
        4  7906 1 1  39 GLY CA   C  -7.316  -1.016  16.327 1.00 . A A .  39 GLY CA   1 1 
        4  7907 1 1  39 GLY H    H  -7.581  -0.538  14.243 1.00 . A A .  39 GLY H    1 1 
        4  7908 1 1  39 GLY HA2  H  -8.307  -0.622  16.500 1.00 . A A .  39 GLY HA2  1 1 
        4  7909 1 1  39 GLY HA3  H  -7.239  -2.000  16.765 1.00 . A A .  39 GLY HA3  1 1 
        4  7910 1 1  39 GLY N    N  -7.065  -1.099  14.861 1.00 . A A .  39 GLY N    1 1 
        4  7911 1 1  39 GLY O    O  -6.137  -0.067  18.182 1.00 . A A .  39 GLY O    1 1 
        4  7912 1 1  40 THR C    C  -4.916   3.028  16.374 1.00 . A A .  40 THR C    1 1 
        4  7913 1 1  40 THR CA   C  -4.529   1.593  16.731 1.00 . A A .  40 THR CA   1 1 
        4  7914 1 1  40 THR CB   C  -3.167   1.259  16.121 1.00 . A A .  40 THR CB   1 1 
        4  7915 1 1  40 THR CG2  C  -2.127   2.262  16.618 1.00 . A A .  40 THR CG2  1 1 
        4  7916 1 1  40 THR H    H  -5.703   0.623  15.219 1.00 . A A .  40 THR H    1 1 
        4  7917 1 1  40 THR HA   H  -4.471   1.498  17.808 1.00 . A A .  40 THR HA   1 1 
        4  7918 1 1  40 THR HB   H  -3.231   1.313  15.046 1.00 . A A .  40 THR HB   1 1 
        4  7919 1 1  40 THR HG1  H  -1.858  -0.167  16.308 1.00 . A A .  40 THR HG1  1 1 
        4  7920 1 1  40 THR HG21 H  -2.263   3.199  16.105 1.00 . A A .  40 THR HG21 1 1 
        4  7921 1 1  40 THR HG22 H  -1.136   1.881  16.418 1.00 . A A .  40 THR HG22 1 1 
        4  7922 1 1  40 THR HG23 H  -2.249   2.412  17.681 1.00 . A A .  40 THR HG23 1 1 
        4  7923 1 1  40 THR N    N  -5.559   0.660  16.182 1.00 . A A .  40 THR N    1 1 
        4  7924 1 1  40 THR O    O  -4.826   3.450  15.239 1.00 . A A .  40 THR O    1 1 
        4  7925 1 1  40 THR OG1  O  -2.789  -0.055  16.512 1.00 . A A .  40 THR OG1  1 1 
        4  7926 1 1  41 GLU C    C  -4.769   5.885  16.184 1.00 . A A .  41 GLU C    1 1 
        4  7927 1 1  41 GLU CA   C  -5.760   5.186  17.122 1.00 . A A .  41 GLU CA   1 1 
        4  7928 1 1  41 GLU CB   C  -5.789   5.930  18.464 1.00 . A A .  41 GLU CB   1 1 
        4  7929 1 1  41 GLU CD   C  -6.349   4.093  20.097 1.00 . A A .  41 GLU CD   1 1 
        4  7930 1 1  41 GLU CG   C  -6.879   5.337  19.375 1.00 . A A .  41 GLU CG   1 1 
        4  7931 1 1  41 GLU H    H  -5.407   3.380  18.242 1.00 . A A .  41 GLU H    1 1 
        4  7932 1 1  41 GLU HA   H  -6.744   5.208  16.680 1.00 . A A .  41 GLU HA   1 1 
        4  7933 1 1  41 GLU HB2  H  -4.825   5.839  18.943 1.00 . A A .  41 GLU HB2  1 1 
        4  7934 1 1  41 GLU HB3  H  -6.002   6.974  18.288 1.00 . A A .  41 GLU HB3  1 1 
        4  7935 1 1  41 GLU HG2  H  -7.170   6.079  20.105 1.00 . A A .  41 GLU HG2  1 1 
        4  7936 1 1  41 GLU HG3  H  -7.740   5.064  18.783 1.00 . A A .  41 GLU HG3  1 1 
        4  7937 1 1  41 GLU N    N  -5.344   3.768  17.351 1.00 . A A .  41 GLU N    1 1 
        4  7938 1 1  41 GLU O    O  -3.622   5.496  16.072 1.00 . A A .  41 GLU O    1 1 
        4  7939 1 1  41 GLU OE1  O  -5.235   3.688  19.809 1.00 . A A .  41 GLU OE1  1 1 
        4  7940 1 1  41 GLU OE2  O  -7.068   3.569  20.933 1.00 . A A .  41 GLU OE2  1 1 
        4  7941 1 1  42 ALA C    C  -4.746   9.104  14.437 1.00 . A A .  42 ALA C    1 1 
        4  7942 1 1  42 ALA CA   C  -4.300   7.643  14.566 1.00 . A A .  42 ALA CA   1 1 
        4  7943 1 1  42 ALA CB   C  -4.344   6.974  13.191 1.00 . A A .  42 ALA CB   1 1 
        4  7944 1 1  42 ALA H    H  -6.138   7.206  15.608 1.00 . A A .  42 ALA H    1 1 
        4  7945 1 1  42 ALA HA   H  -3.291   7.612  14.946 1.00 . A A .  42 ALA HA   1 1 
        4  7946 1 1  42 ALA HB1  H  -5.312   7.136  12.742 1.00 . A A .  42 ALA HB1  1 1 
        4  7947 1 1  42 ALA HB2  H  -4.174   5.912  13.303 1.00 . A A .  42 ALA HB2  1 1 
        4  7948 1 1  42 ALA HB3  H  -3.578   7.396  12.559 1.00 . A A .  42 ALA HB3  1 1 
        4  7949 1 1  42 ALA N    N  -5.208   6.914  15.505 1.00 . A A .  42 ALA N    1 1 
        4  7950 1 1  42 ALA O    O  -5.902   9.433  14.609 1.00 . A A .  42 ALA O    1 1 
        4  7951 1 1  43 GLU C    C  -4.727  11.676  12.585 1.00 . A A .  43 GLU C    1 1 
        4  7952 1 1  43 GLU CA   C  -4.174  11.423  13.989 1.00 . A A .  43 GLU CA   1 1 
        4  7953 1 1  43 GLU CB   C  -2.916  12.265  14.201 1.00 . A A .  43 GLU CB   1 1 
        4  7954 1 1  43 GLU CD   C  -1.186  12.940  15.865 1.00 . A A .  43 GLU CD   1 1 
        4  7955 1 1  43 GLU CG   C  -2.486  12.164  15.663 1.00 . A A .  43 GLU CG   1 1 
        4  7956 1 1  43 GLU H    H  -2.902   9.686  13.999 1.00 . A A .  43 GLU H    1 1 
        4  7957 1 1  43 GLU HA   H  -4.917  11.695  14.724 1.00 . A A .  43 GLU HA   1 1 
        4  7958 1 1  43 GLU HB2  H  -2.126  11.894  13.566 1.00 . A A .  43 GLU HB2  1 1 
        4  7959 1 1  43 GLU HB3  H  -3.122  13.296  13.958 1.00 . A A .  43 GLU HB3  1 1 
        4  7960 1 1  43 GLU HG2  H  -3.258  12.579  16.295 1.00 . A A .  43 GLU HG2  1 1 
        4  7961 1 1  43 GLU HG3  H  -2.328  11.127  15.922 1.00 . A A .  43 GLU HG3  1 1 
        4  7962 1 1  43 GLU N    N  -3.827   9.980  14.134 1.00 . A A .  43 GLU N    1 1 
        4  7963 1 1  43 GLU O    O  -4.562  10.868  11.692 1.00 . A A .  43 GLU O    1 1 
        4  7964 1 1  43 GLU OE1  O  -0.719  13.533  14.905 1.00 . A A .  43 GLU OE1  1 1 
        4  7965 1 1  43 GLU OE2  O  -0.680  12.932  16.975 1.00 . A A .  43 GLU OE2  1 1 
        4  7966 1 1  44 VAL C    C  -5.550  14.538  10.658 1.00 . A A .  44 VAL C    1 1 
        4  7967 1 1  44 VAL CA   C  -5.957  13.116  11.037 1.00 . A A .  44 VAL CA   1 1 
        4  7968 1 1  44 VAL CB   C  -7.483  13.012  11.086 1.00 . A A .  44 VAL CB   1 1 
        4  7969 1 1  44 VAL CG1  C  -8.015  13.821  12.269 1.00 . A A .  44 VAL CG1  1 1 
        4  7970 1 1  44 VAL CG2  C  -8.079  13.554   9.781 1.00 . A A .  44 VAL CG2  1 1 
        4  7971 1 1  44 VAL H    H  -5.499  13.425  13.123 1.00 . A A .  44 VAL H    1 1 
        4  7972 1 1  44 VAL HA   H  -5.577  12.431  10.296 1.00 . A A .  44 VAL HA   1 1 
        4  7973 1 1  44 VAL HB   H  -7.765  11.976  11.208 1.00 . A A .  44 VAL HB   1 1 
        4  7974 1 1  44 VAL HG11 H  -7.566  13.462  13.183 1.00 . A A .  44 VAL HG11 1 1 
        4  7975 1 1  44 VAL HG12 H  -9.088  13.708  12.327 1.00 . A A .  44 VAL HG12 1 1 
        4  7976 1 1  44 VAL HG13 H  -7.770  14.864  12.132 1.00 . A A .  44 VAL HG13 1 1 
        4  7977 1 1  44 VAL HG21 H  -9.106  13.231   9.691 1.00 . A A .  44 VAL HG21 1 1 
        4  7978 1 1  44 VAL HG22 H  -7.509  13.182   8.941 1.00 . A A .  44 VAL HG22 1 1 
        4  7979 1 1  44 VAL HG23 H  -8.042  14.634   9.789 1.00 . A A .  44 VAL HG23 1 1 
        4  7980 1 1  44 VAL N    N  -5.383  12.792  12.384 1.00 . A A .  44 VAL N    1 1 
        4  7981 1 1  44 VAL O    O  -5.521  15.427  11.486 1.00 . A A .  44 VAL O    1 1 
        4  7982 1 1  45 GLU C    C  -5.960  16.827   8.249 1.00 . A A .  45 GLU C    1 1 
        4  7983 1 1  45 GLU CA   C  -4.791  16.119   8.961 1.00 . A A .  45 GLU CA   1 1 
        4  7984 1 1  45 GLU CB   C  -3.613  15.970   7.985 1.00 . A A .  45 GLU CB   1 1 
        4  7985 1 1  45 GLU CD   C  -2.132  15.667   9.986 1.00 . A A .  45 GLU CD   1 1 
        4  7986 1 1  45 GLU CG   C  -2.524  15.098   8.621 1.00 . A A .  45 GLU CG   1 1 
        4  7987 1 1  45 GLU H    H  -5.240  14.017   8.764 1.00 . A A .  45 GLU H    1 1 
        4  7988 1 1  45 GLU HA   H  -4.476  16.691   9.814 1.00 . A A .  45 GLU HA   1 1 
        4  7989 1 1  45 GLU HB2  H  -3.956  15.499   7.071 1.00 . A A .  45 GLU HB2  1 1 
        4  7990 1 1  45 GLU HB3  H  -3.204  16.942   7.757 1.00 . A A .  45 GLU HB3  1 1 
        4  7991 1 1  45 GLU HG2  H  -2.897  14.091   8.744 1.00 . A A .  45 GLU HG2  1 1 
        4  7992 1 1  45 GLU HG3  H  -1.656  15.081   7.978 1.00 . A A .  45 GLU HG3  1 1 
        4  7993 1 1  45 GLU N    N  -5.219  14.757   9.409 1.00 . A A .  45 GLU N    1 1 
        4  7994 1 1  45 GLU O    O  -6.768  16.185   7.608 1.00 . A A .  45 GLU O    1 1 
        4  7995 1 1  45 GLU OE1  O  -1.251  16.508  10.025 1.00 . A A .  45 GLU OE1  1 1 
        4  7996 1 1  45 GLU OE2  O  -2.721  15.249  10.970 1.00 . A A .  45 GLU OE2  1 1 
        4  7997 1 1  46 PRO C    C  -7.334  18.474   6.203 1.00 . A A .  46 PRO C    1 1 
        4  7998 1 1  46 PRO CA   C  -7.132  18.913   7.661 1.00 . A A .  46 PRO CA   1 1 
        4  7999 1 1  46 PRO CB   C  -6.625  20.363   7.705 1.00 . A A .  46 PRO CB   1 1 
        4  8000 1 1  46 PRO CD   C  -5.146  19.036   9.103 1.00 . A A .  46 PRO CD   1 1 
        4  8001 1 1  46 PRO CG   C  -5.740  20.438   8.907 1.00 . A A .  46 PRO CG   1 1 
        4  8002 1 1  46 PRO HA   H  -8.051  18.832   8.213 1.00 . A A .  46 PRO HA   1 1 
        4  8003 1 1  46 PRO HB2  H  -6.060  20.594   6.807 1.00 . A A .  46 PRO HB2  1 1 
        4  8004 1 1  46 PRO HB3  H  -7.454  21.049   7.808 1.00 . A A .  46 PRO HB3  1 1 
        4  8005 1 1  46 PRO HD2  H  -4.136  18.989   8.714 1.00 . A A .  46 PRO HD2  1 1 
        4  8006 1 1  46 PRO HD3  H  -5.163  18.774  10.151 1.00 . A A .  46 PRO HD3  1 1 
        4  8007 1 1  46 PRO HG2  H  -4.949  21.165   8.742 1.00 . A A .  46 PRO HG2  1 1 
        4  8008 1 1  46 PRO HG3  H  -6.316  20.715   9.778 1.00 . A A .  46 PRO HG3  1 1 
        4  8009 1 1  46 PRO N    N  -6.046  18.143   8.339 1.00 . A A .  46 PRO N    1 1 
        4  8010 1 1  46 PRO O    O  -8.437  18.467   5.693 1.00 . A A .  46 PRO O    1 1 
        4  8011 1 1  47 GLU C    C  -4.959  17.431   3.561 1.00 . A A .  47 GLU C    1 1 
        4  8012 1 1  47 GLU CA   C  -6.375  17.697   4.110 1.00 . A A .  47 GLU CA   1 1 
        4  8013 1 1  47 GLU CB   C  -7.080  18.802   3.272 1.00 . A A .  47 GLU CB   1 1 
        4  8014 1 1  47 GLU CD   C  -8.129  17.190   1.661 1.00 . A A .  47 GLU CD   1 1 
        4  8015 1 1  47 GLU CG   C  -8.410  18.283   2.697 1.00 . A A .  47 GLU CG   1 1 
        4  8016 1 1  47 GLU H    H  -5.395  18.148   5.973 1.00 . A A .  47 GLU H    1 1 
        4  8017 1 1  47 GLU HA   H  -6.944  16.778   4.062 1.00 . A A .  47 GLU HA   1 1 
        4  8018 1 1  47 GLU HB2  H  -7.281  19.654   3.903 1.00 . A A .  47 GLU HB2  1 1 
        4  8019 1 1  47 GLU HB3  H  -6.445  19.112   2.453 1.00 . A A .  47 GLU HB3  1 1 
        4  8020 1 1  47 GLU HG2  H  -9.014  17.878   3.494 1.00 . A A .  47 GLU HG2  1 1 
        4  8021 1 1  47 GLU HG3  H  -8.938  19.096   2.223 1.00 . A A .  47 GLU HG3  1 1 
        4  8022 1 1  47 GLU N    N  -6.273  18.125   5.535 1.00 . A A .  47 GLU N    1 1 
        4  8023 1 1  47 GLU O    O  -4.700  16.382   3.004 1.00 . A A .  47 GLU O    1 1 
        4  8024 1 1  47 GLU OE1  O  -7.061  17.218   1.072 1.00 . A A .  47 GLU OE1  1 1 
        4  8025 1 1  47 GLU OE2  O  -8.988  16.344   1.474 1.00 . A A .  47 GLU OE2  1 1 
        4  8026 1 1  48 PRO C    C  -1.790  17.342   4.093 1.00 . A A .  48 PRO C    1 1 
        4  8027 1 1  48 PRO CA   C  -2.659  18.217   3.186 1.00 . A A .  48 PRO CA   1 1 
        4  8028 1 1  48 PRO CB   C  -2.142  19.658   3.125 1.00 . A A .  48 PRO CB   1 1 
        4  8029 1 1  48 PRO CD   C  -4.230  19.687   4.366 1.00 . A A .  48 PRO CD   1 1 
        4  8030 1 1  48 PRO CG   C  -2.855  20.365   4.234 1.00 . A A .  48 PRO CG   1 1 
        4  8031 1 1  48 PRO HA   H  -2.680  17.802   2.190 1.00 . A A .  48 PRO HA   1 1 
        4  8032 1 1  48 PRO HB2  H  -1.070  19.684   3.280 1.00 . A A .  48 PRO HB2  1 1 
        4  8033 1 1  48 PRO HB3  H  -2.395  20.109   2.176 1.00 . A A .  48 PRO HB3  1 1 
        4  8034 1 1  48 PRO HD2  H  -4.474  19.564   5.410 1.00 . A A .  48 PRO HD2  1 1 
        4  8035 1 1  48 PRO HD3  H  -4.990  20.263   3.863 1.00 . A A .  48 PRO HD3  1 1 
        4  8036 1 1  48 PRO HG2  H  -2.293  20.265   5.158 1.00 . A A .  48 PRO HG2  1 1 
        4  8037 1 1  48 PRO HG3  H  -2.983  21.410   3.991 1.00 . A A .  48 PRO HG3  1 1 
        4  8038 1 1  48 PRO N    N  -4.051  18.374   3.699 1.00 . A A .  48 PRO N    1 1 
        4  8039 1 1  48 PRO O    O  -1.953  17.315   5.296 1.00 . A A .  48 PRO O    1 1 
        4  8040 1 1  49 GLY C    C  -0.698  14.430   4.626 1.00 . A A .  49 GLY C    1 1 
        4  8041 1 1  49 GLY CA   C   0.022  15.747   4.329 1.00 . A A .  49 GLY CA   1 1 
        4  8042 1 1  49 GLY H    H  -0.756  16.662   2.542 1.00 . A A .  49 GLY H    1 1 
        4  8043 1 1  49 GLY HA2  H   0.925  15.550   3.773 1.00 . A A .  49 GLY HA2  1 1 
        4  8044 1 1  49 GLY HA3  H   0.270  16.238   5.258 1.00 . A A .  49 GLY HA3  1 1 
        4  8045 1 1  49 GLY N    N  -0.867  16.624   3.516 1.00 . A A .  49 GLY N    1 1 
        4  8046 1 1  49 GLY O    O  -1.461  14.323   5.565 1.00 . A A .  49 GLY O    1 1 
        4  8047 1 1  50 GLY C    C  -0.947  11.640   5.481 1.00 . A A .  50 GLY C    1 1 
        4  8048 1 1  50 GLY CA   C  -1.129  12.112   4.035 1.00 . A A .  50 GLY CA   1 1 
        4  8049 1 1  50 GLY H    H   0.155  13.550   3.071 1.00 . A A .  50 GLY H    1 1 
        4  8050 1 1  50 GLY HA2  H  -2.184  12.209   3.821 1.00 . A A .  50 GLY HA2  1 1 
        4  8051 1 1  50 GLY HA3  H  -0.696  11.382   3.367 1.00 . A A .  50 GLY HA3  1 1 
        4  8052 1 1  50 GLY N    N  -0.460  13.430   3.824 1.00 . A A .  50 GLY N    1 1 
        4  8053 1 1  50 GLY O    O  -0.038  12.047   6.178 1.00 . A A .  50 GLY O    1 1 
        4  8054 1 1  51 LEU C    C  -0.352   9.737   7.631 1.00 . A A .  51 LEU C    1 1 
        4  8055 1 1  51 LEU CA   C  -1.761  10.250   7.318 1.00 . A A .  51 LEU CA   1 1 
        4  8056 1 1  51 LEU CB   C  -2.762   9.087   7.462 1.00 . A A .  51 LEU CB   1 1 
        4  8057 1 1  51 LEU CD1  C  -4.276  10.287   9.094 1.00 . A A .  51 LEU CD1  1 1 
        4  8058 1 1  51 LEU CD2  C  -4.540  10.637   6.613 1.00 . A A .  51 LEU CD2  1 1 
        4  8059 1 1  51 LEU CG   C  -4.181   9.623   7.707 1.00 . A A .  51 LEU CG   1 1 
        4  8060 1 1  51 LEU H    H  -2.547  10.484   5.331 1.00 . A A .  51 LEU H    1 1 
        4  8061 1 1  51 LEU HA   H  -2.012  11.031   8.013 1.00 . A A .  51 LEU HA   1 1 
        4  8062 1 1  51 LEU HB2  H  -2.757   8.504   6.552 1.00 . A A .  51 LEU HB2  1 1 
        4  8063 1 1  51 LEU HB3  H  -2.472   8.455   8.289 1.00 . A A .  51 LEU HB3  1 1 
        4  8064 1 1  51 LEU HD11 H  -3.597   9.804   9.784 1.00 . A A .  51 LEU HD11 1 1 
        4  8065 1 1  51 LEU HD12 H  -5.283  10.190   9.468 1.00 . A A .  51 LEU HD12 1 1 
        4  8066 1 1  51 LEU HD13 H  -4.025  11.332   9.019 1.00 . A A .  51 LEU HD13 1 1 
        4  8067 1 1  51 LEU HD21 H  -3.962  11.539   6.754 1.00 . A A .  51 LEU HD21 1 1 
        4  8068 1 1  51 LEU HD22 H  -5.592  10.872   6.672 1.00 . A A .  51 LEU HD22 1 1 
        4  8069 1 1  51 LEU HD23 H  -4.320  10.216   5.643 1.00 . A A .  51 LEU HD23 1 1 
        4  8070 1 1  51 LEU HG   H  -4.877   8.797   7.665 1.00 . A A .  51 LEU HG   1 1 
        4  8071 1 1  51 LEU N    N  -1.827  10.780   5.923 1.00 . A A .  51 LEU N    1 1 
        4  8072 1 1  51 LEU O    O   0.542  10.501   7.933 1.00 . A A .  51 LEU O    1 1 
        4  8073 1 1  52 TYR C    C   1.569   8.217   9.322 1.00 . A A .  52 TYR C    1 1 
        4  8074 1 1  52 TYR CA   C   1.170   7.852   7.889 1.00 . A A .  52 TYR CA   1 1 
        4  8075 1 1  52 TYR CB   C   2.219   8.388   6.912 1.00 . A A .  52 TYR CB   1 1 
        4  8076 1 1  52 TYR CD1  C   3.616   6.334   6.487 1.00 . A A .  52 TYR CD1  1 1 
        4  8077 1 1  52 TYR CD2  C   4.565   8.135   7.806 1.00 . A A .  52 TYR CD2  1 1 
        4  8078 1 1  52 TYR CE1  C   4.801   5.603   6.634 1.00 . A A .  52 TYR CE1  1 1 
        4  8079 1 1  52 TYR CE2  C   5.749   7.404   7.952 1.00 . A A .  52 TYR CE2  1 1 
        4  8080 1 1  52 TYR CG   C   3.500   7.601   7.072 1.00 . A A .  52 TYR CG   1 1 
        4  8081 1 1  52 TYR CZ   C   5.868   6.137   7.367 1.00 . A A .  52 TYR CZ   1 1 
        4  8082 1 1  52 TYR H    H  -0.914   7.854   7.347 1.00 . A A .  52 TYR H    1 1 
        4  8083 1 1  52 TYR HA   H   1.113   6.777   7.798 1.00 . A A .  52 TYR HA   1 1 
        4  8084 1 1  52 TYR HB2  H   1.857   8.284   5.901 1.00 . A A .  52 TYR HB2  1 1 
        4  8085 1 1  52 TYR HB3  H   2.414   9.430   7.119 1.00 . A A .  52 TYR HB3  1 1 
        4  8086 1 1  52 TYR HD1  H   2.793   5.923   5.922 1.00 . A A .  52 TYR HD1  1 1 
        4  8087 1 1  52 TYR HD2  H   4.475   9.112   8.257 1.00 . A A .  52 TYR HD2  1 1 
        4  8088 1 1  52 TYR HE1  H   4.891   4.626   6.182 1.00 . A A .  52 TYR HE1  1 1 
        4  8089 1 1  52 TYR HE2  H   6.573   7.815   8.517 1.00 . A A .  52 TYR HE2  1 1 
        4  8090 1 1  52 TYR HH   H   7.587   5.872   8.150 1.00 . A A .  52 TYR HH   1 1 
        4  8091 1 1  52 TYR N    N  -0.166   8.443   7.579 1.00 . A A .  52 TYR N    1 1 
        4  8092 1 1  52 TYR O    O   2.673   7.952   9.753 1.00 . A A .  52 TYR O    1 1 
        4  8093 1 1  52 TYR OH   O   7.034   5.416   7.512 1.00 . A A .  52 TYR OH   1 1 
        4  8094 1 1  53 LEU C    C   0.153   8.362  12.442 1.00 . A A .  53 LEU C    1 1 
        4  8095 1 1  53 LEU CA   C   0.976   9.215  11.479 1.00 . A A .  53 LEU CA   1 1 
        4  8096 1 1  53 LEU CB   C   0.623  10.690  11.686 1.00 . A A .  53 LEU CB   1 1 
        4  8097 1 1  53 LEU CD1  C   1.052  13.011  10.875 1.00 . A A .  53 LEU CD1  1 1 
        4  8098 1 1  53 LEU CD2  C   2.991  11.553  11.522 1.00 . A A .  53 LEU CD2  1 1 
        4  8099 1 1  53 LEU CG   C   1.587  11.575  10.885 1.00 . A A .  53 LEU CG   1 1 
        4  8100 1 1  53 LEU H    H  -0.212   9.020   9.684 1.00 . A A .  53 LEU H    1 1 
        4  8101 1 1  53 LEU HA   H   2.023   9.064  11.690 1.00 . A A .  53 LEU HA   1 1 
        4  8102 1 1  53 LEU HB2  H  -0.387  10.862  11.346 1.00 . A A .  53 LEU HB2  1 1 
        4  8103 1 1  53 LEU HB3  H   0.692  10.935  12.734 1.00 . A A .  53 LEU HB3  1 1 
        4  8104 1 1  53 LEU HD11 H   1.704  13.633  10.281 1.00 . A A .  53 LEU HD11 1 1 
        4  8105 1 1  53 LEU HD12 H   1.016  13.386  11.885 1.00 . A A .  53 LEU HD12 1 1 
        4  8106 1 1  53 LEU HD13 H   0.058  13.022  10.450 1.00 . A A .  53 LEU HD13 1 1 
        4  8107 1 1  53 LEU HD21 H   2.909  11.496  12.598 1.00 . A A .  53 LEU HD21 1 1 
        4  8108 1 1  53 LEU HD22 H   3.527  12.450  11.253 1.00 . A A .  53 LEU HD22 1 1 
        4  8109 1 1  53 LEU HD23 H   3.537  10.696  11.159 1.00 . A A .  53 LEU HD23 1 1 
        4  8110 1 1  53 LEU HG   H   1.646  11.211   9.870 1.00 . A A .  53 LEU HG   1 1 
        4  8111 1 1  53 LEU N    N   0.670   8.821  10.062 1.00 . A A .  53 LEU N    1 1 
        4  8112 1 1  53 LEU O    O  -0.943   7.936  12.133 1.00 . A A .  53 LEU O    1 1 
        4  8113 1 1  54 VAL C    C   0.050   7.937  15.994 1.00 . A A .  54 VAL C    1 1 
        4  8114 1 1  54 VAL CA   C  -0.043   7.276  14.618 1.00 . A A .  54 VAL CA   1 1 
        4  8115 1 1  54 VAL CB   C   0.590   5.886  14.672 1.00 . A A .  54 VAL CB   1 1 
        4  8116 1 1  54 VAL CG1  C  -0.122   5.038  15.729 1.00 . A A .  54 VAL CG1  1 1 
        4  8117 1 1  54 VAL CG2  C   0.450   5.219  13.299 1.00 . A A .  54 VAL CG2  1 1 
        4  8118 1 1  54 VAL H    H   1.570   8.463  13.827 1.00 . A A .  54 VAL H    1 1 
        4  8119 1 1  54 VAL HA   H  -1.084   7.183  14.340 1.00 . A A .  54 VAL HA   1 1 
        4  8120 1 1  54 VAL HB   H   1.635   5.978  14.925 1.00 . A A .  54 VAL HB   1 1 
        4  8121 1 1  54 VAL HG11 H   0.230   5.321  16.711 1.00 . A A .  54 VAL HG11 1 1 
        4  8122 1 1  54 VAL HG12 H   0.093   3.992  15.560 1.00 . A A .  54 VAL HG12 1 1 
        4  8123 1 1  54 VAL HG13 H  -1.187   5.203  15.668 1.00 . A A .  54 VAL HG13 1 1 
        4  8124 1 1  54 VAL HG21 H   0.946   5.824  12.554 1.00 . A A .  54 VAL HG21 1 1 
        4  8125 1 1  54 VAL HG22 H  -0.597   5.127  13.049 1.00 . A A .  54 VAL HG22 1 1 
        4  8126 1 1  54 VAL HG23 H   0.902   4.238  13.326 1.00 . A A .  54 VAL HG23 1 1 
        4  8127 1 1  54 VAL N    N   0.684   8.107  13.611 1.00 . A A .  54 VAL N    1 1 
        4  8128 1 1  54 VAL O    O   0.935   8.726  16.260 1.00 . A A .  54 VAL O    1 1 
        4  8129 1 1  55 ASN C    C   0.143   7.490  19.122 1.00 . A A .  55 ASN C    1 1 
        4  8130 1 1  55 ASN CA   C  -0.853   8.228  18.230 1.00 . A A .  55 ASN CA   1 1 
        4  8131 1 1  55 ASN CB   C  -2.250   8.127  18.837 1.00 . A A .  55 ASN CB   1 1 
        4  8132 1 1  55 ASN CG   C  -3.179   9.115  18.134 1.00 . A A .  55 ASN CG   1 1 
        4  8133 1 1  55 ASN H    H  -1.571   6.987  16.625 1.00 . A A .  55 ASN H    1 1 
        4  8134 1 1  55 ASN HA   H  -0.567   9.269  18.160 1.00 . A A .  55 ASN HA   1 1 
        4  8135 1 1  55 ASN HB2  H  -2.626   7.123  18.706 1.00 . A A .  55 ASN HB2  1 1 
        4  8136 1 1  55 ASN HB3  H  -2.206   8.361  19.891 1.00 . A A .  55 ASN HB3  1 1 
        4  8137 1 1  55 ASN HD21 H  -4.497   7.721  17.626 1.00 . A A .  55 ASN HD21 1 1 
        4  8138 1 1  55 ASN HD22 H  -4.882   9.299  17.134 1.00 . A A .  55 ASN HD22 1 1 
        4  8139 1 1  55 ASN N    N  -0.866   7.622  16.868 1.00 . A A .  55 ASN N    1 1 
        4  8140 1 1  55 ASN ND2  N  -4.277   8.675  17.585 1.00 . A A .  55 ASN ND2  1 1 
        4  8141 1 1  55 ASN O    O   0.915   6.675  18.655 1.00 . A A .  55 ASN O    1 1 
        4  8142 1 1  55 ASN OD1  O  -2.902  10.297  18.077 1.00 . A A .  55 ASN OD1  1 1 
        4  8143 1 1  56 VAL C    C   2.398   6.821  20.712 1.00 . A A .  56 VAL C    1 1 
        4  8144 1 1  56 VAL CA   C   1.057   7.137  21.383 1.00 . A A .  56 VAL CA   1 1 
        4  8145 1 1  56 VAL CB   C   0.421   5.855  21.938 1.00 . A A .  56 VAL CB   1 1 
        4  8146 1 1  56 VAL CG1  C  -0.754   6.230  22.846 1.00 . A A .  56 VAL CG1  1 1 
        4  8147 1 1  56 VAL CG2  C  -0.085   4.973  20.792 1.00 . A A .  56 VAL CG2  1 1 
        4  8148 1 1  56 VAL H    H  -0.516   8.457  20.729 1.00 . A A .  56 VAL H    1 1 
        4  8149 1 1  56 VAL HA   H   1.234   7.820  22.200 1.00 . A A .  56 VAL HA   1 1 
        4  8150 1 1  56 VAL HB   H   1.157   5.313  22.514 1.00 . A A .  56 VAL HB   1 1 
        4  8151 1 1  56 VAL HG11 H  -0.376   6.600  23.789 1.00 . A A .  56 VAL HG11 1 1 
        4  8152 1 1  56 VAL HG12 H  -1.368   5.360  23.023 1.00 . A A .  56 VAL HG12 1 1 
        4  8153 1 1  56 VAL HG13 H  -1.347   6.998  22.372 1.00 . A A .  56 VAL HG13 1 1 
        4  8154 1 1  56 VAL HG21 H  -0.926   5.450  20.311 1.00 . A A .  56 VAL HG21 1 1 
        4  8155 1 1  56 VAL HG22 H  -0.394   4.017  21.188 1.00 . A A .  56 VAL HG22 1 1 
        4  8156 1 1  56 VAL HG23 H   0.707   4.824  20.073 1.00 . A A .  56 VAL HG23 1 1 
        4  8157 1 1  56 VAL N    N   0.123   7.787  20.405 1.00 . A A .  56 VAL N    1 1 
        4  8158 1 1  56 VAL O    O   3.036   5.824  20.990 1.00 . A A .  56 VAL O    1 1 
        4  8159 1 1  57 THR C    C   5.132   8.479  19.672 1.00 . A A .  57 THR C    1 1 
        4  8160 1 1  57 THR CA   C   4.114   7.491  19.109 1.00 . A A .  57 THR CA   1 1 
        4  8161 1 1  57 THR CB   C   3.910   7.774  17.618 1.00 . A A .  57 THR CB   1 1 
        4  8162 1 1  57 THR CG2  C   5.223   7.558  16.858 1.00 . A A .  57 THR CG2  1 1 
        4  8163 1 1  57 THR H    H   2.276   8.477  19.633 1.00 . A A .  57 THR H    1 1 
        4  8164 1 1  57 THR HA   H   4.472   6.478  19.242 1.00 . A A .  57 THR HA   1 1 
        4  8165 1 1  57 THR HB   H   3.592   8.797  17.489 1.00 . A A .  57 THR HB   1 1 
        4  8166 1 1  57 THR HG1  H   2.985   6.906  16.147 1.00 . A A .  57 THR HG1  1 1 
        4  8167 1 1  57 THR HG21 H   5.867   8.412  17.004 1.00 . A A .  57 THR HG21 1 1 
        4  8168 1 1  57 THR HG22 H   5.012   7.440  15.805 1.00 . A A .  57 THR HG22 1 1 
        4  8169 1 1  57 THR HG23 H   5.714   6.668  17.227 1.00 . A A .  57 THR HG23 1 1 
        4  8170 1 1  57 THR N    N   2.819   7.684  19.826 1.00 . A A .  57 THR N    1 1 
        4  8171 1 1  57 THR O    O   6.315   8.390  19.409 1.00 . A A .  57 THR O    1 1 
        4  8172 1 1  57 THR OG1  O   2.916   6.901  17.103 1.00 . A A .  57 THR OG1  1 1 
        4  8173 1 1  58 GLY C    C   5.931  11.501  19.984 1.00 . A A .  58 GLY C    1 1 
        4  8174 1 1  58 GLY CA   C   5.613  10.429  21.028 1.00 . A A .  58 GLY CA   1 1 
        4  8175 1 1  58 GLY H    H   3.717   9.480  20.643 1.00 . A A .  58 GLY H    1 1 
        4  8176 1 1  58 GLY HA2  H   5.155  10.887  21.892 1.00 . A A .  58 GLY HA2  1 1 
        4  8177 1 1  58 GLY HA3  H   6.529   9.939  21.323 1.00 . A A .  58 GLY HA3  1 1 
        4  8178 1 1  58 GLY N    N   4.677   9.427  20.446 1.00 . A A .  58 GLY N    1 1 
        4  8179 1 1  58 GLY O    O   6.935  12.179  20.066 1.00 . A A .  58 GLY O    1 1 
        4  8180 1 1  59 ALA C    C   4.011  13.186  17.376 1.00 . A A .  59 ALA C    1 1 
        4  8181 1 1  59 ALA CA   C   5.344  12.689  17.946 1.00 . A A .  59 ALA CA   1 1 
        4  8182 1 1  59 ALA CB   C   6.180  12.069  16.824 1.00 . A A .  59 ALA CB   1 1 
        4  8183 1 1  59 ALA H    H   4.281  11.100  18.949 1.00 . A A .  59 ALA H    1 1 
        4  8184 1 1  59 ALA HA   H   5.883  13.524  18.375 1.00 . A A .  59 ALA HA   1 1 
        4  8185 1 1  59 ALA HB1  H   7.096  11.671  17.235 1.00 . A A .  59 ALA HB1  1 1 
        4  8186 1 1  59 ALA HB2  H   6.414  12.823  16.086 1.00 . A A .  59 ALA HB2  1 1 
        4  8187 1 1  59 ALA HB3  H   5.619  11.273  16.359 1.00 . A A .  59 ALA HB3  1 1 
        4  8188 1 1  59 ALA N    N   5.086  11.659  18.999 1.00 . A A .  59 ALA N    1 1 
        4  8189 1 1  59 ALA O    O   3.018  12.485  17.395 1.00 . A A .  59 ALA O    1 1 
        4  8190 1 1  60 ARG C    C   3.029  15.781  15.053 1.00 . A A .  60 ARG C    1 1 
        4  8191 1 1  60 ARG CA   C   2.715  14.950  16.300 1.00 . A A .  60 ARG CA   1 1 
        4  8192 1 1  60 ARG CB   C   2.035  15.835  17.347 1.00 . A A .  60 ARG CB   1 1 
        4  8193 1 1  60 ARG CD   C   2.298  17.839  18.815 1.00 . A A .  60 ARG CD   1 1 
        4  8194 1 1  60 ARG CG   C   3.003  16.928  17.809 1.00 . A A .  60 ARG CG   1 1 
        4  8195 1 1  60 ARG CZ   C   2.786  16.897  21.002 1.00 . A A .  60 ARG CZ   1 1 
        4  8196 1 1  60 ARG H    H   4.796  14.938  16.871 1.00 . A A .  60 ARG H    1 1 
        4  8197 1 1  60 ARG HA   H   2.048  14.141  16.029 1.00 . A A .  60 ARG HA   1 1 
        4  8198 1 1  60 ARG HB2  H   1.155  16.291  16.916 1.00 . A A .  60 ARG HB2  1 1 
        4  8199 1 1  60 ARG HB3  H   1.746  15.231  18.196 1.00 . A A .  60 ARG HB3  1 1 
        4  8200 1 1  60 ARG HD2  H   2.958  18.648  19.094 1.00 . A A .  60 ARG HD2  1 1 
        4  8201 1 1  60 ARG HD3  H   1.404  18.247  18.365 1.00 . A A .  60 ARG HD3  1 1 
        4  8202 1 1  60 ARG HE   H   1.035  16.652  20.096 1.00 . A A .  60 ARG HE   1 1 
        4  8203 1 1  60 ARG HG2  H   3.865  16.474  18.275 1.00 . A A .  60 ARG HG2  1 1 
        4  8204 1 1  60 ARG HG3  H   3.320  17.515  16.959 1.00 . A A .  60 ARG HG3  1 1 
        4  8205 1 1  60 ARG HH11 H   4.245  17.927  20.095 1.00 . A A .  60 ARG HH11 1 1 
        4  8206 1 1  60 ARG HH12 H   4.634  17.296  21.659 1.00 . A A .  60 ARG HH12 1 1 
        4  8207 1 1  60 ARG HH21 H   1.533  15.822  22.138 1.00 . A A .  60 ARG HH21 1 1 
        4  8208 1 1  60 ARG HH22 H   3.102  16.105  22.814 1.00 . A A .  60 ARG HH22 1 1 
        4  8209 1 1  60 ARG N    N   3.982  14.393  16.872 1.00 . A A .  60 ARG N    1 1 
        4  8210 1 1  60 ARG NE   N   1.928  17.051  20.028 1.00 . A A .  60 ARG NE   1 1 
        4  8211 1 1  60 ARG NH1  N   3.981  17.414  20.911 1.00 . A A .  60 ARG NH1  1 1 
        4  8212 1 1  60 ARG NH2  N   2.447  16.222  22.067 1.00 . A A .  60 ARG NH2  1 1 
        4  8213 1 1  60 ARG O    O   4.109  16.322  14.914 1.00 . A A .  60 ARG O    1 1 
        4  8214 1 1  61 PHE C    C   3.719  16.489  12.368 1.00 . A A .  61 PHE C    1 1 
        4  8215 1 1  61 PHE CA   C   2.296  16.684  12.900 1.00 . A A .  61 PHE CA   1 1 
        4  8216 1 1  61 PHE CB   C   2.076  18.170  13.194 1.00 . A A .  61 PHE CB   1 1 
        4  8217 1 1  61 PHE CD1  C  -0.290  18.538  12.405 1.00 . A A .  61 PHE CD1  1 1 
        4  8218 1 1  61 PHE CD2  C   0.161  18.550  14.787 1.00 . A A .  61 PHE CD2  1 1 
        4  8219 1 1  61 PHE CE1  C  -1.645  18.783  12.660 1.00 . A A .  61 PHE CE1  1 1 
        4  8220 1 1  61 PHE CE2  C  -1.194  18.794  15.043 1.00 . A A .  61 PHE CE2  1 1 
        4  8221 1 1  61 PHE CG   C   0.613  18.423  13.469 1.00 . A A .  61 PHE CG   1 1 
        4  8222 1 1  61 PHE CZ   C  -2.097  18.910  13.979 1.00 . A A .  61 PHE CZ   1 1 
        4  8223 1 1  61 PHE H    H   1.223  15.443  14.300 1.00 . A A .  61 PHE H    1 1 
        4  8224 1 1  61 PHE HA   H   1.589  16.363  12.150 1.00 . A A .  61 PHE HA   1 1 
        4  8225 1 1  61 PHE HB2  H   2.660  18.456  14.055 1.00 . A A .  61 PHE HB2  1 1 
        4  8226 1 1  61 PHE HB3  H   2.385  18.753  12.339 1.00 . A A .  61 PHE HB3  1 1 
        4  8227 1 1  61 PHE HD1  H   0.059  18.440  11.388 1.00 . A A .  61 PHE HD1  1 1 
        4  8228 1 1  61 PHE HD2  H   0.856  18.461  15.608 1.00 . A A .  61 PHE HD2  1 1 
        4  8229 1 1  61 PHE HE1  H  -2.342  18.873  11.839 1.00 . A A .  61 PHE HE1  1 1 
        4  8230 1 1  61 PHE HE2  H  -1.543  18.892  16.059 1.00 . A A .  61 PHE HE2  1 1 
        4  8231 1 1  61 PHE HZ   H  -3.142  19.099  14.175 1.00 . A A .  61 PHE HZ   1 1 
        4  8232 1 1  61 PHE N    N   2.084  15.889  14.151 1.00 . A A .  61 PHE N    1 1 
        4  8233 1 1  61 PHE O    O   4.035  15.486  11.763 1.00 . A A .  61 PHE O    1 1 
        4  8234 1 1  62 ALA C    C   5.968  16.957  10.615 1.00 . A A .  62 ALA C    1 1 
        4  8235 1 1  62 ALA CA   C   5.977  17.351  12.092 1.00 . A A .  62 ALA CA   1 1 
        4  8236 1 1  62 ALA CB   C   6.732  16.293  12.897 1.00 . A A .  62 ALA CB   1 1 
        4  8237 1 1  62 ALA H    H   4.286  18.258  13.071 1.00 . A A .  62 ALA H    1 1 
        4  8238 1 1  62 ALA HA   H   6.468  18.307  12.206 1.00 . A A .  62 ALA HA   1 1 
        4  8239 1 1  62 ALA HB1  H   6.728  16.5