NMR Restraints Grid

Result table
 (Save to zip file containing files for each block)

image mrblock_id pdb_id bmrb_id cing stage program type subtype item_count
496682 2l82 17390 cing 4-filtered-FRED STAR entry full 5303


data_FRED_restraints_with_modified_coordinates_PDB_code_2l82

# This FRED archive file contains, for PDB entry <2l82>:
# 
# - Coordinates and sequence information from the PDB mmCIF file
# - NMR restraints from the PDB MR file
# 
# In this file, the coordinates and NMR restraints share the same atom names,
# and in this way can differ from the data deposited at the wwPDB. To achieve
# this aim, the NMR restraints were parsed from their original format files, and
# the coordinates and NMR restraints information were subsequently harmonized.
# 
# Due to the complexity of this harmonization process and the filtering process
# used in creating these files, the NMR restraints information in these files
# may differ significantly from that in the originally deposited file. Other 
# modifications could have occurred to the NMR restraints information, or data 
# could have been lost because of parsing or conversion errors. The PDB file 
# remains the authoritative reference for the atomic coordinates and the 
# originally deposited restraints files remain the primary reference for these 
# data.
# 
# This file is generated at the BioMagResBank (BMRB) in collaboration with the 
# PDBe (formerly MSD) group at the European Bioinformatics Institute (EBI) and 
# the CMBI/IMM group at the Radboud University of Nijmegen.
# 
# Several software packages were used to produce this file:
# 
# - Wattos (BMRB and CMBI/IMM).
# - FormatConverter and NMRStarExport (PDBe).
# - CCPN framework (http://www.ccpn.ac.uk/).
# 
# More information about this process can be found in the references below.
# Please cite the original reference for this PDB entry.
# 
# JF Doreleijers, A Nederveen, W Vranken, J Lin, AM Bonvin, R Kaptein, JL
# Markley, and EL Ulrich (2005). BioMagResBank databases DOCR and FRED
# containing converted and filtered sets of experimental NMR restraints and
# coordinates from over 500 protein PDB structures. J. Biomol. NMR 32, 1-12.
# 
# WF Vranken, W Boucher, TJ Stevens, RH Fogh, A Pajon, M Llinas, EL Ulrich, JL
# Markley, J Ionides, ED Laue (2005). The CCPN data model for NMR spectroscopy:
# development of a software pipeline. Proteins 59, 687-696. 
# 
# JF Doreleijers, WF Vranken, C Schulte, J Lin, JR Wedell, CJ Penkett, GW Vuister, 
# G Vriend, JL Markley, and EL Ulrich (2009). The NMR Restraints Grid at BMRB for 
# 5,266 Protein and Nucleic Acid PDB Entries. J Biomol. NMR 45, 389?396.




save_Conversion_project_for_entry_Name_1
    _Study_list.Sf_category  study_list
    _Study_list.Entry_ID     1
    _Study_list.ID           1

    loop_
       _Study.ID
       _Study.Name
       _Study.Type
       _Study.Details
       _Study.Entry_ID
       _Study.Study_list_ID

       1 "Conversion project for entry 1" NMR . 1 1 
    stop_

save_


save_originalConstraints_1
    _Entry.PDB_coordinate_file_version  .
    _Entry.Sf_category                  entry_information
    _Entry.ID                           1
    _Entry.Title                        "Data for entry 1"
    _Entry.NMR_STAR_version             3.1.0.8
    _Entry.Experimental_method          NMR
    _Entry.Details                      .

save_


save_assembly_2l82
    _Assembly.Sf_category           assembly
    _Assembly.Entry_ID              1
    _Assembly.ID                    1
    _Assembly.Name                  2l82
    _Assembly.Number_of_components  1
    _Assembly.Organic_ligands       .
    _Assembly.Metal_ions            .
    _Assembly.Paramagnetic          .
    _Assembly.Thiol_state           "not present"
    _Assembly.Molecular_mass        19660.71

    loop_
       _Entity_assembly.ID
       _Entity_assembly.Entity_assembly_name
       _Entity_assembly.Entity_ID
       _Entity_assembly.Entity_label
       _Entity_assembly.Asym_ID
       _Entity_assembly.Details
       _Entity_assembly.Entry_ID
       _Entity_assembly.Assembly_ID

       1 . 1 $DESIGNED_PROTEIN_OR32 A . 1 1 
    stop_

save_


save_DESIGNED_PROTEIN_OR32
    _Entity.Sf_category                  entity
    _Entity.Entry_ID                     1
    _Entity.ID                           1
    _Entity.Name                         "DESIGNED PROTEIN OR32"
    _Entity.Type                         polymer
    _Entity.Polymer_type                 polypeptide(L)
    _Entity.Polymer_seq_one_letter_code  MSQIFVVFSSDPEILKEIVREIKRQGVRVVLLYSDQDEKRRRERLEEFEKQGVDVRTVEDKEDFRENIREIWERYPQLDVVVIVTTDDKEWIKDFIEEAKERGVEVFVVYNNKDDDRRKEAQQEFRSDGVDVRTVSDKEELIEQVRRFVRKVGSLEHHHHHH
    _Entity.Number_of_monomers           162

    loop_
       _Entity_comp_index.ID
       _Entity_comp_index.Comp_ID
       _Entity_comp_index.Comp_label
       _Entity_comp_index.Entry_ID
       _Entity_comp_index.Entity_ID

         1 MET . 1 1 
         2 SER . 1 1 
         3 GLN . 1 1 
         4 ILE . 1 1 
         5 PHE . 1 1 
         6 VAL . 1 1 
         7 VAL . 1 1 
         8 PHE . 1 1 
         9 SER . 1 1 
        10 SER . 1 1 
        11 ASP . 1 1 
        12 PRO . 1 1 
        13 GLU . 1 1 
        14 ILE . 1 1 
        15 LEU . 1 1 
        16 LYS . 1 1 
        17 GLU . 1 1 
        18 ILE . 1 1 
        19 VAL . 1 1 
        20 ARG . 1 1 
        21 GLU . 1 1 
        22 ILE . 1 1 
        23 LYS . 1 1 
        24 ARG . 1 1 
        25 GLN . 1 1 
        26 GLY . 1 1 
        27 VAL . 1 1 
        28 ARG . 1 1 
        29 VAL . 1 1 
        30 VAL . 1 1 
        31 LEU . 1 1 
        32 LEU . 1 1 
        33 TYR . 1 1 
        34 SER . 1 1 
        35 ASP . 1 1 
        36 GLN . 1 1 
        37 ASP . 1 1 
        38 GLU . 1 1 
        39 LYS . 1 1 
        40 ARG . 1 1 
        41 ARG . 1 1 
        42 ARG . 1 1 
        43 GLU . 1 1 
        44 ARG . 1 1 
        45 LEU . 1 1 
        46 GLU . 1 1 
        47 GLU . 1 1 
        48 PHE . 1 1 
        49 GLU . 1 1 
        50 LYS . 1 1 
        51 GLN . 1 1 
        52 GLY . 1 1 
        53 VAL . 1 1 
        54 ASP . 1 1 
        55 VAL . 1 1 
        56 ARG . 1 1 
        57 THR . 1 1 
        58 VAL . 1 1 
        59 GLU . 1 1 
        60 ASP . 1 1 
        61 LYS . 1 1 
        62 GLU . 1 1 
        63 ASP . 1 1 
        64 PHE . 1 1 
        65 ARG . 1 1 
        66 GLU . 1 1 
        67 ASN . 1 1 
        68 ILE . 1 1 
        69 ARG . 1 1 
        70 GLU . 1 1 
        71 ILE . 1 1 
        72 TRP . 1 1 
        73 GLU . 1 1 
        74 ARG . 1 1 
        75 TYR . 1 1 
        76 PRO . 1 1 
        77 GLN . 1 1 
        78 LEU . 1 1 
        79 ASP . 1 1 
        80 VAL . 1 1 
        81 VAL . 1 1 
        82 VAL . 1 1 
        83 ILE . 1 1 
        84 VAL . 1 1 
        85 THR . 1 1 
        86 THR . 1 1 
        87 ASP . 1 1 
        88 ASP . 1 1 
        89 LYS . 1 1 
        90 GLU . 1 1 
        91 TRP . 1 1 
        92 ILE . 1 1 
        93 LYS . 1 1 
        94 ASP . 1 1 
        95 PHE . 1 1 
        96 ILE . 1 1 
        97 GLU . 1 1 
        98 GLU . 1 1 
        99 ALA . 1 1 
       100 LYS . 1 1 
       101 GLU . 1 1 
       102 ARG . 1 1 
       103 GLY . 1 1 
       104 VAL . 1 1 
       105 GLU . 1 1 
       106 VAL . 1 1 
       107 PHE . 1 1 
       108 VAL . 1 1 
       109 VAL . 1 1 
       110 TYR . 1 1 
       111 ASN . 1 1 
       112 ASN . 1 1 
       113 LYS . 1 1 
       114 ASP . 1 1 
       115 ASP . 1 1 
       116 ASP . 1 1 
       117 ARG . 1 1 
       118 ARG . 1 1 
       119 LYS . 1 1 
       120 GLU . 1 1 
       121 ALA . 1 1 
       122 GLN . 1 1 
       123 GLN . 1 1 
       124 GLU . 1 1 
       125 PHE . 1 1 
       126 ARG . 1 1 
       127 SER . 1 1 
       128 ASP . 1 1 
       129 GLY . 1 1 
       130 VAL . 1 1 
       131 ASP . 1 1 
       132 VAL . 1 1 
       133 ARG . 1 1 
       134 THR . 1 1 
       135 VAL . 1 1 
       136 SER . 1 1 
       137 ASP . 1 1 
       138 LYS . 1 1 
       139 GLU . 1 1 
       140 GLU . 1 1 
       141 LEU . 1 1 
       142 ILE . 1 1 
       143 GLU . 1 1 
       144 GLN . 1 1 
       145 VAL . 1 1 
       146 ARG . 1 1 
       147 ARG . 1 1 
       148 PHE . 1 1 
       149 VAL . 1 1 
       150 ARG . 1 1 
       151 LYS . 1 1 
       152 VAL . 1 1 
       153 GLY . 1 1 
       154 SER . 1 1 
       155 LEU . 1 1 
       156 GLU . 1 1 
       157 HIS . 1 1 
       158 HIS . 1 1 
       159 HIS . 1 1 
       160 HIS . 1 1 
       161 HIS . 1 1 
       162 HIS . 1 1 
    stop_

    loop_
       _Entity_poly_seq.Mon_ID
       _Entity_poly_seq.Num
       _Entity_poly_seq.Comp_index_ID
       _Entity_poly_seq.Entry_ID
       _Entity_poly_seq.Entity_ID

       MET   1   1 1 1 
       SER   2   2 1 1 
       GLN   3   3 1 1 
       ILE   4   4 1 1 
       PHE   5   5 1 1 
       VAL   6   6 1 1 
       VAL   7   7 1 1 
       PHE   8   8 1 1 
       SER   9   9 1 1 
       SER  10  10 1 1 
       ASP  11  11 1 1 
       PRO  12  12 1 1 
       GLU  13  13 1 1 
       ILE  14  14 1 1 
       LEU  15  15 1 1 
       LYS  16  16 1 1 
       GLU  17  17 1 1 
       ILE  18  18 1 1 
       VAL  19  19 1 1 
       ARG  20  20 1 1 
       GLU  21  21 1 1 
       ILE  22  22 1 1 
       LYS  23  23 1 1 
       ARG  24  24 1 1 
       GLN  25  25 1 1 
       GLY  26  26 1 1 
       VAL  27  27 1 1 
       ARG  28  28 1 1 
       VAL  29  29 1 1 
       VAL  30  30 1 1 
       LEU  31  31 1 1 
       LEU  32  32 1 1 
       TYR  33  33 1 1 
       SER  34  34 1 1 
       ASP  35  35 1 1 
       GLN  36  36 1 1 
       ASP  37  37 1 1 
       GLU  38  38 1 1 
       LYS  39  39 1 1 
       ARG  40  40 1 1 
       ARG  41  41 1 1 
       ARG  42  42 1 1 
       GLU  43  43 1 1 
       ARG  44  44 1 1 
       LEU  45  45 1 1 
       GLU  46  46 1 1 
       GLU  47  47 1 1 
       PHE  48  48 1 1 
       GLU  49  49 1 1 
       LYS  50  50 1 1 
       GLN  51  51 1 1 
       GLY  52  52 1 1 
       VAL  53  53 1 1 
       ASP  54  54 1 1 
       VAL  55  55 1 1 
       ARG  56  56 1 1 
       THR  57  57 1 1 
       VAL  58  58 1 1 
       GLU  59  59 1 1 
       ASP  60  60 1 1 
       LYS  61  61 1 1 
       GLU  62  62 1 1 
       ASP  63  63 1 1 
       PHE  64  64 1 1 
       ARG  65  65 1 1 
       GLU  66  66 1 1 
       ASN  67  67 1 1 
       ILE  68  68 1 1 
       ARG  69  69 1 1 
       GLU  70  70 1 1 
       ILE  71  71 1 1 
       TRP  72  72 1 1 
       GLU  73  73 1 1 
       ARG  74  74 1 1 
       TYR  75  75 1 1 
       PRO  76  76 1 1 
       GLN  77  77 1 1 
       LEU  78  78 1 1 
       ASP  79  79 1 1 
       VAL  80  80 1 1 
       VAL  81  81 1 1 
       VAL  82  82 1 1 
       ILE  83  83 1 1 
       VAL  84  84 1 1 
       THR  85  85 1 1 
       THR  86  86 1 1 
       ASP  87  87 1 1 
       ASP  88  88 1 1 
       LYS  89  89 1 1 
       GLU  90  90 1 1 
       TRP  91  91 1 1 
       ILE  92  92 1 1 
       LYS  93  93 1 1 
       ASP  94  94 1 1 
       PHE  95  95 1 1 
       ILE  96  96 1 1 
       GLU  97  97 1 1 
       GLU  98  98 1 1 
       ALA  99  99 1 1 
       LYS 100 100 1 1 
       GLU 101 101 1 1 
       ARG 102 102 1 1 
       GLY 103 103 1 1 
       VAL 104 104 1 1 
       GLU 105 105 1 1 
       VAL 106 106 1 1 
       PHE 107 107 1 1 
       VAL 108 108 1 1 
       VAL 109 109 1 1 
       TYR 110 110 1 1 
       ASN 111 111 1 1 
       ASN 112 112 1 1 
       LYS 113 113 1 1 
       ASP 114 114 1 1 
       ASP 115 115 1 1 
       ASP 116 116 1 1 
       ARG 117 117 1 1 
       ARG 118 118 1 1 
       LYS 119 119 1 1 
       GLU 120 120 1 1 
       ALA 121 121 1 1 
       GLN 122 122 1 1 
       GLN 123 123 1 1 
       GLU 124 124 1 1 
       PHE 125 125 1 1 
       ARG 126 126 1 1 
       SER 127 127 1 1 
       ASP 128 128 1 1 
       GLY 129 129 1 1 
       VAL 130 130 1 1 
       ASP 131 131 1 1 
       VAL 132 132 1 1 
       ARG 133 133 1 1 
       THR 134 134 1 1 
       VAL 135 135 1 1 
       SER 136 136 1 1 
       ASP 137 137 1 1 
       LYS 138 138 1 1 
       GLU 139 139 1 1 
       GLU 140 140 1 1 
       LEU 141 141 1 1 
       ILE 142 142 1 1 
       GLU 143 143 1 1 
       GLN 144 144 1 1 
       VAL 145 145 1 1 
       ARG 146 146 1 1 
       ARG 147 147 1 1 
       PHE 148 148 1 1 
       VAL 149 149 1 1 
       ARG 150 150 1 1 
       LYS 151 151 1 1 
       VAL 152 152 1 1 
       GLY 153 153 1 1 
       SER 154 154 1 1 
       LEU 155 155 1 1 
       GLU 156 156 1 1 
       HIS 157 157 1 1 
       HIS 158 158 1 1 
       HIS 159 159 1 1 
       HIS 160 160 1 1 
       HIS 161 161 1 1 
       HIS 162 162 1 1 
    stop_

save_


save_CNS/XPLOR_distance_constraints_3_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  1
    _Distance_constraint_list.Constraint_type     NOE
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

          1 1 . . . 1 1 
          2 1 . . . 1 1 
          3 1 . . . 1 1 
          4 1 . . . 1 1 
          5 1 . . . 1 1 
          6 1 . . . 1 1 
          7 1 . . . 1 1 
          8 1 . . . 1 1 
          9 1 . . . 1 1 
         10 1 . . . 1 1 
         11 1 . . . 1 1 
         12 1 . . . 1 1 
         13 1 . . . 1 1 
         14 1 . . . 1 1 
         15 1 . . . 1 1 
         16 1 . . . 1 1 
         17 1 . . . 1 1 
         18 1 . . . 1 1 
         19 1 . . . 1 1 
         20 1 . . . 1 1 
         21 1 . . . 1 1 
         22 1 . . . 1 1 
         23 1 . . . 1 1 
         24 1 . . . 1 1 
         25 1 . . . 1 1 
         26 1 . . . 1 1 
         27 1 . . . 1 1 
         28 1 . . . 1 1 
         29 1 . . . 1 1 
         30 1 . . . 1 1 
         31 1 . . . 1 1 
         32 1 . . . 1 1 
         33 1 . . . 1 1 
         34 1 . . . 1 1 
         35 1 . . . 1 1 
         36 1 . . . 1 1 
         37 1 . . . 1 1 
         38 1 . . . 1 1 
         39 1 . . . 1 1 
         40 1 . . . 1 1 
         41 1 . . . 1 1 
         42 1 . . . 1 1 
         43 1 . . . 1 1 
         44 1 . . . 1 1 
         45 1 . . . 1 1 
         46 1 . . . 1 1 
         47 1 . . . 1 1 
         48 1 . . . 1 1 
         49 1 . . . 1 1 
         50 1 . . . 1 1 
         51 1 . . . 1 1 
         52 1 . . . 1 1 
         53 1 . . . 1 1 
         54 1 . . . 1 1 
         55 1 . . . 1 1 
         56 1 . . . 1 1 
         57 1 . . . 1 1 
         58 1 . . . 1 1 
         59 1 . . . 1 1 
         60 1 . . . 1 1 
         61 1 . . . 1 1 
         62 1 . . . 1 1 
         63 1 . . . 1 1 
         64 1 . . . 1 1 
         65 1 . . . 1 1 
         66 1 . . . 1 1 
         67 1 . . . 1 1 
         68 1 . . . 1 1 
         69 1 . . . 1 1 
         70 1 . . . 1 1 
         71 1 . . . 1 1 
         72 1 . . . 1 1 
         73 1 . . . 1 1 
         74 1 . . . 1 1 
         75 1 . . . 1 1 
         76 1 . . . 1 1 
         77 1 . . . 1 1 
         78 1 . . . 1 1 
         79 1 . . . 1 1 
         80 1 . . . 1 1 
         81 1 . . . 1 1 
         82 1 . . . 1 1 
         83 1 . . . 1 1 
         84 1 . . . 1 1 
         85 1 . . . 1 1 
         86 1 . . . 1 1 
         87 1 . . . 1 1 
         88 1 . . . 1 1 
         89 1 . . . 1 1 
         90 1 . . . 1 1 
         91 1 . . . 1 1 
         92 1 . . . 1 1 
         93 1 . . . 1 1 
         94 1 . . . 1 1 
         95 1 . . . 1 1 
         96 1 . . . 1 1 
         97 1 . . . 1 1 
         98 1 . . . 1 1 
         99 1 . . . 1 1 
        100 1 . . . 1 1 
        101 1 . . . 1 1 
        102 1 . . . 1 1 
        103 1 . . . 1 1 
        104 1 . . . 1 1 
        105 1 . . . 1 1 
        106 1 . . . 1 1 
        107 1 . . . 1 1 
        108 1 . . . 1 1 
        109 1 . . . 1 1 
        110 1 . . . 1 1 
        111 1 . . . 1 1 
        112 1 . . . 1 1 
        113 1 . . . 1 1 
        114 1 . . . 1 1 
        115 1 . . . 1 1 
        116 1 . . . 1 1 
        117 1 . . . 1 1 
        118 1 . . . 1 1 
        119 1 . . . 1 1 
        120 1 . . . 1 1 
        121 1 . . . 1 1 
        122 1 . . . 1 1 
        123 1 . . . 1 1 
        124 1 . . . 1 1 
        125 1 . . . 1 1 
        126 1 . . . 1 1 
        127 1 . . . 1 1 
        128 1 . . . 1 1 
        129 1 . . . 1 1 
        130 1 . . . 1 1 
        131 1 . . . 1 1 
        132 1 . . . 1 1 
        133 1 . . . 1 1 
        134 1 . . . 1 1 
        135 1 . . . 1 1 
        136 1 . . . 1 1 
        137 1 . . . 1 1 
        138 1 . . . 1 1 
        139 1 . . . 1 1 
        140 1 . . . 1 1 
        141 1 . . . 1 1 
        142 1 . . . 1 1 
        143 1 . . . 1 1 
        144 1 . . . 1 1 
        145 1 . . . 1 1 
        146 1 . . . 1 1 
        147 1 . . . 1 1 
        148 1 . . . 1 1 
        149 1 . . . 1 1 
        150 1 . . . 1 1 
        151 1 . . . 1 1 
        152 1 . . . 1 1 
        153 1 . . . 1 1 
        154 1 . . . 1 1 
        155 1 . . . 1 1 
        156 1 . . . 1 1 
        157 1 . . . 1 1 
        158 1 . . . 1 1 
        159 1 . . . 1 1 
        160 1 . . . 1 1 
        161 1 . . . 1 1 
        162 1 . . . 1 1 
        163 1 . . . 1 1 
        164 1 . . . 1 1 
        165 1 . . . 1 1 
        166 1 . . . 1 1 
        167 1 . . . 1 1 
        168 1 . . . 1 1 
        169 1 . . . 1 1 
        170 1 . . . 1 1 
        171 1 . . . 1 1 
        172 1 . . . 1 1 
        173 1 . . . 1 1 
        174 1 . . . 1 1 
        175 1 . . . 1 1 
        176 1 . . . 1 1 
        177 1 . . . 1 1 
        178 1 . . . 1 1 
        179 1 . . . 1 1 
        180 1 . . . 1 1 
        181 1 . . . 1 1 
        182 1 . . . 1 1 
        183 1 . . . 1 1 
        184 1 . . . 1 1 
        185 1 . . . 1 1 
        186 1 . . . 1 1 
        187 1 . . . 1 1 
        188 1 . . . 1 1 
        189 1 . . . 1 1 
        190 1 . . . 1 1 
        191 1 . . . 1 1 
        192 1 . . . 1 1 
        193 1 . . . 1 1 
        194 1 . . . 1 1 
        195 1 . . . 1 1 
        196 1 . . . 1 1 
        197 1 . . . 1 1 
        198 1 . . . 1 1 
        199 1 . . . 1 1 
        200 1 . . . 1 1 
        201 1 . . . 1 1 
        202 1 . . . 1 1 
        203 1 . . . 1 1 
        204 1 . . . 1 1 
        205 1 . . . 1 1 
        206 1 . . . 1 1 
        207 1 . . . 1 1 
        208 1 . . . 1 1 
        209 1 . . . 1 1 
        210 1 . . . 1 1 
        211 1 . . . 1 1 
        212 1 . . . 1 1 
        213 1 . . . 1 1 
        214 1 . . . 1 1 
        215 1 . . . 1 1 
        216 1 . . . 1 1 
        217 1 . . . 1 1 
        218 1 . . . 1 1 
        219 1 . . . 1 1 
        220 1 . . . 1 1 
        221 1 . . . 1 1 
        222 1 . . . 1 1 
        223 1 . . . 1 1 
        224 1 . . . 1 1 
        225 1 . . . 1 1 
        226 1 . . . 1 1 
        227 1 . . . 1 1 
        228 1 . . . 1 1 
        229 1 . . . 1 1 
        230 1 . . . 1 1 
        231 1 . . . 1 1 
        232 1 . . . 1 1 
        233 1 . . . 1 1 
        234 1 . . . 1 1 
        235 1 . . . 1 1 
        236 1 . . . 1 1 
        237 1 . . . 1 1 
        238 1 . . . 1 1 
        239 1 . . . 1 1 
        240 1 . . . 1 1 
        241 1 . . . 1 1 
        242 1 . . . 1 1 
        243 1 . . . 1 1 
        244 1 . . . 1 1 
        245 1 . . . 1 1 
        246 1 . . . 1 1 
        247 1 . . . 1 1 
        248 1 . . . 1 1 
        249 1 . . . 1 1 
        250 1 . . . 1 1 
        251 1 . . . 1 1 
        252 1 . . . 1 1 
        253 1 . . . 1 1 
        254 1 . . . 1 1 
        255 1 . . . 1 1 
        256 1 . . . 1 1 
        257 1 . . . 1 1 
        258 1 . . . 1 1 
        259 1 . . . 1 1 
        260 1 . . . 1 1 
        261 1 . . . 1 1 
        262 1 . . . 1 1 
        263 1 . . . 1 1 
        264 1 . . . 1 1 
        265 1 . . . 1 1 
        266 1 . . . 1 1 
        267 1 . . . 1 1 
        268 1 . . . 1 1 
        269 1 . . . 1 1 
        270 1 . . . 1 1 
        271 1 . . . 1 1 
        272 1 . . . 1 1 
        273 1 . . . 1 1 
        274 1 . . . 1 1 
        275 1 . . . 1 1 
        276 1 . . . 1 1 
        277 1 . . . 1 1 
        278 1 . . . 1 1 
        279 1 . . . 1 1 
        280 1 . . . 1 1 
        281 1 . . . 1 1 
        282 1 . . . 1 1 
        283 1 . . . 1 1 
        284 1 . . . 1 1 
        285 1 . . . 1 1 
        286 1 . . . 1 1 
        287 1 . . . 1 1 
        288 1 . . . 1 1 
        289 1 . . . 1 1 
        290 1 . . . 1 1 
        291 1 . . . 1 1 
        292 1 . . . 1 1 
        293 1 . . . 1 1 
        294 1 . . . 1 1 
        295 1 . . . 1 1 
        296 1 . . . 1 1 
        297 1 . . . 1 1 
        298 1 . . . 1 1 
        299 1 . . . 1 1 
        300 1 . . . 1 1 
        301 1 . . . 1 1 
        302 1 . . . 1 1 
        303 1 . . . 1 1 
        304 1 . . . 1 1 
        305 1 . . . 1 1 
        306 1 . . . 1 1 
        307 1 . . . 1 1 
        308 1 . . . 1 1 
        309 1 . . . 1 1 
        310 1 . . . 1 1 
        311 1 . . . 1 1 
        312 1 . . . 1 1 
        313 1 . . . 1 1 
        314 1 . . . 1 1 
        315 1 . . . 1 1 
        316 1 . . . 1 1 
        317 1 . . . 1 1 
        318 1 . . . 1 1 
        319 1 . . . 1 1 
        320 1 . . . 1 1 
        321 1 . . . 1 1 
        322 1 . . . 1 1 
        323 1 . . . 1 1 
        324 1 . . . 1 1 
        325 1 . . . 1 1 
        326 1 . . . 1 1 
        327 1 . . . 1 1 
        328 1 . . . 1 1 
        329 1 . . . 1 1 
        330 1 . . . 1 1 
        331 1 . . . 1 1 
        332 1 . . . 1 1 
        333 1 . . . 1 1 
        334 1 . . . 1 1 
        335 1 . . . 1 1 
        336 1 . . . 1 1 
        337 1 . . . 1 1 
        338 1 . . . 1 1 
        339 1 . . . 1 1 
        340 1 . . . 1 1 
        341 1 . . . 1 1 
        342 1 . . . 1 1 
        343 1 . . . 1 1 
        344 1 . . . 1 1 
        345 1 . . . 1 1 
        346 1 . . . 1 1 
        347 1 . . . 1 1 
        348 1 . . . 1 1 
        349 1 . . . 1 1 
        350 1 . . . 1 1 
        351 1 . . . 1 1 
        352 1 . . . 1 1 
        353 1 . . . 1 1 
        354 1 . . . 1 1 
        355 1 . . . 1 1 
        356 1 . . . 1 1 
        357 1 . . . 1 1 
        358 1 . . . 1 1 
        359 1 . . . 1 1 
        360 1 . . . 1 1 
        361 1 . . . 1 1 
        362 1 . . . 1 1 
        363 1 . . . 1 1 
        364 1 . . . 1 1 
        365 1 . . . 1 1 
        366 1 . . . 1 1 
        367 1 . . . 1 1 
        368 1 . . . 1 1 
        369 1 . . . 1 1 
        370 1 . . . 1 1 
        371 1 . . . 1 1 
        372 1 . . . 1 1 
        373 1 . . . 1 1 
        374 1 . . . 1 1 
        375 1 . . . 1 1 
        376 1 . . . 1 1 
        377 1 . . . 1 1 
        378 1 . . . 1 1 
        379 1 . . . 1 1 
        380 1 . . . 1 1 
        381 1 . . . 1 1 
        382 1 . . . 1 1 
        383 1 . . . 1 1 
        384 1 . . . 1 1 
        385 1 . . . 1 1 
        386 1 . . . 1 1 
        387 1 . . . 1 1 
        388 1 . . . 1 1 
        389 1 . . . 1 1 
        390 1 . . . 1 1 
        391 1 . . . 1 1 
        392 1 . . . 1 1 
        393 1 . . . 1 1 
        394 1 . . . 1 1 
        395 1 . . . 1 1 
        396 1 . . . 1 1 
        397 1 . . . 1 1 
        398 1 . . . 1 1 
        399 1 . . . 1 1 
        400 1 . . . 1 1 
        401 1 . . . 1 1 
        402 1 . . . 1 1 
        403 1 . . . 1 1 
        404 1 . . . 1 1 
        405 1 . . . 1 1 
        406 1 . . . 1 1 
        407 1 . . . 1 1 
        408 1 . . . 1 1 
        409 1 . . . 1 1 
        410 1 . . . 1 1 
        411 1 . . . 1 1 
        412 1 . . . 1 1 
        413 1 . . . 1 1 
        414 1 . . . 1 1 
        415 1 . . . 1 1 
        416 1 . . . 1 1 
        417 1 . . . 1 1 
        418 1 . . . 1 1 
        419 1 . . . 1 1 
        420 1 . . . 1 1 
        421 1 . . . 1 1 
        422 1 . . . 1 1 
        423 1 . . . 1 1 
        424 1 . . . 1 1 
        425 1 . . . 1 1 
        426 1 . . . 1 1 
        427 1 . . . 1 1 
        428 1 . . . 1 1 
        429 1 . . . 1 1 
        430 1 . . . 1 1 
        431 1 . . . 1 1 
        432 1 . . . 1 1 
        433 1 . . . 1 1 
        434 1 . . . 1 1 
        435 1 . . . 1 1 
        436 1 . . . 1 1 
        437 1 . . . 1 1 
        438 1 . . . 1 1 
        439 1 . . . 1 1 
        440 1 . . . 1 1 
        441 1 . . . 1 1 
        442 1 . . . 1 1 
        443 1 . . . 1 1 
        444 1 . . . 1 1 
        445 1 . . . 1 1 
        446 1 . . . 1 1 
        447 1 . . . 1 1 
        448 1 . . . 1 1 
        449 1 . . . 1 1 
        450 1 . . . 1 1 
        451 1 . . . 1 1 
        452 1 . . . 1 1 
        453 1 . . . 1 1 
        454 1 . . . 1 1 
        455 1 . . . 1 1 
        456 1 . . . 1 1 
        457 1 . . . 1 1 
        458 1 . . . 1 1 
        459 1 . . . 1 1 
        460 1 . . . 1 1 
        461 1 . . . 1 1 
        462 1 . . . 1 1 
        463 1 . . . 1 1 
        464 1 . . . 1 1 
        465 1 . . . 1 1 
        466 1 . . . 1 1 
        467 1 . . . 1 1 
        468 1 . . . 1 1 
        469 1 . . . 1 1 
        470 1 . . . 1 1 
        471 1 . . . 1 1 
        472 1 . . . 1 1 
        473 1 . . . 1 1 
        474 1 . . . 1 1 
        475 1 . . . 1 1 
        476 1 . . . 1 1 
        477 1 . . . 1 1 
        478 1 . . . 1 1 
        479 1 . . . 1 1 
        480 1 . . . 1 1 
        481 1 . . . 1 1 
        482 1 . . . 1 1 
        483 1 . . . 1 1 
        484 1 . . . 1 1 
        485 1 . . . 1 1 
        486 1 . . . 1 1 
        487 1 . . . 1 1 
        488 1 . . . 1 1 
        489 1 . . . 1 1 
        490 1 . . . 1 1 
        491 1 . . . 1 1 
        492 1 . . . 1 1 
        493 1 . . . 1 1 
        494 1 . . . 1 1 
        495 1 . . . 1 1 
        496 1 . . . 1 1 
        497 1 . . . 1 1 
        498 1 . . . 1 1 
        499 1 . . . 1 1 
        500 1 . . . 1 1 
        501 1 . . . 1 1 
        502 1 . . . 1 1 
        503 1 . . . 1 1 
        504 1 . . . 1 1 
        505 1 . . . 1 1 
        506 1 . . . 1 1 
        507 1 . . . 1 1 
        508 1 . . . 1 1 
        509 1 . . . 1 1 
        510 1 . . . 1 1 
        511 1 . . . 1 1 
        512 1 . . . 1 1 
        513 1 . . . 1 1 
        514 1 . . . 1 1 
        515 1 . . . 1 1 
        516 1 . . . 1 1 
        517 1 . . . 1 1 
        518 1 . . . 1 1 
        519 1 . . . 1 1 
        520 1 . . . 1 1 
        521 1 . . . 1 1 
        522 1 . . . 1 1 
        523 1 . . . 1 1 
        524 1 . . . 1 1 
        525 1 . . . 1 1 
        526 1 . . . 1 1 
        527 1 . . . 1 1 
        528 1 . . . 1 1 
        529 1 . . . 1 1 
        530 1 . . . 1 1 
        531 1 . . . 1 1 
        532 1 . . . 1 1 
        533 1 . . . 1 1 
        534 1 . . . 1 1 
        535 1 . . . 1 1 
        536 1 . . . 1 1 
        537 1 . . . 1 1 
        538 1 . . . 1 1 
        539 1 . . . 1 1 
        540 1 . . . 1 1 
        541 1 . . . 1 1 
        542 1 . . . 1 1 
        543 1 . . . 1 1 
        544 1 . . . 1 1 
        545 1 . . . 1 1 
        546 1 . . . 1 1 
        547 1 . . . 1 1 
        548 1 . . . 1 1 
        549 1 . . . 1 1 
        550 1 . . . 1 1 
        551 1 . . . 1 1 
        552 1 . . . 1 1 
        553 1 . . . 1 1 
        554 1 . . . 1 1 
        555 1 . . . 1 1 
        556 1 . . . 1 1 
        557 1 . . . 1 1 
        558 1 . . . 1 1 
        559 1 . . . 1 1 
        560 1 . . . 1 1 
        561 1 . . . 1 1 
        562 1 . . . 1 1 
        563 1 . . . 1 1 
        564 1 . . . 1 1 
        565 1 . . . 1 1 
        566 1 . . . 1 1 
        567 1 . . . 1 1 
        568 1 . . . 1 1 
        569 1 . . . 1 1 
        570 1 . . . 1 1 
        571 1 . . . 1 1 
        572 1 . . . 1 1 
        573 1 . . . 1 1 
        574 1 . . . 1 1 
        575 1 . . . 1 1 
        576 1 . . . 1 1 
        577 1 . . . 1 1 
        578 1 . . . 1 1 
        579 1 . . . 1 1 
        580 1 . . . 1 1 
        581 1 . . . 1 1 
        582 1 . . . 1 1 
        583 1 . . . 1 1 
        584 1 . . . 1 1 
        585 1 . . . 1 1 
        586 1 . . . 1 1 
        587 1 . . . 1 1 
        588 1 . . . 1 1 
        589 1 . . . 1 1 
        590 1 . . . 1 1 
        591 1 . . . 1 1 
        592 1 . . . 1 1 
        593 1 . . . 1 1 
        594 1 . . . 1 1 
        595 1 . . . 1 1 
        596 1 . . . 1 1 
        597 1 . . . 1 1 
        598 1 . . . 1 1 
        599 1 . . . 1 1 
        600 1 . . . 1 1 
        601 1 . . . 1 1 
        602 1 . . . 1 1 
        603 1 . . . 1 1 
        604 1 . . . 1 1 
        605 1 . . . 1 1 
        606 1 . . . 1 1 
        607 1 . . . 1 1 
        608 1 . . . 1 1 
        609 1 . . . 1 1 
        610 1 . . . 1 1 
        611 1 . . . 1 1 
        612 1 . . . 1 1 
        613 1 . . . 1 1 
        614 1 . . . 1 1 
        615 1 . . . 1 1 
        616 1 . . . 1 1 
        617 1 . . . 1 1 
        618 1 . . . 1 1 
        619 1 . . . 1 1 
        620 1 . . . 1 1 
        621 1 . . . 1 1 
        622 1 . . . 1 1 
        623 1 . . . 1 1 
        624 1 . . . 1 1 
        625 1 . . . 1 1 
        626 1 . . . 1 1 
        627 1 . . . 1 1 
        628 1 . . . 1 1 
        629 1 . . . 1 1 
        630 1 . . . 1 1 
        631 1 . . . 1 1 
        632 1 . . . 1 1 
        633 1 . . . 1 1 
        634 1 . . . 1 1 
        635 1 . . . 1 1 
        636 1 . . . 1 1 
        637 1 . . . 1 1 
        638 1 . . . 1 1 
        639 1 . . . 1 1 
        640 1 . . . 1 1 
        641 1 . . . 1 1 
        642 1 . . . 1 1 
        643 1 . . . 1 1 
        644 1 . . . 1 1 
        645 1 . . . 1 1 
        646 1 . . . 1 1 
        647 1 . . . 1 1 
        648 1 . . . 1 1 
        649 1 . . . 1 1 
        650 1 . . . 1 1 
        651 1 . . . 1 1 
        652 1 . . . 1 1 
        653 1 . . . 1 1 
        654 1 . . . 1 1 
        655 1 . . . 1 1 
        656 1 . . . 1 1 
        657 1 . . . 1 1 
        658 1 . . . 1 1 
        659 1 . . . 1 1 
        660 1 . . . 1 1 
        661 1 . . . 1 1 
        662 1 . . . 1 1 
        663 1 . . . 1 1 
        664 1 . . . 1 1 
        665 1 . . . 1 1 
        666 1 . . . 1 1 
        667 1 . . . 1 1 
        668 1 . . . 1 1 
        669 1 . . . 1 1 
        670 1 . . . 1 1 
        671 1 . . . 1 1 
        672 1 . . . 1 1 
        673 1 . . . 1 1 
        674 1 . . . 1 1 
        675 1 . . . 1 1 
        676 1 . . . 1 1 
        677 1 . . . 1 1 
        678 1 . . . 1 1 
        679 1 . . . 1 1 
        680 1 . . . 1 1 
        681 1 . . . 1 1 
        682 1 . . . 1 1 
        683 1 . . . 1 1 
        684 1 . . . 1 1 
        685 1 . . . 1 1 
        686 1 . . . 1 1 
        687 1 . . . 1 1 
        688 1 . . . 1 1 
        689 1 . . . 1 1 
        690 1 . . . 1 1 
        691 1 . . . 1 1 
        692 1 . . . 1 1 
        693 1 . . . 1 1 
        694 1 . . . 1 1 
        695 1 . . . 1 1 
        696 1 . . . 1 1 
        697 1 . . . 1 1 
        698 1 . . . 1 1 
        699 1 . . . 1 1 
        700 1 . . . 1 1 
        701 1 . . . 1 1 
        702 1 . . . 1 1 
        703 1 . . . 1 1 
        704 1 . . . 1 1 
        705 1 . . . 1 1 
        706 1 . . . 1 1 
        707 1 . . . 1 1 
        708 1 . . . 1 1 
        709 1 . . . 1 1 
        710 1 . . . 1 1 
        711 1 . . . 1 1 
        712 1 . . . 1 1 
        713 1 . . . 1 1 
        714 1 . . . 1 1 
        715 1 . . . 1 1 
        716 1 . . . 1 1 
        717 1 . . . 1 1 
        718 1 . . . 1 1 
        719 1 . . . 1 1 
        720 1 . . . 1 1 
        721 1 . . . 1 1 
        722 1 . . . 1 1 
        723 1 . . . 1 1 
        724 1 . . . 1 1 
        725 1 . . . 1 1 
        726 1 . . . 1 1 
        727 1 . . . 1 1 
        728 1 . . . 1 1 
        729 1 . . . 1 1 
        730 1 . . . 1 1 
        731 1 . . . 1 1 
        732 1 . . . 1 1 
        733 1 . . . 1 1 
        734 1 . . . 1 1 
        735 1 . . . 1 1 
        736 1 . . . 1 1 
        737 1 . . . 1 1 
        738 1 . . . 1 1 
        739 1 . . . 1 1 
        740 1 . . . 1 1 
        741 1 . . . 1 1 
        742 1 . . . 1 1 
        743 1 . . . 1 1 
        744 1 . . . 1 1 
        745 1 . . . 1 1 
        746 1 . . . 1 1 
        747 1 . . . 1 1 
        748 1 . . . 1 1 
        749 1 . . . 1 1 
        750 1 . . . 1 1 
        751 1 . . . 1 1 
        752 1 . . . 1 1 
        753 1 . . . 1 1 
        754 1 . . . 1 1 
        755 1 . . . 1 1 
        756 1 . . . 1 1 
        757 1 . . . 1 1 
        758 1 . . . 1 1 
        759 1 . . . 1 1 
        760 1 . . . 1 1 
        761 1 . . . 1 1 
        762 1 . . . 1 1 
        763 1 . . . 1 1 
        764 1 . . . 1 1 
        765 1 . . . 1 1 
        766 1 . . . 1 1 
        767 1 . . . 1 1 
        768 1 . . . 1 1 
        769 1 . . . 1 1 
        770 1 . . . 1 1 
        771 1 . . . 1 1 
        772 1 . . . 1 1 
        773 1 . . . 1 1 
        774 1 . . . 1 1 
        775 1 . . . 1 1 
        776 1 . . . 1 1 
        777 1 . . . 1 1 
        778 1 . . . 1 1 
        779 1 . . . 1 1 
        780 1 . . . 1 1 
        781 1 . . . 1 1 
        782 1 . . . 1 1 
        783 1 . . . 1 1 
        784 1 . . . 1 1 
        785 1 . . . 1 1 
        786 1 . . . 1 1 
        787 1 . . . 1 1 
        788 1 . . . 1 1 
        789 1 . . . 1 1 
        790 1 . . . 1 1 
        791 1 . . . 1 1 
        792 1 . . . 1 1 
        793 1 . . . 1 1 
        794 1 . . . 1 1 
        795 1 . . . 1 1 
        796 1 . . . 1 1 
        797 1 . . . 1 1 
        798 1 . . . 1 1 
        799 1 . . . 1 1 
        800 1 . . . 1 1 
        801 1 . . . 1 1 
        802 1 . . . 1 1 
        803 1 . . . 1 1 
        804 1 . . . 1 1 
        805 1 . . . 1 1 
        806 1 . . . 1 1 
        807 1 . . . 1 1 
        808 1 . . . 1 1 
        809 1 . . . 1 1 
        810 1 . . . 1 1 
        811 1 . . . 1 1 
        812 1 . . . 1 1 
        813 1 . . . 1 1 
        814 1 . . . 1 1 
        815 1 . . . 1 1 
        816 1 . . . 1 1 
        817 1 . . . 1 1 
        818 1 . . . 1 1 
        819 1 . . . 1 1 
        820 1 . . . 1 1 
        821 1 . . . 1 1 
        822 1 . . . 1 1 
        823 1 . . . 1 1 
        824 1 . . . 1 1 
        825 1 . . . 1 1 
        826 1 . . . 1 1 
        827 1 . . . 1 1 
        828 1 . . . 1 1 
        829 1 . . . 1 1 
        830 1 . . . 1 1 
        831 1 . . . 1 1 
        832 1 . . . 1 1 
        833 1 . . . 1 1 
        834 1 . . . 1 1 
        835 1 . . . 1 1 
        836 1 . . . 1 1 
        837 1 . . . 1 1 
        838 1 . . . 1 1 
        839 1 . . . 1 1 
        840 1 . . . 1 1 
        841 1 . . . 1 1 
        842 1 . . . 1 1 
        843 1 . . . 1 1 
        844 1 . . . 1 1 
        845 1 . . . 1 1 
        846 1 . . . 1 1 
        847 1 . . . 1 1 
        848 1 . . . 1 1 
        849 1 . . . 1 1 
        850 1 . . . 1 1 
        851 1 . . . 1 1 
        852 1 . . . 1 1 
        853 1 . . . 1 1 
        854 1 . . . 1 1 
        855 1 . . . 1 1 
        856 1 . . . 1 1 
        857 1 . . . 1 1 
        858 1 . . . 1 1 
        859 1 . . . 1 1 
        860 1 . . . 1 1 
        861 1 . . . 1 1 
        862 1 . . . 1 1 
        863 1 . . . 1 1 
        864 1 . . . 1 1 
        865 1 . . . 1 1 
        866 1 . . . 1 1 
        867 1 . . . 1 1 
        868 1 . . . 1 1 
        869 1 . . . 1 1 
        870 1 . . . 1 1 
        871 1 . . . 1 1 
        872 1 . . . 1 1 
        873 1 . . . 1 1 
        874 1 . . . 1 1 
        875 1 . . . 1 1 
        876 1 . . . 1 1 
        877 1 . . . 1 1 
        878 1 . . . 1 1 
        879 1 . . . 1 1 
        880 1 . . . 1 1 
        881 1 . . . 1 1 
        882 1 . . . 1 1 
        883 1 . . . 1 1 
        884 1 . . . 1 1 
        885 1 . . . 1 1 
        886 1 . . . 1 1 
        887 1 . . . 1 1 
        888 1 . . . 1 1 
        889 1 . . . 1 1 
        890 1 . . . 1 1 
        891 1 . . . 1 1 
        892 1 . . . 1 1 
        893 1 . . . 1 1 
        894 1 . . . 1 1 
        895 1 . . . 1 1 
        896 1 . . . 1 1 
        897 1 . . . 1 1 
        898 1 . . . 1 1 
        899 1 . . . 1 1 
        900 1 . . . 1 1 
        901 1 . . . 1 1 
        902 1 . . . 1 1 
        903 1 . . . 1 1 
        904 1 . . . 1 1 
        905 1 . . . 1 1 
        906 1 . . . 1 1 
        907 1 . . . 1 1 
        908 1 . . . 1 1 
        909 1 . . . 1 1 
        910 1 . . . 1 1 
        911 1 . . . 1 1 
        912 1 . . . 1 1 
        913 1 . . . 1 1 
        914 1 . . . 1 1 
        915 1 . . . 1 1 
        916 1 . . . 1 1 
        917 1 . . . 1 1 
        918 1 . . . 1 1 
        919 1 . . . 1 1 
        920 1 . . . 1 1 
        921 1 . . . 1 1 
        922 1 . . . 1 1 
        923 1 . . . 1 1 
        924 1 . . . 1 1 
        925 1 . . . 1 1 
        926 1 . . . 1 1 
        927 1 . . . 1 1 
        928 1 . . . 1 1 
        929 1 . . . 1 1 
        930 1 . . . 1 1 
        931 1 . . . 1 1 
        932 1 . . . 1 1 
        933 1 . . . 1 1 
        934 1 . . . 1 1 
        935 1 . . . 1 1 
        936 1 . . . 1 1 
        937 1 . . . 1 1 
        938 1 . . . 1 1 
        939 1 . . . 1 1 
        940 1 . . . 1 1 
        941 1 . . . 1 1 
        942 1 . . . 1 1 
        943 1 . . . 1 1 
        944 1 . . . 1 1 
        945 1 . . . 1 1 
        946 1 . . . 1 1 
        947 1 . . . 1 1 
        948 1 . . . 1 1 
        949 1 . . . 1 1 
        950 1 . . . 1 1 
        951 1 . . . 1 1 
        952 1 . . . 1 1 
        953 1 . . . 1 1 
        954 1 . . . 1 1 
        955 1 . . . 1 1 
        956 1 . . . 1 1 
        957 1 . . . 1 1 
        958 1 . . . 1 1 
        959 1 . . . 1 1 
        960 1 . . . 1 1 
        961 1 . . . 1 1 
        962 1 . . . 1 1 
        963 1 . . . 1 1 
        964 1 . . . 1 1 
        965 1 . . . 1 1 
        966 1 . . . 1 1 
        967 1 . . . 1 1 
        968 1 . . . 1 1 
        969 1 . . . 1 1 
        970 1 . . . 1 1 
        971 1 . . . 1 1 
        972 1 . . . 1 1 
        973 1 . . . 1 1 
        974 1 . . . 1 1 
        975 1 . . . 1 1 
        976 1 . . . 1 1 
        977 1 . . . 1 1 
        978 1 . . . 1 1 
        979 1 . . . 1 1 
        980 1 . . . 1 1 
        981 1 . . . 1 1 
        982 1 . . . 1 1 
        983 1 . . . 1 1 
        984 1 . . . 1 1 
        985 1 . . . 1 1 
        986 1 . . . 1 1 
        987 1 . . . 1 1 
        988 1 . . . 1 1 
        989 1 . . . 1 1 
        990 1 . . . 1 1 
        991 1 . . . 1 1 
        992 1 . . . 1 1 
        993 1 . . . 1 1 
        994 1 . . . 1 1 
        995 1 . . . 1 1 
        996 1 . . . 1 1 
        997 1 . . . 1 1 
        998 1 . . . 1 1 
        999 1 . . . 1 1 
       1000 1 . . . 1 1 
       1001 1 . . . 1 1 
       1002 1 . . . 1 1 
       1003 1 . . . 1 1 
       1004 1 . . . 1 1 
       1005 1 . . . 1 1 
       1006 1 . . . 1 1 
       1007 1 . . . 1 1 
       1008 1 . . . 1 1 
       1009 1 . . . 1 1 
       1010 1 . . . 1 1 
       1011 1 . . . 1 1 
       1012 1 . . . 1 1 
       1013 1 . . . 1 1 
       1014 1 . . . 1 1 
       1015 1 . . . 1 1 
       1016 1 . . . 1 1 
       1017 1 . . . 1 1 
       1018 1 . . . 1 1 
       1019 1 . . . 1 1 
       1020 1 . . . 1 1 
       1021 1 . . . 1 1 
       1022 1 . . . 1 1 
       1023 1 . . . 1 1 
       1024 1 . . . 1 1 
       1025 1 . . . 1 1 
       1026 1 . . . 1 1 
       1027 1 . . . 1 1 
       1028 1 . . . 1 1 
       1029 1 . . . 1 1 
       1030 1 . . . 1 1 
       1031 1 . . . 1 1 
       1032 1 . . . 1 1 
       1033 1 . . . 1 1 
       1034 1 . . . 1 1 
       1035 1 . . . 1 1 
       1036 1 . . . 1 1 
       1037 1 . . . 1 1 
       1038 1 . . . 1 1 
       1039 1 . . . 1 1 
       1040 1 . . . 1 1 
       1041 1 . . . 1 1 
       1042 1 . . . 1 1 
       1043 1 . . . 1 1 
       1044 1 . . . 1 1 
       1045 1 . . . 1 1 
       1046 1 . . . 1 1 
       1047 1 . . . 1 1 
       1048 1 . . . 1 1 
       1049 1 . . . 1 1 
       1050 1 . . . 1 1 
       1051 1 . . . 1 1 
       1052 1 . . . 1 1 
       1053 1 . . . 1 1 
       1054 1 . . . 1 1 
       1055 1 . . . 1 1 
       1056 1 . . . 1 1 
       1057 1 . . . 1 1 
       1058 1 . . . 1 1 
       1059 1 . . . 1 1 
       1060 1 . . . 1 1 
       1061 1 . . . 1 1 
       1062 1 . . . 1 1 
       1063 1 . . . 1 1 
       1064 1 . . . 1 1 
       1065 1 . . . 1 1 
       1066 1 . . . 1 1 
       1067 1 . . . 1 1 
       1068 1 . . . 1 1 
       1069 1 . . . 1 1 
       1070 1 . . . 1 1 
       1071 1 . . . 1 1 
       1072 1 . . . 1 1 
       1073 1 . . . 1 1 
       1074 1 . . . 1 1 
       1075 1 . . . 1 1 
       1076 1 . . . 1 1 
       1077 1 . . . 1 1 
       1078 1 . . . 1 1 
       1079 1 . . . 1 1 
       1080 1 . . . 1 1 
       1081 1 . . . 1 1 
       1082 1 . . . 1 1 
       1083 1 . . . 1 1 
       1084 1 . . . 1 1 
       1085 1 . . . 1 1 
       1086 1 . . . 1 1 
       1087 1 . . . 1 1 
       1088 1 . . . 1 1 
       1089 1 . . . 1 1 
       1090 1 . . . 1 1 
       1091 1 . . . 1 1 
       1092 1 . . . 1 1 
       1093 1 . . . 1 1 
       1094 1 . . . 1 1 
       1095 1 . . . 1 1 
       1096 1 . . . 1 1 
       1097 1 . . . 1 1 
       1098 1 . . . 1 1 
       1099 1 . . . 1 1 
       1100 1 . . . 1 1 
       1101 1 . . . 1 1 
       1102 1 . . . 1 1 
       1103 1 . . . 1 1 
       1104 1 . . . 1 1 
       1105 1 . . . 1 1 
       1106 1 . . . 1 1 
       1107 1 . . . 1 1 
       1108 1 . . . 1 1 
       1109 1 . . . 1 1 
       1110 1 . . . 1 1 
       1111 1 . . . 1 1 
       1112 1 . . . 1 1 
       1113 1 . . . 1 1 
       1114 1 . . . 1 1 
       1115 1 . . . 1 1 
       1116 1 . . . 1 1 
       1117 1 . . . 1 1 
       1118 1 . . . 1 1 
       1119 1 . . . 1 1 
       1120 1 . . . 1 1 
       1121 1 . . . 1 1 
       1122 1 . . . 1 1 
       1123 1 . . . 1 1 
       1124 1 . . . 1 1 
       1125 1 . . . 1 1 
       1126 1 . . . 1 1 
       1127 1 . . . 1 1 
       1128 1 . . . 1 1 
       1129 1 . . . 1 1 
       1130 1 . . . 1 1 
       1131 1 . . . 1 1 
       1132 1 . . . 1 1 
       1133 1 . . . 1 1 
       1134 1 . . . 1 1 
       1135 1 . . . 1 1 
       1136 1 . . . 1 1 
       1137 1 . . . 1 1 
       1138 1 . . . 1 1 
       1139 1 . . . 1 1 
       1140 1 . . . 1 1 
       1141 1 . . . 1 1 
       1142 1 . . . 1 1 
       1143 1 . . . 1 1 
       1144 1 . . . 1 1 
       1145 1 . . . 1 1 
       1146 1 . . . 1 1 
       1147 1 . . . 1 1 
       1148 1 . . . 1 1 
       1149 1 . . . 1 1 
       1150 1 . . . 1 1 
       1151 1 . . . 1 1 
       1152 1 . . . 1 1 
       1153 1 . . . 1 1 
       1154 1 . . . 1 1 
       1155 1 . . . 1 1 
       1156 1 . . . 1 1 
       1157 1 . . . 1 1 
       1158 1 . . . 1 1 
       1159 1 . . . 1 1 
       1160 1 . . . 1 1 
       1161 1 . . . 1 1 
       1162 1 . . . 1 1 
       1163 1 . . . 1 1 
       1164 1 . . . 1 1 
       1165 1 . . . 1 1 
       1166 1 . . . 1 1 
       1167 1 . . . 1 1 
       1168 1 . . . 1 1 
       1169 1 . . . 1 1 
       1170 1 . . . 1 1 
       1171 1 . . . 1 1 
       1172 1 . . . 1 1 
       1173 1 . . . 1 1 
       1174 1 . . . 1 1 
       1175 1 . . . 1 1 
       1176 1 . . . 1 1 
       1177 1 . . . 1 1 
       1178 1 . . . 1 1 
       1179 1 . . . 1 1 
       1180 1 . . . 1 1 
       1181 1 . . . 1 1 
       1182 1 . . . 1 1 
       1183 1 . . . 1 1 
       1184 1 . . . 1 1 
       1185 1 . . . 1 1 
       1186 1 . . . 1 1 
       1187 1 . . . 1 1 
       1188 1 . . . 1 1 
       1189 1 . . . 1 1 
       1190 1 . . . 1 1 
       1191 1 . . . 1 1 
       1192 1 . . . 1 1 
       1193 1 . . . 1 1 
       1194 1 . . . 1 1 
       1195 1 . . . 1 1 
       1196 1 . . . 1 1 
       1197 1 . . . 1 1 
       1198 1 . . . 1 1 
       1199 1 . . . 1 1 
       1200 1 . . . 1 1 
       1201 1 . . . 1 1 
       1202 1 . . . 1 1 
       1203 1 . . . 1 1 
       1204 1 . . . 1 1 
       1205 1 . . . 1 1 
       1206 1 . . . 1 1 
       1207 1 . . . 1 1 
       1208 1 . . . 1 1 
       1209 1 . . . 1 1 
       1210 1 . . . 1 1 
       1211 1 . . . 1 1 
       1212 1 . . . 1 1 
       1213 1 . . . 1 1 
       1214 1 . . . 1 1 
       1215 1 . . . 1 1 
       1216 1 . . . 1 1 
       1217 1 . . . 1 1 
       1218 1 . . . 1 1 
       1219 1 . . . 1 1 
       1220 1 . . . 1 1 
       1221 1 . . . 1 1 
       1222 1 . . . 1 1 
       1223 1 . . . 1 1 
       1224 1 . . . 1 1 
       1225 1 . . . 1 1 
       1226 1 . . . 1 1 
       1227 1 . . . 1 1 
       1228 1 . . . 1 1 
       1229 1 . . . 1 1 
       1230 1 . . . 1 1 
       1231 1 . . . 1 1 
       1232 1 . . . 1 1 
       1233 1 . . . 1 1 
       1234 1 . . . 1 1 
       1235 1 . . . 1 1 
       1236 1 . . . 1 1 
       1237 1 . . . 1 1 
       1238 1 . . . 1 1 
       1239 1 . . . 1 1 
       1240 1 . . . 1 1 
       1241 1 . . . 1 1 
       1242 1 . . . 1 1 
       1243 1 . . . 1 1 
       1244 1 . . . 1 1 
       1245 1 . . . 1 1 
       1246 1 . . . 1 1 
       1247 1 . . . 1 1 
       1248 1 . . . 1 1 
       1249 1 . . . 1 1 
       1250 1 . . . 1 1 
       1251 1 . . . 1 1 
       1252 1 . . . 1 1 
       1253 1 . . . 1 1 
       1254 1 . . . 1 1 
       1255 1 . . . 1 1 
       1256 1 . . . 1 1 
       1257 1 . . . 1 1 
       1258 1 . . . 1 1 
       1259 1 . . . 1 1 
       1260 1 . . . 1 1 
       1261 1 . . . 1 1 
       1262 1 . . . 1 1 
       1263 1 . . . 1 1 
       1264 1 . . . 1 1 
       1265 1 . . . 1 1 
       1266 1 . . . 1 1 
       1267 1 . . . 1 1 
       1268 1 . . . 1 1 
       1269 1 . . . 1 1 
       1270 1 . . . 1 1 
       1271 1 . . . 1 1 
       1272 1 . . . 1 1 
       1273 1 . . . 1 1 
       1274 1 . . . 1 1 
       1275 1 . . . 1 1 
       1276 1 . . . 1 1 
       1277 1 . . . 1 1 
       1278 1 . . . 1 1 
       1279 1 . . . 1 1 
       1280 1 . . . 1 1 
       1281 1 . . . 1 1 
       1282 1 . . . 1 1 
       1283 1 . . . 1 1 
       1284 1 . . . 1 1 
       1285 1 . . . 1 1 
       1286 1 . . . 1 1 
       1287 1 . . . 1 1 
       1288 1 . . . 1 1 
       1289 1 . . . 1 1 
       1290 1 . . . 1 1 
       1291 1 . . . 1 1 
       1292 1 . . . 1 1 
       1293 1 . . . 1 1 
       1294 1 . . . 1 1 
       1295 1 . . . 1 1 
       1296 1 . . . 1 1 
       1297 1 . . . 1 1 
       1298 1 . . . 1 1 
       1299 1 . . . 1 1 
       1300 1 . . . 1 1 
       1301 1 . . . 1 1 
       1302 1 . . . 1 1 
       1303 1 . . . 1 1 
       1304 1 . . . 1 1 
       1305 1 . . . 1 1 
       1306 1 . . . 1 1 
       1307 1 . . . 1 1 
       1308 1 . . . 1 1 
       1309 1 . . . 1 1 
       1310 1 . . . 1 1 
       1311 1 . . . 1 1 
       1312 1 . . . 1 1 
       1313 1 . . . 1 1 
       1314 1 . . . 1 1 
       1315 1 . . . 1 1 
       1316 1 . . . 1 1 
       1317 1 . . . 1 1 
       1318 1 . . . 1 1 
       1319 1 . . . 1 1 
       1320 1 . . . 1 1 
       1321 1 . . . 1 1 
       1322 1 . . . 1 1 
       1323 1 . . . 1 1 
       1324 1 . . . 1 1 
       1325 1 . . . 1 1 
       1326 1 . . . 1 1 
       1327 1 . . . 1 1 
       1328 1 . . . 1 1 
       1329 1 . . . 1 1 
       1330 1 . . . 1 1 
       1331 1 . . . 1 1 
       1332 1 . . . 1 1 
       1333 1 . . . 1 1 
       1334 1 . . . 1 1 
       1335 1 . . . 1 1 
       1336 1 . . . 1 1 
       1337 1 . . . 1 1 
       1338 1 . . . 1 1 
       1339 1 . . . 1 1 
       1340 1 . . . 1 1 
       1341 1 . . . 1 1 
       1342 1 . . . 1 1 
       1343 1 . . . 1 1 
       1344 1 . . . 1 1 
       1345 1 . . . 1 1 
       1346 1 . . . 1 1 
       1347 1 . . . 1 1 
       1348 1 . . . 1 1 
       1349 1 . . . 1 1 
       1350 1 . . . 1 1 
       1351 1 . . . 1 1 
       1352 1 . . . 1 1 
       1353 1 . . . 1 1 
       1354 1 . . . 1 1 
       1355 1 . . . 1 1 
       1356 1 . . . 1 1 
       1357 1 . . . 1 1 
       1358 1 . . . 1 1 
       1359 1 . . . 1 1 
       1360 1 . . . 1 1 
       1361 1 . . . 1 1 
       1362 1 . . . 1 1 
       1363 1 . . . 1 1 
       1364 1 . . . 1 1 
       1365 1 . . . 1 1 
       1366 1 . . . 1 1 
       1367 1 . . . 1 1 
       1368 1 . . . 1 1 
       1369 1 . . . 1 1 
       1370 1 . . . 1 1 
       1371 1 . . . 1 1 
       1372 1 . . . 1 1 
       1373 1 . . . 1 1 
       1374 1 . . . 1 1 
       1375 1 . . . 1 1 
       1376 1 . . . 1 1 
       1377 1 . . . 1 1 
       1378 1 . . . 1 1 
       1379 1 . . . 1 1 
       1380 1 . . . 1 1 
       1381 1 . . . 1 1 
       1382 1 . . . 1 1 
       1383 1 . . . 1 1 
       1384 1 . . . 1 1 
       1385 1 . . . 1 1 
       1386 1 . . . 1 1 
       1387 1 . . . 1 1 
       1388 1 . . . 1 1 
       1389 1 . . . 1 1 
       1390 1 . . . 1 1 
       1391 1 . . . 1 1 
       1392 1 . . . 1 1 
       1393 1 . . . 1 1 
       1394 1 . . . 1 1 
       1395 1 . . . 1 1 
       1396 1 . . . 1 1 
       1397 1 . . . 1 1 
       1398 1 . . . 1 1 
       1399 1 . . . 1 1 
       1400 1 . . . 1 1 
       1401 1 . . . 1 1 
       1402 1 . . . 1 1 
       1403 1 . . . 1 1 
       1404 1 . . . 1 1 
       1405 1 . . . 1 1 
       1406 1 . . . 1 1 
       1407 1 . . . 1 1 
       1408 1 . . . 1 1 
       1409 1 . . . 1 1 
       1410 1 . . . 1 1 
       1411 1 . . . 1 1 
       1412 1 . . . 1 1 
       1413 1 . . . 1 1 
       1414 1 . . . 1 1 
       1415 1 . . . 1 1 
       1416 1 . . . 1 1 
       1417 1 . . . 1 1 
       1418 1 . . . 1 1 
       1419 1 . . . 1 1 
       1420 1 . . . 1 1 
       1421 1 . . . 1 1 
       1422 1 . . . 1 1 
       1423 1 . . . 1 1 
       1424 1 . . . 1 1 
       1425 1 . . . 1 1 
       1426 1 . . . 1 1 
       1427 1 . . . 1 1 
       1428 1 . . . 1 1 
       1429 1 . . . 1 1 
       1430 1 . . . 1 1 
       1431 1 . . . 1 1 
       1432 1 . . . 1 1 
       1433 1 . . . 1 1 
       1434 1 . . . 1 1 
       1435 1 . . . 1 1 
       1436 1 . . . 1 1 
       1437 1 . . . 1 1 
       1438 1 . . . 1 1 
       1439 1 . . . 1 1 
       1440 1 . . . 1 1 
       1441 1 . . . 1 1 
       1442 1 . . . 1 1 
       1443 1 . . . 1 1 
       1444 1 . . . 1 1 
       1445 1 . . . 1 1 
       1446 1 . . . 1 1 
       1447 1 . . . 1 1 
       1448 1 . . . 1 1 
       1449 1 . . . 1 1 
       1450 1 . . . 1 1 
       1451 1 . . . 1 1 
       1452 1 . . . 1 1 
       1453 1 . . . 1 1 
       1454 1 . . . 1 1 
       1455 1 . . . 1 1 
       1456 1 . . . 1 1 
       1457 1 . . . 1 1 
       1458 1 . . . 1 1 
       1459 1 . . . 1 1 
       1460 1 . . . 1 1 
       1461 1 . . . 1 1 
       1462 1 . . . 1 1 
       1463 1 . . . 1 1 
       1464 1 . . . 1 1 
       1465 1 . . . 1 1 
       1466 1 . . . 1 1 
       1467 1 . . . 1 1 
       1468 1 . . . 1 1 
       1469 1 . . . 1 1 
       1470 1 . . . 1 1 
       1471 1 . . . 1 1 
       1472 1 . . . 1 1 
       1473 1 . . . 1 1 
       1474 1 . . . 1 1 
       1475 1 . . . 1 1 
       1476 1 . . . 1 1 
       1477 1 . . . 1 1 
       1478 1 . . . 1 1 
       1479 1 . . . 1 1 
       1480 1 . . . 1 1 
       1481 1 . . . 1 1 
       1482 1 . . . 1 1 
       1483 1 . . . 1 1 
       1484 1 . . . 1 1 
       1485 1 . . . 1 1 
       1486 1 . . . 1 1 
       1487 1 . . . 1 1 
       1488 1 . . . 1 1 
       1489 1 . . . 1 1 
       1490 1 . . . 1 1 
       1491 1 . . . 1 1 
       1492 1 . . . 1 1 
       1493 1 . . . 1 1 
       1494 1 . . . 1 1 
       1495 1 . . . 1 1 
       1496 1 . . . 1 1 
       1497 1 . . . 1 1 
       1498 1 . . . 1 1 
       1499 1 . . . 1 1 
       1500 1 . . . 1 1 
       1501 1 . . . 1 1 
       1502 1 . . . 1 1 
       1503 1 . . . 1 1 
       1504 1 . . . 1 1 
       1505 1 . . . 1 1 
       1506 1 . . . 1 1 
       1507 1 . . . 1 1 
       1508 1 . . . 1 1 
       1509 1 . . . 1 1 
       1510 1 . . . 1 1 
       1511 1 . . . 1 1 
       1512 1 . . . 1 1 
       1513 1 . . . 1 1 
       1514 1 . . . 1 1 
       1515 1 . . . 1 1 
       1516 1 . . . 1 1 
       1517 1 . . . 1 1 
       1518 1 . . . 1 1 
       1519 1 . . . 1 1 
       1520 1 . . . 1 1 
       1521 1 . . . 1 1 
       1522 1 . . . 1 1 
       1523 1 . . . 1 1 
       1524 1 . . . 1 1 
       1525 1 . . . 1 1 
       1526 1 . . . 1 1 
       1527 1 . . . 1 1 
       1528 1 . . . 1 1 
       1529 1 . . . 1 1 
       1530 1 . . . 1 1 
       1531 1 . . . 1 1 
       1532 1 . . . 1 1 
       1533 1 . . . 1 1 
       1534 1 . . . 1 1 
       1535 1 . . . 1 1 
       1536 1 . . . 1 1 
       1537 1 . . . 1 1 
       1538 1 . . . 1 1 
       1539 1 . . . 1 1 
       1540 1 . . . 1 1 
       1541 1 . . . 1 1 
       1542 1 . . . 1 1 
       1543 1 . . . 1 1 
       1544 1 . . . 1 1 
       1545 1 . . . 1 1 
       1546 1 . . . 1 1 
       1547 1 . . . 1 1 
       1548 1 . . . 1 1 
       1549 1 . . . 1 1 
       1550 1 . . . 1 1 
       1551 1 . . . 1 1 
       1552 1 . . . 1 1 
       1553 1 . . . 1 1 
       1554 1 . . . 1 1 
       1555 1 . . . 1 1 
       1556 1 . . . 1 1 
       1557 1 . . . 1 1 
       1558 1 . . . 1 1 
       1559 1 . . . 1 1 
       1560 1 . . . 1 1 
       1561 1 . . . 1 1 
       1562 1 . . . 1 1 
       1563 1 . . . 1 1 
       1564 1 . . . 1 1 
       1565 1 . . . 1 1 
       1566 1 . . . 1 1 
       1567 1 . . . 1 1 
       1568 1 . . . 1 1 
       1569 1 . . . 1 1 
       1570 1 . . . 1 1 
       1571 1 . . . 1 1 
       1572 1 . . . 1 1 
       1573 1 . . . 1 1 
       1574 1 . . . 1 1 
       1575 1 . . . 1 1 
       1576 1 . . . 1 1 
       1577 1 . . . 1 1 
       1578 1 . . . 1 1 
       1579 1 . . . 1 1 
       1580 1 . . . 1 1 
       1581 1 . . . 1 1 
       1582 1 . . . 1 1 
       1583 1 . . . 1 1 
       1584 1 . . . 1 1 
       1585 1 . . . 1 1 
       1586 1 . . . 1 1 
       1587 1 . . . 1 1 
       1588 1 . . . 1 1 
       1589 1 . . . 1 1 
       1590 1 . . . 1 1 
       1591 1 . . . 1 1 
       1592 1 . . . 1 1 
       1593 1 . . . 1 1 
       1594 1 . . . 1 1 
       1595 1 . . . 1 1 
       1596 1 . . . 1 1 
       1597 1 . . . 1 1 
       1598 1 . . . 1 1 
       1599 1 . . . 1 1 
       1600 1 . . . 1 1 
       1601 1 . . . 1 1 
       1602 1 . . . 1 1 
       1603 1 . . . 1 1 
       1604 1 . . . 1 1 
       1605 1 . . . 1 1 
       1606 1 . . . 1 1 
       1607 1 . . . 1 1 
       1608 1 . . . 1 1 
       1609 1 . . . 1 1 
       1610 1 . . . 1 1 
       1611 1 . . . 1 1 
       1612 1 . . . 1 1 
       1613 1 . . . 1 1 
       1614 1 . . . 1 1 
       1615 1 . . . 1 1 
       1616 1 . . . 1 1 
       1617 1 . . . 1 1 
       1618 1 . . . 1 1 
       1619 1 . . . 1 1 
       1620 1 . . . 1 1 
       1621 1 . . . 1 1 
       1622 1 . . . 1 1 
       1623 1 . . . 1 1 
       1624 1 . . . 1 1 
       1625 1 . . . 1 1 
       1626 1 . . . 1 1 
       1627 1 . . . 1 1 
       1628 1 . . . 1 1 
       1629 1 . . . 1 1 
       1630 1 . . . 1 1 
       1631 1 . . . 1 1 
       1632 1 . . . 1 1 
       1633 1 . . . 1 1 
       1634 1 . . . 1 1 
       1635 1 . . . 1 1 
       1636 1 . . . 1 1 
       1637 1 . . . 1 1 
       1638 1 . . . 1 1 
       1639 1 . . . 1 1 
       1640 1 . . . 1 1 
       1641 1 . . . 1 1 
       1642 1 . . . 1 1 
       1643 1 . . . 1 1 
       1644 1 . . . 1 1 
       1645 1 . . . 1 1 
       1646 1 . . . 1 1 
       1647 1 . . . 1 1 
       1648 1 . . . 1 1 
       1649 1 . . . 1 1 
       1650 1 . . . 1 1 
       1651 1 . . . 1 1 
       1652 1 . . . 1 1 
       1653 1 . . . 1 1 
       1654 1 . . . 1 1 
       1655 1 . . . 1 1 
       1656 1 . . . 1 1 
       1657 1 . . . 1 1 
       1658 1 . . . 1 1 
       1659 1 . . . 1 1 
       1660 1 . . . 1 1 
       1661 1 . . . 1 1 
       1662 1 . . . 1 1 
       1663 1 . . . 1 1 
       1664 1 . . . 1 1 
       1665 1 . . . 1 1 
       1666 1 . . . 1 1 
       1667 1 . . . 1 1 
       1668 1 . . . 1 1 
       1669 1 . . . 1 1 
       1670 1 . . . 1 1 
       1671 1 . . . 1 1 
       1672 1 . . . 1 1 
       1673 1 . . . 1 1 
       1674 1 . . . 1 1 
       1675 1 . . . 1 1 
       1676 1 . . . 1 1 
       1677 1 . . . 1 1 
       1678 1 . . . 1 1 
       1679 1 . . . 1 1 
       1680 1 . . . 1 1 
       1681 1 . . . 1 1 
       1682 1 . . . 1 1 
       1683 1 . . . 1 1 
       1684 1 . . . 1 1 
       1685 1 . . . 1 1 
       1686 1 . . . 1 1 
       1687 1 . . . 1 1 
       1688 1 . . . 1 1 
       1689 1 . . . 1 1 
       1690 1 . . . 1 1 
       1691 1 . . . 1 1 
       1692 1 . . . 1 1 
       1693 1 . . . 1 1 
       1694 1 . . . 1 1 
       1695 1 . . . 1 1 
       1696 1 . . . 1 1 
       1697 1 . . . 1 1 
       1698 1 . . . 1 1 
       1699 1 . . . 1 1 
       1700 1 . . . 1 1 
       1701 1 . . . 1 1 
       1702 1 . . . 1 1 
       1703 1 . . . 1 1 
       1704 1 . . . 1 1 
       1705 1 . . . 1 1 
       1706 1 . . . 1 1 
       1707 1 . . . 1 1 
       1708 1 . . . 1 1 
       1709 1 . . . 1 1 
       1710 1 . . . 1 1 
       1711 1 . . . 1 1 
       1712 1 . . . 1 1 
       1713 1 . . . 1 1 
       1714 1 . . . 1 1 
       1715 1 . . . 1 1 
       1716 1 . . . 1 1 
       1717 1 . . . 1 1 
       1718 1 . . . 1 1 
       1719 1 . . . 1 1 
       1720 1 . . . 1 1 
       1721 1 . . . 1 1 
       1722 1 . . . 1 1 
       1723 1 . . . 1 1 
       1724 1 . . . 1 1 
       1725 1 . . . 1 1 
       1726 1 . . . 1 1 
       1727 1 . . . 1 1 
       1728 1 . . . 1 1 
       1729 1 . . . 1 1 
       1730 1 . . . 1 1 
       1731 1 . . . 1 1 
       1732 1 . . . 1 1 
       1733 1 . . . 1 1 
       1734 1 . . . 1 1 
       1735 1 . . . 1 1 
       1736 1 . . . 1 1 
       1737 1 . . . 1 1 
       1738 1 . . . 1 1 
       1739 1 . . . 1 1 
       1740 1 . . . 1 1 
       1741 1 . . . 1 1 
       1742 1 . . . 1 1 
       1743 1 . . . 1 1 
       1744 1 . . . 1 1 
       1745 1 . . . 1 1 
       1746 1 . . . 1 1 
       1747 1 . . . 1 1 
       1748 1 . . . 1 1 
       1749 1 . . . 1 1 
       1750 1 . . . 1 1 
       1751 1 . . . 1 1 
       1752 1 . . . 1 1 
       1753 1 . . . 1 1 
       1754 1 . . . 1 1 
       1755 1 . . . 1 1 
       1756 1 . . . 1 1 
       1757 1 . . . 1 1 
       1758 1 . . . 1 1 
       1759 1 . . . 1 1 
       1760 1 . . . 1 1 
       1761 1 . . . 1 1 
       1762 1 . . . 1 1 
       1763 1 . . . 1 1 
       1764 1 . . . 1 1 
       1765 1 . . . 1 1 
       1766 1 . . . 1 1 
       1767 1 . . . 1 1 
       1768 1 . . . 1 1 
       1769 1 . . . 1 1 
       1770 1 . . . 1 1 
       1771 1 . . . 1 1 
       1772 1 . . . 1 1 
       1773 1 . . . 1 1 
       1774 1 . . . 1 1 
       1775 1 . . . 1 1 
       1776 1 . . . 1 1 
       1777 1 . . . 1 1 
       1778 1 . . . 1 1 
       1779 1 . . . 1 1 
       1780 1 . . . 1 1 
       1781 1 . . . 1 1 
       1782 1 . . . 1 1 
       1783 1 . . . 1 1 
       1784 1 . . . 1 1 
       1785 1 . . . 1 1 
       1786 1 . . . 1 1 
       1787 1 . . . 1 1 
       1788 1 . . . 1 1 
       1789 1 . . . 1 1 
       1790 1 . . . 1 1 
       1791 1 . . . 1 1 
       1792 1 . . . 1 1 
       1793 1 . . . 1 1 
       1794 1 . . . 1 1 
       1795 1 . . . 1 1 
       1796 1 . . . 1 1 
       1797 1 . . . 1 1 
       1798 1 . . . 1 1 
       1799 1 . . . 1 1 
       1800 1 . . . 1 1 
       1801 1 . . . 1 1 
       1802 1 . . . 1 1 
       1803 1 . . . 1 1 
       1804 1 . . . 1 1 
       1805 1 . . . 1 1 
       1806 1 . . . 1 1 
       1807 1 . . . 1 1 
       1808 1 . . . 1 1 
       1809 1 . . . 1 1 
       1810 1 . . . 1 1 
       1811 1 . . . 1 1 
       1812 1 . . . 1 1 
       1813 1 . . . 1 1 
       1814 1 . . . 1 1 
       1815 1 . . . 1 1 
       1816 1 . . . 1 1 
       1817 1 . . . 1 1 
       1818 1 . . . 1 1 
       1819 1 . . . 1 1 
       1820 1 . . . 1 1 
       1821 1 . . . 1 1 
       1822 1 . . . 1 1 
       1823 1 . . . 1 1 
       1824 1 . . . 1 1 
       1825 1 . . . 1 1 
       1826 1 . . . 1 1 
       1827 1 . . . 1 1 
       1828 1 . . . 1 1 
       1829 1 . . . 1 1 
       1830 1 . . . 1 1 
       1831 1 . . . 1 1 
       1832 1 . . . 1 1 
       1833 1 . . . 1 1 
       1834 1 . . . 1 1 
       1835 1 . . . 1 1 
       1836 1 . . . 1 1 
       1837 1 . . . 1 1 
       1838 1 . . . 1 1 
       1839 1 . . . 1 1 
       1840 1 . . . 1 1 
       1841 1 . . . 1 1 
       1842 1 . . . 1 1 
       1843 1 . . . 1 1 
       1844 1 . . . 1 1 
       1845 1 . . . 1 1 
       1846 1 . . . 1 1 
       1847 1 . . . 1 1 
       1848 1 . . . 1 1 
       1849 1 . . . 1 1 
       1850 1 . . . 1 1 
       1851 1 . . . 1 1 
       1852 1 . . . 1 1 
       1853 1 . . . 1 1 
       1854 1 . . . 1 1 
       1855 1 . . . 1 1 
       1856 1 . . . 1 1 
       1857 1 . . . 1 1 
       1858 1 . . . 1 1 
       1859 1 . . . 1 1 
       1860 1 . . . 1 1 
       1861 1 . . . 1 1 
       1862 1 . . . 1 1 
       1863 1 . . . 1 1 
       1864 1 . . . 1 1 
       1865 1 . . . 1 1 
       1866 1 . . . 1 1 
       1867 1 . . . 1 1 
       1868 1 . . . 1 1 
       1869 1 . . . 1 1 
       1870 1 . . . 1 1 
       1871 1 . . . 1 1 
       1872 1 . . . 1 1 
       1873 1 . . . 1 1 
       1874 1 . . . 1 1 
       1875 1 . . . 1 1 
       1876 1 . . . 1 1 
       1877 1 . . . 1 1 
       1878 1 . . . 1 1 
       1879 1 . . . 1 1 
       1880 1 . . . 1 1 
       1881 1 . . . 1 1 
       1882 1 . . . 1 1 
       1883 1 . . . 1 1 
       1884 1 . . . 1 1 
       1885 1 . . . 1 1 
       1886 1 . . . 1 1 
       1887 1 . . . 1 1 
       1888 1 . . . 1 1 
       1889 1 . . . 1 1 
       1890 1 . . . 1 1 
       1891 1 . . . 1 1 
       1892 1 . . . 1 1 
       1893 1 . . . 1 1 
       1894 1 . . . 1 1 
       1895 1 . . . 1 1 
       1896 1 . . . 1 1 
       1897 1 . . . 1 1 
       1898 1 . . . 1 1 
       1899 1 . . . 1 1 
       1900 1 . . . 1 1 
       1901 1 . . . 1 1 
       1902 1 . . . 1 1 
       1903 1 . . . 1 1 
       1904 1 . . . 1 1 
       1905 1 . . . 1 1 
       1906 1 . . . 1 1 
       1907 1 . . . 1 1 
       1908 1 . . . 1 1 
       1909 1 . . . 1 1 
       1910 1 . . . 1 1 
       1911 1 . . . 1 1 
       1912 1 . . . 1 1 
       1913 1 . . . 1 1 
       1914 1 . . . 1 1 
       1915 1 . . . 1 1 
       1916 1 . . . 1 1 
       1917 1 . . . 1 1 
       1918 1 . . . 1 1 
       1919 1 . . . 1 1 
       1920 1 . . . 1 1 
       1921 1 . . . 1 1 
       1922 1 . . . 1 1 
       1923 1 . . . 1 1 
       1924 1 . . . 1 1 
       1925 1 . . . 1 1 
       1926 1 . . . 1 1 
       1927 1 . . . 1 1 
       1928 1 . . . 1 1 
       1929 1 . . . 1 1 
       1930 1 . . . 1 1 
       1931 1 . . . 1 1 
       1932 1 . . . 1 1 
       1933 1 . . . 1 1 
       1934 1 . . . 1 1 
       1935 1 . . . 1 1 
       1936 1 . . . 1 1 
       1937 1 . . . 1 1 
       1938 1 . . . 1 1 
       1939 1 . . . 1 1 
       1940 1 . . . 1 1 
       1941 1 . . . 1 1 
       1942 1 . . . 1 1 
       1943 1 . . . 1 1 
       1944 1 . . . 1 1 
       1945 1 . . . 1 1 
       1946 1 . . . 1 1 
       1947 1 . . . 1 1 
       1948 1 . . . 1 1 
       1949 1 . . . 1 1 
       1950 1 . . . 1 1 
       1951 1 . . . 1 1 
       1952 1 . . . 1 1 
       1953 1 . . . 1 1 
       1954 1 . . . 1 1 
       1955 1 . . . 1 1 
       1956 1 . . . 1 1 
       1957 1 . . . 1 1 
       1958 1 . . . 1 1 
       1959 1 . . . 1 1 
       1960 1 . . . 1 1 
       1961 1 . . . 1 1 
       1962 1 . . . 1 1 
       1963 1 . . . 1 1 
       1964 1 . . . 1 1 
       1965 1 . . . 1 1 
       1966 1 . . . 1 1 
       1967 1 . . . 1 1 
       1968 1 . . . 1 1 
       1969 1 . . . 1 1 
       1970 1 . . . 1 1 
       1971 1 . . . 1 1 
       1972 1 . . . 1 1 
       1973 1 . . . 1 1 
       1974 1 . . . 1 1 
       1975 1 . . . 1 1 
       1976 1 . . . 1 1 
       1977 1 . . . 1 1 
       1978 1 . . . 1 1 
       1979 1 . . . 1 1 
       1980 1 . . . 1 1 
       1981 1 . . . 1 1 
       1982 1 . . . 1 1 
       1983 1 . . . 1 1 
       1984 1 . . . 1 1 
       1985 1 . . . 1 1 
       1986 1 . . . 1 1 
       1987 1 . . . 1 1 
       1988 1 . . . 1 1 
       1989 1 . . . 1 1 
       1990 1 . . . 1 1 
       1991 1 . . . 1 1 
       1992 1 . . . 1 1 
       1993 1 . . . 1 1 
       1994 1 . . . 1 1 
       1995 1 . . . 1 1 
       1996 1 . . . 1 1 
       1997 1 . . . 1 1 
       1998 1 . . . 1 1 
       1999 1 . . . 1 1 
       2000 1 . . . 1 1 
       2001 1 . . . 1 1 
       2002 1 . . . 1 1 
       2003 1 . . . 1 1 
       2004 1 . . . 1 1 
       2005 1 . . . 1 1 
       2006 1 . . . 1 1 
       2007 1 . . . 1 1 
       2008 1 . . . 1 1 
       2009 1 . . . 1 1 
       2010 1 . . . 1 1 
       2011 1 . . . 1 1 
       2012 1 . . . 1 1 
       2013 1 . . . 1 1 
       2014 1 . . . 1 1 
       2015 1 . . . 1 1 
       2016 1 . . . 1 1 
       2017 1 . . . 1 1 
       2018 1 . . . 1 1 
       2019 1 . . . 1 1 
       2020 1 . . . 1 1 
       2021 1 . . . 1 1 
       2022 1 . . . 1 1 
       2023 1 . . . 1 1 
       2024 1 . . . 1 1 
       2025 1 . . . 1 1 
       2026 1 . . . 1 1 
       2027 1 . . . 1 1 
       2028 1 . . . 1 1 
       2029 1 . . . 1 1 
       2030 1 . . . 1 1 
       2031 1 . . . 1 1 
       2032 1 . . . 1 1 
       2033 1 . . . 1 1 
       2034 1 . . . 1 1 
       2035 1 . . . 1 1 
       2036 1 . . . 1 1 
       2037 1 . . . 1 1 
       2038 1 . . . 1 1 
       2039 1 . . . 1 1 
       2040 1 . . . 1 1 
       2041 1 . . . 1 1 
       2042 1 . . . 1 1 
       2043 1 . . . 1 1 
       2044 1 . . . 1 1 
       2045 1 . . . 1 1 
       2046 1 . . . 1 1 
       2047 1 . . . 1 1 
       2048 1 . . . 1 1 
       2049 1 . . . 1 1 
       2050 1 . . . 1 1 
       2051 1 . . . 1 1 
       2052 1 . . . 1 1 
       2053 1 . . . 1 1 
       2054 1 . . . 1 1 
       2055 1 . . . 1 1 
       2056 1 . . . 1 1 
       2057 1 . . . 1 1 
       2058 1 . . . 1 1 
       2059 1 . . . 1 1 
       2060 1 . . . 1 1 
       2061 1 . . . 1 1 
       2062 1 . . . 1 1 
       2063 1 . . . 1 1 
       2064 1 . . . 1 1 
       2065 1 . . . 1 1 
       2066 1 . . . 1 1 
       2067 1 . . . 1 1 
       2068 1 . . . 1 1 
       2069 1 . . . 1 1 
       2070 1 . . . 1 1 
       2071 1 . . . 1 1 
       2072 1 . . . 1 1 
       2073 1 . . . 1 1 
       2074 1 . . . 1 1 
       2075 1 . . . 1 1 
       2076 1 . . . 1 1 
       2077 1 . . . 1 1 
       2078 1 . . . 1 1 
       2079 1 . . . 1 1 
       2080 1 . . . 1 1 
       2081 1 . . . 1 1 
       2082 1 . . . 1 1 
       2083 1 . . . 1 1 
       2084 1 . . . 1 1 
       2085 1 . . . 1 1 
       2086 1 . . . 1 1 
       2087 1 . . . 1 1 
       2088 1 . . . 1 1 
       2089 1 . . . 1 1 
       2090 1 . . . 1 1 
       2091 1 . . . 1 1 
       2092 1 . . . 1 1 
       2093 1 . . . 1 1 
       2094 1 . . . 1 1 
       2095 1 . . . 1 1 
       2096 1 . . . 1 1 
       2097 1 . . . 1 1 
       2098 1 . . . 1 1 
       2099 1 . . . 1 1 
       2100 1 . . . 1 1 
       2101 1 . . . 1 1 
       2102 1 . . . 1 1 
       2103 1 . . . 1 1 
       2104 1 . . . 1 1 
       2105 1 . . . 1 1 
       2106 1 . . . 1 1 
       2107 1 . . . 1 1 
       2108 1 . . . 1 1 
       2109 1 . . . 1 1 
       2110 1 . . . 1 1 
       2111 1 . . . 1 1 
       2112 1 . . . 1 1 
       2113 1 . . . 1 1 
       2114 1 . . . 1 1 
       2115 1 . . . 1 1 
       2116 1 . . . 1 1 
       2117 1 . . . 1 1 
       2118 1 . . . 1 1 
       2119 1 . . . 1 1 
       2120 1 . . . 1 1 
       2121 1 . . . 1 1 
       2122 1 . . . 1 1 
       2123 1 . . . 1 1 
       2124 1 . . . 1 1 
       2125 1 . . . 1 1 
       2126 1 . . . 1 1 
       2127 1 . . . 1 1 
       2128 1 . . . 1 1 
       2129 1 . . . 1 1 
       2130 1 . . . 1 1 
       2131 1 . . . 1 1 
       2132 1 . . . 1 1 
       2133 1 . . . 1 1 
       2134 1 . . . 1 1 
       2135 1 . . . 1 1 
       2136 1 . . . 1 1 
       2137 1 . . . 1 1 
       2138 1 . . . 1 1 
       2139 1 . . . 1 1 
       2140 1 . . . 1 1 
       2141 1 . . . 1 1 
       2142 1 . . . 1 1 
       2143 1 . . . 1 1 
       2144 1 . . . 1 1 
       2145 1 . . . 1 1 
       2146 1 . . . 1 1 
       2147 1 . . . 1 1 
       2148 1 . . . 1 1 
       2149 1 . . . 1 1 
       2150 1 . . . 1 1 
       2151 1 . . . 1 1 
       2152 1 . . . 1 1 
       2153 1 . . . 1 1 
       2154 1 . . . 1 1 
       2155 1 . . . 1 1 
       2156 1 . . . 1 1 
       2157 1 . . . 1 1 
       2158 1 . . . 1 1 
       2159 1 . . . 1 1 
       2160 1 . . . 1 1 
       2161 1 . . . 1 1 
       2162 1 . . . 1 1 
       2163 1 . . . 1 1 
       2164 1 . . . 1 1 
       2165 1 . . . 1 1 
       2166 1 . . . 1 1 
       2167 1 . . . 1 1 
       2168 1 . . . 1 1 
       2169 1 . . . 1 1 
       2170 1 . . . 1 1 
       2171 1 . . . 1 1 
       2172 1 . . . 1 1 
       2173 1 . . . 1 1 
       2174 1 . . . 1 1 
       2175 1 . . . 1 1 
       2176 1 . . . 1 1 
       2177 1 . . . 1 1 
       2178 1 . . . 1 1 
       2179 1 . . . 1 1 
       2180 1 . . . 1 1 
       2181 1 . . . 1 1 
       2182 1 . . . 1 1 
       2183 1 . . . 1 1 
       2184 1 . . . 1 1 
       2185 1 . . . 1 1 
       2186 1 . . . 1 1 
       2187 1 . . . 1 1 
       2188 1 . . . 1 1 
       2189 1 . . . 1 1 
       2190 1 . . . 1 1 
       2191 1 . . . 1 1 
       2192 1 . . . 1 1 
       2193 1 . . . 1 1 
       2194 1 . . . 1 1 
       2195 1 . . . 1 1 
       2196 1 . . . 1 1 
       2197 1 . . . 1 1 
       2198 1 . . . 1 1 
       2199 1 . . . 1 1 
       2200 1 . . . 1 1 
       2201 1 . . . 1 1 
       2202 1 . . . 1 1 
       2203 1 . . . 1 1 
       2204 1 . . . 1 1 
       2205 1 . . . 1 1 
       2206 1 . . . 1 1 
       2207 1 . . . 1 1 
       2208 1 . . . 1 1 
       2209 1 . . . 1 1 
       2210 1 . . . 1 1 
       2211 1 . . . 1 1 
       2212 1 . . . 1 1 
       2213 1 . . . 1 1 
       2214 1 . . . 1 1 
       2215 1 . . . 1 1 
       2216 1 . . . 1 1 
       2217 1 . . . 1 1 
       2218 1 . . . 1 1 
       2219 1 . . . 1 1 
       2220 1 . . . 1 1 
       2221 1 . . . 1 1 
       2222 1 . . . 1 1 
       2223 1 . . . 1 1 
       2224 1 . . . 1 1 
       2225 1 . . . 1 1 
       2226 1 . . . 1 1 
       2227 1 . . . 1 1 
       2228 1 . . . 1 1 
       2229 1 . . . 1 1 
       2230 1 . . . 1 1 
       2231 1 . . . 1 1 
       2232 1 . . . 1 1 
       2233 1 . . . 1 1 
       2234 1 . . . 1 1 
       2235 1 . . . 1 1 
       2236 1 . . . 1 1 
       2237 1 . . . 1 1 
       2238 1 . . . 1 1 
       2239 1 . . . 1 1 
       2240 1 . . . 1 1 
       2241 1 . . . 1 1 
       2242 1 . . . 1 1 
       2243 1 . . . 1 1 
       2244 1 . . . 1 1 
       2245 1 . . . 1 1 
       2246 1 . . . 1 1 
       2247 1 . . . 1 1 
       2248 1 . . . 1 1 
       2249 1 . . . 1 1 
       2250 1 . . . 1 1 
       2251 1 . . . 1 1 
       2252 1 . . . 1 1 
       2253 1 . . . 1 1 
       2254 1 . . . 1 1 
       2255 1 . . . 1 1 
       2256 1 . . . 1 1 
       2257 1 . . . 1 1 
       2258 1 . . . 1 1 
       2259 1 . . . 1 1 
       2260 1 . . . 1 1 
       2261 1 . . . 1 1 
       2262 1 . . . 1 1 
       2263 1 . . . 1 1 
       2264 1 . . . 1 1 
       2265 1 . . . 1 1 
       2266 1 . . . 1 1 
       2267 1 . . . 1 1 
       2268 1 . . . 1 1 
       2269 1 . . . 1 1 
       2270 1 . . . 1 1 
       2271 1 . . . 1 1 
       2272 1 . . . 1 1 
       2273 1 . . . 1 1 
       2274 1 . . . 1 1 
       2275 1 . . . 1 1 
       2276 1 . . . 1 1 
       2277 1 . . . 1 1 
       2278 1 . . . 1 1 
       2279 1 . . . 1 1 
       2280 1 . . . 1 1 
       2281 1 . . . 1 1 
       2282 1 . . . 1 1 
       2283 1 . . . 1 1 
       2284 1 . . . 1 1 
       2285 1 . . . 1 1 
       2286 1 . . . 1 1 
       2287 1 . . . 1 1 
       2288 1 . . . 1 1 
       2289 1 . . . 1 1 
       2290 1 . . . 1 1 
       2291 1 . . . 1 1 
       2292 1 . . . 1 1 
       2293 1 . . . 1 1 
       2294 1 . . . 1 1 
       2295 1 . . . 1 1 
       2296 1 . . . 1 1 
       2297 1 . . . 1 1 
       2298 1 . . . 1 1 
       2299 1 . . . 1 1 
       2300 1 . . . 1 1 
       2301 1 . . . 1 1 
       2302 1 . . . 1 1 
       2303 1 . . . 1 1 
       2304 1 . . . 1 1 
       2305 1 . . . 1 1 
       2306 1 . . . 1 1 
       2307 1 . . . 1 1 
       2308 1 . . . 1 1 
       2309 1 . . . 1 1 
       2310 1 . . . 1 1 
       2311 1 . . . 1 1 
       2312 1 . . . 1 1 
       2313 1 . . . 1 1 
       2314 1 . . . 1 1 
       2315 1 . . . 1 1 
       2316 1 . . . 1 1 
       2317 1 . . . 1 1 
       2318 1 . . . 1 1 
       2319 1 . . . 1 1 
       2320 1 . . . 1 1 
       2321 1 . . . 1 1 
       2322 1 . . . 1 1 
       2323 1 . . . 1 1 
       2324 1 . . . 1 1 
       2325 1 . . . 1 1 
       2326 1 . . . 1 1 
       2327 1 . . . 1 1 
       2328 1 . . . 1 1 
       2329 1 . . . 1 1 
       2330 1 . . . 1 1 
       2331 1 . . . 1 1 
       2332 1 . . . 1 1 
       2333 1 . . . 1 1 
       2334 1 . . . 1 1 
       2335 1 . . . 1 1 
       2336 1 . . . 1 1 
       2337 1 . . . 1 1 
       2338 1 . . . 1 1 
       2339 1 . . . 1 1 
       2340 1 . . . 1 1 
       2341 1 . . . 1 1 
       2342 1 . . . 1 1 
       2343 1 . . . 1 1 
       2344 1 . . . 1 1 
       2345 1 . . . 1 1 
       2346 1 . . . 1 1 
       2347 1 . . . 1 1 
       2348 1 . . . 1 1 
       2349 1 . . . 1 1 
       2350 1 . . . 1 1 
       2351 1 . . . 1 1 
       2352 1 . . . 1 1 
       2353 1 . . . 1 1 
       2354 1 . . . 1 1 
       2355 1 . . . 1 1 
       2356 1 . . . 1 1 
       2357 1 . . . 1 1 
       2358 1 . . . 1 1 
       2359 1 . . . 1 1 
       2360 1 . . . 1 1 
       2361 1 . . . 1 1 
       2362 1 . . . 1 1 
       2363 1 . . . 1 1 
       2364 1 . . . 1 1 
       2365 1 . . . 1 1 
       2366 1 . . . 1 1 
       2367 1 . . . 1 1 
       2368 1 . . . 1 1 
       2369 1 . . . 1 1 
       2370 1 . . . 1 1 
       2371 1 . . . 1 1 
       2372 1 . . . 1 1 
       2373 1 . . . 1 1 
       2374 1 . . . 1 1 
       2375 1 . . . 1 1 
       2376 1 . . . 1 1 
       2377 1 . . . 1 1 
       2378 1 . . . 1 1 
       2379 1 . . . 1 1 
       2380 1 . . . 1 1 
       2381 1 . . . 1 1 
       2382 1 . . . 1 1 
       2383 1 . . . 1 1 
       2384 1 . . . 1 1 
       2385 1 . . . 1 1 
       2386 1 . . . 1 1 
       2387 1 . . . 1 1 
       2388 1 . . . 1 1 
       2389 1 . . . 1 1 
       2390 1 . . . 1 1 
       2391 1 . . . 1 1 
       2392 1 . . . 1 1 
       2393 1 . . . 1 1 
       2394 1 . . . 1 1 
       2395 1 . . . 1 1 
       2396 1 . . . 1 1 
       2397 1 . . . 1 1 
       2398 1 . . . 1 1 
       2399 1 . . . 1 1 
       2400 1 . . . 1 1 
       2401 1 . . . 1 1 
       2402 1 . . . 1 1 
       2403 1 . . . 1 1 
       2404 1 . . . 1 1 
       2405 1 . . . 1 1 
       2406 1 . . . 1 1 
       2407 1 . . . 1 1 
       2408 1 . . . 1 1 
       2409 1 . . . 1 1 
       2410 1 . . . 1 1 
       2411 1 . . . 1 1 
       2412 1 . . . 1 1 
       2413 1 . . . 1 1 
       2414 1 . . . 1 1 
       2415 1 . . . 1 1 
       2416 1 . . . 1 1 
       2417 1 . . . 1 1 
       2418 1 . . . 1 1 
       2419 1 . . . 1 1 
       2420 1 . . . 1 1 
       2421 1 . . . 1 1 
       2422 1 . . . 1 1 
       2423 1 . . . 1 1 
       2424 1 . . . 1 1 
       2425 1 . . . 1 1 
       2426 1 . . . 1 1 
       2427 1 . . . 1 1 
       2428 1 . . . 1 1 
       2429 1 . . . 1 1 
       2430 1 . . . 1 1 
       2431 1 . . . 1 1 
       2432 1 . . . 1 1 
       2433 1 . . . 1 1 
       2434 1 . . . 1 1 
       2435 1 . . . 1 1 
       2436 1 . . . 1 1 
       2437 1 . . . 1 1 
       2438 1 . . . 1 1 
       2439 1 . . . 1 1 
       2440 1 . . . 1 1 
       2441 1 . . . 1 1 
       2442 1 . . . 1 1 
       2443 1 . . . 1 1 
       2444 1 . . . 1 1 
       2445 1 . . . 1 1 
       2446 1 . . . 1 1 
       2447 1 . . . 1 1 
       2448 1 . . . 1 1 
       2449 1 . . . 1 1 
       2450 1 . . . 1 1 
       2451 1 . . . 1 1 
       2452 1 . . . 1 1 
       2453 1 . . . 1 1 
       2454 1 . . . 1 1 
       2455 1 . . . 1 1 
       2456 1 . . . 1 1 
       2457 1 . . . 1 1 
       2458 1 . . . 1 1 
       2459 1 . . . 1 1 
       2460 1 . . . 1 1 
       2461 1 . . . 1 1 
       2462 1 . . . 1 1 
       2463 1 . . . 1 1 
       2464 1 . . . 1 1 
       2465 1 . . . 1 1 
       2466 1 . . . 1 1 
       2467 1 . . . 1 1 
       2468 1 . . . 1 1 
       2469 1 . . . 1 1 
       2470 1 . . . 1 1 
       2471 1 . . . 1 1 
       2472 1 . . . 1 1 
       2473 1 . . . 1 1 
       2474 1 . . . 1 1 
       2475 1 . . . 1 1 
       2476 1 . . . 1 1 
       2477 1 . . . 1 1 
       2478 1 . . . 1 1 
       2479 1 . . . 1 1 
       2480 1 . . . 1 1 
       2481 1 . . . 1 1 
       2482 1 . . . 1 1 
       2483 1 . . . 1 1 
       2484 1 . . . 1 1 
       2485 1 . . . 1 1 
       2486 1 . . . 1 1 
       2487 1 . . . 1 1 
       2488 1 . . . 1 1 
       2489 1 . . . 1 1 
       2490 1 . . . 1 1 
       2491 1 . . . 1 1 
       2492 1 . . . 1 1 
       2493 1 . . . 1 1 
       2494 1 . . . 1 1 
       2495 1 . . . 1 1 
       2496 1 . . . 1 1 
       2497 1 . . . 1 1 
       2498 1 . . . 1 1 
       2499 1 . . . 1 1 
       2500 1 . . . 1 1 
       2501 1 . . . 1 1 
       2502 1 . . . 1 1 
       2503 1 . . . 1 1 
       2504 1 . . . 1 1 
       2505 1 . . . 1 1 
       2506 1 . . . 1 1 
       2507 1 . . . 1 1 
       2508 1 . . . 1 1 
       2509 1 . . . 1 1 
       2510 1 . . . 1 1 
       2511 1 . . . 1 1 
       2512 1 . . . 1 1 
       2513 1 . . . 1 1 
       2514 1 . . . 1 1 
       2515 1 . . . 1 1 
       2516 1 . . . 1 1 
       2517 1 . . . 1 1 
       2518 1 . . . 1 1 
       2519 1 . . . 1 1 
       2520 1 . . . 1 1 
       2521 1 . . . 1 1 
       2522 1 . . . 1 1 
       2523 1 . . . 1 1 
       2524 1 . . . 1 1 
       2525 1 . . . 1 1 
       2526 1 . . . 1 1 
       2527 1 . . . 1 1 
       2528 1 . . . 1 1 
       2529 1 . . . 1 1 
       2530 1 . . . 1 1 
       2531 1 . . . 1 1 
       2532 1 . . . 1 1 
       2533 1 . . . 1 1 
       2534 1 . . . 1 1 
       2535 1 . . . 1 1 
       2536 1 . . . 1 1 
       2537 1 . . . 1 1 
       2538 1 . . . 1 1 
       2539 1 . . . 1 1 
       2540 1 . . . 1 1 
       2541 1 . . . 1 1 
       2542 1 . . . 1 1 
       2543 1 . . . 1 1 
       2544 1 . . . 1 1 
       2545 1 . . . 1 1 
       2546 1 . . . 1 1 
       2547 1 . . . 1 1 
       2548 1 . . . 1 1 
       2549 1 . . . 1 1 
       2550 1 . . . 1 1 
       2551 1 . . . 1 1 
       2552 1 . . . 1 1 
       2553 1 . . . 1 1 
       2554 1 . . . 1 1 
       2555 1 . . . 1 1 
       2556 1 . . . 1 1 
       2557 1 . . . 1 1 
       2558 1 . . . 1 1 
       2559 1 . . . 1 1 
       2560 1 . . . 1 1 
       2561 1 . . . 1 1 
       2562 1 . . . 1 1 
       2563 1 . . . 1 1 
       2564 1 . . . 1 1 
       2565 1 . . . 1 1 
       2566 1 . . . 1 1 
       2567 1 . . . 1 1 
       2568 1 . . . 1 1 
       2569 1 . . . 1 1 
       2570 1 . . . 1 1 
       2571 1 . . . 1 1 
       2572 1 . . . 1 1 
       2573 1 . . . 1 1 
       2574 1 . . . 1 1 
       2575 1 . . . 1 1 
       2576 1 . . . 1 1 
       2577 1 . . . 1 1 
       2578 1 . . . 1 1 
       2579 1 . . . 1 1 
       2580 1 . . . 1 1 
       2581 1 . . . 1 1 
       2582 1 . . . 1 1 
       2583 1 . . . 1 1 
       2584 1 . . . 1 1 
       2585 1 . . . 1 1 
       2586 1 . . . 1 1 
       2587 1 . . . 1 1 
       2588 1 . . . 1 1 
       2589 1 . . . 1 1 
       2590 1 . . . 1 1 
       2591 1 . . . 1 1 
       2592 1 . . . 1 1 
       2593 1 . . . 1 1 
       2594 1 . . . 1 1 
       2595 1 . . . 1 1 
       2596 1 . . . 1 1 
       2597 1 . . . 1 1 
       2598 1 . . . 1 1 
       2599 1 . . . 1 1 
       2600 1 . . . 1 1 
       2601 1 . . . 1 1 
       2602 1 . . . 1 1 
       2603 1 . . . 1 1 
       2604 1 . . . 1 1 
       2605 1 . . . 1 1 
       2606 1 . . . 1 1 
       2607 1 . . . 1 1 
       2608 1 . . . 1 1 
       2609 1 . . . 1 1 
       2610 1 . . . 1 1 
       2611 1 . . . 1 1 
       2612 1 . . . 1 1 
       2613 1 . . . 1 1 
       2614 1 . . . 1 1 
       2615 1 . . . 1 1 
       2616 1 . . . 1 1 
       2617 1 . . . 1 1 
       2618 1 . . . 1 1 
       2619 1 . . . 1 1 
       2620 1 . . . 1 1 
       2621 1 . . . 1 1 
       2622 1 . . . 1 1 
       2623 1 . . . 1 1 
       2624 1 . . . 1 1 
       2625 1 . . . 1 1 
       2626 1 . . . 1 1 
       2627 1 . . . 1 1 
       2628 1 . . . 1 1 
       2629 1 . . . 1 1 
       2630 1 . . . 1 1 
       2631 1 . . . 1 1 
       2632 1 . . . 1 1 
       2633 1 . . . 1 1 
       2634 1 . . . 1 1 
       2635 1 . . . 1 1 
       2636 1 . . . 1 1 
       2637 1 . . . 1 1 
       2638 1 . . . 1 1 
       2639 1 . . . 1 1 
       2640 1 . . . 1 1 
       2641 1 . . . 1 1 
       2642 1 . . . 1 1 
       2643 1 . . . 1 1 
       2644 1 . . . 1 1 
       2645 1 . . . 1 1 
       2646 1 . . . 1 1 
       2647 1 . . . 1 1 
       2648 1 . . . 1 1 
       2649 1 . . . 1 1 
       2650 1 . . . 1 1 
       2651 1 . . . 1 1 
       2652 1 . . . 1 1 
       2653 1 . . . 1 1 
       2654 1 . . . 1 1 
       2655 1 . . . 1 1 
       2656 1 . . . 1 1 
       2657 1 . . . 1 1 
       2658 1 . . . 1 1 
       2659 1 . . . 1 1 
       2660 1 . . . 1 1 
       2661 1 . . . 1 1 
       2662 1 . . . 1 1 
       2663 1 . . . 1 1 
       2664 1 . . . 1 1 
       2665 1 . . . 1 1 
       2666 1 . . . 1 1 
       2667 1 . . . 1 1 
       2668 1 . . . 1 1 
       2669 1 . . . 1 1 
       2670 1 . . . 1 1 
       2671 1 . . . 1 1 
       2672 1 . . . 1 1 
       2673 1 . . . 1 1 
       2674 1 . . . 1 1 
       2675 1 . . . 1 1 
       2676 1 . . . 1 1 
       2677 1 . . . 1 1 
       2678 1 . . . 1 1 
       2679 1 . . . 1 1 
       2680 1 . . . 1 1 
       2681 1 . . . 1 1 
       2682 1 . . . 1 1 
       2683 1 . . . 1 1 
       2684 1 . . . 1 1 
       2685 1 . . . 1 1 
       2686 1 . . . 1 1 
       2687 1 . . . 1 1 
       2688 1 . . . 1 1 
       2689 1 . . . 1 1 
       2690 1 . . . 1 1 
       2691 1 . . . 1 1 
       2692 1 . . . 1 1 
       2693 1 . . . 1 1 
       2694 1 . . . 1 1 
       2695 1 . . . 1 1 
       2696 1 . . . 1 1 
       2697 1 . . . 1 1 
       2698 1 . . . 1 1 
       2699 1 . . . 1 1 
       2700 1 . . . 1 1 
       2701 1 . . . 1 1 
       2702 1 . . . 1 1 
       2703 1 . . . 1 1 
       2704 1 . . . 1 1 
       2705 1 . . . 1 1 
       2706 1 . . . 1 1 
       2707 1 . . . 1 1 
       2708 1 . . . 1 1 
       2709 1 . . . 1 1 
       2710 1 . . . 1 1 
       2711 1 . . . 1 1 
       2712 1 . . . 1 1 
       2713 1 . . . 1 1 
       2714 1 . . . 1 1 
       2715 1 . . . 1 1 
       2716 1 . . . 1 1 
       2717 1 . . . 1 1 
       2718 1 . . . 1 1 
       2719 1 . . . 1 1 
       2720 1 . . . 1 1 
       2721 1 . . . 1 1 
       2722 1 . . . 1 1 
       2723 1 . . . 1 1 
       2724 1 . . . 1 1 
       2725 1 . . . 1 1 
       2726 1 . . . 1 1 
       2727 1 . . . 1 1 
       2728 1 . . . 1 1 
       2729 1 . . . 1 1 
       2730 1 . . . 1 1 
       2731 1 . . . 1 1 
       2732 1 . . . 1 1 
       2733 1 . . . 1 1 
       2734 1 . . . 1 1 
       2735 1 . . . 1 1 
       2736 1 . . . 1 1 
       2737 1 . . . 1 1 
       2738 1 . . . 1 1 
       2739 1 . . . 1 1 
       2740 1 . . . 1 1 
       2741 1 . . . 1 1 
       2742 1 . . . 1 1 
       2743 1 . . . 1 1 
       2744 1 . . . 1 1 
       2745 1 . . . 1 1 
       2746 1 . . . 1 1 
       2747 1 . . . 1 1 
       2748 1 . . . 1 1 
       2749 1 . . . 1 1 
       2750 1 . . . 1 1 
       2751 1 . . . 1 1 
       2752 1 . . . 1 1 
       2753 1 . . . 1 1 
       2754 1 . . . 1 1 
       2755 1 . . . 1 1 
       2756 1 . . . 1 1 
       2757 1 . . . 1 1 
       2758 1 . . . 1 1 
       2759 1 . . . 1 1 
       2760 1 . . . 1 1 
       2761 1 . . . 1 1 
       2762 1 . . . 1 1 
       2763 1 . . . 1 1 
       2764 1 . . . 1 1 
       2765 1 . . . 1 1 
       2766 1 . . . 1 1 
       2767 1 . . . 1 1 
       2768 1 . . . 1 1 
       2769 1 . . . 1 1 
       2770 1 . . . 1 1 
       2771 1 . . . 1 1 
       2772 1 . . . 1 1 
       2773 1 . . . 1 1 
       2774 1 . . . 1 1 
       2775 1 . . . 1 1 
       2776 1 . . . 1 1 
       2777 1 . . . 1 1 
       2778 1 . . . 1 1 
       2779 1 . . . 1 1 
       2780 1 . . . 1 1 
       2781 1 . . . 1 1 
       2782 1 . . . 1 1 
       2783 1 . . . 1 1 
       2784 1 . . . 1 1 
       2785 1 . . . 1 1 
       2786 1 . . . 1 1 
       2787 1 . . . 1 1 
       2788 1 . . . 1 1 
       2789 1 . . . 1 1 
       2790 1 . . . 1 1 
       2791 1 . . . 1 1 
       2792 1 . . . 1 1 
       2793 1 . . . 1 1 
       2794 1 . . . 1 1 
       2795 1 . . . 1 1 
       2796 1 . . . 1 1 
       2797 1 . . . 1 1 
       2798 1 . . . 1 1 
       2799 1 . . . 1 1 
       2800 1 . . . 1 1 
       2801 1 . . . 1 1 
       2802 1 . . . 1 1 
       2803 1 . . . 1 1 
       2804 1 . . . 1 1 
       2805 1 . . . 1 1 
       2806 1 . . . 1 1 
       2807 1 . . . 1 1 
       2808 1 . . . 1 1 
       2809 1 . . . 1 1 
       2810 1 . . . 1 1 
       2811 1 . . . 1 1 
       2812 1 . . . 1 1 
       2813 1 . . . 1 1 
       2814 1 . . . 1 1 
       2815 1 . . . 1 1 
       2816 1 . . . 1 1 
       2817 1 . . . 1 1 
       2818 1 . . . 1 1 
       2819 1 . . . 1 1 
       2820 1 . . . 1 1 
       2821 1 . . . 1 1 
       2822 1 . . . 1 1 
       2823 1 . . . 1 1 
       2824 1 . . . 1 1 
       2825 1 . . . 1 1 
       2826 1 . . . 1 1 
       2827 1 . . . 1 1 
       2828 1 . . . 1 1 
       2829 1 . . . 1 1 
       2830 1 . . . 1 1 
       2831 1 . . . 1 1 
       2832 1 . . . 1 1 
       2833 1 . . . 1 1 
       2834 1 . . . 1 1 
       2835 1 . . . 1 1 
       2836 1 . . . 1 1 
       2837 1 . . . 1 1 
       2838 1 . . . 1 1 
       2839 1 . . . 1 1 
       2840 1 . . . 1 1 
       2841 1 . . . 1 1 
       2842 1 . . . 1 1 
       2843 1 . . . 1 1 
       2844 1 . . . 1 1 
       2845 1 . . . 1 1 
       2846 1 . . . 1 1 
       2847 1 . . . 1 1 
       2848 1 . . . 1 1 
       2849 1 . . . 1 1 
       2850 1 . . . 1 1 
       2851 1 . . . 1 1 
       2852 1 . . . 1 1 
       2853 1 . . . 1 1 
       2854 1 . . . 1 1 
       2855 1 . . . 1 1 
       2856 1 . . . 1 1 
       2857 1 . . . 1 1 
       2858 1 . . . 1 1 
       2859 1 . . . 1 1 
       2860 1 . . . 1 1 
       2861 1 . . . 1 1 
       2862 1 . . . 1 1 
       2863 1 . . . 1 1 
       2864 1 . . . 1 1 
       2865 1 . . . 1 1 
       2866 1 . . . 1 1 
       2867 1 . . . 1 1 
       2868 1 . . . 1 1 
       2869 1 . . . 1 1 
       2870 1 . . . 1 1 
       2871 1 . . . 1 1 
       2872 1 . . . 1 1 
       2873 1 . . . 1 1 
       2874 1 . . . 1 1 
       2875 1 . . . 1 1 
       2876 1 . . . 1 1 
       2877 1 . . . 1 1 
       2878 1 . . . 1 1 
       2879 1 . . . 1 1 
       2880 1 . . . 1 1 
       2881 1 . . . 1 1 
       2882 1 . . . 1 1 
       2883 1 . . . 1 1 
       2884 1 . . . 1 1 
       2885 1 . . . 1 1 
       2886 1 . . . 1 1 
       2887 1 . . . 1 1 
       2888 1 . . . 1 1 
       2889 1 . . . 1 1 
       2890 1 . . . 1 1 
       2891 1 . . . 1 1 
       2892 1 . . . 1 1 
       2893 1 . . . 1 1 
       2894 1 . . . 1 1 
       2895 1 . . . 1 1 
       2896 1 . . . 1 1 
       2897 1 . . . 1 1 
       2898 1 . . . 1 1 
       2899 1 . . . 1 1 
       2900 1 . . . 1 1 
       2901 1 . . . 1 1 
       2902 1 . . . 1 1 
       2903 1 . . . 1 1 
       2904 1 . . . 1 1 
       2905 1 . . . 1 1 
       2906 1 . . . 1 1 
       2907 1 . . . 1 1 
       2908 1 . . . 1 1 
       2909 1 . . . 1 1 
       2910 1 . . . 1 1 
       2911 1 . . . 1 1 
       2912 1 . . . 1 1 
       2913 1 . . . 1 1 
       2914 1 . . . 1 1 
       2915 1 . . . 1 1 
       2916 1 . . . 1 1 
       2917 1 . . . 1 1 
       2918 1 . . . 1 1 
       2919 1 . . . 1 1 
       2920 1 . . . 1 1 
       2921 1 . . . 1 1 
       2922 1 . . . 1 1 
       2923 1 . . . 1 1 
       2924 1 . . . 1 1 
       2925 1 . . . 1 1 
       2926 1 . . . 1 1 
       2927 1 . . . 1 1 
       2928 1 . . . 1 1 
       2929 1 . . . 1 1 
       2930 1 . . . 1 1 
       2931 1 . . . 1 1 
       2932 1 . . . 1 1 
       2933 1 . . . 1 1 
       2934 1 . . . 1 1 
       2935 1 . . . 1 1 
       2936 1 . . . 1 1 
       2937 1 . . . 1 1 
       2938 1 . . . 1 1 
       2939 1 . . . 1 1 
       2940 1 . . . 1 1 
       2941 1 . . . 1 1 
       2942 1 . . . 1 1 
       2943 1 . . . 1 1 
       2944 1 . . . 1 1 
       2945 1 . . . 1 1 
       2946 1 . . . 1 1 
       2947 1 . . . 1 1 
       2948 1 . . . 1 1 
       2949 1 . . . 1 1 
       2950 1 . . . 1 1 
       2951 1 . . . 1 1 
       2952 1 . . . 1 1 
       2953 1 . . . 1 1 
       2954 1 . . . 1 1 
       2955 1 . . . 1 1 
       2956 1 . . . 1 1 
       2957 1 . . . 1 1 
       2958 1 . . . 1 1 
       2959 1 . . . 1 1 
       2960 1 . . . 1 1 
       2961 1 . . . 1 1 
       2962 1 . . . 1 1 
       2963 1 . . . 1 1 
       2964 1 . . . 1 1 
       2965 1 . . . 1 1 
       2966 1 . . . 1 1 
       2967 1 . . . 1 1 
       2968 1 . . . 1 1 
       2969 1 . . . 1 1 
       2970 1 . . . 1 1 
       2971 1 . . . 1 1 
       2972 1 . . . 1 1 
       2973 1 . . . 1 1 
       2974 1 . . . 1 1 
       2975 1 . . . 1 1 
       2976 1 . . . 1 1 
       2977 1 . . . 1 1 
       2978 1 . . . 1 1 
       2979 1 . . . 1 1 
       2980 1 . . . 1 1 
       2981 1 . . . 1 1 
       2982 1 . . . 1 1 
       2983 1 . . . 1 1 
       2984 1 . . . 1 1 
       2985 1 . . . 1 1 
       2986 1 . . . 1 1 
       2987 1 . . . 1 1 
       2988 1 . . . 1 1 
       2989 1 . . . 1 1 
       2990 1 . . . 1 1 
       2991 1 . . . 1 1 
       2992 1 . . . 1 1 
       2993 1 . . . 1 1 
       2994 1 . . . 1 1 
       2995 1 . . . 1 1 
       2996 1 . . . 1 1 
       2997 1 . . . 1 1 
       2998 1 . . . 1 1 
       2999 1 . . . 1 1 
       3000 1 . . . 1 1 
       3001 1 . . . 1 1 
       3002 1 . . . 1 1 
       3003 1 . . . 1 1 
       3004 1 . . . 1 1 
       3005 1 . . . 1 1 
       3006 1 . . . 1 1 
       3007 1 . . . 1 1 
       3008 1 . . . 1 1 
       3009 1 . . . 1 1 
       3010 1 . . . 1 1 
       3011 1 . . . 1 1 
       3012 1 . . . 1 1 
       3013 1 . . . 1 1 
       3014 1 . . . 1 1 
       3015 1 . . . 1 1 
       3016 1 . . . 1 1 
       3017 1 . . . 1 1 
       3018 1 . . . 1 1 
       3019 1 . . . 1 1 
       3020 1 . . . 1 1 
       3021 1 . . . 1 1 
       3022 1 . . . 1 1 
       3023 1 . . . 1 1 
       3024 1 . . . 1 1 
       3025 1 . . . 1 1 
       3026 1 . . . 1 1 
       3027 1 . . . 1 1 
       3028 1 . . . 1 1 
       3029 1 . . . 1 1 
       3030 1 . . . 1 1 
       3031 1 . . . 1 1 
       3032 1 . . . 1 1 
       3033 1 . . . 1 1 
       3034 1 . . . 1 1 
       3035 1 . . . 1 1 
       3036 1 . . . 1 1 
       3037 1 . . . 1 1 
       3038 1 . . . 1 1 
       3039 1 . . . 1 1 
       3040 1 . . . 1 1 
       3041 1 . . . 1 1 
       3042 1 . . . 1 1 
       3043 1 . . . 1 1 
       3044 1 . . . 1 1 
       3045 1 . . . 1 1 
       3046 1 . . . 1 1 
       3047 1 . . . 1 1 
       3048 1 . . . 1 1 
       3049 1 . . . 1 1 
       3050 1 . . . 1 1 
       3051 1 . . . 1 1 
       3052 1 . . . 1 1 
       3053 1 . . . 1 1 
       3054 1 . . . 1 1 
       3055 1 . . . 1 1 
       3056 1 . . . 1 1 
       3057 1 . . . 1 1 
       3058 1 . . . 1 1 
       3059 1 . . . 1 1 
       3060 1 . . . 1 1 
       3061 1 . . . 1 1 
       3062 1 . . . 1 1 
       3063 1 . . . 1 1 
       3064 1 . . . 1 1 
       3065 1 . . . 1 1 
       3066 1 . . . 1 1 
       3067 1 . . . 1 1 
       3068 1 . . . 1 1 
       3069 1 . . . 1 1 
       3070 1 . . . 1 1 
       3071 1 . . . 1 1 
       3072 1 . . . 1 1 
       3073 1 . . . 1 1 
       3074 1 . . . 1 1 
       3075 1 . . . 1 1 
       3076 1 . . . 1 1 
       3077 1 . . . 1 1 
       3078 1 . . . 1 1 
       3079 1 . . . 1 1 
       3080 1 . . . 1 1 
       3081 1 . . . 1 1 
       3082 1 . . . 1 1 
       3083 1 . . . 1 1 
       3084 1 . . . 1 1 
       3085 1 . . . 1 1 
       3086 1 . . . 1 1 
       3087 1 . . . 1 1 
       3088 1 . . . 1 1 
       3089 1 . . . 1 1 
       3090 1 . . . 1 1 
       3091 1 . . . 1 1 
       3092 1 . . . 1 1 
       3093 1 . . . 1 1 
       3094 1 . . . 1 1 
       3095 1 . . . 1 1 
       3096 1 . . . 1 1 
       3097 1 . . . 1 1 
       3098 1 . . . 1 1 
       3099 1 . . . 1 1 
       3100 1 . . . 1 1 
       3101 1 . . . 1 1 
       3102 1 . . . 1 1 
       3103 1 . . . 1 1 
       3104 1 . . . 1 1 
       3105 1 . . . 1 1 
       3106 1 . . . 1 1 
       3107 1 . . . 1 1 
       3108 1 . . . 1 1 
       3109 1 . . . 1 1 
       3110 1 . . . 1 1 
       3111 1 . . . 1 1 
       3112 1 . . . 1 1 
       3113 1 . . . 1 1 
       3114 1 . . . 1 1 
       3115 1 . . . 1 1 
       3116 1 . . . 1 1 
       3117 1 . . . 1 1 
       3118 1 . . . 1 1 
       3119 1 . . . 1 1 
       3120 1 . . . 1 1 
       3121 1 . . . 1 1 
       3122 1 . . . 1 1 
       3123 1 . . . 1 1 
       3124 1 . . . 1 1 
       3125 1 . . . 1 1 
       3126 1 . . . 1 1 
       3127 1 . . . 1 1 
       3128 1 . . . 1 1 
       3129 1 . . . 1 1 
       3130 1 . . . 1 1 
       3131 1 . . . 1 1 
       3132 1 . . . 1 1 
       3133 1 . . . 1 1 
       3134 1 . . . 1 1 
       3135 1 . . . 1 1 
       3136 1 . . . 1 1 
       3137 1 . . . 1 1 
       3138 1 . . . 1 1 
       3139 1 . . . 1 1 
       3140 1 . . . 1 1 
       3141 1 . . . 1 1 
       3142 1 . . . 1 1 
       3143 1 . . . 1 1 
       3144 1 . . . 1 1 
       3145 1 . . . 1 1 
       3146 1 . . . 1 1 
       3147 1 . . . 1 1 
       3148 1 . . . 1 1 
       3149 1 . . . 1 1 
       3150 1 . . . 1 1 
       3151 1 . . . 1 1 
       3152 1 . . . 1 1 
       3153 1 . . . 1 1 
       3154 1 . . . 1 1 
       3155 1 . . . 1 1 
       3156 1 . . . 1 1 
       3157 1 . . . 1 1 
       3158 1 . . . 1 1 
       3159 1 . . . 1 1 
       3160 1 . . . 1 1 
       3161 1 . . . 1 1 
       3162 1 . . . 1 1 
       3163 1 . . . 1 1 
       3164 1 . . . 1 1 
       3165 1 . . . 1 1 
       3166 1 . . . 1 1 
       3167 1 . . . 1 1 
       3168 1 . . . 1 1 
       3169 1 . . . 1 1 
       3170 1 . . . 1 1 
       3171 1 . . . 1 1 
       3172 1 . . . 1 1 
       3173 1 . . . 1 1 
       3174 1 . . . 1 1 
       3175 1 . . . 1 1 
       3176 1 . . . 1 1 
       3177 1 . . . 1 1 
       3178 1 . . . 1 1 
       3179 1 . . . 1 1 
       3180 1 . . . 1 1 
       3181 1 . . . 1 1 
       3182 1 . . . 1 1 
       3183 1 . . . 1 1 
       3184 1 . . . 1 1 
       3185 1 . . . 1 1 
       3186 1 . . . 1 1 
       3187 1 . . . 1 1 
       3188 1 . . . 1 1 
       3189 1 . . . 1 1 
       3190 1 . . . 1 1 
       3191 1 . . . 1 1 
       3192 1 . . . 1 1 
       3193 1 . . . 1 1 
       3194 1 . . . 1 1 
       3195 1 . . . 1 1 
       3196 1 . . . 1 1 
       3197 1 . . . 1 1 
       3198 1 . . . 1 1 
       3199 1 . . . 1 1 
       3200 1 . . . 1 1 
       3201 1 . . . 1 1 
       3202 1 . . . 1 1 
       3203 1 . . . 1 1 
       3204 1 . . . 1 1 
       3205 1 . . . 1 1 
       3206 1 . . . 1 1 
       3207 1 . . . 1 1 
       3208 1 . . . 1 1 
       3209 1 . . . 1 1 
       3210 1 . . . 1 1 
       3211 1 . . . 1 1 
       3212 1 . . . 1 1 
       3213 1 . . . 1 1 
       3214 1 . . . 1 1 
       3215 1 . . . 1 1 
       3216 1 . . . 1 1 
       3217 1 . . . 1 1 
       3218 1 . . . 1 1 
       3219 1 . . . 1 1 
       3220 1 . . . 1 1 
       3221 1 . . . 1 1 
       3222 1 . . . 1 1 
       3223 1 . . . 1 1 
       3224 1 . . . 1 1 
       3225 1 . . . 1 1 
       3226 1 . . . 1 1 
       3227 1 . . . 1 1 
       3228 1 . . . 1 1 
       3229 1 . . . 1 1 
       3230 1 . . . 1 1 
       3231 1 . . . 1 1 
       3232 1 . . . 1 1 
       3233 1 . . . 1 1 
       3234 1 . . . 1 1 
       3235 1 . . . 1 1 
       3236 1 . . . 1 1 
       3237 1 . . . 1 1 
       3238 1 . . . 1 1 
       3239 1 . . . 1 1 
       3240 1 . . . 1 1 
       3241 1 . . . 1 1 
       3242 1 . . . 1 1 
       3243 1 . . . 1 1 
       3244 1 . . . 1 1 
       3245 1 . . . 1 1 
       3246 1 . . . 1 1 
       3247 1 . . . 1 1 
       3248 1 . . . 1 1 
       3249 1 . . . 1 1 
       3250 1 . . . 1 1 
       3251 1 . . . 1 1 
       3252 1 . . . 1 1 
       3253 1 . . . 1 1 
       3254 1 . . . 1 1 
       3255 1 . . . 1 1 
       3256 1 . . . 1 1 
       3257 1 . . . 1 1 
       3258 1 . . . 1 1 
       3259 1 . . . 1 1 
       3260 1 . . . 1 1 
       3261 1 . . . 1 1 
       3262 1 . . . 1 1 
       3263 1 . . . 1 1 
       3264 1 . . . 1 1 
       3265 1 . . . 1 1 
       3266 1 . . . 1 1 
       3267 1 . . . 1 1 
       3268 1 . . . 1 1 
       3269 1 . . . 1 1 
       3270 1 . . . 1 1 
       3271 1 . . . 1 1 
       3272 1 . . . 1 1 
       3273 1 . . . 1 1 
       3274 1 . . . 1 1 
       3275 1 . . . 1 1 
       3276 1 . . . 1 1 
       3277 1 . . . 1 1 
       3278 1 . . . 1 1 
       3279 1 . . . 1 1 
       3280 1 . . . 1 1 
       3281 1 . . . 1 1 
       3282 1 . . . 1 1 
       3283 1 . . . 1 1 
       3284 1 . . . 1 1 
       3285 1 . . . 1 1 
       3286 1 . . . 1 1 
       3287 1 . . . 1 1 
       3288 1 . . . 1 1 
       3289 1 . . . 1 1 
       3290 1 . . . 1 1 
       3291 1 . . . 1 1 
       3292 1 . . . 1 1 
       3293 1 . . . 1 1 
       3294 1 . . . 1 1 
       3295 1 . . . 1 1 
       3296 1 . . . 1 1 
       3297 1 . . . 1 1 
       3298 1 . . . 1 1 
       3299 1 . . . 1 1 
       3300 1 . . . 1 1 
       3301 1 . . . 1 1 
       3302 1 . . . 1 1 
       3303 1 . . . 1 1 
       3304 1 . . . 1 1 
       3305 1 . . . 1 1 
       3306 1 . . . 1 1 
       3307 1 . . . 1 1 
       3308 1 . . . 1 1 
       3309 1 . . . 1 1 
       3310 1 . . . 1 1 
       3311 1 . . . 1 1 
       3312 1 . . . 1 1 
       3313 1 . . . 1 1 
       3314 1 . . . 1 1 
       3315 1 . . . 1 1 
       3316 1 . . . 1 1 
       3317 1 . . . 1 1 
       3318 1 . . . 1 1 
       3319 1 . . . 1 1 
       3320 1 . . . 1 1 
       3321 1 . . . 1 1 
       3322 1 . . . 1 1 
       3323 1 . . . 1 1 
       3324 1 . . . 1 1 
       3325 1 . . . 1 1 
       3326 1 . . . 1 1 
       3327 1 . . . 1 1 
       3328 1 . . . 1 1 
       3329 1 . . . 1 1 
       3330 1 . . . 1 1 
       3331 1 . . . 1 1 
       3332 1 . . . 1 1 
       3333 1 . . . 1 1 
       3334 1 . . . 1 1 
       3335 1 . . . 1 1 
       3336 1 . . . 1 1 
       3337 1 . . . 1 1 
       3338 1 . . . 1 1 
       3339 1 . . . 1 1 
       3340 1 . . . 1 1 
       3341 1 . . . 1 1 
       3342 1 . . . 1 1 
       3343 1 . . . 1 1 
       3344 1 . . . 1 1 
       3345 1 . . . 1 1 
       3346 1 . . . 1 1 
       3347 1 . . . 1 1 
       3348 1 . . . 1 1 
       3349 1 . . . 1 1 
       3350 1 . . . 1 1 
       3351 1 . . . 1 1 
       3352 1 . . . 1 1 
       3353 1 . . . 1 1 
       3354 1 . . . 1 1 
       3355 1 . . . 1 1 
       3356 1 . . . 1 1 
       3357 1 . . . 1 1 
       3358 1 . . . 1 1 
       3359 1 . . . 1 1 
       3360 1 . . . 1 1 
       3361 1 . . . 1 1 
       3362 1 . . . 1 1 
       3363 1 . . . 1 1 
       3364 1 . . . 1 1 
       3365 1 . . . 1 1 
       3366 1 . . . 1 1 
       3367 1 . . . 1 1 
       3368 1 . . . 1 1 
       3369 1 . . . 1 1 
       3370 1 . . . 1 1 
       3371 1 . . . 1 1 
       3372 1 . . . 1 1 
       3373 1 . . . 1 1 
       3374 1 . . . 1 1 
       3375 1 . . . 1 1 
       3376 1 . . . 1 1 
       3377 1 . . . 1 1 
       3378 1 . . . 1 1 
       3379 1 . . . 1 1 
       3380 1 . . . 1 1 
       3381 1 . . . 1 1 
       3382 1 . . . 1 1 
       3383 1 . . . 1 1 
       3384 1 . . . 1 1 
       3385 1 . . . 1 1 
       3386 1 . . . 1 1 
       3387 1 . . . 1 1 
       3388 1 . . . 1 1 
       3389 1 . . . 1 1 
       3390 1 . . . 1 1 
       3391 1 . . . 1 1 
       3392 1 . . . 1 1 
       3393 1 . . . 1 1 
       3394 1 . . . 1 1 
       3395 1 . . . 1 1 
       3396 1 . . . 1 1 
       3397 1 . . . 1 1 
       3398 1 . . . 1 1 
       3399 1 . . . 1 1 
       3400 1 . . . 1 1 
       3401 1 . . . 1 1 
       3402 1 . . . 1 1 
       3403 1 . . . 1 1 
       3404 1 . . . 1 1 
       3405 1 . . . 1 1 
       3406 1 . . . 1 1 
       3407 1 . . . 1 1 
       3408 1 . . . 1 1 
       3409 1 . . . 1 1 
       3410 1 . . . 1 1 
       3411 1 . . . 1 1 
       3412 1 . . . 1 1 
       3413 1 . . . 1 1 
       3414 1 . . . 1 1 
       3415 1 . . . 1 1 
       3416 1 . . . 1 1 
       3417 1 . . . 1 1 
       3418 1 . . . 1 1 
       3419 1 . . . 1 1 
       3420 1 . . . 1 1 
       3421 1 . . . 1 1 
       3422 1 . . . 1 1 
       3423 1 . . . 1 1 
       3424 1 . . . 1 1 
       3425 1 . . . 1 1 
       3426 1 . . . 1 1 
       3427 1 . . . 1 1 
       3428 1 . . . 1 1 
       3429 1 . . . 1 1 
       3430 1 . . . 1 1 
       3431 1 . . . 1 1 
       3432 1 . . . 1 1 
       3433 1 . . . 1 1 
       3434 1 . . . 1 1 
       3435 1 . . . 1 1 
       3436 1 . . . 1 1 
       3437 1 . . . 1 1 
       3438 1 . . . 1 1 
       3439 1 . . . 1 1 
       3440 1 . . . 1 1 
       3441 1 . . . 1 1 
       3442 1 . . . 1 1 
       3443 1 . . . 1 1 
       3444 1 . . . 1 1 
       3445 1 . . . 1 1 
       3446 1 . . . 1 1 
       3447 1 . . . 1 1 
       3448 1 . . . 1 1 
       3449 1 . . . 1 1 
       3450 1 . . . 1 1 
       3451 1 . . . 1 1 
       3452 1 . . . 1 1 
       3453 1 . . . 1 1 
       3454 1 . . . 1 1 
       3455 1 . . . 1 1 
       3456 1 . . . 1 1 
       3457 1 . . . 1 1 
       3458 1 . . . 1 1 
       3459 1 . . . 1 1 
       3460 1 . . . 1 1 
       3461 1 . . . 1 1 
       3462 1 . . . 1 1 
       3463 1 . . . 1 1 
       3464 1 . . . 1 1 
       3465 1 . . . 1 1 
       3466 1 . . . 1 1 
       3467 1 . . . 1 1 
       3468 1 . . . 1 1 
       3469 1 . . . 1 1 
       3470 1 . . . 1 1 
       3471 1 . . . 1 1 
       3472 1 . . . 1 1 
       3473 1 . . . 1 1 
       3474 1 . . . 1 1 
       3475 1 . . . 1 1 
       3476 1 . . . 1 1 
       3477 1 . . . 1 1 
       3478 1 . . . 1 1 
       3479 1 . . . 1 1 
       3480 1 . . . 1 1 
       3481 1 . . . 1 1 
       3482 1 . . . 1 1 
       3483 1 . . . 1 1 
       3484 1 . . . 1 1 
       3485 1 . . . 1 1 
       3486 1 . . . 1 1 
       3487 1 . . . 1 1 
       3488 1 . . . 1 1 
       3489 1 . . . 1 1 
       3490 1 . . . 1 1 
       3491 1 . . . 1 1 
       3492 1 . . . 1 1 
       3493 1 . . . 1 1 
       3494 1 . . . 1 1 
       3495 1 . . . 1 1 
       3496 1 . . . 1 1 
       3497 1 . . . 1 1 
       3498 1 . . . 1 1 
       3499 1 . . . 1 1 
       3500 1 . . . 1 1 
       3501 1 . . . 1 1 
       3502 1 . . . 1 1 
       3503 1 . . . 1 1 
       3504 1 . . . 1 1 
       3505 1 . . . 1 1 
       3506 1 . . . 1 1 
       3507 1 . . . 1 1 
       3508 1 . . . 1 1 
       3509 1 . . . 1 1 
       3510 1 . . . 1 1 
       3511 1 . . . 1 1 
       3512 1 . . . 1 1 
       3513 1 . . . 1 1 
       3514 1 . . . 1 1 
       3515 1 . . . 1 1 
       3516 1 . . . 1 1 
       3517 1 . . . 1 1 
       3518 1 . . . 1 1 
       3519 1 . . . 1 1 
       3520 1 . . . 1 1 
       3521 1 . . . 1 1 
       3522 1 . . . 1 1 
       3523 1 . . . 1 1 
       3524 1 . . . 1 1 
       3525 1 . . . 1 1 
       3526 1 . . . 1 1 
       3527 1 . . . 1 1 
       3528 1 . . . 1 1 
       3529 1 . . . 1 1 
       3530 1 . . . 1 1 
       3531 1 . . . 1 1 
       3532 1 . . . 1 1 
       3533 1 . . . 1 1 
       3534 1 . . . 1 1 
       3535 1 . . . 1 1 
       3536 1 . . . 1 1 
       3537 1 . . . 1 1 
       3538 1 . . . 1 1 
       3539 1 . . . 1 1 
       3540 1 . . . 1 1 
       3541 1 . . . 1 1 
       3542 1 . . . 1 1 
       3543 1 . . . 1 1 
       3544 1 . . . 1 1 
       3545 1 . . . 1 1 
       3546 1 . . . 1 1 
       3547 1 . . . 1 1 
       3548 1 . . . 1 1 
       3549 1 . . . 1 1 
       3550 1 . . . 1 1 
       3551 1 . . . 1 1 
       3552 1 . . . 1 1 
       3553 1 . . . 1 1 
       3554 1 . . . 1 1 
       3555 1 . . . 1 1 
       3556 1 . . . 1 1 
       3557 1 . . . 1 1 
       3558 1 . . . 1 1 
       3559 1 . . . 1 1 
       3560 1 . . . 1 1 
       3561 1 . . . 1 1 
       3562 1 . . . 1 1 
       3563 1 . . . 1 1 
       3564 1 . . . 1 1 
       3565 1 . . . 1 1 
       3566 1 . . . 1 1 
       3567 1 . . . 1 1 
       3568 1 . . . 1 1 
       3569 1 . . . 1 1 
       3570 1 . . . 1 1 
       3571 1 . . . 1 1 
       3572 1 . . . 1 1 
       3573 1 . . . 1 1 
       3574 1 . . . 1 1 
       3575 1 . . . 1 1 
       3576 1 . . . 1 1 
       3577 1 . . . 1 1 
       3578 1 . . . 1 1 
       3579 1 . . . 1 1 
       3580 1 . . . 1 1 
       3581 1 . . . 1 1 
       3582 1 . . . 1 1 
       3583 1 . . . 1 1 
       3584 1 . . . 1 1 
       3585 1 . . . 1 1 
       3586 1 . . . 1 1 
       3587 1 . . . 1 1 
       3588 1 . . . 1 1 
       3589 1 . . . 1 1 
       3590 1 . . . 1 1 
       3591 1 . . . 1 1 
       3592 1 . . . 1 1 
       3593 1 . . . 1 1 
       3594 1 . . . 1 1 
       3595 1 . . . 1 1 
       3596 1 . . . 1 1 
       3597 1 . . . 1 1 
       3598 1 . . . 1 1 
       3599 1 . . . 1 1 
       3600 1 . . . 1 1 
       3601 1 . . . 1 1 
       3602 1 . . . 1 1 
       3603 1 . . . 1 1 
       3604 1 . . . 1 1 
       3605 1 . . . 1 1 
       3606 1 . . . 1 1 
       3607 1 . . . 1 1 
       3608 1 . . . 1 1 
       3609 1 . . . 1 1 
       3610 1 . . . 1 1 
       3611 1 . . . 1 1 
       3612 1 . . . 1 1 
       3613 1 . . . 1 1 
       3614 1 . . . 1 1 
       3615 1 . . . 1 1 
       3616 1 . . . 1 1 
       3617 1 . . . 1 1 
       3618 1 . . . 1 1 
       3619 1 . . . 1 1 
       3620 1 . . . 1 1 
       3621 1 . . . 1 1 
       3622 1 . . . 1 1 
       3623 1 . . . 1 1 
       3624 1 . . . 1 1 
       3625 1 . . . 1 1 
       3626 1 . . . 1 1 
       3627 1 . . . 1 1 
       3628 1 . . . 1 1 
       3629 1 . . . 1 1 
       3630 1 . . . 1 1 
       3631 1 . . . 1 1 
       3632 1 . . . 1 1 
       3633 1 . . . 1 1 
       3634 1 . . . 1 1 
       3635 1 . . . 1 1 
       3636 1 . . . 1 1 
       3637 1 . . . 1 1 
       3638 1 . . . 1 1 
       3639 1 . . . 1 1 
       3640 1 . . . 1 1 
       3641 1 . . . 1 1 
       3642 1 . . . 1 1 
       3643 1 . . . 1 1 
       3644 1 . . . 1 1 
       3645 1 . . . 1 1 
       3646 1 . . . 1 1 
       3647 1 . . . 1 1 
       3648 1 . . . 1 1 
       3649 1 . . . 1 1 
       3650 1 . . . 1 1 
       3651 1 . . . 1 1 
       3652 1 . . . 1 1 
       3653 1 . . . 1 1 
       3654 1 . . . 1 1 
       3655 1 . . . 1 1 
       3656 1 . . . 1 1 
       3657 1 . . . 1 1 
       3658 1 . . . 1 1 
       3659 1 . . . 1 1 
       3660 1 . . . 1 1 
       3661 1 . . . 1 1 
       3662 1 . . . 1 1 
       3663 1 . . . 1 1 
       3664 1 . . . 1 1 
       3665 1 . . . 1 1 
       3666 1 . . . 1 1 
       3667 1 . . . 1 1 
       3668 1 . . . 1 1 
       3669 1 . . . 1 1 
       3670 1 . . . 1 1 
       3671 1 . . . 1 1 
       3672 1 . . . 1 1 
       3673 1 . . . 1 1 
       3674 1 . . . 1 1 
       3675 1 . . . 1 1 
       3676 1 . . . 1 1 
       3677 1 . . . 1 1 
       3678 1 . . . 1 1 
       3679 1 . . . 1 1 
       3680 1 . . . 1 1 
       3681 1 . . . 1 1 
       3682 1 . . . 1 1 
       3683 1 . . . 1 1 
       3684 1 . . . 1 1 
       3685 1 . . . 1 1 
       3686 1 . . . 1 1 
       3687 1 . . . 1 1 
       3688 1 . . . 1 1 
       3689 1 . . . 1 1 
       3690 1 . . . 1 1 
       3691 1 . . . 1 1 
       3692 1 . . . 1 1 
       3693 1 . . . 1 1 
       3694 1 . . . 1 1 
       3695 1 . . . 1 1 
       3696 1 . . . 1 1 
       3697 1 . . . 1 1 
       3698 1 . . . 1 1 
       3699 1 . . . 1 1 
       3700 1 . . . 1 1 
       3701 1 . . . 1 1 
       3702 1 . . . 1 1 
       3703 1 . . . 1 1 
       3704 1 . . . 1 1 
       3705 1 . . . 1 1 
       3706 1 . . . 1 1 
       3707 1 . . . 1 1 
       3708 1 . . . 1 1 
       3709 1 . . . 1 1 
       3710 1 . . . 1 1 
       3711 1 . . . 1 1 
       3712 1 . . . 1 1 
       3713 1 . . . 1 1 
       3714 1 . . . 1 1 
       3715 1 . . . 1 1 
       3716 1 . . . 1 1 
       3717 1 . . . 1 1 
       3718 1 . . . 1 1 
       3719 1 . . . 1 1 
       3720 1 . . . 1 1 
       3721 1 . . . 1 1 
       3722 1 . . . 1 1 
       3723 1 . . . 1 1 
       3724 1 . . . 1 1 
       3725 1 . . . 1 1 
       3726 1 . . . 1 1 
       3727 1 . . . 1 1 
       3728 1 . . . 1 1 
       3729 1 . . . 1 1 
       3730 1 . . . 1 1 
       3731 1 . . . 1 1 
       3732 1 . . . 1 1 
       3733 1 . . . 1 1 
       3734 1 . . . 1 1 
       3735 1 . . . 1 1 
       3736 1 . . . 1 1 
       3737 1 . . . 1 1 
       3738 1 . . . 1 1 
       3739 1 . . . 1 1 
       3740 1 . . . 1 1 
       3741 1 . . . 1 1 
       3742 1 . . . 1 1 
       3743 1 . . . 1 1 
       3744 1 . . . 1 1 
       3745 1 . . . 1 1 
       3746 1 . . . 1 1 
       3747 1 . . . 1 1 
       3748 1 . . . 1 1 
       3749 1 . . . 1 1 
       3750 1 . . . 1 1 
       3751 1 . . . 1 1 
       3752 1 . . . 1 1 
       3753 1 . . . 1 1 
       3754 1 . . . 1 1 
       3755 1 . . . 1 1 
       3756 1 . . . 1 1 
       3757 1 . . . 1 1 
       3758 1 . . . 1 1 
       3759 1 . . . 1 1 
       3760 1 . . . 1 1 
       3761 1 . . . 1 1 
       3762 1 . . . 1 1 
       3763 1 . . . 1 1 
       3764 1 . . . 1 1 
       3765 1 . . . 1 1 
       3766 1 . . . 1 1 
       3767 1 . . . 1 1 
       3768 1 . . . 1 1 
       3769 1 . . . 1 1 
       3770 1 . . . 1 1 
       3771 1 . . . 1 1 
       3772 1 . . . 1 1 
       3773 1 . . . 1 1 
       3774 1 . . . 1 1 
       3775 1 . . . 1 1 
       3776 1 . . . 1 1 
       3777 1 . . . 1 1 
       3778 1 . . . 1 1 
       3779 1 . . . 1 1 
       3780 1 . . . 1 1 
       3781 1 . . . 1 1 
       3782 1 . . . 1 1 
       3783 1 . . . 1 1 
       3784 1 . . . 1 1 
       3785 1 . . . 1 1 
       3786 1 . . . 1 1 
       3787 1 . . . 1 1 
       3788 1 . . . 1 1 
       3789 1 . . . 1 1 
       3790 1 . . . 1 1 
       3791 1 . . . 1 1 
       3792 1 . . . 1 1 
       3793 1 . . . 1 1 
       3794 1 . . . 1 1 
       3795 1 . . . 1 1 
       3796 1 . . . 1 1 
       3797 1 . . . 1 1 
       3798 1 . . . 1 1 
       3799 1 . . . 1 1 
       3800 1 . . . 1 1 
       3801 1 . . . 1 1 
       3802 1 . . . 1 1 
       3803 1 . . . 1 1 
       3804 1 . . . 1 1 
       3805 1 . . . 1 1 
       3806 1 . . . 1 1 
       3807 1 . . . 1 1 
       3808 1 . . . 1 1 
       3809 1 . . . 1 1 
       3810 1 . . . 1 1 
       3811 1 . . . 1 1 
       3812 1 . . . 1 1 
       3813 1 . . . 1 1 
       3814 1 . . . 1 1 
       3815 1 . . . 1 1 
       3816 1 . . . 1 1 
       3817 1 . . . 1 1 
       3818 1 . . . 1 1 
       3819 1 . . . 1 1 
       3820 1 . . . 1 1 
       3821 1 . . . 1 1 
       3822 1 . . . 1 1 
       3823 1 . . . 1 1 
       3824 1 . . . 1 1 
       3825 1 . . . 1 1 
       3826 1 . . . 1 1 
       3827 1 . . . 1 1 
       3828 1 . . . 1 1 
       3829 1 . . . 1 1 
       3830 1 . . . 1 1 
       3831 1 . . . 1 1 
       3832 1 . . . 1 1 
       3833 1 . . . 1 1 
       3834 1 . . . 1 1 
       3835 1 . . . 1 1 
       3836 1 . . . 1 1 
       3837 1 . . . 1 1 
       3838 1 . . . 1 1 
       3839 1 . . . 1 1 
       3840 1 . . . 1 1 
       3841 1 . . . 1 1 
       3842 1 . . . 1 1 
       3843 1 . . . 1 1 
       3844 1 . . . 1 1 
       3845 1 . . . 1 1 
       3846 1 . . . 1 1 
       3847 1 . . . 1 1 
       3848 1 . . . 1 1 
       3849 1 . . . 1 1 
       3850 1 . . . 1 1 
       3851 1 . . . 1 1 
       3852 1 . . . 1 1 
       3853 1 . . . 1 1 
       3854 1 . . . 1 1 
       3855 1 . . . 1 1 
       3856 1 . . . 1 1 
       3857 1 . . . 1 1 
       3858 1 . . . 1 1 
       3859 1 . . . 1 1 
       3860 1 . . . 1 1 
       3861 1 . . . 1 1 
       3862 1 . . . 1 1 
       3863 1 . . . 1 1 
       3864 1 . . . 1 1 
       3865 1 . . . 1 1 
       3866 1 . . . 1 1 
       3867 1 . . . 1 1 
       3868 1 . . . 1 1 
       3869 1 . . . 1 1 
       3870 1 . . . 1 1 
       3871 1 . . . 1 1 
       3872 1 . . . 1 1 
       3873 1 . . . 1 1 
       3874 1 . . . 1 1 
       3875 1 . . . 1 1 
       3876 1 . . . 1 1 
       3877 1 . . . 1 1 
       3878 1 . . . 1 1 
       3879 1 . . . 1 1 
       3880 1 . . . 1 1 
       3881 1 . . . 1 1 
       3882 1 . . . 1 1 
       3883 1 . . . 1 1 
       3884 1 . . . 1 1 
       3885 1 . . . 1 1 
       3886 1 . . . 1 1 
       3887 1 . . . 1 1 
       3888 1 . . . 1 1 
       3889 1 . . . 1 1 
       3890 1 . . . 1 1 
       3891 1 . . . 1 1 
       3892 1 . . . 1 1 
       3893 1 . . . 1 1 
       3894 1 . . . 1 1 
       3895 1 . . . 1 1 
       3896 1 . . . 1 1 
       3897 1 . . . 1 1 
       3898 1 . . . 1 1 
       3899 1 . . . 1 1 
       3900 1 . . . 1 1 
       3901 1 . . . 1 1 
       3902 1 . . . 1 1 
       3903 1 . . . 1 1 
       3904 1 . . . 1 1 
       3905 1 . . . 1 1 
       3906 1 . . . 1 1 
       3907 1 . . . 1 1 
       3908 1 . . . 1 1 
       3909 1 . . . 1 1 
       3910 1 . . . 1 1 
       3911 1 . . . 1 1 
       3912 1 . . . 1 1 
       3913 1 . . . 1 1 
       3914 1 . . . 1 1 
       3915 1 . . . 1 1 
       3916 1 . . . 1 1 
       3917 1 . . . 1 1 
       3918 1 . . . 1 1 
       3919 1 . . . 1 1 
       3920 1 . . . 1 1 
       3921 1 . . . 1 1 
       3922 1 . . . 1 1 
       3923 1 . . . 1 1 
       3924 1 . . . 1 1 
       3925 1 . . . 1 1 
       3926 1 . . . 1 1 
       3927 1 . . . 1 1 
       3928 1 . . . 1 1 
       3929 1 . . . 1 1 
       3930 1 . . . 1 1 
       3931 1 . . . 1 1 
       3932 1 . . . 1 1 
       3933 1 . . . 1 1 
       3934 1 . . . 1 1 
       3935 1 . . . 1 1 
       3936 1 . . . 1 1 
       3937 1 . . . 1 1 
       3938 1 . . . 1 1 
       3939 1 . . . 1 1 
       3940 1 . . . 1 1 
       3941 1 . . . 1 1 
       3942 1 . . . 1 1 
       3943 1 . . . 1 1 
       3944 1 . . . 1 1 
       3945 1 . . . 1 1 
       3946 1 . . . 1 1 
       3947 1 . . . 1 1 
       3948 1 . . . 1 1 
       3949 1 . . . 1 1 
       3950 1 . . . 1 1 
       3951 1 . . . 1 1 
       3952 1 . . . 1 1 
       3953 1 . . . 1 1 
       3954 1 . . . 1 1 
       3955 1 . . . 1 1 
       3956 1 . . . 1 1 
       3957 1 . . . 1 1 
       3958 1 . . . 1 1 
       3959 1 . . . 1 1 
       3960 1 . . . 1 1 
       3961 1 . . . 1 1 
       3962 1 . . . 1 1 
       3963 1 . . . 1 1 
       3964 1 . . . 1 1 
       3965 1 . . . 1 1 
       3966 1 . . . 1 1 
       3967 1 . . . 1 1 
       3968 1 . . . 1 1 
       3969 1 . . . 1 1 
       3970 1 . . . 1 1 
       3971 1 . . . 1 1 
       3972 1 . . . 1 1 
       3973 1 . . . 1 1 
       3974 1 . . . 1 1 
       3975 1 . . . 1 1 
       3976 1 . . . 1 1 
       3977 1 . . . 1 1 
       3978 1 . . . 1 1 
       3979 1 . . . 1 1 
       3980 1 . . . 1 1 
       3981 1 . . . 1 1 
       3982 1 . . . 1 1 
       3983 1 . . . 1 1 
       3984 1 . . . 1 1 
       3985 1 . . . 1 1 
       3986 1 . . . 1 1 
       3987 1 . . . 1 1 
       3988 1 . . . 1 1 
       3989 1 . . . 1 1 
       3990 1 . . . 1 1 
       3991 1 . . . 1 1 
       3992 1 . . . 1 1 
       3993 1 . . . 1 1 
       3994 1 . . . 1 1 
       3995 1 . . . 1 1 
       3996 1 . . . 1 1 
       3997 1 . . . 1 1 
       3998 1 . . . 1 1 
       3999 1 . . . 1 1 
       4000 1 . . . 1 1 
       4001 1 . . . 1 1 
       4002 1 . . . 1 1 
       4003 1 . . . 1 1 
       4004 1 . . . 1 1 
       4005 1 . . . 1 1 
       4006 1 . . . 1 1 
       4007 1 . . . 1 1 
       4008 1 . . . 1 1 
       4009 1 . . . 1 1 
       4010 1 . . . 1 1 
       4011 1 . . . 1 1 
       4012 1 . . . 1 1 
       4013 1 . . . 1 1 
       4014 1 . . . 1 1 
       4015 1 . . . 1 1 
       4016 1 . . . 1 1 
       4017 1 . . . 1 1 
       4018 1 . . . 1 1 
       4019 1 . . . 1 1 
       4020 1 . . . 1 1 
       4021 1 . . . 1 1 
       4022 1 . . . 1 1 
       4023 1 . . . 1 1 
       4024 1 . . . 1 1 
       4025 1 . . . 1 1 
       4026 1 . . . 1 1 
       4027 1 . . . 1 1 
       4028 1 . . . 1 1 
       4029 1 . . . 1 1 
       4030 1 . . . 1 1 
       4031 1 . . . 1 1 
       4032 1 . . . 1 1 
       4033 1 . . . 1 1 
       4034 1 . . . 1 1 
       4035 1 . . . 1 1 
       4036 1 . . . 1 1 
       4037 1 . . . 1 1 
       4038 1 . . . 1 1 
       4039 1 . . . 1 1 
       4040 1 . . . 1 1 
       4041 1 . . . 1 1 
       4042 1 . . . 1 1 
       4043 1 . . . 1 1 
       4044 1 . . . 1 1 
       4045 1 . . . 1 1 
       4046 1 . . . 1 1 
       4047 1 . . . 1 1 
       4048 1 . . . 1 1 
       4049 1 . . . 1 1 
       4050 1 . . . 1 1 
       4051 1 . . . 1 1 
       4052 1 . . . 1 1 
       4053 1 . . . 1 1 
       4054 1 . . . 1 1 
       4055 1 . . . 1 1 
       4056 1 . . . 1 1 
       4057 1 . . . 1 1 
       4058 1 . . . 1 1 
       4059 1 . . . 1 1 
       4060 1 . . . 1 1 
       4061 1 . . . 1 1 
       4062 1 . . . 1 1 
       4063 1 . . . 1 1 
       4064 1 . . . 1 1 
       4065 1 . . . 1 1 
       4066 1 . . . 1 1 
       4067 1 . . . 1 1 
       4068 1 . . . 1 1 
       4069 1 . . . 1 1 
       4070 1 . . . 1 1 
       4071 1 . . . 1 1 
       4072 1 . . . 1 1 
       4073 1 . . . 1 1 
       4074 1 . . . 1 1 
       4075 1 . . . 1 1 
       4076 1 . . . 1 1 
       4077 1 . . . 1 1 
       4078 1 . . . 1 1 
       4079 1 . . . 1 1 
       4080 1 . . . 1 1 
       4081 1 . . . 1 1 
       4082 1 . . . 1 1 
       4083 1 . . . 1 1 
       4084 1 . . . 1 1 
       4085 1 . . . 1 1 
       4086 1 . . . 1 1 
       4087 1 . . . 1 1 
       4088 1 . . . 1 1 
       4089 1 . . . 1 1 
       4090 1 . . . 1 1 
       4091 1 . . . 1 1 
       4092 1 . . . 1 1 
       4093 1 . . . 1 1 
       4094 1 . . . 1 1 
       4095 1 . . . 1 1 
       4096 1 . . . 1 1 
       4097 1 . . . 1 1 
       4098 1 . . . 1 1 
       4099 1 . . . 1 1 
       4100 1 . . . 1 1 
       4101 1 . . . 1 1 
       4102 1 . . . 1 1 
       4103 1 . . . 1 1 
       4104 1 . . . 1 1 
       4105 1 . . . 1 1 
       4106 1 . . . 1 1 
       4107 1 . . . 1 1 
       4108 1 . . . 1 1 
       4109 1 . . . 1 1 
       4110 1 . . . 1 1 
       4111 1 . . . 1 1 
       4112 1 . . . 1 1 
       4113 1 . . . 1 1 
       4114 1 . . . 1 1 
       4115 1 . . . 1 1 
       4116 1 . . . 1 1 
       4117 1 . . . 1 1 
       4118 1 . . . 1 1 
       4119 1 . . . 1 1 
       4120 1 . . . 1 1 
       4121 1 . . . 1 1 
       4122 1 . . . 1 1 
       4123 1 . . . 1 1 
       4124 1 . . . 1 1 
       4125 1 . . . 1 1 
       4126 1 . . . 1 1 
       4127 1 . . . 1 1 
       4128 1 . . . 1 1 
       4129 1 . . . 1 1 
       4130 1 . . . 1 1 
       4131 1 . . . 1 1 
       4132 1 . . . 1 1 
       4133 1 . . . 1 1 
       4134 1 . . . 1 1 
       4135 1 . . . 1 1 
       4136 1 . . . 1 1 
       4137 1 . . . 1 1 
       4138 1 . . . 1 1 
       4139 1 . . . 1 1 
       4140 1 . . . 1 1 
       4141 1 . . . 1 1 
       4142 1 . . . 1 1 
       4143 1 . . . 1 1 
       4144 1 . . . 1 1 
       4145 1 . . . 1 1 
       4146 1 . . . 1 1 
       4147 1 . . . 1 1 
       4148 1 . . . 1 1 
       4149 1 . . . 1 1 
       4150 1 . . . 1 1 
       4151 1 . . . 1 1 
       4152 1 . . . 1 1 
       4153 1 . . . 1 1 
       4154 1 . . . 1 1 
       4155 1 . . . 1 1 
       4156 1 . . . 1 1 
       4157 1 . . . 1 1 
       4158 1 . . . 1 1 
       4159 1 . . . 1 1 
       4160 1 . . . 1 1 
       4161 1 . . . 1 1 
       4162 1 . . . 1 1 
       4163 1 . . . 1 1 
       4164 1 . . . 1 1 
       4165 1 . . . 1 1 
       4166 1 . . . 1 1 
       4167 1 . . . 1 1 
       4168 1 . . . 1 1 
       4169 1 . . . 1 1 
       4170 1 . . . 1 1 
       4171 1 . . . 1 1 
       4172 1 . . . 1 1 
       4173 1 . . . 1 1 
       4174 1 . . . 1 1 
       4175 1 . . . 1 1 
       4176 1 . . . 1 1 
       4177 1 . . . 1 1 
       4178 1 . . . 1 1 
       4179 1 . . . 1 1 
       4180 1 . . . 1 1 
       4181 1 . . . 1 1 
       4182 1 . . . 1 1 
       4183 1 . . . 1 1 
       4184 1 . . . 1 1 
       4185 1 . . . 1 1 
       4186 1 . . . 1 1 
       4187 1 . . . 1 1 
       4188 1 . . . 1 1 
       4189 1 . . . 1 1 
       4190 1 . . . 1 1 
       4191 1 . . . 1 1 
       4192 1 . . . 1 1 
       4193 1 . . . 1 1 
       4194 1 . . . 1 1 
       4195 1 . . . 1 1 
       4196 1 . . . 1 1 
       4197 1 . . . 1 1 
       4198 1 . . . 1 1 
       4199 1 . . . 1 1 
       4200 1 . . . 1 1 
       4201 1 . . . 1 1 
       4202 1 . . . 1 1 
       4203 1 . . . 1 1 
       4204 1 . . . 1 1 
       4205 1 . . . 1 1 
       4206 1 . . . 1 1 
       4207 1 . . . 1 1 
       4208 1 . . . 1 1 
       4209 1 . . . 1 1 
       4210 1 . . . 1 1 
       4211 1 . . . 1 1 
       4212 1 . . . 1 1 
       4213 1 . . . 1 1 
       4214 1 . . . 1 1 
       4215 1 . . . 1 1 
       4216 1 . . . 1 1 
       4217 1 . . . 1 1 
       4218 1 . . . 1 1 
       4219 1 . . . 1 1 
       4220 1 . . . 1 1 
       4221 1 . . . 1 1 
       4222 1 . . . 1 1 
       4223 1 . . . 1 1 
       4224 1 . . . 1 1 
       4225 1 . . . 1 1 
       4226 1 . . . 1 1 
       4227 1 . . . 1 1 
       4228 1 . . . 1 1 
       4229 1 . . . 1 1 
       4230 1 . . . 1 1 
       4231 1 . . . 1 1 
       4232 1 . . . 1 1 
       4233 1 . . . 1 1 
       4234 1 . . . 1 1 
       4235 1 . . . 1 1 
       4236 1 . . . 1 1 
       4237 1 . . . 1 1 
       4238 1 . . . 1 1 
       4239 1 . . . 1 1 
       4240 1 . . . 1 1 
       4241 1 . . . 1 1 
       4242 1 . . . 1 1 
       4243 1 . . . 1 1 
       4244 1 . . . 1 1 
       4245 1 . . . 1 1 
       4246 1 . . . 1 1 
       4247 1 . . . 1 1 
       4248 1 . . . 1 1 
       4249 1 . . . 1 1 
       4250 1 . . . 1 1 
       4251 1 . . . 1 1 
       4252 1 . . . 1 1 
       4253 1 . . . 1 1 
       4254 1 . . . 1 1 
       4255 1 . . . 1 1 
       4256 1 . . . 1 1 
       4257 1 . . . 1 1 
       4258 1 . . . 1 1 
       4259 1 . . . 1 1 
       4260 1 . . . 1 1 
       4261 1 . . . 1 1 
       4262 1 . . . 1 1 
       4263 1 . . . 1 1 
       4264 1 . . . 1 1 
       4265 1 . . . 1 1 
       4266 1 . . . 1 1 
       4267 1 . . . 1 1 
       4268 1 . . . 1 1 
       4269 1 . . . 1 1 
       4270 1 . . . 1 1 
       4271 1 . . . 1 1 
       4272 1 . . . 1 1 
       4273 1 . . . 1 1 
       4274 1 . . . 1 1 
       4275 1 . . . 1 1 
       4276 1 . . . 1 1 
       4277 1 . . . 1 1 
       4278 1 . . . 1 1 
       4279 1 . . . 1 1 
       4280 1 . . . 1 1 
       4281 1 . . . 1 1 
       4282 1 . . . 1 1 
       4283 1 . . . 1 1 
       4284 1 . . . 1 1 
       4285 1 . . . 1 1 
       4286 1 . . . 1 1 
       4287 1 . . . 1 1 
       4288 1 . . . 1 1 
       4289 1 . . . 1 1 
       4290 1 . . . 1 1 
       4291 1 . . . 1 1 
       4292 1 . . . 1 1 
       4293 1 . . . 1 1 
       4294 1 . . . 1 1 
       4295 1 . . . 1 1 
       4296 1 . . . 1 1 
       4297 1 . . . 1 1 
       4298 1 . . . 1 1 
       4299 1 . . . 1 1 
       4300 1 . . . 1 1 
       4301 1 . . . 1 1 
       4302 1 . . . 1 1 
       4303 1 . . . 1 1 
       4304 1 . . . 1 1 
       4305 1 . . . 1 1 
       4306 1 . . . 1 1 
       4307 1 . . . 1 1 
       4308 1 . . . 1 1 
       4309 1 . . . 1 1 
       4310 1 . . . 1 1 
       4311 1 . . . 1 1 
       4312 1 . . . 1 1 
       4313 1 . . . 1 1 
       4314 1 . . . 1 1 
       4315 1 . . . 1 1 
       4316 1 . . . 1 1 
       4317 1 . . . 1 1 
       4318 1 . . . 1 1 
       4319 1 . . . 1 1 
       4320 1 . . . 1 1 
       4321 1 . . . 1 1 
       4322 1 . . . 1 1 
       4323 1 . . . 1 1 
       4324 1 . . . 1 1 
       4325 1 . . . 1 1 
       4326 1 . . . 1 1 
       4327 1 . . . 1 1 
       4328 1 . . . 1 1 
       4329 1 . . . 1 1 
       4330 1 . . . 1 1 
       4331 1 . . . 1 1 
       4332 1 . . . 1 1 
       4333 1 . . . 1 1 
       4334 1 . . . 1 1 
       4335 1 . . . 1 1 
       4336 1 . . . 1 1 
       4337 1 . . . 1 1 
       4338 1 . . . 1 1 
       4339 1 . . . 1 1 
       4340 1 . . . 1 1 
       4341 1 . . . 1 1 
       4342 1 . . . 1 1 
       4343 1 . . . 1 1 
       4344 1 . . . 1 1 
       4345 1 . . . 1 1 
       4346 1 . . . 1 1 
       4347 1 . . . 1 1 
       4348 1 . . . 1 1 
       4349 1 . . . 1 1 
       4350 1 . . . 1 1 
       4351 1 . . . 1 1 
       4352 1 . . . 1 1 
       4353 1 . . . 1 1 
       4354 1 . . . 1 1 
       4355 1 . . . 1 1 
       4356 1 . . . 1 1 
       4357 1 . . . 1 1 
       4358 1 . . . 1 1 
       4359 1 . . . 1 1 
       4360 1 . . . 1 1 
       4361 1 . . . 1 1 
       4362 1 . . . 1 1 
       4363 1 . . . 1 1 
       4364 1 . . . 1 1 
       4365 1 . . . 1 1 
       4366 1 . . . 1 1 
       4367 1 . . . 1 1 
       4368 1 . . . 1 1 
       4369 1 . . . 1 1 
       4370 1 . . . 1 1 
       4371 1 . . . 1 1 
       4372 1 . . . 1 1 
       4373 1 . . . 1 1 
       4374 1 . . . 1 1 
       4375 1 . . . 1 1 
       4376 1 . . . 1 1 
       4377 1 . . . 1 1 
       4378 1 . . . 1 1 
       4379 1 . . . 1 1 
       4380 1 . . . 1 1 
       4381 1 . . . 1 1 
       4382 1 . . . 1 1 
       4383 1 . . . 1 1 
       4384 1 . . . 1 1 
       4385 1 . . . 1 1 
       4386 1 . . . 1 1 
       4387 1 . . . 1 1 
       4388 1 . . . 1 1 
       4389 1 . . . 1 1 
       4390 1 . . . 1 1 
       4391 1 . . . 1 1 
       4392 1 . . . 1 1 
       4393 1 . . . 1 1 
       4394 1 . . . 1 1 
       4395 1 . . . 1 1 
       4396 1 . . . 1 1 
       4397 1 . . . 1 1 
       4398 1 . . . 1 1 
       4399 1 . . . 1 1 
       4400 1 . . . 1 1 
       4401 1 . . . 1 1 
       4402 1 . . . 1 1 
       4403 1 . . . 1 1 
       4404 1 . . . 1 1 
       4405 1 . . . 1 1 
       4406 1 . . . 1 1 
       4407 1 . . . 1 1 
       4408 1 . . . 1 1 
       4409 1 . . . 1 1 
       4410 1 . . . 1 1 
       4411 1 . . . 1 1 
       4412 1 . . . 1 1 
       4413 1 . . . 1 1 
       4414 1 . . . 1 1 
       4415 1 . . . 1 1 
       4416 1 . . . 1 1 
       4417 1 . . . 1 1 
       4418 1 . . . 1 1 
       4419 1 . . . 1 1 
       4420 1 . . . 1 1 
       4421 1 . . . 1 1 
       4422 1 . . . 1 1 
       4423 1 . . . 1 1 
       4424 1 . . . 1 1 
       4425 1 . . . 1 1 
       4426 1 . . . 1 1 
       4427 1 . . . 1 1 
       4428 1 . . . 1 1 
       4429 1 . . . 1 1 
       4430 1 . . . 1 1 
       4431 1 . . . 1 1 
       4432 1 . . . 1 1 
       4433 1 . . . 1 1 
       4434 1 . . . 1 1 
       4435 1 . . . 1 1 
       4436 1 . . . 1 1 
       4437 1 . . . 1 1 
       4438 1 . . . 1 1 
       4439 1 . . . 1 1 
       4440 1 . . . 1 1 
       4441 1 . . . 1 1 
       4442 1 . . . 1 1 
       4443 1 . . . 1 1 
       4444 1 . . . 1 1 
       4445 1 . . . 1 1 
       4446 1 . . . 1 1 
       4447 1 . . . 1 1 
       4448 1 . . . 1 1 
       4449 1 . . . 1 1 
       4450 1 . . . 1 1 
       4451 1 . . . 1 1 
       4452 1 . . . 1 1 
       4453 1 . . . 1 1 
       4454 1 . . . 1 1 
       4455 1 . . . 1 1 
       4456 1 . . . 1 1 
       4457 1 . . . 1 1 
       4458 1 . . . 1 1 
       4459 1 . . . 1 1 
       4460 1 . . . 1 1 
       4461 1 . . . 1 1 
       4462 1 . . . 1 1 
       4463 1 . . . 1 1 
       4464 1 . . . 1 1 
       4465 1 . . . 1 1 
       4466 1 . . . 1 1 
       4467 1 . . . 1 1 
       4468 1 . . . 1 1 
       4469 1 . . . 1 1 
       4470 1 . . . 1 1 
       4471 1 . . . 1 1 
       4472 1 . . . 1 1 
       4473 1 . . . 1 1 
       4474 1 . . . 1 1 
       4475 1 . . . 1 1 
       4476 1 . . . 1 1 
       4477 1 . . . 1 1 
       4478 1 . . . 1 1 
       4479 1 . . . 1 1 
       4480 1 . . . 1 1 
       4481 1 . . . 1 1 
       4482 1 . . . 1 1 
       4483 1 . . . 1 1 
       4484 1 . . . 1 1 
       4485 1 . . . 1 1 
       4486 1 . . . 1 1 
       4487 1 . . . 1 1 
       4488 1 . . . 1 1 
       4489 1 . . . 1 1 
       4490 1 . . . 1 1 
       4491 1 . . . 1 1 
       4492 1 . . . 1 1 
       4493 1 . . . 1 1 
       4494 1 . . . 1 1 
       4495 1 . . . 1 1 
       4496 1 . . . 1 1 
       4497 1 . . . 1 1 
       4498 1 . . . 1 1 
       4499 1 . . . 1 1 
       4500 1 . . . 1 1 
       4501 1 . . . 1 1 
       4502 1 . . . 1 1 
       4503 1 . . . 1 1 
       4504 1 . . . 1 1 
       4505 1 . . . 1 1 
       4506 1 . . . 1 1 
       4507 1 . . . 1 1 
       4508 1 . . . 1 1 
       4509 1 . . . 1 1 
       4510 1 . . . 1 1 
       4511 1 . . . 1 1 
       4512 1 . . . 1 1 
       4513 1 . . . 1 1 
       4514 1 . . . 1 1 
       4515 1 . . . 1 1 
       4516 1 . . . 1 1 
       4517 1 . . . 1 1 
       4518 1 . . . 1 1 
       4519 1 . . . 1 1 
       4520 1 . . . 1 1 
       4521 1 . . . 1 1 
       4522 1 . . . 1 1 
       4523 1 . . . 1 1 
       4524 1 . . . 1 1 
       4525 1 . . . 1 1 
       4526 1 . . . 1 1 
       4527 1 . . . 1 1 
       4528 1 . . . 1 1 
       4529 1 . . . 1 1 
       4530 1 . . . 1 1 
       4531 1 . . . 1 1 
       4532 1 . . . 1 1 
       4533 1 . . . 1 1 
       4534 1 . . . 1 1 
       4535 1 . . . 1 1 
       4536 1 . . . 1 1 
       4537 1 . . . 1 1 
       4538 1 . . . 1 1 
       4539 1 . . . 1 1 
       4540 1 . . . 1 1 
       4541 1 . . . 1 1 
       4542 1 . . . 1 1 
       4543 1 . . . 1 1 
       4544 1 . . . 1 1 
       4545 1 . . . 1 1 
       4546 1 . . . 1 1 
       4547 1 . . . 1 1 
       4548 1 . . . 1 1 
       4549 1 . . . 1 1 
       4550 1 . . . 1 1 
       4551 1 . . . 1 1 
       4552 1 . . . 1 1 
       4553 1 . . . 1 1 
       4554 1 . . . 1 1 
       4555 1 . . . 1 1 
       4556 1 . . . 1 1 
       4557 1 . . . 1 1 
       4558 1 . . . 1 1 
       4559 1 . . . 1 1 
       4560 1 . . . 1 1 
       4561 1 . . . 1 1 
       4562 1 . . . 1 1 
       4563 1 . . . 1 1 
       4564 1 . . . 1 1 
       4565 1 . . . 1 1 
       4566 1 . . . 1 1 
       4567 1 . . . 1 1 
       4568 1 . . . 1 1 
       4569 1 . . . 1 1 
       4570 1 . . . 1 1 
       4571 1 . . . 1 1 
       4572 1 . . . 1 1 
       4573 1 . . . 1 1 
       4574 1 . . . 1 1 
       4575 1 . . . 1 1 
       4576 1 . . . 1 1 
       4577 1 . . . 1 1 
       4578 1 . . . 1 1 
       4579 1 . . . 1 1 
       4580 1 . . . 1 1 
       4581 1 . . . 1 1 
       4582 1 . . . 1 1 
       4583 1 . . . 1 1 
       4584 1 . . . 1 1 
       4585 1 . . . 1 1 
       4586 1 . . . 1 1 
       4587 1 . . . 1 1 
       4588 1 . . . 1 1 
       4589 1 . . . 1 1 
       4590 1 . . . 1 1 
       4591 1 . . . 1 1 
       4592 1 . . . 1 1 
       4593 1 . . . 1 1 
       4594 1 . . . 1 1 
       4595 1 . . . 1 1 
       4596 1 . . . 1 1 
       4597 1 . . . 1 1 
       4598 1 . . . 1 1 
       4599 1 . . . 1 1 
       4600 1 . . . 1 1 
       4601 1 . . . 1 1 
       4602 1 . . . 1 1 
       4603 1 . . . 1 1 
       4604 1 . . . 1 1 
       4605 1 . . . 1 1 
       4606 1 . . . 1 1 
       4607 1 . . . 1 1 
       4608 1 . . . 1 1 
       4609 1 . . . 1 1 
       4610 1 . . . 1 1 
       4611 1 . . . 1 1 
       4612 1 . . . 1 1 
       4613 1 . . . 1 1 
       4614 1 . . . 1 1 
       4615 1 . . . 1 1 
       4616 1 . . . 1 1 
       4617 1 . . . 1 1 
       4618 1 . . . 1 1 
       4619 1 . . . 1 1 
       4620 1 . . . 1 1 
       4621 1 . . . 1 1 
       4622 1 . . . 1 1 
       4623 1 . . . 1 1 
       4624 1 . . . 1 1 
       4625 1 . . . 1 1 
       4626 1 . . . 1 1 
       4627 1 . . . 1 1 
       4628 1 . . . 1 1 
       4629 1 . . . 1 1 
       4630 1 . . . 1 1 
       4631 1 . . . 1 1 
       4632 1 . . . 1 1 
       4633 1 . . . 1 1 
       4634 1 . . . 1 1 
       4635 1 . . . 1 1 
       4636 1 . . . 1 1 
       4637 1 . . . 1 1 
       4638 1 . . . 1 1 
       4639 1 . . . 1 1 
       4640 1 . . . 1 1 
       4641 1 . . . 1 1 
       4642 1 . . . 1 1 
       4643 1 . . . 1 1 
       4644 1 . . . 1 1 
       4645 1 . . . 1 1 
       4646 1 . . . 1 1 
       4647 1 . . . 1 1 
       4648 1 . . . 1 1 
       4649 1 . . . 1 1 
       4650 1 . . . 1 1 
       4651 1 . . . 1 1 
       4652 1 . . . 1 1 
       4653 1 . . . 1 1 
       4654 1 . . . 1 1 
       4655 1 . . . 1 1 
       4656 1 . . . 1 1 
       4657 1 . . . 1 1 
       4658 1 . . . 1 1 
       4659 1 . . . 1 1 
       4660 1 . . . 1 1 
       4661 1 . . . 1 1 
       4662 1 . . . 1 1 
       4663 1 . . . 1 1 
       4664 1 . . . 1 1 
       4665 1 . . . 1 1 
       4666 1 . . . 1 1 
       4667 1 . . . 1 1 
       4668 1 . . . 1 1 
       4669 1 . . . 1 1 
       4670 1 . . . 1 1 
       4671 1 . . . 1 1 
       4672 1 . . . 1 1 
       4673 1 . . . 1 1 
       4674 1 . . . 1 1 
       4675 1 . . . 1 1 
       4676 1 . . . 1 1 
       4677 1 . . . 1 1 
       4678 1 . . . 1 1 
       4679 1 . . . 1 1 
       4680 1 . . . 1 1 
       4681 1 . . . 1 1 
       4682 1 . . . 1 1 
       4683 1 . . . 1 1 
       4684 1 . . . 1 1 
       4685 1 . . . 1 1 
       4686 1 . . . 1 1 
       4687 1 . . . 1 1 
       4688 1 . . . 1 1 
       4689 1 . . . 1 1 
       4690 1 . . . 1 1 
       4691 1 . . . 1 1 
       4692 1 . . . 1 1 
       4693 1 . . . 1 1 
       4694 1 . . . 1 1 
       4695 1 . . . 1 1 
       4696 1 . . . 1 1 
       4697 1 . . . 1 1 
       4698 1 . . . 1 1 
       4699 1 . . . 1 1 
       4700 1 . . . 1 1 
       4701 1 . . . 1 1 
       4702 1 . . . 1 1 
       4703 1 . . . 1 1 
       4704 1 . . . 1 1 
       4705 1 . . . 1 1 
       4706 1 . . . 1 1 
       4707 1 . . . 1 1 
       4708 1 . . . 1 1 
       4709 1 . . . 1 1 
       4710 1 . . . 1 1 
       4711 1 . . . 1 1 
       4712 1 . . . 1 1 
       4713 1 . . . 1 1 
       4714 1 . . . 1 1 
       4715 1 . . . 1 1 
       4716 1 . . . 1 1 
       4717 1 . . . 1 1 
       4718 1 . . . 1 1 
       4719 1 . . . 1 1 
       4720 1 . . . 1 1 
       4721 1 . . . 1 1 
       4722 1 . . . 1 1 
       4723 1 . . . 1 1 
       4724 1 . . . 1 1 
       4725 1 . . . 1 1 
       4726 1 . . . 1 1 
       4727 1 . . . 1 1 
       4728 1 . . . 1 1 
       4729 1 . . . 1 1 
       4730 1 . . . 1 1 
       4731 1 . . . 1 1 
       4732 1 . . . 1 1 
       4733 1 . . . 1 1 
       4734 1 . . . 1 1 
       4735 1 . . . 1 1 
       4736 1 . . . 1 1 
       4737 1 . . . 1 1 
       4738 1 . . . 1 1 
       4739 1 . . . 1 1 
       4740 1 . . . 1 1 
       4741 1 . . . 1 1 
       4742 1 . . . 1 1 
       4743 1 . . . 1 1 
       4744 1 . . . 1 1 
       4745 1 . . . 1 1 
       4746 1 . . . 1 1 
       4747 1 . . . 1 1 
       4748 1 . . . 1 1 
       4749 1 . . . 1 1 
       4750 1 . . . 1 1 
       4751 1 . . . 1 1 
       4752 1 . . . 1 1 
       4753 1 . . . 1 1 
       4754 1 . . . 1 1 
       4755 1 . . . 1 1 
       4756 1 . . . 1 1 
       4757 1 . . . 1 1 
       4758 1 . . . 1 1 
       4759 1 . . . 1 1 
       4760 1 . . . 1 1 
       4761 1 . . . 1 1 
       4762 1 . . . 1 1 
       4763 1 . . . 1 1 
       4764 1 . . . 1 1 
       4765 1 . . . 1 1 
       4766 1 . . . 1 1 
       4767 1 . . . 1 1 
       4768 1 . . . 1 1 
       4769 1 . . . 1 1 
       4770 1 . . . 1 1 
       4771 1 . . . 1 1 
       4772 1 . . . 1 1 
       4773 1 . . . 1 1 
       4774 1 . . . 1 1 
       4775 1 . . . 1 1 
       4776 1 . . . 1 1 
       4777 1 . . . 1 1 
       4778 1 . . . 1 1 
       4779 1 . . . 1 1 
       4780 1 . . . 1 1 
       4781 1 . . . 1 1 
       4782 1 . . . 1 1 
       4783 1 . . . 1 1 
       4784 1 . . . 1 1 
       4785 1 . . . 1 1 
       4786 1 . . . 1 1 
       4787 1 . . . 1 1 
       4788 1 . . . 1 1 
       4789 1 . . . 1 1 
       4790 1 . . . 1 1 
       4791 1 . . . 1 1 
       4792 1 . . . 1 1 
       4793 1 . . . 1 1 
       4794 1 . . . 1 1 
       4795 1 . . . 1 1 
       4796 1 . . . 1 1 
       4797 1 . . . 1 1 
       4798 1 . . . 1 1 
       4799 1 . . . 1 1 
       4800 1 . . . 1 1 
       4801 1 . . . 1 1 
       4802 1 . . . 1 1 
       4803 1 . . . 1 1 
       4804 1 . . . 1 1 
       4805 1 . . . 1 1 
       4806 1 . . . 1 1 
       4807 1 . . . 1 1 
       4808 1 . . . 1 1 
       4809 1 . . . 1 1 
       4810 1 . . . 1 1 
       4811 1 . . . 1 1 
       4812 1 . . . 1 1 
       4813 1 . . . 1 1 
       4814 1 . . . 1 1 
       4815 1 . . . 1 1 
       4816 1 . . . 1 1 
       4817 1 . . . 1 1 
       4818 1 . . . 1 1 
       4819 1 . . . 1 1 
       4820 1 . . . 1 1 
       4821 1 . . . 1 1 
       4822 1 . . . 1 1 
       4823 1 . . . 1 1 
       4824 1 . . . 1 1 
       4825 1 . . . 1 1 
       4826 1 . . . 1 1 
       4827 1 . . . 1 1 
       4828 1 . . . 1 1 
       4829 1 . . . 1 1 
       4830 1 . . . 1 1 
       4831 1 . . . 1 1 
       4832 1 . . . 1 1 
       4833 1 . . . 1 1 
       4834 1 . . . 1 1 
       4835 1 . . . 1 1 
       4836 1 . . . 1 1 
       4837 1 . . . 1 1 
       4838 1 . . . 1 1 
       4839 1 . . . 1 1 
       4840 1 . . . 1 1 
       4841 1 . . . 1 1 
       4842 1 . . . 1 1 
       4843 1 . . . 1 1 
       4844 1 . . . 1 1 
       4845 1 . . . 1 1 
       4846 1 . . . 1 1 
       4847 1 . . . 1 1 
       4848 1 . . . 1 1 
       4849 1 . . . 1 1 
       4850 1 . . . 1 1 
       4851 1 . . . 1 1 
       4852 1 . . . 1 1 
       4853 1 . . . 1 1 
       4854 1 . . . 1 1 
       4855 1 . . . 1 1 
       4856 1 . . . 1 1 
       4857 1 . . . 1 1 
       4858 1 . . . 1 1 
       4859 1 . . . 1 1 
       4860 1 . . . 1 1 
       4861 1 . . . 1 1 
       4862 1 . . . 1 1 
       4863 1 . . . 1 1 
       4864 1 . . . 1 1 
       4865 1 . . . 1 1 
       4866 1 . . . 1 1 
       4867 1 . . . 1 1 
       4868 1 . . . 1 1 
       4869 1 . . . 1 1 
       4870 1 . . . 1 1 
       4871 1 . . . 1 1 
       4872 1 . . . 1 1 
       4873 1 . . . 1 1 
       4874 1 . . . 1 1 
       4875 1 . . . 1 1 
       4876 1 . . . 1 1 
       4877 1 . . . 1 1 
       4878 1 . . . 1 1 
       4879 1 . . . 1 1 
       4880 1 . . . 1 1 
       4881 1 . . . 1 1 
       4882 1 . . . 1 1 
       4883 1 . . . 1 1 
       4884 1 . . . 1 1 
       4885 1 . . . 1 1 
       4886 1 . . . 1 1 
       4887 1 . . . 1 1 
       4888 1 . . . 1 1 
       4889 1 . . . 1 1 
       4890 1 . . . 1 1 
       4891 1 . . . 1 1 
       4892 1 . . . 1 1 
       4893 1 . . . 1 1 
       4894 1 . . . 1 1 
       4895 1 . . . 1 1 
       4896 1 . . . 1 1 
       4897 1 . . . 1 1 
       4898 1 . . . 1 1 
       4899 1 . . . 1 1 
       4900 1 . . . 1 1 
       4901 1 . . . 1 1 
       4902 1 . . . 1 1 
       4903 1 . . . 1 1 
       4904 1 . . . 1 1 
       4905 1 . . . 1 1 
       4906 1 . . . 1 1 
       4907 1 . . . 1 1 
       4908 1 . . . 1 1 
       4909 1 . . . 1 1 
       4910 1 . . . 1 1 
       4911 1 . . . 1 1 
       4912 1 . . . 1 1 
       4913 1 . . . 1 1 
       4914 1 . . . 1 1 
       4915 1 . . . 1 1 
       4916 1 . . . 1 1 
       4917 1 . . . 1 1 
       4918 1 . . . 1 1 
       4919 1 . . . 1 1 
       4920 1 . . . 1 1 
       4921 1 . . . 1 1 
       4922 1 . . . 1 1 
       4923 1 . . . 1 1 
       4924 1 . . . 1 1 
       4925 1 . . . 1 1 
       4926 1 . . . 1 1 
       4927 1 . . . 1 1 
       4928 1 . . . 1 1 
       4929 1 . . . 1 1 
       4930 1 . . . 1 1 
       4931 1 . . . 1 1 
       4932 1 . . . 1 1 
       4933 1 . . . 1 1 
       4934 1 . . . 1 1 
       4935 1 . . . 1 1 
       4936 1 . . . 1 1 
       4937 1 . . . 1 1 
       4938 1 . . . 1 1 
       4939 1 . . . 1 1 
       4940 1 . . . 1 1 
       4941 1 . . . 1 1 
       4942 1 . . . 1 1 
       4943 1 . . . 1 1 
       4944 1 . . . 1 1 
       4945 1 . . . 1 1 
       4946 1 . . . 1 1 
       4947 1 . . . 1 1 
       4948 1 . . . 1 1 
       4949 1 . . . 1 1 
       4950 1 . . . 1 1 
       4951 1 . . . 1 1 
       4952 1 . . . 1 1 
       4953 1 . . . 1 1 
       4954 1 . . . 1 1 
       4955 1 . . . 1 1 
       4956 1 . . . 1 1 
       4957 1 . . . 1 1 
       4958 1 . . . 1 1 
       4959 1 . . . 1 1 
       4960 1 . . . 1 1 
       4961 1 . . . 1 1 
       4962 1 . . . 1 1 
       4963 1 . . . 1 1 
       4964 1 . . . 1 1 
       4965 1 . . . 1 1 
       4966 1 . . . 1 1 
       4967 1 . . . 1 1 
       4968 1 . . . 1 1 
       4969 1 . . . 1 1 
       4970 1 . . . 1 1 
       4971 1 . . . 1 1 
       4972 1 . . . 1 1 
       4973 1 . . . 1 1 
       4974 1 . . . 1 1 
       4975 1 . . . 1 1 
       4976 1 . . . 1 1 
       4977 1 . . . 1 1 
       4978 1 . . . 1 1 
       4979 1 . . . 1 1 
       4980 1 . . . 1 1 
       4981 1 . . . 1 1 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

          1 1 1 1 1   2 SER HB2  .   2 . HB2  1 1 
          1 1 2 1 1   3 GLN H    .   3 . HN   1 1 
          2 1 1 1 1   3 GLN HA   .   3 . HA   1 1 
          2 1 2 1 1   4 ILE H    .   4 . HN   1 1 
          3 1 1 1 1   3 GLN HB3  .   3 . HB1  1 1 
          3 1 2 1 1   4 ILE H    .   4 . HN   1 1 
          4 1 1 1 1   4 ILE H    .   4 . HN   1 1 
          4 1 2 1 1 105 GLU HB2  . 105 . HB2  1 1 
          5 1 1 1 1   3 GLN HB2  .   3 . HB2  1 1 
          5 1 2 1 1   4 ILE H    .   4 . HN   1 1 
          6 1 1 1 1   4 ILE HA   .   4 . HA   1 1 
          6 1 2 1 1   5 PHE H    .   5 . HN   1 1 
          7 1 1 1 1   4 ILE HG13 .   4 . HG11 1 1 
          7 1 2 1 1   5 PHE H    .   5 . HN   1 1 
          8 1 1 1 1   4 ILE HG12 .   4 . HG12 1 1 
          8 1 2 1 1   5 PHE H    .   5 . HN   1 1 
          9 1 1 1 1   5 PHE H    .   5 . HN   1 1 
          9 1 2 1 1   6 VAL H    .   6 . HN   1 1 
         10 1 1 1 1   5 PHE HA   .   5 . HA   1 1 
         10 1 2 1 1   6 VAL H    .   6 . HN   1 1 
         11 1 1 1 1   6 VAL HA   .   6 . HA   1 1 
         11 1 2 1 1   7 VAL H    .   7 . HN   1 1 
         12 1 1 1 1   6 VAL HB   .   6 . HB   1 1 
         12 1 2 1 1   7 VAL H    .   7 . HN   1 1 
         13 1 1 1 1   6 VAL MG1  .   6 . HG1* 1 1 
         13 1 2 1 1   7 VAL H    .   7 . HN   1 1 
         14 1 1 1 1   6 VAL MG2  .   6 . HG2* 1 1 
         14 1 2 1 1   7 VAL H    .   7 . HN   1 1 
         15 1 1 1 1   7 VAL HA   .   7 . HA   1 1 
         15 1 2 1 1   8 PHE H    .   8 . HN   1 1 
         16 1 1 1 1   7 VAL HB   .   7 . HB   1 1 
         16 1 2 1 1   8 PHE H    .   8 . HN   1 1 
         17 1 1 1 1   7 VAL MG1  .   7 . HG1* 1 1 
         17 1 2 1 1   8 PHE H    .   8 . HN   1 1 
         18 1 1 1 1   8 PHE H    .   8 . HN   1 1 
         18 1 2 1 1   9 SER H    .   9 . HN   1 1 
         19 1 1 1 1   8 PHE HA   .   8 . HA   1 1 
         19 1 2 1 1   9 SER H    .   9 . HN   1 1 
         20 1 1 1 1   8 PHE HB2  .   8 . HB2  1 1 
         20 1 2 1 1   9 SER H    .   9 . HN   1 1 
         21 1 1 1 1   8 PHE HB3  .   8 . HB1  1 1 
         21 1 2 1 1   9 SER H    .   9 . HN   1 1 
         22 1 1 1 1   8 PHE QD   .   8 . HD*  1 1 
         22 1 2 1 1   9 SER H    .   9 . HN   1 1 
         23 1 1 1 1   9 SER H    .   9 . HN   1 1 
         23 1 2 1 1  10 SER H    .  10 . HN   1 1 
         24 1 1 1 1   9 SER HB2  .   9 . HB2  1 1 
         24 1 2 1 1  10 SER H    .  10 . HN   1 1 
         25 1 1 1 1  12 PRO HB2  .  12 . HB2  1 1 
         25 1 2 1 1  13 GLU H    .  13 . HN   1 1 
         26 1 1 1 1  12 PRO HD2  .  12 . HD2  1 1 
         26 1 2 1 1  13 GLU H    .  13 . HN   1 1 
         27 1 1 1 1  13 GLU HB2  .  13 . HB2  1 1 
         27 1 2 1 1  14 ILE H    .  14 . HN   1 1 
         28 1 1 1 1  14 ILE HB   .  14 . HB   1 1 
         28 1 2 1 1  15 LEU H    .  15 . HN   1 1 
         29 1 1 1 1  14 ILE HG12 .  14 . HG12 1 1 
         29 1 2 1 1  15 LEU H    .  15 . HN   1 1 
         30 1 1 1 1  14 ILE HG13 .  14 . HG11 1 1 
         30 1 2 1 1  15 LEU H    .  15 . HN   1 1 
         31 1 1 1 1  15 LEU HB3  .  15 . HB1  1 1 
         31 1 2 1 1  16 LYS H    .  16 . HN   1 1 
         32 1 1 1 1  15 LEU MD1  .  15 . HD1* 1 1 
         32 1 2 1 1  16 LYS H    .  16 . HN   1 1 
         33 1 1 1 1  15 LEU MD2  .  15 . HD2* 1 1 
         33 1 2 1 1  16 LYS H    .  16 . HN   1 1 
         34 1 1 1 1  16 LYS H    .  16 . HN   1 1 
         34 1 2 1 1  17 GLU H    .  17 . HN   1 1 
         35 1 1 1 1  16 LYS HB2  .  16 . HB2  1 1 
         35 1 2 1 1  17 GLU H    .  17 . HN   1 1 
         36 1 1 1 1  16 LYS HB3  .  16 . HB1  1 1 
         36 1 2 1 1  17 GLU H    .  17 . HN   1 1 
         37 1 1 1 1  17 GLU H    .  17 . HN   1 1 
         37 1 2 1 1  18 ILE HG13 .  18 . HG11 1 1 
         38 1 1 1 1  17 GLU HB2  .  17 . HB2  1 1 
         38 1 2 1 1  18 ILE H    .  18 . HN   1 1 
         39 1 1 1 1  17 GLU HB3  .  17 . HB1  1 1 
         39 1 2 1 1  18 ILE H    .  18 . HN   1 1 
         40 1 1 1 1  17 GLU HG2  .  17 . HG2  1 1 
         40 1 2 1 1  18 ILE H    .  18 . HN   1 1 
         41 1 1 1 1  18 ILE H    .  18 . HN   1 1 
         41 1 2 1 1  19 VAL H    .  19 . HN   1 1 
         42 1 1 1 1  18 ILE HB   .  18 . HB   1 1 
         42 1 2 1 1  19 VAL H    .  19 . HN   1 1 
         43 1 1 1 1  18 ILE MG   .  18 . HG2* 1 1 
         43 1 2 1 1  19 VAL H    .  19 . HN   1 1 
         44 1 1 1 1  18 ILE HG13 .  18 . HG11 1 1 
         44 1 2 1 1  19 VAL H    .  19 . HN   1 1 
         45 1 1 1 1  15 LEU MD1  .  15 . HD1* 1 1 
         45 1 2 1 1  19 VAL H    .  19 . HN   1 1 
         46 1 1 1 1  19 VAL H    .  19 . HN   1 1 
         46 1 2 1 1  20 ARG H    .  20 . HN   1 1 
         47 1 1 1 1  19 VAL HB   .  19 . HB   1 1 
         47 1 2 1 1  20 ARG H    .  20 . HN   1 1 
         48 1 1 1 1  19 VAL MG2  .  19 . HG2* 1 1 
         48 1 2 1 1  20 ARG H    .  20 . HN   1 1 
         49 1 1 1 1  20 ARG HB2  .  20 . HB2  1 1 
         49 1 2 1 1  21 GLU H    .  21 . HN   1 1 
         50 1 1 1 1  20 ARG HG3  .  20 . HG1  1 1 
         50 1 2 1 1  21 GLU H    .  21 . HN   1 1 
         51 1 1 1 1  21 GLU HB2  .  21 . HB2  1 1 
         51 1 2 1 1  22 ILE H    .  22 . HN   1 1 
         52 1 1 1 1  22 ILE HB   .  22 . HB   1 1 
         52 1 2 1 1  23 LYS H    .  23 . HN   1 1 
         53 1 1 1 1  22 ILE MG   .  22 . HG2* 1 1 
         53 1 2 1 1  23 LYS H    .  23 . HN   1 1 
         54 1 1 1 1  23 LYS H    .  23 . HN   1 1 
         54 1 2 1 1  24 ARG H    .  24 . HN   1 1 
         55 1 1 1 1  23 LYS HB2  .  23 . HB2  1 1 
         55 1 2 1 1  24 ARG H    .  24 . HN   1 1 
         56 1 1 1 1  23 LYS HG2  .  23 . HG2  1 1 
         56 1 2 1 1  24 ARG H    .  24 . HN   1 1 
         57 1 1 1 1  23 LYS HG3  .  23 . HG1  1 1 
         57 1 2 1 1  24 ARG H    .  24 . HN   1 1 
         58 1 1 1 1  24 ARG H    .  24 . HN   1 1 
         58 1 2 1 1  25 GLN H    .  25 . HN   1 1 
         59 1 1 1 1  24 ARG HG2  .  24 . HG2  1 1 
         59 1 2 1 1  25 GLN H    .  25 . HN   1 1 
         60 1 1 1 1  24 ARG HG3  .  24 . HG1  1 1 
         60 1 2 1 1  25 GLN H    .  25 . HN   1 1 
         61 1 1 1 1  25 GLN HB3  .  25 . HB1  1 1 
         61 1 2 1 1  26 GLY H    .  26 . HN   1 1 
         62 1 1 1 1  25 GLN HB2  .  25 . HB2  1 1 
         62 1 2 1 1  26 GLY H    .  26 . HN   1 1 
         63 1 1 1 1  25 GLN HG3  .  25 . HG1  1 1 
         63 1 2 1 1  26 GLY H    .  26 . HN   1 1 
         64 1 1 1 1  25 GLN HG2  .  25 . HG2  1 1 
         64 1 2 1 1  26 GLY H    .  26 . HN   1 1 
         65 1 1 1 1  27 VAL H    .  27 . HN   1 1 
         65 1 2 1 1  28 ARG H    .  28 . HN   1 1 
         66 1 1 1 1  27 VAL HA   .  27 . HA   1 1 
         66 1 2 1 1  28 ARG H    .  28 . HN   1 1 
         67 1 1 1 1  27 VAL HB   .  27 . HB   1 1 
         67 1 2 1 1  28 ARG H    .  28 . HN   1 1 
         68 1 1 1 1  27 VAL MG1  .  27 . HG1* 1 1 
         68 1 2 1 1  28 ARG H    .  28 . HN   1 1 
         69 1 1 1 1  28 ARG HA   .  28 . HA   1 1 
         69 1 2 1 1  29 VAL H    .  29 . HN   1 1 
         70 1 1 1 1  28 ARG HB3  .  28 . HB1  1 1 
         70 1 2 1 1  29 VAL H    .  29 . HN   1 1 
         71 1 1 1 1  28 ARG HG2  .  28 . HG2  1 1 
         71 1 2 1 1  29 VAL H    .  29 . HN   1 1 
         72 1 1 1 1  28 ARG HG3  .  28 . HG1  1 1 
         72 1 2 1 1  29 VAL H    .  29 . HN   1 1 
         73 1 1 1 1  28 ARG HD2  .  28 . HD2  1 1 
         73 1 2 1 1  29 VAL H    .  29 . HN   1 1 
         74 1 1 1 1  29 VAL HA   .  29 . HA   1 1 
         74 1 2 1 1  30 VAL H    .  30 . HN   1 1 
         75 1 1 1 1  29 VAL HB   .  29 . HB   1 1 
         75 1 2 1 1  30 VAL H    .  30 . HN   1 1 
         76 1 1 1 1  30 VAL H    .  30 . HN   1 1 
         76 1 2 1 1  31 LEU H    .  31 . HN   1 1 
         77 1 1 1 1  30 VAL HA   .  30 . HA   1 1 
         77 1 2 1 1  31 LEU H    .  31 . HN   1 1 
         78 1 1 1 1  30 VAL HB   .  30 . HB   1 1 
         78 1 2 1 1  31 LEU H    .  31 . HN   1 1 
         79 1 1 1 1  30 VAL MG1  .  30 . HG1* 1 1 
         79 1 2 1 1  31 LEU H    .  31 . HN   1 1 
         80 1 1 1 1  31 LEU H    .  31 . HN   1 1 
         80 1 2 1 1  31 LEU HB2  .  31 . HB2  1 1 
         81 1 1 1 1  31 LEU H    .  31 . HN   1 1 
         81 1 2 1 1  32 LEU H    .  32 . HN   1 1 
         82 1 1 1 1  31 LEU HA   .  31 . HA   1 1 
         82 1 2 1 1  32 LEU H    .  32 . HN   1 1 
         83 1 1 1 1  31 LEU HB2  .  31 . HB2  1 1 
         83 1 2 1 1  32 LEU H    .  32 . HN   1 1 
         84 1 1 1 1  31 LEU HB3  .  31 . HB1  1 1 
         84 1 2 1 1  32 LEU H    .  32 . HN   1 1 
         85 1 1 1 1  31 LEU HG   .  31 . HG   1 1 
         85 1 2 1 1  32 LEU H    .  32 . HN   1 1 
         86 1 1 1 1  31 LEU MD2  .  31 . HD2* 1 1 
         86 1 2 1 1  32 LEU H    .  32 . HN   1 1 
         87 1 1 1 1  31 LEU MD1  .  31 . HD1* 1 1 
         87 1 2 1 1  32 LEU H    .  32 . HN   1 1 
         88 1 1 1 1  32 LEU H    .  32 . HN   1 1 
         88 1 2 1 1  33 TYR H    .  33 . HN   1 1 
         89 1 1 1 1  32 LEU HA   .  32 . HA   1 1 
         89 1 2 1 1  33 TYR H    .  33 . HN   1 1 
         90 1 1 1 1  32 LEU HB3  .  32 . HB1  1 1 
         90 1 2 1 1  33 TYR H    .  33 . HN   1 1 
         91 1 1 1 1  32 LEU HB2  .  32 . HB2  1 1 
         91 1 2 1 1  33 TYR H    .  33 . HN   1 1 
         92 1 1 1 1  32 LEU MD1  .  32 . HD1* 1 1 
         92 1 2 1 1  33 TYR H    .  33 . HN   1 1 
         93 1 1 1 1  32 LEU MD2  .  32 . HD2* 1 1 
         93 1 2 1 1  33 TYR H    .  33 . HN   1 1 
         94 1 1 1 1  33 TYR H    .  33 . HN   1 1 
         94 1 2 1 1  34 SER H    .  34 . HN   1 1 
         95 1 1 1 1  33 TYR HA   .  33 . HA   1 1 
         95 1 2 1 1  34 SER H    .  34 . HN   1 1 
         96 1 1 1 1  33 TYR HB3  .  33 . HB1  1 1 
         96 1 2 1 1  34 SER H    .  34 . HN   1 1 
         97 1 1 1 1  33 TYR HB2  .  33 . HB2  1 1 
         97 1 2 1 1  34 SER H    .  34 . HN   1 1 
         98 1 1 1 1  33 TYR QD   .  33 . HD*  1 1 
         98 1 2 1 1  34 SER H    .  34 . HN   1 1 
         99 1 1 1 1  34 SER H    .  34 . HN   1 1 
         99 1 2 1 1  35 ASP H    .  35 . HN   1 1 
        100 1 1 1 1  35 ASP H    .  35 . HN   1 1 
        100 1 2 1 1  58 VAL H    .  58 . HN   1 1 
        101 1 1 1 1  34 SER HA   .  34 . HA   1 1 
        101 1 2 1 1  35 ASP H    .  35 . HN   1 1 
        102 1 1 1 1  34 SER HB2  .  34 . HB2  1 1 
        102 1 2 1 1  35 ASP H    .  35 . HN   1 1 
        103 1 1 1 1  35 ASP HA   .  35 . HA   1 1 
        103 1 2 1 1  36 GLN H    .  36 . HN   1 1 
        104 1 1 1 1  35 ASP HB3  .  35 . HB1  1 1 
        104 1 2 1 1  36 GLN H    .  36 . HN   1 1 
        105 1 1 1 1  36 GLN H    .  36 . HN   1 1 
        105 1 2 1 1  37 ASP H    .  37 . HN   1 1 
        106 1 1 1 1  36 GLN HB2  .  36 . HB2  1 1 
        106 1 2 1 1  37 ASP H    .  37 . HN   1 1 
        107 1 1 1 1  36 GLN HB3  .  36 . HB1  1 1 
        107 1 2 1 1  37 ASP H    .  37 . HN   1 1 
        108 1 1 1 1  37 ASP H    .  37 . HN   1 1 
        108 1 2 1 1  38 GLU H    .  38 . HN   1 1 
        109 1 1 1 1  37 ASP HA   .  37 . HA   1 1 
        109 1 2 1 1  38 GLU H    .  38 . HN   1 1 
        110 1 1 1 1  37 ASP HB2  .  37 . HB2  1 1 
        110 1 2 1 1  38 GLU H    .  38 . HN   1 1 
        111 1 1 1 1  37 ASP HB3  .  37 . HB1  1 1 
        111 1 2 1 1  38 GLU H    .  38 . HN   1 1 
        112 1 1 1 1  38 GLU H    .  38 . HN   1 1 
        112 1 2 1 1  39 LYS H    .  39 . HN   1 1 
        113 1 1 1 1  38 GLU HB2  .  38 . HB2  1 1 
        113 1 2 1 1  39 LYS H    .  39 . HN   1 1 
        114 1 1 1 1  39 LYS HG2  .  39 . HG2  1 1 
        114 1 2 1 1  40 ARG H    .  40 . HN   1 1 
        115 1 1 1 1 143 GLU H    . 143 . HN   1 1 
        115 1 2 1 1 146 ARG HG3  . 146 . HG1  1 1 
        116 1 1 1 1  39 LYS HG3  .  39 . HG1  1 1 
        116 1 2 1 1  40 ARG H    .  40 . HN   1 1 
        117 1 1 1 1  40 ARG H    .  40 . HN   1 1 
        117 1 2 1 1  41 ARG H    .  41 . HN   1 1 
        118 1 1 1 1  40 ARG HG2  .  40 . HG2  1 1 
        118 1 2 1 1  41 ARG H    .  41 . HN   1 1 
        119 1 1 1 1  64 PHE HA   .  64 . HA   1 1 
        119 1 2 1 1  67 ASN H    .  67 . HN   1 1 
        120 1 1 1 1  41 ARG HB3  .  41 . HB1  1 1 
        120 1 2 1 1  42 ARG H    .  42 . HN   1 1 
        121 1 1 1 1  41 ARG HG3  .  41 . HG1  1 1 
        121 1 2 1 1  42 ARG H    .  42 . HN   1 1 
        122 1 1 1 1  42 ARG H    .  42 . HN   1 1 
        122 1 2 1 1  44 ARG HB2  .  44 . HB2  1 1 
        123 1 1 1 1  67 ASN H    .  67 . HN   1 1 
        123 1 2 1 1  68 ILE HB   .  68 . HB   1 1 
        124 1 1 1 1  67 ASN H    .  67 . HN   1 1 
        124 1 2 1 1  68 ILE HA   .  68 . HA   1 1 
        125 1 1 1 1  42 ARG H    .  42 . HN   1 1 
        125 1 2 1 1  43 GLU H    .  43 . HN   1 1 
        126 1 1 1 1  42 ARG HD2  .  42 . HD2  1 1 
        126 1 2 1 1  43 GLU H    .  43 . HN   1 1 
        127 1 1 1 1  42 ARG HD3  .  42 . HD1  1 1 
        127 1 2 1 1  43 GLU H    .  43 . HN   1 1 
        128 1 1 1 1  43 GLU H    .  43 . HN   1 1 
        128 1 2 1 1  44 ARG H    .  44 . HN   1 1 
        129 1 1 1 1  43 GLU HB2  .  43 . HB2  1 1 
        129 1 2 1 1  44 ARG H    .  44 . HN   1 1 
        130 1 1 1 1  43 GLU HB3  .  43 . HB1  1 1 
        130 1 2 1 1  44 ARG H    .  44 . HN   1 1 
        131 1 1 1 1  44 ARG H    .  44 . HN   1 1 
        131 1 2 1 1  45 LEU H    .  45 . HN   1 1 
        132 1 1 1 1  44 ARG HB3  .  44 . HB1  1 1 
        132 1 2 1 1  45 LEU H    .  45 . HN   1 1 
        133 1 1 1 1  44 ARG HB2  .  44 . HB2  1 1 
        133 1 2 1 1  45 LEU H    .  45 . HN   1 1 
        134 1 1 1 1  44 ARG HG3  .  44 . HG1  1 1 
        134 1 2 1 1  45 LEU H    .  45 . HN   1 1 
        135 1 1 1 1  45 LEU HB2  .  45 . HB2  1 1 
        135 1 2 1 1  46 GLU H    .  46 . HN   1 1 
        136 1 1 1 1  45 LEU HG   .  45 . HG   1 1 
        136 1 2 1 1  46 GLU H    .  46 . HN   1 1 
        137 1 1 1 1  45 LEU MD1  .  45 . HD1* 1 1 
        137 1 2 1 1  46 GLU H    .  46 . HN   1 1 
        138 1 1 1 1  19 VAL MG1  .  19 . HG1* 1 1 
        138 1 2 1 1  20 ARG H    .  20 . HN   1 1 
        139 1 1 1 1  46 GLU H    .  46 . HN   1 1 
        139 1 2 1 1  47 GLU H    .  47 . HN   1 1 
        140 1 1 1 1  46 GLU HB3  .  46 . HB1  1 1 
        140 1 2 1 1  47 GLU H    .  47 . HN   1 1 
        141 1 1 1 1  46 GLU HG3  .  46 . HG1  1 1 
        141 1 2 1 1  47 GLU H    .  47 . HN   1 1 
        142 1 1 1 1  47 GLU HB2  .  47 . HB2  1 1 
        142 1 2 1 1  48 PHE H    .  48 . HN   1 1 
        143 1 1 1 1  47 GLU HB3  .  47 . HB1  1 1 
        143 1 2 1 1  48 PHE H    .  48 . HN   1 1 
        144 1 1 1 1  48 PHE H    .  48 . HN   1 1 
        144 1 2 1 1  49 GLU H    .  49 . HN   1 1 
        145 1 1 1 1  48 PHE HB2  .  48 . HB2  1 1 
        145 1 2 1 1  49 GLU H    .  49 . HN   1 1 
        146 1 1 1 1  48 PHE HB3  .  48 . HB1  1 1 
        146 1 2 1 1  49 GLU H    .  49 . HN   1 1 
        147 1 1 1 1  48 PHE QD   .  48 . HD*  1 1 
        147 1 2 1 1  49 GLU H    .  49 . HN   1 1 
        148 1 1 1 1  49 GLU H    .  49 . HN   1 1 
        148 1 2 1 1  50 LYS H    .  50 . HN   1 1 
        149 1 1 1 1  49 GLU HB3  .  49 . HB1  1 1 
        149 1 2 1 1  50 LYS H    .  50 . HN   1 1 
        150 1 1 1 1  50 LYS H    .  50 . HN   1 1 
        150 1 2 1 1  51 GLN HG3  .  51 . HG1  1 1 
        151 1 1 1 1  50 LYS H    .  50 . HN   1 1 
        151 1 2 1 1  51 GLN H    .  51 . HN   1 1 
        152 1 1 1 1  50 LYS HA   .  50 . HA   1 1 
        152 1 2 1 1  51 GLN H    .  51 . HN   1 1 
        153 1 1 1 1  50 LYS HG2  .  50 . HG2  1 1 
        153 1 2 1 1  51 GLN H    .  51 . HN   1 1 
        154 1 1 1 1  50 LYS HG3  .  50 . HG1  1 1 
        154 1 2 1 1  51 GLN H    .  51 . HN   1 1 
        155 1 1 1 1  51 GLN HB2  .  51 . HB2  1 1 
        155 1 2 1 1  52 GLY H    .  52 . HN   1 1 
        156 1 1 1 1  51 GLN HG2  .  51 . HG2  1 1 
        156 1 2 1 1  52 GLY H    .  52 . HN   1 1 
        157 1 1 1 1  52 GLY H    .  52 . HN   1 1 
        157 1 2 1 1  53 VAL H    .  53 . HN   1 1 
        158 1 1 1 1  53 VAL H    .  53 . HN   1 1 
        158 1 2 1 1  54 ASP H    .  54 . HN   1 1 
        159 1 1 1 1  53 VAL HA   .  53 . HA   1 1 
        159 1 2 1 1  54 ASP H    .  54 . HN   1 1 
        160 1 1 1 1  29 VAL HB   .  29 . HB   1 1 
        160 1 2 1 1  54 ASP H    .  54 . HN   1 1 
        161 1 1 1 1  53 VAL MG1  .  53 . HG1* 1 1 
        161 1 2 1 1  54 ASP H    .  54 . HN   1 1 
        162 1 1 1 1  54 ASP HA   .  54 . HA   1 1 
        162 1 2 1 1  55 VAL H    .  55 . HN   1 1 
        163 1 1 1 1  54 ASP HB3  .  54 . HB1  1 1 
        163 1 2 1 1  55 VAL H    .  55 . HN   1 1 
        164 1 1 1 1  55 VAL HA   .  55 . HA   1 1 
        164 1 2 1 1  56 ARG H    .  56 . HN   1 1 
        165 1 1 1 1  55 VAL HB   .  55 . HB   1 1 
        165 1 2 1 1  56 ARG H    .  56 . HN   1 1 
        166 1 1 1 1  55 VAL MG2  .  55 . HG2* 1 1 
        166 1 2 1 1  56 ARG H    .  56 . HN   1 1 
        167 1 1 1 1  55 VAL MG1  .  55 . HG1* 1 1 
        167 1 2 1 1  56 ARG H    .  56 . HN   1 1 
        168 1 1 1 1  56 ARG HD2  .  56 . HD2  1 1 
        168 1 2 1 1  57 THR H    .  57 . HN   1 1 
        169 1 1 1 1  56 ARG HD3  .  56 . HD1  1 1 
        169 1 2 1 1  57 THR H    .  57 . HN   1 1 
        170 1 1 1 1  57 THR HA   .  57 . HA   1 1 
        170 1 2 1 1  58 VAL H    .  58 . HN   1 1 
        171 1 1 1 1  58 VAL HA   .  58 . HA   1 1 
        171 1 2 1 1  59 GLU H    .  59 . HN   1 1 
        172 1 1 1 1  58 VAL MG1  .  58 . HG1* 1 1 
        172 1 2 1 1  59 GLU H    .  59 . HN   1 1 
        173 1 1 1 1  58 VAL MG2  .  58 . HG2* 1 1 
        173 1 2 1 1  59 GLU H    .  59 . HN   1 1 
        174 1 1 1 1  59 GLU H    .  59 . HN   1 1 
        174 1 2 1 1  60 ASP H    .  60 . HN   1 1 
        175 1 1 1 1  59 GLU HB2  .  59 . HB2  1 1 
        175 1 2 1 1  60 ASP H    .  60 . HN   1 1 
        176 1 1 1 1  58 VAL HB   .  58 . HB   1 1 
        176 1 2 1 1  60 ASP H    .  60 . HN   1 1 
        177 1 1 1 1  59 GLU HG2  .  59 . HG2  1 1 
        177 1 2 1 1  60 ASP H    .  60 . HN   1 1 
        178 1 1 1 1  60 ASP HA   .  60 . HA   1 1 
        178 1 2 1 1  61 LYS H    .  61 . HN   1 1 
        179 1 1 1 1  62 GLU HB2  .  62 . HB2  1 1 
        179 1 2 1 1  63 ASP H    .  63 . HN   1 1 
        180 1 1 1 1  62 GLU HB3  .  62 . HB1  1 1 
        180 1 2 1 1  63 ASP H    .  63 . HN   1 1 
        181 1 1 1 1  63 ASP HB2  .  63 . HB2  1 1 
        181 1 2 1 1  64 PHE H    .  64 . HN   1 1 
        182 1 1 1 1  63 ASP HB3  .  63 . HB1  1 1 
        182 1 2 1 1  64 PHE H    .  64 . HN   1 1 
        183 1 1 1 1  64 PHE H    .  64 . HN   1 1 
        183 1 2 1 1  65 ARG H    .  65 . HN   1 1 
        184 1 1 1 1  64 PHE QD   .  64 . HD*  1 1 
        184 1 2 1 1  65 ARG H    .  65 . HN   1 1 
        185 1 1 1 1  65 ARG HB3  .  65 . HB1  1 1 
        185 1 2 1 1  66 GLU H    .  66 . HN   1 1 
        186 1 1 1 1  66 GLU HB2  .  66 . HB2  1 1 
        186 1 2 1 1  67 ASN H    .  67 . HN   1 1 
        187 1 1 1 1  66 GLU HG2  .  66 . HG2  1 1 
        187 1 2 1 1  67 ASN H    .  67 . HN   1 1 
        188 1 1 1 1  67 ASN HB3  .  67 . HB1  1 1 
        188 1 2 1 1  68 ILE H    .  68 . HN   1 1 
        189 1 1 1 1  67 ASN HB2  .  67 . HB2  1 1 
        189 1 2 1 1  68 ILE H    .  68 . HN   1 1 
        190 1 1 1 1  68 ILE H    .  68 . HN   1 1 
        190 1 2 1 1  69 ARG H    .  69 . HN   1 1 
        191 1 1 1 1  68 ILE HB   .  68 . HB   1 1 
        191 1 2 1 1  69 ARG H    .  69 . HN   1 1 
        192 1 1 1 1  68 ILE MG   .  68 . HG2* 1 1 
        192 1 2 1 1  69 ARG H    .  69 . HN   1 1 
        193 1 1 1 1  68 ILE HG12 .  68 . HG12 1 1 
        193 1 2 1 1  69 ARG H    .  69 . HN   1 1 
        194 1 1 1 1  68 ILE HG13 .  68 . HG11 1 1 
        194 1 2 1 1  69 ARG H    .  69 . HN   1 1 
        195 1 1 1 1  69 ARG H    .  69 . HN   1 1 
        195 1 2 1 1  70 GLU H    .  70 . HN   1 1 
        196 1 1 1 1  69 ARG HB2  .  69 . HB2  1 1 
        196 1 2 1 1  70 GLU H    .  70 . HN   1 1 
        197 1 1 1 1  69 ARG HB3  .  69 . HB1  1 1 
        197 1 2 1 1  70 GLU H    .  70 . HN   1 1 
        198 1 1 1 1  69 ARG HG3  .  69 . HG1  1 1 
        198 1 2 1 1  70 GLU H    .  70 . HN   1 1 
        199 1 1 1 1  70 GLU HB2  .  70 . HB2  1 1 
        199 1 2 1 1  71 ILE H    .  71 . HN   1 1 
        200 1 1 1 1  70 GLU HG2  .  70 . HG2  1 1 
        200 1 2 1 1  71 ILE H    .  71 . HN   1 1 
        201 1 1 1 1  71 ILE H    .  71 . HN   1 1 
        201 1 2 1 1  72 TRP H    .  72 . HN   1 1 
        202 1 1 1 1  71 ILE HB   .  71 . HB   1 1 
        202 1 2 1 1  72 TRP H    .  72 . HN   1 1 
        203 1 1 1 1  71 ILE MG   .  71 . HG2* 1 1 
        203 1 2 1 1  72 TRP H    .  72 . HN   1 1 
        204 1 1 1 1  71 ILE HG12 .  71 . HG12 1 1 
        204 1 2 1 1  72 TRP H    .  72 . HN   1 1 
        205 1 1 1 1  71 ILE HG13 .  71 . HG11 1 1 
        205 1 2 1 1  72 TRP H    .  72 . HN   1 1 
        206 1 1 1 1  72 TRP HB2  .  72 . HB2  1 1 
        206 1 2 1 1  73 GLU H    .  73 . HN   1 1 
        207 1 1 1 1  72 TRP HB3  .  72 . HB1  1 1 
        207 1 2 1 1  73 GLU H    .  73 . HN   1 1 
        208 1 1 1 1  73 GLU H    .  73 . HN   1 1 
        208 1 2 1 1  74 ARG H    .  74 . HN   1 1 
        209 1 1 1 1  73 GLU HG3  .  73 . HG1  1 1 
        209 1 2 1 1  74 ARG H    .  74 . HN   1 1 
        210 1 1 1 1  74 ARG H    .  74 . HN   1 1 
        210 1 2 1 1  75 TYR H    .  75 . HN   1 1 
        211 1 1 1 1  74 ARG HB2  .  74 . HB2  1 1 
        211 1 2 1 1  75 TYR H    .  75 . HN   1 1 
        212 1 1 1 1  74 ARG HB3  .  74 . HB1  1 1 
        212 1 2 1 1  75 TYR H    .  75 . HN   1 1 
        213 1 1 1 1  74 ARG HG2  .  74 . HG2  1 1 
        213 1 2 1 1  75 TYR H    .  75 . HN   1 1 
        214 1 1 1 1  77 GLN H    .  77 . HN   1 1 
        214 1 2 1 1  77 GLN HB3  .  77 . HB1  1 1 
        215 1 1 1 1  76 PRO HD2  .  76 . HD2  1 1 
        215 1 2 1 1  77 GLN H    .  77 . HN   1 1 
        216 1 1 1 1  76 PRO HD3  .  76 . HD1  1 1 
        216 1 2 1 1  77 GLN H    .  77 . HN   1 1 
        217 1 1 1 1  79 ASP H    .  79 . HN   1 1 
        217 1 2 1 1  80 VAL H    .  80 . HN   1 1 
        218 1 1 1 1  79 ASP HB3  .  79 . HB1  1 1 
        218 1 2 1 1  80 VAL H    .  80 . HN   1 1 
        219 1 1 1 1  80 VAL H    .  80 . HN   1 1 
        219 1 2 1 1  81 VAL H    .  81 . HN   1 1 
        220 1 1 1 1  81 VAL MG2  .  81 . HG2* 1 1 
        220 1 2 1 1  82 VAL H    .  82 . HN   1 1 
        221 1 1 1 1  82 VAL H    .  82 . HN   1 1 
        221 1 2 1 1  83 ILE H    .  83 . HN   1 1 
        222 1 1 1 1   7 VAL HA   .   7 . HA   1 1 
        222 1 2 1 1 109 VAL H    . 109 . HN   1 1 
        223 1 1 1 1  82 VAL HB   .  82 . HB   1 1 
        223 1 2 1 1  83 ILE H    .  83 . HN   1 1 
        224 1 1 1 1  32 LEU MD2  .  32 . HD2* 1 1 
        224 1 2 1 1  56 ARG H    .  56 . HN   1 1 
        225 1 1 1 1  82 VAL MG1  .  82 . HG1* 1 1 
        225 1 2 1 1  83 ILE H    .  83 . HN   1 1 
        226 1 1 1 1  83 ILE HA   .  83 . HA   1 1 
        226 1 2 1 1  84 VAL H    .  84 . HN   1 1 
        227 1 1 1 1  83 ILE MG   .  83 . HG2* 1 1 
        227 1 2 1 1  84 VAL H    .  84 . HN   1 1 
        228 1 1 1 1  83 ILE HB   .  83 . HB   1 1 
        228 1 2 1 1  84 VAL H    .  84 . HN   1 1 
        229 1 1 1 1  83 ILE HG13 .  83 . HG11 1 1 
        229 1 2 1 1  84 VAL H    .  84 . HN   1 1 
        230 1 1 1 1  84 VAL H    .  84 . HN   1 1 
        230 1 2 1 1  84 VAL MG2  .  84 . HG2* 1 1 
        231 1 1 1 1  84 VAL H    .  84 . HN   1 1 
        231 1 2 1 1  85 THR H    .  85 . HN   1 1 
        232 1 1 1 1  84 VAL HA   .  84 . HA   1 1 
        232 1 2 1 1  85 THR H    .  85 . HN   1 1 
        233 1 1 1 1  84 VAL HB   .  84 . HB   1 1 
        233 1 2 1 1  85 THR H    .  85 . HN   1 1 
        234 1 1 1 1  84 VAL MG1  .  84 . HG1* 1 1 
        234 1 2 1 1  85 THR H    .  85 . HN   1 1 
        235 1 1 1 1  84 VAL MG2  .  84 . HG2* 1 1 
        235 1 2 1 1  85 THR H    .  85 . HN   1 1 
        236 1 1 1 1  85 THR H    .  85 . HN   1 1 
        236 1 2 1 1  86 THR H    .  86 . HN   1 1 
        237 1 1 1 1  85 THR HA   .  85 . HA   1 1 
        237 1 2 1 1  86 THR H    .  86 . HN   1 1 
        238 1 1 1 1  86 THR HA   .  86 . HA   1 1 
        238 1 2 1 1  87 ASP H    .  87 . HN   1 1 
        239 1 1 1 1  87 ASP HB2  .  87 . HB2  1 1 
        239 1 2 1 1  88 ASP H    .  88 . HN   1 1 
        240 1 1 1 1  87 ASP HB3  .  87 . HB1  1 1 
        240 1 2 1 1  88 ASP H    .  88 . HN   1 1 
        241 1 1 1 1  88 ASP HA   .  88 . HA   1 1 
        241 1 2 1 1  89 LYS H    .  89 . HN   1 1 
        242 1 1 1 1  88 ASP HB2  .  88 . HB2  1 1 
        242 1 2 1 1  89 LYS H    .  89 . HN   1 1 
        243 1 1 1 1  88 ASP HB3  .  88 . HB1  1 1 
        243 1 2 1 1  89 LYS H    .  89 . HN   1 1 
        244 1 1 1 1  89 LYS H    .  89 . HN   1 1 
        244 1 2 1 1  90 GLU H    .  90 . HN   1 1 
        245 1 1 1 1  89 LYS HB2  .  89 . HB2  1 1 
        245 1 2 1 1  90 GLU H    .  90 . HN   1 1 
        246 1 1 1 1  89 LYS HB3  .  89 . HB1  1 1 
        246 1 2 1 1  90 GLU H    .  90 . HN   1 1 
        247 1 1 1 1  90 GLU HB2  .  90 . HB2  1 1 
        247 1 2 1 1  91 TRP H    .  91 . HN   1 1 
        248 1 1 1 1  91 TRP H    .  91 . HN   1 1 
        248 1 2 1 1  92 ILE H    .  92 . HN   1 1 
        249 1 1 1 1  91 TRP HB2  .  91 . HB2  1 1 
        249 1 2 1 1  92 ILE H    .  92 . HN   1 1 
        250 1 1 1 1  91 TRP HB3  .  91 . HB1  1 1 
        250 1 2 1 1  92 ILE H    .  92 . HN   1 1 
        251 1 1 1 1  92 ILE H    .  92 . HN   1 1 
        251 1 2 1 1  93 LYS H    .  93 . HN   1 1 
        252 1 1 1 1  92 ILE HB   .  92 . HB   1 1 
        252 1 2 1 1  93 LYS H    .  93 . HN   1 1 
        253 1 1 1 1  92 ILE MG   .  92 . HG2* 1 1 
        253 1 2 1 1  93 LYS H    .  93 . HN   1 1 
        254 1 1 1 1  92 ILE HG12 .  92 . HG12 1 1 
        254 1 2 1 1  93 LYS H    .  93 . HN   1 1 
        255 1 1 1 1  92 ILE HG13 .  92 . HG11 1 1 
        255 1 2 1 1  93 LYS H    .  93 . HN   1 1 
        256 1 1 1 1  92 ILE MD   .  92 . HD1* 1 1 
        256 1 2 1 1  93 LYS H    .  93 . HN   1 1 
        257 1 1 1 1  93 LYS HB2  .  93 . HB2  1 1 
        257 1 2 1 1  94 ASP H    .  94 . HN   1 1 
        258 1 1 1 1  93 LYS HB3  .  93 . HB1  1 1 
        258 1 2 1 1  94 ASP H    .  94 . HN   1 1 
        259 1 1 1 1  93 LYS HG2  .  93 . HG2  1 1 
        259 1 2 1 1  94 ASP H    .  94 . HN   1 1 
        260 1 1 1 1  93 LYS HG3  .  93 . HG1  1 1 
        260 1 2 1 1  94 ASP H    .  94 . HN   1 1 
        261 1 1 1 1  94 ASP HB2  .  94 . HB2  1 1 
        261 1 2 1 1  95 PHE H    .  95 . HN   1 1 
        262 1 1 1 1  94 ASP HB3  .  94 . HB1  1 1 
        262 1 2 1 1  95 PHE H    .  95 . HN   1 1 
        263 1 1 1 1  95 PHE HB3  .  95 . HB1  1 1 
        263 1 2 1 1  96 ILE H    .  96 . HN   1 1 
        264 1 1 1 1  95 PHE QD   .  95 . HD*  1 1 
        264 1 2 1 1  96 ILE H    .  96 . HN   1 1 
        265 1 1 1 1  96 ILE H    .  96 . HN   1 1 
        265 1 2 1 1  97 GLU H    .  97 . HN   1 1 
        266 1 1 1 1  96 ILE HB   .  96 . HB   1 1 
        266 1 2 1 1  97 GLU H    .  97 . HN   1 1 
        267 1 1 1 1  96 ILE MG   .  96 . HG2* 1 1 
        267 1 2 1 1  97 GLU H    .  97 . HN   1 1 
        268 1 1 1 1  96 ILE HG13 .  96 . HG11 1 1 
        268 1 2 1 1  97 GLU H    .  97 . HN   1 1 
        269 1 1 1 1  97 GLU HB2  .  97 . HB2  1 1 
        269 1 2 1 1  98 GLU H    .  98 . HN   1 1 
        270 1 1 1 1  97 GLU HG2  .  97 . HG2  1 1 
        270 1 2 1 1  98 GLU H    .  98 . HN   1 1 
        271 1 1 1 1  97 GLU HG3  .  97 . HG1  1 1 
        271 1 2 1 1  98 GLU H    .  98 . HN   1 1 
        272 1 1 1 1  98 GLU HB2  .  98 . HB2  1 1 
        272 1 2 1 1  99 ALA H    .  99 . HN   1 1 
        273 1 1 1 1  98 GLU HG3  .  98 . HG1  1 1 
        273 1 2 1 1  99 ALA H    .  99 . HN   1 1 
        274 1 1 1 1  99 ALA MB   .  99 . HB*  1 1 
        274 1 2 1 1 100 LYS H    . 100 . HN   1 1 
        275 1 1 1 1 100 LYS H    . 100 . HN   1 1 
        275 1 2 1 1 101 GLU H    . 101 . HN   1 1 
        276 1 1 1 1 100 LYS HB3  . 100 . HB1  1 1 
        276 1 2 1 1 101 GLU H    . 101 . HN   1 1 
        277 1 1 1 1 100 LYS HB2  . 100 . HB2  1 1 
        277 1 2 1 1 101 GLU H    . 101 . HN   1 1 
        278 1 1 1 1 100 LYS HG2  . 100 . HG2  1 1 
        278 1 2 1 1 101 GLU H    . 101 . HN   1 1 
        279 1 1 1 1 100 LYS HG3  . 100 . HG1  1 1 
        279 1 2 1 1 101 GLU H    . 101 . HN   1 1 
        280 1 1 1 1 101 GLU HA   . 101 . HA   1 1 
        280 1 2 1 1 102 ARG H    . 102 . HN   1 1 
        281 1 1 1 1 102 ARG H    . 102 . HN   1 1 
        281 1 2 1 1 103 GLY H    . 103 . HN   1 1 
        282 1 1 1 1 102 ARG HB3  . 102 . HB1  1 1 
        282 1 2 1 1 103 GLY H    . 103 . HN   1 1 
        283 1 1 1 1 102 ARG HB2  . 102 . HB2  1 1 
        283 1 2 1 1 103 GLY H    . 103 . HN   1 1 
        284 1 1 1 1 102 ARG HG2  . 102 . HG2  1 1 
        284 1 2 1 1 103 GLY H    . 103 . HN   1 1 
        285 1 1 1 1 102 ARG HG3  . 102 . HG1  1 1 
        285 1 2 1 1 103 GLY H    . 103 . HN   1 1 
        286 1 1 1 1 103 GLY H    . 103 . HN   1 1 
        286 1 2 1 1 104 VAL MG1  . 104 . HG1* 1 1 
        287 1 1 1 1 100 LYS HA   . 100 . HA   1 1 
        287 1 2 1 1 104 VAL H    . 104 . HN   1 1 
        288 1 1 1 1 104 VAL H    . 104 . HN   1 1 
        288 1 2 1 1 105 GLU H    . 105 . HN   1 1 
        289 1 1 1 1 104 VAL HA   . 104 . HA   1 1 
        289 1 2 1 1 105 GLU H    . 105 . HN   1 1 
        290 1 1 1 1 104 VAL HB   . 104 . HB   1 1 
        290 1 2 1 1 105 GLU H    . 105 . HN   1 1 
        291 1 1 1 1 104 VAL MG1  . 104 . HG1* 1 1 
        291 1 2 1 1 105 GLU H    . 105 . HN   1 1 
        292 1 1 1 1 104 VAL MG2  . 104 . HG2* 1 1 
        292 1 2 1 1 105 GLU H    . 105 . HN   1 1 
        293 1 1 1 1 105 GLU HA   . 105 . HA   1 1 
        293 1 2 1 1 106 VAL H    . 106 . HN   1 1 
        294 1 1 1 1 105 GLU HB3  . 105 . HB1  1 1 
        294 1 2 1 1 106 VAL H    . 106 . HN   1 1 
        295 1 1 1 1 106 VAL H    . 106 . HN   1 1 
        295 1 2 1 1 107 PHE H    . 107 . HN   1 1 
        296 1 1 1 1 106 VAL HA   . 106 . HA   1 1 
        296 1 2 1 1 107 PHE H    . 107 . HN   1 1 
        297 1 1 1 1 106 VAL HB   . 106 . HB   1 1 
        297 1 2 1 1 107 PHE H    . 107 . HN   1 1 
        298 1 1 1 1 106 VAL MG2  . 106 . HG2* 1 1 
        298 1 2 1 1 107 PHE H    . 107 . HN   1 1 
        299 1 1 1 1 107 PHE H    . 107 . HN   1 1 
        299 1 2 1 1 108 VAL H    . 108 . HN   1 1 
        300 1 1 1 1 107 PHE HA   . 107 . HA   1 1 
        300 1 2 1 1 108 VAL H    . 108 . HN   1 1 
        301 1 1 1 1 107 PHE HB2  . 107 . HB2  1 1 
        301 1 2 1 1 108 VAL H    . 108 . HN   1 1 
        302 1 1 1 1 107 PHE QD   . 107 . HD*  1 1 
        302 1 2 1 1 108 VAL H    . 108 . HN   1 1 
        303 1 1 1 1   8 PHE H    .   8 . HN   1 1 
        303 1 2 1 1 109 VAL H    . 109 . HN   1 1 
        304 1 1 1 1 108 VAL HA   . 108 . HA   1 1 
        304 1 2 1 1 109 VAL H    . 109 . HN   1 1 
        305 1 1 1 1 108 VAL HB   . 108 . HB   1 1 
        305 1 2 1 1 109 VAL H    . 109 . HN   1 1 
        306 1 1 1 1 108 VAL MG1  . 108 . HG1* 1 1 
        306 1 2 1 1 110 TYR H    . 110 . HN   1 1 
        307 1 1 1 1 110 TYR H    . 110 . HN   1 1 
        307 1 2 1 1 111 ASN H    . 111 . HN   1 1 
        308 1 1 1 1 110 TYR HB2  . 110 . HB2  1 1 
        308 1 2 1 1 111 ASN H    . 111 . HN   1 1 
        309 1 1 1 1 111 ASN H    . 111 . HN   1 1 
        309 1 2 1 1 112 ASN H    . 112 . HN   1 1 
        310 1 1 1 1 111 ASN HA   . 111 . HA   1 1 
        310 1 2 1 1 112 ASN H    . 112 . HN   1 1 
        311 1 1 1 1 111 ASN HB2  . 111 . HB2  1 1 
        311 1 2 1 1 112 ASN H    . 112 . HN   1 1 
        312 1 1 1 1 111 ASN HB3  . 111 . HB1  1 1 
        312 1 2 1 1 112 ASN H    . 112 . HN   1 1 
        313 1 1 1 1 111 ASN HD22 . 111 . HD22 1 1 
        313 1 2 1 1 112 ASN H    . 112 . HN   1 1 
        314 1 1 1 1 112 ASN HA   . 112 . HA   1 1 
        314 1 2 1 1 113 LYS H    . 113 . HN   1 1 
        315 1 1 1 1 113 LYS H    . 113 . HN   1 1 
        315 1 2 1 1 114 ASP H    . 114 . HN   1 1 
        316 1 1 1 1 113 LYS HB2  . 113 . HB2  1 1 
        316 1 2 1 1 114 ASP H    . 114 . HN   1 1 
        317 1 1 1 1 113 LYS HB3  . 113 . HB1  1 1 
        317 1 2 1 1 114 ASP H    . 114 . HN   1 1 
        318 1 1 1 1 113 LYS HD2  . 113 . HD2  1 1 
        318 1 2 1 1 114 ASP H    . 114 . HN   1 1 
        319 1 1 1 1 113 LYS HD3  . 113 . HD1  1 1 
        319 1 2 1 1 114 ASP H    . 114 . HN   1 1 
        320 1 1 1 1 114 ASP HA   . 114 . HA   1 1 
        320 1 2 1 1 115 ASP H    . 115 . HN   1 1 
        321 1 1 1 1 115 ASP H    . 115 . HN   1 1 
        321 1 2 1 1 116 ASP H    . 116 . HN   1 1 
        322 1 1 1 1 115 ASP HB2  . 115 . HB2  1 1 
        322 1 2 1 1 116 ASP H    . 116 . HN   1 1 
        323 1 1 1 1 115 ASP HB3  . 115 . HB1  1 1 
        323 1 2 1 1 116 ASP H    . 116 . HN   1 1 
        324 1 1 1 1 116 ASP HB2  . 116 . HB2  1 1 
        324 1 2 1 1 117 ARG H    . 117 . HN   1 1 
        325 1 1 1 1 116 ASP HB3  . 116 . HB1  1 1 
        325 1 2 1 1 117 ARG H    . 117 . HN   1 1 
        326 1 1 1 1 117 ARG HG2  . 117 . HG2  1 1 
        326 1 2 1 1 118 ARG H    . 118 . HN   1 1 
        327 1 1 1 1 117 ARG HG3  . 117 . HG1  1 1 
        327 1 2 1 1 118 ARG H    . 118 . HN   1 1 
        328 1 1 1 1 120 GLU H    . 120 . HN   1 1 
        328 1 2 1 1 121 ALA H    . 121 . HN   1 1 
        329 1 1 1 1 120 GLU HB3  . 120 . HB1  1 1 
        329 1 2 1 1 121 ALA H    . 121 . HN   1 1 
        330 1 1 1 1 120 GLU HB2  . 120 . HB2  1 1 
        330 1 2 1 1 121 ALA H    . 121 . HN   1 1 
        331 1 1 1 1 120 GLU HG3  . 120 . HG1  1 1 
        331 1 2 1 1 121 ALA H    . 121 . HN   1 1 
        332 1 1 1 1 121 ALA MB   . 121 . HB*  1 1 
        332 1 2 1 1 122 GLN H    . 122 . HN   1 1 
        333 1 1 1 1 122 GLN H    . 122 . HN   1 1 
        333 1 2 1 1 123 GLN H    . 123 . HN   1 1 
        334 1 1 1 1 123 GLN H    . 123 . HN   1 1 
        334 1 2 1 1 124 GLU H    . 124 . HN   1 1 
        335 1 1 1 1 123 GLN HA   . 123 . HA   1 1 
        335 1 2 1 1 124 GLU H    . 124 . HN   1 1 
        336 1 1 1 1 125 PHE H    . 125 . HN   1 1 
        336 1 2 1 1 126 ARG H    . 126 . HN   1 1 
        337 1 1 1 1 126 ARG H    . 126 . HN   1 1 
        337 1 2 1 1 127 SER H    . 127 . HN   1 1 
        338 1 1 1 1 126 ARG HA   . 126 . HA   1 1 
        338 1 2 1 1 127 SER H    . 127 . HN   1 1 
        339 1 1 1 1 126 ARG HB2  . 126 . HB2  1 1 
        339 1 2 1 1 127 SER H    . 127 . HN   1 1 
        340 1 1 1 1  41 ARG H    .  41 . HN   1 1 
        340 1 2 1 1  41 ARG HB2  .  41 . HB2  1 1 
        341 1 1 1 1  41 ARG H    .  41 . HN   1 1 
        341 1 2 1 1  41 ARG HB3  .  41 . HB1  1 1 
        342 1 1 1 1  40 ARG HB3  .  40 . HB1  1 1 
        342 1 2 1 1  41 ARG H    .  41 . HN   1 1 
        343 1 1 1 1 127 SER HB2  . 127 . HB2  1 1 
        343 1 2 1 1 128 ASP H    . 128 . HN   1 1 
        344 1 1 1 1 127 SER HB3  . 127 . HB1  1 1 
        344 1 2 1 1 128 ASP H    . 128 . HN   1 1 
        345 1 1 1 1 128 ASP H    . 128 . HN   1 1 
        345 1 2 1 1 129 GLY H    . 129 . HN   1 1 
        346 1 1 1 1 128 ASP HA   . 128 . HA   1 1 
        346 1 2 1 1 129 GLY H    . 129 . HN   1 1 
        347 1 1 1 1 128 ASP HB2  . 128 . HB2  1 1 
        347 1 2 1 1 129 GLY H    . 129 . HN   1 1 
        348 1 1 1 1 128 ASP HB3  . 128 . HB1  1 1 
        348 1 2 1 1 129 GLY H    . 129 . HN   1 1 
        349 1 1 1 1 130 VAL H    . 130 . HN   1 1 
        349 1 2 1 1 131 ASP H    . 131 . HN   1 1 
        350 1 1 1 1 130 VAL HA   . 130 . HA   1 1 
        350 1 2 1 1 131 ASP H    . 131 . HN   1 1 
        351 1 1 1 1 130 VAL HB   . 130 . HB   1 1 
        351 1 2 1 1 131 ASP H    . 131 . HN   1 1 
        352 1 1 1 1 130 VAL MG1  . 130 . HG1* 1 1 
        352 1 2 1 1 131 ASP H    . 131 . HN   1 1 
        353 1 1 1 1 130 VAL MG2  . 130 . HG2* 1 1 
        353 1 2 1 1 131 ASP H    . 131 . HN   1 1 
        354 1 1 1 1 131 ASP H    . 131 . HN   1 1 
        354 1 2 1 1 132 VAL H    . 132 . HN   1 1 
        355 1 1 1 1 131 ASP HA   . 131 . HA   1 1 
        355 1 2 1 1 132 VAL H    . 132 . HN   1 1 
        356 1 1 1 1 131 ASP HB3  . 131 . HB1  1 1 
        356 1 2 1 1 132 VAL H    . 132 . HN   1 1 
        357 1 1 1 1 131 ASP HB2  . 131 . HB2  1 1 
        357 1 2 1 1 132 VAL H    . 132 . HN   1 1 
        358 1 1 1 1 132 VAL HA   . 132 . HA   1 1 
        358 1 2 1 1 133 ARG H    . 133 . HN   1 1 
        359 1 1 1 1 132 VAL HB   . 132 . HB   1 1 
        359 1 2 1 1 133 ARG H    . 133 . HN   1 1 
        360 1 1 1 1 133 ARG HA   . 133 . HA   1 1 
        360 1 2 1 1 134 THR H    . 134 . HN   1 1 
        361 1 1 1 1 133 ARG HB3  . 133 . HB1  1 1 
        361 1 2 1 1 134 THR H    . 134 . HN   1 1 
        362 1 1 1 1 133 ARG HG2  . 133 . HG2  1 1 
        362 1 2 1 1 134 THR H    . 134 . HN   1 1 
        363 1 1 1 1 134 THR HA   . 134 . HA   1 1 
        363 1 2 1 1 135 VAL H    . 135 . HN   1 1 
        364 1 1 1 1 134 THR HB   . 134 . HB   1 1 
        364 1 2 1 1 135 VAL H    . 135 . HN   1 1 
        365 1 1 1 1 134 THR MG   . 134 . HG2* 1 1 
        365 1 2 1 1 135 VAL H    . 135 . HN   1 1 
        366 1 1 1 1 135 VAL HB   . 135 . HB   1 1 
        366 1 2 1 1 136 SER H    . 136 . HN   1 1 
        367 1 1 1 1 135 VAL MG2  . 135 . HG2* 1 1 
        367 1 2 1 1 136 SER H    . 136 . HN   1 1 
        368 1 1 1 1 135 VAL MG1  . 135 . HG1* 1 1 
        368 1 2 1 1 136 SER H    . 136 . HN   1 1 
        369 1 1 1 1 136 SER H    . 136 . HN   1 1 
        369 1 2 1 1 137 ASP H    . 137 . HN   1 1 
        370 1 1 1 1 136 SER HB3  . 136 . HB1  1 1 
        370 1 2 1 1 137 ASP H    . 137 . HN   1 1 
        371 1 1 1 1 137 ASP HA   . 137 . HA   1 1 
        371 1 2 1 1 138 LYS H    . 138 . HN   1 1 
        372 1 1 1 1 137 ASP HB3  . 137 . HB1  1 1 
        372 1 2 1 1 138 LYS H    . 138 . HN   1 1 
        373 1 1 1 1 137 ASP HB2  . 137 . HB2  1 1 
        373 1 2 1 1 138 LYS H    . 138 . HN   1 1 
        374 1 1 1 1 138 LYS HB3  . 138 . HB1  1 1 
        374 1 2 1 1 139 GLU H    . 139 . HN   1 1 
        375 1 1 1 1 139 GLU H    . 139 . HN   1 1 
        375 1 2 1 1 142 ILE HG12 . 142 . HG12 1 1 
        376 1 1 1 1 137 ASP HB3  . 137 . HB1  1 1 
        376 1 2 1 1 140 GLU H    . 140 . HN   1 1 
        377 1 1 1 1 139 GLU H    . 139 . HN   1 1 
        377 1 2 1 1 139 GLU HB2  . 139 . HB2  1 1 
        378 1 1 1 1 139 GLU H    . 139 . HN   1 1 
        378 1 2 1 1 139 GLU HB3  . 139 . HB1  1 1 
        379 1 1 1 1 140 GLU HB2  . 140 . HB2  1 1 
        379 1 2 1 1 141 LEU H    . 141 . HN   1 1 
        380 1 1 1 1 135 VAL HB   . 135 . HB   1 1 
        380 1 2 1 1 141 LEU H    . 141 . HN   1 1 
        381 1 1 1 1 141 LEU HG   . 141 . HG   1 1 
        381 1 2 1 1 142 ILE H    . 142 . HN   1 1 
        382 1 1 1 1  61 LYS H    .  61 . HN   1 1 
        382 1 2 1 1  61 LYS HG3  .  61 . HG1  1 1 
        383 1 1 1 1 141 LEU MD2  . 141 . HD2* 1 1 
        383 1 2 1 1 142 ILE H    . 142 . HN   1 1 
        384 1 1 1 1 142 ILE MG   . 142 . HG2* 1 1 
        384 1 2 1 1 143 GLU H    . 143 . HN   1 1 
        385 1 1 1 1 142 ILE HG12 . 142 . HG12 1 1 
        385 1 2 1 1 143 GLU H    . 143 . HN   1 1 
        386 1 1 1 1 142 ILE MD   . 142 . HD1* 1 1 
        386 1 2 1 1 143 GLU H    . 143 . HN   1 1 
        387 1 1 1 1 143 GLU H    . 143 . HN   1 1 
        387 1 2 1 1 144 GLN H    . 144 . HN   1 1 
        388 1 1 1 1 143 GLU HB3  . 143 . HB1  1 1 
        388 1 2 1 1 144 GLN H    . 144 . HN   1 1 
        389 1 1 1 1 143 GLU HG3  . 143 . HG1  1 1 
        389 1 2 1 1 144 GLN H    . 144 . HN   1 1 
        390 1 1 1 1 144 GLN HB2  . 144 . HB2  1 1 
        390 1 2 1 1 145 VAL H    . 145 . HN   1 1 
        391 1 1 1 1 144 GLN HG2  . 144 . HG2  1 1 
        391 1 2 1 1 145 VAL H    . 145 . HN   1 1 
        392 1 1 1 1 145 VAL HB   . 145 . HB   1 1 
        392 1 2 1 1 146 ARG H    . 146 . HN   1 1 
        393 1 1 1 1 145 VAL MG1  . 145 . HG1* 1 1 
        393 1 2 1 1 146 ARG H    . 146 . HN   1 1 
        394 1 1 1 1 145 VAL MG2  . 145 . HG2* 1 1 
        394 1 2 1 1 146 ARG H    . 146 . HN   1 1 
        395 1 1 1 1 146 ARG H    . 146 . HN   1 1 
        395 1 2 1 1 147 ARG H    . 147 . HN   1 1 
        396 1 1 1 1 146 ARG HG3  . 146 . HG1  1 1 
        396 1 2 1 1 147 ARG H    . 147 . HN   1 1 
        397 1 1 1 1 146 ARG HG2  . 146 . HG2  1 1 
        397 1 2 1 1 147 ARG H    . 147 . HN   1 1 
        398 1 1 1 1 147 ARG H    . 147 . HN   1 1 
        398 1 2 1 1 148 PHE H    . 148 . HN   1 1 
        399 1 1 1 1 147 ARG HG2  . 147 . HG2  1 1 
        399 1 2 1 1 148 PHE H    . 148 . HN   1 1 
        400 1 1 1 1 147 ARG HB2  . 147 . HB2  1 1 
        400 1 2 1 1 148 PHE H    . 148 . HN   1 1 
        401 1 1 1 1 148 PHE HB2  . 148 . HB2  1 1 
        401 1 2 1 1 149 VAL H    . 149 . HN   1 1 
        402 1 1 1 1 148 PHE HB3  . 148 . HB1  1 1 
        402 1 2 1 1 149 VAL H    . 149 . HN   1 1 
        403 1 1 1 1 148 PHE QD   . 148 . HD*  1 1 
        403 1 2 1 1 149 VAL H    . 149 . HN   1 1 
        404 1 1 1 1 149 VAL H    . 149 . HN   1 1 
        404 1 2 1 1 150 ARG H    . 150 . HN   1 1 
        405 1 1 1 1 149 VAL HB   . 149 . HB   1 1 
        405 1 2 1 1 150 ARG H    . 150 . HN   1 1 
        406 1 1 1 1 150 ARG H    . 150 . HN   1 1 
        406 1 2 1 1 151 LYS H    . 151 . HN   1 1 
        407 1 1 1 1 150 ARG HA   . 150 . HA   1 1 
        407 1 2 1 1 151 LYS H    . 151 . HN   1 1 
        408 1 1 1 1 150 ARG HB2  . 150 . HB2  1 1 
        408 1 2 1 1 151 LYS H    . 151 . HN   1 1 
        409 1 1 1 1 150 ARG HG2  . 150 . HG2  1 1 
        409 1 2 1 1 151 LYS H    . 151 . HN   1 1 
        410 1 1 1 1 151 LYS H    . 151 . HN   1 1 
        410 1 2 1 1 151 LYS HD3  . 151 . HD1  1 1 
        411 1 1 1 1 151 LYS HG2  . 151 . HG2  1 1 
        411 1 2 1 1 152 VAL H    . 152 . HN   1 1 
        412 1 1 1 1 152 VAL HA   . 152 . HA   1 1 
        412 1 2 1 1 153 GLY H    . 153 . HN   1 1 
        413 1 1 1 1 152 VAL HB   . 152 . HB   1 1 
        413 1 2 1 1 153 GLY H    . 153 . HN   1 1 
        414 1 1 1 1 152 VAL MG1  . 152 . HG1* 1 1 
        414 1 2 1 1 153 GLY H    . 153 . HN   1 1 
        415 1 1 1 1 152 VAL MG2  . 152 . HG2* 1 1 
        415 1 2 1 1 153 GLY H    . 153 . HN   1 1 
        416 1 1 1 1 153 GLY H    . 153 . HN   1 1 
        416 1 2 1 1 154 SER H    . 154 . HN   1 1 
        417 1 1 1 1 154 SER HA   . 154 . HA   1 1 
        417 1 2 1 1 155 LEU H    . 155 . HN   1 1 
        418 1 1 1 1 154 SER HB3  . 154 . HB1  1 1 
        418 1 2 1 1 155 LEU H    . 155 . HN   1 1 
        419 1 1 1 1 155 LEU HA   . 155 . HA   1 1 
        419 1 2 1 1 156 GLU H    . 156 . HN   1 1 
        420 1 1 1 1 155 LEU HB3  . 155 . HB1  1 1 
        420 1 2 1 1 156 GLU H    . 156 . HN   1 1 
        421 1 1 1 1 155 LEU HB2  . 155 . HB2  1 1 
        421 1 2 1 1 156 GLU H    . 156 . HN   1 1 
        422 1 1 1 1 155 LEU MD1  . 155 . HD1* 1 1 
        422 1 2 1 1 156 GLU H    . 156 . HN   1 1 
        423 1 1 1 1 155 LEU MD2  . 155 . HD2* 1 1 
        423 1 2 1 1 156 GLU H    . 156 . HN   1 1 
        424 1 1 1 1 156 GLU HB2  . 156 . HB2  1 1 
        424 1 2 1 1 157 HIS H    . 157 . HN   1 1 
        425 1 1 1 1 156 GLU HB3  . 156 . HB1  1 1 
        425 1 2 1 1 157 HIS H    . 157 . HN   1 1 
        426 1 1 1 1 111 ASN HA   . 111 . HA   1 1 
        426 1 2 1 1 111 ASN HD22 . 111 . HD22 1 1 
        427 1 1 1 1 111 ASN HD22 . 111 . HD22 1 1 
        427 1 2 1 1 135 VAL HB   . 135 . HB   1 1 
        428 1 1 1 1 111 ASN HA   . 111 . HA   1 1 
        428 1 2 1 1 111 ASN HD21 . 111 . HD21 1 1 
        429 1 1 1 1 112 ASN HA   . 112 . HA   1 1 
        429 1 2 1 1 112 ASN HD22 . 112 . HD22 1 1 
        430 1 1 1 1  25 GLN H    .  25 . HN   1 1 
        430 1 2 1 1  25 GLN HE21 .  25 . HE21 1 1 
        431 1 1 1 1  25 GLN H    .  25 . HN   1 1 
        431 1 2 1 1  25 GLN HE22 .  25 . HE22 1 1 
        432 1 1 1 1  25 GLN HA   .  25 . HA   1 1 
        432 1 2 1 1  25 GLN HE22 .  25 . HE22 1 1 
        433 1 1 1 1  25 GLN HB3  .  25 . HB1  1 1 
        433 1 2 1 1  25 GLN HE22 .  25 . HE22 1 1 
        434 1 1 1 1  24 ARG HB2  .  24 . HB2  1 1 
        434 1 2 1 1  25 GLN HE22 .  25 . HE22 1 1 
        435 1 1 1 1  24 ARG HB3  .  24 . HB1  1 1 
        435 1 2 1 1  25 GLN HE22 .  25 . HE22 1 1 
        436 1 1 1 1  25 GLN HE22 .  25 . HE22 1 1 
        436 1 2 1 1 146 ARG HB2  . 146 . HB2  1 1 
        437 1 1 1 1  25 GLN HE22 .  25 . HE22 1 1 
        437 1 2 1 1  25 GLN HG2  .  25 . HG2  1 1 
        438 1 1 1 1  36 GLN HA   .  36 . HA   1 1 
        438 1 2 1 1  36 GLN HE21 .  36 . HE21 1 1 
        439 1 1 1 1  36 GLN HA   .  36 . HA   1 1 
        439 1 2 1 1  36 GLN HE22 .  36 . HE22 1 1 
        440 1 1 1 1  51 GLN H    .  51 . HN   1 1 
        440 1 2 1 1  51 GLN HE21 .  51 . HE21 1 1 
        441 1 1 1 1  51 GLN HB3  .  51 . HB1  1 1 
        441 1 2 1 1  51 GLN HE21 .  51 . HE21 1 1 
        442 1 1 1 1  51 GLN H    .  51 . HN   1 1 
        442 1 2 1 1  51 GLN HE22 .  51 . HE22 1 1 
        443 1 1 1 1  51 GLN HB2  .  51 . HB2  1 1 
        443 1 2 1 1  51 GLN HE22 .  51 . HE22 1 1 
        444 1 1 1 1  51 GLN HB3  .  51 . HB1  1 1 
        444 1 2 1 1  51 GLN HE22 .  51 . HE22 1 1 
        445 1 1 1 1  51 GLN HE22 .  51 . HE22 1 1 
        445 1 2 1 1  51 GLN HG2  .  51 . HG2  1 1 
        446 1 1 1 1  51 GLN HE22 .  51 . HE22 1 1 
        446 1 2 1 1  51 GLN HG3  .  51 . HG1  1 1 
        447 1 1 1 1 123 GLN HA   . 123 . HA   1 1 
        447 1 2 1 1 123 GLN HE21 . 123 . HE21 1 1 
        448 1 1 1 1 123 GLN HA   . 123 . HA   1 1 
        448 1 2 1 1 123 GLN HE22 . 123 . HE22 1 1 
        449 1 1 1 1 144 GLN H    . 144 . HN   1 1 
        449 1 2 1 1 144 GLN HE22 . 144 . HE22 1 1 
        450 1 1 1 1 144 GLN HA   . 144 . HA   1 1 
        450 1 2 1 1 144 GLN HE22 . 144 . HE22 1 1 
        451 1 1 1 1 144 GLN HB2  . 144 . HB2  1 1 
        451 1 2 1 1 144 GLN HE22 . 144 . HE22 1 1 
        452 1 1 1 1 144 GLN HE22 . 144 . HE22 1 1 
        452 1 2 1 1 144 GLN HG2  . 144 . HG2  1 1 
        453 1 1 1 1  72 TRP HE1  .  72 . HE1  1 1 
        453 1 2 1 1 102 ARG HE   . 102 . HE   1 1 
        454 1 1 1 1  91 TRP HA   .  91 . HA   1 1 
        454 1 2 1 1  91 TRP HE1  .  91 . HE1  1 1 
        455 1 1 1 1  91 TRP HB2  .  91 . HB2  1 1 
        455 1 2 1 1  91 TRP HE1  .  91 . HE1  1 1 
        456 1 1 1 1   3 GLN H    .   3 . HN   1 1 
        456 1 2 1 1   3 GLN HB3  .   3 . HB1  1 1 
        457 1 1 1 1   4 ILE H    .   4 . HN   1 1 
        457 1 2 1 1   4 ILE HB   .   4 . HB   1 1 
        458 1 1 1 1   4 ILE H    .   4 . HN   1 1 
        458 1 2 1 1   4 ILE MG   .   4 . HG2* 1 1 
        459 1 1 1 1  45 LEU HB2  .  45 . HB2  1 1 
        459 1 2 1 1  49 GLU H    .  49 . HN   1 1 
        460 1 1 1 1   4 ILE H    .   4 . HN   1 1 
        460 1 2 1 1  78 LEU MD1  .  78 . HD1* 1 1 
        461 1 1 1 1   5 PHE H    .   5 . HN   1 1 
        461 1 2 1 1   5 PHE QD   .   5 . HD*  1 1 
        462 1 1 1 1   6 VAL H    .   6 . HN   1 1 
        462 1 2 1 1   6 VAL MG2  .   6 . HG2* 1 1 
        463 1 1 1 1   7 VAL H    .   7 . HN   1 1 
        463 1 2 1 1   7 VAL HB   .   7 . HB   1 1 
        464 1 1 1 1   7 VAL H    .   7 . HN   1 1 
        464 1 2 1 1   7 VAL MG2  .   7 . HG2* 1 1 
        465 1 1 1 1   8 PHE H    .   8 . HN   1 1 
        465 1 2 1 1   8 PHE HB2  .   8 . HB2  1 1 
        466 1 1 1 1   8 PHE H    .   8 . HN   1 1 
        466 1 2 1 1   8 PHE HB3  .   8 . HB1  1 1 
        467 1 1 1 1   9 SER H    .   9 . HN   1 1 
        467 1 2 1 1   9 SER HB3  .   9 . HB1  1 1 
        468 1 1 1 1  11 ASP H    .  11 . HN   1 1 
        468 1 2 1 1  11 ASP HB2  .  11 . HB2  1 1 
        469 1 1 1 1  11 ASP H    .  11 . HN   1 1 
        469 1 2 1 1  11 ASP HB3  .  11 . HB1  1 1 
        470 1 1 1 1  12 PRO HG2  .  12 . HG2  1 1 
        470 1 2 1 1  13 GLU H    .  13 . HN   1 1 
        471 1 1 1 1  13 GLU H    .  13 . HN   1 1 
        471 1 2 1 1  13 GLU HB2  .  13 . HB2  1 1 
        472 1 1 1 1  13 GLU H    .  13 . HN   1 1 
        472 1 2 1 1  13 GLU HG2  .  13 . HG2  1 1 
        473 1 1 1 1  13 GLU H    .  13 . HN   1 1 
        473 1 2 1 1  13 GLU HG3  .  13 . HG1  1 1 
        474 1 1 1 1  14 ILE H    .  14 . HN   1 1 
        474 1 2 1 1  14 ILE HB   .  14 . HB   1 1 
        475 1 1 1 1  14 ILE H    .  14 . HN   1 1 
        475 1 2 1 1  14 ILE MG   .  14 . HG2* 1 1 
        476 1 1 1 1  14 ILE H    .  14 . HN   1 1 
        476 1 2 1 1  14 ILE HG12 .  14 . HG12 1 1 
        477 1 1 1 1  14 ILE H    .  14 . HN   1 1 
        477 1 2 1 1  14 ILE MD   .  14 . HD1* 1 1 
        478 1 1 1 1  15 LEU H    .  15 . HN   1 1 
        478 1 2 1 1  15 LEU HB3  .  15 . HB1  1 1 
        479 1 1 1 1  15 LEU H    .  15 . HN   1 1 
        479 1 2 1 1  15 LEU HB2  .  15 . HB2  1 1 
        480 1 1 1 1  15 LEU H    .  15 . HN   1 1 
        480 1 2 1 1  15 LEU HG   .  15 . HG   1 1 
        481 1 1 1 1  16 LYS H    .  16 . HN   1 1 
        481 1 2 1 1  16 LYS HB2  .  16 . HB2  1 1 
        482 1 1 1 1  16 LYS H    .  16 . HN   1 1 
        482 1 2 1 1  16 LYS HB3  .  16 . HB1  1 1 
        483 1 1 1 1  15 LEU HG   .  15 . HG   1 1 
        483 1 2 1 1  16 LYS H    .  16 . HN   1 1 
        484 1 1 1 1  16 LYS H    .  16 . HN   1 1 
        484 1 2 1 1  16 LYS HG3  .  16 . HG1  1 1 
        485 1 1 1 1  16 LYS H    .  16 . HN   1 1 
        485 1 2 1 1  18 ILE HG13 .  18 . HG11 1 1 
        486 1 1 1 1  17 GLU H    .  17 . HN   1 1 
        486 1 2 1 1  17 GLU HB2  .  17 . HB2  1 1 
        487 1 1 1 1  17 GLU H    .  17 . HN   1 1 
        487 1 2 1 1  17 GLU HB3  .  17 . HB1  1 1 
        488 1 1 1 1  17 GLU H    .  17 . HN   1 1 
        488 1 2 1 1  17 GLU HG3  .  17 . HG1  1 1 
        489 1 1 1 1  17 GLU H    .  17 . HN   1 1 
        489 1 2 1 1  17 GLU HG2  .  17 . HG2  1 1 
        490 1 1 1 1  18 ILE H    .  18 . HN   1 1 
        490 1 2 1 1  18 ILE HB   .  18 . HB   1 1 
        491 1 1 1 1  18 ILE H    .  18 . HN   1 1 
        491 1 2 1 1  18 ILE MG   .  18 . HG2* 1 1 
        492 1 1 1 1  18 ILE H    .  18 . HN   1 1 
        492 1 2 1 1  18 ILE HG13 .  18 . HG11 1 1 
        493 1 1 1 1  18 ILE H    .  18 . HN   1 1 
        493 1 2 1 1  18 ILE HG12 .  18 . HG12 1 1 
        494 1 1 1 1  18 ILE H    .  18 . HN   1 1 
        494 1 2 1 1  18 ILE MD   .  18 . HD1* 1 1 
        495 1 1 1 1  18 ILE H    .  18 . HN   1 1 
        495 1 2 1 1 142 ILE MD   . 142 . HD1* 1 1 
        496 1 1 1 1  19 VAL H    .  19 . HN   1 1 
        496 1 2 1 1  19 VAL HB   .  19 . HB   1 1 
        497 1 1 1 1  19 VAL H    .  19 . HN   1 1 
        497 1 2 1 1  19 VAL MG1  .  19 . HG1* 1 1 
        498 1 1 1 1  19 VAL H    .  19 . HN   1 1 
        498 1 2 1 1  19 VAL MG2  .  19 . HG2* 1 1 
        499 1 1 1 1  20 ARG H    .  20 . HN   1 1 
        499 1 2 1 1  20 ARG HB3  .  20 . HB1  1 1 
        500 1 1 1 1  20 ARG H    .  20 . HN   1 1 
        500 1 2 1 1  20 ARG HG2  .  20 . HG2  1 1 
        501 1 1 1 1  20 ARG H    .  20 . HN   1 1 
        501 1 2 1 1  20 ARG HG3  .  20 . HG1  1 1 
        502 1 1 1 1  21 GLU H    .  21 . HN   1 1 
        502 1 2 1 1  21 GLU HB2  .  21 . HB2  1 1 
        503 1 1 1 1  21 GLU H    .  21 . HN   1 1 
        503 1 2 1 1  21 GLU HB3  .  21 . HB1  1 1 
        504 1 1 1 1  21 GLU H    .  21 . HN   1 1 
        504 1 2 1 1  21 GLU HG2  .  21 . HG2  1 1 
        505 1 1 1 1  21 GLU H    .  21 . HN   1 1 
        505 1 2 1 1  21 GLU HG3  .  21 . HG1  1 1 
        506 1 1 1 1  22 ILE H    .  22 . HN   1 1 
        506 1 2 1 1  22 ILE HB   .  22 . HB   1 1 
        507 1 1 1 1  22 ILE H    .  22 . HN   1 1 
        507 1 2 1 1  22 ILE HG12 .  22 . HG12 1 1 
        508 1 1 1 1  22 ILE H    .  22 . HN   1 1 
        508 1 2 1 1  22 ILE HG13 .  22 . HG11 1 1 
        509 1 1 1 1  22 ILE H    .  22 . HN   1 1 
        509 1 2 1 1  22 ILE MD   .  22 . HD1* 1 1 
        510 1 1 1 1  23 LYS H    .  23 . HN   1 1 
        510 1 2 1 1  23 LYS HB2  .  23 . HB2  1 1 
        511 1 1 1 1  23 LYS H    .  23 . HN   1 1 
        511 1 2 1 1  23 LYS HG2  .  23 . HG2  1 1 
        512 1 1 1 1  23 LYS H    .  23 . HN   1 1 
        512 1 2 1 1  29 VAL HB   .  29 . HB   1 1 
        513 1 1 1 1  23 LYS H    .  23 . HN   1 1 
        513 1 2 1 1  23 LYS HG3  .  23 . HG1  1 1 
        514 1 1 1 1  24 ARG H    .  24 . HN   1 1 
        514 1 2 1 1  24 ARG HG2  .  24 . HG2  1 1 
        515 1 1 1 1  24 ARG H    .  24 . HN   1 1 
        515 1 2 1 1  24 ARG HG3  .  24 . HG1  1 1 
        516 1 1 1 1  25 GLN H    .  25 . HN   1 1 
        516 1 2 1 1  25 GLN HB3  .  25 . HB1  1 1 
        517 1 1 1 1  25 GLN H    .  25 . HN   1 1 
        517 1 2 1 1  25 GLN HB2  .  25 . HB2  1 1 
        518 1 1 1 1  25 GLN H    .  25 . HN   1 1 
        518 1 2 1 1  25 GLN HG2  .  25 . HG2  1 1 
        519 1 1 1 1  27 VAL H    .  27 . HN   1 1 
        519 1 2 1 1  27 VAL HB   .  27 . HB   1 1 
        520 1 1 1 1  27 VAL H    .  27 . HN   1 1 
        520 1 2 1 1  27 VAL MG2  .  27 . HG2* 1 1 
        521 1 1 1 1  28 ARG H    .  28 . HN   1 1 
        521 1 2 1 1  28 ARG HB3  .  28 . HB1  1 1 
        522 1 1 1 1  28 ARG H    .  28 . HN   1 1 
        522 1 2 1 1  28 ARG HB2  .  28 . HB2  1 1 
        523 1 1 1 1  29 VAL H    .  29 . HN   1 1 
        523 1 2 1 1  29 VAL HB   .  29 . HB   1 1 
        524 1 1 1 1  29 VAL H    .  29 . HN   1 1 
        524 1 2 1 1  29 VAL MG1  .  29 . HG1* 1 1 
        525 1 1 1 1  29 VAL H    .  29 . HN   1 1 
        525 1 2 1 1  30 VAL MG2  .  30 . HG2* 1 1 
        526 1 1 1 1  29 VAL H    .  29 . HN   1 1 
        526 1 2 1 1  29 VAL MG2  .  29 . HG2* 1 1 
        527 1 1 1 1  30 VAL H    .  30 . HN   1 1 
        527 1 2 1 1  30 VAL HB   .  30 . HB   1 1 
        528 1 1 1 1  30 VAL H    .  30 . HN   1 1 
        528 1 2 1 1  82 VAL MG2  .  82 . HG2* 1 1 
        529 1 1 1 1  29 VAL MG1  .  29 . HG1* 1 1 
        529 1 2 1 1  30 VAL H    .  30 . HN   1 1 
        530 1 1 1 1  30 VAL H    .  30 . HN   1 1 
        530 1 2 1 1  30 VAL MG2  .  30 . HG2* 1 1 
        531 1 1 1 1  31 LEU H    .  31 . HN   1 1 
        531 1 2 1 1  31 LEU HB3  .  31 . HB1  1 1 
        532 1 1 1 1  31 LEU H    .  31 . HN   1 1 
        532 1 2 1 1  31 LEU HG   .  31 . HG   1 1 
        533 1 1 1 1  31 LEU H    .  31 . HN   1 1 
        533 1 2 1 1  31 LEU MD2  .  31 . HD2* 1 1 
        534 1 1 1 1  32 LEU H    .  32 . HN   1 1 
        534 1 2 1 1  32 LEU HB3  .  32 . HB1  1 1 
        535 1 1 1 1  32 LEU H    .  32 . HN   1 1 
        535 1 2 1 1  32 LEU HB2  .  32 . HB2  1 1 
        536 1 1 1 1  32 LEU H    .  32 . HN   1 1 
        536 1 2 1 1  32 LEU HG   .  32 . HG   1 1 
        537 1 1 1 1  32 LEU H    .  32 . HN   1 1 
        537 1 2 1 1  32 LEU MD1  .  32 . HD1* 1 1 
        538 1 1 1 1  32 LEU H    .  32 . HN   1 1 
        538 1 2 1 1  32 LEU MD2  .  32 . HD2* 1 1 
        539 1 1 1 1  33 TYR H    .  33 . HN   1 1 
        539 1 2 1 1  33 TYR HB3  .  33 . HB1  1 1 
        540 1 1 1 1  33 TYR H    .  33 . HN   1 1 
        540 1 2 1 1  33 TYR HB2  .  33 . HB2  1 1 
        541 1 1 1 1  33 TYR H    .  33 . HN   1 1 
        541 1 2 1 1  33 TYR QD   .  33 . HD*  1 1 
        542 1 1 1 1  35 ASP H    .  35 . HN   1 1 
        542 1 2 1 1  35 ASP HB2  .  35 . HB2  1 1 
        543 1 1 1 1  35 ASP H    .  35 . HN   1 1 
        543 1 2 1 1  35 ASP HB3  .  35 . HB1  1 1 
        544 1 1 1 1  35 ASP HB2  .  35 . HB2  1 1 
        544 1 2 1 1  36 GLN H    .  36 . HN   1 1 
        545 1 1 1 1  37 ASP H    .  37 . HN   1 1 
        545 1 2 1 1  37 ASP HB2  .  37 . HB2  1 1 
        546 1 1 1 1  37 ASP H    .  37 . HN   1 1 
        546 1 2 1 1  37 ASP HB3  .  37 . HB1  1 1 
        547 1 1 1 1  38 GLU H    .  38 . HN   1 1 
        547 1 2 1 1  38 GLU HB2  .  38 . HB2  1 1 
        548 1 1 1 1  38 GLU H    .  38 . HN   1 1 
        548 1 2 1 1  38 GLU HG2  .  38 . HG2  1 1 
        549 1 1 1 1  39 LYS H    .  39 . HN   1 1 
        549 1 2 1 1  39 LYS HG2  .  39 . HG2  1 1 
        550 1 1 1 1 145 VAL H    . 145 . HN   1 1 
        550 1 2 1 1 146 ARG HG3  . 146 . HG1  1 1 
        551 1 1 1 1  39 LYS H    .  39 . HN   1 1 
        551 1 2 1 1  39 LYS HG3  .  39 . HG1  1 1 
        552 1 1 1 1  39 LYS H    .  39 . HN   1 1 
        552 1 2 1 1  39 LYS HD2  .  39 . HD2  1 1 
        553 1 1 1 1  39 LYS H    .  39 . HN   1 1 
        553 1 2 1 1  39 LYS HD3  .  39 . HD1  1 1 
        554 1 1 1 1 142 ILE HB   . 142 . HB   1 1 
        554 1 2 1 1 143 GLU H    . 143 . HN   1 1 
        555 1 1 1 1  40 ARG H    .  40 . HN   1 1 
        555 1 2 1 1  40 ARG HB3  .  40 . HB1  1 1 
        556 1 1 1 1  37 ASP HB2  .  37 . HB2  1 1 
        556 1 2 1 1  40 ARG H    .  40 . HN   1 1 
        557 1 1 1 1  41 ARG H    .  41 . HN   1 1 
        557 1 2 1 1  41 ARG HG2  .  41 . HG2  1 1 
        558 1 1 1 1  41 ARG H    .  41 . HN   1 1 
        558 1 2 1 1  41 ARG HG3  .  41 . HG1  1 1 
        559 1 1 1 1  42 ARG H    .  42 . HN   1 1 
        559 1 2 1 1  42 ARG HB2  .  42 . HB2  1 1 
        560 1 1 1 1  42 ARG H    .  42 . HN   1 1 
        560 1 2 1 1  42 ARG HB3  .  42 . HB1  1 1 
        561 1 1 1 1  42 ARG H    .  42 . HN   1 1 
        561 1 2 1 1  45 LEU HG   .  45 . HG   1 1 
        562 1 1 1 1  43 GLU H    .  43 . HN   1 1 
        562 1 2 1 1  43 GLU HB3  .  43 . HB1  1 1 
        563 1 1 1 1  44 ARG H    .  44 . HN   1 1 
        563 1 2 1 1  44 ARG HB3  .  44 . HB1  1 1 
        564 1 1 1 1  44 ARG H    .  44 . HN   1 1 
        564 1 2 1 1  44 ARG HB2  .  44 . HB2  1 1 
        565 1 1 1 1  44 ARG H    .  44 . HN   1 1 
        565 1 2 1 1  44 ARG HG3  .  44 . HG1  1 1 
        566 1 1 1 1  44 ARG H    .  44 . HN   1 1 
        566 1 2 1 1  44 ARG HG2  .  44 . HG2  1 1 
        567 1 1 1 1  44 ARG H    .  44 . HN   1 1 
        567 1 2 1 1  44 ARG HD3  .  44 . HD1  1 1 
        568 1 1 1 1  45 LEU H    .  45 . HN   1 1 
        568 1 2 1 1  45 LEU HB2  .  45 . HB2  1 1 
        569 1 1 1 1  45 LEU H    .  45 . HN   1 1 
        569 1 2 1 1  45 LEU HB3  .  45 . HB1  1 1 
        570 1 1 1 1  45 LEU H    .  45 . HN   1 1 
        570 1 2 1 1  45 LEU HG   .  45 . HG   1 1 
        571 1 1 1 1  45 LEU H    .  45 . HN   1 1 
        571 1 2 1 1  45 LEU MD1  .  45 . HD1* 1 1 
        572 1 1 1 1  45 LEU H    .  45 . HN   1 1 
        572 1 2 1 1  45 LEU MD2  .  45 . HD2* 1 1 
        573 1 1 1 1  46 GLU H    .  46 . HN   1 1 
        573 1 2 1 1  46 GLU HB3  .  46 . HB1  1 1 
        574 1 1 1 1  46 GLU H    .  46 . HN   1 1 
        574 1 2 1 1  46 GLU HG2  .  46 . HG2  1 1 
        575 1 1 1 1  47 GLU H    .  47 . HN   1 1 
        575 1 2 1 1  47 GLU HB2  .  47 . HB2  1 1 
        576 1 1 1 1  47 GLU H    .  47 . HN   1 1 
        576 1 2 1 1  47 GLU HG2  .  47 . HG2  1 1 
        577 1 1 1 1  47 GLU H    .  47 . HN   1 1 
        577 1 2 1 1  47 GLU HG3  .  47 . HG1  1 1 
        578 1 1 1 1  48 PHE H    .  48 . HN   1 1 
        578 1 2 1 1  48 PHE HB2  .  48 . HB2  1 1 
        579 1 1 1 1  48 PHE H    .  48 . HN   1 1 
        579 1 2 1 1  48 PHE HB3  .  48 . HB1  1 1 
        580 1 1 1 1  48 PHE H    .  48 . HN   1 1 
        580 1 2 1 1  48 PHE QD   .  48 . HD*  1 1 
        581 1 1 1 1  49 GLU H    .  49 . HN   1 1 
        581 1 2 1 1  49 GLU HG3  .  49 . HG1  1 1 
        582 1 1 1 1  49 GLU H    .  49 . HN   1 1 
        582 1 2 1 1  49 GLU HG2  .  49 . HG2  1 1 
        583 1 1 1 1  50 LYS H    .  50 . HN   1 1 
        583 1 2 1 1  50 LYS HB3  .  50 . HB1  1 1 
        584 1 1 1 1  50 LYS H    .  50 . HN   1 1 
        584 1 2 1 1  50 LYS HG2  .  50 . HG2  1 1 
        585 1 1 1 1  50 LYS H    .  50 . HN   1 1 
        585 1 2 1 1  50 LYS HG3  .  50 . HG1  1 1 
        586 1 1 1 1  48 PHE HB2  .  48 . HB2  1 1 
        586 1 2 1 1  50 LYS H    .  50 . HN   1 1 
        587 1 1 1 1  50 LYS H    .  50 . HN   1 1 
        587 1 2 1 1  50 LYS HE2  .  50 . HE2  1 1 
        588 1 1 1 1  50 LYS H    .  50 . HN   1 1 
        588 1 2 1 1  50 LYS HE3  .  50 . HE1  1 1 
        589 1 1 1 1  51 GLN H    .  51 . HN   1 1 
        589 1 2 1 1  51 GLN HB2  .  51 . HB2  1 1 
        590 1 1 1 1  51 GLN H    .  51 . HN   1 1 
        590 1 2 1 1  51 GLN HG2  .  51 . HG2  1 1 
        591 1 1 1 1  51 GLN H    .  51 . HN   1 1 
        591 1 2 1 1  51 GLN HG3  .  51 . HG1  1 1 
        592 1 1 1 1  53 VAL H    .  53 . HN   1 1 
        592 1 2 1 1  53 VAL HB   .  53 . HB   1 1 
        593 1 1 1 1  53 VAL H    .  53 . HN   1 1 
        593 1 2 1 1  53 VAL MG2  .  53 . HG2* 1 1 
        594 1 1 1 1  54 ASP H    .  54 . HN   1 1 
        594 1 2 1 1  54 ASP HB3  .  54 . HB1  1 1 
        595 1 1 1 1  54 ASP H    .  54 . HN   1 1 
        595 1 2 1 1  54 ASP HB2  .  54 . HB2  1 1 
        596 1 1 1 1  55 VAL H    .  55 . HN   1 1 
        596 1 2 1 1  55 VAL HB   .  55 . HB   1 1 
        597 1 1 1 1  55 VAL H    .  55 . HN   1 1 
        597 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
        598 1 1 1 1  32 LEU HA   .  32 . HA   1 1 
        598 1 2 1 1  56 ARG H    .  56 . HN   1 1 
        599 1 1 1 1  56 ARG H    .  56 . HN   1 1 
        599 1 2 1 1  56 ARG HB2  .  56 . HB2  1 1 
        600 1 1 1 1  56 ARG H    .  56 . HN   1 1 
        600 1 2 1 1  56 ARG HB3  .  56 . HB1  1 1 
        601 1 1 1 1  32 LEU HG   .  32 . HG   1 1 
        601 1 2 1 1  83 ILE H    .  83 . HN   1 1 
        602 1 1 1 1  56 ARG H    .  56 . HN   1 1 
        602 1 2 1 1  56 ARG HD2  .  56 . HD2  1 1 
        603 1 1 1 1  56 ARG H    .  56 . HN   1 1 
        603 1 2 1 1  56 ARG HD3  .  56 . HD1  1 1 
        604 1 1 1 1  56 ARG HA   .  56 . HA   1 1 
        604 1 2 1 1  57 THR H    .  57 . HN   1 1 
        605 1 1 1 1  57 THR H    .  57 . HN   1 1 
        605 1 2 1 1  57 THR MG   .  57 . HG2* 1 1 
        606 1 1 1 1  58 VAL H    .  58 . HN   1 1 
        606 1 2 1 1  58 VAL HB   .  58 . HB   1 1 
        607 1 1 1 1  58 VAL H    .  58 . HN   1 1 
        607 1 2 1 1  58 VAL MG1  .  58 . HG1* 1 1 
        608 1 1 1 1  58 VAL H    .  58 . HN   1 1 
        608 1 2 1 1  58 VAL MG2  .  58 . HG2* 1 1 
        609 1 1 1 1  59 GLU H    .  59 . HN   1 1 
        609 1 2 1 1  59 GLU HB2  .  59 . HB2  1 1 
        610 1 1 1 1  58 VAL HB   .  58 . HB   1 1 
        610 1 2 1 1  59 GLU H    .  59 . HN   1 1 
        611 1 1 1 1  59 GLU H    .  59 . HN   1 1 
        611 1 2 1 1  59 GLU HB3  .  59 . HB1  1 1 
        612 1 1 1 1  59 GLU H    .  59 . HN   1 1 
        612 1 2 1 1  59 GLU HG2  .  59 . HG2  1 1 
        613 1 1 1 1  59 GLU H    .  59 . HN   1 1 
        613 1 2 1 1  59 GLU HG3  .  59 . HG1  1 1 
        614 1 1 1 1  60 ASP H    .  60 . HN   1 1 
        614 1 2 1 1  60 ASP HB2  .  60 . HB2  1 1 
        615 1 1 1 1  60 ASP H    .  60 . HN   1 1 
        615 1 2 1 1  60 ASP HB3  .  60 . HB1  1 1 
        616 1 1 1 1  61 LYS H    .  61 . HN   1 1 
        616 1 2 1 1  61 LYS HG2  .  61 . HG2  1 1 
        617 1 1 1 1  62 GLU H    .  62 . HN   1 1 
        617 1 2 1 1  62 GLU HB2  .  62 . HB2  1 1 
        618 1 1 1 1  63 ASP H    .  63 . HN   1 1 
        618 1 2 1 1  63 ASP HB2  .  63 . HB2  1 1 
        619 1 1 1 1  63 ASP H    .  63 . HN   1 1 
        619 1 2 1 1  63 ASP HB3  .  63 . HB1  1 1 
        620 1 1 1 1  64 PHE H    .  64 . HN   1 1 
        620 1 2 1 1  64 PHE HB3  .  64 . HB1  1 1 
        621 1 1 1 1  64 PHE H    .  64 . HN   1 1 
        621 1 2 1 1  64 PHE QD   .  64 . HD*  1 1 
        622 1 1 1 1  65 ARG H    .  65 . HN   1 1 
        622 1 2 1 1  65 ARG HB3  .  65 . HB1  1 1 
        623 1 1 1 1  66 GLU H    .  66 . HN   1 1 
        623 1 2 1 1  66 GLU HB2  .  66 . HB2  1 1 
        624 1 1 1 1  66 GLU H    .  66 . HN   1 1 
        624 1 2 1 1  66 GLU HB3  .  66 . HB1  1 1 
        625 1 1 1 1  66 GLU H    .  66 . HN   1 1 
        625 1 2 1 1  66 GLU HG2  .  66 . HG2  1 1 
        626 1 1 1 1  66 GLU H    .  66 . HN   1 1 
        626 1 2 1 1  66 GLU HG3  .  66 . HG1  1 1 
        627 1 1 1 1  67 ASN H    .  67 . HN   1 1 
        627 1 2 1 1  67 ASN HB2  .  67 . HB2  1 1 
        628 1 1 1 1  67 ASN H    .  67 . HN   1 1 
        628 1 2 1 1  67 ASN HD21 .  67 . HD21 1 1 
        629 1 1 1 1  67 ASN H    .  67 . HN   1 1 
        629 1 2 1 1  67 ASN HD22 .  67 . HD22 1 1 
        630 1 1 1 1  68 ILE H    .  68 . HN   1 1 
        630 1 2 1 1  68 ILE HB   .  68 . HB   1 1 
        631 1 1 1 1  68 ILE H    .  68 . HN   1 1 
        631 1 2 1 1  68 ILE MG   .  68 . HG2* 1 1 
        632 1 1 1 1  68 ILE H    .  68 . HN   1 1 
        632 1 2 1 1  68 ILE HG12 .  68 . HG12 1 1 
        633 1 1 1 1  68 ILE H    .  68 . HN   1 1 
        633 1 2 1 1  68 ILE HG13 .  68 . HG11 1 1 
        634 1 1 1 1  69 ARG H    .  69 . HN   1 1 
        634 1 2 1 1  69 ARG HB2  .  69 . HB2  1 1 
        635 1 1 1 1  69 ARG H    .  69 . HN   1 1 
        635 1 2 1 1  69 ARG HB3  .  69 . HB1  1 1 
        636 1 1 1 1  69 ARG H    .  69 . HN   1 1 
        636 1 2 1 1  69 ARG HG3  .  69 . HG1  1 1 
        637 1 1 1 1  70 GLU H    .  70 . HN   1 1 
        637 1 2 1 1  70 GLU HB2  .  70 . HB2  1 1 
        638 1 1 1 1  70 GLU H    .  70 . HN   1 1 
        638 1 2 1 1  70 GLU HB3  .  70 . HB1  1 1 
        639 1 1 1 1  70 GLU H    .  70 . HN   1 1 
        639 1 2 1 1  70 GLU HG2  .  70 . HG2  1 1 
        640 1 1 1 1  70 GLU H    .  70 . HN   1 1 
        640 1 2 1 1  70 GLU HG3  .  70 . HG1  1 1 
        641 1 1 1 1  71 ILE H    .  71 . HN   1 1 
        641 1 2 1 1  71 ILE HB   .  71 . HB   1 1 
        642 1 1 1 1  71 ILE H    .  71 . HN   1 1 
        642 1 2 1 1  71 ILE HG12 .  71 . HG12 1 1 
        643 1 1 1 1  71 ILE H    .  71 . HN   1 1 
        643 1 2 1 1  71 ILE HG13 .  71 . HG11 1 1 
        644 1 1 1 1  71 ILE H    .  71 . HN   1 1 
        644 1 2 1 1  71 ILE MG   .  71 . HG2* 1 1 
        645 1 1 1 1  72 TRP H    .  72 . HN   1 1 
        645 1 2 1 1  72 TRP HB2  .  72 . HB2  1 1 
        646 1 1 1 1  72 TRP H    .  72 . HN   1 1 
        646 1 2 1 1  72 TRP HB3  .  72 . HB1  1 1 
        647 1 1 1 1  72 TRP H    .  72 . HN   1 1 
        647 1 2 1 1  72 TRP HD1  .  72 . HD1  1 1 
        648 1 1 1 1  72 TRP H    .  72 . HN   1 1 
        648 1 2 1 1  72 TRP HE3  .  72 . HE3  1 1 
        649 1 1 1 1  72 TRP H    .  72 . HN   1 1 
        649 1 2 1 1  72 TRP HE1  .  72 . HE1  1 1 
        650 1 1 1 1  74 ARG H    .  74 . HN   1 1 
        650 1 2 1 1  74 ARG HB2  .  74 . HB2  1 1 
        651 1 1 1 1  74 ARG H    .  74 . HN   1 1 
        651 1 2 1 1  74 ARG HB3  .  74 . HB1  1 1 
        652 1 1 1 1  74 ARG H    .  74 . HN   1 1 
        652 1 2 1 1  74 ARG HG2  .  74 . HG2  1 1 
        653 1 1 1 1  75 TYR H    .  75 . HN   1 1 
        653 1 2 1 1  75 TYR HB2  .  75 . HB2  1 1 
        654 1 1 1 1  75 TYR H    .  75 . HN   1 1 
        654 1 2 1 1  75 TYR HB3  .  75 . HB1  1 1 
        655 1 1 1 1  75 TYR H    .  75 . HN   1 1 
        655 1 2 1 1  75 TYR QE   .  75 . HE*  1 1 
        656 1 1 1 1  75 TYR H    .  75 . HN   1 1 
        656 1 2 1 1  75 TYR QD   .  75 . HD*  1 1 
        657 1 1 1 1  77 GLN H    .  77 . HN   1 1 
        657 1 2 1 1  77 GLN HB2  .  77 . HB2  1 1 
        658 1 1 1 1  76 PRO HG2  .  76 . HG2  1 1 
        658 1 2 1 1  77 GLN H    .  77 . HN   1 1 
        659 1 1 1 1  80 VAL H    .  80 . HN   1 1 
        659 1 2 1 1  80 VAL MG1  .  80 . HG1* 1 1 
        660 1 1 1 1  81 VAL H    .  81 . HN   1 1 
        660 1 2 1 1  81 VAL HB   .  81 . HB   1 1 
        661 1 1 1 1  81 VAL H    .  81 . HN   1 1 
        661 1 2 1 1  81 VAL MG2  .  81 . HG2* 1 1 
        662 1 1 1 1  81 VAL H    .  81 . HN   1 1 
        662 1 2 1 1  81 VAL MG1  .  81 . HG1* 1 1 
        663 1 1 1 1  83 ILE H    .  83 . HN   1 1 
        663 1 2 1 1  83 ILE HB   .  83 . HB   1 1 
        664 1 1 1 1  83 ILE H    .  83 . HN   1 1 
        664 1 2 1 1  83 ILE MG   .  83 . HG2* 1 1 
        665 1 1 1 1  83 ILE H    .  83 . HN   1 1 
        665 1 2 1 1  83 ILE HG13 .  83 . HG11 1 1 
        666 1 1 1 1  83 ILE H    .  83 . HN   1 1 
        666 1 2 1 1  84 VAL MG2  .  84 . HG2* 1 1 
        667 1 1 1 1  84 VAL H    .  84 . HN   1 1 
        667 1 2 1 1  84 VAL HB   .  84 . HB   1 1 
        668 1 1 1 1  84 VAL H    .  84 . HN   1 1 
        668 1 2 1 1  84 VAL MG1  .  84 . HG1* 1 1 
        669 1 1 1 1  85 THR H    .  85 . HN   1 1 
        669 1 2 1 1  85 THR MG   .  85 . HG2* 1 1 
        670 1 1 1 1  86 THR H    .  86 . HN   1 1 
        670 1 2 1 1  86 THR HB   .  86 . HB   1 1 
        671 1 1 1 1  86 THR H    .  86 . HN   1 1 
        671 1 2 1 1  86 THR MG   .  86 . HG2* 1 1 
        672 1 1 1 1  88 ASP H    .  88 . HN   1 1 
        672 1 2 1 1  88 ASP HB2  .  88 . HB2  1 1 
        673 1 1 1 1  88 ASP H    .  88 . HN   1 1 
        673 1 2 1 1  88 ASP HB3  .  88 . HB1  1 1 
        674 1 1 1 1  89 LYS H    .  89 . HN   1 1 
        674 1 2 1 1  89 LYS HG3  .  89 . HG1  1 1 
        675 1 1 1 1  89 LYS H    .  89 . HN   1 1 
        675 1 2 1 1  89 LYS HG2  .  89 . HG2  1 1 
        676 1 1 1 1  90 GLU H    .  90 . HN   1 1 
        676 1 2 1 1  90 GLU HB2  .  90 . HB2  1 1 
        677 1 1 1 1  90 GLU H    .  90 . HN   1 1 
        677 1 2 1 1  90 GLU HB3  .  90 . HB1  1 1 
        678 1 1 1 1  90 GLU H    .  90 . HN   1 1 
        678 1 2 1 1  90 GLU HG2  .  90 . HG2  1 1 
        679 1 1 1 1  90 GLU H    .  90 . HN   1 1 
        679 1 2 1 1  90 GLU HG3  .  90 . HG1  1 1 
        680 1 1 1 1  91 TRP H    .  91 . HN   1 1 
        680 1 2 1 1  91 TRP HB2  .  91 . HB2  1 1 
        681 1 1 1 1  91 TRP H    .  91 . HN   1 1 
        681 1 2 1 1  91 TRP HB3  .  91 . HB1  1 1 
        682 1 1 1 1  91 TRP H    .  91 . HN   1 1 
        682 1 2 1 1  91 TRP HE1  .  91 . HE1  1 1 
        683 1 1 1 1  92 ILE H    .  92 . HN   1 1 
        683 1 2 1 1  92 ILE HB   .  92 . HB   1 1 
        684 1 1 1 1  92 ILE H    .  92 . HN   1 1 
        684 1 2 1 1  92 ILE MG   .  92 . HG2* 1 1 
        685 1 1 1 1  92 ILE H    .  92 . HN   1 1 
        685 1 2 1 1  92 ILE HG12 .  92 . HG12 1 1 
        686 1 1 1 1  92 ILE H    .  92 . HN   1 1 
        686 1 2 1 1  92 ILE HG13 .  92 . HG11 1 1 
        687 1 1 1 1  92 ILE H    .  92 . HN   1 1 
        687 1 2 1 1  92 ILE MD   .  92 . HD1* 1 1 
        688 1 1 1 1  93 LYS H    .  93 . HN   1 1 
        688 1 2 1 1  93 LYS HB2  .  93 . HB2  1 1 
        689 1 1 1 1  93 LYS H    .  93 . HN   1 1 
        689 1 2 1 1  93 LYS HB3  .  93 . HB1  1 1 
        690 1 1 1 1  93 LYS H    .  93 . HN   1 1 
        690 1 2 1 1  93 LYS HG2  .  93 . HG2  1 1 
        691 1 1 1 1  94 ASP H    .  94 . HN   1 1 
        691 1 2 1 1  94 ASP HB2  .  94 . HB2  1 1 
        692 1 1 1 1  94 ASP H    .  94 . HN   1 1 
        692 1 2 1 1  94 ASP HB3  .  94 . HB1  1 1 
        693 1 1 1 1  95 PHE H    .  95 . HN   1 1 
        693 1 2 1 1  95 PHE HB2  .  95 . HB2  1 1 
        694 1 1 1 1  95 PHE H    .  95 . HN   1 1 
        694 1 2 1 1  95 PHE HB3  .  95 . HB1  1 1 
        695 1 1 1 1  95 PHE H    .  95 . HN   1 1 
        695 1 2 1 1  95 PHE QD   .  95 . HD*  1 1 
        696 1 1 1 1  96 ILE H    .  96 . HN   1 1 
        696 1 2 1 1  96 ILE HB   .  96 . HB   1 1 
        697 1 1 1 1  96 ILE H    .  96 . HN   1 1 
        697 1 2 1 1  96 ILE HG12 .  96 . HG12 1 1 
        698 1 1 1 1  96 ILE H    .  96 . HN   1 1 
        698 1 2 1 1  96 ILE HG13 .  96 . HG11 1 1 
        699 1 1 1 1  96 ILE H    .  96 . HN   1 1 
        699 1 2 1 1  96 ILE MD   .  96 . HD1* 1 1 
        700 1 1 1 1  97 GLU H    .  97 . HN   1 1 
        700 1 2 1 1  97 GLU HB2  .  97 . HB2  1 1 
        701 1 1 1 1  98 GLU H    .  98 . HN   1 1 
        701 1 2 1 1  98 GLU HB2  .  98 . HB2  1 1 
        702 1 1 1 1  99 ALA H    .  99 . HN   1 1 
        702 1 2 1 1  99 ALA MB   .  99 . HB*  1 1 
        703 1 1 1 1 100 LYS H    . 100 . HN   1 1 
        703 1 2 1 1 100 LYS HB3  . 100 . HB1  1 1 
        704 1 1 1 1 100 LYS H    . 100 . HN   1 1 
        704 1 2 1 1 100 LYS HB2  . 100 . HB2  1 1 
        705 1 1 1 1 100 LYS H    . 100 . HN   1 1 
        705 1 2 1 1 100 LYS HG3  . 100 . HG1  1 1 
        706 1 1 1 1 101 GLU H    . 101 . HN   1 1 
        706 1 2 1 1 101 GLU HB2  . 101 . HB2  1 1 
        707 1 1 1 1 101 GLU H    . 101 . HN   1 1 
        707 1 2 1 1 101 GLU HB3  . 101 . HB1  1 1 
        708 1 1 1 1  88 ASP HB2  .  88 . HB2  1 1 
        708 1 2 1 1  91 TRP H    .  91 . HN   1 1 
        709 1 1 1 1 102 ARG H    . 102 . HN   1 1 
        709 1 2 1 1 102 ARG HB3  . 102 . HB1  1 1 
        710 1 1 1 1 102 ARG H    . 102 . HN   1 1 
        710 1 2 1 1 102 ARG HB2  . 102 . HB2  1 1 
        711 1 1 1 1 102 ARG H    . 102 . HN   1 1 
        711 1 2 1 1 102 ARG HG2  . 102 . HG2  1 1 
        712 1 1 1 1 102 ARG H    . 102 . HN   1 1 
        712 1 2 1 1 102 ARG HG3  . 102 . HG1  1 1 
        713 1 1 1 1 102 ARG H    . 102 . HN   1 1 
        713 1 2 1 1 102 ARG HD2  . 102 . HD2  1 1 
        714 1 1 1 1 104 VAL H    . 104 . HN   1 1 
        714 1 2 1 1 104 VAL MG1  . 104 . HG1* 1 1 
        715 1 1 1 1 104 VAL H    . 104 . HN   1 1 
        715 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
        716 1 1 1 1 105 GLU H    . 105 . HN   1 1 
        716 1 2 1 1 105 GLU HB2  . 105 . HB2  1 1 
        717 1 1 1 1 105 GLU H    . 105 . HN   1 1 
        717 1 2 1 1 105 GLU HB3  . 105 . HB1  1 1 
        718 1 1 1 1 105 GLU H    . 105 . HN   1 1 
        718 1 2 1 1 105 GLU HG2  . 105 . HG2  1 1 
        719 1 1 1 1 105 GLU H    . 105 . HN   1 1 
        719 1 2 1 1 105 GLU HG3  . 105 . HG1  1 1 
        720 1 1 1 1 106 VAL H    . 106 . HN   1 1 
        720 1 2 1 1 106 VAL HB   . 106 . HB   1 1 
        721 1 1 1 1 107 PHE H    . 107 . HN   1 1 
        721 1 2 1 1 107 PHE HB2  . 107 . HB2  1 1 
        722 1 1 1 1  95 PHE QE   .  95 . HE*  1 1 
        722 1 2 1 1 107 PHE H    . 107 . HN   1 1 
        723 1 1 1 1 108 VAL H    . 108 . HN   1 1 
        723 1 2 1 1 108 VAL HB   . 108 . HB   1 1 
        724 1 1 1 1 108 VAL H    . 108 . HN   1 1 
        724 1 2 1 1 108 VAL MG2  . 108 . HG2* 1 1 
        725 1 1 1 1 108 VAL H    . 108 . HN   1 1 
        725 1 2 1 1 108 VAL MG1  . 108 . HG1* 1 1 
        726 1 1 1 1 109 VAL H    . 109 . HN   1 1 
        726 1 2 1 1 109 VAL HB   . 109 . HB   1 1 
        727 1 1 1 1 108 VAL MG1  . 108 . HG1* 1 1 
        727 1 2 1 1 109 VAL H    . 109 . HN   1 1 
        728 1 1 1 1   7 VAL MG2  .   7 . HG2* 1 1 
        728 1 2 1 1 109 VAL H    . 109 . HN   1 1 
        729 1 1 1 1 113 LYS H    . 113 . HN   1 1 
        729 1 2 1 1 113 LYS HB2  . 113 . HB2  1 1 
        730 1 1 1 1 113 LYS H    . 113 . HN   1 1 
        730 1 2 1 1 113 LYS HB3  . 113 . HB1  1 1 
        731 1 1 1 1 113 LYS H    . 113 . HN   1 1 
        731 1 2 1 1 113 LYS HG2  . 113 . HG2  1 1 
        732 1 1 1 1 113 LYS H    . 113 . HN   1 1 
        732 1 2 1 1 113 LYS HG3  . 113 . HG1  1 1 
        733 1 1 1 1 114 ASP H    . 114 . HN   1 1 
        733 1 2 1 1 114 ASP HB2  . 114 . HB2  1 1 
        734 1 1 1 1 114 ASP H    . 114 . HN   1 1 
        734 1 2 1 1 114 ASP HB3  . 114 . HB1  1 1 
        735 1 1 1 1 116 ASP H    . 116 . HN   1 1 
        735 1 2 1 1 116 ASP HB3  . 116 . HB1  1 1 
        736 1 1 1 1 117 ARG H    . 117 . HN   1 1 
        736 1 2 1 1 117 ARG HB2  . 117 . HB2  1 1 
        737 1 1 1 1 117 ARG H    . 117 . HN   1 1 
        737 1 2 1 1 117 ARG HD2  . 117 . HD2  1 1 
        738 1 1 1 1 117 ARG H    . 117 . HN   1 1 
        738 1 2 1 1 117 ARG HD3  . 117 . HD1  1 1 
        739 1 1 1 1 118 ARG H    . 118 . HN   1 1 
        739 1 2 1 1 118 ARG HB2  . 118 . HB2  1 1 
        740 1 1 1 1 117 ARG HB2  . 117 . HB2  1 1 
        740 1 2 1 1 118 ARG H    . 118 . HN   1 1 
        741 1 1 1 1 120 GLU H    . 120 . HN   1 1 
        741 1 2 1 1 120 GLU HG2  . 120 . HG2  1 1 
        742 1 1 1 1 120 GLU H    . 120 . HN   1 1 
        742 1 2 1 1 120 GLU HG3  . 120 . HG1  1 1 
        743 1 1 1 1 121 ALA H    . 121 . HN   1 1 
        743 1 2 1 1 121 ALA MB   . 121 . HB*  1 1 
        744 1 1 1 1 122 GLN H    . 122 . HN   1 1 
        744 1 2 1 1 122 GLN HG3  . 122 . HG1  1 1 
        745 1 1 1 1 124 GLU H    . 124 . HN   1 1 
        745 1 2 1 1 124 GLU HB2  . 124 . HB2  1 1 
        746 1 1 1 1 125 PHE H    . 125 . HN   1 1 
        746 1 2 1 1 125 PHE QD   . 125 . HD*  1 1 
        747 1 1 1 1 126 ARG H    . 126 . HN   1 1 
        747 1 2 1 1 126 ARG HB2  . 126 . HB2  1 1 
        748 1 1 1 1 126 ARG H    . 126 . HN   1 1 
        748 1 2 1 1 126 ARG HB3  . 126 . HB1  1 1 
        749 1 1 1 1 126 ARG H    . 126 . HN   1 1 
        749 1 2 1 1 126 ARG HG2  . 126 . HG2  1 1 
        750 1 1 1 1 126 ARG H    . 126 . HN   1 1 
        750 1 2 1 1 126 ARG HG3  . 126 . HG1  1 1 
        751 1 1 1 1 127 SER H    . 127 . HN   1 1 
        751 1 2 1 1 127 SER HB2  . 127 . HB2  1 1 
        752 1 1 1 1 127 SER H    . 127 . HN   1 1 
        752 1 2 1 1 127 SER HB3  . 127 . HB1  1 1 
        753 1 1 1 1 128 ASP H    . 128 . HN   1 1 
        753 1 2 1 1 128 ASP HB2  . 128 . HB2  1 1 
        754 1 1 1 1 128 ASP H    . 128 . HN   1 1 
        754 1 2 1 1 128 ASP HB3  . 128 . HB1  1 1 
        755 1 1 1 1 130 VAL H    . 130 . HN   1 1 
        755 1 2 1 1 130 VAL HB   . 130 . HB   1 1 
        756 1 1 1 1 130 VAL H    . 130 . HN   1 1 
        756 1 2 1 1 130 VAL MG1  . 130 . HG1* 1 1 
        757 1 1 1 1 130 VAL H    . 130 . HN   1 1 
        757 1 2 1 1 130 VAL MG2  . 130 . HG2* 1 1 
        758 1 1 1 1 131 ASP H    . 131 . HN   1 1 
        758 1 2 1 1 131 ASP HB3  . 131 . HB1  1 1 
        759 1 1 1 1 131 ASP H    . 131 . HN   1 1 
        759 1 2 1 1 131 ASP HB2  . 131 . HB2  1 1 
        760 1 1 1 1 132 VAL H    . 132 . HN   1 1 
        760 1 2 1 1 132 VAL HB   . 132 . HB   1 1 
        761 1 1 1 1 133 ARG H    . 133 . HN   1 1 
        761 1 2 1 1 133 ARG HB2  . 133 . HB2  1 1 
        762 1 1 1 1 133 ARG H    . 133 . HN   1 1 
        762 1 2 1 1 133 ARG HG2  . 133 . HG2  1 1 
        763 1 1 1 1 133 ARG H    . 133 . HN   1 1 
        763 1 2 1 1 133 ARG HG3  . 133 . HG1  1 1 
        764 1 1 1 1 134 THR H    . 134 . HN   1 1 
        764 1 2 1 1 134 THR MG   . 134 . HG2* 1 1 
        765 1 1 1 1 111 ASN HB2  . 111 . HB2  1 1 
        765 1 2 1 1 135 VAL H    . 135 . HN   1 1 
        766 1 1 1 1 135 VAL H    . 135 . HN   1 1 
        766 1 2 1 1 135 VAL MG1  . 135 . HG1* 1 1 
        767 1 1 1 1 137 ASP H    . 137 . HN   1 1 
        767 1 2 1 1 137 ASP HB3  . 137 . HB1  1 1 
        768 1 1 1 1 137 ASP H    . 137 . HN   1 1 
        768 1 2 1 1 137 ASP HB2  . 137 . HB2  1 1 
        769 1 1 1 1 138 LYS H    . 138 . HN   1 1 
        769 1 2 1 1 138 LYS HB3  . 138 . HB1  1 1 
        770 1 1 1 1 138 LYS H    . 138 . HN   1 1 
        770 1 2 1 1 138 LYS HB2  . 138 . HB2  1 1 
        771 1 1 1 1 140 GLU H    . 140 . HN   1 1 
        771 1 2 1 1 140 GLU HB2  . 140 . HB2  1 1 
        772 1 1 1 1 140 GLU H    . 140 . HN   1 1 
        772 1 2 1 1 140 GLU HB3  . 140 . HB1  1 1 
        773 1 1 1 1 140 GLU H    . 140 . HN   1 1 
        773 1 2 1 1 140 GLU HG2  . 140 . HG2  1 1 
        774 1 1 1 1 141 LEU H    . 141 . HN   1 1 
        774 1 2 1 1 141 LEU HB3  . 141 . HB1  1 1 
        775 1 1 1 1 141 LEU H    . 141 . HN   1 1 
        775 1 2 1 1 141 LEU HB2  . 141 . HB2  1 1 
        776 1 1 1 1 141 LEU H    . 141 . HN   1 1 
        776 1 2 1 1 141 LEU HG   . 141 . HG   1 1 
        777 1 1 1 1 141 LEU HB3  . 141 . HB1  1 1 
        777 1 2 1 1 142 ILE H    . 142 . HN   1 1 
        778 1 1 1 1 142 ILE H    . 142 . HN   1 1 
        778 1 2 1 1 142 ILE MG   . 142 . HG2* 1 1 
        779 1 1 1 1 142 ILE H    . 142 . HN   1 1 
        779 1 2 1 1 142 ILE HG13 . 142 . HG11 1 1 
        780 1 1 1 1 142 ILE H    . 142 . HN   1 1 
        780 1 2 1 1 142 ILE HG12 . 142 . HG12 1 1 
        781 1 1 1 1 142 ILE H    . 142 . HN   1 1 
        781 1 2 1 1 142 ILE MD   . 142 . HD1* 1 1 
        782 1 1 1 1 143 GLU H    . 143 . HN   1 1 
        782 1 2 1 1 143 GLU HB2  . 143 . HB2  1 1 
        783 1 1 1 1 143 GLU H    . 143 . HN   1 1 
        783 1 2 1 1 143 GLU HG2  . 143 . HG2  1 1 
        784 1 1 1 1 143 GLU H    . 143 . HN   1 1 
        784 1 2 1 1 143 GLU HG3  . 143 . HG1  1 1 
        785 1 1 1 1 144 GLN H    . 144 . HN   1 1 
        785 1 2 1 1 144 GLN HB2  . 144 . HB2  1 1 
        786 1 1 1 1 144 GLN H    . 144 . HN   1 1 
        786 1 2 1 1 144 GLN HG2  . 144 . HG2  1 1 
        787 1 1 1 1 144 GLN H    . 144 . HN   1 1 
        787 1 2 1 1 144 GLN HE21 . 144 . HE21 1 1 
        788 1 1 1 1 145 VAL H    . 145 . HN   1 1 
        788 1 2 1 1 145 VAL HB   . 145 . HB   1 1 
        789 1 1 1 1 141 LEU MD2  . 141 . HD2* 1 1 
        789 1 2 1 1 145 VAL H    . 145 . HN   1 1 
        790 1 1 1 1 145 VAL H    . 145 . HN   1 1 
        790 1 2 1 1 145 VAL MG2  . 145 . HG2* 1 1 
        791 1 1 1 1 146 ARG H    . 146 . HN   1 1 
        791 1 2 1 1 146 ARG HB2  . 146 . HB2  1 1 
        792 1 1 1 1 146 ARG H    . 146 . HN   1 1 
        792 1 2 1 1 146 ARG HB3  . 146 . HB1  1 1 
        793 1 1 1 1 146 ARG H    . 146 . HN   1 1 
        793 1 2 1 1 146 ARG HG3  . 146 . HG1  1 1 
        794 1 1 1 1 146 ARG H    . 146 . HN   1 1 
        794 1 2 1 1 146 ARG HG2  . 146 . HG2  1 1 
        795 1 1 1 1 146 ARG H    . 146 . HN   1 1 
        795 1 2 1 1 146 ARG HD2  . 146 . HD2  1 1 
        796 1 1 1 1 146 ARG H    . 146 . HN   1 1 
        796 1 2 1 1 146 ARG HD3  . 146 . HD1  1 1 
        797 1 1 1 1 146 ARG HB2  . 146 . HB2  1 1 
        797 1 2 1 1 147 ARG H    . 147 . HN   1 1 
        798 1 1 1 1 147 ARG H    . 147 . HN   1 1 
        798 1 2 1 1 147 ARG HB3  . 147 . HB1  1 1 
        799 1 1 1 1 147 ARG H    . 147 . HN   1 1 
        799 1 2 1 1 147 ARG HG2  . 147 . HG2  1 1 
        800 1 1 1 1 147 ARG H    . 147 . HN   1 1 
        800 1 2 1 1 147 ARG HB2  . 147 . HB2  1 1 
        801 1 1 1 1 146 ARG HD3  . 146 . HD1  1 1 
        801 1 2 1 1 147 ARG H    . 147 . HN   1 1 
        802 1 1 1 1 147 ARG H    . 147 . HN   1 1 
        802 1 2 1 1 147 ARG HD3  . 147 . HD1  1 1 
        803 1 1 1 1 148 PHE H    . 148 . HN   1 1 
        803 1 2 1 1 148 PHE HB2  . 148 . HB2  1 1 
        804 1 1 1 1 148 PHE H    . 148 . HN   1 1 
        804 1 2 1 1 148 PHE HB3  . 148 . HB1  1 1 
        805 1 1 1 1 148 PHE H    . 148 . HN   1 1 
        805 1 2 1 1 148 PHE QD   . 148 . HD*  1 1 
        806 1 1 1 1 149 VAL H    . 149 . HN   1 1 
        806 1 2 1 1 149 VAL HB   . 149 . HB   1 1 
        807 1 1 1 1 149 VAL H    . 149 . HN   1 1 
        807 1 2 1 1 149 VAL MG2  . 149 . HG2* 1 1 
        808 1 1 1 1 149 VAL H    . 149 . HN   1 1 
        808 1 2 1 1 149 VAL MG1  . 149 . HG1* 1 1 
        809 1 1 1 1 150 ARG H    . 150 . HN   1 1 
        809 1 2 1 1 150 ARG HB2  . 150 . HB2  1 1 
        810 1 1 1 1 150 ARG H    . 150 . HN   1 1 
        810 1 2 1 1 150 ARG HB3  . 150 . HB1  1 1 
        811 1 1 1 1 150 ARG H    . 150 . HN   1 1 
        811 1 2 1 1 150 ARG HG2  . 150 . HG2  1 1 
        812 1 1 1 1 150 ARG H    . 150 . HN   1 1 
        812 1 2 1 1 150 ARG HG3  . 150 . HG1  1 1 
        813 1 1 1 1 150 ARG HB3  . 150 . HB1  1 1 
        813 1 2 1 1 151 LYS H    . 151 . HN   1 1 
        814 1 1 1 1 151 LYS H    . 151 . HN   1 1 
        814 1 2 1 1 151 LYS HG2  . 151 . HG2  1 1 
        815 1 1 1 1 151 LYS H    . 151 . HN   1 1 
        815 1 2 1 1 151 LYS HG3  . 151 . HG1  1 1 
        816 1 1 1 1 152 VAL H    . 152 . HN   1 1 
        816 1 2 1 1 152 VAL HB   . 152 . HB   1 1 
        817 1 1 1 1 152 VAL H    . 152 . HN   1 1 
        817 1 2 1 1 152 VAL MG1  . 152 . HG1* 1 1 
        818 1 1 1 1 152 VAL H    . 152 . HN   1 1 
        818 1 2 1 1 152 VAL MG2  . 152 . HG2* 1 1 
        819 1 1 1 1 154 SER H    . 154 . HN   1 1 
        819 1 2 1 1 154 SER HB3  . 154 . HB1  1 1 
        820 1 1 1 1 155 LEU H    . 155 . HN   1 1 
        820 1 2 1 1 155 LEU HB3  . 155 . HB1  1 1 
        821 1 1 1 1 155 LEU H    . 155 . HN   1 1 
        821 1 2 1 1 155 LEU HG   . 155 . HG   1 1 
        822 1 1 1 1 155 LEU H    . 155 . HN   1 1 
        822 1 2 1 1 155 LEU MD1  . 155 . HD1* 1 1 
        823 1 1 1 1 155 LEU H    . 155 . HN   1 1 
        823 1 2 1 1 155 LEU MD2  . 155 . HD2* 1 1 
        824 1 1 1 1 156 GLU H    . 156 . HN   1 1 
        824 1 2 1 1 156 GLU HG2  . 156 . HG2  1 1 
        825 1 1 1 1 156 GLU H    . 156 . HN   1 1 
        825 1 2 1 1 156 GLU HG3  . 156 . HG1  1 1 
        826 1 1 1 1   7 VAL H    .   7 . HN   1 1 
        826 1 2 1 1   8 PHE H    .   8 . HN   1 1 
        827 1 1 1 1  10 SER H    .  10 . HN   1 1 
        827 1 2 1 1  11 ASP H    .  11 . HN   1 1 
        828 1 1 1 1  15 LEU H    .  15 . HN   1 1 
        828 1 2 1 1  16 LYS H    .  16 . HN   1 1 
        829 1 1 1 1  17 GLU H    .  17 . HN   1 1 
        829 1 2 1 1  18 ILE H    .  18 . HN   1 1 
        830 1 1 1 1  20 ARG H    .  20 . HN   1 1 
        830 1 2 1 1  21 GLU H    .  21 . HN   1 1 
        831 1 1 1 1  21 GLU H    .  21 . HN   1 1 
        831 1 2 1 1  22 ILE H    .  22 . HN   1 1 
        832 1 1 1 1  22 ILE H    .  22 . HN   1 1 
        832 1 2 1 1  23 LYS H    .  23 . HN   1 1 
        833 1 1 1 1  25 GLN H    .  25 . HN   1 1 
        833 1 2 1 1  26 GLY H    .  26 . HN   1 1 
        834 1 1 1 1  26 GLY H    .  26 . HN   1 1 
        834 1 2 1 1  27 VAL H    .  27 . HN   1 1 
        835 1 1 1 1  29 VAL H    .  29 . HN   1 1 
        835 1 2 1 1  30 VAL H    .  30 . HN   1 1 
        836 1 1 1 1  35 ASP H    .  35 . HN   1 1 
        836 1 2 1 1  36 GLN H    .  36 . HN   1 1 
        837 1 1 1 1  39 LYS H    .  39 . HN   1 1 
        837 1 2 1 1  40 ARG H    .  40 . HN   1 1 
        838 1 1 1 1  41 ARG H    .  41 . HN   1 1 
        838 1 2 1 1  42 ARG H    .  42 . HN   1 1 
        839 1 1 1 1  45 LEU H    .  45 . HN   1 1 
        839 1 2 1 1  46 GLU H    .  46 . HN   1 1 
        840 1 1 1 1  47 GLU H    .  47 . HN   1 1 
        840 1 2 1 1  48 PHE H    .  48 . HN   1 1 
        841 1 1 1 1  51 GLN H    .  51 . HN   1 1 
        841 1 2 1 1  52 GLY H    .  52 . HN   1 1 
        842 1 1 1 1  54 ASP H    .  54 . HN   1 1 
        842 1 2 1 1  55 VAL H    .  55 . HN   1 1 
        843 1 1 1 1  55 VAL H    .  55 . HN   1 1 
        843 1 2 1 1  56 ARG H    .  56 . HN   1 1 
        844 1 1 1 1  56 ARG H    .  56 . HN   1 1 
        844 1 2 1 1  57 THR H    .  57 . HN   1 1 
        845 1 1 1 1  57 THR H    .  57 . HN   1 1 
        845 1 2 1 1  58 VAL H    .  58 . HN   1 1 
        846 1 1 1 1  58 VAL H    .  58 . HN   1 1 
        846 1 2 1 1  59 GLU H    .  59 . HN   1 1 
        847 1 1 1 1  60 ASP H    .  60 . HN   1 1 
        847 1 2 1 1  61 LYS H    .  61 . HN   1 1 
        848 1 1 1 1  61 LYS H    .  61 . HN   1 1 
        848 1 2 1 1  62 GLU H    .  62 . HN   1 1 
        849 1 1 1 1  62 GLU H    .  62 . HN   1 1 
        849 1 2 1 1  63 ASP H    .  63 . HN   1 1 
        850 1 1 1 1  63 ASP H    .  63 . HN   1 1 
        850 1 2 1 1  64 PHE H    .  64 . HN   1 1 
        851 1 1 1 1  66 GLU H    .  66 . HN   1 1 
        851 1 2 1 1  67 ASN H    .  67 . HN   1 1 
        852 1 1 1 1  70 GLU H    .  70 . HN   1 1 
        852 1 2 1 1  71 ILE H    .  71 . HN   1 1 
        853 1 1 1 1  72 TRP H    .  72 . HN   1 1 
        853 1 2 1 1  73 GLU H    .  73 . HN   1 1 
        854 1 1 1 1  87 ASP H    .  87 . HN   1 1 
        854 1 2 1 1  88 ASP H    .  88 . HN   1 1 
        855 1 1 1 1  88 ASP H    .  88 . HN   1 1 
        855 1 2 1 1  89 LYS H    .  89 . HN   1 1 
        856 1 1 1 1  90 GLU H    .  90 . HN   1 1 
        856 1 2 1 1  91 TRP H    .  91 . HN   1 1 
        857 1 1 1 1  93 LYS H    .  93 . HN   1 1 
        857 1 2 1 1  94 ASP H    .  94 . HN   1 1 
        858 1 1 1 1  94 ASP H    .  94 . HN   1 1 
        858 1 2 1 1  95 PHE H    .  95 . HN   1 1 
        859 1 1 1 1  95 PHE H    .  95 . HN   1 1 
        859 1 2 1 1  96 ILE H    .  96 . HN   1 1 
        860 1 1 1 1  97 GLU H    .  97 . HN   1 1 
        860 1 2 1 1  98 GLU H    .  98 . HN   1 1 
        861 1 1 1 1  98 GLU H    .  98 . HN   1 1 
        861 1 2 1 1  99 ALA H    .  99 . HN   1 1 
        862 1 1 1 1  99 ALA H    .  99 . HN   1 1 
        862 1 2 1 1 100 LYS H    . 100 . HN   1 1 
        863 1 1 1 1 101 GLU H    . 101 . HN   1 1 
        863 1 2 1 1 102 ARG H    . 102 . HN   1 1 
        864 1 1 1 1 103 GLY H    . 103 . HN   1 1 
        864 1 2 1 1 104 VAL H    . 104 . HN   1 1 
        865 1 1 1 1 105 GLU H    . 105 . HN   1 1 
        865 1 2 1 1 106 VAL H    . 106 . HN   1 1 
        866 1 1 1 1 108 VAL H    . 108 . HN   1 1 
        866 1 2 1 1 109 VAL H    . 109 . HN   1 1 
        867 1 1 1 1 109 VAL H    . 109 . HN   1 1 
        867 1 2 1 1 110 TYR H    . 110 . HN   1 1 
        868 1 1 1 1 112 ASN H    . 112 . HN   1 1 
        868 1 2 1 1 113 LYS H    . 113 . HN   1 1 
        869 1 1 1 1 116 ASP H    . 116 . HN   1 1 
        869 1 2 1 1 117 ARG H    . 117 . HN   1 1 
        870 1 1 1 1 117 ARG H    . 117 . HN   1 1 
        870 1 2 1 1 118 ARG H    . 118 . HN   1 1 
        871 1 1 1 1 121 ALA H    . 121 . HN   1 1 
        871 1 2 1 1 122 GLN H    . 122 . HN   1 1 
        872 1 1 1 1 124 GLU H    . 124 . HN   1 1 
        872 1 2 1 1 125 PHE H    . 125 . HN   1 1 
        873 1 1 1 1 127 SER H    . 127 . HN   1 1 
        873 1 2 1 1 128 ASP H    . 128 . HN   1 1 
        874 1 1 1 1 129 GLY H    . 129 . HN   1 1 
        874 1 2 1 1 130 VAL H    . 130 . HN   1 1 
        875 1 1 1 1 132 VAL H    . 132 . HN   1 1 
        875 1 2 1 1 133 ARG H    . 133 . HN   1 1 
        876 1 1 1 1 133 ARG H    . 133 . HN   1 1 
        876 1 2 1 1 134 THR H    . 134 . HN   1 1 
        877 1 1 1 1 134 THR H    . 134 . HN   1 1 
        877 1 2 1 1 135 VAL H    . 135 . HN   1 1 
        878 1 1 1 1 137 ASP H    . 137 . HN   1 1 
        878 1 2 1 1 138 LYS H    . 138 . HN   1 1 
        879 1 1 1 1 140 GLU H    . 140 . HN   1 1 
        879 1 2 1 1 141 LEU H    . 141 . HN   1 1 
        880 1 1 1 1 142 ILE H    . 142 . HN   1 1 
        880 1 2 1 1 143 GLU H    . 143 . HN   1 1 
        881 1 1 1 1 144 GLN H    . 144 . HN   1 1 
        881 1 2 1 1 145 VAL H    . 145 . HN   1 1 
        882 1 1 1 1 145 VAL H    . 145 . HN   1 1 
        882 1 2 1 1 146 ARG H    . 146 . HN   1 1 
        883 1 1 1 1 148 PHE H    . 148 . HN   1 1 
        883 1 2 1 1 149 VAL H    . 149 . HN   1 1 
        884 1 1 1 1 151 LYS H    . 151 . HN   1 1 
        884 1 2 1 1 152 VAL H    . 152 . HN   1 1 
        885 1 1 1 1 152 VAL H    . 152 . HN   1 1 
        885 1 2 1 1 153 GLY H    . 153 . HN   1 1 
        886 1 1 1 1 154 SER H    . 154 . HN   1 1 
        886 1 2 1 1 155 LEU H    . 155 . HN   1 1 
        887 1 1 1 1  13 GLU H    .  13 . HN   1 1 
        887 1 2 1 1  14 ILE H    .  14 . HN   1 1 
        888 1 1 1 1  13 GLU HA   .  13 . HA   1 1 
        888 1 2 1 1  15 LEU H    .  15 . HN   1 1 
        889 1 1 1 1  13 GLU H    .  13 . HN   1 1 
        889 1 2 1 1  15 LEU H    .  15 . HN   1 1 
        890 1 1 1 1  12 PRO HA   .  12 . HA   1 1 
        890 1 2 1 1  15 LEU H    .  15 . HN   1 1 
        891 1 1 1 1  15 LEU H    .  15 . HN   1 1 
        891 1 2 1 1  17 GLU H    .  17 . HN   1 1 
        892 1 1 1 1  14 ILE HA   .  14 . HA   1 1 
        892 1 2 1 1  16 LYS H    .  16 . HN   1 1 
        893 1 1 1 1  13 GLU HA   .  13 . HA   1 1 
        893 1 2 1 1  16 LYS H    .  16 . HN   1 1 
        894 1 1 1 1  16 LYS H    .  16 . HN   1 1 
        894 1 2 1 1  18 ILE H    .  18 . HN   1 1 
        895 1 1 1 1  14 ILE H    .  14 . HN   1 1 
        895 1 2 1 1  17 GLU H    .  17 . HN   1 1 
        896 1 1 1 1  14 ILE HA   .  14 . HA   1 1 
        896 1 2 1 1  17 GLU H    .  17 . HN   1 1 
        897 1 1 1 1  13 GLU HA   .  13 . HA   1 1 
        897 1 2 1 1  17 GLU H    .  17 . HN   1 1 
        898 1 1 1 1  17 GLU H    .  17 . HN   1 1 
        898 1 2 1 1  19 VAL H    .  19 . HN   1 1 
        899 1 1 1 1  15 LEU HA   .  15 . HA   1 1 
        899 1 2 1 1  18 ILE H    .  18 . HN   1 1 
        900 1 1 1 1  14 ILE HA   .  14 . HA   1 1 
        900 1 2 1 1  18 ILE H    .  18 . HN   1 1 
        901 1 1 1 1  18 ILE H    .  18 . HN   1 1 
        901 1 2 1 1  20 ARG H    .  20 . HN   1 1 
        902 1 1 1 1  46 GLU H    .  46 . HN   1 1 
        902 1 2 1 1  48 PHE H    .  48 . HN   1 1 
        903 1 1 1 1  17 GLU HA   .  17 . HA   1 1 
        903 1 2 1 1  19 VAL H    .  19 . HN   1 1 
        904 1 1 1 1  16 LYS HA   .  16 . HA   1 1 
        904 1 2 1 1  19 VAL H    .  19 . HN   1 1 
        905 1 1 1 1  15 LEU HA   .  15 . HA   1 1 
        905 1 2 1 1  19 VAL H    .  19 . HN   1 1 
        906 1 1 1 1  18 ILE HA   .  18 . HA   1 1 
        906 1 2 1 1  20 ARG H    .  20 . HN   1 1 
        907 1 1 1 1  19 VAL HA   .  19 . HA   1 1 
        907 1 2 1 1  21 GLU H    .  21 . HN   1 1 
        908 1 1 1 1  18 ILE HA   .  18 . HA   1 1 
        908 1 2 1 1  21 GLU H    .  21 . HN   1 1 
        909 1 1 1 1  17 GLU HA   .  17 . HA   1 1 
        909 1 2 1 1  21 GLU H    .  21 . HN   1 1 
        910 1 1 1 1  21 GLU H    .  21 . HN   1 1 
        910 1 2 1 1  23 LYS H    .  23 . HN   1 1 
        911 1 1 1 1  20 ARG HA   .  20 . HA   1 1 
        911 1 2 1 1  22 ILE H    .  22 . HN   1 1 
        912 1 1 1 1  20 ARG H    .  20 . HN   1 1 
        912 1 2 1 1  22 ILE H    .  22 . HN   1 1 
        913 1 1 1 1  19 VAL HA   .  19 . HA   1 1 
        913 1 2 1 1  22 ILE H    .  22 . HN   1 1 
        914 1 1 1 1  18 ILE HA   .  18 . HA   1 1 
        914 1 2 1 1  22 ILE H    .  22 . HN   1 1 
        915 1 1 1 1  19 VAL HA   .  19 . HA   1 1 
        915 1 2 1 1  23 LYS H    .  23 . HN   1 1 
        916 1 1 1 1  22 ILE HA   .  22 . HA   1 1 
        916 1 2 1 1  24 ARG H    .  24 . HN   1 1 
        917 1 1 1 1  21 GLU HA   .  21 . HA   1 1 
        917 1 2 1 1  24 ARG H    .  24 . HN   1 1 
        918 1 1 1 1  38 GLU H    .  38 . HN   1 1 
        918 1 2 1 1  40 ARG H    .  40 . HN   1 1 
        919 1 1 1 1  38 GLU HA   .  38 . HA   1 1 
        919 1 2 1 1  40 ARG H    .  40 . HN   1 1 
        920 1 1 1 1  39 LYS H    .  39 . HN   1 1 
        920 1 2 1 1  41 ARG H    .  41 . HN   1 1 
        921 1 1 1 1  38 GLU HA   .  38 . HA   1 1 
        921 1 2 1 1  41 ARG H    .  41 . HN   1 1 
        922 1 1 1 1  42 ARG H    .  42 . HN   1 1 
        922 1 2 1 1  44 ARG H    .  44 . HN   1 1 
        923 1 1 1 1  42 ARG HA   .  42 . HA   1 1 
        923 1 2 1 1  44 ARG H    .  44 . HN   1 1 
        924 1 1 1 1  44 ARG H    .  44 . HN   1 1 
        924 1 2 1 1  46 GLU H    .  46 . HN   1 1 
        925 1 1 1 1  43 GLU H    .  43 . HN   1 1 
        925 1 2 1 1  45 LEU H    .  45 . HN   1 1 
        926 1 1 1 1  41 ARG HA   .  41 . HA   1 1 
        926 1 2 1 1  45 LEU H    .  45 . HN   1 1 
        927 1 1 1 1  44 ARG HA   .  44 . HA   1 1 
        927 1 2 1 1  46 GLU H    .  46 . HN   1 1 
        928 1 1 1 1  45 LEU HA   .  45 . HA   1 1 
        928 1 2 1 1  47 GLU H    .  47 . HN   1 1 
        929 1 1 1 1  45 LEU H    .  45 . HN   1 1 
        929 1 2 1 1  47 GLU H    .  47 . HN   1 1 
        930 1 1 1 1  45 LEU HA   .  45 . HA   1 1 
        930 1 2 1 1  48 PHE H    .  48 . HN   1 1 
        931 1 1 1 1  47 GLU HA   .  47 . HA   1 1 
        931 1 2 1 1  49 GLU H    .  49 . HN   1 1 
        932 1 1 1 1  47 GLU H    .  47 . HN   1 1 
        932 1 2 1 1  49 GLU H    .  49 . HN   1 1 
        933 1 1 1 1  46 GLU HA   .  46 . HA   1 1 
        933 1 2 1 1  49 GLU H    .  49 . HN   1 1 
        934 1 1 1 1  48 PHE H    .  48 . HN   1 1 
        934 1 2 1 1  50 LYS H    .  50 . HN   1 1 
        935 1 1 1 1  46 GLU HA   .  46 . HA   1 1 
        935 1 2 1 1  50 LYS H    .  50 . HN   1 1 
        936 1 1 1 1  62 GLU H    .  62 . HN   1 1 
        936 1 2 1 1  64 PHE H    .  64 . HN   1 1 
        937 1 1 1 1  61 LYS HA   .  61 . HA   1 1 
        937 1 2 1 1  64 PHE H    .  64 . HN   1 1 
        938 1 1 1 1  64 PHE H    .  64 . HN   1 1 
        938 1 2 1 1  64 PHE HB2  .  64 . HB2  1 1 
        939 1 1 1 1  63 ASP HA   .  63 . HA   1 1 
        939 1 2 1 1  65 ARG H    .  65 . HN   1 1 
        940 1 1 1 1  63 ASP H    .  63 . HN   1 1 
        940 1 2 1 1  65 ARG H    .  65 . HN   1 1 
        941 1 1 1 1  62 GLU HA   .  62 . HA   1 1 
        941 1 2 1 1  65 ARG H    .  65 . HN   1 1 
        942 1 1 1 1  61 LYS HA   .  61 . HA   1 1 
        942 1 2 1 1  65 ARG H    .  65 . HN   1 1 
        943 1 1 1 1  64 PHE HA   .  64 . HA   1 1 
        943 1 2 1 1  66 GLU H    .  66 . HN   1 1 
        944 1 1 1 1  64 PHE H    .  64 . HN   1 1 
        944 1 2 1 1  66 GLU H    .  66 . HN   1 1 
        945 1 1 1 1  63 ASP HA   .  63 . HA   1 1 
        945 1 2 1 1  66 GLU H    .  66 . HN   1 1 
        946 1 1 1 1  62 GLU HA   .  62 . HA   1 1 
        946 1 2 1 1  66 GLU H    .  66 . HN   1 1 
        947 1 1 1 1  66 GLU HA   .  66 . HA   1 1 
        947 1 2 1 1  68 ILE H    .  68 . HN   1 1 
        948 1 1 1 1  65 ARG HA   .  65 . HA   1 1 
        948 1 2 1 1  68 ILE H    .  68 . HN   1 1 
        949 1 1 1 1  64 PHE HA   .  64 . HA   1 1 
        949 1 2 1 1  68 ILE H    .  68 . HN   1 1 
        950 1 1 1 1  67 ASN HD21 .  67 . HD21 1 1 
        950 1 2 1 1  68 ILE H    .  68 . HN   1 1 
        951 1 1 1 1  66 GLU HA   .  66 . HA   1 1 
        951 1 2 1 1  69 ARG H    .  69 . HN   1 1 
        952 1 1 1 1  65 ARG HA   .  65 . HA   1 1 
        952 1 2 1 1  69 ARG H    .  69 . HN   1 1 
        953 1 1 1 1  68 ILE H    .  68 . HN   1 1 
        953 1 2 1 1  70 GLU H    .  70 . HN   1 1 
        954 1 1 1 1  67 ASN HA   .  67 . HA   1 1 
        954 1 2 1 1  70 GLU H    .  70 . HN   1 1 
        955 1 1 1 1  66 GLU HA   .  66 . HA   1 1 
        955 1 2 1 1  70 GLU H    .  70 . HN   1 1 
        956 1 1 1 1  70 GLU H    .  70 . HN   1 1 
        956 1 2 1 1  72 TRP H    .  72 . HN   1 1 
        957 1 1 1 1  69 ARG HA   .  69 . HA   1 1 
        957 1 2 1 1  71 ILE H    .  71 . HN   1 1 
        958 1 1 1 1  69 ARG H    .  69 . HN   1 1 
        958 1 2 1 1  71 ILE H    .  71 . HN   1 1 
        959 1 1 1 1  68 ILE HA   .  68 . HA   1 1 
        959 1 2 1 1  71 ILE H    .  71 . HN   1 1 
        960 1 1 1 1  67 ASN HA   .  67 . HA   1 1 
        960 1 2 1 1  71 ILE H    .  71 . HN   1 1 
        961 1 1 1 1  71 ILE H    .  71 . HN   1 1 
        961 1 2 1 1  73 GLU H    .  73 . HN   1 1 
        962 1 1 1 1  70 GLU HA   .  70 . HA   1 1 
        962 1 2 1 1  72 TRP H    .  72 . HN   1 1 
        963 1 1 1 1  69 ARG HA   .  69 . HA   1 1 
        963 1 2 1 1  72 TRP H    .  72 . HN   1 1 
        964 1 1 1 1  68 ILE HA   .  68 . HA   1 1 
        964 1 2 1 1  72 TRP H    .  72 . HN   1 1 
        965 1 1 1 1  90 GLU H    .  90 . HN   1 1 
        965 1 2 1 1  92 ILE H    .  92 . HN   1 1 
        966 1 1 1 1  89 LYS HA   .  89 . HA   1 1 
        966 1 2 1 1  91 TRP H    .  91 . HN   1 1 
        967 1 1 1 1  89 LYS H    .  89 . HN   1 1 
        967 1 2 1 1  91 TRP H    .  91 . HN   1 1 
        968 1 1 1 1  90 GLU HA   .  90 . HA   1 1 
        968 1 2 1 1  92 ILE H    .  92 . HN   1 1 
        969 1 1 1 1  92 ILE H    .  92 . HN   1 1 
        969 1 2 1 1  94 ASP H    .  94 . HN   1 1 
        970 1 1 1 1  91 TRP HA   .  91 . HA   1 1 
        970 1 2 1 1  93 LYS H    .  93 . HN   1 1 
        971 1 1 1 1  90 GLU HA   .  90 . HA   1 1 
        971 1 2 1 1  93 LYS H    .  93 . HN   1 1 
        972 1 1 1 1  92 ILE HA   .  92 . HA   1 1 
        972 1 2 1 1  94 ASP H    .  94 . HN   1 1 
        973 1 1 1 1  91 TRP HA   .  91 . HA   1 1 
        973 1 2 1 1  94 ASP H    .  94 . HN   1 1 
        974 1 1 1 1  94 ASP H    .  94 . HN   1 1 
        974 1 2 1 1  96 ILE H    .  96 . HN   1 1 
        975 1 1 1 1  93 LYS HA   .  93 . HA   1 1 
        975 1 2 1 1  95 PHE H    .  95 . HN   1 1 
        976 1 1 1 1  93 LYS H    .  93 . HN   1 1 
        976 1 2 1 1  95 PHE H    .  95 . HN   1 1 
        977 1 1 1 1  92 ILE HA   .  92 . HA   1 1 
        977 1 2 1 1  95 PHE H    .  95 . HN   1 1 
        978 1 1 1 1  91 TRP HA   .  91 . HA   1 1 
        978 1 2 1 1  95 PHE H    .  95 . HN   1 1 
        979 1 1 1 1  94 ASP HA   .  94 . HA   1 1 
        979 1 2 1 1  96 ILE H    .  96 . HN   1 1 
        980 1 1 1 1  93 LYS HA   .  93 . HA   1 1 
        980 1 2 1 1  96 ILE H    .  96 . HN   1 1 
        981 1 1 1 1  92 ILE HA   .  92 . HA   1 1 
        981 1 2 1 1  96 ILE H    .  96 . HN   1 1 
        982 1 1 1 1  96 ILE HA   .  96 . HA   1 1 
        982 1 2 1 1  98 GLU H    .  98 . HN   1 1 
        983 1 1 1 1  96 ILE H    .  96 . HN   1 1 
        983 1 2 1 1  98 GLU H    .  98 . HN   1 1 
        984 1 1 1 1  95 PHE HA   .  95 . HA   1 1 
        984 1 2 1 1  98 GLU H    .  98 . HN   1 1 
        985 1 1 1 1  94 ASP HA   .  94 . HA   1 1 
        985 1 2 1 1  98 GLU H    .  98 . HN   1 1 
        986 1 1 1 1  96 ILE HA   .  96 . HA   1 1 
        986 1 2 1 1  99 ALA H    .  99 . HN   1 1 
        987 1 1 1 1  99 ALA H    .  99 . HN   1 1 
        987 1 2 1 1 101 GLU H    . 101 . HN   1 1 
        988 1 1 1 1  98 GLU H    .  98 . HN   1 1 
        988 1 2 1 1 100 LYS H    . 100 . HN   1 1 
        989 1 1 1 1  99 ALA HA   .  99 . HA   1 1 
        989 1 2 1 1 101 GLU H    . 101 . HN   1 1 
        990 1 1 1 1 116 ASP H    . 116 . HN   1 1 
        990 1 2 1 1 118 ARG H    . 118 . HN   1 1 
        991 1 1 1 1 115 ASP H    . 115 . HN   1 1 
        991 1 2 1 1 117 ARG H    . 117 . HN   1 1 
        992 1 1 1 1 116 ASP HA   . 116 . HA   1 1 
        992 1 2 1 1 118 ARG H    . 118 . HN   1 1 
        993 1 1 1 1 115 ASP HA   . 115 . HA   1 1 
        993 1 2 1 1 118 ARG H    . 118 . HN   1 1 
        994 1 1 1 1 118 ARG HA   . 118 . HA   1 1 
        994 1 2 1 1 120 GLU H    . 120 . HN   1 1 
        995 1 1 1 1 118 ARG H    . 118 . HN   1 1 
        995 1 2 1 1 120 GLU H    . 120 . HN   1 1 
        996 1 1 1 1 117 ARG HA   . 117 . HA   1 1 
        996 1 2 1 1 120 GLU H    . 120 . HN   1 1 
        997 1 1 1 1 116 ASP HA   . 116 . HA   1 1 
        997 1 2 1 1 120 GLU H    . 120 . HN   1 1 
        998 1 1 1 1 120 GLU H    . 120 . HN   1 1 
        998 1 2 1 1 122 GLN H    . 122 . HN   1 1 
        999 1 1 1 1 118 ARG HA   . 118 . HA   1 1 
        999 1 2 1 1 121 ALA H    . 121 . HN   1 1 
       1000 1 1 1 1 121 ALA H    . 121 . HN   1 1 
       1000 1 2 1 1 123 GLN H    . 123 . HN   1 1 
       1001 1 1 1 1 121 ALA HA   . 121 . HA   1 1 
       1001 1 2 1 1 123 GLN H    . 123 . HN   1 1 
       1002 1 1 1 1 122 GLN HA   . 122 . HA   1 1 
       1002 1 2 1 1 124 GLU H    . 124 . HN   1 1 
       1003 1 1 1 1 122 GLN H    . 122 . HN   1 1 
       1003 1 2 1 1 124 GLU H    . 124 . HN   1 1 
       1004 1 1 1 1 121 ALA HA   . 121 . HA   1 1 
       1004 1 2 1 1 124 GLU H    . 124 . HN   1 1 
       1005 1 1 1 1 138 LYS H    . 138 . HN   1 1 
       1005 1 2 1 1 139 GLU H    . 139 . HN   1 1 
       1006 1 1 1 1 140 GLU H    . 140 . HN   1 1 
       1006 1 2 1 1 142 ILE H    . 142 . HN   1 1 
       1007 1 1 1 1 138 LYS HA   . 138 . HA   1 1 
       1007 1 2 1 1 141 LEU H    . 141 . HN   1 1 
       1008 1 1 1 1 141 LEU H    . 141 . HN   1 1 
       1008 1 2 1 1 143 GLU H    . 143 . HN   1 1 
       1009 1 1 1 1 140 GLU HA   . 140 . HA   1 1 
       1009 1 2 1 1 142 ILE H    . 142 . HN   1 1 
       1010 1 1 1 1 141 LEU H    . 141 . HN   1 1 
       1010 1 2 1 1 142 ILE H    . 142 . HN   1 1 
       1011 1 1 1 1 142 ILE HA   . 142 . HA   1 1 
       1011 1 2 1 1 144 GLN H    . 144 . HN   1 1 
       1012 1 1 1 1 142 ILE H    . 142 . HN   1 1 
       1012 1 2 1 1 144 GLN H    . 144 . HN   1 1 
       1013 1 1 1 1 141 LEU HA   . 141 . HA   1 1 
       1013 1 2 1 1 144 GLN H    . 144 . HN   1 1 
       1014 1 1 1 1 142 ILE HA   . 142 . HA   1 1 
       1014 1 2 1 1 145 VAL H    . 145 . HN   1 1 
       1015 1 1 1 1 141 LEU HA   . 141 . HA   1 1 
       1015 1 2 1 1 145 VAL H    . 145 . HN   1 1 
       1016 1 1 1 1 144 GLN HA   . 144 . HA   1 1 
       1016 1 2 1 1 146 ARG H    . 146 . HN   1 1 
       1017 1 1 1 1 144 GLN H    . 144 . HN   1 1 
       1017 1 2 1 1 146 ARG H    . 146 . HN   1 1 
       1018 1 1 1 1 143 GLU HA   . 143 . HA   1 1 
       1018 1 2 1 1 146 ARG H    . 146 . HN   1 1 
       1019 1 1 1 1 142 ILE HA   . 142 . HA   1 1 
       1019 1 2 1 1 146 ARG H    . 146 . HN   1 1 
       1020 1 1 1 1 145 VAL HA   . 145 . HA   1 1 
       1020 1 2 1 1 147 ARG H    . 147 . HN   1 1 
       1021 1 1 1 1 145 VAL H    . 145 . HN   1 1 
       1021 1 2 1 1 147 ARG H    . 147 . HN   1 1 
       1022 1 1 1 1 143 GLU HA   . 143 . HA   1 1 
       1022 1 2 1 1 147 ARG H    . 147 . HN   1 1 
       1023 1 1 1 1 146 ARG H    . 146 . HN   1 1 
       1023 1 2 1 1 148 PHE H    . 148 . HN   1 1 
       1024 1 1 1 1 145 VAL HA   . 145 . HA   1 1 
       1024 1 2 1 1 148 PHE H    . 148 . HN   1 1 
       1025 1 1 1 1 144 GLN HA   . 144 . HA   1 1 
       1025 1 2 1 1 148 PHE H    . 148 . HN   1 1 
       1026 1 1 1 1 147 ARG H    . 147 . HN   1 1 
       1026 1 2 1 1 149 VAL H    . 149 . HN   1 1 
       1027 1 1 1 1 146 ARG HA   . 146 . HA   1 1 
       1027 1 2 1 1 149 VAL H    . 149 . HN   1 1 
       1028 1 1 1 1 145 VAL HA   . 145 . HA   1 1 
       1028 1 2 1 1 149 VAL H    . 149 . HN   1 1 
       1029 1 1 1 1 149 VAL H    . 149 . HN   1 1 
       1029 1 2 1 1 151 LYS H    . 151 . HN   1 1 
       1030 1 1 1 1 148 PHE HA   . 148 . HA   1 1 
       1030 1 2 1 1 150 ARG H    . 150 . HN   1 1 
       1031 1 1 1 1 147 ARG HA   . 147 . HA   1 1 
       1031 1 2 1 1 150 ARG H    . 150 . HN   1 1 
       1032 1 1 1 1 147 ARG HA   . 147 . HA   1 1 
       1032 1 2 1 1 151 LYS H    . 151 . HN   1 1 
       1033 1 1 1 1   3 GLN HE22 .   3 . HE22 1 1 
       1033 1 2 1 1 107 PHE QE   . 107 . HE*  1 1 
       1034 1 1 1 1   3 GLN HE21 .   3 . HE21 1 1 
       1034 1 2 1 1 107 PHE HB2  . 107 . HB2  1 1 
       1035 1 1 1 1   3 GLN HE22 .   3 . HE22 1 1 
       1035 1 2 1 1 107 PHE HB2  . 107 . HB2  1 1 
       1036 1 1 1 1  45 LEU MD1  .  45 . HD1* 1 1 
       1036 1 2 1 1  49 GLU H    .  49 . HN   1 1 
       1037 1 1 1 1   4 ILE H    .   4 . HN   1 1 
       1037 1 2 1 1 106 VAL MG2  . 106 . HG2* 1 1 
       1038 1 1 1 1   4 ILE H    .   4 . HN   1 1 
       1038 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       1039 1 1 1 1  49 GLU H    .  49 . HN   1 1 
       1039 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       1040 1 1 1 1   4 ILE H    .   4 . HN   1 1 
       1040 1 2 1 1 104 VAL HB   . 104 . HB   1 1 
       1041 1 1 1 1   4 ILE H    .   4 . HN   1 1 
       1041 1 2 1 1 106 VAL HA   . 106 . HA   1 1 
       1042 1 1 1 1   4 ILE H    .   4 . HN   1 1 
       1042 1 2 1 1 107 PHE H    . 107 . HN   1 1 
       1043 1 1 1 1   5 PHE H    .   5 . HN   1 1 
       1043 1 2 1 1  82 VAL MG2  .  82 . HG2* 1 1 
       1044 1 1 1 1   6 VAL H    .   6 . HN   1 1 
       1044 1 2 1 1 109 VAL MG2  . 109 . HG2* 1 1 
       1045 1 1 1 1   6 VAL H    .   6 . HN   1 1 
       1045 1 2 1 1 107 PHE HB3  . 107 . HB1  1 1 
       1046 1 1 1 1   6 VAL H    .   6 . HN   1 1 
       1046 1 2 1 1 108 VAL HA   . 108 . HA   1 1 
       1047 1 1 1 1   7 VAL H    .   7 . HN   1 1 
       1047 1 2 1 1  83 ILE HA   .  83 . HA   1 1 
       1048 1 1 1 1   7 VAL H    .   7 . HN   1 1 
       1048 1 2 1 1  84 VAL MG2  .  84 . HG2* 1 1 
       1049 1 1 1 1   7 VAL H    .   7 . HN   1 1 
       1049 1 2 1 1  81 VAL MG1  .  81 . HG1* 1 1 
       1050 1 1 1 1   7 VAL H    .   7 . HN   1 1 
       1050 1 2 1 1  82 VAL HB   .  82 . HB   1 1 
       1051 1 1 1 1   8 PHE H    .   8 . HN   1 1 
       1051 1 2 1 1 110 TYR HA   . 110 . HA   1 1 
       1052 1 1 1 1   8 PHE H    .   8 . HN   1 1 
       1052 1 2 1 1   8 PHE QE   .   8 . HE*  1 1 
       1053 1 1 1 1   8 PHE H    .   8 . HN   1 1 
       1053 1 2 1 1 110 TYR QD   . 110 . HD*  1 1 
       1054 1 1 1 1   8 PHE H    .   8 . HN   1 1 
       1054 1 2 1 1 111 ASN H    . 111 . HN   1 1 
       1055 1 1 1 1   8 PHE H    .   8 . HN   1 1 
       1055 1 2 1 1 109 VAL HB   . 109 . HB   1 1 
       1056 1 1 1 1   9 SER H    .   9 . HN   1 1 
       1056 1 2 1 1  84 VAL HB   .  84 . HB   1 1 
       1057 1 1 1 1   9 SER H    .   9 . HN   1 1 
       1057 1 2 1 1  84 VAL MG1  .  84 . HG1* 1 1 
       1058 1 1 1 1   9 SER H    .   9 . HN   1 1 
       1058 1 2 1 1  15 LEU MD2  .  15 . HD2* 1 1 
       1059 1 1 1 1   7 VAL MG1  .   7 . HG1* 1 1 
       1059 1 2 1 1   9 SER H    .   9 . HN   1 1 
       1060 1 1 1 1   9 SER H    .   9 . HN   1 1 
       1060 1 2 1 1  83 ILE MG   .  83 . HG2* 1 1 
       1061 1 1 1 1   9 SER H    .   9 . HN   1 1 
       1061 1 2 1 1  83 ILE HA   .  83 . HA   1 1 
       1062 1 1 1 1   9 SER H    .   9 . HN   1 1 
       1062 1 2 1 1  87 ASP HA   .  87 . HA   1 1 
       1063 1 1 1 1   9 SER H    .   9 . HN   1 1 
       1063 1 2 1 1  85 THR HA   .  85 . HA   1 1 
       1064 1 1 1 1   9 SER H    .   9 . HN   1 1 
       1064 1 2 1 1  84 VAL H    .  84 . HN   1 1 
       1065 1 1 1 1   9 SER HG   .   9 . HG   1 1 
       1065 1 2 1 1  10 SER H    .  10 . HN   1 1 
       1066 1 1 1 1   9 SER HB3  .   9 . HB1  1 1 
       1066 1 2 1 1  11 ASP H    .  11 . HN   1 1 
       1067 1 1 1 1  11 ASP H    .  11 . HN   1 1 
       1067 1 2 1 1  14 ILE HB   .  14 . HB   1 1 
       1068 1 1 1 1  11 ASP H    .  11 . HN   1 1 
       1068 1 2 1 1  14 ILE HG13 .  14 . HG11 1 1 
       1069 1 1 1 1  11 ASP H    .  11 . HN   1 1 
       1069 1 2 1 1  14 ILE MD   .  14 . HD1* 1 1 
       1070 1 1 1 1  11 ASP H    .  11 . HN   1 1 
       1070 1 2 1 1  12 PRO HD3  .  12 . HD1  1 1 
       1071 1 1 1 1   9 SER HA   .   9 . HA   1 1 
       1071 1 2 1 1  11 ASP H    .  11 . HN   1 1 
       1072 1 1 1 1   9 SER HG   .   9 . HG   1 1 
       1072 1 2 1 1  11 ASP H    .  11 . HN   1 1 
       1073 1 1 1 1  11 ASP H    .  11 . HN   1 1 
       1073 1 2 1 1  14 ILE H    .  14 . HN   1 1 
       1074 1 1 1 1  13 GLU H    .  13 . HN   1 1 
       1074 1 2 1 1  14 ILE HB   .  14 . HB   1 1 
       1075 1 1 1 1  13 GLU H    .  13 . HN   1 1 
       1075 1 2 1 1  14 ILE HG13 .  14 . HG11 1 1 
       1076 1 1 1 1  13 GLU H    .  13 . HN   1 1 
       1076 1 2 1 1  15 LEU MD2  .  15 . HD2* 1 1 
       1077 1 1 1 1  13 GLU H    .  13 . HN   1 1 
       1077 1 2 1 1  14 ILE MD   .  14 . HD1* 1 1 
       1078 1 1 1 1  11 ASP HA   .  11 . HA   1 1 
       1078 1 2 1 1  13 GLU H    .  13 . HN   1 1 
       1079 1 1 1 1  13 GLU HB2  .  13 . HB2  1 1 
       1079 1 2 1 1  15 LEU H    .  15 . HN   1 1 
       1080 1 1 1 1  16 LYS H    .  16 . HN   1 1 
       1080 1 2 1 1  19 VAL H    .  19 . HN   1 1 
       1081 1 1 1 1  16 LYS H    .  16 . HN   1 1 
       1081 1 2 1 1  48 PHE HZ   .  48 . HZ   1 1 
       1082 1 1 1 1  12 PRO HB2  .  12 . HB2  1 1 
       1082 1 2 1 1  16 LYS H    .  16 . HN   1 1 
       1083 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
       1083 1 2 1 1  17 GLU H    .  17 . HN   1 1 
       1084 1 1 1 1  17 GLU H    .  17 . HN   1 1 
       1084 1 2 1 1 142 ILE MD   . 142 . HD1* 1 1 
       1085 1 1 1 1  19 VAL H    .  19 . HN   1 1 
       1085 1 2 1 1  83 ILE MD   .  83 . HD1* 1 1 
       1086 1 1 1 1  19 VAL H    .  19 . HN   1 1 
       1086 1 2 1 1  48 PHE QD   .  48 . HD*  1 1 
       1087 1 1 1 1  18 ILE MG   .  18 . HG2* 1 1 
       1087 1 2 1 1  21 GLU H    .  21 . HN   1 1 
       1088 1 1 1 1  21 GLU H    .  21 . HN   1 1 
       1088 1 2 1 1 142 ILE MG   . 142 . HG2* 1 1 
       1089 1 1 1 1  21 GLU H    .  21 . HN   1 1 
       1089 1 2 1 1 142 ILE MD   . 142 . HD1* 1 1 
       1090 1 1 1 1  18 ILE MG   .  18 . HG2* 1 1 
       1090 1 2 1 1  22 ILE H    .  22 . HN   1 1 
       1091 1 1 1 1  23 LYS H    .  23 . HN   1 1 
       1091 1 2 1 1  25 GLN H    .  25 . HN   1 1 
       1092 1 1 1 1  25 GLN H    .  25 . HN   1 1 
       1092 1 2 1 1  27 VAL H    .  27 . HN   1 1 
       1093 1 1 1 1  22 ILE HA   .  22 . HA   1 1 
       1093 1 2 1 1  25 GLN H    .  25 . HN   1 1 
       1094 1 1 1 1  25 GLN HE21 .  25 . HE21 1 1 
       1094 1 2 1 1 146 ARG HA   . 146 . HA   1 1 
       1095 1 1 1 1  22 ILE HA   .  22 . HA   1 1 
       1095 1 2 1 1  25 GLN HE21 .  25 . HE21 1 1 
       1096 1 1 1 1  24 ARG HD2  .  24 . HD2  1 1 
       1096 1 2 1 1  25 GLN HE21 .  25 . HE21 1 1 
       1097 1 1 1 1  24 ARG HD3  .  24 . HD1  1 1 
       1097 1 2 1 1  25 GLN HE21 .  25 . HE21 1 1 
       1098 1 1 1 1  25 GLN HE22 .  25 . HE22 1 1 
       1098 1 2 1 1 146 ARG HA   . 146 . HA   1 1 
       1099 1 1 1 1  25 GLN HE22 .  25 . HE22 1 1 
       1099 1 2 1 1 146 ARG HG2  . 146 . HG2  1 1 
       1100 1 1 1 1  25 GLN HE21 .  25 . HE21 1 1 
       1100 1 2 1 1 146 ARG HG2  . 146 . HG2  1 1 
       1101 1 1 1 1  21 GLU HB2  .  21 . HB2  1 1 
       1101 1 2 1 1  25 GLN HE21 .  25 . HE21 1 1 
       1102 1 1 1 1  25 GLN H    .  25 . HN   1 1 
       1102 1 2 1 1  27 VAL MG2  .  27 . HG2* 1 1 
       1103 1 1 1 1  22 ILE MG   .  22 . HG2* 1 1 
       1103 1 2 1 1  25 GLN H    .  25 . HN   1 1 
       1104 1 1 1 1  25 GLN HE21 .  25 . HE21 1 1 
       1104 1 2 1 1 142 ILE MG   . 142 . HG2* 1 1 
       1105 1 1 1 1  25 GLN HE21 .  25 . HE21 1 1 
       1105 1 2 1 1 145 VAL MG1  . 145 . HG1* 1 1 
       1106 1 1 1 1  25 GLN HE22 .  25 . HE22 1 1 
       1106 1 2 1 1 145 VAL MG1  . 145 . HG1* 1 1 
       1107 1 1 1 1  26 GLY H    .  26 . HN   1 1 
       1107 1 2 1 1  27 VAL HB   .  27 . HB   1 1 
       1108 1 1 1 1  26 GLY H    .  26 . HN   1 1 
       1108 1 2 1 1 149 VAL MG1  . 149 . HG1* 1 1 
       1109 1 1 1 1  26 GLY H    .  26 . HN   1 1 
       1109 1 2 1 1 149 VAL MG2  . 149 . HG2* 1 1 
       1110 1 1 1 1  26 GLY H    .  26 . HN   1 1 
       1110 1 2 1 1  27 VAL MG2  .  27 . HG2* 1 1 
       1111 1 1 1 1  22 ILE MG   .  22 . HG2* 1 1 
       1111 1 2 1 1  26 GLY H    .  26 . HN   1 1 
       1112 1 1 1 1  25 GLN HB2  .  25 . HB2  1 1 
       1112 1 2 1 1  27 VAL H    .  27 . HN   1 1 
       1113 1 1 1 1  25 GLN HB3  .  25 . HB1  1 1 
       1113 1 2 1 1  27 VAL H    .  27 . HN   1 1 
       1114 1 1 1 1  25 GLN HG3  .  25 . HG1  1 1 
       1114 1 2 1 1  27 VAL H    .  27 . HN   1 1 
       1115 1 1 1 1  28 ARG H    .  28 . HN   1 1 
       1115 1 2 1 1  80 VAL MG1  .  80 . HG1* 1 1 
       1116 1 1 1 1  29 VAL H    .  29 . HN   1 1 
       1116 1 2 1 1  53 VAL MG1  .  53 . HG1* 1 1 
       1117 1 1 1 1  29 VAL H    .  29 . HN   1 1 
       1117 1 2 1 1  80 VAL MG2  .  80 . HG2* 1 1 
       1118 1 1 1 1  30 VAL H    .  30 . HN   1 1 
       1118 1 2 1 1  80 VAL HB   .  80 . HB   1 1 
       1119 1 1 1 1  30 VAL H    .  30 . HN   1 1 
       1119 1 2 1 1  80 VAL MG2  .  80 . HG2* 1 1 
       1120 1 1 1 1  30 VAL H    .  30 . HN   1 1 
       1120 1 2 1 1  83 ILE H    .  83 . HN   1 1 
       1121 1 1 1 1  31 LEU H    .  31 . HN   1 1 
       1121 1 2 1 1  56 ARG H    .  56 . HN   1 1 
       1122 1 1 1 1  31 LEU H    .  31 . HN   1 1 
       1122 1 2 1 1  55 VAL H    .  55 . HN   1 1 
       1123 1 1 1 1  31 LEU H    .  31 . HN   1 1 
       1123 1 2 1 1  54 ASP H    .  54 . HN   1 1 
       1124 1 1 1 1  31 LEU H    .  31 . HN   1 1 
       1124 1 2 1 1  55 VAL HB   .  55 . HB   1 1 
       1125 1 1 1 1  31 LEU H    .  31 . HN   1 1 
       1125 1 2 1 1  54 ASP HB2  .  54 . HB2  1 1 
       1126 1 1 1 1  31 LEU H    .  31 . HN   1 1 
       1126 1 2 1 1  54 ASP HB3  .  54 . HB1  1 1 
       1127 1 1 1 1  31 LEU H    .  31 . HN   1 1 
       1127 1 2 1 1  53 VAL MG1  .  53 . HG1* 1 1 
       1128 1 1 1 1  31 LEU H    .  31 . HN   1 1 
       1128 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       1129 1 1 1 1  31 LEU H    .  31 . HN   1 1 
       1129 1 2 1 1  83 ILE HB   .  83 . HB   1 1 
       1130 1 1 1 1  32 LEU H    .  32 . HN   1 1 
       1130 1 2 1 1  84 VAL MG2  .  84 . HG2* 1 1 
       1131 1 1 1 1  32 LEU H    .  32 . HN   1 1 
       1131 1 2 1 1  83 ILE MG   .  83 . HG2* 1 1 
       1132 1 1 1 1  32 LEU H    .  32 . HN   1 1 
       1132 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       1133 1 1 1 1  32 LEU H    .  32 . HN   1 1 
       1133 1 2 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       1134 1 1 1 1  32 LEU H    .  32 . HN   1 1 
       1134 1 2 1 1  85 THR MG   .  85 . HG2* 1 1 
       1135 1 1 1 1  32 LEU H    .  32 . HN   1 1 
       1135 1 2 1 1  33 TYR HA   .  33 . HA   1 1 
       1136 1 1 1 1  32 LEU H    .  32 . HN   1 1 
       1136 1 2 1 1  85 THR H    .  85 . HN   1 1 
       1137 1 1 1 1  31 LEU MD2  .  31 . HD2* 1 1 
       1137 1 2 1 1  33 TYR H    .  33 . HN   1 1 
       1138 1 1 1 1  33 TYR H    .  33 . HN   1 1 
       1138 1 2 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       1139 1 1 1 1  33 TYR H    .  33 . HN   1 1 
       1139 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       1140 1 1 1 1  31 LEU HG   .  31 . HG   1 1 
       1140 1 2 1 1  33 TYR H    .  33 . HN   1 1 
       1141 1 1 1 1  31 LEU HB3  .  31 . HB1  1 1 
       1141 1 2 1 1  33 TYR H    .  33 . HN   1 1 
       1142 1 1 1 1  33 TYR H    .  33 . HN   1 1 
       1142 1 2 1 1  57 THR HA   .  57 . HA   1 1 
       1143 1 1 1 1  33 TYR H    .  33 . HN   1 1 
       1143 1 2 1 1  56 ARG H    .  56 . HN   1 1 
       1144 1 1 1 1  34 SER H    .  34 . HN   1 1 
       1144 1 2 1 1  34 SER HG   .  34 . HG   1 1 
       1145 1 1 1 1  34 SER HG   .  34 . HG   1 1 
       1145 1 2 1 1  35 ASP H    .  35 . HN   1 1 
       1146 1 1 1 1  35 ASP H    .  35 . HN   1 1 
       1146 1 2 1 1  36 GLN HA   .  36 . HA   1 1 
       1147 1 1 1 1  34 SER H    .  34 . HN   1 1 
       1147 1 2 1 1  85 THR HB   .  85 . HB   1 1 
       1148 1 1 1 1  34 SER H    .  34 . HN   1 1 
       1148 1 2 1 1  85 THR MG   .  85 . HG2* 1 1 
       1149 1 1 1 1  34 SER H    .  34 . HN   1 1 
       1149 1 2 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       1150 1 1 1 1  35 ASP H    .  35 . HN   1 1 
       1150 1 2 1 1  58 VAL HB   .  58 . HB   1 1 
       1151 1 1 1 1  35 ASP H    .  35 . HN   1 1 
       1151 1 2 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       1152 1 1 1 1  33 TYR HB3  .  33 . HB1  1 1 
       1152 1 2 1 1  35 ASP H    .  35 . HN   1 1 
       1153 1 1 1 1  36 GLN H    .  36 . HN   1 1 
       1153 1 2 1 1  37 ASP HA   .  37 . HA   1 1 
       1154 1 1 1 1  35 ASP HA   .  35 . HA   1 1 
       1154 1 2 1 1  37 ASP H    .  37 . HN   1 1 
       1155 1 1 1 1  37 ASP H    .  37 . HN   1 1 
       1155 1 2 1 1  41 ARG HB2  .  41 . HB2  1 1 
       1156 1 1 1 1  43 GLU H    .  43 . HN   1 1 
       1156 1 2 1 1  44 ARG HB2  .  44 . HB2  1 1 
       1157 1 1 1 1  98 GLU H    .  98 . HN   1 1 
       1157 1 2 1 1  99 ALA MB   .  99 . HB*  1 1 
       1158 1 1 1 1  96 ILE MG   .  96 . HG2* 1 1 
       1158 1 2 1 1  98 GLU H    .  98 . HN   1 1 
       1159 1 1 1 1  68 ILE MG   .  68 . HG2* 1 1 
       1159 1 2 1 1  98 GLU H    .  98 . HN   1 1 
       1160 1 1 1 1  68 ILE MD   .  68 . HD1* 1 1 
       1160 1 2 1 1  98 GLU H    .  98 . HN   1 1 
       1161 1 1 1 1  33 TYR QE   .  33 . HE*  1 1 
       1161 1 2 1 1  44 ARG H    .  44 . HN   1 1 
       1162 1 1 1 1  33 TYR QD   .  33 . HD*  1 1 
       1162 1 2 1 1  45 LEU H    .  45 . HN   1 1 
       1163 1 1 1 1  20 ARG H    .  20 . HN   1 1 
       1163 1 2 1 1  48 PHE QD   .  48 . HD*  1 1 
       1164 1 1 1 1  46 GLU H    .  46 . HN   1 1 
       1164 1 2 1 1  48 PHE QD   .  48 . HD*  1 1 
       1165 1 1 1 1  47 GLU H    .  47 . HN   1 1 
       1165 1 2 1 1  48 PHE QD   .  48 . HD*  1 1 
       1166 1 1 1 1  48 PHE H    .  48 . HN   1 1 
       1166 1 2 1 1  49 GLU HG2  .  49 . HG2  1 1 
       1167 1 1 1 1  48 PHE H    .  48 . HN   1 1 
       1167 1 2 1 1  49 GLU HG3  .  49 . HG1  1 1 
       1168 1 1 1 1  48 PHE H    .  48 . HN   1 1 
       1168 1 2 1 1  53 VAL MG2  .  53 . HG2* 1 1 
       1169 1 1 1 1  49 GLU H    .  49 . HN   1 1 
       1169 1 2 1 1  51 GLN H    .  51 . HN   1 1 
       1170 1 1 1 1  48 PHE HA   .  48 . HA   1 1 
       1170 1 2 1 1  51 GLN HE21 .  51 . HE21 1 1 
       1171 1 1 1 1  47 GLU HA   .  47 . HA   1 1 
       1171 1 2 1 1  51 GLN HE21 .  51 . HE21 1 1 
       1172 1 1 1 1  47 GLU HA   .  47 . HA   1 1 
       1172 1 2 1 1  51 GLN HE22 .  51 . HE22 1 1 
       1173 1 1 1 1  48 PHE HA   .  48 . HA   1 1 
       1173 1 2 1 1  51 GLN HE22 .  51 . HE22 1 1 
       1174 1 1 1 1  49 GLU HA   .  49 . HA   1 1 
       1174 1 2 1 1  51 GLN H    .  51 . HN   1 1 
       1175 1 1 1 1  48 PHE HA   .  48 . HA   1 1 
       1175 1 2 1 1  51 GLN H    .  51 . HN   1 1 
       1176 1 1 1 1  47 GLU HA   .  47 . HA   1 1 
       1176 1 2 1 1  51 GLN H    .  51 . HN   1 1 
       1177 1 1 1 1  50 LYS HG3  .  50 . HG1  1 1 
       1177 1 2 1 1  51 GLN HE21 .  51 . HE21 1 1 
       1178 1 1 1 1  51 GLN H    .  51 . HN   1 1 
       1178 1 2 1 1  53 VAL MG2  .  53 . HG2* 1 1 
       1179 1 1 1 1  50 LYS HB2  .  50 . HB2  1 1 
       1179 1 2 1 1  52 GLY H    .  52 . HN   1 1 
       1180 1 1 1 1  50 LYS HB3  .  50 . HB1  1 1 
       1180 1 2 1 1  52 GLY H    .  52 . HN   1 1 
       1181 1 1 1 1  52 GLY H    .  52 . HN   1 1 
       1181 1 2 1 1  53 VAL HB   .  53 . HB   1 1 
       1182 1 1 1 1  52 GLY H    .  52 . HN   1 1 
       1182 1 2 1 1  53 VAL MG2  .  53 . HG2* 1 1 
       1183 1 1 1 1  51 GLN HB3  .  51 . HB1  1 1 
       1183 1 2 1 1  53 VAL H    .  53 . HN   1 1 
       1184 1 1 1 1  48 PHE HB3  .  48 . HB1  1 1 
       1184 1 2 1 1  53 VAL H    .  53 . HN   1 1 
       1185 1 1 1 1  49 GLU HA   .  49 . HA   1 1 
       1185 1 2 1 1  53 VAL H    .  53 . HN   1 1 
       1186 1 1 1 1  29 VAL MG1  .  29 . HG1* 1 1 
       1186 1 2 1 1  54 ASP H    .  54 . HN   1 1 
       1187 1 1 1 1  30 VAL MG2  .  30 . HG2* 1 1 
       1187 1 2 1 1  54 ASP H    .  54 . HN   1 1 
       1188 1 1 1 1  54 ASP H    .  54 . HN   1 1 
       1188 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       1189 1 1 1 1  53 VAL MG2  .  53 . HG2* 1 1 
       1189 1 2 1 1  55 VAL H    .  55 . HN   1 1 
       1190 1 1 1 1  33 TYR H    .  33 . HN   1 1 
       1190 1 2 1 1  58 VAL H    .  58 . HN   1 1 
       1191 1 1 1 1  31 LEU HG   .  31 . HG   1 1 
       1191 1 2 1 1  56 ARG H    .  56 . HN   1 1 
       1192 1 1 1 1  31 LEU MD1  .  31 . HD1* 1 1 
       1192 1 2 1 1  83 ILE H    .  83 . HN   1 1 
       1193 1 1 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       1193 1 2 1 1  57 THR H    .  57 . HN   1 1 
       1194 1 1 1 1  57 THR H    .  57 . HN   1 1 
       1194 1 2 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       1195 1 1 1 1  57 THR H    .  57 . HN   1 1 
       1195 1 2 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       1196 1 1 1 1  45 LEU MD1  .  45 . HD1* 1 1 
       1196 1 2 1 1  57 THR H    .  57 . HN   1 1 
       1197 1 1 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       1197 1 2 1 1  57 THR H    .  57 . HN   1 1 
       1198 1 1 1 1  33 TYR HB3  .  33 . HB1  1 1 
       1198 1 2 1 1  57 THR H    .  57 . HN   1 1 
       1199 1 1 1 1  33 TYR H    .  33 . HN   1 1 
       1199 1 2 1 1  57 THR H    .  57 . HN   1 1 
       1200 1 1 1 1  33 TYR HB3  .  33 . HB1  1 1 
       1200 1 2 1 1  58 VAL H    .  58 . HN   1 1 
       1201 1 1 1 1  33 TYR HB2  .  33 . HB2  1 1 
       1201 1 2 1 1  58 VAL H    .  58 . HN   1 1 
       1202 1 1 1 1  59 GLU H    .  59 . HN   1 1 
       1202 1 2 1 1  63 ASP HB3  .  63 . HB1  1 1 
       1203 1 1 1 1  59 GLU H    .  59 . HN   1 1 
       1203 1 2 1 1  63 ASP HB2  .  63 . HB2  1 1 
       1204 1 1 1 1  60 ASP H    .  60 . HN   1 1 
       1204 1 2 1 1  63 ASP H    .  63 . HN   1 1 
       1205 1 1 1 1  60 ASP H    .  60 . HN   1 1 
       1205 1 2 1 1  64 PHE H    .  64 . HN   1 1 
       1206 1 1 1 1  61 LYS H    .  61 . HN   1 1 
       1206 1 2 1 1  91 TRP HZ2  .  91 . HZ2  1 1 
       1207 1 1 1 1  60 ASP H    .  60 . HN   1 1 
       1207 1 2 1 1  63 ASP HB3  .  63 . HB1  1 1 
       1208 1 1 1 1  60 ASP H    .  60 . HN   1 1 
       1208 1 2 1 1  63 ASP HB2  .  63 . HB2  1 1 
       1209 1 1 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       1209 1 2 1 1  60 ASP H    .  60 . HN   1 1 
       1210 1 1 1 1  62 GLU H    .  62 . HN   1 1 
       1210 1 2 1 1  63 ASP HA   .  63 . HA   1 1 
       1211 1 1 1 1  60 ASP HA   .  60 . HA   1 1 
       1211 1 2 1 1  62 GLU H    .  62 . HN   1 1 
       1212 1 1 1 1  60 ASP H    .  60 . HN   1 1 
       1212 1 2 1 1  62 GLU H    .  62 . HN   1 1 
       1213 1 1 1 1  60 ASP HA   .  60 . HA   1 1 
       1213 1 2 1 1  63 ASP H    .  63 . HN   1 1 
       1214 1 1 1 1  63 ASP H    .  63 . HN   1 1 
       1214 1 2 1 1  64 PHE HA   .  64 . HA   1 1 
       1215 1 1 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       1215 1 2 1 1  63 ASP H    .  63 . HN   1 1 
       1216 1 1 1 1  62 GLU HB2  .  62 . HB2  1 1 
       1216 1 2 1 1  64 PHE H    .  64 . HN   1 1 
       1217 1 1 1 1  58 VAL HB   .  58 . HB   1 1 
       1217 1 2 1 1  64 PHE H    .  64 . HN   1 1 
       1218 1 1 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       1218 1 2 1 1  64 PHE H    .  64 . HN   1 1 
       1219 1 1 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       1219 1 2 1 1  65 ARG H    .  65 . HN   1 1 
       1220 1 1 1 1 118 ARG H    . 118 . HN   1 1 
       1220 1 2 1 1 121 ALA MB   . 121 . HB*  1 1 
       1221 1 1 1 1  65 ARG H    .  65 . HN   1 1 
       1221 1 2 1 1  68 ILE MD   .  68 . HD1* 1 1 
       1222 1 1 1 1  63 ASP H    .  63 . HN   1 1 
       1222 1 2 1 1  66 GLU H    .  66 . HN   1 1 
       1223 1 1 1 1  66 GLU H    .  66 . HN   1 1 
       1223 1 2 1 1  67 ASN HD21 .  67 . HD21 1 1 
       1224 1 1 1 1  66 GLU H    .  66 . HN   1 1 
       1224 1 2 1 1  69 ARG H    .  69 . HN   1 1 
       1225 1 1 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       1225 1 2 1 1  66 GLU H    .  66 . HN   1 1 
       1226 1 1 1 1  67 ASN H    .  67 . HN   1 1 
       1226 1 2 1 1  68 ILE HG13 .  68 . HG11 1 1 
       1227 1 1 1 1  42 ARG H    .  42 . HN   1 1 
       1227 1 2 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       1228 1 1 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       1228 1 2 1 1  67 ASN HD21 .  67 . HD21 1 1 
       1229 1 1 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       1229 1 2 1 1  67 ASN HD22 .  67 . HD22 1 1 
       1230 1 1 1 1  63 ASP HA   .  63 . HA   1 1 
       1230 1 2 1 1  67 ASN HD21 .  67 . HD21 1 1 
       1231 1 1 1 1  63 ASP HA   .  63 . HA   1 1 
       1231 1 2 1 1  67 ASN HD22 .  67 . HD22 1 1 
       1232 1 1 1 1  32 LEU MD1  .  32 . HD1* 1 1 
       1232 1 2 1 1  68 ILE H    .  68 . HN   1 1 
       1233 1 1 1 1  64 PHE QD   .  64 . HD*  1 1 
       1233 1 2 1 1  68 ILE H    .  68 . HN   1 1 
       1234 1 1 1 1  69 ARG H    .  69 . HN   1 1 
       1234 1 2 1 1  69 ARG HE   .  69 . HE   1 1 
       1235 1 1 1 1  68 ILE MG   .  68 . HG2* 1 1 
       1235 1 2 1 1  71 ILE H    .  71 . HN   1 1 
       1236 1 1 1 1   4 ILE MD   .   4 . HD1* 1 1 
       1236 1 2 1 1  72 TRP H    .  72 . HN   1 1 
       1237 1 1 1 1  68 ILE MG   .  68 . HG2* 1 1 
       1237 1 2 1 1  72 TRP H    .  72 . HN   1 1 
       1238 1 1 1 1  72 TRP HE1  .  72 . HE1  1 1 
       1238 1 2 1 1  98 GLU HB3  .  98 . HB1  1 1 
       1239 1 1 1 1  69 ARG HB2  .  69 . HB2  1 1 
       1239 1 2 1 1  72 TRP HE1  .  72 . HE1  1 1 
       1240 1 1 1 1  69 ARG HG2  .  69 . HG2  1 1 
       1240 1 2 1 1  72 TRP HE1  .  72 . HE1  1 1 
       1241 1 1 1 1  69 ARG HG3  .  69 . HG1  1 1 
       1241 1 2 1 1  72 TRP HE1  .  72 . HE1  1 1 
       1242 1 1 1 1  69 ARG HA   .  69 . HA   1 1 
       1242 1 2 1 1  72 TRP HE1  .  72 . HE1  1 1 
       1243 1 1 1 1  72 TRP HE1  .  72 . HE1  1 1 
       1243 1 2 1 1  99 ALA HA   .  99 . HA   1 1 
       1244 1 1 1 1  72 TRP HE1  .  72 . HE1  1 1 
       1244 1 2 1 1  98 GLU HA   .  98 . HA   1 1 
       1245 1 1 1 1  72 TRP H    .  72 . HN   1 1 
       1245 1 2 1 1  74 ARG H    .  74 . HN   1 1 
       1246 1 1 1 1  72 TRP HE1  .  72 . HE1  1 1 
       1246 1 2 1 1 102 ARG HB3  . 102 . HB1  1 1 
       1247 1 1 1 1  72 TRP HE1  .  72 . HE1  1 1 
       1247 1 2 1 1 102 ARG HB2  . 102 . HB2  1 1 
       1248 1 1 1 1   4 ILE MD   .   4 . HD1* 1 1 
       1248 1 2 1 1  72 TRP HE1  .  72 . HE1  1 1 
       1249 1 1 1 1  72 TRP HE1  .  72 . HE1  1 1 
       1249 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       1250 1 1 1 1  68 ILE MG   .  68 . HG2* 1 1 
       1250 1 2 1 1  72 TRP HE1  .  72 . HE1  1 1 
       1251 1 1 1 1  73 GLU H    .  73 . HN   1 1 
       1251 1 2 1 1  75 TYR H    .  75 . HN   1 1 
       1252 1 1 1 1  73 GLU H    .  73 . HN   1 1 
       1252 1 2 1 1  74 ARG HB3  .  74 . HB1  1 1 
       1253 1 1 1 1  71 ILE HA   .  71 . HA   1 1 
       1253 1 2 1 1  74 ARG H    .  74 . HN   1 1 
       1254 1 1 1 1  75 TYR H    .  75 . HN   1 1 
       1254 1 2 1 1  76 PRO HB3  .  76 . HB1  1 1 
       1255 1 1 1 1  75 TYR H    .  75 . HN   1 1 
       1255 1 2 1 1  76 PRO HD3  .  76 . HD1  1 1 
       1256 1 1 1 1  75 TYR H    .  75 . HN   1 1 
       1256 1 2 1 1  76 PRO HD2  .  76 . HD2  1 1 
       1257 1 1 1 1  75 TYR H    .  75 . HN   1 1 
       1257 1 2 1 1  78 LEU MD2  .  78 . HD2* 1 1 
       1258 1 1 1 1  71 ILE MG   .  71 . HG2* 1 1 
       1258 1 2 1 1  75 TYR H    .  75 . HN   1 1 
       1259 1 1 1 1  75 TYR H    .  75 . HN   1 1 
       1259 1 2 1 1  80 VAL MG1  .  80 . HG1* 1 1 
       1260 1 1 1 1  77 GLN H    .  77 . HN   1 1 
       1260 1 2 1 1  78 LEU HA   .  78 . HA   1 1 
       1261 1 1 1 1  75 TYR HA   .  75 . HA   1 1 
       1261 1 2 1 1  77 GLN H    .  77 . HN   1 1 
       1262 1 1 1 1  77 GLN H    .  77 . HN   1 1 
       1262 1 2 1 1  79 ASP H    .  79 . HN   1 1 
       1263 1 1 1 1  77 GLN H    .  77 . HN   1 1 
       1263 1 2 1 1  78 LEU H    .  78 . HN   1 1 
       1264 1 1 1 1  77 GLN H    .  77 . HN   1 1 
       1264 1 2 1 1  78 LEU HG   .  78 . HG   1 1 
       1265 1 1 1 1  77 GLN H    .  77 . HN   1 1 
       1265 1 2 1 1  78 LEU MD2  .  78 . HD2* 1 1 
       1266 1 1 1 1  77 GLN HB3  .  77 . HB1  1 1 
       1266 1 2 1 1  79 ASP H    .  79 . HN   1 1 
       1267 1 1 1 1  80 VAL H    .  80 . HN   1 1 
       1267 1 2 1 1  82 VAL MG2  .  82 . HG2* 1 1 
       1268 1 1 1 1  27 VAL MG1  .  27 . HG1* 1 1 
       1268 1 2 1 1  80 VAL H    .  80 . HN   1 1 
       1269 1 1 1 1  75 TYR QD   .  75 . HD*  1 1 
       1269 1 2 1 1  80 VAL H    .  80 . HN   1 1 
       1270 1 1 1 1  81 VAL H    .  81 . HN   1 1 
       1270 1 2 1 1  82 VAL H    .  82 . HN   1 1 
       1271 1 1 1 1  80 VAL HA   .  80 . HA   1 1 
       1271 1 2 1 1  81 VAL H    .  81 . HN   1 1 
       1272 1 1 1 1  29 VAL HA   .  29 . HA   1 1 
       1272 1 2 1 1  81 VAL H    .  81 . HN   1 1 
       1273 1 1 1 1  22 ILE MG   .  22 . HG2* 1 1 
       1273 1 2 1 1  81 VAL H    .  81 . HN   1 1 
       1274 1 1 1 1  80 VAL MG2  .  80 . HG2* 1 1 
       1274 1 2 1 1  81 VAL H    .  81 . HN   1 1 
       1275 1 1 1 1  80 VAL MG1  .  80 . HG1* 1 1 
       1275 1 2 1 1  81 VAL H    .  81 . HN   1 1 
       1276 1 1 1 1  80 VAL HB   .  80 . HB   1 1 
       1276 1 2 1 1  81 VAL H    .  81 . HN   1 1 
       1277 1 1 1 1  31 LEU HA   .  31 . HA   1 1 
       1277 1 2 1 1  83 ILE H    .  83 . HN   1 1 
       1278 1 1 1 1   6 VAL HA   .   6 . HA   1 1 
       1278 1 2 1 1  83 ILE H    .  83 . HN   1 1 
       1279 1 1 1 1   6 VAL HA   .   6 . HA   1 1 
       1279 1 2 1 1 109 VAL H    . 109 . HN   1 1 
       1280 1 1 1 1   7 VAL H    .   7 . HN   1 1 
       1280 1 2 1 1  84 VAL H    .  84 . HN   1 1 
       1281 1 1 1 1  34 SER H    .  34 . HN   1 1 
       1281 1 2 1 1  85 THR H    .  85 . HN   1 1 
       1282 1 1 1 1   8 PHE HA   .   8 . HA   1 1 
       1282 1 2 1 1  84 VAL H    .  84 . HN   1 1 
       1283 1 1 1 1  31 LEU MD1  .  31 . HD1* 1 1 
       1283 1 2 1 1  84 VAL H    .  84 . HN   1 1 
       1284 1 1 1 1   6 VAL MG2  .   6 . HG2* 1 1 
       1284 1 2 1 1  84 VAL H    .  84 . HN   1 1 
       1285 1 1 1 1   7 VAL HB   .   7 . HB   1 1 
       1285 1 2 1 1  84 VAL H    .  84 . HN   1 1 
       1286 1 1 1 1  33 TYR HA   .  33 . HA   1 1 
       1286 1 2 1 1  85 THR H    .  85 . HN   1 1 
       1287 1 1 1 1  34 SER HG   .  34 . HG   1 1 
       1287 1 2 1 1  85 THR H    .  85 . HN   1 1 
       1288 1 1 1 1  34 SER HG   .  34 . HG   1 1 
       1288 1 2 1 1  86 THR H    .  86 . HN   1 1 
       1289 1 1 1 1   8 PHE HA   .   8 . HA   1 1 
       1289 1 2 1 1  86 THR H    .  86 . HN   1 1 
       1290 1 1 1 1  10 SER HA   .  10 . HA   1 1 
       1290 1 2 1 1  86 THR H    .  86 . HN   1 1 
       1291 1 1 1 1  31 LEU MD1  .  31 . HD1* 1 1 
       1291 1 2 1 1  85 THR H    .  85 . HN   1 1 
       1292 1 1 1 1  85 THR H    .  85 . HN   1 1 
       1292 1 2 1 1  86 THR MG   .  86 . HG2* 1 1 
       1293 1 1 1 1  32 LEU MD1  .  32 . HD1* 1 1 
       1293 1 2 1 1  85 THR H    .  85 . HN   1 1 
       1294 1 1 1 1  32 LEU HB3  .  32 . HB1  1 1 
       1294 1 2 1 1  85 THR H    .  85 . HN   1 1 
       1295 1 1 1 1  32 LEU HB2  .  32 . HB2  1 1 
       1295 1 2 1 1  85 THR H    .  85 . HN   1 1 
       1296 1 1 1 1  15 LEU MD2  .  15 . HD2* 1 1 
       1296 1 2 1 1  86 THR H    .  86 . HN   1 1 
       1297 1 1 1 1   9 SER H    .   9 . HN   1 1 
       1297 1 2 1 1  86 THR H    .  86 . HN   1 1 
       1298 1 1 1 1  84 VAL H    .  84 . HN   1 1 
       1298 1 2 1 1  86 THR H    .  86 . HN   1 1 
       1299 1 1 1 1  10 SER HB2  .  10 . HB2  1 1 
       1299 1 2 1 1  87 ASP H    .  87 . HN   1 1 
       1300 1 1 1 1  10 SER HB3  .  10 . HB1  1 1 
       1300 1 2 1 1  87 ASP H    .  87 . HN   1 1 
       1301 1 1 1 1  10 SER HA   .  10 . HA   1 1 
       1301 1 2 1 1  87 ASP H    .  87 . HN   1 1 
       1302 1 1 1 1  86 THR MG   .  86 . HG2* 1 1 
       1302 1 2 1 1  88 ASP H    .  88 . HN   1 1 
       1303 1 1 1 1  89 LYS H    .  89 . HN   1 1 
       1303 1 2 1 1  92 ILE MD   .  92 . HD1* 1 1 
       1304 1 1 1 1  90 GLU H    .  90 . HN   1 1 
       1304 1 2 1 1  91 TRP HB2  .  91 . HB2  1 1 
       1305 1 1 1 1  88 ASP HA   .  88 . HA   1 1 
       1305 1 2 1 1  90 GLU H    .  90 . HN   1 1 
       1306 1 1 1 1  90 GLU H    .  90 . HN   1 1 
       1306 1 2 1 1  91 TRP HD1  .  91 . HD1  1 1 
       1307 1 1 1 1  61 LYS H    .  61 . HN   1 1 
       1307 1 2 1 1  91 TRP HE1  .  91 . HE1  1 1 
       1308 1 1 1 1  61 LYS HE2  .  61 . HE2  1 1 
       1308 1 2 1 1  91 TRP HE1  .  91 . HE1  1 1 
       1309 1 1 1 1  61 LYS HE3  .  61 . HE1  1 1 
       1309 1 2 1 1  91 TRP HE1  .  91 . HE1  1 1 
       1310 1 1 1 1  61 LYS HA   .  61 . HA   1 1 
       1310 1 2 1 1  91 TRP HE1  .  91 . HE1  1 1 
       1311 1 1 1 1  90 GLU HB2  .  90 . HB2  1 1 
       1311 1 2 1 1  91 TRP HE1  .  91 . HE1  1 1 
       1312 1 1 1 1  61 LYS HB3  .  61 . HB1  1 1 
       1312 1 2 1 1  91 TRP HE1  .  91 . HE1  1 1 
       1313 1 1 1 1  61 LYS HD2  .  61 . HD2  1 1 
       1313 1 2 1 1  91 TRP HE1  .  91 . HE1  1 1 
       1314 1 1 1 1  61 LYS HD3  .  61 . HD1  1 1 
       1314 1 2 1 1  91 TRP HE1  .  91 . HE1  1 1 
       1315 1 1 1 1  61 LYS HG2  .  61 . HG2  1 1 
       1315 1 2 1 1  91 TRP HE1  .  91 . HE1  1 1 
       1316 1 1 1 1  61 LYS HG3  .  61 . HG1  1 1 
       1316 1 2 1 1  91 TRP HE1  .  91 . HE1  1 1 
       1317 1 1 1 1  86 THR MG   .  86 . HG2* 1 1 
       1317 1 2 1 1  91 TRP H    .  91 . HN   1 1 
       1318 1 1 1 1  90 GLU HB3  .  90 . HB1  1 1 
       1318 1 2 1 1  91 TRP HE1  .  91 . HE1  1 1 
       1319 1 1 1 1  93 LYS H    .  93 . HN   1 1 
       1319 1 2 1 1 125 PHE QE   . 125 . HE*  1 1 
       1320 1 1 1 1  64 PHE QE   .  64 . HE*  1 1 
       1320 1 2 1 1  94 ASP H    .  94 . HN   1 1 
       1321 1 1 1 1  95 PHE H    .  95 . HN   1 1 
       1321 1 2 1 1  96 ILE HB   .  96 . HB   1 1 
       1322 1 1 1 1  95 PHE H    .  95 . HN   1 1 
       1322 1 2 1 1  96 ILE HG13 .  96 . HG11 1 1 
       1323 1 1 1 1  95 PHE H    .  95 . HN   1 1 
       1323 1 2 1 1  96 ILE HG12 .  96 . HG12 1 1 
       1324 1 1 1 1  95 PHE H    .  95 . HN   1 1 
       1324 1 2 1 1  96 ILE MD   .  96 . HD1* 1 1 
       1325 1 1 1 1  95 PHE H    .  95 . HN   1 1 
       1325 1 2 1 1 108 VAL MG2  . 108 . HG2* 1 1 
       1326 1 1 1 1  64 PHE HZ   .  64 . HZ   1 1 
       1326 1 2 1 1  95 PHE H    .  95 . HN   1 1 
       1327 1 1 1 1  64 PHE QE   .  64 . HE*  1 1 
       1327 1 2 1 1  95 PHE H    .  95 . HN   1 1 
       1328 1 1 1 1  92 ILE MG   .  92 . HG2* 1 1 
       1328 1 2 1 1  96 ILE H    .  96 . HN   1 1 
       1329 1 1 1 1  96 ILE MG   .  96 . HG2* 1 1 
       1329 1 2 1 1  99 ALA H    .  99 . HN   1 1 
       1330 1 1 1 1  99 ALA H    .  99 . HN   1 1 
       1330 1 2 1 1 106 VAL MG1  . 106 . HG1* 1 1 
       1331 1 1 1 1  68 ILE MG   .  68 . HG2* 1 1 
       1331 1 2 1 1  99 ALA H    .  99 . HN   1 1 
       1332 1 1 1 1  99 ALA H    .  99 . HN   1 1 
       1332 1 2 1 1 100 LYS HB2  . 100 . HB2  1 1 
       1333 1 1 1 1  99 ALA H    .  99 . HN   1 1 
       1333 1 2 1 1 102 ARG H    . 102 . HN   1 1 
       1334 1 1 1 1  72 TRP HZ2  .  72 . HZ2  1 1 
       1334 1 2 1 1  99 ALA H    .  99 . HN   1 1 
       1335 1 1 1 1  96 ILE MG   .  96 . HG2* 1 1 
       1335 1 2 1 1 100 LYS H    . 100 . HN   1 1 
       1336 1 1 1 1  98 GLU HB2  .  98 . HB2  1 1 
       1336 1 2 1 1 100 LYS H    . 100 . HN   1 1 
       1337 1 1 1 1  99 ALA MB   .  99 . HB*  1 1 
       1337 1 2 1 1 101 GLU H    . 101 . HN   1 1 
       1338 1 1 1 1  99 ALA HA   .  99 . HA   1 1 
       1338 1 2 1 1 102 ARG H    . 102 . HN   1 1 
       1339 1 1 1 1 100 LYS H    . 100 . HN   1 1 
       1339 1 2 1 1 102 ARG H    . 102 . HN   1 1 
       1340 1 1 1 1 103 GLY H    . 103 . HN   1 1 
       1340 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       1341 1 1 1 1 101 GLU HB2  . 101 . HB2  1 1 
       1341 1 2 1 1 103 GLY H    . 103 . HN   1 1 
       1342 1 1 1 1 101 GLU HB3  . 101 . HB1  1 1 
       1342 1 2 1 1 103 GLY H    . 103 . HN   1 1 
       1343 1 1 1 1 100 LYS H    . 100 . HN   1 1 
       1343 1 2 1 1 104 VAL H    . 104 . HN   1 1 
       1344 1 1 1 1 102 ARG H    . 102 . HN   1 1 
       1344 1 2 1 1 104 VAL H    . 104 . HN   1 1 
       1345 1 1 1 1 102 ARG HB2  . 102 . HB2  1 1 
       1345 1 2 1 1 104 VAL H    . 104 . HN   1 1 
       1346 1 1 1 1  99 ALA MB   .  99 . HB*  1 1 
       1346 1 2 1 1 104 VAL H    . 104 . HN   1 1 
       1347 1 1 1 1  78 LEU MD1  .  78 . HD1* 1 1 
       1347 1 2 1 1 105 GLU H    . 105 . HN   1 1 
       1348 1 1 1 1   3 GLN HA   .   3 . HA   1 1 
       1348 1 2 1 1 105 GLU H    . 105 . HN   1 1 
       1349 1 1 1 1   3 GLN HB2  .   3 . HB2  1 1 
       1349 1 2 1 1 105 GLU H    . 105 . HN   1 1 
       1350 1 1 1 1   3 GLN H    .   3 . HN   1 1 
       1350 1 2 1 1 105 GLU H    . 105 . HN   1 1 
       1351 1 1 1 1   4 ILE H    .   4 . HN   1 1 
       1351 1 2 1 1 105 GLU H    . 105 . HN   1 1 
       1352 1 1 1 1   5 PHE HA   .   5 . HA   1 1 
       1352 1 2 1 1 107 PHE H    . 107 . HN   1 1 
       1353 1 1 1 1   4 ILE MG   .   4 . HG2* 1 1 
       1353 1 2 1 1 107 PHE H    . 107 . HN   1 1 
       1354 1 1 1 1   6 VAL MG1  .   6 . HG1* 1 1 
       1354 1 2 1 1 108 VAL H    . 108 . HN   1 1 
       1355 1 1 1 1 106 VAL MG1  . 106 . HG1* 1 1 
       1355 1 2 1 1 108 VAL H    . 108 . HN   1 1 
       1356 1 1 1 1 108 VAL H    . 108 . HN   1 1 
       1356 1 2 1 1 131 ASP HB2  . 131 . HB2  1 1 
       1357 1 1 1 1 108 VAL H    . 108 . HN   1 1 
       1357 1 2 1 1 131 ASP HB3  . 131 . HB1  1 1 
       1358 1 1 1 1 108 VAL H    . 108 . HN   1 1 
       1358 1 2 1 1 132 VAL HA   . 132 . HA   1 1 
       1359 1 1 1 1   6 VAL H    .   6 . HN   1 1 
       1359 1 2 1 1 109 VAL H    . 109 . HN   1 1 
       1360 1 1 1 1   7 VAL H    .   7 . HN   1 1 
       1360 1 2 1 1  83 ILE H    .  83 . HN   1 1 
       1361 1 1 1 1   8 PHE QD   .   8 . HD*  1 1 
       1361 1 2 1 1 109 VAL H    . 109 . HN   1 1 
       1362 1 1 1 1 111 ASN HD22 . 111 . HD22 1 1 
       1362 1 2 1 1 141 LEU H    . 141 . HN   1 1 
       1363 1 1 1 1 111 ASN HD21 . 111 . HD21 1 1 
       1363 1 2 1 1 112 ASN H    . 112 . HN   1 1 
       1364 1 1 1 1 111 ASN HD21 . 111 . HD21 1 1 
       1364 1 2 1 1 141 LEU H    . 141 . HN   1 1 
       1365 1 1 1 1   9 SER HG   .   9 . HG   1 1 
       1365 1 2 1 1 111 ASN HD22 . 111 . HD22 1 1 
       1366 1 1 1 1   9 SER HG   .   9 . HG   1 1 
       1366 1 2 1 1 111 ASN HD21 . 111 . HD21 1 1 
       1367 1 1 1 1 111 ASN HD22 . 111 . HD22 1 1 
       1367 1 2 1 1 136 SER HA   . 136 . HA   1 1 
       1368 1 1 1 1 111 ASN HD21 . 111 . HD21 1 1 
       1368 1 2 1 1 137 ASP HA   . 137 . HA   1 1 
       1369 1 1 1 1 111 ASN HD21 . 111 . HD21 1 1 
       1369 1 2 1 1 136 SER HA   . 136 . HA   1 1 
       1370 1 1 1 1   7 VAL MG1  .   7 . HG1* 1 1 
       1370 1 2 1 1 111 ASN H    . 111 . HN   1 1 
       1371 1 1 1 1 111 ASN HD22 . 111 . HD22 1 1 
       1371 1 2 1 1 141 LEU MD1  . 141 . HD1* 1 1 
       1372 1 1 1 1  14 ILE MD   .  14 . HD1* 1 1 
       1372 1 2 1 1 111 ASN HD21 . 111 . HD21 1 1 
       1373 1 1 1 1 111 ASN HD21 . 111 . HD21 1 1 
       1373 1 2 1 1 135 VAL MG2  . 135 . HG2* 1 1 
       1374 1 1 1 1 112 ASN H    . 112 . HN   1 1 
       1374 1 2 1 1 135 VAL MG2  . 135 . HG2* 1 1 
       1375 1 1 1 1 112 ASN H    . 112 . HN   1 1 
       1375 1 2 1 1 135 VAL MG1  . 135 . HG1* 1 1 
       1376 1 1 1 1 112 ASN H    . 112 . HN   1 1 
       1376 1 2 1 1 141 LEU MD1  . 141 . HD1* 1 1 
       1377 1 1 1 1 112 ASN H    . 112 . HN   1 1 
       1377 1 2 1 1 118 ARG HD3  . 118 . HD1  1 1 
       1378 1 1 1 1 112 ASN H    . 112 . HN   1 1 
       1378 1 2 1 1 135 VAL H    . 135 . HN   1 1 
       1379 1 1 1 1 112 ASN HA   . 112 . HA   1 1 
       1379 1 2 1 1 114 ASP H    . 114 . HN   1 1 
       1380 1 1 1 1 116 ASP H    . 116 . HN   1 1 
       1380 1 2 1 1 117 ARG HB2  . 117 . HB2  1 1 
       1381 1 1 1 1 121 ALA H    . 121 . HN   1 1 
       1381 1 2 1 1 134 THR MG   . 134 . HG2* 1 1 
       1382 1 1 1 1 122 GLN H    . 122 . HN   1 1 
       1382 1 2 1 1 125 PHE QD   . 125 . HD*  1 1 
       1383 1 1 1 1 120 GLU H    . 120 . HN   1 1 
       1383 1 2 1 1 123 GLN HE21 . 123 . HE21 1 1 
       1384 1 1 1 1 122 GLN HE21 . 122 . HE21 1 1 
       1384 1 2 1 1 132 VAL HB   . 132 . HB   1 1 
       1385 1 1 1 1 122 GLN HE21 . 122 . HE21 1 1 
       1385 1 2 1 1 134 THR MG   . 134 . HG2* 1 1 
       1386 1 1 1 1 122 GLN HE22 . 122 . HE22 1 1 
       1386 1 2 1 1 132 VAL HB   . 132 . HB   1 1 
       1387 1 1 1 1 122 GLN HE22 . 122 . HE22 1 1 
       1387 1 2 1 1 134 THR MG   . 134 . HG2* 1 1 
       1388 1 1 1 1 120 GLU HA   . 120 . HA   1 1 
       1388 1 2 1 1 123 GLN HE22 . 123 . HE22 1 1 
       1389 1 1 1 1 120 GLU HA   . 120 . HA   1 1 
       1389 1 2 1 1 123 GLN HE21 . 123 . HE21 1 1 
       1390 1 1 1 1 121 ALA MB   . 121 . HB*  1 1 
       1390 1 2 1 1 124 GLU H    . 124 . HN   1 1 
       1391 1 1 1 1 124 GLU H    . 124 . HN   1 1 
       1391 1 2 1 1 132 VAL MG1  . 132 . HG1* 1 1 
       1392 1 1 1 1 124 GLU H    . 124 . HN   1 1 
       1392 1 2 1 1 132 VAL MG2  . 132 . HG2* 1 1 
       1393 1 1 1 1 124 GLU H    . 124 . HN   1 1 
       1393 1 2 1 1 126 ARG H    . 126 . HN   1 1 
       1394 1 1 1 1 124 GLU H    . 124 . HN   1 1 
       1394 1 2 1 1 125 PHE QD   . 125 . HD*  1 1 
       1395 1 1 1 1 125 PHE H    . 125 . HN   1 1 
       1395 1 2 1 1 132 VAL MG1  . 132 . HG1* 1 1 
       1396 1 1 1 1 125 PHE H    . 125 . HN   1 1 
       1396 1 2 1 1 132 VAL MG2  . 132 . HG2* 1 1 
       1397 1 1 1 1  41 ARG H    .  41 . HN   1 1 
       1397 1 2 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       1398 1 1 1 1 127 SER H    . 127 . HN   1 1 
       1398 1 2 1 1 130 VAL H    . 130 . HN   1 1 
       1399 1 1 1 1 128 ASP HA   . 128 . HA   1 1 
       1399 1 2 1 1 130 VAL H    . 130 . HN   1 1 
       1400 1 1 1 1 106 VAL MG1  . 106 . HG1* 1 1 
       1400 1 2 1 1 131 ASP H    . 131 . HN   1 1 
       1401 1 1 1 1 106 VAL HB   . 106 . HB   1 1 
       1401 1 2 1 1 131 ASP H    . 131 . HN   1 1 
       1402 1 1 1 1 107 PHE HA   . 107 . HA   1 1 
       1402 1 2 1 1 131 ASP H    . 131 . HN   1 1 
       1403 1 1 1 1 108 VAL MG2  . 108 . HG2* 1 1 
       1403 1 2 1 1 131 ASP H    . 131 . HN   1 1 
       1404 1 1 1 1 108 VAL H    . 108 . HN   1 1 
       1404 1 2 1 1 131 ASP H    . 131 . HN   1 1 
       1405 1 1 1 1 108 VAL H    . 108 . HN   1 1 
       1405 1 2 1 1 132 VAL H    . 132 . HN   1 1 
       1406 1 1 1 1 126 ARG HG3  . 126 . HG1  1 1 
       1406 1 2 1 1 132 VAL H    . 132 . HN   1 1 
       1407 1 1 1 1 126 ARG HG2  . 126 . HG2  1 1 
       1407 1 2 1 1 132 VAL H    . 132 . HN   1 1 
       1408 1 1 1 1 109 VAL MG2  . 109 . HG2* 1 1 
       1408 1 2 1 1 133 ARG H    . 133 . HN   1 1 
       1409 1 1 1 1 108 VAL H    . 108 . HN   1 1 
       1409 1 2 1 1 133 ARG H    . 133 . HN   1 1 
       1410 1 1 1 1 110 TYR H    . 110 . HN   1 1 
       1410 1 2 1 1 133 ARG H    . 133 . HN   1 1 
       1411 1 1 1 1 134 THR H    . 134 . HN   1 1 
       1411 1 2 1 1 135 VAL MG1  . 135 . HG1* 1 1 
       1412 1 1 1 1 109 VAL MG1  . 109 . HG1* 1 1 
       1412 1 2 1 1 134 THR H    . 134 . HN   1 1 
       1413 1 1 1 1 111 ASN HA   . 111 . HA   1 1 
       1413 1 2 1 1 135 VAL H    . 135 . HN   1 1 
       1414 1 1 1 1 137 ASP H    . 137 . HN   1 1 
       1414 1 2 1 1 140 GLU HG2  . 140 . HG2  1 1 
       1415 1 1 1 1 137 ASP H    . 137 . HN   1 1 
       1415 1 2 1 1 140 GLU HG3  . 140 . HG1  1 1 
       1416 1 1 1 1 135 VAL HB   . 135 . HB   1 1 
       1416 1 2 1 1 137 ASP H    . 137 . HN   1 1 
       1417 1 1 1 1 137 ASP H    . 137 . HN   1 1 
       1417 1 2 1 1 140 GLU HB2  . 140 . HB2  1 1 
       1418 1 1 1 1 151 LYS H    . 151 . HN   1 1 
       1418 1 2 1 1 152 VAL MG2  . 152 . HG2* 1 1 
       1419 1 1 1 1 135 VAL MG2  . 135 . HG2* 1 1 
       1419 1 2 1 1 137 ASP H    . 137 . HN   1 1 
       1420 1 1 1 1  14 ILE MD   .  14 . HD1* 1 1 
       1420 1 2 1 1 138 LYS H    . 138 . HN   1 1 
       1421 1 1 1 1 137 ASP HB2  . 137 . HB2  1 1 
       1421 1 2 1 1 140 GLU H    . 140 . HN   1 1 
       1422 1 1 1 1 137 ASP H    . 137 . HN   1 1 
       1422 1 2 1 1 140 GLU H    . 140 . HN   1 1 
       1423 1 1 1 1 135 VAL MG2  . 135 . HG2* 1 1 
       1423 1 2 1 1 140 GLU H    . 140 . HN   1 1 
       1424 1 1 1 1 137 ASP H    . 137 . HN   1 1 
       1424 1 2 1 1 141 LEU H    . 141 . HN   1 1 
       1425 1 1 1 1 135 VAL MG2  . 135 . HG2* 1 1 
       1425 1 2 1 1 141 LEU H    . 141 . HN   1 1 
       1426 1 1 1 1 135 VAL MG1  . 135 . HG1* 1 1 
       1426 1 2 1 1 141 LEU H    . 141 . HN   1 1 
       1427 1 1 1 1 133 ARG HD3  . 133 . HD1  1 1 
       1427 1 2 1 1 144 GLN HE22 . 144 . HE22 1 1 
       1428 1 1 1 1 144 GLN H    . 144 . HN   1 1 
       1428 1 2 1 1 147 ARG HB2  . 147 . HB2  1 1 
       1429 1 1 1 1 144 GLN H    . 144 . HN   1 1 
       1429 1 2 1 1 147 ARG HG3  . 147 . HG1  1 1 
       1430 1 1 1 1 144 GLN H    . 144 . HN   1 1 
       1430 1 2 1 1 145 VAL MG2  . 145 . HG2* 1 1 
       1431 1 1 1 1 135 VAL MG1  . 135 . HG1* 1 1 
       1431 1 2 1 1 144 GLN H    . 144 . HN   1 1 
       1432 1 1 1 1 135 VAL MG1  . 135 . HG1* 1 1 
       1432 1 2 1 1 144 GLN HE21 . 144 . HE21 1 1 
       1433 1 1 1 1 144 GLN HE22 . 144 . HE22 1 1 
       1433 1 2 1 1 147 ARG HG3  . 147 . HG1  1 1 
       1434 1 1 1 1 135 VAL MG1  . 135 . HG1* 1 1 
       1434 1 2 1 1 144 GLN HE22 . 144 . HE22 1 1 
       1435 1 1 1 1 142 ILE MG   . 142 . HG2* 1 1 
       1435 1 2 1 1 145 VAL H    . 145 . HN   1 1 
       1436 1 1 1 1 142 ILE MG   . 142 . HG2* 1 1 
       1436 1 2 1 1 146 ARG H    . 146 . HN   1 1 
       1437 1 1 1 1   5 PHE HZ   .   5 . HZ   1 1 
       1437 1 2 1 1 145 VAL H    . 145 . HN   1 1 
       1438 1 1 1 1 145 VAL MG1  . 145 . HG1* 1 1 
       1438 1 2 1 1 147 ARG H    . 147 . HN   1 1 
       1439 1 1 1 1 149 VAL H    . 149 . HN   1 1 
       1439 1 2 1 1 152 VAL MG2  . 152 . HG2* 1 1 
       1440 1 1 1 1 149 VAL H    . 149 . HN   1 1 
       1440 1 2 1 1 152 VAL MG1  . 152 . HG1* 1 1 
       1441 1 1 1 1 146 ARG HB3  . 146 . HB1  1 1 
       1441 1 2 1 1 149 VAL H    . 149 . HN   1 1 
       1442 1 1 1 1 147 ARG HB2  . 147 . HB2  1 1 
       1442 1 2 1 1 149 VAL H    . 149 . HN   1 1 
       1443 1 1 1 1 149 VAL H    . 149 . HN   1 1 
       1443 1 2 1 1 150 ARG HB2  . 150 . HB2  1 1 
       1444 1 1 1 1 111 ASN HD21 . 111 . HD21 1 1 
       1444 1 2 1 1 137 ASP H    . 137 . HN   1 1 
       1445 1 1 1 1 149 VAL MG1  . 149 . HG1* 1 1 
       1445 1 2 1 1 151 LYS H    . 151 . HN   1 1 
       1446 1 1 1 1 149 VAL MG2  . 149 . HG2* 1 1 
       1446 1 2 1 1 151 LYS H    . 151 . HN   1 1 
       1447 1 1 1 1 149 VAL HA   . 149 . HA   1 1 
       1447 1 2 1 1 153 GLY H    . 153 . HN   1 1 
       1448 1 1 1 1 154 SER H    . 154 . HN   1 1 
       1448 1 2 1 1 155 LEU HG   . 155 . HG   1 1 
       1449 1 1 1 1 152 VAL MG2  . 152 . HG2* 1 1 
       1449 1 2 1 1 154 SER H    . 154 . HN   1 1 
       1450 1 1 1 1 152 VAL MG1  . 152 . HG1* 1 1 
       1450 1 2 1 1 154 SER H    . 154 . HN   1 1 
       1451 1 1 1 1 154 SER H    . 154 . HN   1 1 
       1451 1 2 1 1 155 LEU MD2  . 155 . HD2* 1 1 
       1452 1 1 1 1 106 VAL H    . 106 . HN   1 1 
       1452 1 2 1 1 130 VAL H    . 130 . HN   1 1 
       1453 1 1 1 1 128 ASP H    . 128 . HN   1 1 
       1453 1 2 1 1 130 VAL H    . 130 . HN   1 1 
       1454 1 1 1 1 130 VAL H    . 130 . HN   1 1 
       1454 1 2 1 1 131 ASP HA   . 131 . HA   1 1 
       1455 1 1 1 1   7 VAL HA   .   7 . HA   1 1 
       1455 1 2 1 1 110 TYR H    . 110 . HN   1 1 
       1456 1 1 1 1 110 TYR H    . 110 . HN   1 1 
       1456 1 2 1 1 132 VAL HA   . 132 . HA   1 1 
       1457 1 1 1 1 109 VAL HA   . 109 . HA   1 1 
       1457 1 2 1 1 133 ARG H    . 133 . HN   1 1 
       1458 1 1 1 1 110 TYR H    . 110 . HN   1 1 
       1458 1 2 1 1 133 ARG HB2  . 133 . HB2  1 1 
       1459 1 1 1 1 110 TYR H    . 110 . HN   1 1 
       1459 1 2 1 1 133 ARG HB3  . 133 . HB1  1 1 
       1460 1 1 1 1 107 PHE QE   . 107 . HE*  1 1 
       1460 1 2 1 1 108 VAL H    . 108 . HN   1 1 
       1461 1 1 1 1 107 PHE QD   . 107 . HD*  1 1 
       1461 1 2 1 1 131 ASP H    . 131 . HN   1 1 
       1462 1 1 1 1   6 VAL H    .   6 . HN   1 1 
       1462 1 2 1 1  81 VAL MG1  .  81 . HG1* 1 1 
       1463 1 1 1 1   6 VAL H    .   6 . HN   1 1 
       1463 1 2 1 1   7 VAL MG2  .   7 . HG2* 1 1 
       1464 1 1 1 1 150 ARG HA   . 150 . HA   1 1 
       1464 1 2 1 1 153 GLY H    . 153 . HN   1 1 
       1465 1 1 1 1 149 VAL MG1  . 149 . HG1* 1 1 
       1465 1 2 1 1 152 VAL H    . 152 . HN   1 1 
       1466 1 1 1 1 152 VAL H    . 152 . HN   1 1 
       1466 1 2 1 1 153 GLY HA2  . 153 . HA2  1 1 
       1467 1 1 1 1 152 VAL H    . 152 . HN   1 1 
       1467 1 2 1 1 153 GLY HA3  . 153 . HA1  1 1 
       1468 1 1 1 1 151 LYS H    . 151 . HN   1 1 
       1468 1 2 1 1 153 GLY H    . 153 . HN   1 1 
       1469 1 1 1 1 152 VAL H    . 152 . HN   1 1 
       1469 1 2 1 1 154 SER H    . 154 . HN   1 1 
       1470 1 1 1 1 150 ARG HA   . 150 . HA   1 1 
       1470 1 2 1 1 154 SER H    . 154 . HN   1 1 
       1471 1 1 1 1 151 LYS HA   . 151 . HA   1 1 
       1471 1 2 1 1 154 SER H    . 154 . HN   1 1 
       1472 1 1 1 1 152 VAL HB   . 152 . HB   1 1 
       1472 1 2 1 1 154 SER H    . 154 . HN   1 1 
       1473 1 1 1 1  72 TRP HE1  .  72 . HE1  1 1 
       1473 1 2 1 1  98 GLU H    .  98 . HN   1 1 
       1474 1 1 1 1 141 LEU H    . 141 . HN   1 1 
       1474 1 2 1 1 142 ILE HA   . 142 . HA   1 1 
       1475 1 1 1 1 148 PHE HZ   . 148 . HZ   1 1 
       1475 1 2 1 1 149 VAL H    . 149 . HN   1 1 
       1476 1 1 1 1 106 VAL H    . 106 . HN   1 1 
       1476 1 2 1 1 130 VAL HA   . 130 . HA   1 1 
       1477 1 1 1 1 111 ASN HD21 . 111 . HD21 1 1 
       1477 1 2 1 1 141 LEU HG   . 141 . HG   1 1 
       1478 1 1 1 1  14 ILE H    .  14 . HN   1 1 
       1478 1 2 1 1  15 LEU HB3  .  15 . HB1  1 1 
       1479 1 1 1 1  14 ILE H    .  14 . HN   1 1 
       1479 1 2 1 1  15 LEU HG   .  15 . HG   1 1 
       1480 1 1 1 1  34 SER HA   .  34 . HA   1 1 
       1480 1 2 1 1  58 VAL H    .  58 . HN   1 1 
       1481 1 1 1 1 110 TYR HB2  . 110 . HB2  1 1 
       1481 1 2 1 1 135 VAL H    . 135 . HN   1 1 
       1482 1 1 1 1  84 VAL MG1  .  84 . HG1* 1 1 
       1482 1 2 1 1  86 THR H    .  86 . HN   1 1 
       1483 1 1 1 1  84 VAL HB   .  84 . HB   1 1 
       1483 1 2 1 1  86 THR H    .  86 . HN   1 1 
       1484 1 1 1 1  84 VAL MG2  .  84 . HG2* 1 1 
       1484 1 2 1 1  86 THR H    .  86 . HN   1 1 
       1485 1 1 1 1  30 VAL H    .  30 . HN   1 1 
       1485 1 2 1 1  82 VAL HA   .  82 . HA   1 1 
       1486 1 1 1 1  30 VAL HA   .  30 . HA   1 1 
       1486 1 2 1 1  54 ASP H    .  54 . HN   1 1 
       1487 1 1 1 1  29 VAL H    .  29 . HN   1 1 
       1487 1 2 1 1  54 ASP H    .  54 . HN   1 1 
       1488 1 1 1 1   6 VAL H    .   6 . HN   1 1 
       1488 1 2 1 1 107 PHE H    . 107 . HN   1 1 
       1489 1 1 1 1   6 VAL H    .   6 . HN   1 1 
       1489 1 2 1 1  95 PHE HZ   .  95 . HZ   1 1 
       1490 1 1 1 1   6 VAL H    .   6 . HN   1 1 
       1490 1 2 1 1 107 PHE QD   . 107 . HD*  1 1 
       1491 1 1 1 1   6 VAL H    .   6 . HN   1 1 
       1491 1 2 1 1 107 PHE QE   . 107 . HE*  1 1 
       1492 1 1 1 1   7 VAL H    .   7 . HN   1 1 
       1492 1 2 1 1  82 VAL H    .  82 . HN   1 1 
       1493 1 1 1 1  59 GLU H    .  59 . HN   1 1 
       1493 1 2 1 1  63 ASP H    .  63 . HN   1 1 
       1494 1 1 1 1  59 GLU H    .  59 . HN   1 1 
       1494 1 2 1 1  64 PHE H    .  64 . HN   1 1 
       1495 1 1 1 1  66 GLU H    .  66 . HN   1 1 
       1495 1 2 1 1  68 ILE MD   .  68 . HD1* 1 1 
       1496 1 1 1 1  33 TYR QD   .  33 . HD*  1 1 
       1496 1 2 1 1  85 THR H    .  85 . HN   1 1 
       1497 1 1 1 1   8 PHE QD   .   8 . HD*  1 1 
       1497 1 2 1 1  86 THR H    .  86 . HN   1 1 
       1498 1 1 1 1  89 LYS H    .  89 . HN   1 1 
       1498 1 2 1 1 125 PHE HZ   . 125 . HZ   1 1 
       1499 1 1 1 1  89 LYS H    .  89 . HN   1 1 
       1499 1 2 1 1  92 ILE H    .  92 . HN   1 1 
       1500 1 1 1 1   3 GLN HE21 .   3 . HE21 1 1 
       1500 1 2 1 1 107 PHE QE   . 107 . HE*  1 1 
       1501 1 1 1 1  50 LYS HE2  .  50 . HE2  1 1 
       1501 1 2 1 1  51 GLN H    .  51 . HN   1 1 
       1502 1 1 1 1  50 LYS HE3  .  50 . HE1  1 1 
       1502 1 2 1 1  51 GLN H    .  51 . HN   1 1 
       1503 1 1 1 1   7 VAL MG2  .   7 . HG2* 1 1 
       1503 1 2 1 1 145 VAL H    . 145 . HN   1 1 
       1504 1 1 1 1  22 ILE MG   .  22 . HG2* 1 1 
       1504 1 2 1 1  27 VAL H    .  27 . HN   1 1 
       1505 1 1 1 1  22 ILE MG   .  22 . HG2* 1 1 
       1505 1 2 1 1  28 ARG H    .  28 . HN   1 1 
       1506 1 1 1 1 107 PHE QE   . 107 . HE*  1 1 
       1506 1 2 1 1 148 PHE H    . 148 . HN   1 1 
       1507 1 1 1 1   6 VAL MG1  .   6 . HG1* 1 1 
       1507 1 2 1 1 109 VAL H    . 109 . HN   1 1 
       1508 1 1 1 1   9 SER HA   .   9 . HA   1 1 
       1508 1 2 1 1 111 ASN H    . 111 . HN   1 1 
       1509 1 1 1 1 127 SER H    . 127 . HN   1 1 
       1509 1 2 1 1 130 VAL HB   . 130 . HB   1 1 
       1510 1 1 1 1  40 ARG HB2  .  40 . HB2  1 1 
       1510 1 2 1 1  41 ARG H    .  41 . HN   1 1 
       1511 1 1 1 1  28 ARG H    .  28 . HN   1 1 
       1511 1 2 1 1  80 VAL HA   .  80 . HA   1 1 
       1512 1 1 1 1  50 LYS HG2  .  50 . HG2  1 1 
       1512 1 2 1 1  51 GLN HE22 .  51 . HE22 1 1 
       1513 1 1 1 1  78 LEU HG   .  78 . HG   1 1 
       1513 1 2 1 1  79 ASP H    .  79 . HN   1 1 
       1514 1 1 1 1   8 PHE H    .   8 . HN   1 1 
       1514 1 2 1 1 110 TYR HB2  . 110 . HB2  1 1 
       1515 1 1 1 1  11 ASP H    .  11 . HN   1 1 
       1515 1 2 1 1  85 THR HA   .  85 . HA   1 1 
       1516 1 1 1 1 102 ARG H    . 102 . HN   1 1 
       1516 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       1517 1 1 1 1  32 LEU H    .  32 . HN   1 1 
       1517 1 2 1 1  34 SER H    .  34 . HN   1 1 
       1518 1 1 1 1  32 LEU H    .  32 . HN   1 1 
       1518 1 2 1 1  33 TYR QD   .  33 . HD*  1 1 
       1519 1 1 1 1  88 ASP H    .  88 . HN   1 1 
       1519 1 2 1 1  91 TRP HD1  .  91 . HD1  1 1 
       1520 1 1 1 1   8 PHE QE   .   8 . HE*  1 1 
       1520 1 2 1 1  91 TRP H    .  91 . HN   1 1 
       1521 1 1 1 1  86 THR MG   .  86 . HG2* 1 1 
       1521 1 2 1 1  91 TRP HE1  .  91 . HE1  1 1 
       1522 1 1 1 1  72 TRP HZ2  .  72 . HZ2  1 1 
       1522 1 2 1 1  98 GLU H    .  98 . HN   1 1 
       1523 1 1 1 1  30 VAL H    .  30 . HN   1 1 
       1523 1 2 1 1  81 VAL H    .  81 . HN   1 1 
       1524 1 1 1 1  32 LEU H    .  32 . HN   1 1 
       1524 1 2 1 1  83 ILE H    .  83 . HN   1 1 
       1525 1 1 1 1  30 VAL HA   .  30 . HA   1 1 
       1525 1 2 1 1  56 ARG HE   .  56 . HE   1 1 
       1526 1 1 1 1  56 ARG HA   .  56 . HA   1 1 
       1526 1 2 1 1  56 ARG HE   .  56 . HE   1 1 
       1527 1 1 1 1  56 ARG HE   .  56 . HE   1 1 
       1527 1 2 1 1  56 ARG HG3  .  56 . HG1  1 1 
       1528 1 1 1 1  56 ARG HE   .  56 . HE   1 1 
       1528 1 2 1 1  56 ARG HG2  .  56 . HG2  1 1 
       1529 1 1 1 1  30 VAL MG1  .  30 . HG1* 1 1 
       1529 1 2 1 1  56 ARG HE   .  56 . HE   1 1 
       1530 1 1 1 1  62 GLU HA   .  62 . HA   1 1 
       1530 1 2 1 1  65 ARG HE   .  65 . HE   1 1 
       1531 1 1 1 1  65 ARG HB2  .  65 . HB2  1 1 
       1531 1 2 1 1  65 ARG HE   .  65 . HE   1 1 
       1532 1 1 1 1  65 ARG HB3  .  65 . HB1  1 1 
       1532 1 2 1 1  65 ARG HE   .  65 . HE   1 1 
       1533 1 1 1 1  65 ARG HE   .  65 . HE   1 1 
       1533 1 2 1 1  68 ILE MD   .  68 . HD1* 1 1 
       1534 1 1 1 1  69 ARG HA   .  69 . HA   1 1 
       1534 1 2 1 1  69 ARG HE   .  69 . HE   1 1 
       1535 1 1 1 1  69 ARG HB2  .  69 . HB2  1 1 
       1535 1 2 1 1  69 ARG HE   .  69 . HE   1 1 
       1536 1 1 1 1  69 ARG HE   .  69 . HE   1 1 
       1536 1 2 1 1  69 ARG HG2  .  69 . HG2  1 1 
       1537 1 1 1 1  44 ARG H    .  44 . HN   1 1 
       1537 1 2 1 1  45 LEU HG   .  45 . HG   1 1 
       1538 1 1 1 1  72 TRP HD1  .  72 . HD1  1 1 
       1538 1 2 1 1 102 ARG HE   . 102 . HE   1 1 
       1539 1 1 1 1 102 ARG HB3  . 102 . HB1  1 1 
       1539 1 2 1 1 102 ARG HE   . 102 . HE   1 1 
       1540 1 1 1 1 102 ARG HB2  . 102 . HB2  1 1 
       1540 1 2 1 1 102 ARG HE   . 102 . HE   1 1 
       1541 1 1 1 1 146 ARG HE   . 146 . HE   1 1 
       1541 1 2 1 1 146 ARG HG2  . 146 . HG2  1 1 
       1542 1 1 1 1 146 ARG HE   . 146 . HE   1 1 
       1542 1 2 1 1 146 ARG HG3  . 146 . HG1  1 1 
       1543 1 1 1 1 146 ARG HB3  . 146 . HB1  1 1 
       1543 1 2 1 1 146 ARG HE   . 146 . HE   1 1 
       1544 1 1 1 1 146 ARG HB2  . 146 . HB2  1 1 
       1544 1 2 1 1 146 ARG HE   . 146 . HE   1 1 
       1545 1 1 1 1  25 GLN HE21 .  25 . HE21 1 1 
       1545 1 2 1 1 146 ARG HG3  . 146 . HG1  1 1 
       1546 1 1 1 1  25 GLN HE22 .  25 . HE22 1 1 
       1546 1 2 1 1 146 ARG HG3  . 146 . HG1  1 1 
       1547 1 1 1 1  35 ASP H    .  35 . HN   1 1 
       1547 1 2 1 1  41 ARG HB2  .  41 . HB2  1 1 
       1548 1 1 1 1  35 ASP H    .  35 . HN   1 1 
       1548 1 2 1 1  41 ARG HB3  .  41 . HB1  1 1 
       1549 1 1 1 1  35 ASP H    .  35 . HN   1 1 
       1549 1 2 1 1  57 THR MG   .  57 . HG2* 1 1 
       1550 1 1 1 1  35 ASP H    .  35 . HN   1 1 
       1550 1 2 1 1  85 THR MG   .  85 . HG2* 1 1 
       1551 1 1 1 1  68 ILE MG   .  68 . HG2* 1 1 
       1551 1 2 1 1  70 GLU H    .  70 . HN   1 1 
       1552 1 1 1 1  95 PHE H    .  95 . HN   1 1 
       1552 1 2 1 1 108 VAL MG1  . 108 . HG1* 1 1 
       1553 1 1 1 1 112 ASN H    . 112 . HN   1 1 
       1553 1 2 1 1 137 ASP H    . 137 . HN   1 1 
       1554 1 1 1 1 111 ASN HD21 . 111 . HD21 1 1 
       1554 1 2 1 1 141 LEU HA   . 141 . HA   1 1 
       1555 1 1 1 1  23 LYS HA   .  23 . HA   1 1 
       1555 1 2 1 1  27 VAL H    .  27 . HN   1 1 
       1556 1 1 1 1  25 GLN HA   .  25 . HA   1 1 
       1556 1 2 1 1  27 VAL H    .  27 . HN   1 1 
       1557 1 1 1 1  32 LEU H    .  32 . HN   1 1 
       1557 1 2 1 1  83 ILE HB   .  83 . HB   1 1 
       1558 1 1 1 1  50 LYS HA   .  50 . HA   1 1 
       1558 1 2 1 1  52 GLY H    .  52 . HN   1 1 
       1559 1 1 1 1  65 ARG HD2  .  65 . HD2  1 1 
       1559 1 2 1 1  66 GLU H    .  66 . HN   1 1 
       1560 1 1 1 1  65 ARG HD3  .  65 . HD1  1 1 
       1560 1 2 1 1  66 GLU H    .  66 . HN   1 1 
       1561 1 1 1 1   7 VAL MG1  .   7 . HG1* 1 1 
       1561 1 2 1 1  84 VAL H    .  84 . HN   1 1 
       1562 1 1 1 1  82 VAL MG1  .  82 . HG1* 1 1 
       1562 1 2 1 1  84 VAL H    .  84 . HN   1 1 
       1563 1 1 1 1  15 LEU MD2  .  15 . HD2* 1 1 
       1563 1 2 1 1  84 VAL H    .  84 . HN   1 1 
       1564 1 1 1 1 122 GLN HA   . 122 . HA   1 1 
       1564 1 2 1 1 125 PHE H    . 125 . HN   1 1 
       1565 1 1 1 1  35 ASP H    .  35 . HN   1 1 
       1565 1 2 1 1  41 ARG HE   .  41 . HE   1 1 
       1566 1 1 1 1  41 ARG HE   .  41 . HE   1 1 
       1566 1 2 1 1  42 ARG H    .  42 . HN   1 1 
       1567 1 1 1 1  33 TYR QD   .  33 . HD*  1 1 
       1567 1 2 1 1  41 ARG HE   .  41 . HE   1 1 
       1568 1 1 1 1  33 TYR QE   .  33 . HE*  1 1 
       1568 1 2 1 1  41 ARG HE   .  41 . HE   1 1 
       1569 1 1 1 1  41 ARG HB2  .  41 . HB2  1 1 
       1569 1 2 1 1  41 ARG HE   .  41 . HE   1 1 
       1570 1 1 1 1  49 GLU HA   .  49 . HA   1 1 
       1570 1 2 1 1  52 GLY H    .  52 . HN   1 1 
       1571 1 1 1 1   3 GLN HA   .   3 . HA   1 1 
       1571 1 2 1 1 105 GLU HB2  . 105 . HB2  1 1 
       1572 1 1 1 1   4 ILE MD   .   4 . HD1* 1 1 
       1572 1 2 1 1   4 ILE MG   .   4 . HG2* 1 1 
       1573 1 1 1 1   4 ILE H    .   4 . HN   1 1 
       1573 1 2 1 1   4 ILE HG12 .   4 . HG12 1 1 
       1574 1 1 1 1   4 ILE H    .   4 . HN   1 1 
       1574 1 2 1 1   4 ILE HG13 .   4 . HG11 1 1 
       1575 1 1 1 1   4 ILE H    .   4 . HN   1 1 
       1575 1 2 1 1   4 ILE MD   .   4 . HD1* 1 1 
       1576 1 1 1 1   4 ILE HA   .   4 . HA   1 1 
       1576 1 2 1 1   4 ILE MD   .   4 . HD1* 1 1 
       1577 1 1 1 1   4 ILE HB   .   4 . HB   1 1 
       1577 1 2 1 1   4 ILE MD   .   4 . HD1* 1 1 
       1578 1 1 1 1   7 VAL HA   .   7 . HA   1 1 
       1578 1 2 1 1   7 VAL MG1  .   7 . HG1* 1 1 
       1579 1 1 1 1   7 VAL HA   .   7 . HA   1 1 
       1579 1 2 1 1   7 VAL MG2  .   7 . HG2* 1 1 
       1580 1 1 1 1   8 PHE HA   .   8 . HA   1 1 
       1580 1 2 1 1   8 PHE QE   .   8 . HE*  1 1 
       1581 1 1 1 1  13 GLU HA   .  13 . HA   1 1 
       1581 1 2 1 1  13 GLU HG3  .  13 . HG1  1 1 
       1582 1 1 1 1  13 GLU HA   .  13 . HA   1 1 
       1582 1 2 1 1  13 GLU HG2  .  13 . HG2  1 1 
       1583 1 1 1 1  14 ILE HA   .  14 . HA   1 1 
       1583 1 2 1 1  14 ILE MD   .  14 . HD1* 1 1 
       1584 1 1 1 1  14 ILE HA   .  14 . HA   1 1 
       1584 1 2 1 1  14 ILE MG   .  14 . HG2* 1 1 
       1585 1 1 1 1  14 ILE HG13 .  14 . HG11 1 1 
       1585 1 2 1 1  14 ILE MG   .  14 . HG2* 1 1 
       1586 1 1 1 1  14 ILE HG12 .  14 . HG12 1 1 
       1586 1 2 1 1  14 ILE MG   .  14 . HG2* 1 1 
       1587 1 1 1 1  14 ILE HA   .  14 . HA   1 1 
       1587 1 2 1 1  14 ILE HG13 .  14 . HG11 1 1 
       1588 1 1 1 1  14 ILE HB   .  14 . HB   1 1 
       1588 1 2 1 1  14 ILE MD   .  14 . HD1* 1 1 
       1589 1 1 1 1  14 ILE MD   .  14 . HD1* 1 1 
       1589 1 2 1 1  14 ILE MG   .  14 . HG2* 1 1 
       1590 1 1 1 1  15 LEU HA   .  15 . HA   1 1 
       1590 1 2 1 1  15 LEU HG   .  15 . HG   1 1 
       1591 1 1 1 1  15 LEU HA   .  15 . HA   1 1 
       1591 1 2 1 1  18 ILE MD   .  18 . HD1* 1 1 
       1592 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
       1592 1 2 1 1  15 LEU HA   .  15 . HA   1 1 
       1593 1 1 1 1  15 LEU HB2  .  15 . HB2  1 1 
       1593 1 2 1 1  15 LEU HG   .  15 . HG   1 1 
       1594 1 1 1 1  15 LEU H    .  15 . HN   1 1 
       1594 1 2 1 1  15 LEU MD1  .  15 . HD1* 1 1 
       1595 1 1 1 1  15 LEU HA   .  15 . HA   1 1 
       1595 1 2 1 1  15 LEU MD1  .  15 . HD1* 1 1 
       1596 1 1 1 1  15 LEU HB3  .  15 . HB1  1 1 
       1596 1 2 1 1  15 LEU MD1  .  15 . HD1* 1 1 
       1597 1 1 1 1  15 LEU HB2  .  15 . HB2  1 1 
       1597 1 2 1 1  15 LEU MD1  .  15 . HD1* 1 1 
       1598 1 1 1 1  15 LEU H    .  15 . HN   1 1 
       1598 1 2 1 1  15 LEU MD2  .  15 . HD2* 1 1 
       1599 1 1 1 1  15 LEU HA   .  15 . HA   1 1 
       1599 1 2 1 1  15 LEU MD2  .  15 . HD2* 1 1 
       1600 1 1 1 1  15 LEU HB2  .  15 . HB2  1 1 
       1600 1 2 1 1  15 LEU MD2  .  15 . HD2* 1 1 
       1601 1 1 1 1  16 LYS HA   .  16 . HA   1 1 
       1601 1 2 1 1  16 LYS HG2  .  16 . HG2  1 1 
       1602 1 1 1 1  16 LYS HA   .  16 . HA   1 1 
       1602 1 2 1 1  16 LYS HG3  .  16 . HG1  1 1 
       1603 1 1 1 1  16 LYS HA   .  16 . HA   1 1 
       1603 1 2 1 1  16 LYS HD2  .  16 . HD2  1 1 
       1604 1 1 1 1  16 LYS HA   .  16 . HA   1 1 
       1604 1 2 1 1  16 LYS HD3  .  16 . HD1  1 1 
       1605 1 1 1 1  16 LYS HA   .  16 . HA   1 1 
       1605 1 2 1 1  16 LYS HE2  .  16 . HE2  1 1 
       1606 1 1 1 1  16 LYS HA   .  16 . HA   1 1 
       1606 1 2 1 1  16 LYS HE3  .  16 . HE1  1 1 
       1607 1 1 1 1  16 LYS H    .  16 . HN   1 1 
       1607 1 2 1 1  16 LYS HG2  .  16 . HG2  1 1 
       1608 1 1 1 1  16 LYS H    .  16 . HN   1 1 
       1608 1 2 1 1  16 LYS HE2  .  16 . HE2  1 1 
       1609 1 1 1 1  16 LYS H    .  16 . HN   1 1 
       1609 1 2 1 1  16 LYS HE3  .  16 . HE1  1 1 
       1610 1 1 1 1  17 GLU HA   .  17 . HA   1 1 
       1610 1 2 1 1  17 GLU HG2  .  17 . HG2  1 1 
       1611 1 1 1 1  17 GLU HA   .  17 . HA   1 1 
       1611 1 2 1 1  17 GLU HG3  .  17 . HG1  1 1 
       1612 1 1 1 1  17 GLU HB3  .  17 . HB1  1 1 
       1612 1 2 1 1  17 GLU HG3  .  17 . HG1  1 1 
       1613 1 1 1 1  59 GLU HG3  .  59 . HG1  1 1 
       1613 1 2 1 1  60 ASP H    .  60 . HN   1 1 
       1614 1 1 1 1  18 ILE HA   .  18 . HA   1 1 
       1614 1 2 1 1 142 ILE MD   . 142 . HD1* 1 1 
       1615 1 1 1 1  18 ILE HB   .  18 . HB   1 1 
       1615 1 2 1 1  18 ILE MD   .  18 . HD1* 1 1 
       1616 1 1 1 1  18 ILE HA   .  18 . HA   1 1 
       1616 1 2 1 1  18 ILE MD   .  18 . HD1* 1 1 
       1617 1 1 1 1  18 ILE MD   .  18 . HD1* 1 1 
       1617 1 2 1 1  18 ILE MG   .  18 . HG2* 1 1 
       1618 1 1 1 1  19 VAL HA   .  19 . HA   1 1 
       1618 1 2 1 1  19 VAL MG1  .  19 . HG1* 1 1 
       1619 1 1 1 1  19 VAL HA   .  19 . HA   1 1 
       1619 1 2 1 1  22 ILE MD   .  22 . HD1* 1 1 
       1620 1 1 1 1  19 VAL HA   .  19 . HA   1 1 
       1620 1 2 1 1  19 VAL MG2  .  19 . HG2* 1 1 
       1621 1 1 1 1  15 LEU MD1  .  15 . HD1* 1 1 
       1621 1 2 1 1  19 VAL MG2  .  19 . HG2* 1 1 
       1622 1 1 1 1  20 ARG HA   .  20 . HA   1 1 
       1622 1 2 1 1  23 LYS HG2  .  23 . HG2  1 1 
       1623 1 1 1 1  20 ARG HA   .  20 . HA   1 1 
       1623 1 2 1 1  20 ARG HG2  .  20 . HG2  1 1 
       1624 1 1 1 1  20 ARG HA   .  20 . HA   1 1 
       1624 1 2 1 1  20 ARG HG3  .  20 . HG1  1 1 
       1625 1 1 1 1  20 ARG H    .  20 . HN   1 1 
       1625 1 2 1 1  20 ARG HD2  .  20 . HD2  1 1 
       1626 1 1 1 1  20 ARG H    .  20 . HN   1 1 
       1626 1 2 1 1  20 ARG HD3  .  20 . HD1  1 1 
       1627 1 1 1 1  21 GLU HA   .  21 . HA   1 1 
       1627 1 2 1 1  21 GLU HG2  .  21 . HG2  1 1 
       1628 1 1 1 1  66 GLU HB3  .  66 . HB1  1 1 
       1628 1 2 1 1  67 ASN H    .  67 . HN   1 1 
       1629 1 1 1 1  21 GLU HA   .  21 . HA   1 1 
       1629 1 2 1 1  21 GLU HG3  .  21 . HG1  1 1 
       1630 1 1 1 1  22 ILE HA   .  22 . HA   1 1 
       1630 1 2 1 1  22 ILE MG   .  22 . HG2* 1 1 
       1631 1 1 1 1  22 ILE HA   .  22 . HA   1 1 
       1631 1 2 1 1  22 ILE HG13 .  22 . HG11 1 1 
       1632 1 1 1 1  22 ILE HA   .  22 . HA   1 1 
       1632 1 2 1 1  22 ILE HG12 .  22 . HG12 1 1 
       1633 1 1 1 1  22 ILE HB   .  22 . HB   1 1 
       1633 1 2 1 1  22 ILE MD   .  22 . HD1* 1 1 
       1634 1 1 1 1  22 ILE H    .  22 . HN   1 1 
       1634 1 2 1 1  22 ILE MG   .  22 . HG2* 1 1 
       1635 1 1 1 1  22 ILE HG13 .  22 . HG11 1 1 
       1635 1 2 1 1  22 ILE MG   .  22 . HG2* 1 1 
       1636 1 1 1 1  22 ILE HG12 .  22 . HG12 1 1 
       1636 1 2 1 1  22 ILE MG   .  22 . HG2* 1 1 
       1637 1 1 1 1  22 ILE MD   .  22 . HD1* 1 1 
       1637 1 2 1 1  22 ILE MG   .  22 . HG2* 1 1 
       1638 1 1 1 1  22 ILE HA   .  22 . HA   1 1 
       1638 1 2 1 1  22 ILE MD   .  22 . HD1* 1 1 
       1639 1 1 1 1  71 ILE HA   .  71 . HA   1 1 
       1639 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
       1640 1 1 1 1  23 LYS HA   .  23 . HA   1 1 
       1640 1 2 1 1  23 LYS HG3  .  23 . HG1  1 1 
       1641 1 1 1 1  23 LYS HA   .  23 . HA   1 1 
       1641 1 2 1 1  23 LYS HG2  .  23 . HG2  1 1 
       1642 1 1 1 1  23 LYS H    .  23 . HN   1 1 
       1642 1 2 1 1  23 LYS HD2  .  23 . HD2  1 1 
       1643 1 1 1 1  23 LYS H    .  23 . HN   1 1 
       1643 1 2 1 1  23 LYS HD3  .  23 . HD1  1 1 
       1644 1 1 1 1  24 ARG H    .  24 . HN   1 1 
       1644 1 2 1 1  24 ARG HD2  .  24 . HD2  1 1 
       1645 1 1 1 1  24 ARG H    .  24 . HN   1 1 
       1645 1 2 1 1  24 ARG HD3  .  24 . HD1  1 1 
       1646 1 1 1 1  25 GLN HA   .  25 . HA   1 1 
       1646 1 2 1 1  25 GLN HG2  .  25 . HG2  1 1 
       1647 1 1 1 1  25 GLN HA   .  25 . HA   1 1 
       1647 1 2 1 1  25 GLN HE21 .  25 . HE21 1 1 
       1648 1 1 1 1  25 GLN H    .  25 . HN   1 1 
       1648 1 2 1 1  25 GLN HG3  .  25 . HG1  1 1 
       1649 1 1 1 1  25 GLN HA   .  25 . HA   1 1 
       1649 1 2 1 1  25 GLN HG3  .  25 . HG1  1 1 
       1650 1 1 1 1  25 GLN HB3  .  25 . HB1  1 1 
       1650 1 2 1 1  25 GLN HG3  .  25 . HG1  1 1 
       1651 1 1 1 1  27 VAL HA   .  27 . HA   1 1 
       1651 1 2 1 1  27 VAL MG1  .  27 . HG1* 1 1 
       1652 1 1 1 1  27 VAL HA   .  27 . HA   1 1 
       1652 1 2 1 1  27 VAL MG2  .  27 . HG2* 1 1 
       1653 1 1 1 1  27 VAL H    .  27 . HN   1 1 
       1653 1 2 1 1  27 VAL MG1  .  27 . HG1* 1 1 
       1654 1 1 1 1  28 ARG HA   .  28 . HA   1 1 
       1654 1 2 1 1  28 ARG HG3  .  28 . HG1  1 1 
       1655 1 1 1 1  28 ARG HA   .  28 . HA   1 1 
       1655 1 2 1 1  28 ARG HG2  .  28 . HG2  1 1 
       1656 1 1 1 1  28 ARG HB3  .  28 . HB1  1 1 
       1656 1 2 1 1  28 ARG HG2  .  28 . HG2  1 1 
       1657 1 1 1 1  28 ARG HA   .  28 . HA   1 1 
       1657 1 2 1 1  28 ARG HD2  .  28 . HD2  1 1 
       1658 1 1 1 1  28 ARG HB3  .  28 . HB1  1 1 
       1658 1 2 1 1  28 ARG HD2  .  28 . HD2  1 1 
       1659 1 1 1 1  28 ARG HA   .  28 . HA   1 1 
       1659 1 2 1 1  28 ARG HD3  .  28 . HD1  1 1 
       1660 1 1 1 1  28 ARG HB3  .  28 . HB1  1 1 
       1660 1 2 1 1  28 ARG HD3  .  28 . HD1  1 1 
       1661 1 1 1 1  22 ILE MG   .  22 . HG2* 1 1 
       1661 1 2 1 1  29 VAL HB   .  29 . HB   1 1 
       1662 1 1 1 1  29 VAL HA   .  29 . HA   1 1 
       1662 1 2 1 1  29 VAL MG1  .  29 . HG1* 1 1 
       1663 1 1 1 1  29 VAL HA   .  29 . HA   1 1 
       1663 1 2 1 1  29 VAL MG2  .  29 . HG2* 1 1 
       1664 1 1 1 1 109 VAL MG2  . 109 . HG2* 1 1 
       1664 1 2 1 1 133 ARG HB2  . 133 . HB2  1 1 
       1665 1 1 1 1  30 VAL HB   .  30 . HB   1 1 
       1665 1 2 1 1  82 VAL MG2  .  82 . HG2* 1 1 
       1666 1 1 1 1  30 VAL H    .  30 . HN   1 1 
       1666 1 2 1 1  30 VAL MG1  .  30 . HG1* 1 1 
       1667 1 1 1 1  30 VAL HA   .  30 . HA   1 1 
       1667 1 2 1 1  30 VAL MG1  .  30 . HG1* 1 1 
       1668 1 1 1 1  30 VAL HA   .  30 . HA   1 1 
       1668 1 2 1 1  30 VAL MG2  .  30 . HG2* 1 1 
       1669 1 1 1 1  15 LEU MD1  .  15 . HD1* 1 1 
       1669 1 2 1 1  31 LEU MD2  .  31 . HD2* 1 1 
       1670 1 1 1 1  31 LEU H    .  31 . HN   1 1 
       1670 1 2 1 1  31 LEU MD1  .  31 . HD1* 1 1 
       1671 1 1 1 1  31 LEU HA   .  31 . HA   1 1 
       1671 1 2 1 1  31 LEU MD1  .  31 . HD1* 1 1 
       1672 1 1 1 1  15 LEU MD1  .  15 . HD1* 1 1 
       1672 1 2 1 1  31 LEU MD1  .  31 . HD1* 1 1 
       1673 1 1 1 1  31 LEU HB2  .  31 . HB2  1 1 
       1673 1 2 1 1  31 LEU MD1  .  31 . HD1* 1 1 
       1674 1 1 1 1  15 LEU HB2  .  15 . HB2  1 1 
       1674 1 2 1 1  31 LEU MD1  .  31 . HD1* 1 1 
       1675 1 1 1 1   5 PHE HB2  .   5 . HB2  1 1 
       1675 1 2 1 1  81 VAL MG1  .  81 . HG1* 1 1 
       1676 1 1 1 1  32 LEU HA   .  32 . HA   1 1 
       1676 1 2 1 1  32 LEU HG   .  32 . HG   1 1 
       1677 1 1 1 1  32 LEU HA   .  32 . HA   1 1 
       1677 1 2 1 1  32 LEU MD1  .  32 . HD1* 1 1 
       1678 1 1 1 1  32 LEU HA   .  32 . HA   1 1 
       1678 1 2 1 1  32 LEU MD2  .  32 . HD2* 1 1 
       1679 1 1 1 1  32 LEU HB2  .  32 . HB2  1 1 
       1679 1 2 1 1  32 LEU MD2  .  32 . HD2* 1 1 
       1680 1 1 1 1  34 SER H    .  34 . HN   1 1 
       1680 1 2 1 1  34 SER HB2  .  34 . HB2  1 1 
       1681 1 1 1 1  34 SER H    .  34 . HN   1 1 
       1681 1 2 1 1  34 SER HB3  .  34 . HB1  1 1 
       1682 1 1 1 1  36 GLN H    .  36 . HN   1 1 
       1682 1 2 1 1  36 GLN HG2  .  36 . HG2  1 1 
       1683 1 1 1 1  36 GLN H    .  36 . HN   1 1 
       1683 1 2 1 1  36 GLN HG3  .  36 . HG1  1 1 
       1684 1 1 1 1  38 GLU HA   .  38 . HA   1 1 
       1684 1 2 1 1  38 GLU HG2  .  38 . HG2  1 1 
       1685 1 1 1 1  38 GLU H    .  38 . HN   1 1 
       1685 1 2 1 1  38 GLU HG3  .  38 . HG1  1 1 
       1686 1 1 1 1  38 GLU HA   .  38 . HA   1 1 
       1686 1 2 1 1  38 GLU HG3  .  38 . HG1  1 1 
       1687 1 1 1 1  39 LYS HA   .  39 . HA   1 1 
       1687 1 2 1 1  39 LYS HG2  .  39 . HG2  1 1 
       1688 1 1 1 1  39 LYS HA   .  39 . HA   1 1 
       1688 1 2 1 1  39 LYS HG3  .  39 . HG1  1 1 
       1689 1 1 1 1 119 LYS HA   . 119 . HA   1 1 
       1689 1 2 1 1 119 LYS HD3  . 119 . HD1  1 1 
       1690 1 1 1 1  62 GLU H    .  62 . HN   1 1 
       1690 1 2 1 1  63 ASP HB2  .  63 . HB2  1 1 
       1691 1 1 1 1  39 LYS HA   .  39 . HA   1 1 
       1691 1 2 1 1  39 LYS HE2  .  39 . HE2  1 1 
       1692 1 1 1 1  39 LYS HA   .  39 . HA   1 1 
       1692 1 2 1 1  39 LYS HE3  .  39 . HE1  1 1 
       1693 1 1 1 1  40 ARG HA   .  40 . HA   1 1 
       1693 1 2 1 1  40 ARG HG2  .  40 . HG2  1 1 
       1694 1 1 1 1  40 ARG H    .  40 . HN   1 1 
       1694 1 2 1 1  40 ARG HB2  .  40 . HB2  1 1 
       1695 1 1 1 1  37 ASP HB2  .  37 . HB2  1 1 
       1695 1 2 1 1  40 ARG HB2  .  40 . HB2  1 1 
       1696 1 1 1 1  37 ASP HB2  .  37 . HB2  1 1 
       1696 1 2 1 1  40 ARG HB3  .  40 . HB1  1 1 
       1697 1 1 1 1  40 ARG HA   .  40 . HA   1 1 
       1697 1 2 1 1  40 ARG HG3  .  40 . HG1  1 1 
       1698 1 1 1 1 143 GLU H    . 143 . HN   1 1 
       1698 1 2 1 1 146 ARG HD2  . 146 . HD2  1 1 
       1699 1 1 1 1 142 ILE HB   . 142 . HB   1 1 
       1699 1 2 1 1 146 ARG HD2  . 146 . HD2  1 1 
       1700 1 1 1 1  41 ARG HA   .  41 . HA   1 1 
       1700 1 2 1 1  41 ARG HD2  .  41 . HD2  1 1 
       1701 1 1 1 1  41 ARG HA   .  41 . HA   1 1 
       1701 1 2 1 1  41 ARG HD3  .  41 . HD1  1 1 
       1702 1 1 1 1  42 ARG HA   .  42 . HA   1 1 
       1702 1 2 1 1  42 ARG HG3  .  42 . HG1  1 1 
       1703 1 1 1 1  42 ARG HA   .  42 . HA   1 1 
       1703 1 2 1 1  42 ARG HG2  .  42 . HG2  1 1 
       1704 1 1 1 1  20 ARG HG2  .  20 . HG2  1 1 
       1704 1 2 1 1  21 GLU H    .  21 . HN   1 1 
       1705 1 1 1 1  20 ARG HB3  .  20 . HB1  1 1 
       1705 1 2 1 1  20 ARG HG2  .  20 . HG2  1 1 
       1706 1 1 1 1  42 ARG HA   .  42 . HA   1 1 
       1706 1 2 1 1  42 ARG HD2  .  42 . HD2  1 1 
       1707 1 1 1 1  42 ARG HA   .  42 . HA   1 1 
       1707 1 2 1 1  42 ARG HD3  .  42 . HD1  1 1 
       1708 1 1 1 1  43 GLU H    .  43 . HN   1 1 
       1708 1 2 1 1  43 GLU HB2  .  43 . HB2  1 1 
       1709 1 1 1 1  43 GLU H    .  43 . HN   1 1 
       1709 1 2 1 1  43 GLU HG2  .  43 . HG2  1 1 
       1710 1 1 1 1  43 GLU H    .  43 . HN   1 1 
       1710 1 2 1 1  43 GLU HG3  .  43 . HG1  1 1 
       1711 1 1 1 1  44 ARG HA   .  44 . HA   1 1 
       1711 1 2 1 1  44 ARG HG3  .  44 . HG1  1 1 
       1712 1 1 1 1  44 ARG HA   .  44 . HA   1 1 
       1712 1 2 1 1  44 ARG HG2  .  44 . HG2  1 1 
       1713 1 1 1 1  44 ARG HA   .  44 . HA   1 1 
       1713 1 2 1 1  44 ARG HD2  .  44 . HD2  1 1 
       1714 1 1 1 1  44 ARG HB3  .  44 . HB1  1 1 
       1714 1 2 1 1  44 ARG HD2  .  44 . HD2  1 1 
       1715 1 1 1 1  44 ARG HA   .  44 . HA   1 1 
       1715 1 2 1 1  44 ARG HD3  .  44 . HD1  1 1 
       1716 1 1 1 1  44 ARG HB3  .  44 . HB1  1 1 
       1716 1 2 1 1  44 ARG HD3  .  44 . HD1  1 1 
       1717 1 1 1 1  42 ARG HA   .  42 . HA   1 1 
       1717 1 2 1 1  45 LEU HG   .  45 . HG   1 1 
       1718 1 1 1 1  42 ARG HA   .  42 . HA   1 1 
       1718 1 2 1 1  45 LEU MD1  .  45 . HD1* 1 1 
       1719 1 1 1 1  45 LEU HB2  .  45 . HB2  1 1 
       1719 1 2 1 1  45 LEU MD1  .  45 . HD1* 1 1 
       1720 1 1 1 1  42 ARG HA   .  42 . HA   1 1 
       1720 1 2 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       1721 1 1 1 1  41 ARG HB3  .  41 . HB1  1 1 
       1721 1 2 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       1722 1 1 1 1  45 LEU HB3  .  45 . HB1  1 1 
       1722 1 2 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       1723 1 1 1 1  46 GLU H    .  46 . HN   1 1 
       1723 1 2 1 1  46 GLU HB2  .  46 . HB2  1 1 
       1724 1 1 1 1  46 GLU H    .  46 . HN   1 1 
       1724 1 2 1 1  46 GLU HG3  .  46 . HG1  1 1 
       1725 1 1 1 1  17 GLU HB2  .  17 . HB2  1 1 
       1725 1 2 1 1  17 GLU HG2  .  17 . HG2  1 1 
       1726 1 1 1 1  47 GLU HA   .  47 . HA   1 1 
       1726 1 2 1 1  50 LYS HD3  .  50 . HD1  1 1 
       1727 1 1 1 1  47 GLU HA   .  47 . HA   1 1 
       1727 1 2 1 1  47 GLU HG3  .  47 . HG1  1 1 
       1728 1 1 1 1  47 GLU H    .  47 . HN   1 1 
       1728 1 2 1 1  47 GLU HB3  .  47 . HB1  1 1 
       1729 1 1 1 1  47 GLU HA   .  47 . HA   1 1 
       1729 1 2 1 1  47 GLU HG2  .  47 . HG2  1 1 
       1730 1 1 1 1  48 PHE HA   .  48 . HA   1 1 
       1730 1 2 1 1  48 PHE QD   .  48 . HD*  1 1 
       1731 1 1 1 1  49 GLU H    .  49 . HN   1 1 
       1731 1 2 1 1  49 GLU HB2  .  49 . HB2  1 1 
       1732 1 1 1 1  49 GLU H    .  49 . HN   1 1 
       1732 1 2 1 1  49 GLU HB3  .  49 . HB1  1 1 
       1733 1 1 1 1  49 GLU HA   .  49 . HA   1 1 
       1733 1 2 1 1  49 GLU HG3  .  49 . HG1  1 1 
       1734 1 1 1 1  49 GLU HA   .  49 . HA   1 1 
       1734 1 2 1 1  49 GLU HG2  .  49 . HG2  1 1 
       1735 1 1 1 1  50 LYS HA   .  50 . HA   1 1 
       1735 1 2 1 1  50 LYS HE2  .  50 . HE2  1 1 
       1736 1 1 1 1  50 LYS HA   .  50 . HA   1 1 
       1736 1 2 1 1  50 LYS HE3  .  50 . HE1  1 1 
       1737 1 1 1 1  50 LYS HB3  .  50 . HB1  1 1 
       1737 1 2 1 1  50 LYS HD2  .  50 . HD2  1 1 
       1738 1 1 1 1  50 LYS HA   .  50 . HA   1 1 
       1738 1 2 1 1  50 LYS HG3  .  50 . HG1  1 1 
       1739 1 1 1 1  50 LYS HE2  .  50 . HE2  1 1 
       1739 1 2 1 1  50 LYS HG3  .  50 . HG1  1 1 
       1740 1 1 1 1  50 LYS HE3  .  50 . HE1  1 1 
       1740 1 2 1 1  50 LYS HG3  .  50 . HG1  1 1 
       1741 1 1 1 1  50 LYS HA   .  50 . HA   1 1 
       1741 1 2 1 1  50 LYS HG2  .  50 . HG2  1 1 
       1742 1 1 1 1  50 LYS H    .  50 . HN   1 1 
       1742 1 2 1 1  50 LYS HD2  .  50 . HD2  1 1 
       1743 1 1 1 1  50 LYS HB2  .  50 . HB2  1 1 
       1743 1 2 1 1  50 LYS HD2  .  50 . HD2  1 1 
       1744 1 1 1 1  51 GLN HA   .  51 . HA   1 1 
       1744 1 2 1 1  51 GLN HG2  .  51 . HG2  1 1 
       1745 1 1 1 1  51 GLN HA   .  51 . HA   1 1 
       1745 1 2 1 1  51 GLN HG3  .  51 . HG1  1 1 
       1746 1 1 1 1  51 GLN H    .  51 . HN   1 1 
       1746 1 2 1 1  51 GLN HB3  .  51 . HB1  1 1 
       1747 1 1 1 1  53 VAL HA   .  53 . HA   1 1 
       1747 1 2 1 1  53 VAL MG2  .  53 . HG2* 1 1 
       1748 1 1 1 1  53 VAL H    .  53 . HN   1 1 
       1748 1 2 1 1  53 VAL MG1  .  53 . HG1* 1 1 
       1749 1 1 1 1  53 VAL HA   .  53 . HA   1 1 
       1749 1 2 1 1  53 VAL MG1  .  53 . HG1* 1 1 
       1750 1 1 1 1  55 VAL H    .  55 . HN   1 1 
       1750 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       1751 1 1 1 1  55 VAL HA   .  55 . HA   1 1 
       1751 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       1752 1 1 1 1  56 ARG HA   .  56 . HA   1 1 
       1752 1 2 1 1  56 ARG HG2  .  56 . HG2  1 1 
       1753 1 1 1 1  56 ARG HA   .  56 . HA   1 1 
       1753 1 2 1 1  56 ARG HD2  .  56 . HD2  1 1 
       1754 1 1 1 1  56 ARG H    .  56 . HN   1 1 
       1754 1 2 1 1  56 ARG HG2  .  56 . HG2  1 1 
       1755 1 1 1 1  56 ARG H    .  56 . HN   1 1 
       1755 1 2 1 1  56 ARG HG3  .  56 . HG1  1 1 
       1756 1 1 1 1  56 ARG HA   .  56 . HA   1 1 
       1756 1 2 1 1  56 ARG HG3  .  56 . HG1  1 1 
       1757 1 1 1 1  56 ARG HA   .  56 . HA   1 1 
       1757 1 2 1 1  56 ARG HD3  .  56 . HD1  1 1 
       1758 1 1 1 1  57 THR H    .  57 . HN   1 1 
       1758 1 2 1 1  57 THR HB   .  57 . HB   1 1 
       1759 1 1 1 1  57 THR HA   .  57 . HA   1 1 
       1759 1 2 1 1  57 THR MG   .  57 . HG2* 1 1 
       1760 1 1 1 1  58 VAL HA   .  58 . HA   1 1 
       1760 1 2 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       1761 1 1 1 1  58 VAL HA   .  58 . HA   1 1 
       1761 1 2 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       1762 1 1 1 1  59 GLU HA   .  59 . HA   1 1 
       1762 1 2 1 1  59 GLU HG2  .  59 . HG2  1 1 
       1763 1 1 1 1  59 GLU HA   .  59 . HA   1 1 
       1763 1 2 1 1  59 GLU HG3  .  59 . HG1  1 1 
       1764 1 1 1 1  61 LYS HA   .  61 . HA   1 1 
       1764 1 2 1 1  61 LYS HE2  .  61 . HE2  1 1 
       1765 1 1 1 1  61 LYS HA   .  61 . HA   1 1 
       1765 1 2 1 1  61 LYS HE3  .  61 . HE1  1 1 
       1766 1 1 1 1  61 LYS H    .  61 . HN   1 1 
       1766 1 2 1 1  61 LYS HB2  .  61 . HB2  1 1 
       1767 1 1 1 1  61 LYS H    .  61 . HN   1 1 
       1767 1 2 1 1  61 LYS HB3  .  61 . HB1  1 1 
       1768 1 1 1 1  61 LYS HA   .  61 . HA   1 1 
       1768 1 2 1 1  61 LYS HG2  .  61 . HG2  1 1 
       1769 1 1 1 1  61 LYS HA   .  61 . HA   1 1 
       1769 1 2 1 1  61 LYS HG3  .  61 . HG1  1 1 
       1770 1 1 1 1  62 GLU HA   .  62 . HA   1 1 
       1770 1 2 1 1  62 GLU HG2  .  62 . HG2  1 1 
       1771 1 1 1 1  62 GLU H    .  62 . HN   1 1 
       1771 1 2 1 1  62 GLU HB3  .  62 . HB1  1 1 
       1772 1 1 1 1  62 GLU HA   .  62 . HA   1 1 
       1772 1 2 1 1  62 GLU HG3  .  62 . HG1  1 1 
       1773 1 1 1 1  64 PHE HA   .  64 . HA   1 1 
       1773 1 2 1 1  64 PHE QD   .  64 . HD*  1 1 
       1774 1 1 1 1 150 ARG HB3  . 150 . HB1  1 1 
       1774 1 2 1 1 150 ARG HD3  . 150 . HD1  1 1 
       1775 1 1 1 1  38 GLU HA   .  38 . HA   1 1 
       1775 1 2 1 1  38 GLU HB3  .  38 . HB1  1 1 
       1776 1 1 1 1  66 GLU HA   .  66 . HA   1 1 
       1776 1 2 1 1  66 GLU HG3  .  66 . HG1  1 1 
       1777 1 1 1 1  66 GLU HA   .  66 . HA   1 1 
       1777 1 2 1 1  66 GLU HG2  .  66 . HG2  1 1 
       1778 1 1 1 1  68 ILE H    .  68 . HN   1 1 
       1778 1 2 1 1  68 ILE MD   .  68 . HD1* 1 1 
       1779 1 1 1 1  68 ILE HA   .  68 . HA   1 1 
       1779 1 2 1 1  68 ILE MD   .  68 . HD1* 1 1 
       1780 1 1 1 1  68 ILE MD   .  68 . HD1* 1 1 
       1780 1 2 1 1  68 ILE MG   .  68 . HG2* 1 1 
       1781 1 1 1 1  69 ARG HA   .  69 . HA   1 1 
       1781 1 2 1 1  69 ARG HG2  .  69 . HG2  1 1 
       1782 1 1 1 1  69 ARG HA   .  69 . HA   1 1 
       1782 1 2 1 1  69 ARG HG3  .  69 . HG1  1 1 
       1783 1 1 1 1  69 ARG HA   .  69 . HA   1 1 
       1783 1 2 1 1  69 ARG HD2  .  69 . HD2  1 1 
       1784 1 1 1 1  69 ARG HB2  .  69 . HB2  1 1 
       1784 1 2 1 1  69 ARG HD2  .  69 . HD2  1 1 
       1785 1 1 1 1  69 ARG HA   .  69 . HA   1 1 
       1785 1 2 1 1  69 ARG HD3  .  69 . HD1  1 1 
       1786 1 1 1 1  69 ARG HB2  .  69 . HB2  1 1 
       1786 1 2 1 1  69 ARG HD3  .  69 . HD1  1 1 
       1787 1 1 1 1  70 GLU HA   .  70 . HA   1 1 
       1787 1 2 1 1  70 GLU HG2  .  70 . HG2  1 1 
       1788 1 1 1 1  70 GLU HA   .  70 . HA   1 1 
       1788 1 2 1 1  70 GLU HG3  .  70 . HG1  1 1 
       1789 1 1 1 1  71 ILE HA   .  71 . HA   1 1 
       1789 1 2 1 1  71 ILE HG12 .  71 . HG12 1 1 
       1790 1 1 1 1  71 ILE HA   .  71 . HA   1 1 
       1790 1 2 1 1  71 ILE HG13 .  71 . HG11 1 1 
       1791 1 1 1 1  71 ILE HA   .  71 . HA   1 1 
       1791 1 2 1 1  71 ILE MG   .  71 . HG2* 1 1 
       1792 1 1 1 1  71 ILE H    .  71 . HN   1 1 
       1792 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
       1793 1 1 1 1  71 ILE HB   .  71 . HB   1 1 
       1793 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
       1794 1 1 1 1  72 TRP HA   .  72 . HA   1 1 
       1794 1 2 1 1  72 TRP HE3  .  72 . HE3  1 1 
       1795 1 1 1 1  73 GLU HA   .  73 . HA   1 1 
       1795 1 2 1 1  73 GLU HG2  .  73 . HG2  1 1 
       1796 1 1 1 1  73 GLU H    .  73 . HN   1 1 
       1796 1 2 1 1  73 GLU HG2  .  73 . HG2  1 1 
       1797 1 1 1 1  73 GLU H    .  73 . HN   1 1 
       1797 1 2 1 1  73 GLU HG3  .  73 . HG1  1 1 
       1798 1 1 1 1  73 GLU HA   .  73 . HA   1 1 
       1798 1 2 1 1  73 GLU HG3  .  73 . HG1  1 1 
       1799 1 1 1 1  74 ARG HA   .  74 . HA   1 1 
       1799 1 2 1 1  74 ARG HG2  .  74 . HG2  1 1 
       1800 1 1 1 1  74 ARG H    .  74 . HN   1 1 
       1800 1 2 1 1  74 ARG HG3  .  74 . HG1  1 1 
       1801 1 1 1 1  74 ARG HA   .  74 . HA   1 1 
       1801 1 2 1 1  74 ARG HG3  .  74 . HG1  1 1 
       1802 1 1 1 1  74 ARG HA   .  74 . HA   1 1 
       1802 1 2 1 1  74 ARG HD2  .  74 . HD2  1 1 
       1803 1 1 1 1  74 ARG HB3  .  74 . HB1  1 1 
       1803 1 2 1 1  74 ARG HD2  .  74 . HD2  1 1 
       1804 1 1 1 1  74 ARG HA   .  74 . HA   1 1 
       1804 1 2 1 1  74 ARG HD3  .  74 . HD1  1 1 
       1805 1 1 1 1  74 ARG HB3  .  74 . HB1  1 1 
       1805 1 2 1 1  74 ARG HD3  .  74 . HD1  1 1 
       1806 1 1 1 1  77 GLN HA   .  77 . HA   1 1 
       1806 1 2 1 1  77 GLN HG2  .  77 . HG2  1 1 
       1807 1 1 1 1  77 GLN HA   .  77 . HA   1 1 
       1807 1 2 1 1  77 GLN HG3  .  77 . HG1  1 1 
       1808 1 1 1 1  78 LEU HA   .  78 . HA   1 1 
       1808 1 2 1 1  78 LEU HG   .  78 . HG   1 1 
       1809 1 1 1 1  78 LEU HA   .  78 . HA   1 1 
       1809 1 2 1 1  78 LEU MD2  .  78 . HD2* 1 1 
       1810 1 1 1 1  53 VAL HB   .  53 . HB   1 1 
       1810 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       1811 1 1 1 1  78 LEU HA   .  78 . HA   1 1 
       1811 1 2 1 1  78 LEU MD1  .  78 . HD1* 1 1 
       1812 1 1 1 1  78 LEU HB2  .  78 . HB2  1 1 
       1812 1 2 1 1  78 LEU MD1  .  78 . HD1* 1 1 
       1813 1 1 1 1  78 LEU HB3  .  78 . HB1  1 1 
       1813 1 2 1 1  78 LEU MD1  .  78 . HD1* 1 1 
       1814 1 1 1 1  80 VAL H    .  80 . HN   1 1 
       1814 1 2 1 1  80 VAL MG2  .  80 . HG2* 1 1 
       1815 1 1 1 1  82 VAL H    .  82 . HN   1 1 
       1815 1 2 1 1  82 VAL MG2  .  82 . HG2* 1 1 
       1816 1 1 1 1  82 VAL HA   .  82 . HA   1 1 
       1816 1 2 1 1  82 VAL MG2  .  82 . HG2* 1 1 
       1817 1 1 1 1  71 ILE MD   .  71 . HD1* 1 1 
       1817 1 2 1 1  82 VAL MG2  .  82 . HG2* 1 1 
       1818 1 1 1 1  83 ILE HA   .  83 . HA   1 1 
       1818 1 2 1 1  83 ILE MG   .  83 . HG2* 1 1 
       1819 1 1 1 1  83 ILE HG13 .  83 . HG11 1 1 
       1819 1 2 1 1  83 ILE MG   .  83 . HG2* 1 1 
       1820 1 1 1 1  83 ILE H    .  83 . HN   1 1 
       1820 1 2 1 1  83 ILE HG12 .  83 . HG12 1 1 
       1821 1 1 1 1  83 ILE HG12 .  83 . HG12 1 1 
       1821 1 2 1 1  83 ILE MG   .  83 . HG2* 1 1 
       1822 1 1 1 1  83 ILE H    .  83 . HN   1 1 
       1822 1 2 1 1  83 ILE MD   .  83 . HD1* 1 1 
       1823 1 1 1 1  83 ILE HA   .  83 . HA   1 1 
       1823 1 2 1 1  83 ILE MD   .  83 . HD1* 1 1 
       1824 1 1 1 1  83 ILE MD   .  83 . HD1* 1 1 
       1824 1 2 1 1  83 ILE MG   .  83 . HG2* 1 1 
       1825 1 1 1 1  83 ILE HB   .  83 . HB   1 1 
       1825 1 2 1 1  83 ILE MD   .  83 . HD1* 1 1 
       1826 1 1 1 1  84 VAL HA   .  84 . HA   1 1 
       1826 1 2 1 1  84 VAL MG1  .  84 . HG1* 1 1 
       1827 1 1 1 1  84 VAL HA   .  84 . HA   1 1 
       1827 1 2 1 1  84 VAL MG2  .  84 . HG2* 1 1 
       1828 1 1 1 1  85 THR HA   .  85 . HA   1 1 
       1828 1 2 1 1  85 THR MG   .  85 . HG2* 1 1 
       1829 1 1 1 1  89 LYS HA   .  89 . HA   1 1 
       1829 1 2 1 1  89 LYS HG2  .  89 . HG2  1 1 
       1830 1 1 1 1  89 LYS HA   .  89 . HA   1 1 
       1830 1 2 1 1  89 LYS HG3  .  89 . HG1  1 1 
       1831 1 1 1 1  89 LYS H    .  89 . HN   1 1 
       1831 1 2 1 1  89 LYS HD2  .  89 . HD2  1 1 
       1832 1 1 1 1  89 LYS H    .  89 . HN   1 1 
       1832 1 2 1 1  89 LYS HD3  .  89 . HD1  1 1 
       1833 1 1 1 1  89 LYS H    .  89 . HN   1 1 
       1833 1 2 1 1  89 LYS HE2  .  89 . HE2  1 1 
       1834 1 1 1 1  89 LYS H    .  89 . HN   1 1 
       1834 1 2 1 1  89 LYS HE3  .  89 . HE1  1 1 
       1835 1 1 1 1  90 GLU HA   .  90 . HA   1 1 
       1835 1 2 1 1  90 GLU HG2  .  90 . HG2  1 1 
       1836 1 1 1 1  90 GLU HA   .  90 . HA   1 1 
       1836 1 2 1 1  90 GLU HG3  .  90 . HG1  1 1 
       1837 1 1 1 1  92 ILE HA   .  92 . HA   1 1 
       1837 1 2 1 1  92 ILE HG13 .  92 . HG11 1 1 
       1838 1 1 1 1  92 ILE HA   .  92 . HA   1 1 
       1838 1 2 1 1  92 ILE MD   .  92 . HD1* 1 1 
       1839 1 1 1 1  92 ILE MG   .  92 . HG2* 1 1 
       1839 1 2 1 1 108 VAL MG2  . 108 . HG2* 1 1 
       1840 1 1 1 1  92 ILE MD   .  92 . HD1* 1 1 
       1840 1 2 1 1  92 ILE MG   .  92 . HG2* 1 1 
       1841 1 1 1 1  93 LYS H    .  93 . HN   1 1 
       1841 1 2 1 1  93 LYS HG3  .  93 . HG1  1 1 
       1842 1 1 1 1  96 ILE HA   .  96 . HA   1 1 
       1842 1 2 1 1 106 VAL MG1  . 106 . HG1* 1 1 
       1843 1 1 1 1  96 ILE HA   .  96 . HA   1 1 
       1843 1 2 1 1  96 ILE MG   .  96 . HG2* 1 1 
       1844 1 1 1 1  96 ILE HA   .  96 . HA   1 1 
       1844 1 2 1 1  96 ILE HG12 .  96 . HG12 1 1 
       1845 1 1 1 1  96 ILE HA   .  96 . HA   1 1 
       1845 1 2 1 1  96 ILE HG13 .  96 . HG11 1 1 
       1846 1 1 1 1  96 ILE H    .  96 . HN   1 1 
       1846 1 2 1 1  96 ILE MG   .  96 . HG2* 1 1 
       1847 1 1 1 1  96 ILE HG13 .  96 . HG11 1 1 
       1847 1 2 1 1  96 ILE MG   .  96 . HG2* 1 1 
       1848 1 1 1 1  96 ILE MD   .  96 . HD1* 1 1 
       1848 1 2 1 1  96 ILE MG   .  96 . HG2* 1 1 
       1849 1 1 1 1  96 ILE HB   .  96 . HB   1 1 
       1849 1 2 1 1  96 ILE HG13 .  96 . HG11 1 1 
       1850 1 1 1 1  96 ILE HA   .  96 . HA   1 1 
       1850 1 2 1 1  96 ILE MD   .  96 . HD1* 1 1 
       1851 1 1 1 1  96 ILE HB   .  96 . HB   1 1 
       1851 1 2 1 1  96 ILE MD   .  96 . HD1* 1 1 
       1852 1 1 1 1  97 GLU H    .  97 . HN   1 1 
       1852 1 2 1 1  97 GLU HG2  .  97 . HG2  1 1 
       1853 1 1 1 1  97 GLU HA   .  97 . HA   1 1 
       1853 1 2 1 1  97 GLU HG2  .  97 . HG2  1 1 
       1854 1 1 1 1  97 GLU HA   .  97 . HA   1 1 
       1854 1 2 1 1  97 GLU HG3  .  97 . HG1  1 1 
       1855 1 1 1 1  49 GLU HB2  .  49 . HB2  1 1 
       1855 1 2 1 1  49 GLU HG3  .  49 . HG1  1 1 
       1856 1 1 1 1  98 GLU HA   .  98 . HA   1 1 
       1856 1 2 1 1  98 GLU HG2  .  98 . HG2  1 1 
       1857 1 1 1 1  98 GLU HA   .  98 . HA   1 1 
       1857 1 2 1 1  98 GLU HG3  .  98 . HG1  1 1 
       1858 1 1 1 1  20 ARG HA   .  20 . HA   1 1 
       1858 1 2 1 1  20 ARG HB2  .  20 . HB2  1 1 
       1859 1 1 1 1  97 GLU HA   .  97 . HA   1 1 
       1859 1 2 1 1 100 LYS HB2  . 100 . HB2  1 1 
       1860 1 1 1 1 100 LYS HA   . 100 . HA   1 1 
       1860 1 2 1 1 100 LYS HG2  . 100 . HG2  1 1 
       1861 1 1 1 1  20 ARG HA   .  20 . HA   1 1 
       1861 1 2 1 1  23 LYS HG3  .  23 . HG1  1 1 
       1862 1 1 1 1 100 LYS HA   . 100 . HA   1 1 
       1862 1 2 1 1 100 LYS HG3  . 100 . HG1  1 1 
       1863 1 1 1 1 100 LYS HA   . 100 . HA   1 1 
       1863 1 2 1 1 100 LYS HE2  . 100 . HE2  1 1 
       1864 1 1 1 1 100 LYS HA   . 100 . HA   1 1 
       1864 1 2 1 1 100 LYS HE3  . 100 . HE1  1 1 
       1865 1 1 1 1 100 LYS H    . 100 . HN   1 1 
       1865 1 2 1 1 100 LYS HG2  . 100 . HG2  1 1 
       1866 1 1 1 1 100 LYS H    . 100 . HN   1 1 
       1866 1 2 1 1 100 LYS HD2  . 100 . HD2  1 1 
       1867 1 1 1 1 100 LYS H    . 100 . HN   1 1 
       1867 1 2 1 1 100 LYS HD3  . 100 . HD1  1 1 
       1868 1 1 1 1 100 LYS H    . 100 . HN   1 1 
       1868 1 2 1 1 100 LYS HE2  . 100 . HE2  1 1 
       1869 1 1 1 1 100 LYS H    . 100 . HN   1 1 
       1869 1 2 1 1 100 LYS HE3  . 100 . HE1  1 1 
       1870 1 1 1 1 101 GLU HA   . 101 . HA   1 1 
       1870 1 2 1 1 101 GLU HG2  . 101 . HG2  1 1 
       1871 1 1 1 1 101 GLU HA   . 101 . HA   1 1 
       1871 1 2 1 1 101 GLU HG3  . 101 . HG1  1 1 
       1872 1 1 1 1 101 GLU H    . 101 . HN   1 1 
       1872 1 2 1 1 101 GLU HG2  . 101 . HG2  1 1 
       1873 1 1 1 1 101 GLU H    . 101 . HN   1 1 
       1873 1 2 1 1 101 GLU HG3  . 101 . HG1  1 1 
       1874 1 1 1 1 102 ARG HA   . 102 . HA   1 1 
       1874 1 2 1 1 102 ARG HG2  . 102 . HG2  1 1 
       1875 1 1 1 1 102 ARG HA   . 102 . HA   1 1 
       1875 1 2 1 1 102 ARG HG3  . 102 . HG1  1 1 
       1876 1 1 1 1 102 ARG HA   . 102 . HA   1 1 
       1876 1 2 1 1 102 ARG HD3  . 102 . HD1  1 1 
       1877 1 1 1 1 102 ARG HA   . 102 . HA   1 1 
       1877 1 2 1 1 102 ARG HD2  . 102 . HD2  1 1 
       1878 1 1 1 1 102 ARG H    . 102 . HN   1 1 
       1878 1 2 1 1 102 ARG HD3  . 102 . HD1  1 1 
       1879 1 1 1 1 104 VAL H    . 104 . HN   1 1 
       1879 1 2 1 1 104 VAL HB   . 104 . HB   1 1 
       1880 1 1 1 1 104 VAL HA   . 104 . HA   1 1 
       1880 1 2 1 1 104 VAL MG1  . 104 . HG1* 1 1 
       1881 1 1 1 1 104 VAL HA   . 104 . HA   1 1 
       1881 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       1882 1 1 1 1 105 GLU HA   . 105 . HA   1 1 
       1882 1 2 1 1 105 GLU HG3  . 105 . HG1  1 1 
       1883 1 1 1 1 105 GLU HA   . 105 . HA   1 1 
       1883 1 2 1 1 105 GLU HG2  . 105 . HG2  1 1 
       1884 1 1 1 1 106 VAL HA   . 106 . HA   1 1 
       1884 1 2 1 1 106 VAL MG1  . 106 . HG1* 1 1 
       1885 1 1 1 1 106 VAL H    . 106 . HN   1 1 
       1885 1 2 1 1 106 VAL MG2  . 106 . HG2* 1 1 
       1886 1 1 1 1 106 VAL HB   . 106 . HB   1 1 
       1886 1 2 1 1 130 VAL MG2  . 130 . HG2* 1 1 
       1887 1 1 1 1 106 VAL H    . 106 . HN   1 1 
       1887 1 2 1 1 106 VAL MG1  . 106 . HG1* 1 1 
       1888 1 1 1 1  55 VAL HA   .  55 . HA   1 1 
       1888 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       1889 1 1 1 1 107 PHE H    . 107 . HN   1 1 
       1889 1 2 1 1 107 PHE HB3  . 107 . HB1  1 1 
       1890 1 1 1 1   8 PHE H    .   8 . HN   1 1 
       1890 1 2 1 1 108 VAL MG1  . 108 . HG1* 1 1 
       1891 1 1 1 1 108 VAL HA   . 108 . HA   1 1 
       1891 1 2 1 1 108 VAL MG1  . 108 . HG1* 1 1 
       1892 1 1 1 1   7 VAL MG2  .   7 . HG2* 1 1 
       1892 1 2 1 1 109 VAL HB   . 109 . HB   1 1 
       1893 1 1 1 1 109 VAL H    . 109 . HN   1 1 
       1893 1 2 1 1 109 VAL MG2  . 109 . HG2* 1 1 
       1894 1 1 1 1 109 VAL HA   . 109 . HA   1 1 
       1894 1 2 1 1 109 VAL MG2  . 109 . HG2* 1 1 
       1895 1 1 1 1  22 ILE MG   .  22 . HG2* 1 1 
       1895 1 2 1 1  81 VAL MG2  .  81 . HG2* 1 1 
       1896 1 1 1 1 109 VAL H    . 109 . HN   1 1 
       1896 1 2 1 1 109 VAL MG1  . 109 . HG1* 1 1 
       1897 1 1 1 1   8 PHE H    .   8 . HN   1 1 
       1897 1 2 1 1 110 TYR HB3  . 110 . HB1  1 1 
       1898 1 1 1 1 113 LYS H    . 113 . HN   1 1 
       1898 1 2 1 1 113 LYS HE2  . 113 . HE2  1 1 
       1899 1 1 1 1 113 LYS H    . 113 . HN   1 1 
       1899 1 2 1 1 113 LYS HE3  . 113 . HE1  1 1 
       1900 1 1 1 1 115 ASP H    . 115 . HN   1 1 
       1900 1 2 1 1 115 ASP HB2  . 115 . HB2  1 1 
       1901 1 1 1 1 115 ASP H    . 115 . HN   1 1 
       1901 1 2 1 1 115 ASP HB3  . 115 . HB1  1 1 
       1902 1 1 1 1 116 ASP H    . 116 . HN   1 1 
       1902 1 2 1 1 116 ASP HB2  . 116 . HB2  1 1 
       1903 1 1 1 1 117 ARG H    . 117 . HN   1 1 
       1903 1 2 1 1 117 ARG HB3  . 117 . HB1  1 1 
       1904 1 1 1 1 118 ARG H    . 118 . HN   1 1 
       1904 1 2 1 1 118 ARG HB3  . 118 . HB1  1 1 
       1905 1 1 1 1 118 ARG HA   . 118 . HA   1 1 
       1905 1 2 1 1 118 ARG HD2  . 118 . HD2  1 1 
       1906 1 1 1 1 118 ARG HA   . 118 . HA   1 1 
       1906 1 2 1 1 118 ARG HD3  . 118 . HD1  1 1 
       1907 1 1 1 1 119 LYS HA   . 119 . HA   1 1 
       1907 1 2 1 1 119 LYS HG2  . 119 . HG2  1 1 
       1908 1 1 1 1 119 LYS HA   . 119 . HA   1 1 
       1908 1 2 1 1 119 LYS HG3  . 119 . HG1  1 1 
       1909 1 1 1 1 119 LYS HA   . 119 . HA   1 1 
       1909 1 2 1 1 119 LYS HD2  . 119 . HD2  1 1 
       1910 1 1 1 1 119 LYS HA   . 119 . HA   1 1 
       1910 1 2 1 1 119 LYS HE2  . 119 . HE2  1 1 
       1911 1 1 1 1 119 LYS HA   . 119 . HA   1 1 
       1911 1 2 1 1 119 LYS HE3  . 119 . HE1  1 1 
       1912 1 1 1 1 120 GLU HA   . 120 . HA   1 1 
       1912 1 2 1 1 120 GLU HG2  . 120 . HG2  1 1 
       1913 1 1 1 1 120 GLU H    . 120 . HN   1 1 
       1913 1 2 1 1 120 GLU HB3  . 120 . HB1  1 1 
       1914 1 1 1 1 120 GLU H    . 120 . HN   1 1 
       1914 1 2 1 1 120 GLU HB2  . 120 . HB2  1 1 
       1915 1 1 1 1 122 GLN H    . 122 . HN   1 1 
       1915 1 2 1 1 122 GLN HB2  . 122 . HB2  1 1 
       1916 1 1 1 1 122 GLN H    . 122 . HN   1 1 
       1916 1 2 1 1 122 GLN HG2  . 122 . HG2  1 1 
       1917 1 1 1 1 122 GLN HA   . 122 . HA   1 1 
       1917 1 2 1 1 122 GLN HG2  . 122 . HG2  1 1 
       1918 1 1 1 1 122 GLN HA   . 122 . HA   1 1 
       1918 1 2 1 1 122 GLN HG3  . 122 . HG1  1 1 
       1919 1 1 1 1 123 GLN HA   . 123 . HA   1 1 
       1919 1 2 1 1 123 GLN HG2  . 123 . HG2  1 1 
       1920 1 1 1 1 123 GLN HA   . 123 . HA   1 1 
       1920 1 2 1 1 123 GLN HG3  . 123 . HG1  1 1 
       1921 1 1 1 1 124 GLU HA   . 124 . HA   1 1 
       1921 1 2 1 1 124 GLU HG2  . 124 . HG2  1 1 
       1922 1 1 1 1 124 GLU H    . 124 . HN   1 1 
       1922 1 2 1 1 124 GLU HB3  . 124 . HB1  1 1 
       1923 1 1 1 1 124 GLU H    . 124 . HN   1 1 
       1923 1 2 1 1 124 GLU HG2  . 124 . HG2  1 1 
       1924 1 1 1 1 124 GLU H    . 124 . HN   1 1 
       1924 1 2 1 1 124 GLU HG3  . 124 . HG1  1 1 
       1925 1 1 1 1 124 GLU HA   . 124 . HA   1 1 
       1925 1 2 1 1 124 GLU HG3  . 124 . HG1  1 1 
       1926 1 1 1 1 126 ARG HA   . 126 . HA   1 1 
       1926 1 2 1 1 126 ARG HG2  . 126 . HG2  1 1 
       1927 1 1 1 1 126 ARG HA   . 126 . HA   1 1 
       1927 1 2 1 1 126 ARG HG3  . 126 . HG1  1 1 
       1928 1 1 1 1 133 ARG HA   . 133 . HA   1 1 
       1928 1 2 1 1 133 ARG HD2  . 133 . HD2  1 1 
       1929 1 1 1 1 133 ARG HB3  . 133 . HB1  1 1 
       1929 1 2 1 1 133 ARG HD2  . 133 . HD2  1 1 
       1930 1 1 1 1 133 ARG HA   . 133 . HA   1 1 
       1930 1 2 1 1 133 ARG HD3  . 133 . HD1  1 1 
       1931 1 1 1 1 133 ARG HB3  . 133 . HB1  1 1 
       1931 1 2 1 1 133 ARG HD3  . 133 . HD1  1 1 
       1932 1 1 1 1 135 VAL H    . 135 . HN   1 1 
       1932 1 2 1 1 135 VAL MG2  . 135 . HG2* 1 1 
       1933 1 1 1 1  22 ILE MG   .  22 . HG2* 1 1 
       1933 1 2 1 1  29 VAL HA   .  29 . HA   1 1 
       1934 1 1 1 1 135 VAL HA   . 135 . HA   1 1 
       1934 1 2 1 1 135 VAL MG1  . 135 . HG1* 1 1 
       1935 1 1 1 1 135 VAL MG1  . 135 . HG1* 1 1 
       1935 1 2 1 1 140 GLU HB3  . 140 . HB1  1 1 
       1936 1 1 1 1 136 SER H    . 136 . HN   1 1 
       1936 1 2 1 1 136 SER HB3  . 136 . HB1  1 1 
       1937 1 1 1 1 138 LYS HA   . 138 . HA   1 1 
       1937 1 2 1 1 138 LYS HG2  . 138 . HG2  1 1 
       1938 1 1 1 1 138 LYS HB3  . 138 . HB1  1 1 
       1938 1 2 1 1 138 LYS HE2  . 138 . HE2  1 1 
       1939 1 1 1 1 138 LYS H    . 138 . HN   1 1 
       1939 1 2 1 1 138 LYS HG2  . 138 . HG2  1 1 
       1940 1 1 1 1 138 LYS H    . 138 . HN   1 1 
       1940 1 2 1 1 138 LYS HG3  . 138 . HG1  1 1 
       1941 1 1 1 1 138 LYS HA   . 138 . HA   1 1 
       1941 1 2 1 1 138 LYS HG3  . 138 . HG1  1 1 
       1942 1 1 1 1 138 LYS H    . 138 . HN   1 1 
       1942 1 2 1 1 138 LYS HE2  . 138 . HE2  1 1 
       1943 1 1 1 1 138 LYS H    . 138 . HN   1 1 
       1943 1 2 1 1 138 LYS HE3  . 138 . HE1  1 1 
       1944 1 1 1 1 138 LYS HB3  . 138 . HB1  1 1 
       1944 1 2 1 1 138 LYS HE3  . 138 . HE1  1 1 
       1945 1 1 1 1 139 GLU HA   . 139 . HA   1 1 
       1945 1 2 1 1 139 GLU HG2  . 139 . HG2  1 1 
       1946 1 1 1 1 139 GLU HA   . 139 . HA   1 1 
       1946 1 2 1 1 139 GLU HG3  . 139 . HG1  1 1 
       1947 1 1 1 1  97 GLU HB2  .  97 . HB2  1 1 
       1947 1 2 1 1  97 GLU HG3  .  97 . HG1  1 1 
       1948 1 1 1 1  17 GLU HB2  .  17 . HB2  1 1 
       1948 1 2 1 1  17 GLU HG3  .  17 . HG1  1 1 
       1949 1 1 1 1  17 GLU HA   .  17 . HA   1 1 
       1949 1 2 1 1  17 GLU HB3  .  17 . HB1  1 1 
       1950 1 1 1 1 140 GLU HA   . 140 . HA   1 1 
       1950 1 2 1 1 140 GLU HB3  . 140 . HB1  1 1 
       1951 1 1 1 1 140 GLU HB2  . 140 . HB2  1 1 
       1951 1 2 1 1 140 GLU HG3  . 140 . HG1  1 1 
       1952 1 1 1 1 140 GLU HB3  . 140 . HB1  1 1 
       1952 1 2 1 1 140 GLU HG3  . 140 . HG1  1 1 
       1953 1 1 1 1 140 GLU HA   . 140 . HA   1 1 
       1953 1 2 1 1 140 GLU HG2  . 140 . HG2  1 1 
       1954 1 1 1 1 141 LEU HA   . 141 . HA   1 1 
       1954 1 2 1 1 141 LEU MD2  . 141 . HD2* 1 1 
       1955 1 1 1 1 144 GLN H    . 144 . HN   1 1 
       1955 1 2 1 1 146 ARG HG3  . 146 . HG1  1 1 
       1956 1 1 1 1 141 LEU HA   . 141 . HA   1 1 
       1956 1 2 1 1 141 LEU HG   . 141 . HG   1 1 
       1957 1 1 1 1 141 LEU H    . 141 . HN   1 1 
       1957 1 2 1 1 141 LEU MD2  . 141 . HD2* 1 1 
       1958 1 1 1 1 141 LEU MD2  . 141 . HD2* 1 1 
       1958 1 2 1 1 144 GLN H    . 144 . HN   1 1 
       1959 1 1 1 1 141 LEU HB3  . 141 . HB1  1 1 
       1959 1 2 1 1 141 LEU MD2  . 141 . HD2* 1 1 
       1960 1 1 1 1 141 LEU H    . 141 . HN   1 1 
       1960 1 2 1 1 141 LEU MD1  . 141 . HD1* 1 1 
       1961 1 1 1 1 141 LEU HA   . 141 . HA   1 1 
       1961 1 2 1 1 141 LEU MD1  . 141 . HD1* 1 1 
       1962 1 1 1 1 141 LEU HB2  . 141 . HB2  1 1 
       1962 1 2 1 1 141 LEU MD1  . 141 . HD1* 1 1 
       1963 1 1 1 1  18 ILE HG12 .  18 . HG12 1 1 
       1963 1 2 1 1 142 ILE HA   . 142 . HA   1 1 
       1964 1 1 1 1 142 ILE H    . 142 . HN   1 1 
       1964 1 2 1 1 142 ILE HB   . 142 . HB   1 1 
       1965 1 1 1 1 142 ILE HA   . 142 . HA   1 1 
       1965 1 2 1 1 142 ILE MG   . 142 . HG2* 1 1 
       1966 1 1 1 1 142 ILE HG13 . 142 . HG11 1 1 
       1966 1 2 1 1 142 ILE MG   . 142 . HG2* 1 1 
       1967 1 1 1 1 142 ILE HA   . 142 . HA   1 1 
       1967 1 2 1 1 142 ILE HG13 . 142 . HG11 1 1 
       1968 1 1 1 1 142 ILE HA   . 142 . HA   1 1 
       1968 1 2 1 1 142 ILE HG12 . 142 . HG12 1 1 
       1969 1 1 1 1 142 ILE HG12 . 142 . HG12 1 1 
       1969 1 2 1 1 142 ILE MG   . 142 . HG2* 1 1 
       1970 1 1 1 1 142 ILE HA   . 142 . HA   1 1 
       1970 1 2 1 1 142 ILE MD   . 142 . HD1* 1 1 
       1971 1 1 1 1  17 GLU HB2  .  17 . HB2  1 1 
       1971 1 2 1 1 142 ILE MD   . 142 . HD1* 1 1 
       1972 1 1 1 1 142 ILE MD   . 142 . HD1* 1 1 
       1972 1 2 1 1 142 ILE MG   . 142 . HG2* 1 1 
       1973 1 1 1 1  18 ILE HG12 .  18 . HG12 1 1 
       1973 1 2 1 1 142 ILE MD   . 142 . HD1* 1 1 
       1974 1 1 1 1 143 GLU H    . 143 . HN   1 1 
       1974 1 2 1 1 143 GLU HB3  . 143 . HB1  1 1 
       1975 1 1 1 1 135 VAL HB   . 135 . HB   1 1 
       1975 1 2 1 1 140 GLU HB3  . 140 . HB1  1 1 
       1976 1 1 1 1 135 VAL HB   . 135 . HB   1 1 
       1976 1 2 1 1 140 GLU HB2  . 140 . HB2  1 1 
       1977 1 1 1 1 120 GLU HA   . 120 . HA   1 1 
       1977 1 2 1 1 120 GLU HG3  . 120 . HG1  1 1 
       1978 1 1 1 1 144 GLN HA   . 144 . HA   1 1 
       1978 1 2 1 1 144 GLN HE21 . 144 . HE21 1 1 
       1979 1 1 1 1 144 GLN H    . 144 . HN   1 1 
       1979 1 2 1 1 144 GLN HG3  . 144 . HG1  1 1 
       1980 1 1 1 1 145 VAL HA   . 145 . HA   1 1 
       1980 1 2 1 1 145 VAL MG1  . 145 . HG1* 1 1 
       1981 1 1 1 1 145 VAL H    . 145 . HN   1 1 
       1981 1 2 1 1 145 VAL MG1  . 145 . HG1* 1 1 
       1982 1 1 1 1 145 VAL HA   . 145 . HA   1 1 
       1982 1 2 1 1 145 VAL MG2  . 145 . HG2* 1 1 
       1983 1 1 1 1 146 ARG HA   . 146 . HA   1 1 
       1983 1 2 1 1 146 ARG HG3  . 146 . HG1  1 1 
       1984 1 1 1 1 146 ARG HA   . 146 . HA   1 1 
       1984 1 2 1 1 146 ARG HG2  . 146 . HG2  1 1 
       1985 1 1 1 1 146 ARG HB3  . 146 . HB1  1 1 
       1985 1 2 1 1 146 ARG HG2  . 146 . HG2  1 1 
       1986 1 1 1 1 146 ARG HA   . 146 . HA   1 1 
       1986 1 2 1 1 146 ARG HD3  . 146 . HD1  1 1 
       1987 1 1 1 1 146 ARG HB2  . 146 . HB2  1 1 
       1987 1 2 1 1 146 ARG HD3  . 146 . HD1  1 1 
       1988 1 1 1 1 147 ARG HB2  . 147 . HB2  1 1 
       1988 1 2 1 1 147 ARG HD3  . 147 . HD1  1 1 
       1989 1 1 1 1 147 ARG HA   . 147 . HA   1 1 
       1989 1 2 1 1 147 ARG HG2  . 147 . HG2  1 1 
       1990 1 1 1 1 147 ARG HB3  . 147 . HB1  1 1 
       1990 1 2 1 1 147 ARG HG2  . 147 . HG2  1 1 
       1991 1 1 1 1 147 ARG H    . 147 . HN   1 1 
       1991 1 2 1 1 147 ARG HG3  . 147 . HG1  1 1 
       1992 1 1 1 1 147 ARG HA   . 147 . HA   1 1 
       1992 1 2 1 1 147 ARG HG3  . 147 . HG1  1 1 
       1993 1 1 1 1 147 ARG HA   . 147 . HA   1 1 
       1993 1 2 1 1 147 ARG HD2  . 147 . HD2  1 1 
       1994 1 1 1 1 146 ARG HB3  . 146 . HB1  1 1 
       1994 1 2 1 1 146 ARG HD3  . 146 . HD1  1 1 
       1995 1 1 1 1 147 ARG HB3  . 147 . HB1  1 1 
       1995 1 2 1 1 147 ARG HD2  . 147 . HD2  1 1 
       1996 1 1 1 1 147 ARG HA   . 147 . HA   1 1 
       1996 1 2 1 1 147 ARG HD3  . 147 . HD1  1 1 
       1997 1 1 1 1 147 ARG HB3  . 147 . HB1  1 1 
       1997 1 2 1 1 147 ARG HD3  . 147 . HD1  1 1 
       1998 1 1 1 1 147 ARG HD3  . 147 . HD1  1 1 
       1998 1 2 1 1 147 ARG HG2  . 147 . HG2  1 1 
       1999 1 1 1 1 148 PHE HA   . 148 . HA   1 1 
       1999 1 2 1 1 148 PHE QE   . 148 . HE*  1 1 
       2000 1 1 1 1 148 PHE HA   . 148 . HA   1 1 
       2000 1 2 1 1 148 PHE QD   . 148 . HD*  1 1 
       2001 1 1 1 1 149 VAL HA   . 149 . HA   1 1 
       2001 1 2 1 1 149 VAL MG2  . 149 . HG2* 1 1 
       2002 1 1 1 1 149 VAL HA   . 149 . HA   1 1 
       2002 1 2 1 1 149 VAL MG1  . 149 . HG1* 1 1 
       2003 1 1 1 1 150 ARG HA   . 150 . HA   1 1 
       2003 1 2 1 1 150 ARG HG2  . 150 . HG2  1 1 
       2004 1 1 1 1 150 ARG HA   . 150 . HA   1 1 
       2004 1 2 1 1 150 ARG HG3  . 150 . HG1  1 1 
       2005 1 1 1 1 150 ARG HB2  . 150 . HB2  1 1 
       2005 1 2 1 1 150 ARG HD2  . 150 . HD2  1 1 
       2006 1 1 1 1 150 ARG HB2  . 150 . HB2  1 1 
       2006 1 2 1 1 150 ARG HD3  . 150 . HD1  1 1 
       2007 1 1 1 1 147 ARG HB3  . 147 . HB1  1 1 
       2007 1 2 1 1 148 PHE H    . 148 . HN   1 1 
       2008 1 1 1 1 150 ARG H    . 150 . HN   1 1 
       2008 1 2 1 1 150 ARG HD2  . 150 . HD2  1 1 
       2009 1 1 1 1 150 ARG H    . 150 . HN   1 1 
       2009 1 2 1 1 150 ARG HD3  . 150 . HD1  1 1 
       2010 1 1 1 1 150 ARG HB3  . 150 . HB1  1 1 
       2010 1 2 1 1 150 ARG HD2  . 150 . HD2  1 1 
       2011 1 1 1 1 151 LYS HA   . 151 . HA   1 1 
       2011 1 2 1 1 151 LYS HG2  . 151 . HG2  1 1 
       2012 1 1 1 1 151 LYS HA   . 151 . HA   1 1 
       2012 1 2 1 1 151 LYS HG3  . 151 . HG1  1 1 
       2013 1 1 1 1 151 LYS HB2  . 151 . HB2  1 1 
       2013 1 2 1 1 151 LYS HE2  . 151 . HE2  1 1 
       2014 1 1 1 1 151 LYS HB2  . 151 . HB2  1 1 
       2014 1 2 1 1 151 LYS HE3  . 151 . HE1  1 1 
       2015 1 1 1 1 148 PHE HA   . 148 . HA   1 1 
       2015 1 2 1 1 151 LYS HG2  . 151 . HG2  1 1 
       2016 1 1 1 1 148 PHE HA   . 148 . HA   1 1 
       2016 1 2 1 1 151 LYS HG3  . 151 . HG1  1 1 
       2017 1 1 1 1 151 LYS H    . 151 . HN   1 1 
       2017 1 2 1 1 151 LYS HD2  . 151 . HD2  1 1 
       2018 1 1 1 1 148 PHE HA   . 148 . HA   1 1 
       2018 1 2 1 1 151 LYS HE2  . 151 . HE2  1 1 
       2019 1 1 1 1 148 PHE HA   . 148 . HA   1 1 
       2019 1 2 1 1 151 LYS HE3  . 151 . HE1  1 1 
       2020 1 1 1 1 151 LYS HB3  . 151 . HB1  1 1 
       2020 1 2 1 1 151 LYS HE2  . 151 . HE2  1 1 
       2021 1 1 1 1 151 LYS HB3  . 151 . HB1  1 1 
       2021 1 2 1 1 151 LYS HE3  . 151 . HE1  1 1 
       2022 1 1 1 1 152 VAL HA   . 152 . HA   1 1 
       2022 1 2 1 1 152 VAL MG1  . 152 . HG1* 1 1 
       2023 1 1 1 1 154 SER H    . 154 . HN   1 1 
       2023 1 2 1 1 154 SER HB2  . 154 . HB2  1 1 
       2024 1 1 1 1 155 LEU H    . 155 . HN   1 1 
       2024 1 2 1 1 155 LEU HB2  . 155 . HB2  1 1 
       2025 1 1 1 1 155 LEU HA   . 155 . HA   1 1 
       2025 1 2 1 1 155 LEU HG   . 155 . HG   1 1 
       2026 1 1 1 1 155 LEU HA   . 155 . HA   1 1 
       2026 1 2 1 1 155 LEU MD1  . 155 . HD1* 1 1 
       2027 1 1 1 1 155 LEU HB3  . 155 . HB1  1 1 
       2027 1 2 1 1 155 LEU MD1  . 155 . HD1* 1 1 
       2028 1 1 1 1 155 LEU HB2  . 155 . HB2  1 1 
       2028 1 2 1 1 155 LEU MD1  . 155 . HD1* 1 1 
       2029 1 1 1 1 155 LEU HA   . 155 . HA   1 1 
       2029 1 2 1 1 155 LEU MD2  . 155 . HD2* 1 1 
       2030 1 1 1 1 155 LEU HB3  . 155 . HB1  1 1 
       2030 1 2 1 1 155 LEU MD2  . 155 . HD2* 1 1 
       2031 1 1 1 1 155 LEU HB2  . 155 . HB2  1 1 
       2031 1 2 1 1 155 LEU MD2  . 155 . HD2* 1 1 
       2032 1 1 1 1 156 GLU HA   . 156 . HA   1 1 
       2032 1 2 1 1 156 GLU HG2  . 156 . HG2  1 1 
       2033 1 1 1 1 156 GLU HA   . 156 . HA   1 1 
       2033 1 2 1 1 156 GLU HG3  . 156 . HG1  1 1 
       2034 1 1 1 1   2 SER HB3  .   2 . HB1  1 1 
       2034 1 2 1 1   3 GLN H    .   3 . HN   1 1 
       2035 1 1 1 1   4 ILE HB   .   4 . HB   1 1 
       2035 1 2 1 1   5 PHE H    .   5 . HN   1 1 
       2036 1 1 1 1   4 ILE MG   .   4 . HG2* 1 1 
       2036 1 2 1 1   5 PHE H    .   5 . HN   1 1 
       2037 1 1 1 1   4 ILE MD   .   4 . HD1* 1 1 
       2037 1 2 1 1   5 PHE H    .   5 . HN   1 1 
       2038 1 1 1 1   6 VAL H    .   6 . HN   1 1 
       2038 1 2 1 1   6 VAL MG1  .   6 . HG1* 1 1 
       2039 1 1 1 1   9 SER HB3  .   9 . HB1  1 1 
       2039 1 2 1 1  10 SER H    .  10 . HN   1 1 
       2040 1 1 1 1  12 PRO HD3  .  12 . HD1  1 1 
       2040 1 2 1 1  13 GLU H    .  13 . HN   1 1 
       2041 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
       2041 1 2 1 1  15 LEU H    .  15 . HN   1 1 
       2042 1 1 1 1  14 ILE H    .  14 . HN   1 1 
       2042 1 2 1 1  14 ILE HG13 .  14 . HG11 1 1 
       2043 1 1 1 1  15 LEU HB2  .  15 . HB2  1 1 
       2043 1 2 1 1  16 LYS H    .  16 . HN   1 1 
       2044 1 1 1 1  16 LYS HG2  .  16 . HG2  1 1 
       2044 1 2 1 1  17 GLU H    .  17 . HN   1 1 
       2045 1 1 1 1  16 LYS HG3  .  16 . HG1  1 1 
       2045 1 2 1 1  17 GLU H    .  17 . HN   1 1 
       2046 1 1 1 1  16 LYS HD2  .  16 . HD2  1 1 
       2046 1 2 1 1  17 GLU H    .  17 . HN   1 1 
       2047 1 1 1 1  16 LYS HD3  .  16 . HD1  1 1 
       2047 1 2 1 1  17 GLU H    .  17 . HN   1 1 
       2048 1 1 1 1  17 GLU HG3  .  17 . HG1  1 1 
       2048 1 2 1 1  18 ILE H    .  18 . HN   1 1 
       2049 1 1 1 1  18 ILE HG12 .  18 . HG12 1 1 
       2049 1 2 1 1  19 VAL H    .  19 . HN   1 1 
       2050 1 1 1 1  18 ILE MD   .  18 . HD1* 1 1 
       2050 1 2 1 1  19 VAL H    .  19 . HN   1 1 
       2051 1 1 1 1  20 ARG HB3  .  20 . HB1  1 1 
       2051 1 2 1 1  21 GLU H    .  21 . HN   1 1 
       2052 1 1 1 1  21 GLU HB3  .  21 . HB1  1 1 
       2052 1 2 1 1  22 ILE H    .  22 . HN   1 1 
       2053 1 1 1 1  21 GLU HG2  .  21 . HG2  1 1 
       2053 1 2 1 1  22 ILE H    .  22 . HN   1 1 
       2054 1 1 1 1  21 GLU HG3  .  21 . HG1  1 1 
       2054 1 2 1 1  22 ILE H    .  22 . HN   1 1 
       2055 1 1 1 1  22 ILE MD   .  22 . HD1* 1 1 
       2055 1 2 1 1  23 LYS H    .  23 . HN   1 1 
       2056 1 1 1 1  22 ILE H    .  22 . HN   1 1 
       2056 1 2 1 1  23 LYS HG2  .  23 . HG2  1 1 
       2057 1 1 1 1  24 ARG HB2  .  24 . HB2  1 1 
       2057 1 2 1 1  25 GLN H    .  25 . HN   1 1 
       2058 1 1 1 1  24 ARG HB3  .  24 . HB1  1 1 
       2058 1 2 1 1  25 GLN H    .  25 . HN   1 1 
       2059 1 1 1 1  24 ARG HD2  .  24 . HD2  1 1 
       2059 1 2 1 1  25 GLN H    .  25 . HN   1 1 
       2060 1 1 1 1  24 ARG HD3  .  24 . HD1  1 1 
       2060 1 2 1 1  25 GLN H    .  25 . HN   1 1 
       2061 1 1 1 1  22 ILE H    .  22 . HN   1 1 
       2061 1 2 1 1  25 GLN HG3  .  25 . HG1  1 1 
       2062 1 1 1 1  22 ILE H    .  22 . HN   1 1 
       2062 1 2 1 1  25 GLN HG2  .  25 . HG2  1 1 
       2063 1 1 1 1  27 VAL MG2  .  27 . HG2* 1 1 
       2063 1 2 1 1  28 ARG H    .  28 . HN   1 1 
       2064 1 1 1 1  28 ARG HD3  .  28 . HD1  1 1 
       2064 1 2 1 1  29 VAL H    .  29 . HN   1 1 
       2065 1 1 1 1  29 VAL MG2  .  29 . HG2* 1 1 
       2065 1 2 1 1  30 VAL H    .  30 . HN   1 1 
       2066 1 1 1 1  32 LEU HG   .  32 . HG   1 1 
       2066 1 2 1 1  33 TYR H    .  33 . HN   1 1 
       2067 1 1 1 1  34 SER HB3  .  34 . HB1  1 1 
       2067 1 2 1 1  35 ASP H    .  35 . HN   1 1 
       2068 1 1 1 1  39 LYS HB2  .  39 . HB2  1 1 
       2068 1 2 1 1  40 ARG H    .  40 . HN   1 1 
       2069 1 1 1 1  39 LYS HB3  .  39 . HB1  1 1 
       2069 1 2 1 1  40 ARG H    .  40 . HN   1 1 
       2070 1 1 1 1  40 ARG HG3  .  40 . HG1  1 1 
       2070 1 2 1 1  41 ARG H    .  41 . HN   1 1 
       2071 1 1 1 1  41 ARG HG2  .  41 . HG2  1 1 
       2071 1 2 1 1  42 ARG H    .  42 . HN   1 1 
       2072 1 1 1 1  42 ARG HG2  .  42 . HG2  1 1 
       2072 1 2 1 1  43 GLU H    .  43 . HN   1 1 
       2073 1 1 1 1  43 GLU H    .  43 . HN   1 1 
       2073 1 2 1 1  45 LEU HG   .  45 . HG   1 1 
       2074 1 1 1 1  42 ARG HG3  .  42 . HG1  1 1 
       2074 1 2 1 1  43 GLU H    .  43 . HN   1 1 
       2075 1 1 1 1  43 GLU HG2  .  43 . HG2  1 1 
       2075 1 2 1 1  44 ARG H    .  44 . HN   1 1 
       2076 1 1 1 1  43 GLU HG3  .  43 . HG1  1 1 
       2076 1 2 1 1  44 ARG H    .  44 . HN   1 1 
       2077 1 1 1 1  44 ARG HG2  .  44 . HG2  1 1 
       2077 1 2 1 1  45 LEU H    .  45 . HN   1 1 
       2078 1 1 1 1  42 ARG HA   .  42 . HA   1 1 
       2078 1 2 1 1  46 GLU H    .  46 . HN   1 1 
       2079 1 1 1 1  45 LEU HB3  .  45 . HB1  1 1 
       2079 1 2 1 1  46 GLU H    .  46 . HN   1 1 
       2080 1 1 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       2080 1 2 1 1  46 GLU H    .  46 . HN   1 1 
       2081 1 1 1 1  46 GLU HB2  .  46 . HB2  1 1 
       2081 1 2 1 1  47 GLU H    .  47 . HN   1 1 
       2082 1 1 1 1  46 GLU HG2  .  46 . HG2  1 1 
       2082 1 2 1 1  47 GLU H    .  47 . HN   1 1 
       2083 1 1 1 1  47 GLU HG2  .  47 . HG2  1 1 
       2083 1 2 1 1  48 PHE H    .  48 . HN   1 1 
       2084 1 1 1 1  47 GLU HG3  .  47 . HG1  1 1 
       2084 1 2 1 1  48 PHE H    .  48 . HN   1 1 
       2085 1 1 1 1  49 GLU HB2  .  49 . HB2  1 1 
       2085 1 2 1 1  50 LYS H    .  50 . HN   1 1 
       2086 1 1 1 1  49 GLU HG3  .  49 . HG1  1 1 
       2086 1 2 1 1  50 LYS H    .  50 . HN   1 1 
       2087 1 1 1 1  49 GLU HG2  .  49 . HG2  1 1 
       2087 1 2 1 1  50 LYS H    .  50 . HN   1 1 
       2088 1 1 1 1  50 LYS HB2  .  50 . HB2  1 1 
       2088 1 2 1 1  51 GLN H    .  51 . HN   1 1 
       2089 1 1 1 1  50 LYS HB3  .  50 . HB1  1 1 
       2089 1 2 1 1  51 GLN H    .  51 . HN   1 1 
       2090 1 1 1 1  51 GLN HB3  .  51 . HB1  1 1 
       2090 1 2 1 1  52 GLY H    .  52 . HN   1 1 
       2091 1 1 1 1  51 GLN HG3  .  51 . HG1  1 1 
       2091 1 2 1 1  52 GLY H    .  52 . HN   1 1 
       2092 1 1 1 1  53 VAL HB   .  53 . HB   1 1 
       2092 1 2 1 1  54 ASP H    .  54 . HN   1 1 
       2093 1 1 1 1  53 VAL MG2  .  53 . HG2* 1 1 
       2093 1 2 1 1  54 ASP H    .  54 . HN   1 1 
       2094 1 1 1 1  54 ASP HB3  .  54 . HB1  1 1 
       2094 1 2 1 1  56 ARG HE   .  56 . HE   1 1 
       2095 1 1 1 1  54 ASP HB2  .  54 . HB2  1 1 
       2095 1 2 1 1  55 VAL H    .  55 . HN   1 1 
       2096 1 1 1 1  57 THR HB   .  57 . HB   1 1 
       2096 1 2 1 1  58 VAL H    .  58 . HN   1 1 
       2097 1 1 1 1  57 THR MG   .  57 . HG2* 1 1 
       2097 1 2 1 1  58 VAL H    .  58 . HN   1 1 
       2098 1 1 1 1  59 GLU HB3  .  59 . HB1  1 1 
       2098 1 2 1 1  60 ASP H    .  60 . HN   1 1 
       2099 1 1 1 1  61 LYS HB2  .  61 . HB2  1 1 
       2099 1 2 1 1  62 GLU H    .  62 . HN   1 1 
       2100 1 1 1 1  61 LYS HB3  .  61 . HB1  1 1 
       2100 1 2 1 1  62 GLU H    .  62 . HN   1 1 
       2101 1 1 1 1  61 LYS HE2  .  61 . HE2  1 1 
       2101 1 2 1 1  62 GLU H    .  62 . HN   1 1 
       2102 1 1 1 1  61 LYS HE3  .  61 . HE1  1 1 
       2102 1 2 1 1  62 GLU H    .  62 . HN   1 1 
       2103 1 1 1 1  65 ARG H    .  65 . HN   1 1 
       2103 1 2 1 1  65 ARG HB2  .  65 . HB2  1 1 
       2104 1 1 1 1  66 GLU HG3  .  66 . HG1  1 1 
       2104 1 2 1 1  67 ASN H    .  67 . HN   1 1 
       2105 1 1 1 1  67 ASN H    .  67 . HN   1 1 
       2105 1 2 1 1  67 ASN HB3  .  67 . HB1  1 1 
       2106 1 1 1 1  68 ILE MD   .  68 . HD1* 1 1 
       2106 1 2 1 1  69 ARG H    .  69 . HN   1 1 
       2107 1 1 1 1  69 ARG HG2  .  69 . HG2  1 1 
       2107 1 2 1 1  70 GLU H    .  70 . HN   1 1 
       2108 1 1 1 1  70 GLU HB3  .  70 . HB1  1 1 
       2108 1 2 1 1  71 ILE H    .  71 . HN   1 1 
       2109 1 1 1 1  70 GLU HG3  .  70 . HG1  1 1 
       2109 1 2 1 1  71 ILE H    .  71 . HN   1 1 
       2110 1 1 1 1  71 ILE MD   .  71 . HD1* 1 1 
       2110 1 2 1 1  72 TRP H    .  72 . HN   1 1 
       2111 1 1 1 1  73 GLU HG2  .  73 . HG2  1 1 
       2111 1 2 1 1  74 ARG H    .  74 . HN   1 1 
       2112 1 1 1 1  74 ARG HG3  .  74 . HG1  1 1 
       2112 1 2 1 1  75 TYR H    .  75 . HN   1 1 
       2113 1 1 1 1  76 PRO HB3  .  76 . HB1  1 1 
       2113 1 2 1 1  77 GLN H    .  77 . HN   1 1 
       2114 1 1 1 1  76 PRO HG3  .  76 . HG1  1 1 
       2114 1 2 1 1  77 GLN H    .  77 . HN   1 1 
       2115 1 1 1 1  81 VAL HB   .  81 . HB   1 1 
       2115 1 2 1 1  82 VAL H    .  82 . HN   1 1 
       2116 1 1 1 1 149 VAL MG1  . 149 . HG1* 1 1 
       2116 1 2 1 1 153 GLY H    . 153 . HN   1 1 
       2117 1 1 1 1  83 ILE HG12 .  83 . HG12 1 1 
       2117 1 2 1 1  84 VAL H    .  84 . HN   1 1 
       2118 1 1 1 1  83 ILE MD   .  83 . HD1* 1 1 
       2118 1 2 1 1  84 VAL H    .  84 . HN   1 1 
       2119 1 1 1 1  64 PHE QE   .  64 . HE*  1 1 
       2119 1 2 1 1  84 VAL MG2  .  84 . HG2* 1 1 
       2120 1 1 1 1  85 THR HB   .  85 . HB   1 1 
       2120 1 2 1 1  86 THR H    .  86 . HN   1 1 
       2121 1 1 1 1  85 THR MG   .  85 . HG2* 1 1 
       2121 1 2 1 1  86 THR H    .  86 . HN   1 1 
       2122 1 1 1 1  86 THR HB   .  86 . HB   1 1 
       2122 1 2 1 1  87 ASP H    .  87 . HN   1 1 
       2123 1 1 1 1  86 THR MG   .  86 . HG2* 1 1 
       2123 1 2 1 1  87 ASP H    .  87 . HN   1 1 
       2124 1 1 1 1  90 GLU HB3  .  90 . HB1  1 1 
       2124 1 2 1 1  91 TRP H    .  91 . HN   1 1 
       2125 1 1 1 1  88 ASP H    .  88 . HN   1 1 
       2125 1 2 1 1  92 ILE HG12 .  92 . HG12 1 1 
       2126 1 1 1 1  88 ASP H    .  88 . HN   1 1 
       2126 1 2 1 1  92 ILE HG13 .  92 . HG11 1 1 
       2127 1 1 1 1  91 TRP H    .  91 . HN   1 1 
       2127 1 2 1 1  92 ILE HG13 .  92 . HG11 1 1 
       2128 1 1 1 1  88 ASP H    .  88 . HN   1 1 
       2128 1 2 1 1  92 ILE MD   .  92 . HD1* 1 1 
       2129 1 1 1 1  95 PHE HB2  .  95 . HB2  1 1 
       2129 1 2 1 1  96 ILE H    .  96 . HN   1 1 
       2130 1 1 1 1  96 ILE HG12 .  96 . HG12 1 1 
       2130 1 2 1 1  97 GLU H    .  97 . HN   1 1 
       2131 1 1 1 1  96 ILE MD   .  96 . HD1* 1 1 
       2131 1 2 1 1  97 GLU H    .  97 . HN   1 1 
       2132 1 1 1 1  98 GLU HG2  .  98 . HG2  1 1 
       2132 1 2 1 1  99 ALA H    .  99 . HN   1 1 
       2133 1 1 1 1 100 LYS HA   . 100 . HA   1 1 
       2133 1 2 1 1 103 GLY H    . 103 . HN   1 1 
       2134 1 1 1 1 100 LYS HD2  . 100 . HD2  1 1 
       2134 1 2 1 1 101 GLU H    . 101 . HN   1 1 
       2135 1 1 1 1 100 LYS HD3  . 100 . HD1  1 1 
       2135 1 2 1 1 101 GLU H    . 101 . HN   1 1 
       2136 1 1 1 1  88 ASP HB3  .  88 . HB1  1 1 
       2136 1 2 1 1  91 TRP H    .  91 . HN   1 1 
       2137 1 1 1 1 105 GLU HB2  . 105 . HB2  1 1 
       2137 1 2 1 1 106 VAL H    . 106 . HN   1 1 
       2138 1 1 1 1  82 VAL MG2  .  82 . HG2* 1 1 
       2138 1 2 1 1  83 ILE H    .  83 . HN   1 1 
       2139 1 1 1 1 106 VAL MG1  . 106 . HG1* 1 1 
       2139 1 2 1 1 107 PHE H    . 107 . HN   1 1 
       2140 1 1 1 1 107 PHE HB3  . 107 . HB1  1 1 
       2140 1 2 1 1 108 VAL H    . 108 . HN   1 1 
       2141 1 1 1 1 108 VAL MG2  . 108 . HG2* 1 1 
       2141 1 2 1 1 109 VAL H    . 109 . HN   1 1 
       2142 1 1 1 1 109 VAL HB   . 109 . HB   1 1 
       2142 1 2 1 1 110 TYR H    . 110 . HN   1 1 
       2143 1 1 1 1 109 VAL MG1  . 109 . HG1* 1 1 
       2143 1 2 1 1 110 TYR H    . 110 . HN   1 1 
       2144 1 1 1 1 110 TYR HB3  . 110 . HB1  1 1 
       2144 1 2 1 1 111 ASN H    . 111 . HN   1 1 
       2145 1 1 1 1 113 LYS HG2  . 113 . HG2  1 1 
       2145 1 2 1 1 114 ASP H    . 114 . HN   1 1 
       2146 1 1 1 1 113 LYS HG3  . 113 . HG1  1 1 
       2146 1 2 1 1 114 ASP H    . 114 . HN   1 1 
       2147 1 1 1 1 113 LYS HE2  . 113 . HE2  1 1 
       2147 1 2 1 1 114 ASP H    . 114 . HN   1 1 
       2148 1 1 1 1 113 LYS HE3  . 113 . HE1  1 1 
       2148 1 2 1 1 114 ASP H    . 114 . HN   1 1 
       2149 1 1 1 1 120 GLU HG2  . 120 . HG2  1 1 
       2149 1 2 1 1 121 ALA H    . 121 . HN   1 1 
       2150 1 1 1 1 122 GLN HB2  . 122 . HB2  1 1 
       2150 1 2 1 1 123 GLN H    . 123 . HN   1 1 
       2151 1 1 1 1 124 GLU HB2  . 124 . HB2  1 1 
       2151 1 2 1 1 125 PHE H    . 125 . HN   1 1 
       2152 1 1 1 1 124 GLU HB3  . 124 . HB1  1 1 
       2152 1 2 1 1 125 PHE H    . 125 . HN   1 1 
       2153 1 1 1 1 124 GLU HG2  . 124 . HG2  1 1 
       2153 1 2 1 1 125 PHE H    . 125 . HN   1 1 
       2154 1 1 1 1 124 GLU HG3  . 124 . HG1  1 1 
       2154 1 2 1 1 125 PHE H    . 125 . HN   1 1 
       2155 1 1 1 1 126 ARG HB3  . 126 . HB1  1 1 
       2155 1 2 1 1 127 SER H    . 127 . HN   1 1 
       2156 1 1 1 1   3 GLN H    .   3 . HN   1 1 
       2156 1 2 1 1  78 LEU HG   .  78 . HG   1 1 
       2157 1 1 1 1 133 ARG HG3  . 133 . HG1  1 1 
       2157 1 2 1 1 134 THR H    . 134 . HN   1 1 
       2158 1 1 1 1 133 ARG HD2  . 133 . HD2  1 1 
       2158 1 2 1 1 134 THR H    . 134 . HN   1 1 
       2159 1 1 1 1 133 ARG HD3  . 133 . HD1  1 1 
       2159 1 2 1 1 134 THR H    . 134 . HN   1 1 
       2160 1 1 1 1 136 SER HB2  . 136 . HB2  1 1 
       2160 1 2 1 1 137 ASP H    . 137 . HN   1 1 
       2161 1 1 1 1 138 LYS HA   . 138 . HA   1 1 
       2161 1 2 1 1 140 GLU H    . 140 . HN   1 1 
       2162 1 1 1 1 138 LYS HD2  . 138 . HD2  1 1 
       2162 1 2 1 1 139 GLU H    . 139 . HN   1 1 
       2163 1 1 1 1 138 LYS HD3  . 138 . HD1  1 1 
       2163 1 2 1 1 139 GLU H    . 139 . HN   1 1 
       2164 1 1 1 1 138 LYS HE2  . 138 . HE2  1 1 
       2164 1 2 1 1 139 GLU H    . 139 . HN   1 1 
       2165 1 1 1 1 138 LYS HE3  . 138 . HE1  1 1 
       2165 1 2 1 1 139 GLU H    . 139 . HN   1 1 
       2166 1 1 1 1  97 GLU H    .  97 . HN   1 1 
       2166 1 2 1 1  97 GLU HG3  .  97 . HG1  1 1 
       2167 1 1 1 1 140 GLU HB3  . 140 . HB1  1 1 
       2167 1 2 1 1 141 LEU H    . 141 . HN   1 1 
       2168 1 1 1 1  94 ASP H    .  94 . HN   1 1 
       2168 1 2 1 1  97 GLU HG3  .  97 . HG1  1 1 
       2169 1 1 1 1 140 GLU HG2  . 140 . HG2  1 1 
       2169 1 2 1 1 141 LEU H    . 141 . HN   1 1 
       2170 1 1 1 1 141 LEU HB2  . 141 . HB2  1 1 
       2170 1 2 1 1 142 ILE H    . 142 . HN   1 1 
       2171 1 1 1 1 111 ASN H    . 111 . HN   1 1 
       2171 1 2 1 1 141 LEU HG   . 141 . HG   1 1 
       2172 1 1 1 1 111 ASN H    . 111 . HN   1 1 
       2172 1 2 1 1 141 LEU MD1  . 141 . HD1* 1 1 
       2173 1 1 1 1 142 ILE HG13 . 142 . HG11 1 1 
       2173 1 2 1 1 143 GLU H    . 143 . HN   1 1 
       2174 1 1 1 1 143 GLU HB2  . 143 . HB2  1 1 
       2174 1 2 1 1 144 GLN H    . 144 . HN   1 1 
       2175 1 1 1 1 143 GLU HG2  . 143 . HG2  1 1 
       2175 1 2 1 1 144 GLN H    . 144 . HN   1 1 
       2176 1 1 1 1 144 GLN HG3  . 144 . HG1  1 1 
       2176 1 2 1 1 145 VAL H    . 145 . HN   1 1 
       2177 1 1 1 1 144 GLN HE21 . 144 . HE21 1 1 
       2177 1 2 1 1 147 ARG HG3  . 147 . HG1  1 1 
       2178 1 1 1 1 147 ARG HG3  . 147 . HG1  1 1 
       2178 1 2 1 1 148 PHE H    . 148 . HN   1 1 
       2179 1 1 1 1 144 GLN HE21 . 144 . HE21 1 1 
       2179 1 2 1 1 147 ARG HD2  . 147 . HD2  1 1 
       2180 1 1 1 1 149 VAL MG2  . 149 . HG2* 1 1 
       2180 1 2 1 1 150 ARG H    . 150 . HN   1 1 
       2181 1 1 1 1 149 VAL MG1  . 149 . HG1* 1 1 
       2181 1 2 1 1 150 ARG H    . 150 . HN   1 1 
       2182 1 1 1 1 150 ARG HG3  . 150 . HG1  1 1 
       2182 1 2 1 1 151 LYS H    . 151 . HN   1 1 
       2183 1 1 1 1 151 LYS HB2  . 151 . HB2  1 1 
       2183 1 2 1 1 152 VAL H    . 152 . HN   1 1 
       2184 1 1 1 1 151 LYS HB3  . 151 . HB1  1 1 
       2184 1 2 1 1 152 VAL H    . 152 . HN   1 1 
       2185 1 1 1 1 151 LYS HG3  . 151 . HG1  1 1 
       2185 1 2 1 1 152 VAL H    . 152 . HN   1 1 
       2186 1 1 1 1 154 SER HB2  . 154 . HB2  1 1 
       2186 1 2 1 1 155 LEU H    . 155 . HN   1 1 
       2187 1 1 1 1 155 LEU HG   . 155 . HG   1 1 
       2187 1 2 1 1 156 GLU H    . 156 . HN   1 1 
       2188 1 1 1 1  12 PRO HA   .  12 . HA   1 1 
       2188 1 2 1 1  14 ILE H    .  14 . HN   1 1 
       2189 1 1 1 1  12 PRO HA   .  12 . HA   1 1 
       2189 1 2 1 1  15 LEU HB3  .  15 . HB1  1 1 
       2190 1 1 1 1  12 PRO HA   .  12 . HA   1 1 
       2190 1 2 1 1  15 LEU HB2  .  15 . HB2  1 1 
       2191 1 1 1 1  12 PRO HA   .  12 . HA   1 1 
       2191 1 2 1 1  16 LYS H    .  16 . HN   1 1 
       2192 1 1 1 1  14 ILE HA   .  14 . HA   1 1 
       2192 1 2 1 1  17 GLU HB2  .  17 . HB2  1 1 
       2193 1 1 1 1  14 ILE HA   .  14 . HA   1 1 
       2193 1 2 1 1  17 GLU HB3  .  17 . HB1  1 1 
       2194 1 1 1 1  15 LEU HA   .  15 . HA   1 1 
       2194 1 2 1 1  17 GLU H    .  17 . HN   1 1 
       2195 1 1 1 1  15 LEU HA   .  15 . HA   1 1 
       2195 1 2 1 1  18 ILE HB   .  18 . HB   1 1 
       2196 1 1 1 1  16 LYS HA   .  16 . HA   1 1 
       2196 1 2 1 1  18 ILE H    .  18 . HN   1 1 
       2197 1 1 1 1  16 LYS HA   .  16 . HA   1 1 
       2197 1 2 1 1  19 VAL HB   .  19 . HB   1 1 
       2198 1 1 1 1  19 VAL HB   .  19 . HB   1 1 
       2198 1 2 1 1  20 ARG HA   .  20 . HA   1 1 
       2199 1 1 1 1  16 LYS HA   .  16 . HA   1 1 
       2199 1 2 1 1  20 ARG H    .  20 . HN   1 1 
       2200 1 1 1 1  17 GLU HA   .  17 . HA   1 1 
       2200 1 2 1 1  20 ARG HB3  .  20 . HB1  1 1 
       2201 1 1 1 1  18 ILE HA   .  18 . HA   1 1 
       2201 1 2 1 1  21 GLU HB2  .  21 . HB2  1 1 
       2202 1 1 1 1  18 ILE HA   .  18 . HA   1 1 
       2202 1 2 1 1  21 GLU HB3  .  21 . HB1  1 1 
       2203 1 1 1 1  17 GLU HB3  .  17 . HB1  1 1 
       2203 1 2 1 1  18 ILE HA   .  18 . HA   1 1 
       2204 1 1 1 1  19 VAL HA   .  19 . HA   1 1 
       2204 1 2 1 1  22 ILE HB   .  22 . HB   1 1 
       2205 1 1 1 1  20 ARG HA   .  20 . HA   1 1 
       2205 1 2 1 1  24 ARG H    .  24 . HN   1 1 
       2206 1 1 1 1  20 ARG HA   .  20 . HA   1 1 
       2206 1 2 1 1  23 LYS H    .  23 . HN   1 1 
       2207 1 1 1 1  20 ARG HA   .  20 . HA   1 1 
       2207 1 2 1 1  23 LYS HB2  .  23 . HB2  1 1 
       2208 1 1 1 1  21 GLU HA   .  21 . HA   1 1 
       2208 1 2 1 1  23 LYS H    .  23 . HN   1 1 
       2209 1 1 1 1  38 GLU HA   .  38 . HA   1 1 
       2209 1 2 1 1  41 ARG HB3  .  41 . HB1  1 1 
       2210 1 1 1 1  38 GLU HA   .  38 . HA   1 1 
       2210 1 2 1 1  41 ARG HB2  .  41 . HB2  1 1 
       2211 1 1 1 1  39 LYS HA   .  39 . HA   1 1 
       2211 1 2 1 1  41 ARG H    .  41 . HN   1 1 
       2212 1 1 1 1  39 LYS HA   .  39 . HA   1 1 
       2212 1 2 1 1  42 ARG H    .  42 . HN   1 1 
       2213 1 1 1 1  39 LYS HA   .  39 . HA   1 1 
       2213 1 2 1 1  42 ARG HB2  .  42 . HB2  1 1 
       2214 1 1 1 1  39 LYS HA   .  39 . HA   1 1 
       2214 1 2 1 1  42 ARG HB3  .  42 . HB1  1 1 
       2215 1 1 1 1  40 ARG HA   .  40 . HA   1 1 
       2215 1 2 1 1  43 GLU H    .  43 . HN   1 1 
       2216 1 1 1 1  40 ARG HA   .  40 . HA   1 1 
       2216 1 2 1 1  44 ARG H    .  44 . HN   1 1 
       2217 1 1 1 1  41 ARG HA   .  41 . HA   1 1 
       2217 1 2 1 1  43 GLU H    .  43 . HN   1 1 
       2218 1 1 1 1  41 ARG HA   .  41 . HA   1 1 
       2218 1 2 1 1  44 ARG H    .  44 . HN   1 1 
       2219 1 1 1 1  41 ARG HA   .  41 . HA   1 1 
       2219 1 2 1 1  44 ARG HB3  .  44 . HB1  1 1 
       2220 1 1 1 1  41 ARG HA   .  41 . HA   1 1 
       2220 1 2 1 1  44 ARG HB2  .  44 . HB2  1 1 
       2221 1 1 1 1  43 GLU HA   .  43 . HA   1 1 
       2221 1 2 1 1  46 GLU HB3  .  46 . HB1  1 1 
       2222 1 1 1 1  46 GLU HA   .  46 . HA   1 1 
       2222 1 2 1 1  46 GLU HB2  .  46 . HB2  1 1 
       2223 1 1 1 1  44 ARG HA   .  44 . HA   1 1 
       2223 1 2 1 1  47 GLU H    .  47 . HN   1 1 
       2224 1 1 1 1  44 ARG HA   .  44 . HA   1 1 
       2224 1 2 1 1  47 GLU HG2  .  47 . HG2  1 1 
       2225 1 1 1 1  45 LEU HA   .  45 . HA   1 1 
       2225 1 2 1 1  48 PHE HB2  .  48 . HB2  1 1 
       2226 1 1 1 1  45 LEU HA   .  45 . HA   1 1 
       2226 1 2 1 1  48 PHE HB3  .  48 . HB1  1 1 
       2227 1 1 1 1  45 LEU HA   .  45 . HA   1 1 
       2227 1 2 1 1  49 GLU H    .  49 . HN   1 1 
       2228 1 1 1 1  46 GLU HA   .  46 . HA   1 1 
       2228 1 2 1 1  49 GLU HB2  .  49 . HB2  1 1 
       2229 1 1 1 1  46 GLU HA   .  46 . HA   1 1 
       2229 1 2 1 1  49 GLU HG3  .  49 . HG1  1 1 
       2230 1 1 1 1  46 GLU HA   .  46 . HA   1 1 
       2230 1 2 1 1  49 GLU HB3  .  49 . HB1  1 1 
       2231 1 1 1 1  47 GLU HA   .  47 . HA   1 1 
       2231 1 2 1 1  50 LYS H    .  50 . HN   1 1 
       2232 1 1 1 1  47 GLU HA   .  47 . HA   1 1 
       2232 1 2 1 1  50 LYS HB3  .  50 . HB1  1 1 
       2233 1 1 1 1  48 PHE HA   .  48 . HA   1 1 
       2233 1 2 1 1  50 LYS H    .  50 . HN   1 1 
       2234 1 1 1 1  61 LYS HA   .  61 . HA   1 1 
       2234 1 2 1 1  63 ASP H    .  63 . HN   1 1 
       2235 1 1 1 1  62 GLU HA   .  62 . HA   1 1 
       2235 1 2 1 1  64 PHE H    .  64 . HN   1 1 
       2236 1 1 1 1  63 ASP HA   .  63 . HA   1 1 
       2236 1 2 1 1  67 ASN H    .  67 . HN   1 1 
       2237 1 1 1 1  64 PHE HA   .  64 . HA   1 1 
       2237 1 2 1 1  67 ASN HB3  .  67 . HB1  1 1 
       2238 1 1 1 1  64 PHE HA   .  64 . HA   1 1 
       2238 1 2 1 1  67 ASN HB2  .  67 . HB2  1 1 
       2239 1 1 1 1  65 ARG HA   .  65 . HA   1 1 
       2239 1 2 1 1  68 ILE HB   .  68 . HB   1 1 
       2240 1 1 1 1  66 GLU HA   .  66 . HA   1 1 
       2240 1 2 1 1  69 ARG HB2  .  69 . HB2  1 1 
       2241 1 1 1 1  66 GLU HA   .  66 . HA   1 1 
       2241 1 2 1 1  69 ARG HB3  .  69 . HB1  1 1 
       2242 1 1 1 1  67 ASN HA   .  67 . HA   1 1 
       2242 1 2 1 1  67 ASN HD22 .  67 . HD22 1 1 
       2243 1 1 1 1  67 ASN HA   .  67 . HA   1 1 
       2243 1 2 1 1  67 ASN HD21 .  67 . HD21 1 1 
       2244 1 1 1 1 117 ARG HA   . 117 . HA   1 1 
       2244 1 2 1 1 120 GLU HB3  . 120 . HB1  1 1 
       2245 1 1 1 1  68 ILE HA   .  68 . HA   1 1 
       2245 1 2 1 1  70 GLU H    .  70 . HN   1 1 
       2246 1 1 1 1  68 ILE HA   .  68 . HA   1 1 
       2246 1 2 1 1  71 ILE HB   .  71 . HB   1 1 
       2247 1 1 1 1  69 ARG HA   .  69 . HA   1 1 
       2247 1 2 1 1 102 ARG HE   . 102 . HE   1 1 
       2248 1 1 1 1  69 ARG HA   .  69 . HA   1 1 
       2248 1 2 1 1  73 GLU H    .  73 . HN   1 1 
       2249 1 1 1 1  70 GLU HA   .  70 . HA   1 1 
       2249 1 2 1 1  73 GLU H    .  73 . HN   1 1 
       2250 1 1 1 1  71 ILE HA   .  71 . HA   1 1 
       2250 1 2 1 1  73 GLU H    .  73 . HN   1 1 
       2251 1 1 1 1  89 LYS HA   .  89 . HA   1 1 
       2251 1 2 1 1  93 LYS H    .  93 . HN   1 1 
       2252 1 1 1 1  89 LYS HA   .  89 . HA   1 1 
       2252 1 2 1 1  92 ILE HB   .  92 . HB   1 1 
       2253 1 1 1 1  90 GLU HA   .  90 . HA   1 1 
       2253 1 2 1 1  94 ASP H    .  94 . HN   1 1 
       2254 1 1 1 1  92 ILE HA   .  92 . HA   1 1 
       2254 1 2 1 1  95 PHE HB2  .  95 . HB2  1 1 
       2255 1 1 1 1  92 ILE HA   .  92 . HA   1 1 
       2255 1 2 1 1  95 PHE HB3  .  95 . HB1  1 1 
       2256 1 1 1 1  93 LYS HA   .  93 . HA   1 1 
       2256 1 2 1 1  96 ILE HB   .  96 . HB   1 1 
       2257 1 1 1 1  93 LYS HA   .  93 . HA   1 1 
       2257 1 2 1 1  97 GLU H    .  97 . HN   1 1 
       2258 1 1 1 1  94 ASP HA   .  94 . HA   1 1 
       2258 1 2 1 1  97 GLU H    .  97 . HN   1 1 
       2259 1 1 1 1  94 ASP HA   .  94 . HA   1 1 
       2259 1 2 1 1  97 GLU HB2  .  97 . HB2  1 1 
       2260 1 1 1 1  95 PHE HA   .  95 . HA   1 1 
       2260 1 2 1 1  97 GLU H    .  97 . HN   1 1 
       2261 1 1 1 1  95 PHE HA   .  95 . HA   1 1 
       2261 1 2 1 1  98 GLU HB2  .  98 . HB2  1 1 
       2262 1 1 1 1  95 PHE HA   .  95 . HA   1 1 
       2262 1 2 1 1  99 ALA H    .  99 . HN   1 1 
       2263 1 1 1 1  96 ILE HA   .  96 . HA   1 1 
       2263 1 2 1 1  99 ALA MB   .  99 . HB*  1 1 
       2264 1 1 1 1  96 ILE HA   .  96 . HA   1 1 
       2264 1 2 1 1 100 LYS H    . 100 . HN   1 1 
       2265 1 1 1 1  97 GLU HA   .  97 . HA   1 1 
       2265 1 2 1 1  99 ALA H    .  99 . HN   1 1 
       2266 1 1 1 1  97 GLU HA   .  97 . HA   1 1 
       2266 1 2 1 1 101 GLU H    . 101 . HN   1 1 
       2267 1 1 1 1  98 GLU HA   .  98 . HA   1 1 
       2267 1 2 1 1 100 LYS H    . 100 . HN   1 1 
       2268 1 1 1 1  98 GLU HA   .  98 . HA   1 1 
       2268 1 2 1 1 101 GLU H    . 101 . HN   1 1 
       2269 1 1 1 1  99 ALA HA   .  99 . HA   1 1 
       2269 1 2 1 1 103 GLY H    . 103 . HN   1 1 
       2270 1 1 1 1 115 ASP HA   . 115 . HA   1 1 
       2270 1 2 1 1 117 ARG H    . 117 . HN   1 1 
       2271 1 1 1 1 115 ASP HA   . 115 . HA   1 1 
       2271 1 2 1 1 118 ARG HB2  . 118 . HB2  1 1 
       2272 1 1 1 1 115 ASP HA   . 115 . HA   1 1 
       2272 1 2 1 1 118 ARG HB3  . 118 . HB1  1 1 
       2273 1 1 1 1 117 ARG HA   . 117 . HA   1 1 
       2273 1 2 1 1 120 GLU HB2  . 120 . HB2  1 1 
       2274 1 1 1 1 117 ARG HA   . 117 . HA   1 1 
       2274 1 2 1 1 121 ALA H    . 121 . HN   1 1 
       2275 1 1 1 1 118 ARG HA   . 118 . HA   1 1 
       2275 1 2 1 1 121 ALA MB   . 121 . HB*  1 1 
       2276 1 1 1 1 118 ARG HA   . 118 . HA   1 1 
       2276 1 2 1 1 122 GLN H    . 122 . HN   1 1 
       2277 1 1 1 1 119 LYS HA   . 119 . HA   1 1 
       2277 1 2 1 1 121 ALA H    . 121 . HN   1 1 
       2278 1 1 1 1 119 LYS HA   . 119 . HA   1 1 
       2278 1 2 1 1 122 GLN H    . 122 . HN   1 1 
       2279 1 1 1 1 119 LYS HA   . 119 . HA   1 1 
       2279 1 2 1 1 122 GLN HB2  . 122 . HB2  1 1 
       2280 1 1 1 1 119 LYS HA   . 119 . HA   1 1 
       2280 1 2 1 1 123 GLN H    . 123 . HN   1 1 
       2281 1 1 1 1 120 GLU HA   . 120 . HA   1 1 
       2281 1 2 1 1 122 GLN H    . 122 . HN   1 1 
       2282 1 1 1 1 120 GLU HA   . 120 . HA   1 1 
       2282 1 2 1 1 123 GLN H    . 123 . HN   1 1 
       2283 1 1 1 1 120 GLU HA   . 120 . HA   1 1 
       2283 1 2 1 1 124 GLU H    . 124 . HN   1 1 
       2284 1 1 1 1 121 ALA HA   . 121 . HA   1 1 
       2284 1 2 1 1 124 GLU HB2  . 124 . HB2  1 1 
       2285 1 1 1 1 121 ALA HA   . 121 . HA   1 1 
       2285 1 2 1 1 124 GLU HB3  . 124 . HB1  1 1 
       2286 1 1 1 1 138 LYS HA   . 138 . HA   1 1 
       2286 1 2 1 1 141 LEU HB3  . 141 . HB1  1 1 
       2287 1 1 1 1 138 LYS HA   . 138 . HA   1 1 
       2287 1 2 1 1 141 LEU HB2  . 141 . HB2  1 1 
       2288 1 1 1 1 138 LYS HA   . 138 . HA   1 1 
       2288 1 2 1 1 142 ILE H    . 142 . HN   1 1 
       2289 1 1 1 1 139 GLU HA   . 139 . HA   1 1 
       2289 1 2 1 1 141 LEU H    . 141 . HN   1 1 
       2290 1 1 1 1 139 GLU HA   . 139 . HA   1 1 
       2290 1 2 1 1 142 ILE H    . 142 . HN   1 1 
       2291 1 1 1 1 139 GLU HA   . 139 . HA   1 1 
       2291 1 2 1 1 142 ILE HB   . 142 . HB   1 1 
       2292 1 1 1 1 139 GLU HA   . 139 . HA   1 1 
       2292 1 2 1 1 143 GLU H    . 143 . HN   1 1 
       2293 1 1 1 1 140 GLU HA   . 140 . HA   1 1 
       2293 1 2 1 1 143 GLU H    . 143 . HN   1 1 
       2294 1 1 1 1 141 LEU HA   . 141 . HA   1 1 
       2294 1 2 1 1 143 GLU H    . 143 . HN   1 1 
       2295 1 1 1 1 141 LEU HA   . 141 . HA   1 1 
       2295 1 2 1 1 144 GLN HB2  . 144 . HB2  1 1 
       2296 1 1 1 1 142 ILE HA   . 142 . HA   1 1 
       2296 1 2 1 1 145 VAL HB   . 145 . HB   1 1 
       2297 1 1 1 1 143 GLU HA   . 143 . HA   1 1 
       2297 1 2 1 1 145 VAL H    . 145 . HN   1 1 
       2298 1 1 1 1 143 GLU HA   . 143 . HA   1 1 
       2298 1 2 1 1 146 ARG HB2  . 146 . HB2  1 1 
       2299 1 1 1 1  17 GLU HA   .  17 . HA   1 1 
       2299 1 2 1 1  20 ARG HG2  .  20 . HG2  1 1 
       2300 1 1 1 1 144 GLN HA   . 144 . HA   1 1 
       2300 1 2 1 1 147 ARG H    . 147 . HN   1 1 
       2301 1 1 1 1 144 GLN HA   . 144 . HA   1 1 
       2301 1 2 1 1 147 ARG HB2  . 147 . HB2  1 1 
       2302 1 1 1 1 144 GLN HA   . 144 . HA   1 1 
       2302 1 2 1 1 147 ARG HG3  . 147 . HG1  1 1 
       2303 1 1 1 1 144 GLN HA   . 144 . HA   1 1 
       2303 1 2 1 1 147 ARG HB3  . 147 . HB1  1 1 
       2304 1 1 1 1 145 VAL HA   . 145 . HA   1 1 
       2304 1 2 1 1 148 PHE HB2  . 148 . HB2  1 1 
       2305 1 1 1 1 145 VAL HA   . 145 . HA   1 1 
       2305 1 2 1 1 148 PHE HB3  . 148 . HB1  1 1 
       2306 1 1 1 1 146 ARG HA   . 146 . HA   1 1 
       2306 1 2 1 1 149 VAL HB   . 149 . HB   1 1 
       2307 1 1 1 1 146 ARG HA   . 146 . HA   1 1 
       2307 1 2 1 1 148 PHE H    . 148 . HN   1 1 
       2308 1 1 1 1 147 ARG HA   . 147 . HA   1 1 
       2308 1 2 1 1 149 VAL H    . 149 . HN   1 1 
       2309 1 1 1 1 147 ARG HA   . 147 . HA   1 1 
       2309 1 2 1 1 150 ARG HB2  . 150 . HB2  1 1 
       2310 1 1 1 1 148 PHE HA   . 148 . HA   1 1 
       2310 1 2 1 1 151 LYS H    . 151 . HN   1 1 
       2311 1 1 1 1 147 ARG HB3  . 147 . HB1  1 1 
       2311 1 2 1 1 148 PHE HA   . 148 . HA   1 1 
       2312 1 1 1 1 149 VAL HA   . 149 . HA   1 1 
       2312 1 2 1 1 151 LYS H    . 151 . HN   1 1 
       2313 1 1 1 1 149 VAL HA   . 149 . HA   1 1 
       2313 1 2 1 1 152 VAL H    . 152 . HN   1 1 
       2314 1 1 1 1 149 VAL HA   . 149 . HA   1 1 
       2314 1 2 1 1 152 VAL HB   . 152 . HB   1 1 
       2315 1 1 1 1   2 SER HB2  .   2 . HB2  1 1 
       2315 1 2 1 1 105 GLU HB2  . 105 . HB2  1 1 
       2316 1 1 1 1   2 SER HB2  .   2 . HB2  1 1 
       2316 1 2 1 1  78 LEU MD1  .  78 . HD1* 1 1 
       2317 1 1 1 1   2 SER HB3  .   2 . HB1  1 1 
       2317 1 2 1 1 105 GLU HB2  . 105 . HB2  1 1 
       2318 1 1 1 1   2 SER HB3  .   2 . HB1  1 1 
       2318 1 2 1 1  78 LEU MD1  .  78 . HD1* 1 1 
       2319 1 1 1 1   3 GLN HB3  .   3 . HB1  1 1 
       2319 1 2 1 1 105 GLU H    . 105 . HN   1 1 
       2320 1 1 1 1   5 PHE HZ   .   5 . HZ   1 1 
       2320 1 2 1 1 109 VAL HB   . 109 . HB   1 1 
       2321 1 1 1 1 107 PHE QE   . 107 . HE*  1 1 
       2321 1 2 1 1 109 VAL HB   . 109 . HB   1 1 
       2322 1 1 1 1   3 GLN HA   .   3 . HA   1 1 
       2322 1 2 1 1 104 VAL MG1  . 104 . HG1* 1 1 
       2323 1 1 1 1   3 GLN HA   .   3 . HA   1 1 
       2323 1 2 1 1 104 VAL HB   . 104 . HB   1 1 
       2324 1 1 1 1   3 GLN HA   .   3 . HA   1 1 
       2324 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       2325 1 1 1 1   4 ILE HB   .   4 . HB   1 1 
       2325 1 2 1 1 104 VAL MG1  . 104 . HG1* 1 1 
       2326 1 1 1 1   4 ILE HB   .   4 . HB   1 1 
       2326 1 2 1 1 106 VAL MG2  . 106 . HG2* 1 1 
       2327 1 1 1 1   4 ILE HA   .   4 . HA   1 1 
       2327 1 2 1 1  82 VAL MG2  .  82 . HG2* 1 1 
       2328 1 1 1 1   4 ILE MG   .   4 . HG2* 1 1 
       2328 1 2 1 1 106 VAL MG1  . 106 . HG1* 1 1 
       2329 1 1 1 1   4 ILE MG   .   4 . HG2* 1 1 
       2329 1 2 1 1  71 ILE MG   .  71 . HG2* 1 1 
       2330 1 1 1 1   4 ILE MG   .   4 . HG2* 1 1 
       2330 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
       2331 1 1 1 1   4 ILE MG   .   4 . HG2* 1 1 
       2331 1 2 1 1   6 VAL MG1  .   6 . HG1* 1 1 
       2332 1 1 1 1   4 ILE MD   .   4 . HD1* 1 1 
       2332 1 2 1 1  82 VAL MG2  .  82 . HG2* 1 1 
       2333 1 1 1 1   4 ILE MD   .   4 . HD1* 1 1 
       2333 1 2 1 1  71 ILE MG   .  71 . HG2* 1 1 
       2334 1 1 1 1   4 ILE MD   .   4 . HD1* 1 1 
       2334 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
       2335 1 1 1 1   4 ILE MD   .   4 . HD1* 1 1 
       2335 1 2 1 1   6 VAL MG1  .   6 . HG1* 1 1 
       2336 1 1 1 1   4 ILE MD   .   4 . HD1* 1 1 
       2336 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       2337 1 1 1 1   4 ILE MD   .   4 . HD1* 1 1 
       2337 1 2 1 1  80 VAL MG2  .  80 . HG2* 1 1 
       2338 1 1 1 1   4 ILE MD   .   4 . HD1* 1 1 
       2338 1 2 1 1  68 ILE MG   .  68 . HG2* 1 1 
       2339 1 1 1 1   4 ILE MD   .   4 . HD1* 1 1 
       2339 1 2 1 1   6 VAL HB   .   6 . HB   1 1 
       2340 1 1 1 1   4 ILE MD   .   4 . HD1* 1 1 
       2340 1 2 1 1  99 ALA MB   .  99 . HB*  1 1 
       2341 1 1 1 1   4 ILE MD   .   4 . HD1* 1 1 
       2341 1 2 1 1  78 LEU HG   .  78 . HG   1 1 
       2342 1 1 1 1   4 ILE MD   .   4 . HD1* 1 1 
       2342 1 2 1 1 104 VAL HB   . 104 . HB   1 1 
       2343 1 1 1 1   4 ILE HG12 .   4 . HG12 1 1 
       2343 1 2 1 1  71 ILE MG   .  71 . HG2* 1 1 
       2344 1 1 1 1   4 ILE MG   .   4 . HG2* 1 1 
       2344 1 2 1 1 106 VAL HB   . 106 . HB   1 1 
       2345 1 1 1 1   4 ILE MG   .   4 . HG2* 1 1 
       2345 1 2 1 1 106 VAL HA   . 106 . HA   1 1 
       2346 1 1 1 1   4 ILE MG   .   4 . HG2* 1 1 
       2346 1 2 1 1  99 ALA HA   .  99 . HA   1 1 
       2347 1 1 1 1   4 ILE MD   .   4 . HD1* 1 1 
       2347 1 2 1 1 106 VAL HA   . 106 . HA   1 1 
       2348 1 1 1 1   4 ILE MD   .   4 . HD1* 1 1 
       2348 1 2 1 1  78 LEU HA   .  78 . HA   1 1 
       2349 1 1 1 1   3 GLN HA   .   3 . HA   1 1 
       2349 1 2 1 1   4 ILE MG   .   4 . HG2* 1 1 
       2350 1 1 1 1   4 ILE MG   .   4 . HG2* 1 1 
       2350 1 2 1 1  72 TRP HZ3  .  72 . HZ3  1 1 
       2351 1 1 1 1   4 ILE MG   .   4 . HG2* 1 1 
       2351 1 2 1 1  95 PHE QE   .  95 . HE*  1 1 
       2352 1 1 1 1   4 ILE MD   .   4 . HD1* 1 1 
       2352 1 2 1 1  72 TRP HH2  .  72 . HH2  1 1 
       2353 1 1 1 1   4 ILE MD   .   4 . HD1* 1 1 
       2353 1 2 1 1  72 TRP HZ3  .  72 . HZ3  1 1 
       2354 1 1 1 1   4 ILE MD   .   4 . HD1* 1 1 
       2354 1 2 1 1  95 PHE HZ   .  95 . HZ   1 1 
       2355 1 1 1 1   4 ILE MD   .   4 . HD1* 1 1 
       2355 1 2 1 1  95 PHE QD   .  95 . HD*  1 1 
       2356 1 1 1 1   4 ILE MD   .   4 . HD1* 1 1 
       2356 1 2 1 1  80 VAL H    .  80 . HN   1 1 
       2357 1 1 1 1   4 ILE MD   .   4 . HD1* 1 1 
       2357 1 2 1 1  72 TRP HE3  .  72 . HE3  1 1 
       2358 1 1 1 1   5 PHE HA   .   5 . HA   1 1 
       2358 1 2 1 1 107 PHE QD   . 107 . HD*  1 1 
       2359 1 1 1 1   5 PHE HB3  .   5 . HB1  1 1 
       2359 1 2 1 1  81 VAL MG1  .  81 . HG1* 1 1 
       2360 1 1 1 1 107 PHE HB2  . 107 . HB2  1 1 
       2360 1 2 1 1 108 VAL MG2  . 108 . HG2* 1 1 
       2361 1 1 1 1   6 VAL HA   .   6 . HA   1 1 
       2361 1 2 1 1  82 VAL MG1  .  82 . HG1* 1 1 
       2362 1 1 1 1   6 VAL HA   .   6 . HA   1 1 
       2362 1 2 1 1  81 VAL MG1  .  81 . HG1* 1 1 
       2363 1 1 1 1   6 VAL HB   .   6 . HB   1 1 
       2363 1 2 1 1  82 VAL MG2  .  82 . HG2* 1 1 
       2364 1 1 1 1   6 VAL HB   .   6 . HB   1 1 
       2364 1 2 1 1 106 VAL MG1  . 106 . HG1* 1 1 
       2365 1 1 1 1   6 VAL HB   .   6 . HB   1 1 
       2365 1 2 1 1  82 VAL HB   .  82 . HB   1 1 
       2366 1 1 1 1   6 VAL HA   .   6 . HA   1 1 
       2366 1 2 1 1   7 VAL HB   .   7 . HB   1 1 
       2367 1 1 1 1   6 VAL MG1  .   6 . HG1* 1 1 
       2367 1 2 1 1 106 VAL MG1  . 106 . HG1* 1 1 
       2368 1 1 1 1   6 VAL MG1  .   6 . HG1* 1 1 
       2368 1 2 1 1   7 VAL MG2  .   7 . HG2* 1 1 
       2369 1 1 1 1   6 VAL MG2  .   6 . HG2* 1 1 
       2369 1 2 1 1  82 VAL MG1  .  82 . HG1* 1 1 
       2370 1 1 1 1   6 VAL MG2  .   6 . HG2* 1 1 
       2370 1 2 1 1  82 VAL MG2  .  82 . HG2* 1 1 
       2371 1 1 1 1   6 VAL MG2  .   6 . HG2* 1 1 
       2371 1 2 1 1 106 VAL MG1  . 106 . HG1* 1 1 
       2372 1 1 1 1   4 ILE MG   .   4 . HG2* 1 1 
       2372 1 2 1 1   6 VAL MG2  .   6 . HG2* 1 1 
       2373 1 1 1 1   4 ILE HG13 .   4 . HG11 1 1 
       2373 1 2 1 1   6 VAL MG2  .   6 . HG2* 1 1 
       2374 1 1 1 1   6 VAL MG2  .   6 . HG2* 1 1 
       2374 1 2 1 1  82 VAL HB   .  82 . HB   1 1 
       2375 1 1 1 1   6 VAL MG1  .   6 . HG1* 1 1 
       2375 1 2 1 1  82 VAL HB   .  82 . HB   1 1 
       2376 1 1 1 1   4 ILE HG12 .   4 . HG12 1 1 
       2376 1 2 1 1   6 VAL MG2  .   6 . HG2* 1 1 
       2377 1 1 1 1   6 VAL MG2  .   6 . HG2* 1 1 
       2377 1 2 1 1   7 VAL HB   .   7 . HB   1 1 
       2378 1 1 1 1   6 VAL HA   .   6 . HA   1 1 
       2378 1 2 1 1  83 ILE HA   .  83 . HA   1 1 
       2379 1 1 1 1   6 VAL HA   .   6 . HA   1 1 
       2379 1 2 1 1  81 VAL HA   .  81 . HA   1 1 
       2380 1 1 1 1   5 PHE HA   .   5 . HA   1 1 
       2380 1 2 1 1   6 VAL MG1  .   6 . HG1* 1 1 
       2381 1 1 1 1   6 VAL MG1  .   6 . HG1* 1 1 
       2381 1 2 1 1 108 VAL HA   . 108 . HA   1 1 
       2382 1 1 1 1   6 VAL MG2  .   6 . HG2* 1 1 
       2382 1 2 1 1   7 VAL HA   .   7 . HA   1 1 
       2383 1 1 1 1   6 VAL MG2  .   6 . HG2* 1 1 
       2383 1 2 1 1  83 ILE HA   .  83 . HA   1 1 
       2384 1 1 1 1   7 VAL HB   .   7 . HB   1 1 
       2384 1 2 1 1  83 ILE HA   .  83 . HA   1 1 
       2385 1 1 1 1   7 VAL HB   .   7 . HB   1 1 
       2385 1 2 1 1   8 PHE HA   .   8 . HA   1 1 
       2386 1 1 1 1   6 VAL HA   .   6 . HA   1 1 
       2386 1 2 1 1   7 VAL MG2  .   7 . HG2* 1 1 
       2387 1 1 1 1   7 VAL MG1  .   7 . HG1* 1 1 
       2387 1 2 1 1   8 PHE HA   .   8 . HA   1 1 
       2388 1 1 1 1   7 VAL HB   .   7 . HB   1 1 
       2388 1 2 1 1  83 ILE HG12 .  83 . HG12 1 1 
       2389 1 1 1 1   7 VAL HA   .   7 . HA   1 1 
       2389 1 2 1 1   8 PHE HA   .   8 . HA   1 1 
       2390 1 1 1 1   8 PHE HB3  .   8 . HB1  1 1 
       2390 1 2 1 1 110 TYR HA   . 110 . HA   1 1 
       2391 1 1 1 1   8 PHE HB3  .   8 . HB1  1 1 
       2391 1 2 1 1  87 ASP HA   .  87 . HA   1 1 
       2392 1 1 1 1   8 PHE HA   .   8 . HA   1 1 
       2392 1 2 1 1   9 SER HB3  .   9 . HB1  1 1 
       2393 1 1 1 1   8 PHE HA   .   8 . HA   1 1 
       2393 1 2 1 1  84 VAL HB   .  84 . HB   1 1 
       2394 1 1 1 1   8 PHE HB2  .   8 . HB2  1 1 
       2394 1 2 1 1 108 VAL MG1  . 108 . HG1* 1 1 
       2395 1 1 1 1   8 PHE HB2  .   8 . HB2  1 1 
       2395 1 2 1 1  92 ILE HG13 .  92 . HG11 1 1 
       2396 1 1 1 1   8 PHE HB2  .   8 . HB2  1 1 
       2396 1 2 1 1  92 ILE MD   .  92 . HD1* 1 1 
       2397 1 1 1 1   8 PHE HA   .   8 . HA   1 1 
       2397 1 2 1 1  86 THR MG   .  86 . HG2* 1 1 
       2398 1 1 1 1   8 PHE HB3  .   8 . HB1  1 1 
       2398 1 2 1 1 108 VAL MG1  . 108 . HG1* 1 1 
       2399 1 1 1 1   7 VAL MG1  .   7 . HG1* 1 1 
       2399 1 2 1 1   8 PHE HB3  .   8 . HB1  1 1 
       2400 1 1 1 1   8 PHE HB3  .   8 . HB1  1 1 
       2400 1 2 1 1  92 ILE HG13 .  92 . HG11 1 1 
       2401 1 1 1 1   8 PHE HB3  .   8 . HB1  1 1 
       2401 1 2 1 1  86 THR MG   .  86 . HG2* 1 1 
       2402 1 1 1 1   8 PHE HB3  .   8 . HB1  1 1 
       2402 1 2 1 1  92 ILE MD   .  92 . HD1* 1 1 
       2403 1 1 1 1   9 SER HB3  .   9 . HB1  1 1 
       2403 1 2 1 1 111 ASN HB3  . 111 . HB1  1 1 
       2404 1 1 1 1   9 SER HB2  .   9 . HB2  1 1 
       2404 1 2 1 1 111 ASN HB3  . 111 . HB1  1 1 
       2405 1 1 1 1   9 SER HB3  .   9 . HB1  1 1 
       2405 1 2 1 1  14 ILE MD   .  14 . HD1* 1 1 
       2406 1 1 1 1   9 SER HB3  .   9 . HB1  1 1 
       2406 1 2 1 1 141 LEU MD1  . 141 . HD1* 1 1 
       2407 1 1 1 1   9 SER HB3  .   9 . HB1  1 1 
       2407 1 2 1 1  18 ILE MD   .  18 . HD1* 1 1 
       2408 1 1 1 1   9 SER HB2  .   9 . HB2  1 1 
       2408 1 2 1 1 141 LEU MD1  . 141 . HD1* 1 1 
       2409 1 1 1 1   7 VAL MG1  .   7 . HG1* 1 1 
       2409 1 2 1 1   9 SER HB2  .   9 . HB2  1 1 
       2410 1 1 1 1   9 SER HB2  .   9 . HB2  1 1 
       2410 1 2 1 1  18 ILE MD   .  18 . HD1* 1 1 
       2411 1 1 1 1  11 ASP HA   .  11 . HA   1 1 
       2411 1 2 1 1  14 ILE MD   .  14 . HD1* 1 1 
       2412 1 1 1 1  11 ASP H    .  11 . HN   1 1 
       2412 1 2 1 1  12 PRO HD2  .  12 . HD2  1 1 
       2413 1 1 1 1  12 PRO HD2  .  12 . HD2  1 1 
       2413 1 2 1 1  14 ILE H    .  14 . HN   1 1 
       2414 1 1 1 1  12 PRO HG2  .  12 . HG2  1 1 
       2414 1 2 1 1  14 ILE H    .  14 . HN   1 1 
       2415 1 1 1 1  11 ASP HA   .  11 . HA   1 1 
       2415 1 2 1 1  12 PRO HD2  .  12 . HD2  1 1 
       2416 1 1 1 1  11 ASP HA   .  11 . HA   1 1 
       2416 1 2 1 1  12 PRO HD3  .  12 . HD1  1 1 
       2417 1 1 1 1  11 ASP HA   .  11 . HA   1 1 
       2417 1 2 1 1  12 PRO HG2  .  12 . HG2  1 1 
       2418 1 1 1 1  11 ASP HA   .  11 . HA   1 1 
       2418 1 2 1 1  12 PRO HG3  .  12 . HG1  1 1 
       2419 1 1 1 1  12 PRO HG2  .  12 . HG2  1 1 
       2419 1 2 1 1  13 GLU HA   .  13 . HA   1 1 
       2420 1 1 1 1  11 ASP HB3  .  11 . HB1  1 1 
       2420 1 2 1 1  12 PRO HD3  .  12 . HD1  1 1 
       2421 1 1 1 1  11 ASP HB2  .  11 . HB2  1 1 
       2421 1 2 1 1  12 PRO HD3  .  12 . HD1  1 1 
       2422 1 1 1 1  12 PRO HA   .  12 . HA   1 1 
       2422 1 2 1 1  15 LEU MD2  .  15 . HD2* 1 1 
       2423 1 1 1 1  12 PRO HA   .  12 . HA   1 1 
       2423 1 2 1 1  15 LEU MD1  .  15 . HD1* 1 1 
       2424 1 1 1 1  12 PRO HB3  .  12 . HB1  1 1 
       2424 1 2 1 1  15 LEU HB2  .  15 . HB2  1 1 
       2425 1 1 1 1  12 PRO HB3  .  12 . HB1  1 1 
       2425 1 2 1 1  15 LEU HB3  .  15 . HB1  1 1 
       2426 1 1 1 1  12 PRO HB3  .  12 . HB1  1 1 
       2426 1 2 1 1  15 LEU MD1  .  15 . HD1* 1 1 
       2427 1 1 1 1  13 GLU H    .  13 . HN   1 1 
       2427 1 2 1 1  14 ILE HA   .  14 . HA   1 1 
       2428 1 1 1 1  13 GLU H    .  13 . HN   1 1 
       2428 1 2 1 1  14 ILE HG12 .  14 . HG12 1 1 
       2429 1 1 1 1  14 ILE MD   .  14 . HD1* 1 1 
       2429 1 2 1 1 112 ASN H    . 112 . HN   1 1 
       2430 1 1 1 1  14 ILE MD   .  14 . HD1* 1 1 
       2430 1 2 1 1 141 LEU H    . 141 . HN   1 1 
       2431 1 1 1 1  14 ILE MD   .  14 . HD1* 1 1 
       2431 1 2 1 1 139 GLU H    . 139 . HN   1 1 
       2432 1 1 1 1   9 SER HG   .   9 . HG   1 1 
       2432 1 2 1 1  14 ILE MG   .  14 . HG2* 1 1 
       2433 1 1 1 1  14 ILE MD   .  14 . HD1* 1 1 
       2433 1 2 1 1 111 ASN HD22 . 111 . HD22 1 1 
       2434 1 1 1 1   9 SER HG   .   9 . HG   1 1 
       2434 1 2 1 1  14 ILE MD   .  14 . HD1* 1 1 
       2435 1 1 1 1  11 ASP HB3  .  11 . HB1  1 1 
       2435 1 2 1 1  14 ILE HB   .  14 . HB   1 1 
       2436 1 1 1 1  11 ASP HB2  .  11 . HB2  1 1 
       2436 1 2 1 1  14 ILE HB   .  14 . HB   1 1 
       2437 1 1 1 1  14 ILE HA   .  14 . HA   1 1 
       2437 1 2 1 1  17 GLU HG2  .  17 . HG2  1 1 
       2438 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
       2438 1 2 1 1  17 GLU HG3  .  17 . HG1  1 1 
       2439 1 1 1 1  11 ASP HB3  .  11 . HB1  1 1 
       2439 1 2 1 1  14 ILE MG   .  14 . HG2* 1 1 
       2440 1 1 1 1  11 ASP HB2  .  11 . HB2  1 1 
       2440 1 2 1 1  14 ILE MG   .  14 . HG2* 1 1 
       2441 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
       2441 1 2 1 1 138 LYS HE2  . 138 . HE2  1 1 
       2442 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
       2442 1 2 1 1 138 LYS HE3  . 138 . HE1  1 1 
       2443 1 1 1 1  11 ASP HB2  .  11 . HB2  1 1 
       2443 1 2 1 1  14 ILE HG12 .  14 . HG12 1 1 
       2444 1 1 1 1  11 ASP HB3  .  11 . HB1  1 1 
       2444 1 2 1 1  14 ILE HG12 .  14 . HG12 1 1 
       2445 1 1 1 1  14 ILE HG13 .  14 . HG11 1 1 
       2445 1 2 1 1 138 LYS HB2  . 138 . HB2  1 1 
       2446 1 1 1 1  13 GLU HB2  .  13 . HB2  1 1 
       2446 1 2 1 1  14 ILE HG13 .  14 . HG11 1 1 
       2447 1 1 1 1  11 ASP HB3  .  11 . HB1  1 1 
       2447 1 2 1 1  14 ILE HG13 .  14 . HG11 1 1 
       2448 1 1 1 1  11 ASP HB2  .  11 . HB2  1 1 
       2448 1 2 1 1  14 ILE HG13 .  14 . HG11 1 1 
       2449 1 1 1 1  11 ASP HB3  .  11 . HB1  1 1 
       2449 1 2 1 1  14 ILE MD   .  14 . HD1* 1 1 
       2450 1 1 1 1  11 ASP HB2  .  11 . HB2  1 1 
       2450 1 2 1 1  14 ILE MD   .  14 . HD1* 1 1 
       2451 1 1 1 1  13 GLU HB2  .  13 . HB2  1 1 
       2451 1 2 1 1  14 ILE MD   .  14 . HD1* 1 1 
       2452 1 1 1 1  14 ILE MD   .  14 . HD1* 1 1 
       2452 1 2 1 1 138 LYS HB2  . 138 . HB2  1 1 
       2453 1 1 1 1  14 ILE MD   .  14 . HD1* 1 1 
       2453 1 2 1 1 141 LEU HB3  . 141 . HB1  1 1 
       2454 1 1 1 1  14 ILE HG13 .  14 . HG11 1 1 
       2454 1 2 1 1 138 LYS HD2  . 138 . HD2  1 1 
       2455 1 1 1 1  14 ILE HG13 .  14 . HG11 1 1 
       2455 1 2 1 1 138 LYS HD3  . 138 . HD1  1 1 
       2456 1 1 1 1  15 LEU MD2  .  15 . HD2* 1 1 
       2456 1 2 1 1  85 THR MG   .  85 . HG2* 1 1 
       2457 1 1 1 1  15 LEU MD2  .  15 . HD2* 1 1 
       2457 1 2 1 1  31 LEU MD2  .  31 . HD2* 1 1 
       2458 1 1 1 1   9 SER HB3  .   9 . HB1  1 1 
       2458 1 2 1 1  15 LEU MD2  .  15 . HD2* 1 1 
       2459 1 1 1 1  33 TYR HB3  .  33 . HB1  1 1 
       2459 1 2 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       2460 1 1 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       2460 1 2 1 1  55 VAL HB   .  55 . HB   1 1 
       2461 1 1 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       2461 1 2 1 1  57 THR HA   .  57 . HA   1 1 
       2462 1 1 1 1  15 LEU MD1  .  15 . HD1* 1 1 
       2462 1 2 1 1  85 THR HA   .  85 . HA   1 1 
       2463 1 1 1 1  15 LEU HB3  .  15 . HB1  1 1 
       2463 1 2 1 1  48 PHE HZ   .  48 . HZ   1 1 
       2464 1 1 1 1  15 LEU HG   .  15 . HG   1 1 
       2464 1 2 1 1  48 PHE HZ   .  48 . HZ   1 1 
       2465 1 1 1 1  15 LEU HG   .  15 . HG   1 1 
       2465 1 2 1 1  48 PHE QE   .  48 . HE*  1 1 
       2466 1 1 1 1  15 LEU MD1  .  15 . HD1* 1 1 
       2466 1 2 1 1  48 PHE HZ   .  48 . HZ   1 1 
       2467 1 1 1 1  15 LEU MD2  .  15 . HD2* 1 1 
       2467 1 2 1 1  33 TYR QD   .  33 . HD*  1 1 
       2468 1 1 1 1  16 LYS HA   .  16 . HA   1 1 
       2468 1 2 1 1  48 PHE QE   .  48 . HE*  1 1 
       2469 1 1 1 1  16 LYS HG3  .  16 . HG1  1 1 
       2469 1 2 1 1  48 PHE QE   .  48 . HE*  1 1 
       2470 1 1 1 1  16 LYS HG2  .  16 . HG2  1 1 
       2470 1 2 1 1  48 PHE QE   .  48 . HE*  1 1 
       2471 1 1 1 1  16 LYS HA   .  16 . HA   1 1 
       2471 1 2 1 1  19 VAL MG2  .  19 . HG2* 1 1 
       2472 1 1 1 1  45 LEU MD1  .  45 . HD1* 1 1 
       2472 1 2 1 1  46 GLU HA   .  46 . HA   1 1 
       2473 1 1 1 1  17 GLU HA   .  17 . HA   1 1 
       2473 1 2 1 1 142 ILE MD   . 142 . HD1* 1 1 
       2474 1 1 1 1  21 GLU HB3  .  21 . HB1  1 1 
       2474 1 2 1 1 142 ILE MG   . 142 . HG2* 1 1 
       2475 1 1 1 1  17 GLU HG3  .  17 . HG1  1 1 
       2475 1 2 1 1 142 ILE MD   . 142 . HD1* 1 1 
       2476 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
       2476 1 2 1 1  17 GLU HG2  .  17 . HG2  1 1 
       2477 1 1 1 1  17 GLU H    .  17 . HN   1 1 
       2477 1 2 1 1  18 ILE HB   .  18 . HB   1 1 
       2478 1 1 1 1  17 GLU H    .  17 . HN   1 1 
       2478 1 2 1 1  18 ILE MD   .  18 . HD1* 1 1 
       2479 1 1 1 1  15 LEU H    .  15 . HN   1 1 
       2479 1 2 1 1  18 ILE MD   .  18 . HD1* 1 1 
       2480 1 1 1 1  15 LEU HA   .  15 . HA   1 1 
       2480 1 2 1 1  18 ILE MG   .  18 . HG2* 1 1 
       2481 1 1 1 1  15 LEU HA   .  15 . HA   1 1 
       2481 1 2 1 1  18 ILE HG13 .  18 . HG11 1 1 
       2482 1 1 1 1  18 ILE MG   .  18 . HG2* 1 1 
       2482 1 2 1 1  22 ILE HA   .  22 . HA   1 1 
       2483 1 1 1 1  18 ILE MG   .  18 . HG2* 1 1 
       2483 1 2 1 1 142 ILE HA   . 142 . HA   1 1 
       2484 1 1 1 1  17 GLU HB2  .  17 . HB2  1 1 
       2484 1 2 1 1  18 ILE HB   .  18 . HB   1 1 
       2485 1 1 1 1  18 ILE HB   .  18 . HB   1 1 
       2485 1 2 1 1  21 GLU HB2  .  21 . HB2  1 1 
       2486 1 1 1 1  18 ILE HB   .  18 . HB   1 1 
       2486 1 2 1 1  19 VAL HB   .  19 . HB   1 1 
       2487 1 1 1 1  18 ILE HB   .  18 . HB   1 1 
       2487 1 2 1 1 145 VAL MG2  . 145 . HG2* 1 1 
       2488 1 1 1 1  18 ILE MG   .  18 . HG2* 1 1 
       2488 1 2 1 1 145 VAL MG2  . 145 . HG2* 1 1 
       2489 1 1 1 1  18 ILE MG   .  18 . HG2* 1 1 
       2489 1 2 1 1  83 ILE HG12 .  83 . HG12 1 1 
       2490 1 1 1 1  18 ILE MG   .  18 . HG2* 1 1 
       2490 1 2 1 1  21 GLU HB2  .  21 . HB2  1 1 
       2491 1 1 1 1  18 ILE MD   .  18 . HD1* 1 1 
       2491 1 2 1 1  83 ILE MG   .  83 . HG2* 1 1 
       2492 1 1 1 1  18 ILE MD   .  18 . HD1* 1 1 
       2492 1 2 1 1  31 LEU MD1  .  31 . HD1* 1 1 
       2493 1 1 1 1  18 ILE MD   .  18 . HD1* 1 1 
       2493 1 2 1 1  83 ILE HG12 .  83 . HG12 1 1 
       2494 1 1 1 1  15 LEU HB2  .  15 . HB2  1 1 
       2494 1 2 1 1  18 ILE MD   .  18 . HD1* 1 1 
       2495 1 1 1 1  18 ILE HG12 .  18 . HG12 1 1 
       2495 1 2 1 1  83 ILE HG12 .  83 . HG12 1 1 
       2496 1 1 1 1  19 VAL HA   .  19 . HA   1 1 
       2496 1 2 1 1  83 ILE MD   .  83 . HD1* 1 1 
       2497 1 1 1 1  18 ILE MG   .  18 . HG2* 1 1 
       2497 1 2 1 1  19 VAL HA   .  19 . HA   1 1 
       2498 1 1 1 1  19 VAL HA   .  19 . HA   1 1 
       2498 1 2 1 1  29 VAL HB   .  29 . HB   1 1 
       2499 1 1 1 1  18 ILE HB   .  18 . HB   1 1 
       2499 1 2 1 1  19 VAL HA   .  19 . HA   1 1 
       2500 1 1 1 1  19 VAL HA   .  19 . HA   1 1 
       2500 1 2 1 1  22 ILE HG13 .  22 . HG11 1 1 
       2501 1 1 1 1  18 ILE HB   .  18 . HB   1 1 
       2501 1 2 1 1  19 VAL MG2  .  19 . HG2* 1 1 
       2502 1 1 1 1  19 VAL MG2  .  19 . HG2* 1 1 
       2502 1 2 1 1  20 ARG HG2  .  20 . HG2  1 1 
       2503 1 1 1 1  19 VAL MG2  .  19 . HG2* 1 1 
       2503 1 2 1 1  29 VAL HB   .  29 . HB   1 1 
       2504 1 1 1 1  19 VAL MG2  .  19 . HG2* 1 1 
       2504 1 2 1 1  53 VAL HB   .  53 . HB   1 1 
       2505 1 1 1 1  18 ILE HG13 .  18 . HG11 1 1 
       2505 1 2 1 1  19 VAL MG2  .  19 . HG2* 1 1 
       2506 1 1 1 1  15 LEU HG   .  15 . HG   1 1 
       2506 1 2 1 1  19 VAL MG2  .  19 . HG2* 1 1 
       2507 1 1 1 1  19 VAL MG2  .  19 . HG2* 1 1 
       2507 1 2 1 1  31 LEU HB3  .  31 . HB1  1 1 
       2508 1 1 1 1  19 VAL MG2  .  19 . HG2* 1 1 
       2508 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       2509 1 1 1 1  19 VAL MG2  .  19 . HG2* 1 1 
       2509 1 2 1 1  83 ILE MD   .  83 . HD1* 1 1 
       2510 1 1 1 1  19 VAL MG2  .  19 . HG2* 1 1 
       2510 1 2 1 1  31 LEU MD1  .  31 . HD1* 1 1 
       2511 1 1 1 1  19 VAL MG2  .  19 . HG2* 1 1 
       2511 1 2 1 1  31 LEU MD2  .  31 . HD2* 1 1 
       2512 1 1 1 1  15 LEU HA   .  15 . HA   1 1 
       2512 1 2 1 1  19 VAL MG2  .  19 . HG2* 1 1 
       2513 1 1 1 1  19 VAL HA   .  19 . HA   1 1 
       2513 1 2 1 1  20 ARG HA   .  20 . HA   1 1 
       2514 1 1 1 1  19 VAL MG1  .  19 . HG1* 1 1 
       2514 1 2 1 1  20 ARG HA   .  20 . HA   1 1 
       2515 1 1 1 1  19 VAL HB   .  19 . HB   1 1 
       2515 1 2 1 1  48 PHE QE   .  48 . HE*  1 1 
       2516 1 1 1 1  19 VAL HB   .  19 . HB   1 1 
       2516 1 2 1 1  48 PHE HZ   .  48 . HZ   1 1 
       2517 1 1 1 1 148 PHE QD   . 148 . HD*  1 1 
       2517 1 2 1 1 149 VAL HB   . 149 . HB   1 1 
       2518 1 1 1 1  18 ILE H    .  18 . HN   1 1 
       2518 1 2 1 1  19 VAL MG2  .  19 . HG2* 1 1 
       2519 1 1 1 1  21 GLU HG3  .  21 . HG1  1 1 
       2519 1 2 1 1 142 ILE MG   . 142 . HG2* 1 1 
       2520 1 1 1 1  21 GLU HG2  .  21 . HG2  1 1 
       2520 1 2 1 1 142 ILE MG   . 142 . HG2* 1 1 
       2521 1 1 1 1  17 GLU HB3  .  17 . HB1  1 1 
       2521 1 2 1 1 142 ILE MD   . 142 . HD1* 1 1 
       2522 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
       2522 1 2 1 1  17 GLU HB2  .  17 . HB2  1 1 
       2523 1 1 1 1  21 GLU HB2  .  21 . HB2  1 1 
       2523 1 2 1 1 142 ILE MG   . 142 . HG2* 1 1 
       2524 1 1 1 1  19 VAL HA   .  19 . HA   1 1 
       2524 1 2 1 1  22 ILE MG   .  22 . HG2* 1 1 
       2525 1 1 1 1  22 ILE HG12 .  22 . HG12 1 1 
       2525 1 2 1 1  81 VAL MG2  .  81 . HG2* 1 1 
       2526 1 1 1 1  22 ILE MG   .  22 . HG2* 1 1 
       2526 1 2 1 1  23 LYS HA   .  23 . HA   1 1 
       2527 1 1 1 1  28 ARG HB3  .  28 . HB1  1 1 
       2527 1 2 1 1  30 VAL MG2  .  30 . HG2* 1 1 
       2528 1 1 1 1  23 LYS HG2  .  23 . HG2  1 1 
       2528 1 2 1 1  53 VAL MG2  .  53 . HG2* 1 1 
       2529 1 1 1 1  25 GLN H    .  25 . HN   1 1 
       2529 1 2 1 1  26 GLY HA3  .  26 . HA1  1 1 
       2530 1 1 1 1  25 GLN H    .  25 . HN   1 1 
       2530 1 2 1 1  26 GLY HA2  .  26 . HA2  1 1 
       2531 1 1 1 1  22 ILE HA   .  22 . HA   1 1 
       2531 1 2 1 1  25 GLN HB3  .  25 . HB1  1 1 
       2532 1 1 1 1  22 ILE HA   .  22 . HA   1 1 
       2532 1 2 1 1  25 GLN HG3  .  25 . HG1  1 1 
       2533 1 1 1 1  22 ILE HA   .  22 . HA   1 1 
       2533 1 2 1 1  25 GLN HG2  .  25 . HG2  1 1 
       2534 1 1 1 1  22 ILE HA   .  22 . HA   1 1 
       2534 1 2 1 1  25 GLN HB2  .  25 . HB2  1 1 
       2535 1 1 1 1  25 GLN HG3  .  25 . HG1  1 1 
       2535 1 2 1 1  27 VAL HB   .  27 . HB   1 1 
       2536 1 1 1 1  25 GLN HG3  .  25 . HG1  1 1 
       2536 1 2 1 1 146 ARG HG2  . 146 . HG2  1 1 
       2537 1 1 1 1  24 ARG HG3  .  24 . HG1  1 1 
       2537 1 2 1 1  25 GLN HG2  .  25 . HG2  1 1 
       2538 1 1 1 1  24 ARG HG2  .  24 . HG2  1 1 
       2538 1 2 1 1  25 GLN HA   .  25 . HA   1 1 
       2539 1 1 1 1  24 ARG HG3  .  24 . HG1  1 1 
       2539 1 2 1 1  25 GLN HA   .  25 . HA   1 1 
       2540 1 1 1 1  25 GLN HA   .  25 . HA   1 1 
       2540 1 2 1 1 149 VAL MG1  . 149 . HG1* 1 1 
       2541 1 1 1 1  25 GLN HB3  .  25 . HB1  1 1 
       2541 1 2 1 1  27 VAL MG2  .  27 . HG2* 1 1 
       2542 1 1 1 1  25 GLN HB2  .  25 . HB2  1 1 
       2542 1 2 1 1 149 VAL MG1  . 149 . HG1* 1 1 
       2543 1 1 1 1  25 GLN HB2  .  25 . HB2  1 1 
       2543 1 2 1 1  27 VAL MG2  .  27 . HG2* 1 1 
       2544 1 1 1 1  25 GLN HG3  .  25 . HG1  1 1 
       2544 1 2 1 1 149 VAL MG2  . 149 . HG2* 1 1 
       2545 1 1 1 1  25 GLN HG3  .  25 . HG1  1 1 
       2545 1 2 1 1  27 VAL MG2  .  27 . HG2* 1 1 
       2546 1 1 1 1  25 GLN HG3  .  25 . HG1  1 1 
       2546 1 2 1 1 145 VAL MG1  . 145 . HG1* 1 1 
       2547 1 1 1 1  25 GLN HG2  .  25 . HG2  1 1 
       2547 1 2 1 1 149 VAL MG2  . 149 . HG2* 1 1 
       2548 1 1 1 1  25 GLN HG2  .  25 . HG2  1 1 
       2548 1 2 1 1  27 VAL MG2  .  27 . HG2* 1 1 
       2549 1 1 1 1  25 GLN HG2  .  25 . HG2  1 1 
       2549 1 2 1 1 145 VAL MG1  . 145 . HG1* 1 1 
       2550 1 1 1 1  22 ILE MG   .  22 . HG2* 1 1 
       2550 1 2 1 1  25 GLN HG2  .  25 . HG2  1 1 
       2551 1 1 1 1  22 ILE HG12 .  22 . HG12 1 1 
       2551 1 2 1 1  25 GLN HG3  .  25 . HG1  1 1 
       2552 1 1 1 1  26 GLY HA3  .  26 . HA1  1 1 
       2552 1 2 1 1 149 VAL MG1  . 149 . HG1* 1 1 
       2553 1 1 1 1  26 GLY HA3  .  26 . HA1  1 1 
       2553 1 2 1 1  27 VAL MG2  .  27 . HG2* 1 1 
       2554 1 1 1 1  26 GLY HA2  .  26 . HA2  1 1 
       2554 1 2 1 1  27 VAL MG1  .  27 . HG1* 1 1 
       2555 1 1 1 1  26 GLY HA2  .  26 . HA2  1 1 
       2555 1 2 1 1 149 VAL MG1  . 149 . HG1* 1 1 
       2556 1 1 1 1  26 GLY HA2  .  26 . HA2  1 1 
       2556 1 2 1 1  27 VAL MG2  .  27 . HG2* 1 1 
       2557 1 1 1 1  23 LYS HB3  .  23 . HB1  1 1 
       2557 1 2 1 1  26 GLY HA2  .  26 . HA2  1 1 
       2558 1 1 1 1  25 GLN HB2  .  25 . HB2  1 1 
       2558 1 2 1 1  26 GLY HA2  .  26 . HA2  1 1 
       2559 1 1 1 1  27 VAL MG1  .  27 . HG1* 1 1 
       2559 1 2 1 1  81 VAL H    .  81 . HN   1 1 
       2560 1 1 1 1  26 GLY H    .  26 . HN   1 1 
       2560 1 2 1 1  27 VAL MG1  .  27 . HG1* 1 1 
       2561 1 1 1 1  27 VAL HA   .  27 . HA   1 1 
       2561 1 2 1 1  28 ARG HB2  .  28 . HB2  1 1 
       2562 1 1 1 1  27 VAL MG1  .  27 . HG1* 1 1 
       2562 1 2 1 1  28 ARG HB3  .  28 . HB1  1 1 
       2563 1 1 1 1  27 VAL MG1  .  27 . HG1* 1 1 
       2563 1 2 1 1  28 ARG HB2  .  28 . HB2  1 1 
       2564 1 1 1 1  51 GLN HB2  .  51 . HB2  1 1 
       2564 1 2 1 1  53 VAL MG2  .  53 . HG2* 1 1 
       2565 1 1 1 1  48 PHE HB2  .  48 . HB2  1 1 
       2565 1 2 1 1  53 VAL MG2  .  53 . HG2* 1 1 
       2566 1 1 1 1  48 PHE HB3  .  48 . HB1  1 1 
       2566 1 2 1 1  53 VAL MG2  .  53 . HG2* 1 1 
       2567 1 1 1 1  28 ARG HB3  .  28 . HB1  1 1 
       2567 1 2 1 1  80 VAL MG1  .  80 . HG1* 1 1 
       2568 1 1 1 1  29 VAL HB   .  29 . HB   1 1 
       2568 1 2 1 1  53 VAL MG1  .  53 . HG1* 1 1 
       2569 1 1 1 1  28 ARG HA   .  28 . HA   1 1 
       2569 1 2 1 1  29 VAL HB   .  29 . HB   1 1 
       2570 1 1 1 1  28 ARG HA   .  28 . HA   1 1 
       2570 1 2 1 1  30 VAL MG2  .  30 . HG2* 1 1 
       2571 1 1 1 1  30 VAL MG1  .  30 . HG1* 1 1 
       2571 1 2 1 1  80 VAL MG2  .  80 . HG2* 1 1 
       2572 1 1 1 1  30 VAL MG2  .  30 . HG2* 1 1 
       2572 1 2 1 1  80 VAL MG1  .  80 . HG1* 1 1 
       2573 1 1 1 1  30 VAL HB   .  30 . HB   1 1 
       2573 1 2 1 1  83 ILE H    .  83 . HN   1 1 
       2574 1 1 1 1  31 LEU HB2  .  31 . HB2  1 1 
       2574 1 2 1 1  83 ILE H    .  83 . HN   1 1 
       2575 1 1 1 1  31 LEU HB3  .  31 . HB1  1 1 
       2575 1 2 1 1  56 ARG H    .  56 . HN   1 1 
       2576 1 1 1 1  31 LEU MD2  .  31 . HD2* 1 1 
       2576 1 2 1 1  56 ARG H    .  56 . HN   1 1 
       2577 1 1 1 1  31 LEU MD1  .  31 . HD1* 1 1 
       2577 1 2 1 1  34 SER H    .  34 . HN   1 1 
       2578 1 1 1 1  31 LEU MD1  .  31 . HD1* 1 1 
       2578 1 2 1 1  86 THR H    .  86 . HN   1 1 
       2579 1 1 1 1  31 LEU MD2  .  31 . HD2* 1 1 
       2579 1 2 1 1  55 VAL H    .  55 . HN   1 1 
       2580 1 1 1 1  31 LEU HG   .  31 . HG   1 1 
       2580 1 2 1 1  34 SER H    .  34 . HN   1 1 
       2581 1 1 1 1  31 LEU HG   .  31 . HG   1 1 
       2581 1 2 1 1  55 VAL H    .  55 . HN   1 1 
       2582 1 1 1 1  30 VAL HA   .  30 . HA   1 1 
       2582 1 2 1 1  31 LEU HA   .  31 . HA   1 1 
       2583 1 1 1 1  31 LEU HA   .  31 . HA   1 1 
       2583 1 2 1 1  32 LEU HA   .  32 . HA   1 1 
       2584 1 1 1 1  31 LEU HA   .  31 . HA   1 1 
       2584 1 2 1 1  55 VAL HA   .  55 . HA   1 1 
       2585 1 1 1 1  31 LEU HB2  .  31 . HB2  1 1 
       2585 1 2 1 1  55 VAL HA   .  55 . HA   1 1 
       2586 1 1 1 1  31 LEU HB3  .  31 . HB1  1 1 
       2586 1 2 1 1  55 VAL HA   .  55 . HA   1 1 
       2587 1 1 1 1  31 LEU HG   .  31 . HG   1 1 
       2587 1 2 1 1  32 LEU HA   .  32 . HA   1 1 
       2588 1 1 1 1  31 LEU HG   .  31 . HG   1 1 
       2588 1 2 1 1  55 VAL HA   .  55 . HA   1 1 
       2589 1 1 1 1  31 LEU HG   .  31 . HG   1 1 
       2589 1 2 1 1  33 TYR HA   .  33 . HA   1 1 
       2590 1 1 1 1  31 LEU MD2  .  31 . HD2* 1 1 
       2590 1 2 1 1  55 VAL HA   .  55 . HA   1 1 
       2591 1 1 1 1  31 LEU MD1  .  31 . HD1* 1 1 
       2591 1 2 1 1  32 LEU HA   .  32 . HA   1 1 
       2592 1 1 1 1  31 LEU MD1  .  31 . HD1* 1 1 
       2592 1 2 1 1  33 TYR HA   .  33 . HA   1 1 
       2593 1 1 1 1  31 LEU HG   .  31 . HG   1 1 
       2593 1 2 1 1  33 TYR HB2  .  33 . HB2  1 1 
       2594 1 1 1 1  31 LEU HG   .  31 . HG   1 1 
       2594 1 2 1 1  33 TYR HB3  .  33 . HB1  1 1 
       2595 1 1 1 1  31 LEU MD2  .  31 . HD2* 1 1 
       2595 1 2 1 1  33 TYR HB3  .  33 . HB1  1 1 
       2596 1 1 1 1  15 LEU HB3  .  15 . HB1  1 1 
       2596 1 2 1 1  31 LEU MD1  .  31 . HD1* 1 1 
       2597 1 1 1 1  31 LEU MD1  .  31 . HD1* 1 1 
       2597 1 2 1 1  33 TYR HB2  .  33 . HB2  1 1 
       2598 1 1 1 1  19 VAL HA   .  19 . HA   1 1 
       2598 1 2 1 1  31 LEU MD1  .  31 . HD1* 1 1 
       2599 1 1 1 1  31 LEU HA   .  31 . HA   1 1 
       2599 1 2 1 1  83 ILE HG13 .  83 . HG11 1 1 
       2600 1 1 1 1  31 LEU HA   .  31 . HA   1 1 
       2600 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       2601 1 1 1 1  31 LEU HA   .  31 . HA   1 1 
       2601 1 2 1 1  85 THR MG   .  85 . HG2* 1 1 
       2602 1 1 1 1  31 LEU HB2  .  31 . HB2  1 1 
       2602 1 2 1 1  53 VAL MG1  .  53 . HG1* 1 1 
       2603 1 1 1 1  31 LEU HB2  .  31 . HB2  1 1 
       2603 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       2604 1 1 1 1  31 LEU HB2  .  31 . HB2  1 1 
       2604 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       2605 1 1 1 1  31 LEU HA   .  31 . HA   1 1 
       2605 1 2 1 1  83 ILE HB   .  83 . HB   1 1 
       2606 1 1 1 1  31 LEU HB3  .  31 . HB1  1 1 
       2606 1 2 1 1  83 ILE HB   .  83 . HB   1 1 
       2607 1 1 1 1  31 LEU HB3  .  31 . HB1  1 1 
       2607 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       2608 1 1 1 1  31 LEU HB3  .  31 . HB1  1 1 
       2608 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       2609 1 1 1 1  31 LEU HG   .  31 . HG   1 1 
       2609 1 2 1 1  53 VAL MG1  .  53 . HG1* 1 1 
       2610 1 1 1 1  31 LEU HG   .  31 . HG   1 1 
       2610 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       2611 1 1 1 1  31 LEU HG   .  31 . HG   1 1 
       2611 1 2 1 1  83 ILE HB   .  83 . HB   1 1 
       2612 1 1 1 1  31 LEU MD2  .  31 . HD2* 1 1 
       2612 1 2 1 1  83 ILE HB   .  83 . HB   1 1 
       2613 1 1 1 1  31 LEU MD1  .  31 . HD1* 1 1 
       2613 1 2 1 1  83 ILE MG   .  83 . HG2* 1 1 
       2614 1 1 1 1  31 LEU MD1  .  31 . HD1* 1 1 
       2614 1 2 1 1  83 ILE HG13 .  83 . HG11 1 1 
       2615 1 1 1 1  15 LEU MD2  .  15 . HD2* 1 1 
       2615 1 2 1 1  31 LEU MD1  .  31 . HD1* 1 1 
       2616 1 1 1 1  31 LEU MD1  .  31 . HD1* 1 1 
       2616 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       2617 1 1 1 1  31 LEU MD1  .  31 . HD1* 1 1 
       2617 1 2 1 1  85 THR MG   .  85 . HG2* 1 1 
       2618 1 1 1 1  31 LEU MD1  .  31 . HD1* 1 1 
       2618 1 2 1 1  83 ILE HB   .  83 . HB   1 1 
       2619 1 1 1 1  32 LEU HB2  .  32 . HB2  1 1 
       2619 1 2 1 1  82 VAL MG1  .  82 . HG1* 1 1 
       2620 1 1 1 1  32 LEU HB3  .  32 . HB1  1 1 
       2620 1 2 1 1  82 VAL MG1  .  82 . HG1* 1 1 
       2621 1 1 1 1  32 LEU HG   .  32 . HG   1 1 
       2621 1 2 1 1  82 VAL MG1  .  82 . HG1* 1 1 
       2622 1 1 1 1  32 LEU HG   .  32 . HG   1 1 
       2622 1 2 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       2623 1 1 1 1  32 LEU HG   .  32 . HG   1 1 
       2623 1 2 1 1  84 VAL MG1  .  84 . HG1* 1 1 
       2624 1 1 1 1  32 LEU MD1  .  32 . HD1* 1 1 
       2624 1 2 1 1  82 VAL MG1  .  82 . HG1* 1 1 
       2625 1 1 1 1  32 LEU MD1  .  32 . HD1* 1 1 
       2625 1 2 1 1  84 VAL MG1  .  84 . HG1* 1 1 
       2626 1 1 1 1 141 LEU MD2  . 141 . HD2* 1 1 
       2626 1 2 1 1 145 VAL MG2  . 145 . HG2* 1 1 
       2627 1 1 1 1  18 ILE HG12 .  18 . HG12 1 1 
       2627 1 2 1 1 141 LEU MD2  . 141 . HD2* 1 1 
       2628 1 1 1 1  32 LEU MD1  .  32 . HD1* 1 1 
       2628 1 2 1 1  67 ASN HB3  .  67 . HB1  1 1 
       2629 1 1 1 1  32 LEU MD2  .  32 . HD2* 1 1 
       2629 1 2 1 1  67 ASN HB3  .  67 . HB1  1 1 
       2630 1 1 1 1  32 LEU MD2  .  32 . HD2* 1 1 
       2630 1 2 1 1  67 ASN HB2  .  67 . HB2  1 1 
       2631 1 1 1 1   9 SER HB2  .   9 . HB2  1 1 
       2631 1 2 1 1 141 LEU MD2  . 141 . HD2* 1 1 
       2632 1 1 1 1   9 SER HB3  .   9 . HB1  1 1 
       2632 1 2 1 1 141 LEU MD2  . 141 . HD2* 1 1 
       2633 1 1 1 1  32 LEU MD1  .  32 . HD1* 1 1 
       2633 1 2 1 1  64 PHE HA   .  64 . HA   1 1 
       2634 1 1 1 1   9 SER HG   .   9 . HG   1 1 
       2634 1 2 1 1 141 LEU MD2  . 141 . HD2* 1 1 
       2635 1 1 1 1  31 LEU HA   .  31 . HA   1 1 
       2635 1 2 1 1  32 LEU HG   .  32 . HG   1 1 
       2636 1 1 1 1  31 LEU HA   .  31 . HA   1 1 
       2636 1 2 1 1  32 LEU MD1  .  32 . HD1* 1 1 
       2637 1 1 1 1  31 LEU HA   .  31 . HA   1 1 
       2637 1 2 1 1  32 LEU HB3  .  32 . HB1  1 1 
       2638 1 1 1 1  31 LEU HA   .  31 . HA   1 1 
       2638 1 2 1 1  32 LEU MD2  .  32 . HD2* 1 1 
       2639 1 1 1 1  32 LEU HB3  .  32 . HB1  1 1 
       2639 1 2 1 1  64 PHE QE   .  64 . HE*  1 1 
       2640 1 1 1 1  32 LEU HB2  .  32 . HB2  1 1 
       2640 1 2 1 1  64 PHE QE   .  64 . HE*  1 1 
       2641 1 1 1 1  32 LEU MD1  .  32 . HD1* 1 1 
       2641 1 2 1 1  83 ILE H    .  83 . HN   1 1 
       2642 1 1 1 1  32 LEU MD1  .  32 . HD1* 1 1 
       2642 1 2 1 1  64 PHE QE   .  64 . HE*  1 1 
       2643 1 1 1 1  33 TYR HB3  .  33 . HB1  1 1 
       2643 1 2 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       2644 1 1 1 1  33 TYR HB3  .  33 . HB1  1 1 
       2644 1 2 1 1  45 LEU MD1  .  45 . HD1* 1 1 
       2645 1 1 1 1  31 LEU MD1  .  31 . HD1* 1 1 
       2645 1 2 1 1  33 TYR HB3  .  33 . HB1  1 1 
       2646 1 1 1 1  33 TYR HB2  .  33 . HB2  1 1 
       2646 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       2647 1 1 1 1  33 TYR HB2  .  33 . HB2  1 1 
       2647 1 2 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       2648 1 1 1 1  31 LEU MD2  .  31 . HD2* 1 1 
       2648 1 2 1 1  33 TYR HB2  .  33 . HB2  1 1 
       2649 1 1 1 1  32 LEU HA   .  32 . HA   1 1 
       2649 1 2 1 1  33 TYR HB2  .  33 . HB2  1 1 
       2650 1 1 1 1  33 TYR HB2  .  33 . HB2  1 1 
       2650 1 2 1 1  57 THR HA   .  57 . HA   1 1 
       2651 1 1 1 1  34 SER HB3  .  34 . HB1  1 1 
       2651 1 2 1 1  64 PHE QD   .  64 . HD*  1 1 
       2652 1 1 1 1  34 SER HB3  .  34 . HB1  1 1 
       2652 1 2 1 1  91 TRP HZ3  .  91 . HZ3  1 1 
       2653 1 1 1 1  34 SER HB2  .  34 . HB2  1 1 
       2653 1 2 1 1  91 TRP HZ3  .  91 . HZ3  1 1 
       2654 1 1 1 1  34 SER HB2  .  34 . HB2  1 1 
       2654 1 2 1 1  58 VAL HB   .  58 . HB   1 1 
       2655 1 1 1 1  34 SER HB3  .  34 . HB1  1 1 
       2655 1 2 1 1  58 VAL HB   .  58 . HB   1 1 
       2656 1 1 1 1  34 SER HB2  .  34 . HB2  1 1 
       2656 1 2 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       2657 1 1 1 1 142 ILE HA   . 142 . HA   1 1 
       2657 1 2 1 1 145 VAL MG2  . 145 . HG2* 1 1 
       2658 1 1 1 1  34 SER HB3  .  34 . HB1  1 1 
       2658 1 2 1 1  84 VAL MG1  .  84 . HG1* 1 1 
       2659 1 1 1 1  34 SER HB3  .  34 . HB1  1 1 
       2659 1 2 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       2660 1 1 1 1  34 SER HB2  .  34 . HB2  1 1 
       2660 1 2 1 1  84 VAL MG1  .  84 . HG1* 1 1 
       2661 1 1 1 1  35 ASP HB2  .  35 . HB2  1 1 
       2661 1 2 1 1  41 ARG HB2  .  41 . HB2  1 1 
       2662 1 1 1 1  37 ASP HB3  .  37 . HB1  1 1 
       2662 1 2 1 1  40 ARG HB2  .  40 . HB2  1 1 
       2663 1 1 1 1  37 ASP HB3  .  37 . HB1  1 1 
       2663 1 2 1 1  40 ARG HB3  .  40 . HB1  1 1 
       2664 1 1 1 1  37 ASP HB3  .  37 . HB1  1 1 
       2664 1 2 1 1  40 ARG H    .  40 . HN   1 1 
       2665 1 1 1 1  33 TYR QD   .  33 . HD*  1 1 
       2665 1 2 1 1  41 ARG HD2  .  41 . HD2  1 1 
       2666 1 1 1 1  33 TYR QD   .  33 . HD*  1 1 
       2666 1 2 1 1  41 ARG HD3  .  41 . HD1  1 1 
       2667 1 1 1 1  33 TYR QD   .  33 . HD*  1 1 
       2667 1 2 1 1  41 ARG HB2  .  41 . HB2  1 1 
       2668 1 1 1 1  33 TYR QD   .  33 . HD*  1 1 
       2668 1 2 1 1  41 ARG HB3  .  41 . HB1  1 1 
       2669 1 1 1 1  33 TYR QD   .  33 . HD*  1 1 
       2669 1 2 1 1  41 ARG HA   .  41 . HA   1 1 
       2670 1 1 1 1  33 TYR QE   .  33 . HE*  1 1 
       2670 1 2 1 1  44 ARG HG2  .  44 . HG2  1 1 
       2671 1 1 1 1  33 TYR QD   .  33 . HD*  1 1 
       2671 1 2 1 1  44 ARG HB2  .  44 . HB2  1 1 
       2672 1 1 1 1  33 TYR QD   .  33 . HD*  1 1 
       2672 1 2 1 1  45 LEU HG   .  45 . HG   1 1 
       2673 1 1 1 1  33 TYR QE   .  33 . HE*  1 1 
       2673 1 2 1 1  45 LEU HG   .  45 . HG   1 1 
       2674 1 1 1 1  33 TYR QE   .  33 . HE*  1 1 
       2674 1 2 1 1  45 LEU HA   .  45 . HA   1 1 
       2675 1 1 1 1  45 LEU HA   .  45 . HA   1 1 
       2675 1 2 1 1  48 PHE QE   .  48 . HE*  1 1 
       2676 1 1 1 1  15 LEU MD1  .  15 . HD1* 1 1 
       2676 1 2 1 1  48 PHE QE   .  48 . HE*  1 1 
       2677 1 1 1 1  45 LEU HB3  .  45 . HB1  1 1 
       2677 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       2678 1 1 1 1  45 LEU HG   .  45 . HG   1 1 
       2678 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       2679 1 1 1 1  31 LEU MD2  .  31 . HD2* 1 1 
       2679 1 2 1 1  45 LEU MD1  .  45 . HD1* 1 1 
       2680 1 1 1 1  47 GLU HG2  .  47 . HG2  1 1 
       2680 1 2 1 1  51 GLN HE21 .  51 . HE21 1 1 
       2681 1 1 1 1  47 GLU HG3  .  47 . HG1  1 1 
       2681 1 2 1 1  51 GLN HE21 .  51 . HE21 1 1 
       2682 1 1 1 1  47 GLU HG3  .  47 . HG1  1 1 
       2682 1 2 1 1  48 PHE QD   .  48 . HD*  1 1 
       2683 1 1 1 1  47 GLU HG2  .  47 . HG2  1 1 
       2683 1 2 1 1  51 GLN HE22 .  51 . HE22 1 1 
       2684 1 1 1 1  47 GLU HG3  .  47 . HG1  1 1 
       2684 1 2 1 1  51 GLN HE22 .  51 . HE22 1 1 
       2685 1 1 1 1  48 PHE HB3  .  48 . HB1  1 1 
       2685 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       2686 1 1 1 1  31 LEU MD2  .  31 . HD2* 1 1 
       2686 1 2 1 1  48 PHE HB3  .  48 . HB1  1 1 
       2687 1 1 1 1  47 GLU H    .  47 . HN   1 1 
       2687 1 2 1 1  48 PHE HB2  .  48 . HB2  1 1 
       2688 1 1 1 1  48 PHE HB3  .  48 . HB1  1 1 
       2688 1 2 1 1  51 GLN H    .  51 . HN   1 1 
       2689 1 1 1 1  49 GLU HB3  .  49 . HB1  1 1 
       2689 1 2 1 1  51 GLN H    .  51 . HN   1 1 
       2690 1 1 1 1  49 GLU HB3  .  49 . HB1  1 1 
       2690 1 2 1 1  53 VAL H    .  53 . HN   1 1 
       2691 1 1 1 1  47 GLU H    .  47 . HN   1 1 
       2691 1 2 1 1  49 GLU HG3  .  49 . HG1  1 1 
       2692 1 1 1 1  49 GLU HG2  .  49 . HG2  1 1 
       2692 1 2 1 1  53 VAL H    .  53 . HN   1 1 
       2693 1 1 1 1  46 GLU HA   .  46 . HA   1 1 
       2693 1 2 1 1  49 GLU HG2  .  49 . HG2  1 1 
       2694 1 1 1 1  45 LEU HA   .  45 . HA   1 1 
       2694 1 2 1 1  49 GLU HG2  .  49 . HG2  1 1 
       2695 1 1 1 1  49 GLU HG2  .  49 . HG2  1 1 
       2695 1 2 1 1  55 VAL HB   .  55 . HB   1 1 
       2696 1 1 1 1  49 GLU HA   .  49 . HA   1 1 
       2696 1 2 1 1  53 VAL MG2  .  53 . HG2* 1 1 
       2697 1 1 1 1  49 GLU HB3  .  49 . HB1  1 1 
       2697 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       2698 1 1 1 1  49 GLU HB3  .  49 . HB1  1 1 
       2698 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       2699 1 1 1 1  49 GLU HG3  .  49 . HG1  1 1 
       2699 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       2700 1 1 1 1  45 LEU MD1  .  45 . HD1* 1 1 
       2700 1 2 1 1  49 GLU HG3  .  49 . HG1  1 1 
       2701 1 1 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       2701 1 2 1 1  49 GLU HG3  .  49 . HG1  1 1 
       2702 1 1 1 1 135 VAL MG2  . 135 . HG2* 1 1 
       2702 1 2 1 1 140 GLU HG3  . 140 . HG1  1 1 
       2703 1 1 1 1  49 GLU HG2  .  49 . HG2  1 1 
       2703 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       2704 1 1 1 1  49 GLU HG2  .  49 . HG2  1 1 
       2704 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       2705 1 1 1 1  45 LEU MD1  .  45 . HD1* 1 1 
       2705 1 2 1 1  49 GLU HG2  .  49 . HG2  1 1 
       2706 1 1 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       2706 1 2 1 1  49 GLU HG2  .  49 . HG2  1 1 
       2707 1 1 1 1  48 PHE HA   .  48 . HA   1 1 
       2707 1 2 1 1  51 GLN HB2  .  51 . HB2  1 1 
       2708 1 1 1 1  48 PHE HA   .  48 . HA   1 1 
       2708 1 2 1 1  51 GLN HG3  .  51 . HG1  1 1 
       2709 1 1 1 1  48 PHE HA   .  48 . HA   1 1 
       2709 1 2 1 1  51 GLN HG2  .  51 . HG2  1 1 
       2710 1 1 1 1  50 LYS HB2  .  50 . HB2  1 1 
       2710 1 2 1 1  51 GLN HG3  .  51 . HG1  1 1 
       2711 1 1 1 1  51 GLN HG3  .  51 . HG1  1 1 
       2711 1 2 1 1  53 VAL MG2  .  53 . HG2* 1 1 
       2712 1 1 1 1  51 GLN HG2  .  51 . HG2  1 1 
       2712 1 2 1 1  53 VAL MG2  .  53 . HG2* 1 1 
       2713 1 1 1 1  51 GLN HB3  .  51 . HB1  1 1 
       2713 1 2 1 1  53 VAL MG2  .  53 . HG2* 1 1 
       2714 1 1 1 1  50 LYS HG3  .  50 . HG1  1 1 
       2714 1 2 1 1  51 GLN HA   .  51 . HA   1 1 
       2715 1 1 1 1  51 GLN HA   .  51 . HA   1 1 
       2715 1 2 1 1  53 VAL MG2  .  53 . HG2* 1 1 
       2716 1 1 1 1 105 GLU HG2  . 105 . HG2  1 1 
       2716 1 2 1 1 129 GLY HA3  . 129 . HA1  1 1 
       2717 1 1 1 1  53 VAL MG1  .  53 . HG1* 1 1 
       2717 1 2 1 1  55 VAL H    .  55 . HN   1 1 
       2718 1 1 1 1  30 VAL H    .  30 . HN   1 1 
       2718 1 2 1 1  53 VAL MG1  .  53 . HG1* 1 1 
       2719 1 1 1 1  53 VAL MG1  .  53 . HG1* 1 1 
       2719 1 2 1 1  56 ARG H    .  56 . HN   1 1 
       2720 1 1 1 1  51 GLN HE22 .  51 . HE22 1 1 
       2720 1 2 1 1  53 VAL MG2  .  53 . HG2* 1 1 
       2721 1 1 1 1  48 PHE QD   .  48 . HD*  1 1 
       2721 1 2 1 1  53 VAL HB   .  53 . HB   1 1 
       2722 1 1 1 1  48 PHE QD   .  48 . HD*  1 1 
       2722 1 2 1 1  53 VAL MG1  .  53 . HG1* 1 1 
       2723 1 1 1 1  48 PHE HA   .  48 . HA   1 1 
       2723 1 2 1 1  53 VAL MG1  .  53 . HG1* 1 1 
       2724 1 1 1 1  30 VAL HA   .  30 . HA   1 1 
       2724 1 2 1 1  53 VAL MG1  .  53 . HG1* 1 1 
       2725 1 1 1 1  53 VAL MG1  .  53 . HG1* 1 1 
       2725 1 2 1 1  55 VAL HA   .  55 . HA   1 1 
       2726 1 1 1 1  31 LEU HA   .  31 . HA   1 1 
       2726 1 2 1 1  53 VAL MG1  .  53 . HG1* 1 1 
       2727 1 1 1 1  48 PHE HB2  .  48 . HB2  1 1 
       2727 1 2 1 1  53 VAL MG1  .  53 . HG1* 1 1 
       2728 1 1 1 1  48 PHE HB3  .  48 . HB1  1 1 
       2728 1 2 1 1  53 VAL MG1  .  53 . HG1* 1 1 
       2729 1 1 1 1  31 LEU HB3  .  31 . HB1  1 1 
       2729 1 2 1 1  53 VAL MG1  .  53 . HG1* 1 1 
       2730 1 1 1 1  92 ILE HA   .  92 . HA   1 1 
       2730 1 2 1 1  95 PHE HA   .  95 . HA   1 1 
       2731 1 1 1 1  48 PHE HB3  .  48 . HB1  1 1 
       2731 1 2 1 1  53 VAL HB   .  53 . HB   1 1 
       2732 1 1 1 1  48 PHE HB2  .  48 . HB2  1 1 
       2732 1 2 1 1  53 VAL HB   .  53 . HB   1 1 
       2733 1 1 1 1  29 VAL MG1  .  29 . HG1* 1 1 
       2733 1 2 1 1  53 VAL HA   .  53 . HA   1 1 
       2734 1 1 1 1  31 LEU MD1  .  31 . HD1* 1 1 
       2734 1 2 1 1  53 VAL MG1  .  53 . HG1* 1 1 
       2735 1 1 1 1  31 LEU MD2  .  31 . HD2* 1 1 
       2735 1 2 1 1  53 VAL MG1  .  53 . HG1* 1 1 
       2736 1 1 1 1  53 VAL MG1  .  53 . HG1* 1 1 
       2736 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       2737 1 1 1 1  53 VAL HA   .  53 . HA   1 1 
       2737 1 2 1 1  54 ASP HB2  .  54 . HB2  1 1 
       2738 1 1 1 1  53 VAL HA   .  53 . HA   1 1 
       2738 1 2 1 1  54 ASP HB3  .  54 . HB1  1 1 
       2739 1 1 1 1  30 VAL MG2  .  30 . HG2* 1 1 
       2739 1 2 1 1  54 ASP HB2  .  54 . HB2  1 1 
       2740 1 1 1 1  53 VAL MG1  .  53 . HG1* 1 1 
       2740 1 2 1 1  54 ASP HB3  .  54 . HB1  1 1 
       2741 1 1 1 1  28 ARG HG3  .  28 . HG1  1 1 
       2741 1 2 1 1  54 ASP HB2  .  54 . HB2  1 1 
       2742 1 1 1 1  45 LEU MD1  .  45 . HD1* 1 1 
       2742 1 2 1 1  55 VAL HB   .  55 . HB   1 1 
       2743 1 1 1 1  53 VAL MG1  .  53 . HG1* 1 1 
       2743 1 2 1 1  55 VAL HB   .  55 . HB   1 1 
       2744 1 1 1 1  31 LEU MD2  .  31 . HD2* 1 1 
       2744 1 2 1 1  55 VAL HB   .  55 . HB   1 1 
       2745 1 1 1 1  31 LEU MD2  .  31 . HD2* 1 1 
       2745 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       2746 1 1 1 1  45 LEU MD1  .  45 . HD1* 1 1 
       2746 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       2747 1 1 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       2747 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       2748 1 1 1 1  53 VAL MG1  .  53 . HG1* 1 1 
       2748 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       2749 1 1 1 1  31 LEU MD2  .  31 . HD2* 1 1 
       2749 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       2750 1 1 1 1  31 LEU MD1  .  31 . HD1* 1 1 
       2750 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       2751 1 1 1 1  45 LEU HB3  .  45 . HB1  1 1 
       2751 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       2752 1 1 1 1  45 LEU HB2  .  45 . HB2  1 1 
       2752 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       2753 1 1 1 1  49 GLU HG3  .  49 . HG1  1 1 
       2753 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       2754 1 1 1 1  33 TYR HB2  .  33 . HB2  1 1 
       2754 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       2755 1 1 1 1  31 LEU HB3  .  31 . HB1  1 1 
       2755 1 2 1 1  55 VAL HB   .  55 . HB   1 1 
       2756 1 1 1 1  45 LEU HB3  .  45 . HB1  1 1 
       2756 1 2 1 1  55 VAL HB   .  55 . HB   1 1 
       2757 1 1 1 1  48 PHE HB3  .  48 . HB1  1 1 
       2757 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       2758 1 1 1 1  48 PHE HB2  .  48 . HB2  1 1 
       2758 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       2759 1 1 1 1  33 TYR HB3  .  33 . HB1  1 1 
       2759 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       2760 1 1 1 1  45 LEU HA   .  45 . HA   1 1 
       2760 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       2761 1 1 1 1  49 GLU HA   .  49 . HA   1 1 
       2761 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       2762 1 1 1 1  48 PHE HB2  .  48 . HB2  1 1 
       2762 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       2763 1 1 1 1  45 LEU HA   .  45 . HA   1 1 
       2763 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       2764 1 1 1 1  48 PHE HB3  .  48 . HB1  1 1 
       2764 1 2 1 1  55 VAL HB   .  55 . HB   1 1 
       2765 1 1 1 1  48 PHE HB2  .  48 . HB2  1 1 
       2765 1 2 1 1  55 VAL HB   .  55 . HB   1 1 
       2766 1 1 1 1  54 ASP HB2  .  54 . HB2  1 1 
       2766 1 2 1 1  55 VAL HA   .  55 . HA   1 1 
       2767 1 1 1 1  54 ASP HB3  .  54 . HB1  1 1 
       2767 1 2 1 1  55 VAL HA   .  55 . HA   1 1 
       2768 1 1 1 1  33 TYR HA   .  33 . HA   1 1 
       2768 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       2769 1 1 1 1  76 PRO HA   .  76 . HA   1 1 
       2769 1 2 1 1  78 LEU MD2  .  78 . HD2* 1 1 
       2770 1 1 1 1  31 LEU H    .  31 . HN   1 1 
       2770 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       2771 1 1 1 1  49 GLU H    .  49 . HN   1 1 
       2771 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       2772 1 1 1 1  47 GLU H    .  47 . HN   1 1 
       2772 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       2773 1 1 1 1  33 TYR QD   .  33 . HD*  1 1 
       2773 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       2774 1 1 1 1  48 PHE QD   .  48 . HD*  1 1 
       2774 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       2775 1 1 1 1  53 VAL H    .  53 . HN   1 1 
       2775 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       2776 1 1 1 1  95 PHE QE   .  95 . HE*  1 1 
       2776 1 2 1 1 106 VAL MG1  . 106 . HG1* 1 1 
       2777 1 1 1 1  33 TYR H    .  33 . HN   1 1 
       2777 1 2 1 1  57 THR MG   .  57 . HG2* 1 1 
       2778 1 1 1 1  56 ARG HB2  .  56 . HB2  1 1 
       2778 1 2 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       2779 1 1 1 1  57 THR HB   .  57 . HB   1 1 
       2779 1 2 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       2780 1 1 1 1  45 LEU MD1  .  45 . HD1* 1 1 
       2780 1 2 1 1  57 THR HB   .  57 . HB   1 1 
       2781 1 1 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       2781 1 2 1 1  57 THR HB   .  57 . HB   1 1 
       2782 1 1 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       2782 1 2 1 1  57 THR MG   .  57 . HG2* 1 1 
       2783 1 1 1 1  57 THR MG   .  57 . HG2* 1 1 
       2783 1 2 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       2784 1 1 1 1  45 LEU MD1  .  45 . HD1* 1 1 
       2784 1 2 1 1  57 THR MG   .  57 . HG2* 1 1 
       2785 1 1 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       2785 1 2 1 1  57 THR MG   .  57 . HG2* 1 1 
       2786 1 1 1 1  45 LEU HB3  .  45 . HB1  1 1 
       2786 1 2 1 1  57 THR MG   .  57 . HG2* 1 1 
       2787 1 1 1 1  41 ARG HB3  .  41 . HB1  1 1 
       2787 1 2 1 1  57 THR MG   .  57 . HG2* 1 1 
       2788 1 1 1 1  45 LEU HB2  .  45 . HB2  1 1 
       2788 1 2 1 1  57 THR MG   .  57 . HG2* 1 1 
       2789 1 1 1 1  55 VAL HB   .  55 . HB   1 1 
       2789 1 2 1 1  57 THR MG   .  57 . HG2* 1 1 
       2790 1 1 1 1  33 TYR HB2  .  33 . HB2  1 1 
       2790 1 2 1 1  57 THR MG   .  57 . HG2* 1 1 
       2791 1 1 1 1  57 THR HA   .  57 . HA   1 1 
       2791 1 2 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       2792 1 1 1 1  33 TYR HB3  .  33 . HB1  1 1 
       2792 1 2 1 1  57 THR MG   .  57 . HG2* 1 1 
       2793 1 1 1 1  41 ARG HD2  .  41 . HD2  1 1 
       2793 1 2 1 1  57 THR MG   .  57 . HG2* 1 1 
       2794 1 1 1 1  41 ARG HD3  .  41 . HD1  1 1 
       2794 1 2 1 1  57 THR MG   .  57 . HG2* 1 1 
       2795 1 1 1 1  42 ARG HA   .  42 . HA   1 1 
       2795 1 2 1 1  57 THR MG   .  57 . HG2* 1 1 
       2796 1 1 1 1  33 TYR HB3  .  33 . HB1  1 1 
       2796 1 2 1 1  57 THR HB   .  57 . HB   1 1 
       2797 1 1 1 1  33 TYR HB3  .  33 . HB1  1 1 
       2797 1 2 1 1  57 THR HA   .  57 . HA   1 1 
       2798 1 1 1 1  33 TYR QD   .  33 . HD*  1 1 
       2798 1 2 1 1  57 THR MG   .  57 . HG2* 1 1 
       2799 1 1 1 1  33 TYR QD   .  33 . HD*  1 1 
       2799 1 2 1 1  57 THR HB   .  57 . HB   1 1 
       2800 1 1 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       2800 1 2 1 1  64 PHE H    .  64 . HN   1 1 
       2801 1 1 1 1  56 ARG H    .  56 . HN   1 1 
       2801 1 2 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       2802 1 1 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       2802 1 2 1 1  60 ASP H    .  60 . HN   1 1 
       2803 1 1 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       2803 1 2 1 1  64 PHE QE   .  64 . HE*  1 1 
       2804 1 1 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       2804 1 2 1 1  85 THR H    .  85 . HN   1 1 
       2805 1 1 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       2805 1 2 1 1  67 ASN H    .  67 . HN   1 1 
       2806 1 1 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       2806 1 2 1 1  91 TRP HZ2  .  91 . HZ2  1 1 
       2807 1 1 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       2807 1 2 1 1  64 PHE QD   .  64 . HD*  1 1 
       2808 1 1 1 1  58 VAL HB   .  58 . HB   1 1 
       2808 1 2 1 1  91 TRP HZ2  .  91 . HZ2  1 1 
       2809 1 1 1 1  58 VAL HB   .  58 . HB   1 1 
       2809 1 2 1 1  64 PHE QD   .  64 . HD*  1 1 
       2810 1 1 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       2810 1 2 1 1  67 ASN HD21 .  67 . HD21 1 1 
       2811 1 1 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       2811 1 2 1 1  91 TRP HZ3  .  91 . HZ3  1 1 
       2812 1 1 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       2812 1 2 1 1  91 TRP HH2  .  91 . HH2  1 1 
       2813 1 1 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       2813 1 2 1 1  91 TRP HZ3  .  91 . HZ3  1 1 
       2814 1 1 1 1  58 VAL HB   .  58 . HB   1 1 
       2814 1 2 1 1  91 TRP HZ3  .  91 . HZ3  1 1 
       2815 1 1 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       2815 1 2 1 1  59 GLU HA   .  59 . HA   1 1 
       2816 1 1 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       2816 1 2 1 1  64 PHE HA   .  64 . HA   1 1 
       2817 1 1 1 1  34 SER HB2  .  34 . HB2  1 1 
       2817 1 2 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       2818 1 1 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       2818 1 2 1 1  59 GLU HA   .  59 . HA   1 1 
       2819 1 1 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       2819 1 2 1 1  64 PHE HA   .  64 . HA   1 1 
       2820 1 1 1 1  34 SER HA   .  34 . HA   1 1 
       2820 1 2 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       2821 1 1 1 1  32 LEU HA   .  32 . HA   1 1 
       2821 1 2 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       2822 1 1 1 1  34 SER HA   .  34 . HA   1 1 
       2822 1 2 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       2823 1 1 1 1  34 SER HG   .  34 . HG   1 1 
       2823 1 2 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       2824 1 1 1 1  58 VAL HB   .  58 . HB   1 1 
       2824 1 2 1 1  64 PHE HB2  .  64 . HB2  1 1 
       2825 1 1 1 1  58 VAL HB   .  58 . HB   1 1 
       2825 1 2 1 1  64 PHE HB3  .  64 . HB1  1 1 
       2826 1 1 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       2826 1 2 1 1  64 PHE HB2  .  64 . HB2  1 1 
       2827 1 1 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       2827 1 2 1 1  67 ASN HB2  .  67 . HB2  1 1 
       2828 1 1 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       2828 1 2 1 1  63 ASP HB3  .  63 . HB1  1 1 
       2829 1 1 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       2829 1 2 1 1  64 PHE HB3  .  64 . HB1  1 1 
       2830 1 1 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       2830 1 2 1 1  63 ASP HB3  .  63 . HB1  1 1 
       2831 1 1 1 1  32 LEU HB2  .  32 . HB2  1 1 
       2831 1 2 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       2832 1 1 1 1  32 LEU MD2  .  32 . HD2* 1 1 
       2832 1 2 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       2833 1 1 1 1  32 LEU MD2  .  32 . HD2* 1 1 
       2833 1 2 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       2834 1 1 1 1  32 LEU HB3  .  32 . HB1  1 1 
       2834 1 2 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       2835 1 1 1 1  56 ARG HB3  .  56 . HB1  1 1 
       2835 1 2 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       2836 1 1 1 1  32 LEU HB3  .  32 . HB1  1 1 
       2836 1 2 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       2837 1 1 1 1  61 LYS HA   .  61 . HA   1 1 
       2837 1 2 1 1  64 PHE QD   .  64 . HD*  1 1 
       2838 1 1 1 1  61 LYS HB2  .  61 . HB2  1 1 
       2838 1 2 1 1  91 TRP HZ2  .  91 . HZ2  1 1 
       2839 1 1 1 1  61 LYS HB3  .  61 . HB1  1 1 
       2839 1 2 1 1  91 TRP HZ2  .  91 . HZ2  1 1 
       2840 1 1 1 1  60 ASP HA   .  60 . HA   1 1 
       2840 1 2 1 1  61 LYS HA   .  61 . HA   1 1 
       2841 1 1 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       2841 1 2 1 1  63 ASP HA   .  63 . HA   1 1 
       2842 1 1 1 1  58 VAL HB   .  58 . HB   1 1 
       2842 1 2 1 1  63 ASP HB3  .  63 . HB1  1 1 
       2843 1 1 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       2843 1 2 1 1  63 ASP HB2  .  63 . HB2  1 1 
       2844 1 1 1 1  62 GLU HB2  .  62 . HB2  1 1 
       2844 1 2 1 1  63 ASP HB3  .  63 . HB1  1 1 
       2845 1 1 1 1  63 ASP HB3  .  63 . HB1  1 1 
       2845 1 2 1 1  64 PHE QD   .  64 . HD*  1 1 
       2846 1 1 1 1  58 VAL HB   .  58 . HB   1 1 
       2846 1 2 1 1  64 PHE HA   .  64 . HA   1 1 
       2847 1 1 1 1  32 LEU MD2  .  32 . HD2* 1 1 
       2847 1 2 1 1  64 PHE HA   .  64 . HA   1 1 
       2848 1 1 1 1  31 LEU MD2  .  31 . HD2* 1 1 
       2848 1 2 1 1  48 PHE HB2  .  48 . HB2  1 1 
       2849 1 1 1 1  65 ARG HA   .  65 . HA   1 1 
       2849 1 2 1 1  68 ILE HG13 .  68 . HG11 1 1 
       2850 1 1 1 1  65 ARG HA   .  65 . HA   1 1 
       2850 1 2 1 1  68 ILE HG12 .  68 . HG12 1 1 
       2851 1 1 1 1  65 ARG HA   .  65 . HA   1 1 
       2851 1 2 1 1  68 ILE MG   .  68 . HG2* 1 1 
       2852 1 1 1 1  64 PHE QD   .  64 . HD*  1 1 
       2852 1 2 1 1  65 ARG HA   .  65 . HA   1 1 
       2853 1 1 1 1  67 ASN HB3  .  67 . HB1  1 1 
       2853 1 2 1 1  68 ILE HG13 .  68 . HG11 1 1 
       2854 1 1 1 1  67 ASN HB2  .  67 . HB2  1 1 
       2854 1 2 1 1  68 ILE HG13 .  68 . HG11 1 1 
       2855 1 1 1 1  32 LEU MD2  .  32 . HD2* 1 1 
       2855 1 2 1 1  67 ASN HA   .  67 . HA   1 1 
       2856 1 1 1 1  68 ILE HA   .  68 . HA   1 1 
       2856 1 2 1 1  82 VAL MG2  .  82 . HG2* 1 1 
       2857 1 1 1 1  32 LEU MD1  .  32 . HD1* 1 1 
       2857 1 2 1 1  68 ILE HA   .  68 . HA   1 1 
       2858 1 1 1 1  32 LEU MD1  .  32 . HD1* 1 1 
       2858 1 2 1 1  68 ILE MG   .  68 . HG2* 1 1 
       2859 1 1 1 1  68 ILE MD   .  68 . HD1* 1 1 
       2859 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
       2860 1 1 1 1  32 LEU MD1  .  32 . HD1* 1 1 
       2860 1 2 1 1  68 ILE MD   .  68 . HD1* 1 1 
       2861 1 1 1 1  68 ILE HG13 .  68 . HG11 1 1 
       2861 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
       2862 1 1 1 1  68 ILE HG12 .  68 . HG12 1 1 
       2862 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
       2863 1 1 1 1  65 ARG HB2  .  65 . HB2  1 1 
       2863 1 2 1 1  68 ILE HB   .  68 . HB   1 1 
       2864 1 1 1 1  68 ILE MG   .  68 . HG2* 1 1 
       2864 1 2 1 1  71 ILE HB   .  71 . HB   1 1 
       2865 1 1 1 1  68 ILE MG   .  68 . HG2* 1 1 
       2865 1 2 1 1  98 GLU HB2  .  98 . HB2  1 1 
       2866 1 1 1 1  32 LEU MD1  .  32 . HD1* 1 1 
       2866 1 2 1 1  68 ILE HG12 .  68 . HG12 1 1 
       2867 1 1 1 1  65 ARG HB2  .  65 . HB2  1 1 
       2867 1 2 1 1  68 ILE MD   .  68 . HD1* 1 1 
       2868 1 1 1 1  68 ILE MD   .  68 . HD1* 1 1 
       2868 1 2 1 1  98 GLU HB2  .  98 . HB2  1 1 
       2869 1 1 1 1  68 ILE MD   .  68 . HD1* 1 1 
       2869 1 2 1 1  98 GLU HG3  .  98 . HG1  1 1 
       2870 1 1 1 1  68 ILE MD   .  68 . HD1* 1 1 
       2870 1 2 1 1  98 GLU HG2  .  98 . HG2  1 1 
       2871 1 1 1 1  68 ILE MG   .  68 . HG2* 1 1 
       2871 1 2 1 1  69 ARG HA   .  69 . HA   1 1 
       2872 1 1 1 1  68 ILE MG   .  68 . HG2* 1 1 
       2872 1 2 1 1  95 PHE HA   .  95 . HA   1 1 
       2873 1 1 1 1  66 GLU HA   .  66 . HA   1 1 
       2873 1 2 1 1  68 ILE HB   .  68 . HB   1 1 
       2874 1 1 1 1  68 ILE HB   .  68 . HB   1 1 
       2874 1 2 1 1  95 PHE HA   .  95 . HA   1 1 
       2875 1 1 1 1  65 ARG HA   .  65 . HA   1 1 
       2875 1 2 1 1  68 ILE MD   .  68 . HD1* 1 1 
       2876 1 1 1 1  68 ILE MD   .  68 . HD1* 1 1 
       2876 1 2 1 1  95 PHE HB2  .  95 . HB2  1 1 
       2877 1 1 1 1  68 ILE MD   .  68 . HD1* 1 1 
       2877 1 2 1 1  95 PHE HB3  .  95 . HB1  1 1 
       2878 1 1 1 1  68 ILE MD   .  68 . HD1* 1 1 
       2878 1 2 1 1  95 PHE HA   .  95 . HA   1 1 
       2879 1 1 1 1  68 ILE MG   .  68 . HG2* 1 1 
       2879 1 2 1 1  95 PHE QD   .  95 . HD*  1 1 
       2880 1 1 1 1  68 ILE MG   .  68 . HG2* 1 1 
       2880 1 2 1 1  95 PHE QE   .  95 . HE*  1 1 
       2881 1 1 1 1  68 ILE MG   .  68 . HG2* 1 1 
       2881 1 2 1 1  72 TRP HZ3  .  72 . HZ3  1 1 
       2882 1 1 1 1  68 ILE MG   .  68 . HG2* 1 1 
       2882 1 2 1 1  72 TRP HZ2  .  72 . HZ2  1 1 
       2883 1 1 1 1  68 ILE MG   .  68 . HG2* 1 1 
       2883 1 2 1 1  72 TRP HH2  .  72 . HH2  1 1 
       2884 1 1 1 1  68 ILE HG12 .  68 . HG12 1 1 
       2884 1 2 1 1  95 PHE QE   .  95 . HE*  1 1 
       2885 1 1 1 1  68 ILE HG13 .  68 . HG11 1 1 
       2885 1 2 1 1  95 PHE QD   .  95 . HD*  1 1 
       2886 1 1 1 1  64 PHE QD   .  64 . HD*  1 1 
       2886 1 2 1 1  68 ILE HG13 .  68 . HG11 1 1 
       2887 1 1 1 1  68 ILE MD   .  68 . HD1* 1 1 
       2887 1 2 1 1  95 PHE QD   .  95 . HD*  1 1 
       2888 1 1 1 1  64 PHE QD   .  64 . HD*  1 1 
       2888 1 2 1 1  68 ILE MD   .  68 . HD1* 1 1 
       2889 1 1 1 1  68 ILE MD   .  68 . HD1* 1 1 
       2889 1 2 1 1  95 PHE QE   .  95 . HE*  1 1 
       2890 1 1 1 1  68 ILE MD   .  68 . HD1* 1 1 
       2890 1 2 1 1  72 TRP HZ2  .  72 . HZ2  1 1 
       2891 1 1 1 1  64 PHE QE   .  64 . HE*  1 1 
       2891 1 2 1 1  68 ILE MD   .  68 . HD1* 1 1 
       2892 1 1 1 1  68 ILE MG   .  68 . HG2* 1 1 
       2892 1 2 1 1  72 TRP HE3  .  72 . HE3  1 1 
       2893 1 1 1 1  68 ILE MD   .  68 . HD1* 1 1 
       2893 1 2 1 1  95 PHE H    .  95 . HN   1 1 
       2894 1 1 1 1  68 ILE MD   .  68 . HD1* 1 1 
       2894 1 2 1 1  96 ILE H    .  96 . HN   1 1 
       2895 1 1 1 1  71 ILE MG   .  71 . HG2* 1 1 
       2895 1 2 1 1  72 TRP HZ3  .  72 . HZ3  1 1 
       2896 1 1 1 1  71 ILE MG   .  71 . HG2* 1 1 
       2896 1 2 1 1  72 TRP HE3  .  72 . HE3  1 1 
       2897 1 1 1 1  71 ILE MG   .  71 . HG2* 1 1 
       2897 1 2 1 1  74 ARG H    .  74 . HN   1 1 
       2898 1 1 1 1  71 ILE HA   .  71 . HA   1 1 
       2898 1 2 1 1  75 TYR H    .  75 . HN   1 1 
       2899 1 1 1 1  68 ILE H    .  68 . HN   1 1 
       2899 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
       2900 1 1 1 1  70 GLU H    .  70 . HN   1 1 
       2900 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
       2901 1 1 1 1  71 ILE MD   .  71 . HD1* 1 1 
       2901 1 2 1 1  75 TYR QD   .  75 . HD*  1 1 
       2902 1 1 1 1  71 ILE MD   .  71 . HD1* 1 1 
       2902 1 2 1 1  95 PHE QE   .  95 . HE*  1 1 
       2903 1 1 1 1  71 ILE MD   .  71 . HD1* 1 1 
       2903 1 2 1 1  72 TRP HZ2  .  72 . HZ2  1 1 
       2904 1 1 1 1  71 ILE MG   .  71 . HG2* 1 1 
       2904 1 2 1 1  78 LEU HA   .  78 . HA   1 1 
       2905 1 1 1 1   4 ILE HA   .   4 . HA   1 1 
       2905 1 2 1 1  71 ILE MG   .  71 . HG2* 1 1 
       2906 1 1 1 1  71 ILE MG   .  71 . HG2* 1 1 
       2906 1 2 1 1  75 TYR HA   .  75 . HA   1 1 
       2907 1 1 1 1  71 ILE MG   .  71 . HG2* 1 1 
       2907 1 2 1 1  72 TRP HA   .  72 . HA   1 1 
       2908 1 1 1 1  30 VAL HA   .  30 . HA   1 1 
       2908 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
       2909 1 1 1 1  68 ILE HA   .  68 . HA   1 1 
       2909 1 2 1 1  71 ILE MG   .  71 . HG2* 1 1 
       2910 1 1 1 1  71 ILE MG   .  71 . HG2* 1 1 
       2910 1 2 1 1  75 TYR HB3  .  75 . HB1  1 1 
       2911 1 1 1 1  71 ILE MG   .  71 . HG2* 1 1 
       2911 1 2 1 1  75 TYR HB2  .  75 . HB2  1 1 
       2912 1 1 1 1  68 ILE HA   .  68 . HA   1 1 
       2912 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
       2913 1 1 1 1  67 ASN HB3  .  67 . HB1  1 1 
       2913 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
       2914 1 1 1 1  68 ILE MG   .  68 . HG2* 1 1 
       2914 1 2 1 1  71 ILE HA   .  71 . HA   1 1 
       2915 1 1 1 1  71 ILE HA   .  71 . HA   1 1 
       2915 1 2 1 1  80 VAL MG1  .  80 . HG1* 1 1 
       2916 1 1 1 1  68 ILE MG   .  68 . HG2* 1 1 
       2916 1 2 1 1  71 ILE MG   .  71 . HG2* 1 1 
       2917 1 1 1 1  71 ILE MG   .  71 . HG2* 1 1 
       2917 1 2 1 1  82 VAL MG2  .  82 . HG2* 1 1 
       2918 1 1 1 1   4 ILE HG13 .   4 . HG11 1 1 
       2918 1 2 1 1  71 ILE MG   .  71 . HG2* 1 1 
       2919 1 1 1 1  71 ILE HA   .  71 . HA   1 1 
       2919 1 2 1 1  74 ARG HB3  .  74 . HB1  1 1 
       2920 1 1 1 1  68 ILE MG   .  68 . HG2* 1 1 
       2920 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
       2921 1 1 1 1  72 TRP HZ2  .  72 . HZ2  1 1 
       2921 1 2 1 1  98 GLU HB3  .  98 . HB1  1 1 
       2922 1 1 1 1  74 ARG HA   .  74 . HA   1 1 
       2922 1 2 1 1  76 PRO HD3  .  76 . HD1  1 1 
       2923 1 1 1 1  71 ILE HA   .  71 . HA   1 1 
       2923 1 2 1 1  74 ARG HB2  .  74 . HB2  1 1 
       2924 1 1 1 1  74 ARG HA   .  74 . HA   1 1 
       2924 1 2 1 1  75 TYR QD   .  75 . HD*  1 1 
       2925 1 1 1 1  73 GLU H    .  73 . HN   1 1 
       2925 1 2 1 1  74 ARG HB2  .  74 . HB2  1 1 
       2926 1 1 1 1  72 TRP H    .  72 . HN   1 1 
       2926 1 2 1 1  74 ARG HB2  .  74 . HB2  1 1 
       2927 1 1 1 1  74 ARG HG2  .  74 . HG2  1 1 
       2927 1 2 1 1  75 TYR QD   .  75 . HD*  1 1 
       2928 1 1 1 1  74 ARG HG2  .  74 . HG2  1 1 
       2928 1 2 1 1  75 TYR QE   .  75 . HE*  1 1 
       2929 1 1 1 1  74 ARG HG3  .  74 . HG1  1 1 
       2929 1 2 1 1  75 TYR QD   .  75 . HD*  1 1 
       2930 1 1 1 1  74 ARG HG3  .  74 . HG1  1 1 
       2930 1 2 1 1  75 TYR QE   .  75 . HE*  1 1 
       2931 1 1 1 1  74 ARG HD2  .  74 . HD2  1 1 
       2931 1 2 1 1  75 TYR QD   .  75 . HD*  1 1 
       2932 1 1 1 1  74 ARG HD3  .  74 . HD1  1 1 
       2932 1 2 1 1  75 TYR QE   .  75 . HE*  1 1 
       2933 1 1 1 1  75 TYR HA   .  75 . HA   1 1 
       2933 1 2 1 1  76 PRO HG2  .  76 . HG2  1 1 
       2934 1 1 1 1  75 TYR HA   .  75 . HA   1 1 
       2934 1 2 1 1  76 PRO HG3  .  76 . HG1  1 1 
       2935 1 1 1 1  75 TYR QD   .  75 . HD*  1 1 
       2935 1 2 1 1  76 PRO HD2  .  76 . HD2  1 1 
       2936 1 1 1 1  75 TYR QD   .  75 . HD*  1 1 
       2936 1 2 1 1  76 PRO HD3  .  76 . HD1  1 1 
       2937 1 1 1 1  75 TYR HA   .  75 . HA   1 1 
       2937 1 2 1 1  76 PRO HD3  .  76 . HD1  1 1 
       2938 1 1 1 1  74 ARG HA   .  74 . HA   1 1 
       2938 1 2 1 1  76 PRO HD2  .  76 . HD2  1 1 
       2939 1 1 1 1  75 TYR HA   .  75 . HA   1 1 
       2939 1 2 1 1  76 PRO HD2  .  76 . HD2  1 1 
       2940 1 1 1 1  75 TYR HA   .  75 . HA   1 1 
       2940 1 2 1 1  76 PRO HB3  .  76 . HB1  1 1 
       2941 1 1 1 1  76 PRO HG2  .  76 . HG2  1 1 
       2941 1 2 1 1  77 GLN HA   .  77 . HA   1 1 
       2942 1 1 1 1  77 GLN HB2  .  77 . HB2  1 1 
       2942 1 2 1 1  79 ASP H    .  79 . HN   1 1 
       2943 1 1 1 1   4 ILE HA   .   4 . HA   1 1 
       2943 1 2 1 1  78 LEU MD2  .  78 . HD2* 1 1 
       2944 1 1 1 1   4 ILE HA   .   4 . HA   1 1 
       2944 1 2 1 1  78 LEU MD1  .  78 . HD1* 1 1 
       2945 1 1 1 1   3 GLN HA   .   3 . HA   1 1 
       2945 1 2 1 1  78 LEU MD1  .  78 . HD1* 1 1 
       2946 1 1 1 1   3 GLN HA   .   3 . HA   1 1 
       2946 1 2 1 1  78 LEU MD2  .  78 . HD2* 1 1 
       2947 1 1 1 1  72 TRP HZ2  .  72 . HZ2  1 1 
       2947 1 2 1 1  78 LEU MD1  .  78 . HD1* 1 1 
       2948 1 1 1 1  72 TRP HE3  .  72 . HE3  1 1 
       2948 1 2 1 1  78 LEU MD1  .  78 . HD1* 1 1 
       2949 1 1 1 1   5 PHE QD   .   5 . HD*  1 1 
       2949 1 2 1 1 145 VAL MG2  . 145 . HG2* 1 1 
       2950 1 1 1 1  72 TRP HZ3  .  72 . HZ3  1 1 
       2950 1 2 1 1  78 LEU MD2  .  78 . HD2* 1 1 
       2951 1 1 1 1  75 TYR QD   .  75 . HD*  1 1 
       2951 1 2 1 1  78 LEU MD2  .  78 . HD2* 1 1 
       2952 1 1 1 1  72 TRP HE3  .  72 . HE3  1 1 
       2952 1 2 1 1  78 LEU MD2  .  78 . HD2* 1 1 
       2953 1 1 1 1   3 GLN H    .   3 . HN   1 1 
       2953 1 2 1 1  78 LEU MD1  .  78 . HD1* 1 1 
       2954 1 1 1 1  78 LEU H    .  78 . HN   1 1 
       2954 1 2 1 1  78 LEU MD1  .  78 . HD1* 1 1 
       2955 1 1 1 1  78 LEU H    .  78 . HN   1 1 
       2955 1 2 1 1  78 LEU MD2  .  78 . HD2* 1 1 
       2956 1 1 1 1  48 PHE H    .  48 . HN   1 1 
       2956 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       2957 1 1 1 1   4 ILE MG   .   4 . HG2* 1 1 
       2957 1 2 1 1  78 LEU MD1  .  78 . HD1* 1 1 
       2958 1 1 1 1  78 LEU MD1  .  78 . HD1* 1 1 
       2958 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       2959 1 1 1 1  31 LEU HG   .  31 . HG   1 1 
       2959 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       2960 1 1 1 1  78 LEU MD2  .  78 . HD2* 1 1 
       2960 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       2961 1 1 1 1  79 ASP HB2  .  79 . HB2  1 1 
       2961 1 2 1 1  80 VAL H    .  80 . HN   1 1 
       2962 1 1 1 1  27 VAL MG1  .  27 . HG1* 1 1 
       2962 1 2 1 1  79 ASP HB3  .  79 . HB1  1 1 
       2963 1 1 1 1  27 VAL MG1  .  27 . HG1* 1 1 
       2963 1 2 1 1  80 VAL HB   .  80 . HB   1 1 
       2964 1 1 1 1  28 ARG HG3  .  28 . HG1  1 1 
       2964 1 2 1 1  80 VAL HB   .  80 . HB   1 1 
       2965 1 1 1 1  30 VAL HB   .  30 . HB   1 1 
       2965 1 2 1 1  80 VAL HB   .  80 . HB   1 1 
       2966 1 1 1 1  28 ARG HB2  .  28 . HB2  1 1 
       2966 1 2 1 1  80 VAL HB   .  80 . HB   1 1 
       2967 1 1 1 1  28 ARG HG2  .  28 . HG2  1 1 
       2967 1 2 1 1  80 VAL HB   .  80 . HB   1 1 
       2968 1 1 1 1  30 VAL HB   .  30 . HB   1 1 
       2968 1 2 1 1  80 VAL MG2  .  80 . HG2* 1 1 
       2969 1 1 1 1  28 ARG HG2  .  28 . HG2  1 1 
       2969 1 2 1 1  80 VAL MG2  .  80 . HG2* 1 1 
       2970 1 1 1 1  80 VAL MG2  .  80 . HG2* 1 1 
       2970 1 2 1 1  82 VAL MG2  .  82 . HG2* 1 1 
       2971 1 1 1 1  71 ILE MG   .  71 . HG2* 1 1 
       2971 1 2 1 1  80 VAL MG2  .  80 . HG2* 1 1 
       2972 1 1 1 1  71 ILE MG   .  71 . HG2* 1 1 
       2972 1 2 1 1  80 VAL MG1  .  80 . HG1* 1 1 
       2973 1 1 1 1   4 ILE MD   .   4 . HD1* 1 1 
       2973 1 2 1 1  80 VAL MG1  .  80 . HG1* 1 1 
       2974 1 1 1 1  78 LEU MD2  .  78 . HD2* 1 1 
       2974 1 2 1 1  80 VAL MG1  .  80 . HG1* 1 1 
       2975 1 1 1 1  28 ARG HG3  .  28 . HG1  1 1 
       2975 1 2 1 1  80 VAL MG1  .  80 . HG1* 1 1 
       2976 1 1 1 1  28 ARG HB2  .  28 . HB2  1 1 
       2976 1 2 1 1  80 VAL MG1  .  80 . HG1* 1 1 
       2977 1 1 1 1  28 ARG HG2  .  28 . HG2  1 1 
       2977 1 2 1 1  80 VAL MG1  .  80 . HG1* 1 1 
       2978 1 1 1 1  75 TYR HB2  .  75 . HB2  1 1 
       2978 1 2 1 1  80 VAL MG1  .  80 . HG1* 1 1 
       2979 1 1 1 1  75 TYR HB3  .  75 . HB1  1 1 
       2979 1 2 1 1  80 VAL MG1  .  80 . HG1* 1 1 
       2980 1 1 1 1  78 LEU HA   .  78 . HA   1 1 
       2980 1 2 1 1  80 VAL MG1  .  80 . HG1* 1 1 
       2981 1 1 1 1  75 TYR HB2  .  75 . HB2  1 1 
       2981 1 2 1 1  80 VAL MG2  .  80 . HG2* 1 1 
       2982 1 1 1 1  75 TYR HB3  .  75 . HB1  1 1 
       2982 1 2 1 1  80 VAL MG2  .  80 . HG2* 1 1 
       2983 1 1 1 1  78 LEU HA   .  78 . HA   1 1 
       2983 1 2 1 1  80 VAL MG2  .  80 . HG2* 1 1 
       2984 1 1 1 1  30 VAL H    .  30 . HN   1 1 
       2984 1 2 1 1  81 VAL HB   .  81 . HB   1 1 
       2985 1 1 1 1 108 VAL H    . 108 . HN   1 1 
       2985 1 2 1 1 109 VAL MG2  . 109 . HG2* 1 1 
       2986 1 1 1 1 109 VAL MG2  . 109 . HG2* 1 1 
       2986 1 2 1 1 110 TYR H    . 110 . HN   1 1 
       2987 1 1 1 1  81 VAL MG1  .  81 . HG1* 1 1 
       2987 1 2 1 1  82 VAL H    .  82 . HN   1 1 
       2988 1 1 1 1  29 VAL HA   .  29 . HA   1 1 
       2988 1 2 1 1  81 VAL HB   .  81 . HB   1 1 
       2989 1 1 1 1  81 VAL MG1  .  81 . HG1* 1 1 
       2989 1 2 1 1  83 ILE HG12 .  83 . HG12 1 1 
       2990 1 1 1 1  81 VAL MG1  .  81 . HG1* 1 1 
       2990 1 2 1 1  83 ILE MD   .  83 . HD1* 1 1 
       2991 1 1 1 1   6 VAL MG1  .   6 . HG1* 1 1 
       2991 1 2 1 1  82 VAL MG1  .  82 . HG1* 1 1 
       2992 1 1 1 1   6 VAL HB   .   6 . HB   1 1 
       2992 1 2 1 1  82 VAL MG1  .  82 . HG1* 1 1 
       2993 1 1 1 1   7 VAL H    .   7 . HN   1 1 
       2993 1 2 1 1  83 ILE MG   .  83 . HG2* 1 1 
       2994 1 1 1 1  83 ILE MG   .  83 . HG2* 1 1 
       2994 1 2 1 1  85 THR H    .  85 . HN   1 1 
       2995 1 1 1 1   7 VAL H    .   7 . HN   1 1 
       2995 1 2 1 1  83 ILE MD   .  83 . HD1* 1 1 
       2996 1 1 1 1  18 ILE H    .  18 . HN   1 1 
       2996 1 2 1 1  83 ILE MD   .  83 . HD1* 1 1 
       2997 1 1 1 1  31 LEU HA   .  31 . HA   1 1 
       2997 1 2 1 1  83 ILE MG   .  83 . HG2* 1 1 
       2998 1 1 1 1   8 PHE HA   .   8 . HA   1 1 
       2998 1 2 1 1  83 ILE MG   .  83 . HG2* 1 1 
       2999 1 1 1 1  31 LEU HA   .  31 . HA   1 1 
       2999 1 2 1 1  83 ILE MD   .  83 . HD1* 1 1 
       3000 1 1 1 1  15 LEU HA   .  15 . HA   1 1 
       3000 1 2 1 1  83 ILE MD   .  83 . HD1* 1 1 
       3001 1 1 1 1  15 LEU HA   .  15 . HA   1 1 
       3001 1 2 1 1  83 ILE MG   .  83 . HG2* 1 1 
       3002 1 1 1 1   9 SER HB3  .   9 . HB1  1 1 
       3002 1 2 1 1  83 ILE MG   .  83 . HG2* 1 1 
       3003 1 1 1 1   7 VAL HB   .   7 . HB   1 1 
       3003 1 2 1 1  83 ILE MG   .  83 . HG2* 1 1 
       3004 1 1 1 1  19 VAL HB   .  19 . HB   1 1 
       3004 1 2 1 1  83 ILE MD   .  83 . HD1* 1 1 
       3005 1 1 1 1  18 ILE HB   .  18 . HB   1 1 
       3005 1 2 1 1  83 ILE MD   .  83 . HD1* 1 1 
       3006 1 1 1 1   7 VAL HB   .   7 . HB   1 1 
       3006 1 2 1 1  83 ILE MD   .  83 . HD1* 1 1 
       3007 1 1 1 1  29 VAL HB   .  29 . HB   1 1 
       3007 1 2 1 1  83 ILE MD   .  83 . HD1* 1 1 
       3008 1 1 1 1  81 VAL HB   .  81 . HB   1 1 
       3008 1 2 1 1  83 ILE MD   .  83 . HD1* 1 1 
       3009 1 1 1 1  18 ILE HG13 .  18 . HG11 1 1 
       3009 1 2 1 1  83 ILE MD   .  83 . HD1* 1 1 
       3010 1 1 1 1  15 LEU HB2  .  15 . HB2  1 1 
       3010 1 2 1 1  83 ILE MD   .  83 . HD1* 1 1 
       3011 1 1 1 1  31 LEU HB2  .  31 . HB2  1 1 
       3011 1 2 1 1  83 ILE HB   .  83 . HB   1 1 
       3012 1 1 1 1  31 LEU MD2  .  31 . HD2* 1 1 
       3012 1 2 1 1  83 ILE MG   .  83 . HG2* 1 1 
       3013 1 1 1 1  15 LEU MD1  .  15 . HD1* 1 1 
       3013 1 2 1 1  83 ILE MG   .  83 . HG2* 1 1 
       3014 1 1 1 1  15 LEU MD2  .  15 . HD2* 1 1 
       3014 1 2 1 1  83 ILE MG   .  83 . HG2* 1 1 
       3015 1 1 1 1  83 ILE MG   .  83 . HG2* 1 1 
       3015 1 2 1 1  85 THR MG   .  85 . HG2* 1 1 
       3016 1 1 1 1  31 LEU HG   .  31 . HG   1 1 
       3016 1 2 1 1  83 ILE MG   .  83 . HG2* 1 1 
       3017 1 1 1 1  18 ILE MG   .  18 . HG2* 1 1 
       3017 1 2 1 1  83 ILE HG13 .  83 . HG11 1 1 
       3018 1 1 1 1   7 VAL HB   .   7 . HB   1 1 
       3018 1 2 1 1  83 ILE HG13 .  83 . HG11 1 1 
       3019 1 1 1 1  81 VAL HB   .  81 . HB   1 1 
       3019 1 2 1 1  83 ILE HG13 .  83 . HG11 1 1 
       3020 1 1 1 1  18 ILE MG   .  18 . HG2* 1 1 
       3020 1 2 1 1  83 ILE MD   .  83 . HD1* 1 1 
       3021 1 1 1 1  31 LEU MD1  .  31 . HD1* 1 1 
       3021 1 2 1 1  83 ILE MD   .  83 . HD1* 1 1 
       3022 1 1 1 1  31 LEU MD2  .  31 . HD2* 1 1 
       3022 1 2 1 1  83 ILE MD   .  83 . HD1* 1 1 
       3023 1 1 1 1  32 LEU H    .  32 . HN   1 1 
       3023 1 2 1 1  84 VAL MG1  .  84 . HG1* 1 1 
       3024 1 1 1 1  64 PHE QD   .  64 . HD*  1 1 
       3024 1 2 1 1  84 VAL MG1  .  84 . HG1* 1 1 
       3025 1 1 1 1  64 PHE QD   .  64 . HD*  1 1 
       3025 1 2 1 1  84 VAL MG2  .  84 . HG2* 1 1 
       3026 1 1 1 1  84 VAL MG1  .  84 . HG1* 1 1 
       3026 1 2 1 1  91 TRP HZ3  .  91 . HZ3  1 1 
       3027 1 1 1 1  84 VAL MG1  .  84 . HG1* 1 1 
       3027 1 2 1 1  91 TRP HE3  .  91 . HE3  1 1 
       3028 1 1 1 1   8 PHE HA   .   8 . HA   1 1 
       3028 1 2 1 1  84 VAL MG1  .  84 . HG1* 1 1 
       3029 1 1 1 1   8 PHE HA   .   8 . HA   1 1 
       3029 1 2 1 1  84 VAL MG2  .  84 . HG2* 1 1 
       3030 1 1 1 1  84 VAL HB   .  84 . HB   1 1 
       3030 1 2 1 1  86 THR MG   .  86 . HG2* 1 1 
       3031 1 1 1 1   6 VAL MG2  .   6 . HG2* 1 1 
       3031 1 2 1 1  84 VAL MG1  .  84 . HG1* 1 1 
       3032 1 1 1 1  82 VAL MG1  .  82 . HG1* 1 1 
       3032 1 2 1 1  84 VAL MG1  .  84 . HG1* 1 1 
       3033 1 1 1 1  32 LEU HB3  .  32 . HB1  1 1 
       3033 1 2 1 1  84 VAL MG1  .  84 . HG1* 1 1 
       3034 1 1 1 1  32 LEU HB2  .  32 . HB2  1 1 
       3034 1 2 1 1  84 VAL MG1  .  84 . HG1* 1 1 
       3035 1 1 1 1  32 LEU HB3  .  32 . HB1  1 1 
       3035 1 2 1 1  84 VAL MG2  .  84 . HG2* 1 1 
       3036 1 1 1 1  32 LEU HB2  .  32 . HB2  1 1 
       3036 1 2 1 1  84 VAL MG2  .  84 . HG2* 1 1 
       3037 1 1 1 1  82 VAL MG1  .  82 . HG1* 1 1 
       3037 1 2 1 1  84 VAL MG2  .  84 . HG2* 1 1 
       3038 1 1 1 1  32 LEU MD1  .  32 . HD1* 1 1 
       3038 1 2 1 1  84 VAL MG2  .  84 . HG2* 1 1 
       3039 1 1 1 1   6 VAL MG1  .   6 . HG1* 1 1 
       3039 1 2 1 1  84 VAL MG2  .  84 . HG2* 1 1 
       3040 1 1 1 1   6 VAL MG2  .   6 . HG2* 1 1 
       3040 1 2 1 1  84 VAL MG2  .  84 . HG2* 1 1 
       3041 1 1 1 1   8 PHE HB3  .   8 . HB1  1 1 
       3041 1 2 1 1  84 VAL MG2  .  84 . HG2* 1 1 
       3042 1 1 1 1  84 VAL MG2  .  84 . HG2* 1 1 
       3042 1 2 1 1  95 PHE HB2  .  95 . HB2  1 1 
       3043 1 1 1 1  84 VAL MG1  .  84 . HG1* 1 1 
       3043 1 2 1 1  91 TRP HB3  .  91 . HB1  1 1 
       3044 1 1 1 1  34 SER HG   .  34 . HG   1 1 
       3044 1 2 1 1  85 THR MG   .  85 . HG2* 1 1 
       3045 1 1 1 1   8 PHE HA   .   8 . HA   1 1 
       3045 1 2 1 1  85 THR MG   .  85 . HG2* 1 1 
       3046 1 1 1 1  33 TYR HA   .  33 . HA   1 1 
       3046 1 2 1 1  85 THR MG   .  85 . HG2* 1 1 
       3047 1 1 1 1  15 LEU MD1  .  15 . HD1* 1 1 
       3047 1 2 1 1  85 THR MG   .  85 . HG2* 1 1 
       3048 1 1 1 1  31 LEU MD2  .  31 . HD2* 1 1 
       3048 1 2 1 1  85 THR MG   .  85 . HG2* 1 1 
       3049 1 1 1 1  15 LEU HG   .  15 . HG   1 1 
       3049 1 2 1 1  85 THR MG   .  85 . HG2* 1 1 
       3050 1 1 1 1  84 VAL MG1  .  84 . HG1* 1 1 
       3050 1 2 1 1  86 THR HA   .  86 . HA   1 1 
       3051 1 1 1 1  84 VAL MG1  .  84 . HG1* 1 1 
       3051 1 2 1 1  86 THR HB   .  86 . HB   1 1 
       3052 1 1 1 1  86 THR MG   .  86 . HG2* 1 1 
       3052 1 2 1 1  92 ILE MD   .  92 . HD1* 1 1 
       3053 1 1 1 1  84 VAL MG1  .  84 . HG1* 1 1 
       3053 1 2 1 1  86 THR MG   .  86 . HG2* 1 1 
       3054 1 1 1 1  86 THR MG   .  86 . HG2* 1 1 
       3054 1 2 1 1  88 ASP HB3  .  88 . HB1  1 1 
       3055 1 1 1 1  86 THR MG   .  86 . HG2* 1 1 
       3055 1 2 1 1  88 ASP HB2  .  88 . HB2  1 1 
       3056 1 1 1 1  34 SER HB2  .  34 . HB2  1 1 
       3056 1 2 1 1  86 THR HB   .  86 . HB   1 1 
       3057 1 1 1 1  34 SER HB2  .  34 . HB2  1 1 
       3057 1 2 1 1  86 THR MG   .  86 . HG2* 1 1 
       3058 1 1 1 1  34 SER HB3  .  34 . HB1  1 1 
       3058 1 2 1 1  86 THR MG   .  86 . HG2* 1 1 
       3059 1 1 1 1  86 THR MG   .  86 . HG2* 1 1 
       3059 1 2 1 1  91 TRP HB2  .  91 . HB2  1 1 
       3060 1 1 1 1  86 THR MG   .  86 . HG2* 1 1 
       3060 1 2 1 1  91 TRP HB3  .  91 . HB1  1 1 
       3061 1 1 1 1   8 PHE HB2  .   8 . HB2  1 1 
       3061 1 2 1 1  86 THR MG   .  86 . HG2* 1 1 
       3062 1 1 1 1  86 THR MG   .  86 . HG2* 1 1 
       3062 1 2 1 1  91 TRP HE3  .  91 . HE3  1 1 
       3063 1 1 1 1  86 THR MG   .  86 . HG2* 1 1 
       3063 1 2 1 1  91 TRP HZ3  .  91 . HZ3  1 1 
       3064 1 1 1 1   8 PHE QE   .   8 . HE*  1 1 
       3064 1 2 1 1  86 THR MG   .  86 . HG2* 1 1 
       3065 1 1 1 1  64 PHE QD   .  64 . HD*  1 1 
       3065 1 2 1 1  86 THR MG   .  86 . HG2* 1 1 
       3066 1 1 1 1  86 THR MG   .  86 . HG2* 1 1 
       3066 1 2 1 1  92 ILE H    .  92 . HN   1 1 
       3067 1 1 1 1  86 THR HB   .  86 . HB   1 1 
       3067 1 2 1 1  88 ASP H    .  88 . HN   1 1 
       3068 1 1 1 1  86 THR HA   .  86 . HA   1 1 
       3068 1 2 1 1  88 ASP H    .  88 . HN   1 1 
       3069 1 1 1 1  90 GLU HA   .  90 . HA   1 1 
       3069 1 2 1 1  91 TRP HD1  .  91 . HD1  1 1 
       3070 1 1 1 1  90 GLU HG2  .  90 . HG2  1 1 
       3070 1 2 1 1  91 TRP HD1  .  91 . HD1  1 1 
       3071 1 1 1 1  90 GLU HG3  .  90 . HG1  1 1 
       3071 1 2 1 1  91 TRP HD1  .  91 . HD1  1 1 
       3072 1 1 1 1  64 PHE QE   .  64 . HE*  1 1 
       3072 1 2 1 1  91 TRP HB3  .  91 . HB1  1 1 
       3073 1 1 1 1  64 PHE QE   .  64 . HE*  1 1 
       3073 1 2 1 1  91 TRP HB2  .  91 . HB2  1 1 
       3074 1 1 1 1  64 PHE QE   .  64 . HE*  1 1 
       3074 1 2 1 1  91 TRP HA   .  91 . HA   1 1 
       3075 1 1 1 1  86 THR MG   .  86 . HG2* 1 1 
       3075 1 2 1 1  91 TRP HA   .  91 . HA   1 1 
       3076 1 1 1 1  84 VAL MG1  .  84 . HG1* 1 1 
       3076 1 2 1 1  91 TRP HB2  .  91 . HB2  1 1 
       3077 1 1 1 1  92 ILE HB   .  92 . HB   1 1 
       3077 1 2 1 1 125 PHE QE   . 125 . HE*  1 1 
       3078 1 1 1 1   8 PHE QD   .   8 . HD*  1 1 
       3078 1 2 1 1  92 ILE HA   .  92 . HA   1 1 
       3079 1 1 1 1  92 ILE HA   .  92 . HA   1 1 
       3079 1 2 1 1  95 PHE QD   .  95 . HD*  1 1 
       3080 1 1 1 1  92 ILE MG   .  92 . HG2* 1 1 
       3080 1 2 1 1 125 PHE QE   . 125 . HE*  1 1 
       3081 1 1 1 1   8 PHE QD   .   8 . HD*  1 1 
       3081 1 2 1 1  92 ILE MD   .  92 . HD1* 1 1 
       3082 1 1 1 1  92 ILE MD   .  92 . HD1* 1 1 
       3082 1 2 1 1 125 PHE HZ   . 125 . HZ   1 1 
       3083 1 1 1 1  92 ILE MD   .  92 . HD1* 1 1 
       3083 1 2 1 1 125 PHE QE   . 125 . HE*  1 1 
       3084 1 1 1 1  92 ILE MD   .  92 . HD1* 1 1 
       3084 1 2 1 1 110 TYR QE   . 110 . HE*  1 1 
       3085 1 1 1 1  64 PHE HZ   .  64 . HZ   1 1 
       3085 1 2 1 1  92 ILE HA   .  92 . HA   1 1 
       3086 1 1 1 1  92 ILE MG   .  92 . HG2* 1 1 
       3086 1 2 1 1  96 ILE HG13 .  96 . HG11 1 1 
       3087 1 1 1 1  92 ILE MG   .  92 . HG2* 1 1 
       3087 1 2 1 1 108 VAL HB   . 108 . HB   1 1 
       3088 1 1 1 1  89 LYS HA   .  89 . HA   1 1 
       3088 1 2 1 1  92 ILE MG   .  92 . HG2* 1 1 
       3089 1 1 1 1  89 LYS HA   .  89 . HA   1 1 
       3089 1 2 1 1  92 ILE MD   .  92 . HD1* 1 1 
       3090 1 1 1 1  87 ASP HA   .  87 . HA   1 1 
       3090 1 2 1 1  92 ILE MD   .  92 . HD1* 1 1 
       3091 1 1 1 1  92 ILE MD   .  92 . HD1* 1 1 
       3091 1 2 1 1 110 TYR HA   . 110 . HA   1 1 
       3092 1 1 1 1  92 ILE MG   .  92 . HG2* 1 1 
       3092 1 2 1 1 106 VAL MG1  . 106 . HG1* 1 1 
       3093 1 1 1 1  92 ILE MD   .  92 . HD1* 1 1 
       3093 1 2 1 1 108 VAL MG1  . 108 . HG1* 1 1 
       3094 1 1 1 1  89 LYS HG3  .  89 . HG1  1 1 
       3094 1 2 1 1  92 ILE MD   .  92 . HD1* 1 1 
       3095 1 1 1 1  92 ILE MD   .  92 . HD1* 1 1 
       3095 1 2 1 1 121 ALA MB   . 121 . HB*  1 1 
       3096 1 1 1 1  92 ILE HB   .  92 . HB   1 1 
       3096 1 2 1 1 108 VAL MG1  . 108 . HG1* 1 1 
       3097 1 1 1 1  92 ILE MG   .  92 . HG2* 1 1 
       3097 1 2 1 1  93 LYS HA   .  93 . HA   1 1 
       3098 1 1 1 1  93 LYS HA   .  93 . HA   1 1 
       3098 1 2 1 1 125 PHE QE   . 125 . HE*  1 1 
       3099 1 1 1 1  93 LYS HB2  .  93 . HB2  1 1 
       3099 1 2 1 1 125 PHE QE   . 125 . HE*  1 1 
       3100 1 1 1 1  93 LYS HG2  .  93 . HG2  1 1 
       3100 1 2 1 1 125 PHE QE   . 125 . HE*  1 1 
       3101 1 1 1 1  93 LYS HG3  .  93 . HG1  1 1 
       3101 1 2 1 1 125 PHE QE   . 125 . HE*  1 1 
       3102 1 1 1 1  64 PHE QE   .  64 . HE*  1 1 
       3102 1 2 1 1  94 ASP HB2  .  94 . HB2  1 1 
       3103 1 1 1 1  64 PHE QE   .  64 . HE*  1 1 
       3103 1 2 1 1  94 ASP HB3  .  94 . HB1  1 1 
       3104 1 1 1 1  53 VAL HA   .  53 . HA   1 1 
       3104 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       3105 1 1 1 1  95 PHE HB3  .  95 . HB1  1 1 
       3105 1 2 1 1  96 ILE HB   .  96 . HB   1 1 
       3106 1 1 1 1   8 PHE HZ   .   8 . HZ   1 1 
       3106 1 2 1 1  95 PHE HA   .  95 . HA   1 1 
       3107 1 1 1 1  64 PHE QE   .  64 . HE*  1 1 
       3107 1 2 1 1  95 PHE HB3  .  95 . HB1  1 1 
       3108 1 1 1 1  64 PHE QE   .  64 . HE*  1 1 
       3108 1 2 1 1  95 PHE HB2  .  95 . HB2  1 1 
       3109 1 1 1 1  95 PHE QD   .  95 . HD*  1 1 
       3109 1 2 1 1  96 ILE HA   .  96 . HA   1 1 
       3110 1 1 1 1  95 PHE QD   .  95 . HD*  1 1 
       3110 1 2 1 1  96 ILE HB   .  96 . HB   1 1 
       3111 1 1 1 1  96 ILE HB   .  96 . HB   1 1 
       3111 1 2 1 1 125 PHE QD   . 125 . HD*  1 1 
       3112 1 1 1 1  95 PHE QD   .  95 . HD*  1 1 
       3112 1 2 1 1  96 ILE MG   .  96 . HG2* 1 1 
       3113 1 1 1 1  96 ILE MG   .  96 . HG2* 1 1 
       3113 1 2 1 1 125 PHE QD   . 125 . HD*  1 1 
       3114 1 1 1 1  95 PHE QE   .  95 . HE*  1 1 
       3114 1 2 1 1  96 ILE MG   .  96 . HG2* 1 1 
       3115 1 1 1 1  95 PHE QD   .  95 . HD*  1 1 
       3115 1 2 1 1  96 ILE HG12 .  96 . HG12 1 1 
       3116 1 1 1 1  92 ILE MG   .  92 . HG2* 1 1 
       3116 1 2 1 1  96 ILE MG   .  96 . HG2* 1 1 
       3117 1 1 1 1  92 ILE MG   .  92 . HG2* 1 1 
       3117 1 2 1 1  96 ILE HG12 .  96 . HG12 1 1 
       3118 1 1 1 1  92 ILE MG   .  92 . HG2* 1 1 
       3118 1 2 1 1  96 ILE MD   .  96 . HD1* 1 1 
       3119 1 1 1 1  96 ILE MG   .  96 . HG2* 1 1 
       3119 1 2 1 1  97 GLU HG2  .  97 . HG2  1 1 
       3120 1 1 1 1  96 ILE MD   .  96 . HD1* 1 1 
       3120 1 2 1 1  97 GLU HG2  .  97 . HG2  1 1 
       3121 1 1 1 1  49 GLU HB2  .  49 . HB2  1 1 
       3121 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       3122 1 1 1 1  96 ILE MG   .  96 . HG2* 1 1 
       3122 1 2 1 1  97 GLU HA   .  97 . HA   1 1 
       3123 1 1 1 1  78 LEU MD2  .  78 . HD2* 1 1 
       3123 1 2 1 1  99 ALA HA   .  99 . HA   1 1 
       3124 1 1 1 1  96 ILE MG   .  96 . HG2* 1 1 
       3124 1 2 1 1  99 ALA HA   .  99 . HA   1 1 
       3125 1 1 1 1  99 ALA HA   .  99 . HA   1 1 
       3125 1 2 1 1 106 VAL MG1  . 106 . HG1* 1 1 
       3126 1 1 1 1  99 ALA HA   .  99 . HA   1 1 
       3126 1 2 1 1 106 VAL MG2  . 106 . HG2* 1 1 
       3127 1 1 1 1  99 ALA HA   .  99 . HA   1 1 
       3127 1 2 1 1 104 VAL HB   . 104 . HB   1 1 
       3128 1 1 1 1  99 ALA MB   .  99 . HB*  1 1 
       3128 1 2 1 1 102 ARG HB2  . 102 . HB2  1 1 
       3129 1 1 1 1  99 ALA MB   .  99 . HB*  1 1 
       3129 1 2 1 1 106 VAL MG1  . 106 . HG1* 1 1 
       3130 1 1 1 1  68 ILE MG   .  68 . HG2* 1 1 
       3130 1 2 1 1  99 ALA MB   .  99 . HB*  1 1 
       3131 1 1 1 1   4 ILE MG   .   4 . HG2* 1 1 
       3131 1 2 1 1  99 ALA MB   .  99 . HB*  1 1 
       3132 1 1 1 1  99 ALA MB   .  99 . HB*  1 1 
       3132 1 2 1 1 100 LYS HB2  . 100 . HB2  1 1 
       3133 1 1 1 1  99 ALA MB   .  99 . HB*  1 1 
       3133 1 2 1 1 100 LYS HB3  . 100 . HB1  1 1 
       3134 1 1 1 1  98 GLU HB2  .  98 . HB2  1 1 
       3134 1 2 1 1  99 ALA MB   .  99 . HB*  1 1 
       3135 1 1 1 1  99 ALA HA   .  99 . HA   1 1 
       3135 1 2 1 1 104 VAL H    . 104 . HN   1 1 
       3136 1 1 1 1  99 ALA MB   .  99 . HB*  1 1 
       3136 1 2 1 1 106 VAL H    . 106 . HN   1 1 
       3137 1 1 1 1  99 ALA MB   .  99 . HB*  1 1 
       3137 1 2 1 1 105 GLU H    . 105 . HN   1 1 
       3138 1 1 1 1  99 ALA MB   .  99 . HB*  1 1 
       3138 1 2 1 1 103 GLY H    . 103 . HN   1 1 
       3139 1 1 1 1  99 ALA MB   .  99 . HB*  1 1 
       3139 1 2 1 1 102 ARG H    . 102 . HN   1 1 
       3140 1 1 1 1  95 PHE QE   .  95 . HE*  1 1 
       3140 1 2 1 1  99 ALA MB   .  99 . HB*  1 1 
       3141 1 1 1 1  72 TRP HZ3  .  72 . HZ3  1 1 
       3141 1 2 1 1  99 ALA MB   .  99 . HB*  1 1 
       3142 1 1 1 1  96 ILE MG   .  96 . HG2* 1 1 
       3142 1 2 1 1 100 LYS HB2  . 100 . HB2  1 1 
       3143 1 1 1 1 101 GLU HB2  . 101 . HB2  1 1 
       3143 1 2 1 1 102 ARG HA   . 102 . HA   1 1 
       3144 1 1 1 1 101 GLU HB3  . 101 . HB1  1 1 
       3144 1 2 1 1 102 ARG HA   . 102 . HA   1 1 
       3145 1 1 1 1 102 ARG HB3  . 102 . HB1  1 1 
       3145 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       3146 1 1 1 1 102 ARG HB2  . 102 . HB2  1 1 
       3146 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       3147 1 1 1 1  99 ALA HA   .  99 . HA   1 1 
       3147 1 2 1 1 102 ARG HB2  . 102 . HB2  1 1 
       3148 1 1 1 1  99 ALA HA   .  99 . HA   1 1 
       3148 1 2 1 1 102 ARG HB3  . 102 . HB1  1 1 
       3149 1 1 1 1 102 ARG HA   . 102 . HA   1 1 
       3149 1 2 1 1 104 VAL H    . 104 . HN   1 1 
       3150 1 1 1 1 102 ARG HB3  . 102 . HB1  1 1 
       3150 1 2 1 1 104 VAL H    . 104 . HN   1 1 
       3151 1 1 1 1  72 TRP HZ2  .  72 . HZ2  1 1 
       3151 1 2 1 1 102 ARG HB3  . 102 . HB1  1 1 
       3152 1 1 1 1  72 TRP HZ2  .  72 . HZ2  1 1 
       3152 1 2 1 1 102 ARG HB2  . 102 . HB2  1 1 
       3153 1 1 1 1 103 GLY HA2  . 103 . HA2  1 1 
       3153 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       3154 1 1 1 1 102 ARG H    . 102 . HN   1 1 
       3154 1 2 1 1 103 GLY HA2  . 103 . HA2  1 1 
       3155 1 1 1 1 102 ARG H    . 102 . HN   1 1 
       3155 1 2 1 1 103 GLY HA3  . 103 . HA1  1 1 
       3156 1 1 1 1 103 GLY H    . 103 . HN   1 1 
       3156 1 2 1 1 104 VAL HB   . 104 . HB   1 1 
       3157 1 1 1 1  99 ALA H    .  99 . HN   1 1 
       3157 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       3158 1 1 1 1 100 LYS H    . 100 . HN   1 1 
       3158 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       3159 1 1 1 1   3 GLN H    .   3 . HN   1 1 
       3159 1 2 1 1 104 VAL HB   . 104 . HB   1 1 
       3160 1 1 1 1  72 TRP HH2  .  72 . HH2  1 1 
       3160 1 2 1 1 104 VAL HB   . 104 . HB   1 1 
       3161 1 1 1 1  72 TRP HZ3  .  72 . HZ3  1 1 
       3161 1 2 1 1 104 VAL MG1  . 104 . HG1* 1 1 
       3162 1 1 1 1  72 TRP HZ3  .  72 . HZ3  1 1 
       3162 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       3163 1 1 1 1  72 TRP HH2  .  72 . HH2  1 1 
       3163 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       3164 1 1 1 1 100 LYS HA   . 100 . HA   1 1 
       3164 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       3165 1 1 1 1 103 GLY HA3  . 103 . HA1  1 1 
       3165 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       3166 1 1 1 1  99 ALA HA   .  99 . HA   1 1 
       3166 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       3167 1 1 1 1  78 LEU MD1  .  78 . HD1* 1 1 
       3167 1 2 1 1 104 VAL HA   . 104 . HA   1 1 
       3168 1 1 1 1  99 ALA MB   .  99 . HB*  1 1 
       3168 1 2 1 1 104 VAL HA   . 104 . HA   1 1 
       3169 1 1 1 1 104 VAL HA   . 104 . HA   1 1 
       3169 1 2 1 1 105 GLU HB2  . 105 . HB2  1 1 
       3170 1 1 1 1  78 LEU MD1  .  78 . HD1* 1 1 
       3170 1 2 1 1 104 VAL HB   . 104 . HB   1 1 
       3171 1 1 1 1   4 ILE MG   .   4 . HG2* 1 1 
       3171 1 2 1 1 104 VAL HB   . 104 . HB   1 1 
       3172 1 1 1 1  99 ALA MB   .  99 . HB*  1 1 
       3172 1 2 1 1 104 VAL HB   . 104 . HB   1 1 
       3173 1 1 1 1 104 VAL HB   . 104 . HB   1 1 
       3173 1 2 1 1 105 GLU HB2  . 105 . HB2  1 1 
       3174 1 1 1 1   4 ILE MG   .   4 . HG2* 1 1 
       3174 1 2 1 1 106 VAL MG2  . 106 . HG2* 1 1 
       3175 1 1 1 1  99 ALA MB   .  99 . HB*  1 1 
       3175 1 2 1 1 106 VAL MG2  . 106 . HG2* 1 1 
       3176 1 1 1 1   4 ILE MG   .   4 . HG2* 1 1 
       3176 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       3177 1 1 1 1  99 ALA MB   .  99 . HB*  1 1 
       3177 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       3178 1 1 1 1   4 ILE HB   .   4 . HB   1 1 
       3178 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       3179 1 1 1 1   3 GLN HA   .   3 . HA   1 1 
       3179 1 2 1 1 105 GLU HB3  . 105 . HB1  1 1 
       3180 1 1 1 1   3 GLN HA   .   3 . HA   1 1 
       3180 1 2 1 1 105 GLU HG2  . 105 . HG2  1 1 
       3181 1 1 1 1   3 GLN HA   .   3 . HA   1 1 
       3181 1 2 1 1 105 GLU HG3  . 105 . HG1  1 1 
       3182 1 1 1 1   3 GLN H    .   3 . HN   1 1 
       3182 1 2 1 1 105 GLU HB2  . 105 . HB2  1 1 
       3183 1 1 1 1  99 ALA MB   .  99 . HB*  1 1 
       3183 1 2 1 1 106 VAL HB   . 106 . HB   1 1 
       3184 1 1 1 1 105 GLU HA   . 105 . HA   1 1 
       3184 1 2 1 1 106 VAL HB   . 106 . HB   1 1 
       3185 1 1 1 1  48 PHE HA   .  48 . HA   1 1 
       3185 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       3186 1 1 1 1   5 PHE HA   .   5 . HA   1 1 
       3186 1 2 1 1 107 PHE HB3  . 107 . HB1  1 1 
       3187 1 1 1 1 108 VAL MG1  . 108 . HG1* 1 1 
       3187 1 2 1 1 110 TYR HB3  . 110 . HB1  1 1 
       3188 1 1 1 1 107 PHE HA   . 107 . HA   1 1 
       3188 1 2 1 1 108 VAL HB   . 108 . HB   1 1 
       3189 1 1 1 1 107 PHE HA   . 107 . HA   1 1 
       3189 1 2 1 1 108 VAL MG2  . 108 . HG2* 1 1 
       3190 1 1 1 1 108 VAL MG1  . 108 . HG1* 1 1 
       3190 1 2 1 1 109 VAL HA   . 109 . HA   1 1 
       3191 1 1 1 1   6 VAL HA   .   6 . HA   1 1 
       3191 1 2 1 1 108 VAL MG1  . 108 . HG1* 1 1 
       3192 1 1 1 1   8 PHE HA   .   8 . HA   1 1 
       3192 1 2 1 1 108 VAL MG1  . 108 . HG1* 1 1 
       3193 1 1 1 1 108 VAL HB   . 108 . HB   1 1 
       3193 1 2 1 1 133 ARG H    . 133 . HN   1 1 
       3194 1 1 1 1  95 PHE QD   .  95 . HD*  1 1 
       3194 1 2 1 1 108 VAL MG2  . 108 . HG2* 1 1 
       3195 1 1 1 1 108 VAL MG1  . 108 . HG1* 1 1 
       3195 1 2 1 1 110 TYR QD   . 110 . HD*  1 1 
       3196 1 1 1 1   8 PHE HZ   .   8 . HZ   1 1 
       3196 1 2 1 1 108 VAL MG1  . 108 . HG1* 1 1 
       3197 1 1 1 1  29 VAL MG2  .  29 . HG2* 1 1 
       3197 1 2 1 1  54 ASP H    .  54 . HN   1 1 
       3198 1 1 1 1 107 PHE QE   . 107 . HE*  1 1 
       3198 1 2 1 1 109 VAL MG2  . 109 . HG2* 1 1 
       3199 1 1 1 1   5 PHE QD   .   5 . HD*  1 1 
       3199 1 2 1 1  81 VAL MG2  .  81 . HG2* 1 1 
       3200 1 1 1 1 109 VAL MG2  . 109 . HG2* 1 1 
       3200 1 2 1 1 144 GLN HB3  . 144 . HB1  1 1 
       3201 1 1 1 1  81 VAL MG2  .  81 . HG2* 1 1 
       3201 1 2 1 1 145 VAL HA   . 145 . HA   1 1 
       3202 1 1 1 1  29 VAL MG2  .  29 . HG2* 1 1 
       3202 1 2 1 1  53 VAL HA   .  53 . HA   1 1 
       3203 1 1 1 1 149 VAL HA   . 149 . HA   1 1 
       3203 1 2 1 1 152 VAL MG1  . 152 . HG1* 1 1 
       3204 1 1 1 1 148 PHE HA   . 148 . HA   1 1 
       3204 1 2 1 1 152 VAL MG1  . 152 . HG1* 1 1 
       3205 1 1 1 1   7 VAL MG1  .   7 . HG1* 1 1 
       3205 1 2 1 1 110 TYR HA   . 110 . HA   1 1 
       3206 1 1 1 1 109 VAL MG1  . 109 . HG1* 1 1 
       3206 1 2 1 1 110 TYR HA   . 110 . HA   1 1 
       3207 1 1 1 1 110 TYR HB3  . 110 . HB1  1 1 
       3207 1 2 1 1 134 THR MG   . 134 . HG2* 1 1 
       3208 1 1 1 1 109 VAL MG1  . 109 . HG1* 1 1 
       3208 1 2 1 1 110 TYR HB3  . 110 . HB1  1 1 
       3209 1 1 1 1 110 TYR HB3  . 110 . HB1  1 1 
       3209 1 2 1 1 141 LEU MD1  . 141 . HD1* 1 1 
       3210 1 1 1 1 108 VAL MG1  . 108 . HG1* 1 1 
       3210 1 2 1 1 110 TYR HB2  . 110 . HB2  1 1 
       3211 1 1 1 1   7 VAL MG1  .   7 . HG1* 1 1 
       3211 1 2 1 1 110 TYR HB2  . 110 . HB2  1 1 
       3212 1 1 1 1 109 VAL MG1  . 109 . HG1* 1 1 
       3212 1 2 1 1 110 TYR HB2  . 110 . HB2  1 1 
       3213 1 1 1 1  92 ILE MD   .  92 . HD1* 1 1 
       3213 1 2 1 1 110 TYR HB2  . 110 . HB2  1 1 
       3214 1 1 1 1 110 TYR QE   . 110 . HE*  1 1 
       3214 1 2 1 1 132 VAL HA   . 132 . HA   1 1 
       3215 1 1 1 1  87 ASP HA   .  87 . HA   1 1 
       3215 1 2 1 1 110 TYR HB3  . 110 . HB1  1 1 
       3216 1 1 1 1   9 SER HG   .   9 . HG   1 1 
       3216 1 2 1 1 111 ASN HB2  . 111 . HB2  1 1 
       3217 1 1 1 1   9 SER HG   .   9 . HG   1 1 
       3217 1 2 1 1 111 ASN HB3  . 111 . HB1  1 1 
       3218 1 1 1 1 111 ASN HA   . 111 . HA   1 1 
       3218 1 2 1 1 112 ASN HA   . 112 . HA   1 1 
       3219 1 1 1 1 111 ASN HA   . 111 . HA   1 1 
       3219 1 2 1 1 136 SER HA   . 136 . HA   1 1 
       3220 1 1 1 1   9 SER HA   .   9 . HA   1 1 
       3220 1 2 1 1 111 ASN HB2  . 111 . HB2  1 1 
       3221 1 1 1 1   9 SER HA   .   9 . HA   1 1 
       3221 1 2 1 1 111 ASN HB3  . 111 . HB1  1 1 
       3222 1 1 1 1 111 ASN HB3  . 111 . HB1  1 1 
       3222 1 2 1 1 112 ASN HA   . 112 . HA   1 1 
       3223 1 1 1 1   9 SER HB3  .   9 . HB1  1 1 
       3223 1 2 1 1 111 ASN HB2  . 111 . HB2  1 1 
       3224 1 1 1 1   9 SER HB2  .   9 . HB2  1 1 
       3224 1 2 1 1 111 ASN HB2  . 111 . HB2  1 1 
       3225 1 1 1 1 111 ASN HB2  . 111 . HB2  1 1 
       3225 1 2 1 1 135 VAL MG2  . 135 . HG2* 1 1 
       3226 1 1 1 1 111 ASN HB2  . 111 . HB2  1 1 
       3226 1 2 1 1 141 LEU MD1  . 141 . HD1* 1 1 
       3227 1 1 1 1  14 ILE MD   .  14 . HD1* 1 1 
       3227 1 2 1 1 111 ASN HB3  . 111 . HB1  1 1 
       3228 1 1 1 1 111 ASN HB3  . 111 . HB1  1 1 
       3228 1 2 1 1 135 VAL MG2  . 135 . HG2* 1 1 
       3229 1 1 1 1 114 ASP HB2  . 114 . HB2  1 1 
       3229 1 2 1 1 117 ARG HB2  . 117 . HB2  1 1 
       3230 1 1 1 1 114 ASP HB3  . 114 . HB1  1 1 
       3230 1 2 1 1 117 ARG HB2  . 117 . HB2  1 1 
       3231 1 1 1 1 115 ASP HB2  . 115 . HB2  1 1 
       3231 1 2 1 1 117 ARG H    . 117 . HN   1 1 
       3232 1 1 1 1 115 ASP HB3  . 115 . HB1  1 1 
       3232 1 2 1 1 117 ARG H    . 117 . HN   1 1 
       3233 1 1 1 1 115 ASP HB2  . 115 . HB2  1 1 
       3233 1 2 1 1 118 ARG H    . 118 . HN   1 1 
       3234 1 1 1 1 115 ASP HB3  . 115 . HB1  1 1 
       3234 1 2 1 1 118 ARG H    . 118 . HN   1 1 
       3235 1 1 1 1 121 ALA MB   . 121 . HB*  1 1 
       3235 1 2 1 1 134 THR MG   . 134 . HG2* 1 1 
       3236 1 1 1 1 121 ALA HA   . 121 . HA   1 1 
       3236 1 2 1 1 125 PHE QD   . 125 . HD*  1 1 
       3237 1 1 1 1 121 ALA HA   . 121 . HA   1 1 
       3237 1 2 1 1 125 PHE QE   . 125 . HE*  1 1 
       3238 1 1 1 1 120 GLU H    . 120 . HN   1 1 
       3238 1 2 1 1 121 ALA MB   . 121 . HB*  1 1 
       3239 1 1 1 1 121 ALA MB   . 121 . HB*  1 1 
       3239 1 2 1 1 125 PHE QD   . 125 . HD*  1 1 
       3240 1 1 1 1 110 TYR QD   . 110 . HD*  1 1 
       3240 1 2 1 1 121 ALA MB   . 121 . HB*  1 1 
       3241 1 1 1 1 122 GLN HG3  . 122 . HG1  1 1 
       3241 1 2 1 1 134 THR MG   . 134 . HG2* 1 1 
       3242 1 1 1 1 122 GLN HG2  . 122 . HG2  1 1 
       3242 1 2 1 1 134 THR MG   . 134 . HG2* 1 1 
       3243 1 1 1 1 122 GLN HB2  . 122 . HB2  1 1 
       3243 1 2 1 1 134 THR MG   . 134 . HG2* 1 1 
       3244 1 1 1 1 122 GLN HB3  . 122 . HB1  1 1 
       3244 1 2 1 1 134 THR MG   . 134 . HG2* 1 1 
       3245 1 1 1 1 122 GLN HB3  . 122 . HB1  1 1 
       3245 1 2 1 1 132 VAL MG1  . 132 . HG1* 1 1 
       3246 1 1 1 1 122 GLN HB3  . 122 . HB1  1 1 
       3246 1 2 1 1 132 VAL MG2  . 132 . HG2* 1 1 
       3247 1 1 1 1 125 PHE HB2  . 125 . HB2  1 1 
       3247 1 2 1 1 132 VAL HB   . 132 . HB   1 1 
       3248 1 1 1 1 125 PHE HB2  . 125 . HB2  1 1 
       3248 1 2 1 1 132 VAL MG1  . 132 . HG1* 1 1 
       3249 1 1 1 1 125 PHE HB2  . 125 . HB2  1 1 
       3249 1 2 1 1 132 VAL MG2  . 132 . HG2* 1 1 
       3250 1 1 1 1 125 PHE HB3  . 125 . HB1  1 1 
       3250 1 2 1 1 132 VAL HB   . 132 . HB   1 1 
       3251 1 1 1 1  96 ILE MG   .  96 . HG2* 1 1 
       3251 1 2 1 1 125 PHE HB3  . 125 . HB1  1 1 
       3252 1 1 1 1  96 ILE MD   .  96 . HD1* 1 1 
       3252 1 2 1 1 125 PHE HB3  . 125 . HB1  1 1 
       3253 1 1 1 1 127 SER HB2  . 127 . HB2  1 1 
       3253 1 2 1 1 130 VAL HB   . 130 . HB   1 1 
       3254 1 1 1 1   9 SER HA   .   9 . HA   1 1 
       3254 1 2 1 1 141 LEU MD1  . 141 . HD1* 1 1 
       3255 1 1 1 1 105 GLU HG3  . 105 . HG1  1 1 
       3255 1 2 1 1 129 GLY HA3  . 129 . HA1  1 1 
       3256 1 1 1 1 105 GLU HG2  . 105 . HG2  1 1 
       3256 1 2 1 1 129 GLY HA2  . 129 . HA2  1 1 
       3257 1 1 1 1 105 GLU HG3  . 105 . HG1  1 1 
       3257 1 2 1 1 129 GLY HA2  . 129 . HA2  1 1 
       3258 1 1 1 1 105 GLU HA   . 105 . HA   1 1 
       3258 1 2 1 1 129 GLY HA2  . 129 . HA2  1 1 
       3259 1 1 1 1 128 ASP HA   . 128 . HA   1 1 
       3259 1 2 1 1 129 GLY HA2  . 129 . HA2  1 1 
       3260 1 1 1 1 105 GLU HA   . 105 . HA   1 1 
       3260 1 2 1 1 129 GLY HA3  . 129 . HA1  1 1 
       3261 1 1 1 1 128 ASP HA   . 128 . HA   1 1 
       3261 1 2 1 1 129 GLY HA3  . 129 . HA1  1 1 
       3262 1 1 1 1 127 SER HA   . 127 . HA   1 1 
       3262 1 2 1 1 130 VAL HB   . 130 . HB   1 1 
       3263 1 1 1 1 127 SER HB3  . 127 . HB1  1 1 
       3263 1 2 1 1 130 VAL HB   . 130 . HB   1 1 
       3264 1 1 1 1  95 PHE HB2  .  95 . HB2  1 1 
       3264 1 2 1 1 108 VAL MG1  . 108 . HG1* 1 1 
       3265 1 1 1 1  96 ILE MG   .  96 . HG2* 1 1 
       3265 1 2 1 1 130 VAL HB   . 130 . HB   1 1 
       3266 1 1 1 1  96 ILE MD   .  96 . HD1* 1 1 
       3266 1 2 1 1 130 VAL HB   . 130 . HB   1 1 
       3267 1 1 1 1  96 ILE HA   .  96 . HA   1 1 
       3267 1 2 1 1 106 VAL MG2  . 106 . HG2* 1 1 
       3268 1 1 1 1 107 PHE HA   . 107 . HA   1 1 
       3268 1 2 1 1 131 ASP HB2  . 131 . HB2  1 1 
       3269 1 1 1 1 107 PHE QE   . 107 . HE*  1 1 
       3269 1 2 1 1 131 ASP HB3  . 131 . HB1  1 1 
       3270 1 1 1 1 107 PHE QE   . 107 . HE*  1 1 
       3270 1 2 1 1 131 ASP HB2  . 131 . HB2  1 1 
       3271 1 1 1 1 107 PHE QE   . 107 . HE*  1 1 
       3271 1 2 1 1 133 ARG HG2  . 133 . HG2  1 1 
       3272 1 1 1 1 107 PHE QE   . 107 . HE*  1 1 
       3272 1 2 1 1 133 ARG HG3  . 133 . HG1  1 1 
       3273 1 1 1 1 107 PHE QE   . 107 . HE*  1 1 
       3273 1 2 1 1 133 ARG HD2  . 133 . HD2  1 1 
       3274 1 1 1 1 107 PHE HZ   . 107 . HZ   1 1 
       3274 1 2 1 1 133 ARG HD2  . 133 . HD2  1 1 
       3275 1 1 1 1 133 ARG HD2  . 133 . HD2  1 1 
       3275 1 2 1 1 144 GLN HE22 . 144 . HE22 1 1 
       3276 1 1 1 1 107 PHE QE   . 107 . HE*  1 1 
       3276 1 2 1 1 133 ARG HD3  . 133 . HD1  1 1 
       3277 1 1 1 1 107 PHE HZ   . 107 . HZ   1 1 
       3277 1 2 1 1 133 ARG HD3  . 133 . HD1  1 1 
       3278 1 1 1 1 118 ARG HD3  . 118 . HD1  1 1 
       3278 1 2 1 1 134 THR HB   . 134 . HB   1 1 
       3279 1 1 1 1 118 ARG HD2  . 118 . HD2  1 1 
       3279 1 2 1 1 134 THR HB   . 134 . HB   1 1 
       3280 1 1 1 1 122 GLN HA   . 122 . HA   1 1 
       3280 1 2 1 1 134 THR MG   . 134 . HG2* 1 1 
       3281 1 1 1 1 110 TYR HB2  . 110 . HB2  1 1 
       3281 1 2 1 1 134 THR MG   . 134 . HG2* 1 1 
       3282 1 1 1 1 110 TYR HB2  . 110 . HB2  1 1 
       3282 1 2 1 1 134 THR HA   . 134 . HA   1 1 
       3283 1 1 1 1 110 TYR HB3  . 110 . HB1  1 1 
       3283 1 2 1 1 134 THR HA   . 134 . HA   1 1 
       3284 1 1 1 1 134 THR HB   . 134 . HB   1 1 
       3284 1 2 1 1 135 VAL HA   . 135 . HA   1 1 
       3285 1 1 1 1 133 ARG HA   . 133 . HA   1 1 
       3285 1 2 1 1 134 THR MG   . 134 . HG2* 1 1 
       3286 1 1 1 1 134 THR HA   . 134 . HA   1 1 
       3286 1 2 1 1 135 VAL MG1  . 135 . HG1* 1 1 
       3287 1 1 1 1 109 VAL MG1  . 109 . HG1* 1 1 
       3287 1 2 1 1 134 THR HA   . 134 . HA   1 1 
       3288 1 1 1 1 134 THR HB   . 134 . HB   1 1 
       3288 1 2 1 1 135 VAL MG1  . 135 . HG1* 1 1 
       3289 1 1 1 1 134 THR HB   . 134 . HB   1 1 
       3289 1 2 1 1 135 VAL MG2  . 135 . HG2* 1 1 
       3290 1 1 1 1 118 ARG HB2  . 118 . HB2  1 1 
       3290 1 2 1 1 134 THR HB   . 134 . HB   1 1 
       3291 1 1 1 1 118 ARG HB3  . 118 . HB1  1 1 
       3291 1 2 1 1 134 THR HB   . 134 . HB   1 1 
       3292 1 1 1 1 108 VAL MG1  . 108 . HG1* 1 1 
       3292 1 2 1 1 134 THR MG   . 134 . HG2* 1 1 
       3293 1 1 1 1 134 THR MG   . 134 . HG2* 1 1 
       3293 1 2 1 1 135 VAL MG1  . 135 . HG1* 1 1 
       3294 1 1 1 1 118 ARG HB2  . 118 . HB2  1 1 
       3294 1 2 1 1 134 THR MG   . 134 . HG2* 1 1 
       3295 1 1 1 1 132 VAL HB   . 132 . HB   1 1 
       3295 1 2 1 1 134 THR MG   . 134 . HG2* 1 1 
       3296 1 1 1 1 118 ARG HB3  . 118 . HB1  1 1 
       3296 1 2 1 1 134 THR MG   . 134 . HG2* 1 1 
       3297 1 1 1 1 122 GLN H    . 122 . HN   1 1 
       3297 1 2 1 1 134 THR MG   . 134 . HG2* 1 1 
       3298 1 1 1 1 132 VAL H    . 132 . HN   1 1 
       3298 1 2 1 1 134 THR MG   . 134 . HG2* 1 1 
       3299 1 1 1 1 135 VAL HB   . 135 . HB   1 1 
       3299 1 2 1 1 140 GLU H    . 140 . HN   1 1 
       3300 1 1 1 1 135 VAL MG1  . 135 . HG1* 1 1 
       3300 1 2 1 1 137 ASP H    . 137 . HN   1 1 
       3301 1 1 1 1 111 ASN H    . 111 . HN   1 1 
       3301 1 2 1 1 135 VAL MG2  . 135 . HG2* 1 1 
       3302 1 1 1 1 135 VAL MG2  . 135 . HG2* 1 1 
       3302 1 2 1 1 142 ILE H    . 142 . HN   1 1 
       3303 1 1 1 1 110 TYR H    . 110 . HN   1 1 
       3303 1 2 1 1 135 VAL MG2  . 135 . HG2* 1 1 
       3304 1 1 1 1 135 VAL MG2  . 135 . HG2* 1 1 
       3304 1 2 1 1 141 LEU HA   . 141 . HA   1 1 
       3305 1 1 1 1 111 ASN HA   . 111 . HA   1 1 
       3305 1 2 1 1 135 VAL MG2  . 135 . HG2* 1 1 
       3306 1 1 1 1 134 THR HA   . 134 . HA   1 1 
       3306 1 2 1 1 135 VAL MG2  . 135 . HG2* 1 1 
       3307 1 1 1 1 135 VAL MG1  . 135 . HG1* 1 1 
       3307 1 2 1 1 141 LEU HA   . 141 . HA   1 1 
       3308 1 1 1 1 135 VAL HB   . 135 . HB   1 1 
       3308 1 2 1 1 140 GLU HG2  . 140 . HG2  1 1 
       3309 1 1 1 1 135 VAL HB   . 135 . HB   1 1 
       3309 1 2 1 1 141 LEU HB2  . 141 . HB2  1 1 
       3310 1 1 1 1 135 VAL MG2  . 135 . HG2* 1 1 
       3310 1 2 1 1 141 LEU HB2  . 141 . HB2  1 1 
       3311 1 1 1 1 135 VAL MG1  . 135 . HG1* 1 1 
       3311 1 2 1 1 140 GLU HB2  . 140 . HB2  1 1 
       3312 1 1 1 1 135 VAL MG1  . 135 . HG1* 1 1 
       3312 1 2 1 1 141 LEU HB2  . 141 . HB2  1 1 
       3313 1 1 1 1 135 VAL MG1  . 135 . HG1* 1 1 
       3313 1 2 1 1 141 LEU HG   . 141 . HG   1 1 
       3314 1 1 1 1 135 VAL HA   . 135 . HA   1 1 
       3314 1 2 1 1 136 SER HB3  . 136 . HB1  1 1 
       3315 1 1 1 1 135 VAL HA   . 135 . HA   1 1 
       3315 1 2 1 1 136 SER HB2  . 136 . HB2  1 1 
       3316 1 1 1 1  14 ILE MD   .  14 . HD1* 1 1 
       3316 1 2 1 1 137 ASP HA   . 137 . HA   1 1 
       3317 1 1 1 1 137 ASP HB3  . 137 . HB1  1 1 
       3317 1 2 1 1 140 GLU HB2  . 140 . HB2  1 1 
       3318 1 1 1 1 137 ASP HB3  . 137 . HB1  1 1 
       3318 1 2 1 1 138 LYS HB3  . 138 . HB1  1 1 
       3319 1 1 1 1 135 VAL HB   . 135 . HB   1 1 
       3319 1 2 1 1 137 ASP HB2  . 137 . HB2  1 1 
       3320 1 1 1 1 137 ASP HB2  . 137 . HB2  1 1 
       3320 1 2 1 1 140 GLU HB3  . 140 . HB1  1 1 
       3321 1 1 1 1 137 ASP HB2  . 137 . HB2  1 1 
       3321 1 2 1 1 140 GLU HB2  . 140 . HB2  1 1 
       3322 1 1 1 1 137 ASP HB2  . 137 . HB2  1 1 
       3322 1 2 1 1 138 LYS HB3  . 138 . HB1  1 1 
       3323 1 1 1 1 135 VAL MG1  . 135 . HG1* 1 1 
       3323 1 2 1 1 137 ASP HB2  . 137 . HB2  1 1 
       3324 1 1 1 1 139 GLU HA   . 139 . HA   1 1 
       3324 1 2 1 1 142 ILE MD   . 142 . HD1* 1 1 
       3325 1 1 1 1 135 VAL MG1  . 135 . HG1* 1 1 
       3325 1 2 1 1 140 GLU HG3  . 140 . HG1  1 1 
       3326 1 1 1 1 135 VAL MG1  . 135 . HG1* 1 1 
       3326 1 2 1 1 140 GLU HA   . 140 . HA   1 1 
       3327 1 1 1 1 135 VAL MG2  . 135 . HG2* 1 1 
       3327 1 2 1 1 140 GLU HB2  . 140 . HB2  1 1 
       3328 1 1 1 1 135 VAL MG2  . 135 . HG2* 1 1 
       3328 1 2 1 1 140 GLU HB3  . 140 . HB1  1 1 
       3329 1 1 1 1 135 VAL MG1  . 135 . HG1* 1 1 
       3329 1 2 1 1 140 GLU HG2  . 140 . HG2  1 1 
       3330 1 1 1 1 135 VAL MG2  . 135 . HG2* 1 1 
       3330 1 2 1 1 140 GLU HG2  . 140 . HG2  1 1 
       3331 1 1 1 1 137 ASP H    . 137 . HN   1 1 
       3331 1 2 1 1 140 GLU HB3  . 140 . HB1  1 1 
       3332 1 1 1 1 111 ASN HD21 . 111 . HD21 1 1 
       3332 1 2 1 1 141 LEU MD2  . 141 . HD2* 1 1 
       3333 1 1 1 1 143 GLU HA   . 143 . HA   1 1 
       3333 1 2 1 1 146 ARG HG3  . 146 . HG1  1 1 
       3334 1 1 1 1 141 LEU MD2  . 141 . HD2* 1 1 
       3334 1 2 1 1 142 ILE HA   . 142 . HA   1 1 
       3335 1 1 1 1 141 LEU HG   . 141 . HG   1 1 
       3335 1 2 1 1 142 ILE HA   . 142 . HA   1 1 
       3336 1 1 1 1  93 LYS HA   .  93 . HA   1 1 
       3336 1 2 1 1  96 ILE MD   .  96 . HD1* 1 1 
       3337 1 1 1 1 141 LEU HA   . 141 . HA   1 1 
       3337 1 2 1 1 145 VAL MG2  . 145 . HG2* 1 1 
       3338 1 1 1 1 141 LEU HB3  . 141 . HB1  1 1 
       3338 1 2 1 1 142 ILE MD   . 142 . HD1* 1 1 
       3339 1 1 1 1 109 VAL MG1  . 109 . HG1* 1 1 
       3339 1 2 1 1 141 LEU HG   . 141 . HG   1 1 
       3340 1 1 1 1 135 VAL MG2  . 135 . HG2* 1 1 
       3340 1 2 1 1 141 LEU HG   . 141 . HG   1 1 
       3341 1 1 1 1 142 ILE MG   . 142 . HG2* 1 1 
       3341 1 2 1 1 144 GLN H    . 144 . HN   1 1 
       3342 1 1 1 1 141 LEU H    . 141 . HN   1 1 
       3342 1 2 1 1 142 ILE HG12 . 142 . HG12 1 1 
       3343 1 1 1 1 142 ILE MD   . 142 . HD1* 1 1 
       3343 1 2 1 1 145 VAL H    . 145 . HN   1 1 
       3344 1 1 1 1 139 GLU HA   . 139 . HA   1 1 
       3344 1 2 1 1 142 ILE MG   . 142 . HG2* 1 1 
       3345 1 1 1 1 142 ILE MG   . 142 . HG2* 1 1 
       3345 1 2 1 1 143 GLU HA   . 143 . HA   1 1 
       3346 1 1 1 1 142 ILE HB   . 142 . HB   1 1 
       3346 1 2 1 1 143 GLU HA   . 143 . HA   1 1 
       3347 1 1 1 1  18 ILE HA   .  18 . HA   1 1 
       3347 1 2 1 1 142 ILE HG13 . 142 . HG11 1 1 
       3348 1 1 1 1 139 GLU HA   . 139 . HA   1 1 
       3348 1 2 1 1 142 ILE HG13 . 142 . HG11 1 1 
       3349 1 1 1 1 138 LYS HA   . 138 . HA   1 1 
       3349 1 2 1 1 142 ILE HG12 . 142 . HG12 1 1 
       3350 1 1 1 1 139 GLU HA   . 139 . HA   1 1 
       3350 1 2 1 1 142 ILE HG12 . 142 . HG12 1 1 
       3351 1 1 1 1 142 ILE MG   . 142 . HG2* 1 1 
       3351 1 2 1 1 146 ARG HD2  . 146 . HD2  1 1 
       3352 1 1 1 1 142 ILE HA   . 142 . HA   1 1 
       3352 1 2 1 1 146 ARG HG3  . 146 . HG1  1 1 
       3353 1 1 1 1 142 ILE HB   . 142 . HB   1 1 
       3353 1 2 1 1 146 ARG HG2  . 146 . HG2  1 1 
       3354 1 1 1 1 142 ILE HB   . 142 . HB   1 1 
       3354 1 2 1 1 145 VAL MG2  . 145 . HG2* 1 1 
       3355 1 1 1 1 138 LYS HG2  . 138 . HG2  1 1 
       3355 1 2 1 1 142 ILE MD   . 142 . HD1* 1 1 
       3356 1 1 1 1 138 LYS HG3  . 138 . HG1  1 1 
       3356 1 2 1 1 142 ILE MD   . 142 . HD1* 1 1 
       3357 1 1 1 1  17 GLU HG2  .  17 . HG2  1 1 
       3357 1 2 1 1 142 ILE MD   . 142 . HD1* 1 1 
       3358 1 1 1 1 142 ILE MD   . 142 . HD1* 1 1 
       3358 1 2 1 1 145 VAL HB   . 145 . HB   1 1 
       3359 1 1 1 1 139 GLU HG2  . 139 . HG2  1 1 
       3359 1 2 1 1 142 ILE HG12 . 142 . HG12 1 1 
       3360 1 1 1 1 139 GLU HG3  . 139 . HG1  1 1 
       3360 1 2 1 1 142 ILE HG12 . 142 . HG12 1 1 
       3361 1 1 1 1 143 GLU HA   . 143 . HA   1 1 
       3361 1 2 1 1 146 ARG HD2  . 146 . HD2  1 1 
       3362 1 1 1 1 143 GLU HA   . 143 . HA   1 1 
       3362 1 2 1 1 146 ARG HD3  . 146 . HD1  1 1 
       3363 1 1 1 1   5 PHE QE   .   5 . HE*  1 1 
       3363 1 2 1 1 144 GLN HA   . 144 . HA   1 1 
       3364 1 1 1 1   5 PHE HZ   .   5 . HZ   1 1 
       3364 1 2 1 1 144 GLN HA   . 144 . HA   1 1 
       3365 1 1 1 1 141 LEU HA   . 141 . HA   1 1 
       3365 1 2 1 1 144 GLN HG3  . 144 . HG1  1 1 
       3366 1 1 1 1 141 LEU HA   . 141 . HA   1 1 
       3366 1 2 1 1 144 GLN HG2  . 144 . HG2  1 1 
       3367 1 1 1 1 144 GLN HA   . 144 . HA   1 1 
       3367 1 2 1 1 147 ARG HD2  . 147 . HD2  1 1 
       3368 1 1 1 1 144 GLN HA   . 144 . HA   1 1 
       3368 1 2 1 1 147 ARG HD3  . 147 . HD1  1 1 
       3369 1 1 1 1 109 VAL MG2  . 109 . HG2* 1 1 
       3369 1 2 1 1 144 GLN HA   . 144 . HA   1 1 
       3370 1 1 1 1 144 GLN HA   . 144 . HA   1 1 
       3370 1 2 1 1 145 VAL MG2  . 145 . HG2* 1 1 
       3371 1 1 1 1 141 LEU MD2  . 141 . HD2* 1 1 
       3371 1 2 1 1 144 GLN HA   . 144 . HA   1 1 
       3372 1 1 1 1 144 GLN HB2  . 144 . HB2  1 1 
       3372 1 2 1 1 145 VAL MG2  . 145 . HG2* 1 1 
       3373 1 1 1 1 135 VAL MG1  . 135 . HG1* 1 1 
       3373 1 2 1 1 144 GLN HG3  . 144 . HG1  1 1 
       3374 1 1 1 1 135 VAL MG1  . 135 . HG1* 1 1 
       3374 1 2 1 1 144 GLN HG2  . 144 . HG2  1 1 
       3375 1 1 1 1  18 ILE MG   .  18 . HG2* 1 1 
       3375 1 2 1 1 145 VAL HA   . 145 . HA   1 1 
       3376 1 1 1 1  18 ILE MG   .  18 . HG2* 1 1 
       3376 1 2 1 1 145 VAL HB   . 145 . HB   1 1 
       3377 1 1 1 1  45 LEU HB2  .  45 . HB2  1 1 
       3377 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       3378 1 1 1 1 142 ILE HA   . 142 . HA   1 1 
       3378 1 2 1 1 145 VAL MG1  . 145 . HG1* 1 1 
       3379 1 1 1 1   5 PHE QD   .   5 . HD*  1 1 
       3379 1 2 1 1 145 VAL HA   . 145 . HA   1 1 
       3380 1 1 1 1   5 PHE HZ   .   5 . HZ   1 1 
       3380 1 2 1 1 145 VAL MG1  . 145 . HG1* 1 1 
       3381 1 1 1 1 145 VAL MG1  . 145 . HG1* 1 1 
       3381 1 2 1 1 148 PHE QD   . 148 . HD*  1 1 
       3382 1 1 1 1 146 ARG HA   . 146 . HA   1 1 
       3382 1 2 1 1 149 VAL MG2  . 149 . HG2* 1 1 
       3383 1 1 1 1 145 VAL MG1  . 145 . HG1* 1 1 
       3383 1 2 1 1 146 ARG HA   . 146 . HA   1 1 
       3384 1 1 1 1  22 ILE HA   .  22 . HA   1 1 
       3384 1 2 1 1 149 VAL MG2  . 149 . HG2* 1 1 
       3385 1 1 1 1 146 ARG HA   . 146 . HA   1 1 
       3385 1 2 1 1 149 VAL MG1  . 149 . HG1* 1 1 
       3386 1 1 1 1  25 GLN HB3  .  25 . HB1  1 1 
       3386 1 2 1 1 149 VAL MG1  . 149 . HG1* 1 1 
       3387 1 1 1 1  25 GLN HG3  .  25 . HG1  1 1 
       3387 1 2 1 1 149 VAL MG1  . 149 . HG1* 1 1 
       3388 1 1 1 1 145 VAL HA   . 145 . HA   1 1 
       3388 1 2 1 1 149 VAL MG2  . 149 . HG2* 1 1 
       3389 1 1 1 1  25 GLN HB3  .  25 . HB1  1 1 
       3389 1 2 1 1 149 VAL MG2  . 149 . HG2* 1 1 
       3390 1 1 1 1  27 VAL HB   .  27 . HB   1 1 
       3390 1 2 1 1 149 VAL MG2  . 149 . HG2* 1 1 
       3391 1 1 1 1 146 ARG HB3  . 146 . HB1  1 1 
       3391 1 2 1 1 149 VAL MG2  . 149 . HG2* 1 1 
       3392 1 1 1 1 148 PHE QE   . 148 . HE*  1 1 
       3392 1 2 1 1 149 VAL HA   . 149 . HA   1 1 
       3393 1 1 1 1 148 PHE QD   . 148 . HD*  1 1 
       3393 1 2 1 1 149 VAL HA   . 149 . HA   1 1 
       3394 1 1 1 1 148 PHE QE   . 148 . HE*  1 1 
       3394 1 2 1 1 149 VAL MG2  . 149 . HG2* 1 1 
       3395 1 1 1 1 148 PHE QD   . 148 . HD*  1 1 
       3395 1 2 1 1 149 VAL MG2  . 149 . HG2* 1 1 
       3396 1 1 1 1  81 VAL MG2  .  81 . HG2* 1 1 
       3396 1 2 1 1 148 PHE QE   . 148 . HE*  1 1 
       3397 1 1 1 1  25 GLN HE21 .  25 . HE21 1 1 
       3397 1 2 1 1 149 VAL MG2  . 149 . HG2* 1 1 
       3398 1 1 1 1 149 VAL MG1  . 149 . HG1* 1 1 
       3398 1 2 1 1 150 ARG HA   . 150 . HA   1 1 
       3399 1 1 1 1 150 ARG HA   . 150 . HA   1 1 
       3399 1 2 1 1 152 VAL MG2  . 152 . HG2* 1 1 
       3400 1 1 1 1 151 LYS HA   . 151 . HA   1 1 
       3400 1 2 1 1 152 VAL MG1  . 152 . HG1* 1 1 
       3401 1 1 1 1 151 LYS HA   . 151 . HA   1 1 
       3401 1 2 1 1 152 VAL MG2  . 152 . HG2* 1 1 
       3402 1 1 1 1 149 VAL HA   . 149 . HA   1 1 
       3402 1 2 1 1 152 VAL HA   . 152 . HA   1 1 
       3403 1 1 1 1 148 PHE QD   . 148 . HD*  1 1 
       3403 1 2 1 1 152 VAL HA   . 152 . HA   1 1 
       3404 1 1 1 1 109 VAL MG1  . 109 . HG1* 1 1 
       3404 1 2 1 1 144 GLN H    . 144 . HN   1 1 
       3405 1 1 1 1 154 SER HA   . 154 . HA   1 1 
       3405 1 2 1 1 155 LEU HG   . 155 . HG   1 1 
       3406 1 1 1 1 122 GLN HA   . 122 . HA   1 1 
       3406 1 2 1 1 132 VAL HB   . 132 . HB   1 1 
       3407 1 1 1 1 110 TYR H    . 110 . HN   1 1 
       3407 1 2 1 1 134 THR HA   . 134 . HA   1 1 
       3408 1 1 1 1 111 ASN HA   . 111 . HA   1 1 
       3408 1 2 1 1 135 VAL MG1  . 135 . HG1* 1 1 
       3409 1 1 1 1 135 VAL MG1  . 135 . HG1* 1 1 
       3409 1 2 1 1 140 GLU H    . 140 . HN   1 1 
       3410 1 1 1 1 111 ASN HD22 . 111 . HD22 1 1 
       3410 1 2 1 1 135 VAL MG2  . 135 . HG2* 1 1 
       3411 1 1 1 1 111 ASN HD21 . 111 . HD21 1 1 
       3411 1 2 1 1 135 VAL MG1  . 135 . HG1* 1 1 
       3412 1 1 1 1 111 ASN HA   . 111 . HA   1 1 
       3412 1 2 1 1 135 VAL HB   . 135 . HB   1 1 
       3413 1 1 1 1 109 VAL HA   . 109 . HA   1 1 
       3413 1 2 1 1 133 ARG HB2  . 133 . HB2  1 1 
       3414 1 1 1 1 109 VAL HA   . 109 . HA   1 1 
       3414 1 2 1 1 133 ARG HG2  . 133 . HG2  1 1 
       3415 1 1 1 1 109 VAL HA   . 109 . HA   1 1 
       3415 1 2 1 1 133 ARG HG3  . 133 . HG1  1 1 
       3416 1 1 1 1 109 VAL MG2  . 109 . HG2* 1 1 
       3416 1 2 1 1 133 ARG HD2  . 133 . HD2  1 1 
       3417 1 1 1 1 109 VAL MG2  . 109 . HG2* 1 1 
       3417 1 2 1 1 133 ARG HD3  . 133 . HD1  1 1 
       3418 1 1 1 1 109 VAL MG1  . 109 . HG1* 1 1 
       3418 1 2 1 1 133 ARG HD3  . 133 . HD1  1 1 
       3419 1 1 1 1 109 VAL MG2  . 109 . HG2* 1 1 
       3419 1 2 1 1 133 ARG HG3  . 133 . HG1  1 1 
       3420 1 1 1 1   7 VAL HA   .   7 . HA   1 1 
       3420 1 2 1 1 109 VAL HB   . 109 . HB   1 1 
       3421 1 1 1 1   7 VAL HA   .   7 . HA   1 1 
       3421 1 2 1 1 109 VAL MG2  . 109 . HG2* 1 1 
       3422 1 1 1 1   7 VAL HA   .   7 . HA   1 1 
       3422 1 2 1 1 109 VAL HA   . 109 . HA   1 1 
       3423 1 1 1 1 107 PHE HA   . 107 . HA   1 1 
       3423 1 2 1 1 130 VAL HA   . 130 . HA   1 1 
       3424 1 1 1 1 107 PHE HA   . 107 . HA   1 1 
       3424 1 2 1 1 132 VAL HA   . 132 . HA   1 1 
       3425 1 1 1 1 107 PHE HA   . 107 . HA   1 1 
       3425 1 2 1 1 131 ASP HB3  . 131 . HB1  1 1 
       3426 1 1 1 1 107 PHE HB3  . 107 . HB1  1 1 
       3426 1 2 1 1 131 ASP HB3  . 131 . HB1  1 1 
       3427 1 1 1 1 109 VAL MG2  . 109 . HG2* 1 1 
       3427 1 2 1 1 131 ASP HB3  . 131 . HB1  1 1 
       3428 1 1 1 1 107 PHE QE   . 107 . HE*  1 1 
       3428 1 2 1 1 145 VAL HA   . 145 . HA   1 1 
       3429 1 1 1 1  22 ILE MG   .  22 . HG2* 1 1 
       3429 1 2 1 1  25 GLN HG3  .  25 . HG1  1 1 
       3430 1 1 1 1   4 ILE HB   .   4 . HB   1 1 
       3430 1 2 1 1 106 VAL HA   . 106 . HA   1 1 
       3431 1 1 1 1   6 VAL HB   .   6 . HB   1 1 
       3431 1 2 1 1 108 VAL HA   . 108 . HA   1 1 
       3432 1 1 1 1  32 LEU HB3  .  32 . HB1  1 1 
       3432 1 2 1 1  84 VAL HA   .  84 . HA   1 1 
       3433 1 1 1 1   6 VAL MG1  .   6 . HG1* 1 1 
       3433 1 2 1 1 108 VAL HB   . 108 . HB   1 1 
       3434 1 1 1 1   6 VAL MG2  .   6 . HG2* 1 1 
       3434 1 2 1 1  84 VAL HA   .  84 . HA   1 1 
       3435 1 1 1 1   6 VAL MG2  .   6 . HG2* 1 1 
       3435 1 2 1 1 108 VAL HA   . 108 . HA   1 1 
       3436 1 1 1 1   5 PHE HA   .   5 . HA   1 1 
       3436 1 2 1 1   6 VAL HB   .   6 . HB   1 1 
       3437 1 1 1 1   8 PHE HA   .   8 . HA   1 1 
       3437 1 2 1 1 110 TYR HA   . 110 . HA   1 1 
       3438 1 1 1 1   8 PHE HB2  .   8 . HB2  1 1 
       3438 1 2 1 1 110 TYR HA   . 110 . HA   1 1 
       3439 1 1 1 1 108 VAL MG1  . 108 . HG1* 1 1 
       3439 1 2 1 1 110 TYR HA   . 110 . HA   1 1 
       3440 1 1 1 1  18 ILE HA   .  18 . HA   1 1 
       3440 1 2 1 1 145 VAL HB   . 145 . HB   1 1 
       3441 1 1 1 1 145 VAL HB   . 145 . HB   1 1 
       3441 1 2 1 1 146 ARG HA   . 146 . HA   1 1 
       3442 1 1 1 1 109 VAL MG1  . 109 . HG1* 1 1 
       3442 1 2 1 1 144 GLN HG3  . 144 . HG1  1 1 
       3443 1 1 1 1 109 VAL MG1  . 109 . HG1* 1 1 
       3443 1 2 1 1 144 GLN HB2  . 144 . HB2  1 1 
       3444 1 1 1 1 109 VAL MG1  . 109 . HG1* 1 1 
       3444 1 2 1 1 144 GLN HB3  . 144 . HB1  1 1 
       3445 1 1 1 1 109 VAL MG1  . 109 . HG1* 1 1 
       3445 1 2 1 1 133 ARG HD2  . 133 . HD2  1 1 
       3446 1 1 1 1 152 VAL MG2  . 152 . HG2* 1 1 
       3446 1 2 1 1 153 GLY HA2  . 153 . HA2  1 1 
       3447 1 1 1 1 152 VAL MG2  . 152 . HG2* 1 1 
       3447 1 2 1 1 153 GLY HA3  . 153 . HA1  1 1 
       3448 1 1 1 1 148 PHE HZ   . 148 . HZ   1 1 
       3448 1 2 1 1 152 VAL HB   . 152 . HB   1 1 
       3449 1 1 1 1  72 TRP HH2  .  72 . HH2  1 1 
       3449 1 2 1 1 106 VAL MG2  . 106 . HG2* 1 1 
       3450 1 1 1 1 148 PHE QD   . 148 . HD*  1 1 
       3450 1 2 1 1 152 VAL MG2  . 152 . HG2* 1 1 
       3451 1 1 1 1 148 PHE QE   . 148 . HE*  1 1 
       3451 1 2 1 1 152 VAL MG2  . 152 . HG2* 1 1 
       3452 1 1 1 1  82 VAL MG2  .  82 . HG2* 1 1 
       3452 1 2 1 1  95 PHE QE   .  95 . HE*  1 1 
       3453 1 1 1 1  95 PHE QE   .  95 . HE*  1 1 
       3453 1 2 1 1 106 VAL MG2  . 106 . HG2* 1 1 
       3454 1 1 1 1 151 LYS HA   . 151 . HA   1 1 
       3454 1 2 1 1 151 LYS HE2  . 151 . HE2  1 1 
       3455 1 1 1 1 151 LYS HA   . 151 . HA   1 1 
       3455 1 2 1 1 151 LYS HE3  . 151 . HE1  1 1 
       3456 1 1 1 1 106 VAL HA   . 106 . HA   1 1 
       3456 1 2 1 1 107 PHE HB2  . 107 . HB2  1 1 
       3457 1 1 1 1   5 PHE HA   .   5 . HA   1 1 
       3457 1 2 1 1 108 VAL HA   . 108 . HA   1 1 
       3458 1 1 1 1   4 ILE HB   .   4 . HB   1 1 
       3458 1 2 1 1   5 PHE HA   .   5 . HA   1 1 
       3459 1 1 1 1   5 PHE HA   .   5 . HA   1 1 
       3459 1 2 1 1  82 VAL HB   .  82 . HB   1 1 
       3460 1 1 1 1   5 PHE HA   .   5 . HA   1 1 
       3460 1 2 1 1  81 VAL MG1  .  81 . HG1* 1 1 
       3461 1 1 1 1   5 PHE HA   .   5 . HA   1 1 
       3461 1 2 1 1  82 VAL MG2  .  82 . HG2* 1 1 
       3462 1 1 1 1   5 PHE QE   .   5 . HE*  1 1 
       3462 1 2 1 1 144 GLN HB2  . 144 . HB2  1 1 
       3463 1 1 1 1   5 PHE QE   .   5 . HE*  1 1 
       3463 1 2 1 1  81 VAL HB   .  81 . HB   1 1 
       3464 1 1 1 1  15 LEU HB2  .  15 . HB2  1 1 
       3464 1 2 1 1  33 TYR QE   .  33 . HE*  1 1 
       3465 1 1 1 1  31 LEU HB3  .  31 . HB1  1 1 
       3465 1 2 1 1  33 TYR QE   .  33 . HE*  1 1 
       3466 1 1 1 1  31 LEU HG   .  31 . HG   1 1 
       3466 1 2 1 1  33 TYR QE   .  33 . HE*  1 1 
       3467 1 1 1 1  33 TYR QE   .  33 . HE*  1 1 
       3467 1 2 1 1  57 THR MG   .  57 . HG2* 1 1 
       3468 1 1 1 1  33 TYR QD   .  33 . HD*  1 1 
       3468 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       3469 1 1 1 1 106 VAL MG1  . 106 . HG1* 1 1 
       3469 1 2 1 1 107 PHE QD   . 107 . HD*  1 1 
       3470 1 1 1 1  33 TYR HB2  .  33 . HB2  1 1 
       3470 1 2 1 1  45 LEU MD1  .  45 . HD1* 1 1 
       3471 1 1 1 1  62 GLU HA   .  62 . HA   1 1 
       3471 1 2 1 1  64 PHE QD   .  64 . HD*  1 1 
       3472 1 1 1 1  72 TRP HH2  .  72 . HH2  1 1 
       3472 1 2 1 1 104 VAL MG1  . 104 . HG1* 1 1 
       3473 1 1 1 1  75 TYR HA   .  75 . HA   1 1 
       3473 1 2 1 1  75 TYR QE   .  75 . HE*  1 1 
       3474 1 1 1 1  30 VAL MG2  .  30 . HG2* 1 1 
       3474 1 2 1 1  75 TYR QD   .  75 . HD*  1 1 
       3475 1 1 1 1  71 ILE HG13 .  71 . HG11 1 1 
       3475 1 2 1 1  75 TYR QE   .  75 . HE*  1 1 
       3476 1 1 1 1  71 ILE HG12 .  71 . HG12 1 1 
       3476 1 2 1 1  75 TYR QE   .  75 . HE*  1 1 
       3477 1 1 1 1  95 PHE HB2  .  95 . HB2  1 1 
       3477 1 2 1 1  96 ILE HG13 .  96 . HG11 1 1 
       3478 1 1 1 1  68 ILE HG13 .  68 . HG11 1 1 
       3478 1 2 1 1  95 PHE HB2  .  95 . HB2  1 1 
       3479 1 1 1 1  95 PHE HB2  .  95 . HB2  1 1 
       3479 1 2 1 1  96 ILE HG12 .  96 . HG12 1 1 
       3480 1 1 1 1  95 PHE HB2  .  95 . HB2  1 1 
       3480 1 2 1 1 106 VAL MG1  . 106 . HG1* 1 1 
       3481 1 1 1 1  95 PHE QD   .  95 . HD*  1 1 
       3481 1 2 1 1 108 VAL MG1  . 108 . HG1* 1 1 
       3482 1 1 1 1  95 PHE HB3  .  95 . HB1  1 1 
       3482 1 2 1 1  96 ILE HG12 .  96 . HG12 1 1 
       3483 1 1 1 1  95 PHE HB3  .  95 . HB1  1 1 
       3483 1 2 1 1 106 VAL MG1  . 106 . HG1* 1 1 
       3484 1 1 1 1   5 PHE QE   .   5 . HE*  1 1 
       3484 1 2 1 1 107 PHE HB3  . 107 . HB1  1 1 
       3485 1 1 1 1 106 VAL HA   . 106 . HA   1 1 
       3485 1 2 1 1 107 PHE HB3  . 107 . HB1  1 1 
       3486 1 1 1 1  92 ILE MD   .  92 . HD1* 1 1 
       3486 1 2 1 1 110 TYR HB3  . 110 . HB1  1 1 
       3487 1 1 1 1 140 GLU H    . 140 . HN   1 1 
       3487 1 2 1 1 141 LEU HB3  . 141 . HB1  1 1 
       3488 1 1 1 1 140 GLU H    . 140 . HN   1 1 
       3488 1 2 1 1 141 LEU HB2  . 141 . HB2  1 1 
       3489 1 1 1 1 141 LEU HA   . 141 . HA   1 1 
       3489 1 2 1 1 142 ILE HA   . 142 . HA   1 1 
       3490 1 1 1 1  22 ILE HA   .  22 . HA   1 1 
       3490 1 2 1 1  81 VAL MG2  .  81 . HG2* 1 1 
       3491 1 1 1 1 149 VAL MG2  . 149 . HG2* 1 1 
       3491 1 2 1 1 150 ARG HA   . 150 . HA   1 1 
       3492 1 1 1 1 149 VAL HB   . 149 . HB   1 1 
       3492 1 2 1 1 150 ARG HA   . 150 . HA   1 1 
       3493 1 1 1 1 148 PHE HA   . 148 . HA   1 1 
       3493 1 2 1 1 149 VAL HA   . 149 . HA   1 1 
       3494 1 1 1 1 149 VAL HA   . 149 . HA   1 1 
       3494 1 2 1 1 150 ARG HA   . 150 . HA   1 1 
       3495 1 1 1 1 149 VAL HA   . 149 . HA   1 1 
       3495 1 2 1 1 152 VAL MG2  . 152 . HG2* 1 1 
       3496 1 1 1 1  54 ASP HA   .  54 . HA   1 1 
       3496 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       3497 1 1 1 1 106 VAL MG1  . 106 . HG1* 1 1 
       3497 1 2 1 1 130 VAL HA   . 130 . HA   1 1 
       3498 1 1 1 1 130 VAL HA   . 130 . HA   1 1 
       3498 1 2 1 1 130 VAL MG2  . 130 . HG2* 1 1 
       3499 1 1 1 1  89 LYS HG2  .  89 . HG2  1 1 
       3499 1 2 1 1 125 PHE QE   . 125 . HE*  1 1 
       3500 1 1 1 1  96 ILE MG   .  96 . HG2* 1 1 
       3500 1 2 1 1 100 LYS HE2  . 100 . HE2  1 1 
       3501 1 1 1 1  96 ILE MG   .  96 . HG2* 1 1 
       3501 1 2 1 1 100 LYS HE3  . 100 . HE1  1 1 
       3502 1 1 1 1 102 ARG HB3  . 102 . HB1  1 1 
       3502 1 2 1 1 104 VAL MG1  . 104 . HG1* 1 1 
       3503 1 1 1 1 130 VAL HA   . 130 . HA   1 1 
       3503 1 2 1 1 130 VAL MG1  . 130 . HG1* 1 1 
       3504 1 1 1 1 108 VAL HB   . 108 . HB   1 1 
       3504 1 2 1 1 132 VAL HA   . 132 . HA   1 1 
       3505 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
       3505 1 2 1 1 138 LYS HA   . 138 . HA   1 1 
       3506 1 1 1 1  89 LYS HB2  .  89 . HB2  1 1 
       3506 1 2 1 1  92 ILE MD   .  92 . HD1* 1 1 
       3507 1 1 1 1  89 LYS HB3  .  89 . HB1  1 1 
       3507 1 2 1 1  92 ILE MD   .  92 . HD1* 1 1 
       3508 1 1 1 1  89 LYS HG2  .  89 . HG2  1 1 
       3508 1 2 1 1  92 ILE MD   .  92 . HD1* 1 1 
       3509 1 1 1 1  21 GLU HG3  .  21 . HG1  1 1 
       3509 1 2 1 1 142 ILE MD   . 142 . HD1* 1 1 
       3510 1 1 1 1  21 GLU HG2  .  21 . HG2  1 1 
       3510 1 2 1 1 142 ILE MD   . 142 . HD1* 1 1 
       3511 1 1 1 1  15 LEU HA   .  15 . HA   1 1 
       3511 1 2 1 1  18 ILE HG12 .  18 . HG12 1 1 
       3512 1 1 1 1  15 LEU HB3  .  15 . HB1  1 1 
       3512 1 2 1 1  18 ILE MD   .  18 . HD1* 1 1 
       3513 1 1 1 1   7 VAL HB   .   7 . HB   1 1 
       3513 1 2 1 1  18 ILE MD   .  18 . HD1* 1 1 
       3514 1 1 1 1  22 ILE HG13 .  22 . HG11 1 1 
       3514 1 2 1 1  23 LYS H    .  23 . HN   1 1 
       3515 1 1 1 1 135 VAL MG2  . 135 . HG2* 1 1 
       3515 1 2 1 1 141 LEU HB3  . 141 . HB1  1 1 
       3516 1 1 1 1  22 ILE HB   .  22 . HB   1 1 
       3516 1 2 1 1  29 VAL HB   .  29 . HB   1 1 
       3517 1 1 1 1  22 ILE MD   .  22 . HD1* 1 1 
       3517 1 2 1 1  29 VAL HB   .  29 . HB   1 1 
       3518 1 1 1 1  27 VAL HB   .  27 . HB   1 1 
       3518 1 2 1 1  80 VAL HA   .  80 . HA   1 1 
       3519 1 1 1 1  27 VAL MG1  .  27 . HG1* 1 1 
       3519 1 2 1 1  80 VAL HA   .  80 . HA   1 1 
       3520 1 1 1 1  28 ARG HD3  .  28 . HD1  1 1 
       3520 1 2 1 1  75 TYR QD   .  75 . HD*  1 1 
       3521 1 1 1 1  28 ARG HD2  .  28 . HD2  1 1 
       3521 1 2 1 1  75 TYR QD   .  75 . HD*  1 1 
       3522 1 1 1 1  29 VAL HB   .  29 . HB   1 1 
       3522 1 2 1 1  53 VAL HA   .  53 . HA   1 1 
       3523 1 1 1 1  22 ILE HB   .  22 . HB   1 1 
       3523 1 2 1 1  29 VAL MG1  .  29 . HG1* 1 1 
       3524 1 1 1 1  22 ILE HB   .  22 . HB   1 1 
       3524 1 2 1 1  29 VAL MG2  .  29 . HG2* 1 1 
       3525 1 1 1 1  30 VAL HB   .  30 . HB   1 1 
       3525 1 2 1 1  82 VAL HA   .  82 . HA   1 1 
       3526 1 1 1 1  23 LYS HG2  .  23 . HG2  1 1 
       3526 1 2 1 1  29 VAL MG1  .  29 . HG1* 1 1 
       3527 1 1 1 1  30 VAL MG1  .  30 . HG1* 1 1 
       3527 1 2 1 1  32 LEU HG   .  32 . HG   1 1 
       3528 1 1 1 1  30 VAL MG2  .  30 . HG2* 1 1 
       3528 1 2 1 1  80 VAL HB   .  80 . HB   1 1 
       3529 1 1 1 1  35 ASP HB3  .  35 . HB1  1 1 
       3529 1 2 1 1  41 ARG HB2  .  41 . HB2  1 1 
       3530 1 1 1 1  41 ARG HD2  .  41 . HD2  1 1 
       3530 1 2 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       3531 1 1 1 1  41 ARG HD3  .  41 . HD1  1 1 
       3531 1 2 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       3532 1 1 1 1  41 ARG HB3  .  41 . HB1  1 1 
       3532 1 2 1 1  45 LEU MD1  .  45 . HD1* 1 1 
       3533 1 1 1 1  44 ARG HA   .  44 . HA   1 1 
       3533 1 2 1 1  47 GLU HG3  .  47 . HG1  1 1 
       3534 1 1 1 1  49 GLU HA   .  49 . HA   1 1 
       3534 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       3535 1 1 1 1  30 VAL HA   .  30 . HA   1 1 
       3535 1 2 1 1  54 ASP HB2  .  54 . HB2  1 1 
       3536 1 1 1 1  30 VAL HA   .  30 . HA   1 1 
       3536 1 2 1 1  54 ASP HB3  .  54 . HB1  1 1 
       3537 1 1 1 1  34 SER HA   .  34 . HA   1 1 
       3537 1 2 1 1  58 VAL HB   .  58 . HB   1 1 
       3538 1 1 1 1  58 VAL HB   .  58 . HB   1 1 
       3538 1 2 1 1  60 ASP HA   .  60 . HA   1 1 
       3539 1 1 1 1   6 VAL HA   .   6 . HA   1 1 
       3539 1 2 1 1  82 VAL H    .  82 . HN   1 1 
       3540 1 1 1 1   6 VAL HB   .   6 . HB   1 1 
       3540 1 2 1 1 107 PHE H    . 107 . HN   1 1 
       3541 1 1 1 1   6 VAL HB   .   6 . HB   1 1 
       3541 1 2 1 1   8 PHE QE   .   8 . HE*  1 1 
       3542 1 1 1 1   6 VAL MG1  .   6 . HG1* 1 1 
       3542 1 2 1 1  84 VAL H    .  84 . HN   1 1 
       3543 1 1 1 1   6 VAL MG2  .   6 . HG2* 1 1 
       3543 1 2 1 1  83 ILE H    .  83 . HN   1 1 
       3544 1 1 1 1   6 VAL MG2  .   6 . HG2* 1 1 
       3544 1 2 1 1  82 VAL H    .  82 . HN   1 1 
       3545 1 1 1 1   6 VAL MG2  .   6 . HG2* 1 1 
       3545 1 2 1 1  95 PHE QE   .  95 . HE*  1 1 
       3546 1 1 1 1   6 VAL MG1  .   6 . HG1* 1 1 
       3546 1 2 1 1  95 PHE QD   .  95 . HD*  1 1 
       3547 1 1 1 1   6 VAL MG1  .   6 . HG1* 1 1 
       3547 1 2 1 1  95 PHE QE   .  95 . HE*  1 1 
       3548 1 1 1 1  61 LYS HB2  .  61 . HB2  1 1 
       3548 1 2 1 1  91 TRP HE1  .  91 . HE1  1 1 
       3549 1 1 1 1  64 PHE HA   .  64 . HA   1 1 
       3549 1 2 1 1  67 ASN HD21 .  67 . HD21 1 1 
       3550 1 1 1 1  65 ARG HG2  .  65 . HG2  1 1 
       3550 1 2 1 1  68 ILE MD   .  68 . HD1* 1 1 
       3551 1 1 1 1  65 ARG HG3  .  65 . HG1  1 1 
       3551 1 2 1 1  68 ILE MD   .  68 . HD1* 1 1 
       3552 1 1 1 1  64 PHE HA   .  64 . HA   1 1 
       3552 1 2 1 1  68 ILE MD   .  68 . HD1* 1 1 
       3553 1 1 1 1  66 GLU HA   .  66 . HA   1 1 
       3553 1 2 1 1  69 ARG HD3  .  69 . HD1  1 1 
       3554 1 1 1 1  66 GLU HA   .  66 . HA   1 1 
       3554 1 2 1 1  69 ARG HD2  .  69 . HD2  1 1 
       3555 1 1 1 1   4 ILE HA   .   4 . HA   1 1 
       3555 1 2 1 1  78 LEU HG   .  78 . HG   1 1 
       3556 1 1 1 1   6 VAL HA   .   6 . HA   1 1 
       3556 1 2 1 1  82 VAL HB   .  82 . HB   1 1 
       3557 1 1 1 1   6 VAL HA   .   6 . HA   1 1 
       3557 1 2 1 1  82 VAL MG2  .  82 . HG2* 1 1 
       3558 1 1 1 1  14 ILE MD   .  14 . HD1* 1 1 
       3558 1 2 1 1 138 LYS HA   . 138 . HA   1 1 
       3559 1 1 1 1  89 LYS HA   .  89 . HA   1 1 
       3559 1 2 1 1  92 ILE H    .  92 . HN   1 1 
       3560 1 1 1 1  89 LYS HA   .  89 . HA   1 1 
       3560 1 2 1 1 125 PHE HZ   . 125 . HZ   1 1 
       3561 1 1 1 1  89 LYS HA   .  89 . HA   1 1 
       3561 1 2 1 1 125 PHE QE   . 125 . HE*  1 1 
       3562 1 1 1 1   8 PHE QE   .   8 . HE*  1 1 
       3562 1 2 1 1  95 PHE HB3  .  95 . HB1  1 1 
       3563 1 1 1 1  93 LYS HA   .  93 . HA   1 1 
       3563 1 2 1 1  96 ILE MG   .  96 . HG2* 1 1 
       3564 1 1 1 1  96 ILE MG   .  96 . HG2* 1 1 
       3564 1 2 1 1 127 SER HB2  . 127 . HB2  1 1 
       3565 1 1 1 1  96 ILE HB   .  96 . HB   1 1 
       3565 1 2 1 1  97 GLU HA   .  97 . HA   1 1 
       3566 1 1 1 1  95 PHE HA   .  95 . HA   1 1 
       3566 1 2 1 1  96 ILE HG12 .  96 . HG12 1 1 
       3567 1 1 1 1  96 ILE MD   .  96 . HD1* 1 1 
       3567 1 2 1 1 125 PHE HB2  . 125 . HB2  1 1 
       3568 1 1 1 1  93 LYS H    .  93 . HN   1 1 
       3568 1 2 1 1  96 ILE MD   .  96 . HD1* 1 1 
       3569 1 1 1 1  96 ILE MD   .  96 . HD1* 1 1 
       3569 1 2 1 1 125 PHE QD   . 125 . HD*  1 1 
       3570 1 1 1 1  96 ILE MD   .  96 . HD1* 1 1 
       3570 1 2 1 1 125 PHE QE   . 125 . HE*  1 1 
       3571 1 1 1 1  22 ILE MG   .  22 . HG2* 1 1 
       3571 1 2 1 1  27 VAL HA   .  27 . HA   1 1 
       3572 1 1 1 1  22 ILE MG   .  22 . HG2* 1 1 
       3572 1 2 1 1  27 VAL HB   .  27 . HB   1 1 
       3573 1 1 1 1  22 ILE MG   .  22 . HG2* 1 1 
       3573 1 2 1 1  27 VAL MG1  .  27 . HG1* 1 1 
       3574 1 1 1 1  53 VAL MG1  .  53 . HG1* 1 1 
       3574 1 2 1 1  54 ASP HB2  .  54 . HB2  1 1 
       3575 1 1 1 1  50 LYS HG3  .  50 . HG1  1 1 
       3575 1 2 1 1  51 GLN HG3  .  51 . HG1  1 1 
       3576 1 1 1 1  50 LYS HG2  .  50 . HG2  1 1 
       3576 1 2 1 1  51 GLN HG3  .  51 . HG1  1 1 
       3577 1 1 1 1  23 LYS HG2  .  23 . HG2  1 1 
       3577 1 2 1 1  51 GLN HB3  .  51 . HB1  1 1 
       3578 1 1 1 1  50 LYS HG2  .  50 . HG2  1 1 
       3578 1 2 1 1  51 GLN HB3  .  51 . HB1  1 1 
       3579 1 1 1 1  29 VAL HA   .  29 . HA   1 1 
       3579 1 2 1 1  80 VAL MG2  .  80 . HG2* 1 1 
       3580 1 1 1 1  80 VAL MG2  .  80 . HG2* 1 1 
       3580 1 2 1 1  81 VAL HA   .  81 . HA   1 1 
       3581 1 1 1 1  10 SER HA   .  10 . HA   1 1 
       3581 1 2 1 1  85 THR HA   .  85 . HA   1 1 
       3582 1 1 1 1  98 GLU HB3  .  98 . HB1  1 1 
       3582 1 2 1 1 102 ARG HB2  . 102 . HB2  1 1 
       3583 1 1 1 1 102 ARG HA   . 102 . HA   1 1 
       3583 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       3584 1 1 1 1  72 TRP HD1  .  72 . HD1  1 1 
       3584 1 2 1 1 102 ARG HB2  . 102 . HB2  1 1 
       3585 1 1 1 1   3 GLN HG2  .   3 . HG2  1 1 
       3585 1 2 1 1 107 PHE HB2  . 107 . HB2  1 1 
       3586 1 1 1 1   3 GLN HG3  .   3 . HG1  1 1 
       3586 1 2 1 1 107 PHE HB2  . 107 . HB2  1 1 
       3587 1 1 1 1   5 PHE QE   .   5 . HE*  1 1 
       3587 1 2 1 1 144 GLN HG3  . 144 . HG1  1 1 
       3588 1 1 1 1   5 PHE HZ   .   5 . HZ   1 1 
       3588 1 2 1 1 144 GLN HG3  . 144 . HG1  1 1 
       3589 1 1 1 1   5 PHE HZ   .   5 . HZ   1 1 
       3589 1 2 1 1 144 GLN HG2  . 144 . HG2  1 1 
       3590 1 1 1 1 106 VAL HB   . 106 . HB   1 1 
       3590 1 2 1 1 130 VAL MG1  . 130 . HG1* 1 1 
       3591 1 1 1 1   6 VAL MG2  .   6 . HG2* 1 1 
       3591 1 2 1 1 108 VAL MG2  . 108 . HG2* 1 1 
       3592 1 1 1 1  92 ILE MD   .  92 . HD1* 1 1 
       3592 1 2 1 1 108 VAL MG2  . 108 . HG2* 1 1 
       3593 1 1 1 1   6 VAL MG2  .   6 . HG2* 1 1 
       3593 1 2 1 1 108 VAL MG1  . 108 . HG1* 1 1 
       3594 1 1 1 1  92 ILE MG   .  92 . HG2* 1 1 
       3594 1 2 1 1 108 VAL MG1  . 108 . HG1* 1 1 
       3595 1 1 1 1  92 ILE HG12 .  92 . HG12 1 1 
       3595 1 2 1 1 108 VAL MG1  . 108 . HG1* 1 1 
       3596 1 1 1 1 109 VAL MG2  . 109 . HG2* 1 1 
       3596 1 2 1 1 133 ARG HG2  . 133 . HG2  1 1 
       3597 1 1 1 1   8 PHE HB3  .   8 . HB1  1 1 
       3597 1 2 1 1 110 TYR HB2  . 110 . HB2  1 1 
       3598 1 1 1 1   8 PHE QD   .   8 . HD*  1 1 
       3598 1 2 1 1 110 TYR HB2  . 110 . HB2  1 1 
       3599 1 1 1 1 117 ARG HB3  . 117 . HB1  1 1 
       3599 1 2 1 1 121 ALA MB   . 121 . HB*  1 1 
       3600 1 1 1 1 110 TYR QE   . 110 . HE*  1 1 
       3600 1 2 1 1 122 GLN HA   . 122 . HA   1 1 
       3601 1 1 1 1 122 GLN HA   . 122 . HA   1 1 
       3601 1 2 1 1 125 PHE QD   . 125 . HD*  1 1 
       3602 1 1 1 1 121 ALA HA   . 121 . HA   1 1 
       3602 1 2 1 1 124 GLU HG2  . 124 . HG2  1 1 
       3603 1 1 1 1 121 ALA HA   . 121 . HA   1 1 
       3603 1 2 1 1 124 GLU HG3  . 124 . HG1  1 1 
       3604 1 1 1 1 124 GLU HG2  . 124 . HG2  1 1 
       3604 1 2 1 1 125 PHE QD   . 125 . HD*  1 1 
       3605 1 1 1 1 124 GLU HG2  . 124 . HG2  1 1 
       3605 1 2 1 1 125 PHE QE   . 125 . HE*  1 1 
       3606 1 1 1 1 124 GLU HG3  . 124 . HG1  1 1 
       3606 1 2 1 1 125 PHE QE   . 125 . HE*  1 1 
       3607 1 1 1 1 124 GLU HA   . 124 . HA   1 1 
       3607 1 2 1 1 125 PHE QD   . 125 . HD*  1 1 
       3608 1 1 1 1 125 PHE HB2  . 125 . HB2  1 1 
       3608 1 2 1 1 126 ARG H    . 126 . HN   1 1 
       3609 1 1 1 1 125 PHE HB3  . 125 . HB1  1 1 
       3609 1 2 1 1 126 ARG H    . 126 . HN   1 1 
       3610 1 1 1 1  96 ILE MG   .  96 . HG2* 1 1 
       3610 1 2 1 1 127 SER HB3  . 127 . HB1  1 1 
       3611 1 1 1 1 109 VAL MG1  . 109 . HG1* 1 1 
       3611 1 2 1 1 133 ARG HB2  . 133 . HB2  1 1 
       3612 1 1 1 1 109 VAL MG1  . 109 . HG1* 1 1 
       3612 1 2 1 1 133 ARG HB3  . 133 . HB1  1 1 
       3613 1 1 1 1 133 ARG HB3  . 133 . HB1  1 1 
       3613 1 2 1 1 135 VAL MG1  . 135 . HG1* 1 1 
       3614 1 1 1 1 133 ARG HD2  . 133 . HD2  1 1 
       3614 1 2 1 1 144 GLN HE21 . 144 . HE21 1 1 
       3615 1 1 1 1 133 ARG HD3  . 133 . HD1  1 1 
       3615 1 2 1 1 144 GLN HE21 . 144 . HE21 1 1 
       3616 1 1 1 1 118 ARG HD2  . 118 . HD2  1 1 
       3616 1 2 1 1 134 THR MG   . 134 . HG2* 1 1 
       3617 1 1 1 1  14 ILE HA   .  14 . HA   1 1 
       3617 1 2 1 1 138 LYS HB2  . 138 . HB2  1 1 
       3618 1 1 1 1  17 GLU HG3  .  17 . HG1  1 1 
       3618 1 2 1 1 138 LYS HE2  . 138 . HE2  1 1 
       3619 1 1 1 1  17 GLU HG3  .  17 . HG1  1 1 
       3619 1 2 1 1 138 LYS HE3  . 138 . HE1  1 1 
       3620 1 1 1 1  14 ILE MD   .  14 . HD1* 1 1 
       3620 1 2 1 1 111 ASN HB2  . 111 . HB2  1 1 
       3621 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
       3621 1 2 1 1 111 ASN HD21 . 111 . HD21 1 1 
       3622 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
       3622 1 2 1 1 111 ASN HD22 . 111 . HD22 1 1 
       3623 1 1 1 1  14 ILE HB   .  14 . HB   1 1 
       3623 1 2 1 1  15 LEU HB3  .  15 . HB1  1 1 
       3624 1 1 1 1  14 ILE HB   .  14 . HB   1 1 
       3624 1 2 1 1  18 ILE HG13 .  18 . HG11 1 1 
       3625 1 1 1 1  14 ILE HB   .  14 . HB   1 1 
       3625 1 2 1 1 138 LYS HD2  . 138 . HD2  1 1 
       3626 1 1 1 1  14 ILE HB   .  14 . HB   1 1 
       3626 1 2 1 1 138 LYS HD3  . 138 . HD1  1 1 
       3627 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
       3627 1 2 1 1 138 LYS HB2  . 138 . HB2  1 1 
       3628 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
       3628 1 2 1 1 138 LYS HD2  . 138 . HD2  1 1 
       3629 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
       3629 1 2 1 1 138 LYS HD3  . 138 . HD1  1 1 
       3630 1 1 1 1 137 ASP HB3  . 137 . HB1  1 1 
       3630 1 2 1 1 140 GLU HB3  . 140 . HB1  1 1 
       3631 1 1 1 1 137 ASP HB2  . 137 . HB2  1 1 
       3631 1 2 1 1 140 GLU HG3  . 140 . HG1  1 1 
       3632 1 1 1 1 137 ASP HB3  . 137 . HB1  1 1 
       3632 1 2 1 1 140 GLU HG3  . 140 . HG1  1 1 
       3633 1 1 1 1 137 ASP HB2  . 137 . HB2  1 1 
       3633 1 2 1 1 140 GLU HG2  . 140 . HG2  1 1 
       3634 1 1 1 1 109 VAL HB   . 109 . HB   1 1 
       3634 1 2 1 1 141 LEU MD2  . 141 . HD2* 1 1 
       3635 1 1 1 1 141 LEU MD2  . 141 . HD2* 1 1 
       3635 1 2 1 1 144 GLN HG3  . 144 . HG1  1 1 
       3636 1 1 1 1 141 LEU MD2  . 141 . HD2* 1 1 
       3636 1 2 1 1 144 GLN HG2  . 144 . HG2  1 1 
       3637 1 1 1 1 144 GLN HG3  . 144 . HG1  1 1 
       3637 1 2 1 1 145 VAL MG2  . 145 . HG2* 1 1 
       3638 1 1 1 1 109 VAL HB   . 109 . HB   1 1 
       3638 1 2 1 1 144 GLN HG3  . 144 . HG1  1 1 
       3639 1 1 1 1 141 LEU HG   . 141 . HG   1 1 
       3639 1 2 1 1 144 GLN HG3  . 144 . HG1  1 1 
       3640 1 1 1 1   7 VAL MG2  .   7 . HG2* 1 1 
       3640 1 2 1 1 145 VAL HB   . 145 . HB   1 1 
       3641 1 1 1 1  22 ILE HG12 .  22 . HG12 1 1 
       3641 1 2 1 1 145 VAL HB   . 145 . HB   1 1 
       3642 1 1 1 1  22 ILE MD   .  22 . HD1* 1 1 
       3642 1 2 1 1 145 VAL HB   . 145 . HB   1 1 
       3643 1 1 1 1   7 VAL MG2  .   7 . HG2* 1 1 
       3643 1 2 1 1 145 VAL HA   . 145 . HA   1 1 
       3644 1 1 1 1 142 ILE MG   . 142 . HG2* 1 1 
       3644 1 2 1 1 145 VAL HB   . 145 . HB   1 1 
       3645 1 1 1 1  18 ILE HA   .  18 . HA   1 1 
       3645 1 2 1 1 145 VAL MG2  . 145 . HG2* 1 1 
       3646 1 1 1 1  19 VAL MG1  .  19 . HG1* 1 1 
       3646 1 2 1 1  23 LYS HG3  .  23 . HG1  1 1 
       3647 1 1 1 1  18 ILE HG12 .  18 . HG12 1 1 
       3647 1 2 1 1 145 VAL MG1  . 145 . HG1* 1 1 
       3648 1 1 1 1 142 ILE MG   . 142 . HG2* 1 1 
       3648 1 2 1 1 146 ARG HB2  . 146 . HB2  1 1 
       3649 1 1 1 1 142 ILE MG   . 142 . HG2* 1 1 
       3649 1 2 1 1 146 ARG HB3  . 146 . HB1  1 1 
       3650 1 1 1 1 144 GLN HA   . 144 . HA   1 1 
       3650 1 2 1 1 147 ARG HG2  . 147 . HG2  1 1 
       3651 1 1 1 1   5 PHE QE   .   5 . HE*  1 1 
       3651 1 2 1 1 148 PHE HB2  . 148 . HB2  1 1 
       3652 1 1 1 1   5 PHE QE   .   5 . HE*  1 1 
       3652 1 2 1 1 148 PHE HB3  . 148 . HB1  1 1 
       3653 1 1 1 1  15 LEU HG   .  15 . HG   1 1 
       3653 1 2 1 1  83 ILE MG   .  83 . HG2* 1 1 
       3654 1 1 1 1  15 LEU MD1  .  15 . HD1* 1 1 
       3654 1 2 1 1  83 ILE HB   .  83 . HB   1 1 
       3655 1 1 1 1  15 LEU HG   .  15 . HG   1 1 
       3655 1 2 1 1  16 LYS HA   .  16 . HA   1 1 
       3656 1 1 1 1  16 LYS HA   .  16 . HA   1 1 
       3656 1 2 1 1  51 GLN HE22 .  51 . HE22 1 1 
       3657 1 1 1 1  17 GLU HB2  .  17 . HB2  1 1 
       3657 1 2 1 1  18 ILE HG12 .  18 . HG12 1 1 
       3658 1 1 1 1  17 GLU HB2  .  17 . HB2  1 1 
       3658 1 2 1 1 142 ILE HG13 . 142 . HG11 1 1 
       3659 1 1 1 1  21 GLU HB3  .  21 . HB1  1 1 
       3659 1 2 1 1 145 VAL MG2  . 145 . HG2* 1 1 
       3660 1 1 1 1  96 ILE MG   .  96 . HG2* 1 1 
       3660 1 2 1 1  97 GLU HG3  .  97 . HG1  1 1 
       3661 1 1 1 1  18 ILE HG12 .  18 . HG12 1 1 
       3661 1 2 1 1  83 ILE MD   .  83 . HD1* 1 1 
       3662 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
       3662 1 2 1 1  18 ILE HG12 .  18 . HG12 1 1 
       3663 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
       3663 1 2 1 1  18 ILE HG13 .  18 . HG11 1 1 
       3664 1 1 1 1  21 GLU HB2  .  21 . HB2  1 1 
       3664 1 2 1 1  22 ILE MD   .  22 . HD1* 1 1 
       3665 1 1 1 1  21 GLU HA   .  21 . HA   1 1 
       3665 1 2 1 1 142 ILE MG   . 142 . HG2* 1 1 
       3666 1 1 1 1  21 GLU HG2  .  21 . HG2  1 1 
       3666 1 2 1 1 142 ILE HG13 . 142 . HG11 1 1 
       3667 1 1 1 1  21 GLU HG3  .  21 . HG1  1 1 
       3667 1 2 1 1 142 ILE HG13 . 142 . HG11 1 1 
       3668 1 1 1 1  23 LYS HG2  .  23 . HG2  1 1 
       3668 1 2 1 1  29 VAL MG2  .  29 . HG2* 1 1 
       3669 1 1 1 1  22 ILE MG   .  22 . HG2* 1 1 
       3669 1 2 1 1  23 LYS HG2  .  23 . HG2  1 1 
       3670 1 1 1 1  28 ARG HG3  .  28 . HG1  1 1 
       3670 1 2 1 1  75 TYR QE   .  75 . HE*  1 1 
       3671 1 1 1 1  21 GLU HA   .  21 . HA   1 1 
       3671 1 2 1 1  24 ARG HG2  .  24 . HG2  1 1 
       3672 1 1 1 1  21 GLU HA   .  21 . HA   1 1 
       3672 1 2 1 1  24 ARG HG3  .  24 . HG1  1 1 
       3673 1 1 1 1  22 ILE MG   .  22 . HG2* 1 1 
       3673 1 2 1 1  25 GLN HB3  .  25 . HB1  1 1 
       3674 1 1 1 1  22 ILE MG   .  22 . HG2* 1 1 
       3674 1 2 1 1  25 GLN HB2  .  25 . HB2  1 1 
       3675 1 1 1 1  27 VAL MG1  .  27 . HG1* 1 1 
       3675 1 2 1 1  79 ASP HB2  .  79 . HB2  1 1 
       3676 1 1 1 1   3 GLN HA   .   3 . HA   1 1 
       3676 1 2 1 1 104 VAL HA   . 104 . HA   1 1 
       3677 1 1 1 1   3 GLN HA   .   3 . HA   1 1 
       3677 1 2 1 1 106 VAL HA   . 106 . HA   1 1 
       3678 1 1 1 1   4 ILE MG   .   4 . HG2* 1 1 
       3678 1 2 1 1 106 VAL H    . 106 . HN   1 1 
       3679 1 1 1 1   4 ILE MG   .   4 . HG2* 1 1 
       3679 1 2 1 1  99 ALA H    .  99 . HN   1 1 
       3680 1 1 1 1   4 ILE MG   .   4 . HG2* 1 1 
       3680 1 2 1 1 105 GLU H    . 105 . HN   1 1 
       3681 1 1 1 1   3 GLN HA   .   3 . HA   1 1 
       3681 1 2 1 1   4 ILE HB   .   4 . HB   1 1 
       3682 1 1 1 1   4 ILE HB   .   4 . HB   1 1 
       3682 1 2 1 1  72 TRP HH2  .  72 . HH2  1 1 
       3683 1 1 1 1   4 ILE HB   .   4 . HB   1 1 
       3683 1 2 1 1  72 TRP HZ3  .  72 . HZ3  1 1 
       3684 1 1 1 1   4 ILE HB   .   4 . HB   1 1 
       3684 1 2 1 1  95 PHE QE   .  95 . HE*  1 1 
       3685 1 1 1 1   4 ILE HB   .   4 . HB   1 1 
       3685 1 2 1 1  95 PHE HZ   .  95 . HZ   1 1 
       3686 1 1 1 1  45 LEU HG   .  45 . HG   1 1 
       3686 1 2 1 1  57 THR MG   .  57 . HG2* 1 1 
       3687 1 1 1 1   6 VAL MG2  .   6 . HG2* 1 1 
       3687 1 2 1 1  32 LEU MD1  .  32 . HD1* 1 1 
       3688 1 1 1 1   6 VAL MG1  .   6 . HG1* 1 1 
       3688 1 2 1 1 108 VAL MG1  . 108 . HG1* 1 1 
       3689 1 1 1 1  62 GLU HA   .  62 . HA   1 1 
       3689 1 2 1 1  65 ARG HD2  .  65 . HD2  1 1 
       3690 1 1 1 1  62 GLU HA   .  62 . HA   1 1 
       3690 1 2 1 1  65 ARG HD3  .  65 . HD1  1 1 
       3691 1 1 1 1  32 LEU HG   .  32 . HG   1 1 
       3691 1 2 1 1  67 ASN HB3  .  67 . HB1  1 1 
       3692 1 1 1 1  32 LEU HG   .  32 . HG   1 1 
       3692 1 2 1 1  67 ASN HB2  .  67 . HB2  1 1 
       3693 1 1 1 1  68 ILE MD   .  68 . HD1* 1 1 
       3693 1 2 1 1  94 ASP HB2  .  94 . HB2  1 1 
       3694 1 1 1 1  69 ARG HG2  .  69 . HG2  1 1 
       3694 1 2 1 1  72 TRP HD1  .  72 . HD1  1 1 
       3695 1 1 1 1   7 VAL HB   .   7 . HB   1 1 
       3695 1 2 1 1  18 ILE MG   .  18 . HG2* 1 1 
       3696 1 1 1 1  72 TRP HA   .  72 . HA   1 1 
       3696 1 2 1 1  78 LEU MD1  .  78 . HD1* 1 1 
       3697 1 1 1 1  22 ILE MD   .  22 . HD1* 1 1 
       3697 1 2 1 1  81 VAL HB   .  81 . HB   1 1 
       3698 1 1 1 1  22 ILE MG   .  22 . HG2* 1 1 
       3698 1 2 1 1  81 VAL HB   .  81 . HB   1 1 
       3699 1 1 1 1  22 ILE HG13 .  22 . HG11 1 1 
       3699 1 2 1 1  81 VAL MG1  .  81 . HG1* 1 1 
       3700 1 1 1 1  32 LEU H    .  32 . HN   1 1 
       3700 1 2 1 1  82 VAL MG1  .  82 . HG1* 1 1 
       3701 1 1 1 1  32 LEU HG   .  32 . HG   1 1 
       3701 1 2 1 1  84 VAL MG2  .  84 . HG2* 1 1 
       3702 1 1 1 1  88 ASP HB3  .  88 . HB1  1 1 
       3702 1 2 1 1  91 TRP HE1  .  91 . HE1  1 1 
       3703 1 1 1 1  88 ASP HB2  .  88 . HB2  1 1 
       3703 1 2 1 1  91 TRP HE1  .  91 . HE1  1 1 
       3704 1 1 1 1  96 ILE MG   .  96 . HG2* 1 1 
       3704 1 2 1 1 100 LYS HB3  . 100 . HB1  1 1 
       3705 1 1 1 1 148 PHE QD   . 148 . HD*  1 1 
       3705 1 2 1 1 152 VAL HB   . 152 . HB   1 1 
       3706 1 1 1 1  64 PHE QD   .  64 . HD*  1 1 
       3706 1 2 1 1  91 TRP HA   .  91 . HA   1 1 
       3707 1 1 1 1  90 GLU HB2  .  90 . HB2  1 1 
       3707 1 2 1 1  91 TRP HB3  .  91 . HB1  1 1 
       3708 1 1 1 1  91 TRP HB2  .  91 . HB2  1 1 
       3708 1 2 1 1  92 ILE HG13 .  92 . HG11 1 1 
       3709 1 1 1 1  89 LYS HA   .  89 . HA   1 1 
       3709 1 2 1 1  92 ILE HG13 .  92 . HG11 1 1 
       3710 1 1 1 1  91 TRP HB3  .  91 . HB1  1 1 
       3710 1 2 1 1  92 ILE HG13 .  92 . HG11 1 1 
       3711 1 1 1 1  64 PHE QD   .  64 . HD*  1 1 
       3711 1 2 1 1  94 ASP HB2  .  94 . HB2  1 1 
       3712 1 1 1 1  64 PHE QD   .  64 . HD*  1 1 
       3712 1 2 1 1  94 ASP HB3  .  94 . HB1  1 1 
       3713 1 1 1 1  68 ILE MD   .  68 . HD1* 1 1 
       3713 1 2 1 1  94 ASP HB3  .  94 . HB1  1 1 
       3714 1 1 1 1  96 ILE MD   .  96 . HD1* 1 1 
       3714 1 2 1 1 125 PHE HA   . 125 . HA   1 1 
       3715 1 1 1 1  96 ILE MG   .  96 . HG2* 1 1 
       3715 1 2 1 1 125 PHE HA   . 125 . HA   1 1 
       3716 1 1 1 1  96 ILE MG   .  96 . HG2* 1 1 
       3716 1 2 1 1 130 VAL HA   . 130 . HA   1 1 
       3717 1 1 1 1  93 LYS HA   .  93 . HA   1 1 
       3717 1 2 1 1  96 ILE HG12 .  96 . HG12 1 1 
       3718 1 1 1 1  92 ILE MG   .  92 . HG2* 1 1 
       3718 1 2 1 1  96 ILE HB   .  96 . HB   1 1 
       3719 1 1 1 1  65 ARG HB2  .  65 . HB2  1 1 
       3719 1 2 1 1  98 GLU HG3  .  98 . HG1  1 1 
       3720 1 1 1 1   2 SER HA   .   2 . HA   1 1 
       3720 1 2 1 1  78 LEU MD1  .  78 . HD1* 1 1 
       3721 1 1 1 1   2 SER HA   .   2 . HA   1 1 
       3721 1 2 1 1 104 VAL MG1  . 104 . HG1* 1 1 
       3722 1 1 1 1  22 ILE MG   .  22 . HG2* 1 1 
       3722 1 2 1 1  28 ARG HA   .  28 . HA   1 1 
       3723 1 1 1 1  28 ARG HA   .  28 . HA   1 1 
       3723 1 2 1 1  80 VAL MG2  .  80 . HG2* 1 1 
       3724 1 1 1 1  33 TYR QE   .  33 . HE*  1 1 
       3724 1 2 1 1  44 ARG HA   .  44 . HA   1 1 
       3725 1 1 1 1  33 TYR QD   .  33 . HD*  1 1 
       3725 1 2 1 1  44 ARG HG3  .  44 . HG1  1 1 
       3726 1 1 1 1  31 LEU H    .  31 . HN   1 1 
       3726 1 2 1 1  55 VAL HA   .  55 . HA   1 1 
       3727 1 1 1 1  30 VAL MG1  .  30 . HG1* 1 1 
       3727 1 2 1 1  32 LEU H    .  32 . HN   1 1 
       3728 1 1 1 1  30 VAL MG1  .  30 . HG1* 1 1 
       3728 1 2 1 1  54 ASP H    .  54 . HN   1 1 
       3729 1 1 1 1  30 VAL MG1  .  30 . HG1* 1 1 
       3729 1 2 1 1  82 VAL HA   .  82 . HA   1 1 
       3730 1 1 1 1  30 VAL MG1  .  30 . HG1* 1 1 
       3730 1 2 1 1  54 ASP HB3  .  54 . HB1  1 1 
       3731 1 1 1 1  30 VAL HB   .  30 . HB   1 1 
       3731 1 2 1 1  54 ASP HB3  .  54 . HB1  1 1 
       3732 1 1 1 1  30 VAL MG2  .  30 . HG2* 1 1 
       3732 1 2 1 1  54 ASP HB3  .  54 . HB1  1 1 
       3733 1 1 1 1  46 GLU HG2  .  46 . HG2  1 1 
       3733 1 2 1 1  50 LYS HD2  .  50 . HD2  1 1 
       3734 1 1 1 1  46 GLU HG2  .  46 . HG2  1 1 
       3734 1 2 1 1  50 LYS HG2  .  50 . HG2  1 1 
       3735 1 1 1 1  46 GLU HG3  .  46 . HG1  1 1 
       3735 1 2 1 1  50 LYS HD2  .  50 . HD2  1 1 
       3736 1 1 1 1  46 GLU HG3  .  46 . HG1  1 1 
       3736 1 2 1 1  50 LYS HG2  .  50 . HG2  1 1 
       3737 1 1 1 1 112 ASN HA   . 112 . HA   1 1 
       3737 1 2 1 1 118 ARG HD3  . 118 . HD1  1 1 
       3738 1 1 1 1 112 ASN HA   . 112 . HA   1 1 
       3738 1 2 1 1 118 ARG HD2  . 118 . HD2  1 1 
       3739 1 1 1 1 112 ASN H    . 112 . HN   1 1 
       3739 1 2 1 1 118 ARG HD2  . 118 . HD2  1 1 
       3740 1 1 1 1 118 ARG HD3  . 118 . HD1  1 1 
       3740 1 2 1 1 134 THR MG   . 134 . HG2* 1 1 
       3741 1 1 1 1 110 TYR H    . 110 . HN   1 1 
       3741 1 2 1 1 134 THR MG   . 134 . HG2* 1 1 
       3742 1 1 1 1 151 LYS H    . 151 . HN   1 1 
       3742 1 2 1 1 152 VAL MG1  . 152 . HG1* 1 1 
       3743 1 1 1 1   7 VAL MG1  .   7 . HG1* 1 1 
       3743 1 2 1 1   8 PHE HB2  .   8 . HB2  1 1 
       3744 1 1 1 1   7 VAL MG1  .   7 . HG1* 1 1 
       3744 1 2 1 1  83 ILE HG12 .  83 . HG12 1 1 
       3745 1 1 1 1   7 VAL MG2  .   7 . HG2* 1 1 
       3745 1 2 1 1  83 ILE HG12 .  83 . HG12 1 1 
       3746 1 1 1 1 109 VAL MG1  . 109 . HG1* 1 1 
       3746 1 2 1 1 141 LEU HA   . 141 . HA   1 1 
       3747 1 1 1 1 148 PHE HZ   . 148 . HZ   1 1 
       3747 1 2 1 1 152 VAL MG1  . 152 . HG1* 1 1 
       3748 1 1 1 1 144 GLN HE22 . 144 . HE22 1 1 
       3748 1 2 1 1 147 ARG HD2  . 147 . HD2  1 1 
       3749 1 1 1 1  71 ILE HB   .  71 . HB   1 1 
       3749 1 2 1 1  82 VAL MG2  .  82 . HG2* 1 1 
       3750 1 1 1 1 111 ASN HD21 . 111 . HD21 1 1 
       3750 1 2 1 1 138 LYS HB2  . 138 . HB2  1 1 
       3751 1 1 1 1  19 VAL HA   .  19 . HA   1 1 
       3751 1 2 1 1  48 PHE QD   .  48 . HD*  1 1 
       3752 1 1 1 1  19 VAL HA   .  19 . HA   1 1 
       3752 1 2 1 1  48 PHE QE   .  48 . HE*  1 1 
       3753 1 1 1 1  99 ALA MB   .  99 . HB*  1 1 
       3753 1 2 1 1 100 LYS HA   . 100 . HA   1 1 
       3754 1 1 1 1  89 LYS HG3  .  89 . HG1  1 1 
       3754 1 2 1 1 125 PHE QE   . 125 . HE*  1 1 
       3755 1 1 1 1 107 PHE HB3  . 107 . HB1  1 1 
       3755 1 2 1 1 131 ASP HB2  . 131 . HB2  1 1 
       3756 1 1 1 1 106 VAL MG1  . 106 . HG1* 1 1 
       3756 1 2 1 1 107 PHE HA   . 107 . HA   1 1 
       3757 1 1 1 1 107 PHE QE   . 107 . HE*  1 1 
       3757 1 2 1 1 144 GLN HG2  . 144 . HG2  1 1 
       3758 1 1 1 1  82 VAL MG1  .  82 . HG1* 1 1 
       3758 1 2 1 1  95 PHE QE   .  95 . HE*  1 1 
       3759 1 1 1 1  95 PHE QE   .  95 . HE*  1 1 
       3759 1 2 1 1 106 VAL HB   . 106 . HB   1 1 
       3760 1 1 1 1  12 PRO HA   .  12 . HA   1 1 
       3760 1 2 1 1  15 LEU HG   .  15 . HG   1 1 
       3761 1 1 1 1  12 PRO HG3  .  12 . HG1  1 1 
       3761 1 2 1 1  33 TYR QE   .  33 . HE*  1 1 
       3762 1 1 1 1  12 PRO HB2  .  12 . HB2  1 1 
       3762 1 2 1 1  48 PHE HZ   .  48 . HZ   1 1 
       3763 1 1 1 1 126 ARG HA   . 126 . HA   1 1 
       3763 1 2 1 1 130 VAL HB   . 130 . HB   1 1 
       3764 1 1 1 1 118 ARG HA   . 118 . HA   1 1 
       3764 1 2 1 1 134 THR MG   . 134 . HG2* 1 1 
       3765 1 1 1 1 138 LYS HG2  . 138 . HG2  1 1 
       3765 1 2 1 1 139 GLU HA   . 139 . HA   1 1 
       3766 1 1 1 1 138 LYS HG3  . 138 . HG1  1 1 
       3766 1 2 1 1 139 GLU HA   . 139 . HA   1 1 
       3767 1 1 1 1 111 ASN HB2  . 111 . HB2  1 1 
       3767 1 2 1 1 141 LEU HB3  . 141 . HB1  1 1 
       3768 1 1 1 1 111 ASN HB2  . 111 . HB2  1 1 
       3768 1 2 1 1 141 LEU HB2  . 141 . HB2  1 1 
       3769 1 1 1 1  18 ILE HA   .  18 . HA   1 1 
       3769 1 2 1 1 141 LEU MD2  . 141 . HD2* 1 1 
       3770 1 1 1 1 138 LYS HA   . 138 . HA   1 1 
       3770 1 2 1 1 141 LEU MD2  . 141 . HD2* 1 1 
       3771 1 1 1 1 141 LEU MD2  . 141 . HD2* 1 1 
       3771 1 2 1 1 144 GLN HB2  . 144 . HB2  1 1 
       3772 1 1 1 1 142 ILE HB   . 142 . HB   1 1 
       3772 1 2 1 1 146 ARG HG3  . 146 . HG1  1 1 
       3773 1 1 1 1 142 ILE MG   . 142 . HG2* 1 1 
       3773 1 2 1 1 146 ARG HG2  . 146 . HG2  1 1 
       3774 1 1 1 1 133 ARG HB3  . 133 . HB1  1 1 
       3774 1 2 1 1 144 GLN HG3  . 144 . HG1  1 1 
       3775 1 1 1 1  25 GLN HE21 .  25 . HE21 1 1 
       3775 1 2 1 1 146 ARG HB2  . 146 . HB2  1 1 
       3776 1 1 1 1 142 ILE MG   . 142 . HG2* 1 1 
       3776 1 2 1 1 146 ARG HG3  . 146 . HG1  1 1 
       3777 1 1 1 1 147 ARG HA   . 147 . HA   1 1 
       3777 1 2 1 1 150 ARG HD2  . 150 . HD2  1 1 
       3778 1 1 1 1 147 ARG HA   . 147 . HA   1 1 
       3778 1 2 1 1 150 ARG HD3  . 150 . HD1  1 1 
       3779 1 1 1 1  25 GLN HE22 .  25 . HE22 1 1 
       3779 1 2 1 1 149 VAL MG2  . 149 . HG2* 1 1 
       3780 1 1 1 1  15 LEU MD2  .  15 . HD2* 1 1 
       3780 1 2 1 1  19 VAL H    .  19 . HN   1 1 
       3781 1 1 1 1  15 LEU MD2  .  15 . HD2* 1 1 
       3781 1 2 1 1  34 SER H    .  34 . HN   1 1 
       3782 1 1 1 1  15 LEU MD1  .  15 . HD1* 1 1 
       3782 1 2 1 1  18 ILE H    .  18 . HN   1 1 
       3783 1 1 1 1  23 LYS HA   .  23 . HA   1 1 
       3783 1 2 1 1  26 GLY H    .  26 . HN   1 1 
       3784 1 1 1 1  24 ARG HG2  .  24 . HG2  1 1 
       3784 1 2 1 1  25 GLN HG2  .  25 . HG2  1 1 
       3785 1 1 1 1  25 GLN HB3  .  25 . HB1  1 1 
       3785 1 2 1 1  27 VAL HB   .  27 . HB   1 1 
       3786 1 1 1 1  28 ARG HB3  .  28 . HB1  1 1 
       3786 1 2 1 1  80 VAL HA   .  80 . HA   1 1 
       3787 1 1 1 1  28 ARG HB2  .  28 . HB2  1 1 
       3787 1 2 1 1  80 VAL HA   .  80 . HA   1 1 
       3788 1 1 1 1  28 ARG HG3  .  28 . HG1  1 1 
       3788 1 2 1 1  30 VAL MG2  .  30 . HG2* 1 1 
       3789 1 1 1 1  28 ARG HG2  .  28 . HG2  1 1 
       3789 1 2 1 1  30 VAL MG2  .  30 . HG2* 1 1 
       3790 1 1 1 1   4 ILE HA   .   4 . HA   1 1 
       3790 1 2 1 1  80 VAL H    .  80 . HN   1 1 
       3791 1 1 1 1   4 ILE MG   .   4 . HG2* 1 1 
       3791 1 2 1 1  68 ILE MG   .  68 . HG2* 1 1 
       3792 1 1 1 1   4 ILE MD   .   4 . HD1* 1 1 
       3792 1 2 1 1   6 VAL MG2  .   6 . HG2* 1 1 
       3793 1 1 1 1  44 ARG H    .  44 . HN   1 1 
       3793 1 2 1 1  44 ARG HD2  .  44 . HD2  1 1 
       3794 1 1 1 1   9 SER HB3  .   9 . HB1  1 1 
       3794 1 2 1 1  15 LEU MD1  .  15 . HD1* 1 1 
       3795 1 1 1 1  15 LEU HB2  .  15 . HB2  1 1 
       3795 1 2 1 1  48 PHE HZ   .  48 . HZ   1 1 
       3796 1 1 1 1  50 LYS HG3  .  50 . HG1  1 1 
       3796 1 2 1 1  51 GLN HG2  .  51 . HG2  1 1 
       3797 1 1 1 1  47 GLU HA   .  47 . HA   1 1 
       3797 1 2 1 1  50 LYS HE2  .  50 . HE2  1 1 
       3798 1 1 1 1  47 GLU HA   .  47 . HA   1 1 
       3798 1 2 1 1  50 LYS HE3  .  50 . HE1  1 1 
       3799 1 1 1 1  61 LYS HG2  .  61 . HG2  1 1 
       3799 1 2 1 1  90 GLU HB2  .  90 . HB2  1 1 
       3800 1 1 1 1  61 LYS HG3  .  61 . HG1  1 1 
       3800 1 2 1 1  90 GLU HB2  .  90 . HB2  1 1 
       3801 1 1 1 1  65 ARG HD2  .  65 . HD2  1 1 
       3801 1 2 1 1  68 ILE MD   .  68 . HD1* 1 1 
       3802 1 1 1 1  65 ARG HD3  .  65 . HD1  1 1 
       3802 1 2 1 1  68 ILE MD   .  68 . HD1* 1 1 
       3803 1 1 1 1  66 GLU HA   .  66 . HA   1 1 
       3803 1 2 1 1  69 ARG HE   .  69 . HE   1 1 
       3804 1 1 1 1  30 VAL HB   .  30 . HB   1 1 
       3804 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
       3805 1 1 1 1  77 GLN HG2  .  77 . HG2  1 1 
       3805 1 2 1 1  78 LEU H    .  78 . HN   1 1 
       3806 1 1 1 1  77 GLN HG3  .  77 . HG1  1 1 
       3806 1 2 1 1  78 LEU H    .  78 . HN   1 1 
       3807 1 1 1 1   8 PHE HZ   .   8 . HZ   1 1 
       3807 1 2 1 1  84 VAL MG1  .  84 . HG1* 1 1 
       3808 1 1 1 1  33 TYR HA   .  33 . HA   1 1 
       3808 1 2 1 1  84 VAL MG1  .  84 . HG1* 1 1 
       3809 1 1 1 1  83 ILE HA   .  83 . HA   1 1 
       3809 1 2 1 1  84 VAL MG1  .  84 . HG1* 1 1 
       3810 1 1 1 1  83 ILE HA   .  83 . HA   1 1 
       3810 1 2 1 1  84 VAL MG2  .  84 . HG2* 1 1 
       3811 1 1 1 1   8 PHE HZ   .   8 . HZ   1 1 
       3811 1 2 1 1  92 ILE HG13 .  92 . HG11 1 1 
       3812 1 1 1 1  92 ILE HG13 .  92 . HG11 1 1 
       3812 1 2 1 1 125 PHE QE   . 125 . HE*  1 1 
       3813 1 1 1 1  64 PHE QE   .  64 . HE*  1 1 
       3813 1 2 1 1  95 PHE HA   .  95 . HA   1 1 
       3814 1 1 1 1  94 ASP HA   .  94 . HA   1 1 
       3814 1 2 1 1  97 GLU HG2  .  97 . HG2  1 1 
       3815 1 1 1 1  65 ARG HB2  .  65 . HB2  1 1 
       3815 1 2 1 1  98 GLU HG2  .  98 . HG2  1 1 
       3816 1 1 1 1  50 LYS HG2  .  50 . HG2  1 1 
       3816 1 2 1 1  51 GLN HA   .  51 . HA   1 1 
       3817 1 1 1 1  15 LEU HB3  .  15 . HB1  1 1 
       3817 1 2 1 1  48 PHE QE   .  48 . HE*  1 1 
       3818 1 1 1 1  15 LEU HB2  .  15 . HB2  1 1 
       3818 1 2 1 1  48 PHE QE   .  48 . HE*  1 1 
       3819 1 1 1 1  15 LEU HA   .  15 . HA   1 1 
       3819 1 2 1 1  48 PHE HZ   .  48 . HZ   1 1 
       3820 1 1 1 1  41 ARG HA   .  41 . HA   1 1 
       3820 1 2 1 1  41 ARG HE   .  41 . HE   1 1 
       3821 1 1 1 1  74 ARG HB2  .  74 . HB2  1 1 
       3821 1 2 1 1  74 ARG HE   .  74 . HE   1 1 
       3822 1 1 1 1 113 LYS HA   . 113 . HA   1 1 
       3822 1 2 1 1 136 SER HB3  . 136 . HB1  1 1 
       3823 1 1 1 1   7 VAL MG1  .   7 . HG1* 1 1 
       3823 1 2 1 1   9 SER HG   .   9 . HG   1 1 
       3824 1 1 1 1 113 LYS HA   . 113 . HA   1 1 
       3824 1 2 1 1 136 SER HB2  . 136 . HB2  1 1 
       3825 1 1 1 1  78 LEU H    .  78 . HN   1 1 
       3825 1 2 1 1  78 LEU HG   .  78 . HG   1 1 
       3826 1 1 1 1   5 PHE HA   .   5 . HA   1 1 
       3826 1 2 1 1   5 PHE QD   .   5 . HD*  1 1 
       3827 1 1 1 1   8 PHE HA   .   8 . HA   1 1 
       3827 1 2 1 1   8 PHE QD   .   8 . HD*  1 1 
       3828 1 1 1 1  33 TYR HA   .  33 . HA   1 1 
       3828 1 2 1 1  33 TYR QD   .  33 . HD*  1 1 
       3829 1 1 1 1  64 PHE HZ   .  64 . HZ   1 1 
       3829 1 2 1 1  95 PHE QE   .  95 . HE*  1 1 
       3830 1 1 1 1  72 TRP HB2  .  72 . HB2  1 1 
       3830 1 2 1 1  72 TRP HD1  .  72 . HD1  1 1 
       3831 1 1 1 1  72 TRP HB3  .  72 . HB1  1 1 
       3831 1 2 1 1  72 TRP HD1  .  72 . HD1  1 1 
       3832 1 1 1 1  75 TYR HA   .  75 . HA   1 1 
       3832 1 2 1 1  75 TYR QD   .  75 . HD*  1 1 
       3833 1 1 1 1  91 TRP HA   .  91 . HA   1 1 
       3833 1 2 1 1  91 TRP HD1  .  91 . HD1  1 1 
       3834 1 1 1 1 107 PHE HA   . 107 . HA   1 1 
       3834 1 2 1 1 107 PHE QD   . 107 . HD*  1 1 
       3835 1 1 1 1 110 TYR HA   . 110 . HA   1 1 
       3835 1 2 1 1 110 TYR QD   . 110 . HD*  1 1 
       3836 1 1 1 1 125 PHE HA   . 125 . HA   1 1 
       3836 1 2 1 1 125 PHE QD   . 125 . HD*  1 1 
       3837 1 1 1 1   5 PHE QD   .   5 . HD*  1 1 
       3837 1 2 1 1   6 VAL H    .   6 . HN   1 1 
       3838 1 1 1 1   5 PHE QD   .   5 . HD*  1 1 
       3838 1 2 1 1 107 PHE QE   . 107 . HE*  1 1 
       3839 1 1 1 1   5 PHE HA   .   5 . HA   1 1 
       3839 1 2 1 1   5 PHE QE   .   5 . HE*  1 1 
       3840 1 1 1 1   5 PHE QD   .   5 . HD*  1 1 
       3840 1 2 1 1 107 PHE HB3  . 107 . HB1  1 1 
       3841 1 1 1 1   5 PHE QE   .   5 . HE*  1 1 
       3841 1 2 1 1 145 VAL HA   . 145 . HA   1 1 
       3842 1 1 1 1   5 PHE QE   .   5 . HE*  1 1 
       3842 1 2 1 1 144 GLN HB3  . 144 . HB1  1 1 
       3843 1 1 1 1   5 PHE QE   .   5 . HE*  1 1 
       3843 1 2 1 1 109 VAL HB   . 109 . HB   1 1 
       3844 1 1 1 1   5 PHE QE   .   5 . HE*  1 1 
       3844 1 2 1 1   7 VAL HB   .   7 . HB   1 1 
       3845 1 1 1 1   5 PHE QD   .   5 . HD*  1 1 
       3845 1 2 1 1   7 VAL HB   .   7 . HB   1 1 
       3846 1 1 1 1   5 PHE QD   .   5 . HD*  1 1 
       3846 1 2 1 1  81 VAL HB   .  81 . HB   1 1 
       3847 1 1 1 1   5 PHE HZ   .   5 . HZ   1 1 
       3847 1 2 1 1 145 VAL HA   . 145 . HA   1 1 
       3848 1 1 1 1   5 PHE HZ   .   5 . HZ   1 1 
       3848 1 2 1 1 144 GLN HB3  . 144 . HB1  1 1 
       3849 1 1 1 1   5 PHE QD   .   5 . HD*  1 1 
       3849 1 2 1 1  81 VAL MG1  .  81 . HG1* 1 1 
       3850 1 1 1 1   5 PHE QD   .   5 . HD*  1 1 
       3850 1 2 1 1   7 VAL MG2  .   7 . HG2* 1 1 
       3851 1 1 1 1   5 PHE QE   .   5 . HE*  1 1 
       3851 1 2 1 1 145 VAL MG2  . 145 . HG2* 1 1 
       3852 1 1 1 1   5 PHE QE   .   5 . HE*  1 1 
       3852 1 2 1 1 109 VAL MG2  . 109 . HG2* 1 1 
       3853 1 1 1 1   5 PHE QE   .   5 . HE*  1 1 
       3853 1 2 1 1  81 VAL MG1  .  81 . HG1* 1 1 
       3854 1 1 1 1   5 PHE QE   .   5 . HE*  1 1 
       3854 1 2 1 1   7 VAL MG2  .   7 . HG2* 1 1 
       3855 1 1 1 1   5 PHE HZ   .   5 . HZ   1 1 
       3855 1 2 1 1 145 VAL MG2  . 145 . HG2* 1 1 
       3856 1 1 1 1   5 PHE HZ   .   5 . HZ   1 1 
       3856 1 2 1 1 109 VAL MG2  . 109 . HG2* 1 1 
       3857 1 1 1 1   5 PHE HZ   .   5 . HZ   1 1 
       3857 1 2 1 1   7 VAL MG2  .   7 . HG2* 1 1 
       3858 1 1 1 1   8 PHE H    .   8 . HN   1 1 
       3858 1 2 1 1   8 PHE QD   .   8 . HD*  1 1 
       3859 1 1 1 1   8 PHE QD   .   8 . HD*  1 1 
       3859 1 2 1 1  84 VAL H    .  84 . HN   1 1 
       3860 1 1 1 1   8 PHE QD   .   8 . HD*  1 1 
       3860 1 2 1 1 110 TYR HA   . 110 . HA   1 1 
       3861 1 1 1 1   8 PHE QE   .   8 . HE*  1 1 
       3861 1 2 1 1  95 PHE HB2  .  95 . HB2  1 1 
       3862 1 1 1 1   8 PHE QE   .   8 . HE*  1 1 
       3862 1 2 1 1  92 ILE HA   .  92 . HA   1 1 
       3863 1 1 1 1   8 PHE QE   .   8 . HE*  1 1 
       3863 1 2 1 1  91 TRP HB2  .  91 . HB2  1 1 
       3864 1 1 1 1   8 PHE QE   .   8 . HE*  1 1 
       3864 1 2 1 1  91 TRP HB3  .  91 . HB1  1 1 
       3865 1 1 1 1   8 PHE QD   .   8 . HD*  1 1 
       3865 1 2 1 1  84 VAL HB   .  84 . HB   1 1 
       3866 1 1 1 1   8 PHE QD   .   8 . HD*  1 1 
       3866 1 2 1 1  84 VAL MG1  .  84 . HG1* 1 1 
       3867 1 1 1 1   8 PHE QD   .   8 . HD*  1 1 
       3867 1 2 1 1 108 VAL MG1  . 108 . HG1* 1 1 
       3868 1 1 1 1   8 PHE QD   .   8 . HD*  1 1 
       3868 1 2 1 1  92 ILE HG13 .  92 . HG11 1 1 
       3869 1 1 1 1   8 PHE QD   .   8 . HD*  1 1 
       3869 1 2 1 1  86 THR MG   .  86 . HG2* 1 1 
       3870 1 1 1 1   6 VAL MG1  .   6 . HG1* 1 1 
       3870 1 2 1 1   8 PHE QD   .   8 . HD*  1 1 
       3871 1 1 1 1   6 VAL MG2  .   6 . HG2* 1 1 
       3871 1 2 1 1   8 PHE QD   .   8 . HD*  1 1 
       3872 1 1 1 1   8 PHE QE   .   8 . HE*  1 1 
       3872 1 2 1 1  84 VAL HB   .  84 . HB   1 1 
       3873 1 1 1 1   8 PHE QE   .   8 . HE*  1 1 
       3873 1 2 1 1  84 VAL MG1  .  84 . HG1* 1 1 
       3874 1 1 1 1   8 PHE QE   .   8 . HE*  1 1 
       3874 1 2 1 1 108 VAL MG1  . 108 . HG1* 1 1 
       3875 1 1 1 1   8 PHE QE   .   8 . HE*  1 1 
       3875 1 2 1 1  92 ILE HG13 .  92 . HG11 1 1 
       3876 1 1 1 1   8 PHE QE   .   8 . HE*  1 1 
       3876 1 2 1 1 108 VAL MG2  . 108 . HG2* 1 1 
       3877 1 1 1 1   8 PHE QE   .   8 . HE*  1 1 
       3877 1 2 1 1  84 VAL MG2  .  84 . HG2* 1 1 
       3878 1 1 1 1   6 VAL MG1  .   6 . HG1* 1 1 
       3878 1 2 1 1   8 PHE QE   .   8 . HE*  1 1 
       3879 1 1 1 1   6 VAL MG2  .   6 . HG2* 1 1 
       3879 1 2 1 1   8 PHE QE   .   8 . HE*  1 1 
       3880 1 1 1 1   8 PHE HZ   .   8 . HZ   1 1 
       3880 1 2 1 1  95 PHE HB3  .  95 . HB1  1 1 
       3881 1 1 1 1   8 PHE HZ   .   8 . HZ   1 1 
       3881 1 2 1 1  95 PHE H    .  95 . HN   1 1 
       3882 1 1 1 1   8 PHE HZ   .   8 . HZ   1 1 
       3882 1 2 1 1  95 PHE HB2  .  95 . HB2  1 1 
       3883 1 1 1 1   8 PHE HZ   .   8 . HZ   1 1 
       3883 1 2 1 1  92 ILE HA   .  92 . HA   1 1 
       3884 1 1 1 1   8 PHE HZ   .   8 . HZ   1 1 
       3884 1 2 1 1  84 VAL MG2  .  84 . HG2* 1 1 
       3885 1 1 1 1   6 VAL MG1  .   6 . HG1* 1 1 
       3885 1 2 1 1   8 PHE HZ   .   8 . HZ   1 1 
       3886 1 1 1 1   6 VAL MG2  .   6 . HG2* 1 1 
       3886 1 2 1 1   8 PHE HZ   .   8 . HZ   1 1 
       3887 1 1 1 1   8 PHE QD   .   8 . HD*  1 1 
       3887 1 2 1 1  92 ILE MG   .  92 . HG2* 1 1 
       3888 1 1 1 1   8 PHE QE   .   8 . HE*  1 1 
       3888 1 2 1 1  92 ILE MG   .  92 . HG2* 1 1 
       3889 1 1 1 1   8 PHE HZ   .   8 . HZ   1 1 
       3889 1 2 1 1  92 ILE MG   .  92 . HG2* 1 1 
       3890 1 1 1 1  33 TYR QE   .  33 . HE*  1 1 
       3890 1 2 1 1  45 LEU H    .  45 . HN   1 1 
       3891 1 1 1 1  33 TYR QE   .  33 . HE*  1 1 
       3891 1 2 1 1  41 ARG HA   .  41 . HA   1 1 
       3892 1 1 1 1  33 TYR QD   .  33 . HD*  1 1 
       3892 1 2 1 1  45 LEU HB2  .  45 . HB2  1 1 
       3893 1 1 1 1  33 TYR QD   .  33 . HD*  1 1 
       3893 1 2 1 1  45 LEU HB3  .  45 . HB1  1 1 
       3894 1 1 1 1  33 TYR QD   .  33 . HD*  1 1 
       3894 1 2 1 1  41 ARG HG3  .  41 . HG1  1 1 
       3895 1 1 1 1  33 TYR QD   .  33 . HD*  1 1 
       3895 1 2 1 1  41 ARG HG2  .  41 . HG2  1 1 
       3896 1 1 1 1  31 LEU HG   .  31 . HG   1 1 
       3896 1 2 1 1  33 TYR QD   .  33 . HD*  1 1 
       3897 1 1 1 1  33 TYR QD   .  33 . HD*  1 1 
       3897 1 2 1 1  85 THR MG   .  85 . HG2* 1 1 
       3898 1 1 1 1  12 PRO HB3  .  12 . HB1  1 1 
       3898 1 2 1 1  33 TYR QE   .  33 . HE*  1 1 
       3899 1 1 1 1  33 TYR QE   .  33 . HE*  1 1 
       3899 1 2 1 1  44 ARG HB3  .  44 . HB1  1 1 
       3900 1 1 1 1  33 TYR QE   .  33 . HE*  1 1 
       3900 1 2 1 1  45 LEU HB3  .  45 . HB1  1 1 
       3901 1 1 1 1  33 TYR QE   .  33 . HE*  1 1 
       3901 1 2 1 1  44 ARG HG3  .  44 . HG1  1 1 
       3902 1 1 1 1  33 TYR QE   .  33 . HE*  1 1 
       3902 1 2 1 1  44 ARG HB2  .  44 . HB2  1 1 
       3903 1 1 1 1  33 TYR QE   .  33 . HE*  1 1 
       3903 1 2 1 1  85 THR MG   .  85 . HG2* 1 1 
       3904 1 1 1 1  32 LEU MD1  .  32 . HD1* 1 1 
       3904 1 2 1 1  64 PHE QD   .  64 . HD*  1 1 
       3905 1 1 1 1  33 TYR QD   .  33 . HD*  1 1 
       3905 1 2 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       3906 1 1 1 1  31 LEU MD1  .  31 . HD1* 1 1 
       3906 1 2 1 1  33 TYR QD   .  33 . HD*  1 1 
       3907 1 1 1 1  31 LEU MD2  .  31 . HD2* 1 1 
       3907 1 2 1 1  33 TYR QD   .  33 . HD*  1 1 
       3908 1 1 1 1  15 LEU MD2  .  15 . HD2* 1 1 
       3908 1 2 1 1  33 TYR QE   .  33 . HE*  1 1 
       3909 1 1 1 1  15 LEU MD1  .  15 . HD1* 1 1 
       3909 1 2 1 1  33 TYR QE   .  33 . HE*  1 1 
       3910 1 1 1 1  33 TYR QE   .  33 . HE*  1 1 
       3910 1 2 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       3911 1 1 1 1  31 LEU MD1  .  31 . HD1* 1 1 
       3911 1 2 1 1  33 TYR QE   .  33 . HE*  1 1 
       3912 1 1 1 1  31 LEU MD2  .  31 . HD2* 1 1 
       3912 1 2 1 1  33 TYR QE   .  33 . HE*  1 1 
       3913 1 1 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       3913 1 2 1 1  64 PHE QD   .  64 . HD*  1 1 
       3914 1 1 1 1  45 LEU HA   .  45 . HA   1 1 
       3914 1 2 1 1  48 PHE QD   .  48 . HD*  1 1 
       3915 1 1 1 1  16 LYS HA   .  16 . HA   1 1 
       3915 1 2 1 1  48 PHE HZ   .  48 . HZ   1 1 
       3916 1 1 1 1  19 VAL HB   .  19 . HB   1 1 
       3916 1 2 1 1  48 PHE QD   .  48 . HD*  1 1 
       3917 1 1 1 1  47 GLU HB3  .  47 . HB1  1 1 
       3917 1 2 1 1  48 PHE QD   .  48 . HD*  1 1 
       3918 1 1 1 1  47 GLU HG2  .  47 . HG2  1 1 
       3918 1 2 1 1  48 PHE QD   .  48 . HD*  1 1 
       3919 1 1 1 1  45 LEU HB2  .  45 . HB2  1 1 
       3919 1 2 1 1  48 PHE QD   .  48 . HD*  1 1 
       3920 1 1 1 1  45 LEU HB3  .  45 . HB1  1 1 
       3920 1 2 1 1  48 PHE QD   .  48 . HD*  1 1 
       3921 1 1 1 1  47 GLU HB2  .  47 . HB2  1 1 
       3921 1 2 1 1  48 PHE QD   .  48 . HD*  1 1 
       3922 1 1 1 1  16 LYS HG2  .  16 . HG2  1 1 
       3922 1 2 1 1  48 PHE QD   .  48 . HD*  1 1 
       3923 1 1 1 1  16 LYS HG3  .  16 . HG1  1 1 
       3923 1 2 1 1  48 PHE QD   .  48 . HD*  1 1 
       3924 1 1 1 1  16 LYS HG3  .  16 . HG1  1 1 
       3924 1 2 1 1  48 PHE HZ   .  48 . HZ   1 1 
       3925 1 1 1 1  48 PHE QD   .  48 . HD*  1 1 
       3925 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       3926 1 1 1 1  19 VAL MG1  .  19 . HG1* 1 1 
       3926 1 2 1 1  48 PHE QD   .  48 . HD*  1 1 
       3927 1 1 1 1  48 PHE QD   .  48 . HD*  1 1 
       3927 1 2 1 1  53 VAL MG2  .  53 . HG2* 1 1 
       3928 1 1 1 1  19 VAL MG2  .  19 . HG2* 1 1 
       3928 1 2 1 1  48 PHE QD   .  48 . HD*  1 1 
       3929 1 1 1 1  31 LEU MD1  .  31 . HD1* 1 1 
       3929 1 2 1 1  48 PHE QD   .  48 . HD*  1 1 
       3930 1 1 1 1  31 LEU MD2  .  31 . HD2* 1 1 
       3930 1 2 1 1  48 PHE QD   .  48 . HD*  1 1 
       3931 1 1 1 1  16 LYS HG2  .  16 . HG2  1 1 
       3931 1 2 1 1  48 PHE HZ   .  48 . HZ   1 1 
       3932 1 1 1 1  15 LEU MD2  .  15 . HD2* 1 1 
       3932 1 2 1 1  48 PHE HZ   .  48 . HZ   1 1 
       3933 1 1 1 1  19 VAL MG2  .  19 . HG2* 1 1 
       3933 1 2 1 1  48 PHE HZ   .  48 . HZ   1 1 
       3934 1 1 1 1  31 LEU MD1  .  31 . HD1* 1 1 
       3934 1 2 1 1  48 PHE HZ   .  48 . HZ   1 1 
       3935 1 1 1 1  64 PHE HZ   .  64 . HZ   1 1 
       3935 1 2 1 1  95 PHE QD   .  95 . HD*  1 1 
       3936 1 1 1 1   8 PHE QE   .   8 . HE*  1 1 
       3936 1 2 1 1  64 PHE HZ   .  64 . HZ   1 1 
       3937 1 1 1 1  64 PHE HZ   .  64 . HZ   1 1 
       3937 1 2 1 1  95 PHE HB3  .  95 . HB1  1 1 
       3938 1 1 1 1  64 PHE HZ   .  64 . HZ   1 1 
       3938 1 2 1 1  95 PHE HB2  .  95 . HB2  1 1 
       3939 1 1 1 1  32 LEU HB3  .  32 . HB1  1 1 
       3939 1 2 1 1  64 PHE QD   .  64 . HD*  1 1 
       3940 1 1 1 1  64 PHE HZ   .  64 . HZ   1 1 
       3940 1 2 1 1  91 TRP HB2  .  91 . HB2  1 1 
       3941 1 1 1 1  64 PHE HZ   .  64 . HZ   1 1 
       3941 1 2 1 1  91 TRP HB3  .  91 . HB1  1 1 
       3942 1 1 1 1  64 PHE QE   .  64 . HE*  1 1 
       3942 1 2 1 1  84 VAL MG1  .  84 . HG1* 1 1 
       3943 1 1 1 1  32 LEU MD2  .  32 . HD2* 1 1 
       3943 1 2 1 1  64 PHE QD   .  64 . HD*  1 1 
       3944 1 1 1 1  64 PHE HZ   .  64 . HZ   1 1 
       3944 1 2 1 1  84 VAL MG1  .  84 . HG1* 1 1 
       3945 1 1 1 1  32 LEU MD1  .  32 . HD1* 1 1 
       3945 1 2 1 1  64 PHE HZ   .  64 . HZ   1 1 
       3946 1 1 1 1  64 PHE HZ   .  64 . HZ   1 1 
       3946 1 2 1 1  84 VAL MG2  .  84 . HG2* 1 1 
       3947 1 1 1 1  64 PHE HZ   .  64 . HZ   1 1 
       3947 1 2 1 1  68 ILE MD   .  68 . HD1* 1 1 
       3948 1 1 1 1  69 ARG HA   .  69 . HA   1 1 
       3948 1 2 1 1  72 TRP HD1  .  72 . HD1  1 1 
       3949 1 1 1 1  69 ARG HB2  .  69 . HB2  1 1 
       3949 1 2 1 1  72 TRP HD1  .  72 . HD1  1 1 
       3950 1 1 1 1  69 ARG HB3  .  69 . HB1  1 1 
       3950 1 2 1 1  72 TRP HD1  .  72 . HD1  1 1 
       3951 1 1 1 1  69 ARG HG3  .  69 . HG1  1 1 
       3951 1 2 1 1  72 TRP HD1  .  72 . HD1  1 1 
       3952 1 1 1 1  72 TRP HZ3  .  72 . HZ3  1 1 
       3952 1 2 1 1  78 LEU MD1  .  78 . HD1* 1 1 
       3953 1 1 1 1  72 TRP HH2  .  72 . HH2  1 1 
       3953 1 2 1 1  99 ALA HA   .  99 . HA   1 1 
       3954 1 1 1 1  72 TRP HZ2  .  72 . HZ2  1 1 
       3954 1 2 1 1  99 ALA HA   .  99 . HA   1 1 
       3955 1 1 1 1  72 TRP HH2  .  72 . HH2  1 1 
       3955 1 2 1 1  99 ALA MB   .  99 . HB*  1 1 
       3956 1 1 1 1  72 TRP HZ2  .  72 . HZ2  1 1 
       3956 1 2 1 1  98 GLU HB2  .  98 . HB2  1 1 
       3957 1 1 1 1   4 ILE MG   .   4 . HG2* 1 1 
       3957 1 2 1 1  72 TRP HH2  .  72 . HH2  1 1 
       3958 1 1 1 1  72 TRP HZ2  .  72 . HZ2  1 1 
       3958 1 2 1 1 104 VAL HB   . 104 . HB   1 1 
       3959 1 1 1 1  72 TRP HZ2  .  72 . HZ2  1 1 
       3959 1 2 1 1  99 ALA MB   .  99 . HB*  1 1 
       3960 1 1 1 1   4 ILE MD   .   4 . HD1* 1 1 
       3960 1 2 1 1  72 TRP HZ2  .  72 . HZ2  1 1 
       3961 1 1 1 1  72 TRP HZ2  .  72 . HZ2  1 1 
       3961 1 2 1 1 106 VAL MG2  . 106 . HG2* 1 1 
       3962 1 1 1 1  72 TRP HZ2  .  72 . HZ2  1 1 
       3962 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       3963 1 1 1 1  74 ARG H    .  74 . HN   1 1 
       3963 1 2 1 1  75 TYR QD   .  75 . HD*  1 1 
       3964 1 1 1 1  71 ILE HA   .  71 . HA   1 1 
       3964 1 2 1 1  75 TYR QD   .  75 . HD*  1 1 
       3965 1 1 1 1  74 ARG HD3  .  74 . HD1  1 1 
       3965 1 2 1 1  75 TYR QD   .  75 . HD*  1 1 
       3966 1 1 1 1  71 ILE HA   .  71 . HA   1 1 
       3966 1 2 1 1  75 TYR QE   .  75 . HE*  1 1 
       3967 1 1 1 1  28 ARG HD3  .  28 . HD1  1 1 
       3967 1 2 1 1  75 TYR QE   .  75 . HE*  1 1 
       3968 1 1 1 1  28 ARG HD2  .  28 . HD2  1 1 
       3968 1 2 1 1  75 TYR QE   .  75 . HE*  1 1 
       3969 1 1 1 1  74 ARG HD2  .  74 . HD2  1 1 
       3969 1 2 1 1  75 TYR QE   .  75 . HE*  1 1 
       3970 1 1 1 1  71 ILE HB   .  71 . HB   1 1 
       3970 1 2 1 1  75 TYR QD   .  75 . HD*  1 1 
       3971 1 1 1 1  74 ARG HB2  .  74 . HB2  1 1 
       3971 1 2 1 1  75 TYR QD   .  75 . HD*  1 1 
       3972 1 1 1 1  75 TYR QD   .  75 . HD*  1 1 
       3972 1 2 1 1  80 VAL HB   .  80 . HB   1 1 
       3973 1 1 1 1  74 ARG HB3  .  74 . HB1  1 1 
       3973 1 2 1 1  75 TYR QD   .  75 . HD*  1 1 
       3974 1 1 1 1   4 ILE MD   .   4 . HD1* 1 1 
       3974 1 2 1 1  75 TYR QD   .  75 . HD*  1 1 
       3975 1 1 1 1  71 ILE MG   .  71 . HG2* 1 1 
       3975 1 2 1 1  75 TYR QD   .  75 . HD*  1 1 
       3976 1 1 1 1  28 ARG HG2  .  28 . HG2  1 1 
       3976 1 2 1 1  75 TYR QE   .  75 . HE*  1 1 
       3977 1 1 1 1  30 VAL HB   .  30 . HB   1 1 
       3977 1 2 1 1  75 TYR QE   .  75 . HE*  1 1 
       3978 1 1 1 1  74 ARG HB2  .  74 . HB2  1 1 
       3978 1 2 1 1  75 TYR QE   .  75 . HE*  1 1 
       3979 1 1 1 1  74 ARG HB3  .  74 . HB1  1 1 
       3979 1 2 1 1  75 TYR QE   .  75 . HE*  1 1 
       3980 1 1 1 1  30 VAL MG2  .  30 . HG2* 1 1 
       3980 1 2 1 1  75 TYR QE   .  75 . HE*  1 1 
       3981 1 1 1 1  71 ILE MG   .  71 . HG2* 1 1 
       3981 1 2 1 1  75 TYR QE   .  75 . HE*  1 1 
       3982 1 1 1 1  71 ILE MD   .  71 . HD1* 1 1 
       3982 1 2 1 1  75 TYR QE   .  75 . HE*  1 1 
       3983 1 1 1 1  91 TRP H    .  91 . HN   1 1 
       3983 1 2 1 1  91 TRP HD1  .  91 . HD1  1 1 
       3984 1 1 1 1  90 GLU HB2  .  90 . HB2  1 1 
       3984 1 2 1 1  91 TRP HD1  .  91 . HD1  1 1 
       3985 1 1 1 1  90 GLU HB3  .  90 . HB1  1 1 
       3985 1 2 1 1  91 TRP HD1  .  91 . HD1  1 1 
       3986 1 1 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       3986 1 2 1 1  91 TRP HE3  .  91 . HE3  1 1 
       3987 1 1 1 1  60 ASP HA   .  60 . HA   1 1 
       3987 1 2 1 1  91 TRP HH2  .  91 . HH2  1 1 
       3988 1 1 1 1  60 ASP HA   .  60 . HA   1 1 
       3988 1 2 1 1  91 TRP HZ2  .  91 . HZ2  1 1 
       3989 1 1 1 1  34 SER HB2  .  34 . HB2  1 1 
       3989 1 2 1 1  91 TRP HH2  .  91 . HH2  1 1 
       3990 1 1 1 1  34 SER HB3  .  34 . HB1  1 1 
       3990 1 2 1 1  91 TRP HH2  .  91 . HH2  1 1 
       3991 1 1 1 1  61 LYS HA   .  61 . HA   1 1 
       3991 1 2 1 1  91 TRP HZ2  .  91 . HZ2  1 1 
       3992 1 1 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       3992 1 2 1 1  91 TRP HZ2  .  91 . HZ2  1 1 
       3993 1 1 1 1  58 VAL HB   .  58 . HB   1 1 
       3993 1 2 1 1  91 TRP HH2  .  91 . HH2  1 1 
       3994 1 1 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       3994 1 2 1 1  91 TRP HH2  .  91 . HH2  1 1 
       3995 1 1 1 1  95 PHE QD   .  95 . HD*  1 1 
       3995 1 2 1 1  96 ILE HG13 .  96 . HG11 1 1 
       3996 1 1 1 1  95 PHE QD   .  95 . HD*  1 1 
       3996 1 2 1 1  99 ALA MB   .  99 . HB*  1 1 
       3997 1 1 1 1   4 ILE MG   .   4 . HG2* 1 1 
       3997 1 2 1 1  95 PHE QD   .  95 . HD*  1 1 
       3998 1 1 1 1  92 ILE HB   .  92 . HB   1 1 
       3998 1 2 1 1 125 PHE QD   . 125 . HD*  1 1 
       3999 1 1 1 1  95 PHE QD   .  95 . HD*  1 1 
       3999 1 2 1 1 106 VAL MG1  . 106 . HG1* 1 1 
       4000 1 1 1 1  32 LEU MD1  .  32 . HD1* 1 1 
       4000 1 2 1 1  95 PHE QD   .  95 . HD*  1 1 
       4001 1 1 1 1 148 PHE QE   . 148 . HE*  1 1 
       4001 1 2 1 1 152 VAL MG1  . 152 . HG1* 1 1 
       4002 1 1 1 1  84 VAL MG2  .  84 . HG2* 1 1 
       4002 1 2 1 1  95 PHE QD   .  95 . HD*  1 1 
       4003 1 1 1 1   6 VAL MG2  .   6 . HG2* 1 1 
       4003 1 2 1 1  95 PHE QD   .  95 . HD*  1 1 
       4004 1 1 1 1  92 ILE MD   .  92 . HD1* 1 1 
       4004 1 2 1 1 125 PHE QD   . 125 . HD*  1 1 
       4005 1 1 1 1   5 PHE QE   .   5 . HE*  1 1 
       4005 1 2 1 1 107 PHE QD   . 107 . HD*  1 1 
       4006 1 1 1 1   5 PHE QD   .   5 . HD*  1 1 
       4006 1 2 1 1 107 PHE QD   . 107 . HD*  1 1 
       4007 1 1 1 1 107 PHE H    . 107 . HN   1 1 
       4007 1 2 1 1 107 PHE QD   . 107 . HD*  1 1 
       4008 1 1 1 1 107 PHE QD   . 107 . HD*  1 1 
       4008 1 2 1 1 131 ASP HA   . 131 . HA   1 1 
       4009 1 1 1 1 107 PHE QD   . 107 . HD*  1 1 
       4009 1 2 1 1 131 ASP HB2  . 131 . HB2  1 1 
       4010 1 1 1 1 107 PHE QD   . 107 . HD*  1 1 
       4010 1 2 1 1 109 VAL MG2  . 109 . HG2* 1 1 
       4011 1 1 1 1 110 TYR QD   . 110 . HD*  1 1 
       4011 1 2 1 1 111 ASN H    . 111 . HN   1 1 
       4012 1 1 1 1 110 TYR H    . 110 . HN   1 1 
       4012 1 2 1 1 110 TYR QD   . 110 . HD*  1 1 
       4013 1 1 1 1 110 TYR QD   . 110 . HD*  1 1 
       4013 1 2 1 1 134 THR HA   . 134 . HA   1 1 
       4014 1 1 1 1 110 TYR QD   . 110 . HD*  1 1 
       4014 1 2 1 1 134 THR HB   . 134 . HB   1 1 
       4015 1 1 1 1 110 TYR QE   . 110 . HE*  1 1 
       4015 1 2 1 1 118 ARG HA   . 118 . HA   1 1 
       4016 1 1 1 1   8 PHE HB3  .   8 . HB1  1 1 
       4016 1 2 1 1 110 TYR QD   . 110 . HD*  1 1 
       4017 1 1 1 1 110 TYR QE   . 110 . HE*  1 1 
       4017 1 2 1 1 122 GLN HG3  . 122 . HG1  1 1 
       4018 1 1 1 1 110 TYR QE   . 110 . HE*  1 1 
       4018 1 2 1 1 122 GLN HG2  . 122 . HG2  1 1 
       4019 1 1 1 1 108 VAL HB   . 108 . HB   1 1 
       4019 1 2 1 1 110 TYR QE   . 110 . HE*  1 1 
       4020 1 1 1 1 110 TYR QE   . 110 . HE*  1 1 
       4020 1 2 1 1 132 VAL HB   . 132 . HB   1 1 
       4021 1 1 1 1 110 TYR QE   . 110 . HE*  1 1 
       4021 1 2 1 1 134 THR MG   . 134 . HG2* 1 1 
       4022 1 1 1 1 110 TYR QE   . 110 . HE*  1 1 
       4022 1 2 1 1 121 ALA MB   . 121 . HB*  1 1 
       4023 1 1 1 1 108 VAL MG1  . 108 . HG1* 1 1 
       4023 1 2 1 1 110 TYR QE   . 110 . HE*  1 1 
       4024 1 1 1 1   8 PHE HB2  .   8 . HB2  1 1 
       4024 1 2 1 1 110 TYR QD   . 110 . HD*  1 1 
       4025 1 1 1 1 110 TYR QD   . 110 . HD*  1 1 
       4025 1 2 1 1 134 THR MG   . 134 . HG2* 1 1 
       4026 1 1 1 1  92 ILE MD   .  92 . HD1* 1 1 
       4026 1 2 1 1 110 TYR QD   . 110 . HD*  1 1 
       4027 1 1 1 1  92 ILE MG   .  92 . HG2* 1 1 
       4027 1 2 1 1 110 TYR QD   . 110 . HD*  1 1 
       4028 1 1 1 1  92 ILE MG   .  92 . HG2* 1 1 
       4028 1 2 1 1 110 TYR QE   . 110 . HE*  1 1 
       4029 1 1 1 1 124 GLU HG3  . 124 . HG1  1 1 
       4029 1 2 1 1 125 PHE QD   . 125 . HD*  1 1 
       4030 1 1 1 1  81 VAL MG2  .  81 . HG2* 1 1 
       4030 1 2 1 1 148 PHE QD   . 148 . HD*  1 1 
       4031 1 1 1 1 148 PHE QD   . 148 . HD*  1 1 
       4031 1 2 1 1 152 VAL MG1  . 152 . HG1* 1 1 
       4032 1 1 1 1   5 PHE QD   .   5 . HD*  1 1 
       4032 1 2 1 1  81 VAL HA   .  81 . HA   1 1 
       4033 1 1 1 1  75 TYR QD   .  75 . HD*  1 1 
       4033 1 2 1 1  80 VAL MG2  .  80 . HG2* 1 1 
       4034 1 1 1 1  75 TYR QD   .  75 . HD*  1 1 
       4034 1 2 1 1  80 VAL MG1  .  80 . HG1* 1 1 
       4035 1 1 1 1  75 TYR QE   .  75 . HE*  1 1 
       4035 1 2 1 1  80 VAL MG2  .  80 . HG2* 1 1 
       4036 1 1 1 1  75 TYR QE   .  75 . HE*  1 1 
       4036 1 2 1 1  80 VAL MG1  .  80 . HG1* 1 1 
       4037 1 1 1 1 110 TYR QE   . 110 . HE*  1 1 
       4037 1 2 1 1 125 PHE QD   . 125 . HD*  1 1 
       4038 1 1 1 1  68 ILE HG12 .  68 . HG12 1 1 
       4038 1 2 1 1  95 PHE QD   .  95 . HD*  1 1 
       4039 1 1 1 1  92 ILE MG   .  92 . HG2* 1 1 
       4039 1 2 1 1 125 PHE QD   . 125 . HD*  1 1 
       4040 1 1 1 1 121 ALA MB   . 121 . HB*  1 1 
       4040 1 2 1 1 125 PHE HZ   . 125 . HZ   1 1 
       4041 1 1 1 1  92 ILE HG13 .  92 . HG11 1 1 
       4041 1 2 1 1 125 PHE HZ   . 125 . HZ   1 1 
       4042 1 1 1 1  96 ILE MD   .  96 . HD1* 1 1 
       4042 1 2 1 1 125 PHE HZ   . 125 . HZ   1 1 
       4043 1 1 1 1   5 PHE QD   .   5 . HD*  1 1 
       4043 1 2 1 1 148 PHE HB3  . 148 . HB1  1 1 
       4044 1 1 1 1   5 PHE QD   .   5 . HD*  1 1 
       4044 1 2 1 1 148 PHE HB2  . 148 . HB2  1 1 
       4045 1 1 1 1   8 PHE QE   .   8 . HE*  1 1 
       4045 1 2 1 1  64 PHE QE   .  64 . HE*  1 1 
       4046 1 1 1 1  64 PHE QD   .  64 . HD*  1 1 
       4046 1 2 1 1  91 TRP HE3  .  91 . HE3  1 1 
       4047 1 1 1 1 107 PHE QD   . 107 . HD*  1 1 
       4047 1 2 1 1 131 ASP HB3  . 131 . HB1  1 1 
       4048 1 1 1 1 107 PHE QD   . 107 . HD*  1 1 
       4048 1 2 1 1 133 ARG HG2  . 133 . HG2  1 1 
       4049 1 1 1 1 107 PHE QD   . 107 . HD*  1 1 
       4049 1 2 1 1 133 ARG HG3  . 133 . HG1  1 1 
       4050 1 1 1 1 107 PHE QD   . 107 . HD*  1 1 
       4050 1 2 1 1 133 ARG HB2  . 133 . HB2  1 1 
       4051 1 1 1 1 107 PHE HZ   . 107 . HZ   1 1 
       4051 1 2 1 1 133 ARG HB2  . 133 . HB2  1 1 
       4052 1 1 1 1 107 PHE HZ   . 107 . HZ   1 1 
       4052 1 2 1 1 133 ARG HG2  . 133 . HG2  1 1 
       4053 1 1 1 1 107 PHE HZ   . 107 . HZ   1 1 
       4053 1 2 1 1 133 ARG HG3  . 133 . HG1  1 1 
       4054 1 1 1 1 107 PHE HZ   . 107 . HZ   1 1 
       4054 1 2 1 1 109 VAL MG2  . 109 . HG2* 1 1 
       4055 1 1 1 1   5 PHE QE   .   5 . HE*  1 1 
       4055 1 2 1 1 107 PHE QE   . 107 . HE*  1 1 
       4056 1 1 1 1 107 PHE HA   . 107 . HA   1 1 
       4056 1 2 1 1 107 PHE QE   . 107 . HE*  1 1 
       4057 1 1 1 1 107 PHE QE   . 107 . HE*  1 1 
       4057 1 2 1 1 144 GLN HG3  . 144 . HG1  1 1 
       4058 1 1 1 1 107 PHE QE   . 107 . HE*  1 1 
       4058 1 2 1 1 133 ARG HB2  . 133 . HB2  1 1 
       4059 1 1 1 1  95 PHE QE   .  95 . HE*  1 1 
       4059 1 2 1 1 106 VAL HA   . 106 . HA   1 1 
       4060 1 1 1 1   4 ILE HG12 .   4 . HG12 1 1 
       4060 1 2 1 1  95 PHE HZ   .  95 . HZ   1 1 
       4061 1 1 1 1   6 VAL HB   .   6 . HB   1 1 
       4061 1 2 1 1  95 PHE HZ   .  95 . HZ   1 1 
       4062 1 1 1 1   4 ILE MG   .   4 . HG2* 1 1 
       4062 1 2 1 1  95 PHE HZ   .  95 . HZ   1 1 
       4063 1 1 1 1   4 ILE HG13 .   4 . HG11 1 1 
       4063 1 2 1 1  95 PHE HZ   .  95 . HZ   1 1 
       4064 1 1 1 1  95 PHE HZ   .  95 . HZ   1 1 
       4064 1 2 1 1 106 VAL MG1  . 106 . HG1* 1 1 
       4065 1 1 1 1  82 VAL MG2  .  82 . HG2* 1 1 
       4065 1 2 1 1  95 PHE HZ   .  95 . HZ   1 1 
       4066 1 1 1 1  71 ILE MD   .  71 . HD1* 1 1 
       4066 1 2 1 1  95 PHE HZ   .  95 . HZ   1 1 
       4067 1 1 1 1  82 VAL MG1  .  82 . HG1* 1 1 
       4067 1 2 1 1  95 PHE HZ   .  95 . HZ   1 1 
       4068 1 1 1 1   6 VAL MG1  .   6 . HG1* 1 1 
       4068 1 2 1 1  95 PHE HZ   .  95 . HZ   1 1 
       4069 1 1 1 1  68 ILE MG   .  68 . HG2* 1 1 
       4069 1 2 1 1  95 PHE HZ   .  95 . HZ   1 1 
       4070 1 1 1 1   6 VAL MG2  .   6 . HG2* 1 1 
       4070 1 2 1 1  95 PHE HZ   .  95 . HZ   1 1 
       4071 1 1 1 1   4 ILE MD   .   4 . HD1* 1 1 
       4071 1 2 1 1  95 PHE QE   .  95 . HE*  1 1 
       4072 1 1 1 1  68 ILE HG13 .  68 . HG11 1 1 
       4072 1 2 1 1  95 PHE QE   .  95 . HE*  1 1 
       4073 1 1 1 1  19 VAL MG2  .  19 . HG2* 1 1 
       4073 1 2 1 1  48 PHE QE   .  48 . HE*  1 1 
       4074 1 1 1 1  15 LEU MD2  .  15 . HD2* 1 1 
       4074 1 2 1 1  48 PHE QE   .  48 . HE*  1 1 
       4075 1 1 1 1  84 VAL MG2  .  84 . HG2* 1 1 
       4075 1 2 1 1  95 PHE QE   .  95 . HE*  1 1 
       4076 1 1 1 1  31 LEU MD2  .  31 . HD2* 1 1 
       4076 1 2 1 1  48 PHE QE   .  48 . HE*  1 1 
       4077 1 1 1 1   6 VAL HB   .   6 . HB   1 1 
       4077 1 2 1 1  95 PHE QE   .  95 . HE*  1 1 
       4078 1 1 1 1  89 LYS HB2  .  89 . HB2  1 1 
       4078 1 2 1 1 125 PHE HZ   . 125 . HZ   1 1 
       4079 1 1 1 1  89 LYS HB3  .  89 . HB1  1 1 
       4079 1 2 1 1 125 PHE HZ   . 125 . HZ   1 1 
       4080 1 1 1 1  89 LYS HG2  .  89 . HG2  1 1 
       4080 1 2 1 1 125 PHE HZ   . 125 . HZ   1 1 
       4081 1 1 1 1  89 LYS HG3  .  89 . HG1  1 1 
       4081 1 2 1 1 125 PHE HZ   . 125 . HZ   1 1 
       4082 1 1 1 1  92 ILE HB   .  92 . HB   1 1 
       4082 1 2 1 1 125 PHE HZ   . 125 . HZ   1 1 
       4083 1 1 1 1  93 LYS HA   .  93 . HA   1 1 
       4083 1 2 1 1 125 PHE QD   . 125 . HD*  1 1 
       4084 1 1 1 1  93 LYS HB3  .  93 . HB1  1 1 
       4084 1 2 1 1 125 PHE QE   . 125 . HE*  1 1 
       4085 1 1 1 1  89 LYS HB2  .  89 . HB2  1 1 
       4085 1 2 1 1 125 PHE QE   . 125 . HE*  1 1 
       4086 1 1 1 1  89 LYS HB3  .  89 . HB1  1 1 
       4086 1 2 1 1 125 PHE QE   . 125 . HE*  1 1 
       4087 1 1 1 1 121 ALA MB   . 121 . HB*  1 1 
       4087 1 2 1 1 125 PHE QE   . 125 . HE*  1 1 
       4088 1 1 1 1  64 PHE QE   .  64 . HE*  1 1 
       4088 1 2 1 1  95 PHE QD   .  95 . HD*  1 1 
       4089 1 1 1 1 107 PHE HZ   . 107 . HZ   1 1 
       4089 1 2 1 1 144 GLN HB3  . 144 . HB1  1 1 
       4090 1 1 1 1 107 PHE HZ   . 107 . HZ   1 1 
       4090 1 2 1 1 109 VAL HB   . 109 . HB   1 1 
       4091 1 1 1 1 145 VAL HA   . 145 . HA   1 1 
       4091 1 2 1 1 148 PHE QD   . 148 . HD*  1 1 
       4092 1 1 1 1   8 PHE HZ   .   8 . HZ   1 1 
       4092 1 2 1 1  64 PHE HZ   .  64 . HZ   1 1 
       4093 1 1 1 1   8 PHE QD   .   8 . HD*  1 1 
       4093 1 2 1 1 110 TYR HB3  . 110 . HB1  1 1 
       4094 1 1 1 1   8 PHE QD   .   8 . HD*  1 1 
       4094 1 2 1 1 108 VAL HA   . 108 . HA   1 1 
       4095 1 1 1 1  33 TYR QD   .  33 . HD*  1 1 
       4095 1 2 1 1  44 ARG HB3  .  44 . HB1  1 1 
       4096 1 1 1 1   2 SER QB   .   2 . HB*  1 1 
       4096 1 2 1 1   3 GLN H    .   3 . HN   1 1 
       4097 1 1 1 1   2 SER QB   .   2 . HB*  1 1 
       4097 1 2 1 1  78 LEU QB   .  78 . HB*  1 1 
       4098 1 1 1 1   2 SER QB   .   2 . HB*  1 1 
       4098 1 2 1 1  78 LEU HG   .  78 . HG   1 1 
       4099 1 1 1 1   2 SER QB   .   2 . HB*  1 1 
       4099 1 2 1 1  78 LEU MD1  .  78 . HD1* 1 1 
       4100 1 1 1 1   2 SER QB   .   2 . HB*  1 1 
       4100 1 2 1 1  78 LEU MD2  .  78 . HD2* 1 1 
       4101 1 1 1 1   2 SER QB   .   2 . HB*  1 1 
       4101 1 2 1 1 104 VAL HA   . 104 . HA   1 1 
       4102 1 1 1 1   2 SER QB   .   2 . HB*  1 1 
       4102 1 2 1 1 104 VAL HB   . 104 . HB   1 1 
       4103 1 1 1 1   2 SER QB   .   2 . HB*  1 1 
       4103 1 2 1 1 104 VAL MG1  . 104 . HG1* 1 1 
       4104 1 1 1 1   2 SER QB   .   2 . HB*  1 1 
       4104 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       4105 1 1 1 1   3 GLN HA   .   3 . HA   1 1 
       4105 1 2 1 1   3 GLN QG   .   3 . HG*  1 1 
       4106 1 1 1 1   3 GLN HA   .   3 . HA   1 1 
       4106 1 2 1 1 105 GLU QG   . 105 . HG*  1 1 
       4107 1 1 1 1   3 GLN HB2  .   3 . HB2  1 1 
       4107 1 2 1 1   3 GLN QE   .   3 . HE*  1 1 
       4108 1 1 1 1   3 GLN HB3  .   3 . HB1  1 1 
       4108 1 2 1 1   3 GLN QE   .   3 . HE*  1 1 
       4109 1 1 1 1   3 GLN QG   .   3 . HG*  1 1 
       4109 1 2 1 1   4 ILE H    .   4 . HN   1 1 
       4110 1 1 1 1   3 GLN QG   .   3 . HG*  1 1 
       4110 1 2 1 1   4 ILE MG   .   4 . HG2* 1 1 
       4111 1 1 1 1   3 GLN QG   .   3 . HG*  1 1 
       4111 1 2 1 1 105 GLU H    . 105 . HN   1 1 
       4112 1 1 1 1   3 GLN QG   .   3 . HG*  1 1 
       4112 1 2 1 1 106 VAL H    . 106 . HN   1 1 
       4113 1 1 1 1   3 GLN QG   .   3 . HG*  1 1 
       4113 1 2 1 1 106 VAL HA   . 106 . HA   1 1 
       4114 1 1 1 1   3 GLN QG   .   3 . HG*  1 1 
       4114 1 2 1 1 107 PHE H    . 107 . HN   1 1 
       4115 1 1 1 1   3 GLN QG   .   3 . HG*  1 1 
       4115 1 2 1 1 107 PHE HB2  . 107 . HB2  1 1 
       4116 1 1 1 1   3 GLN QG   .   3 . HG*  1 1 
       4116 1 2 1 1 107 PHE HB3  . 107 . HB1  1 1 
       4117 1 1 1 1   3 GLN QG   .   3 . HG*  1 1 
       4117 1 2 1 1 107 PHE QE   . 107 . HE*  1 1 
       4118 1 1 1 1   3 GLN QE   .   3 . HE*  1 1 
       4118 1 2 1 1 107 PHE QE   . 107 . HE*  1 1 
       4119 1 1 1 1   3 GLN QE   .   3 . HE*  1 1 
       4119 1 2 1 1 151 LYS QE   . 151 . HE*  1 1 
       4120 1 1 1 1   4 ILE HA   .   4 . HA   1 1 
       4120 1 2 1 1   4 ILE QG   .   4 . HG1* 1 1 
       4121 1 1 1 1   4 ILE HA   .   4 . HA   1 1 
       4121 1 2 1 1   5 PHE QB   .   5 . HB*  1 1 
       4122 1 1 1 1   4 ILE QG   .   4 . HG1* 1 1 
       4122 1 2 1 1   4 ILE MG   .   4 . HG2* 1 1 
       4123 1 1 1 1   4 ILE QG   .   4 . HG1* 1 1 
       4123 1 2 1 1   5 PHE H    .   5 . HN   1 1 
       4124 1 1 1 1   4 ILE QG   .   4 . HG1* 1 1 
       4124 1 2 1 1   5 PHE QB   .   5 . HB*  1 1 
       4125 1 1 1 1   4 ILE QG   .   4 . HG1* 1 1 
       4125 1 2 1 1   6 VAL MG1  .   6 . HG1* 1 1 
       4126 1 1 1 1   4 ILE QG   .   4 . HG1* 1 1 
       4126 1 2 1 1   6 VAL MG2  .   6 . HG2* 1 1 
       4127 1 1 1 1   4 ILE QG   .   4 . HG1* 1 1 
       4127 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
       4128 1 1 1 1   4 ILE QG   .   4 . HG1* 1 1 
       4128 1 2 1 1  72 TRP HZ3  .  72 . HZ3  1 1 
       4129 1 1 1 1   4 ILE QG   .   4 . HG1* 1 1 
       4129 1 2 1 1  78 LEU MD1  .  78 . HD1* 1 1 
       4130 1 1 1 1   4 ILE QG   .   4 . HG1* 1 1 
       4130 1 2 1 1  80 VAL H    .  80 . HN   1 1 
       4131 1 1 1 1   4 ILE QG   .   4 . HG1* 1 1 
       4131 1 2 1 1  80 VAL MG2  .  80 . HG2* 1 1 
       4132 1 1 1 1   4 ILE QG   .   4 . HG1* 1 1 
       4132 1 2 1 1  82 VAL MG2  .  82 . HG2* 1 1 
       4133 1 1 1 1   4 ILE QG   .   4 . HG1* 1 1 
       4133 1 2 1 1  95 PHE HZ   .  95 . HZ   1 1 
       4134 1 1 1 1   4 ILE QG   .   4 . HG1* 1 1 
       4134 1 2 1 1 106 VAL HA   . 106 . HA   1 1 
       4135 1 1 1 1   5 PHE H    .   5 . HN   1 1 
       4135 1 2 1 1   5 PHE QB   .   5 . HB*  1 1 
       4136 1 1 1 1   5 PHE QB   .   5 . HB*  1 1 
       4136 1 2 1 1   6 VAL H    .   6 . HN   1 1 
       4137 1 1 1 1   5 PHE QB   .   5 . HB*  1 1 
       4137 1 2 1 1   7 VAL MG2  .   7 . HG2* 1 1 
       4138 1 1 1 1   5 PHE QB   .   5 . HB*  1 1 
       4138 1 2 1 1  81 VAL MG2  .  81 . HG2* 1 1 
       4139 1 1 1 1   5 PHE QB   .   5 . HB*  1 1 
       4139 1 2 1 1 148 PHE QD   . 148 . HD*  1 1 
       4140 1 1 1 1   5 PHE QB   .   5 . HB*  1 1 
       4140 1 2 1 1 148 PHE QE   . 148 . HE*  1 1 
       4141 1 1 1 1   5 PHE QB   .   5 . HB*  1 1 
       4141 1 2 1 1 148 PHE HZ   . 148 . HZ   1 1 
       4142 1 1 1 1   5 PHE QB   .   5 . HB*  1 1 
       4142 1 2 1 1 152 VAL MG1  . 152 . HG1* 1 1 
       4143 1 1 1 1   5 PHE QD   .   5 . HD*  1 1 
       4143 1 2 1 1 148 PHE QB   . 148 . HB*  1 1 
       4144 1 1 1 1   5 PHE QD   .   5 . HD*  1 1 
       4144 1 2 1 1 151 LYS QE   . 151 . HE*  1 1 
       4145 1 1 1 1   5 PHE QE   .   5 . HE*  1 1 
       4145 1 2 1 1 148 PHE QB   . 148 . HB*  1 1 
       4146 1 1 1 1   5 PHE QE   .   5 . HE*  1 1 
       4146 1 2 1 1 151 LYS QG   . 151 . HG*  1 1 
       4147 1 1 1 1   5 PHE QE   .   5 . HE*  1 1 
       4147 1 2 1 1 151 LYS QD   . 151 . HD*  1 1 
       4148 1 1 1 1   5 PHE QE   .   5 . HE*  1 1 
       4148 1 2 1 1 151 LYS QE   . 151 . HE*  1 1 
       4149 1 1 1 1   5 PHE HZ   .   5 . HZ   1 1 
       4149 1 2 1 1 148 PHE QB   . 148 . HB*  1 1 
       4150 1 1 1 1   8 PHE HB3  .   8 . HB1  1 1 
       4150 1 2 1 1  87 ASP QB   .  87 . HB*  1 1 
       4151 1 1 1 1   9 SER HG   .   9 . HG   1 1 
       4151 1 2 1 1  11 ASP QB   .  11 . HB*  1 1 
       4152 1 1 1 1  10 SER QB   .  10 . HB*  1 1 
       4152 1 2 1 1  11 ASP H    .  11 . HN   1 1 
       4153 1 1 1 1  10 SER QB   .  10 . HB*  1 1 
       4153 1 2 1 1  11 ASP QB   .  11 . HB*  1 1 
       4154 1 1 1 1  10 SER QB   .  10 . HB*  1 1 
       4154 1 2 1 1  85 THR HA   .  85 . HA   1 1 
       4155 1 1 1 1  10 SER QB   .  10 . HB*  1 1 
       4155 1 2 1 1  86 THR H    .  86 . HN   1 1 
       4156 1 1 1 1  10 SER QB   .  10 . HB*  1 1 
       4156 1 2 1 1  86 THR HA   .  86 . HA   1 1 
       4157 1 1 1 1  10 SER QB   .  10 . HB*  1 1 
       4157 1 2 1 1  87 ASP H    .  87 . HN   1 1 
       4158 1 1 1 1  11 ASP H    .  11 . HN   1 1 
       4158 1 2 1 1  11 ASP QB   .  11 . HB*  1 1 
       4159 1 1 1 1  11 ASP QB   .  11 . HB*  1 1 
       4159 1 2 1 1  12 PRO HD2  .  12 . HD2  1 1 
       4160 1 1 1 1  11 ASP QB   .  11 . HB*  1 1 
       4160 1 2 1 1  12 PRO HD3  .  12 . HD1  1 1 
       4161 1 1 1 1  11 ASP QB   .  11 . HB*  1 1 
       4161 1 2 1 1  13 GLU H    .  13 . HN   1 1 
       4162 1 1 1 1  11 ASP QB   .  11 . HB*  1 1 
       4162 1 2 1 1  14 ILE H    .  14 . HN   1 1 
       4163 1 1 1 1  11 ASP QB   .  11 . HB*  1 1 
       4163 1 2 1 1  14 ILE HB   .  14 . HB   1 1 
       4164 1 1 1 1  11 ASP QB   .  11 . HB*  1 1 
       4164 1 2 1 1  14 ILE MG   .  14 . HG2* 1 1 
       4165 1 1 1 1  11 ASP QB   .  11 . HB*  1 1 
       4165 1 2 1 1  14 ILE HG12 .  14 . HG12 1 1 
       4166 1 1 1 1  11 ASP QB   .  11 . HB*  1 1 
       4166 1 2 1 1  14 ILE HG13 .  14 . HG11 1 1 
       4167 1 1 1 1  11 ASP QB   .  11 . HB*  1 1 
       4167 1 2 1 1  14 ILE MD   .  14 . HD1* 1 1 
       4168 1 1 1 1  12 PRO HD2  .  12 . HD2  1 1 
       4168 1 2 1 1  13 GLU QG   .  13 . HG*  1 1 
       4169 1 1 1 1  13 GLU HA   .  13 . HA   1 1 
       4169 1 2 1 1  13 GLU QG   .  13 . HG*  1 1 
       4170 1 1 1 1  13 GLU HA   .  13 . HA   1 1 
       4170 1 2 1 1  16 LYS QB   .  16 . HB*  1 1 
       4171 1 1 1 1  13 GLU HB2  .  13 . HB2  1 1 
       4171 1 2 1 1  13 GLU QG   .  13 . HG*  1 1 
       4172 1 1 1 1  13 GLU HB3  .  13 . HB1  1 1 
       4172 1 2 1 1  13 GLU QG   .  13 . HG*  1 1 
       4173 1 1 1 1  13 GLU QG   .  13 . HG*  1 1 
       4173 1 2 1 1  14 ILE H    .  14 . HN   1 1 
       4174 1 1 1 1  14 ILE H    .  14 . HN   1 1 
       4174 1 2 1 1  16 LYS QB   .  16 . HB*  1 1 
       4175 1 1 1 1  14 ILE HA   .  14 . HA   1 1 
       4175 1 2 1 1 138 LYS QG   . 138 . HG*  1 1 
       4176 1 1 1 1  14 ILE HA   .  14 . HA   1 1 
       4176 1 2 1 1 138 LYS QD   . 138 . HD*  1 1 
       4177 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
       4177 1 2 1 1 138 LYS QG   . 138 . HG*  1 1 
       4178 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
       4178 1 2 1 1 138 LYS QE   . 138 . HE*  1 1 
       4179 1 1 1 1  14 ILE HG12 .  14 . HG12 1 1 
       4179 1 2 1 1 138 LYS QD   . 138 . HD*  1 1 
       4180 1 1 1 1  14 ILE HG13 .  14 . HG11 1 1 
       4180 1 2 1 1 138 LYS QG   . 138 . HG*  1 1 
       4181 1 1 1 1  14 ILE HG13 .  14 . HG11 1 1 
       4181 1 2 1 1 138 LYS QD   . 138 . HD*  1 1 
       4182 1 1 1 1  14 ILE MD   .  14 . HD1* 1 1 
       4182 1 2 1 1 138 LYS QG   . 138 . HG*  1 1 
       4183 1 1 1 1  14 ILE MD   .  14 . HD1* 1 1 
       4183 1 2 1 1 138 LYS QD   . 138 . HD*  1 1 
       4184 1 1 1 1  15 LEU H    .  15 . HN   1 1 
       4184 1 2 1 1  16 LYS QB   .  16 . HB*  1 1 
       4185 1 1 1 1  16 LYS H    .  16 . HN   1 1 
       4185 1 2 1 1  16 LYS QB   .  16 . HB*  1 1 
       4186 1 1 1 1  16 LYS H    .  16 . HN   1 1 
       4186 1 2 1 1  16 LYS QG   .  16 . HG*  1 1 
       4187 1 1 1 1  16 LYS H    .  16 . HN   1 1 
       4187 1 2 1 1  16 LYS QD   .  16 . HD*  1 1 
       4188 1 1 1 1  16 LYS HA   .  16 . HA   1 1 
       4188 1 2 1 1  16 LYS QG   .  16 . HG*  1 1 
       4189 1 1 1 1  16 LYS HA   .  16 . HA   1 1 
       4189 1 2 1 1  16 LYS QD   .  16 . HD*  1 1 
       4190 1 1 1 1  16 LYS QB   .  16 . HB*  1 1 
       4190 1 2 1 1  16 LYS QD   .  16 . HD*  1 1 
       4191 1 1 1 1  16 LYS QB   .  16 . HB*  1 1 
       4191 1 2 1 1  16 LYS QE   .  16 . HE*  1 1 
       4192 1 1 1 1  16 LYS QB   .  16 . HB*  1 1 
       4192 1 2 1 1  17 GLU H    .  17 . HN   1 1 
       4193 1 1 1 1  16 LYS QB   .  16 . HB*  1 1 
       4193 1 2 1 1  48 PHE QE   .  48 . HE*  1 1 
       4194 1 1 1 1  16 LYS QB   .  16 . HB*  1 1 
       4194 1 2 1 1  48 PHE HZ   .  48 . HZ   1 1 
       4195 1 1 1 1  16 LYS QD   .  16 . HD*  1 1 
       4195 1 2 1 1  16 LYS QG   .  16 . HG*  1 1 
       4196 1 1 1 1  16 LYS QE   .  16 . HE*  1 1 
       4196 1 2 1 1  16 LYS QG   .  16 . HG*  1 1 
       4197 1 1 1 1  16 LYS QG   .  16 . HG*  1 1 
       4197 1 2 1 1  17 GLU H    .  17 . HN   1 1 
       4198 1 1 1 1  16 LYS QG   .  16 . HG*  1 1 
       4198 1 2 1 1  48 PHE QD   .  48 . HD*  1 1 
       4199 1 1 1 1  16 LYS QG   .  16 . HG*  1 1 
       4199 1 2 1 1  48 PHE QE   .  48 . HE*  1 1 
       4200 1 1 1 1  16 LYS QG   .  16 . HG*  1 1 
       4200 1 2 1 1  48 PHE HZ   .  48 . HZ   1 1 
       4201 1 1 1 1  16 LYS QG   .  16 . HG*  1 1 
       4201 1 2 1 1  51 GLN HE22 .  51 . HE22 1 1 
       4202 1 1 1 1  16 LYS QD   .  16 . HD*  1 1 
       4202 1 2 1 1  48 PHE QE   .  48 . HE*  1 1 
       4203 1 1 1 1  16 LYS QD   .  16 . HD*  1 1 
       4203 1 2 1 1  48 PHE HZ   .  48 . HZ   1 1 
       4204 1 1 1 1  17 GLU H    .  17 . HN   1 1 
       4204 1 2 1 1 138 LYS QG   . 138 . HG*  1 1 
       4205 1 1 1 1  17 GLU H    .  17 . HN   1 1 
       4205 1 2 1 1 138 LYS QD   . 138 . HD*  1 1 
       4206 1 1 1 1  17 GLU HB2  .  17 . HB2  1 1 
       4206 1 2 1 1  20 ARG QD   .  20 . HD*  1 1 
       4207 1 1 1 1  17 GLU HB2  .  17 . HB2  1 1 
       4207 1 2 1 1 138 LYS QG   . 138 . HG*  1 1 
       4208 1 1 1 1  17 GLU HB2  .  17 . HB2  1 1 
       4208 1 2 1 1 138 LYS QD   . 138 . HD*  1 1 
       4209 1 1 1 1  17 GLU HB3  .  17 . HB1  1 1 
       4209 1 2 1 1 138 LYS QD   . 138 . HD*  1 1 
       4210 1 1 1 1  17 GLU HB3  .  17 . HB1  1 1 
       4210 1 2 1 1 138 LYS QE   . 138 . HE*  1 1 
       4211 1 1 1 1  17 GLU HG3  .  17 . HG1  1 1 
       4211 1 2 1 1 138 LYS QG   . 138 . HG*  1 1 
       4212 1 1 1 1  17 GLU HG3  .  17 . HG1  1 1 
       4212 1 2 1 1 138 LYS QD   . 138 . HD*  1 1 
       4213 1 1 1 1  17 GLU HG3  .  17 . HG1  1 1 
       4213 1 2 1 1 138 LYS QE   . 138 . HE*  1 1 
       4214 1 1 1 1  18 ILE HA   .  18 . HA   1 1 
       4214 1 2 1 1  21 GLU QG   .  21 . HG*  1 1 
       4215 1 1 1 1  18 ILE HG12 .  18 . HG12 1 1 
       4215 1 2 1 1 138 LYS QG   . 138 . HG*  1 1 
       4216 1 1 1 1  19 VAL HA   .  19 . HA   1 1 
       4216 1 2 1 1  29 VAL QG   .  29 . HG*  1 1 
       4217 1 1 1 1  19 VAL MG1  .  19 . HG1* 1 1 
       4217 1 2 1 1  23 LYS QD   .  23 . HD*  1 1 
       4218 1 1 1 1  20 ARG H    .  20 . HN   1 1 
       4218 1 2 1 1  20 ARG QD   .  20 . HD*  1 1 
       4219 1 1 1 1  20 ARG H    .  20 . HN   1 1 
       4219 1 2 1 1  21 GLU QG   .  21 . HG*  1 1 
       4220 1 1 1 1  20 ARG HA   .  20 . HA   1 1 
       4220 1 2 1 1  20 ARG QD   .  20 . HD*  1 1 
       4221 1 1 1 1  20 ARG HB2  .  20 . HB2  1 1 
       4221 1 2 1 1  20 ARG QD   .  20 . HD*  1 1 
       4222 1 1 1 1  20 ARG HB3  .  20 . HB1  1 1 
       4222 1 2 1 1  20 ARG QD   .  20 . HD*  1 1 
       4223 1 1 1 1  20 ARG HG2  .  20 . HG2  1 1 
       4223 1 2 1 1  21 GLU QG   .  21 . HG*  1 1 
       4224 1 1 1 1  20 ARG HG3  .  20 . HG1  1 1 
       4224 1 2 1 1  21 GLU QG   .  21 . HG*  1 1 
       4225 1 1 1 1  20 ARG QD   .  20 . HD*  1 1 
       4225 1 2 1 1  21 GLU H    .  21 . HN   1 1 
       4226 1 1 1 1  20 ARG QD   .  20 . HD*  1 1 
       4226 1 2 1 1  21 GLU QG   .  21 . HG*  1 1 
       4227 1 1 1 1  21 GLU H    .  21 . HN   1 1 
       4227 1 2 1 1  21 GLU QG   .  21 . HG*  1 1 
       4228 1 1 1 1  21 GLU HA   .  21 . HA   1 1 
       4228 1 2 1 1  21 GLU QG   .  21 . HG*  1 1 
       4229 1 1 1 1  21 GLU HA   .  21 . HA   1 1 
       4229 1 2 1 1  24 ARG QB   .  24 . HB*  1 1 
       4230 1 1 1 1  21 GLU HA   .  21 . HA   1 1 
       4230 1 2 1 1  24 ARG QG   .  24 . HG*  1 1 
       4231 1 1 1 1  21 GLU HA   .  21 . HA   1 1 
       4231 1 2 1 1  24 ARG QD   .  24 . HD*  1 1 
       4232 1 1 1 1  21 GLU HB2  .  21 . HB2  1 1 
       4232 1 2 1 1  21 GLU QG   .  21 . HG*  1 1 
       4233 1 1 1 1  21 GLU QG   .  21 . HG*  1 1 
       4233 1 2 1 1  22 ILE H    .  22 . HN   1 1 
       4234 1 1 1 1  21 GLU QG   .  21 . HG*  1 1 
       4234 1 2 1 1  25 GLN HE21 .  25 . HE21 1 1 
       4235 1 1 1 1  21 GLU QG   .  21 . HG*  1 1 
       4235 1 2 1 1 142 ILE MG   . 142 . HG2* 1 1 
       4236 1 1 1 1  21 GLU QG   .  21 . HG*  1 1 
       4236 1 2 1 1 142 ILE HG12 . 142 . HG12 1 1 
       4237 1 1 1 1  21 GLU QG   .  21 . HG*  1 1 
       4237 1 2 1 1 142 ILE HG13 . 142 . HG11 1 1 
       4238 1 1 1 1  21 GLU QG   .  21 . HG*  1 1 
       4238 1 2 1 1 142 ILE MD   . 142 . HD1* 1 1 
       4239 1 1 1 1  21 GLU QG   .  21 . HG*  1 1 
       4239 1 2 1 1 145 VAL HB   . 145 . HB   1 1 
       4240 1 1 1 1  22 ILE HB   .  22 . HB   1 1 
       4240 1 2 1 1  29 VAL QG   .  29 . HG*  1 1 
       4241 1 1 1 1  22 ILE MD   .  22 . HD1* 1 1 
       4241 1 2 1 1  29 VAL QG   .  29 . HG*  1 1 
       4242 1 1 1 1  23 LYS H    .  23 . HN   1 1 
       4242 1 2 1 1  23 LYS QE   .  23 . HE*  1 1 
       4243 1 1 1 1  23 LYS H    .  23 . HN   1 1 
       4243 1 2 1 1  29 VAL QG   .  29 . HG*  1 1 
       4244 1 1 1 1  23 LYS HA   .  23 . HA   1 1 
       4244 1 2 1 1  23 LYS QD   .  23 . HD*  1 1 
       4245 1 1 1 1  23 LYS HA   .  23 . HA   1 1 
       4245 1 2 1 1  23 LYS QE   .  23 . HE*  1 1 
       4246 1 1 1 1  23 LYS HA   .  23 . HA   1 1 
       4246 1 2 1 1  29 VAL QG   .  29 . HG*  1 1 
       4247 1 1 1 1  23 LYS HB2  .  23 . HB2  1 1 
       4247 1 2 1 1  29 VAL QG   .  29 . HG*  1 1 
       4248 1 1 1 1  23 LYS HB3  .  23 . HB1  1 1 
       4248 1 2 1 1  23 LYS QD   .  23 . HD*  1 1 
       4249 1 1 1 1  23 LYS HB3  .  23 . HB1  1 1 
       4249 1 2 1 1  23 LYS QE   .  23 . HE*  1 1 
       4250 1 1 1 1  23 LYS HB3  .  23 . HB1  1 1 
       4250 1 2 1 1  29 VAL QG   .  29 . HG*  1 1 
       4251 1 1 1 1  23 LYS QD   .  23 . HD*  1 1 
       4251 1 2 1 1  23 LYS HG2  .  23 . HG2  1 1 
       4252 1 1 1 1  23 LYS HG2  .  23 . HG2  1 1 
       4252 1 2 1 1  29 VAL QG   .  29 . HG*  1 1 
       4253 1 1 1 1  23 LYS QE   .  23 . HE*  1 1 
       4253 1 2 1 1  23 LYS HG3  .  23 . HG1  1 1 
       4254 1 1 1 1  23 LYS HG3  .  23 . HG1  1 1 
       4254 1 2 1 1  29 VAL QG   .  29 . HG*  1 1 
       4255 1 1 1 1  23 LYS QD   .  23 . HD*  1 1 
       4255 1 2 1 1  29 VAL QG   .  29 . HG*  1 1 
       4256 1 1 1 1  23 LYS QD   .  23 . HD*  1 1 
       4256 1 2 1 1  53 VAL MG2  .  53 . HG2* 1 1 
       4257 1 1 1 1  23 LYS QE   .  23 . HE*  1 1 
       4257 1 2 1 1  24 ARG H    .  24 . HN   1 1 
       4258 1 1 1 1  23 LYS QE   .  23 . HE*  1 1 
       4258 1 2 1 1  29 VAL QG   .  29 . HG*  1 1 
       4259 1 1 1 1  23 LYS QE   .  23 . HE*  1 1 
       4259 1 2 1 1  52 GLY QA   .  52 . HA*  1 1 
       4260 1 1 1 1  23 LYS QE   .  23 . HE*  1 1 
       4260 1 2 1 1  53 VAL H    .  53 . HN   1 1 
       4261 1 1 1 1  23 LYS QE   .  23 . HE*  1 1 
       4261 1 2 1 1  53 VAL MG1  .  53 . HG1* 1 1 
       4262 1 1 1 1  23 LYS QE   .  23 . HE*  1 1 
       4262 1 2 1 1  53 VAL MG2  .  53 . HG2* 1 1 
       4263 1 1 1 1  24 ARG H    .  24 . HN   1 1 
       4263 1 2 1 1  24 ARG QB   .  24 . HB*  1 1 
       4264 1 1 1 1  24 ARG H    .  24 . HN   1 1 
       4264 1 2 1 1  24 ARG QG   .  24 . HG*  1 1 
       4265 1 1 1 1  24 ARG H    .  24 . HN   1 1 
       4265 1 2 1 1  24 ARG QD   .  24 . HD*  1 1 
       4266 1 1 1 1  24 ARG HA   .  24 . HA   1 1 
       4266 1 2 1 1  24 ARG QG   .  24 . HG*  1 1 
       4267 1 1 1 1  24 ARG HA   .  24 . HA   1 1 
       4267 1 2 1 1  24 ARG QD   .  24 . HD*  1 1 
       4268 1 1 1 1  24 ARG QB   .  24 . HB*  1 1 
       4268 1 2 1 1  24 ARG QD   .  24 . HD*  1 1 
       4269 1 1 1 1  24 ARG QB   .  24 . HB*  1 1 
       4269 1 2 1 1  25 GLN H    .  25 . HN   1 1 
       4270 1 1 1 1  24 ARG QB   .  24 . HB*  1 1 
       4270 1 2 1 1  25 GLN HE21 .  25 . HE21 1 1 
       4271 1 1 1 1  24 ARG QG   .  24 . HG*  1 1 
       4271 1 2 1 1  25 GLN H    .  25 . HN   1 1 
       4272 1 1 1 1  24 ARG QG   .  24 . HG*  1 1 
       4272 1 2 1 1  25 GLN HG2  .  25 . HG2  1 1 
       4273 1 1 1 1  24 ARG QG   .  24 . HG*  1 1 
       4273 1 2 1 1  25 GLN HE21 .  25 . HE21 1 1 
       4274 1 1 1 1  24 ARG QG   .  24 . HG*  1 1 
       4274 1 2 1 1  25 GLN HE22 .  25 . HE22 1 1 
       4275 1 1 1 1  27 VAL MG1  .  27 . HG1* 1 1 
       4275 1 2 1 1  79 ASP QB   .  79 . HB*  1 1 
       4276 1 1 1 1  27 VAL MG2  .  27 . HG2* 1 1 
       4276 1 2 1 1  79 ASP QB   .  79 . HB*  1 1 
       4277 1 1 1 1  28 ARG H    .  28 . HN   1 1 
       4277 1 2 1 1  28 ARG QD   .  28 . HD*  1 1 
       4278 1 1 1 1  28 ARG HA   .  28 . HA   1 1 
       4278 1 2 1 1  29 VAL QG   .  29 . HG*  1 1 
       4279 1 1 1 1  28 ARG HB2  .  28 . HB2  1 1 
       4279 1 2 1 1  28 ARG QD   .  28 . HD*  1 1 
       4280 1 1 1 1  28 ARG HB2  .  28 . HB2  1 1 
       4280 1 2 1 1  29 VAL QG   .  29 . HG*  1 1 
       4281 1 1 1 1  28 ARG HB3  .  28 . HB1  1 1 
       4281 1 2 1 1  28 ARG QD   .  28 . HD*  1 1 
       4282 1 1 1 1  28 ARG HB3  .  28 . HB1  1 1 
       4282 1 2 1 1  29 VAL QG   .  29 . HG*  1 1 
       4283 1 1 1 1  28 ARG QD   .  28 . HD*  1 1 
       4283 1 2 1 1  29 VAL H    .  29 . HN   1 1 
       4284 1 1 1 1  28 ARG QD   .  28 . HD*  1 1 
       4284 1 2 1 1  80 VAL MG1  .  80 . HG1* 1 1 
       4285 1 1 1 1  28 ARG QD   .  28 . HD*  1 1 
       4285 1 2 1 1  80 VAL MG2  .  80 . HG2* 1 1 
       4286 1 1 1 1  29 VAL H    .  29 . HN   1 1 
       4286 1 2 1 1  29 VAL QG   .  29 . HG*  1 1 
       4287 1 1 1 1  29 VAL QG   .  29 . HG*  1 1 
       4287 1 2 1 1  30 VAL H    .  30 . HN   1 1 
       4288 1 1 1 1  29 VAL QG   .  29 . HG*  1 1 
       4288 1 2 1 1  31 LEU H    .  31 . HN   1 1 
       4289 1 1 1 1  29 VAL QG   .  29 . HG*  1 1 
       4289 1 2 1 1  31 LEU HB3  .  31 . HB1  1 1 
       4290 1 1 1 1  29 VAL QG   .  29 . HG*  1 1 
       4290 1 2 1 1  53 VAL HA   .  53 . HA   1 1 
       4291 1 1 1 1  29 VAL QG   .  29 . HG*  1 1 
       4291 1 2 1 1  54 ASP H    .  54 . HN   1 1 
       4292 1 1 1 1  29 VAL QG   .  29 . HG*  1 1 
       4292 1 2 1 1  83 ILE H    .  83 . HN   1 1 
       4293 1 1 1 1  29 VAL QG   .  29 . HG*  1 1 
       4293 1 2 1 1  83 ILE HG13 .  83 . HG11 1 1 
       4294 1 1 1 1  29 VAL QG   .  29 . HG*  1 1 
       4294 1 2 1 1  83 ILE MD   .  83 . HD1* 1 1 
       4295 1 1 1 1  30 VAL MG1  .  30 . HG1* 1 1 
       4295 1 2 1 1  56 ARG QD   .  56 . HD*  1 1 
       4296 1 1 1 1  32 LEU HA   .  32 . HA   1 1 
       4296 1 2 1 1  56 ARG QB   .  56 . HB*  1 1 
       4297 1 1 1 1  32 LEU MD2  .  32 . HD2* 1 1 
       4297 1 2 1 1  56 ARG QB   .  56 . HB*  1 1 
       4298 1 1 1 1  32 LEU MD2  .  32 . HD2* 1 1 
       4298 1 2 1 1  56 ARG QG   .  56 . HG*  1 1 
       4299 1 1 1 1  32 LEU MD2  .  32 . HD2* 1 1 
       4299 1 2 1 1  56 ARG QD   .  56 . HD*  1 1 
       4300 1 1 1 1  33 TYR H    .  33 . HN   1 1 
       4300 1 2 1 1  56 ARG QB   .  56 . HB*  1 1 
       4301 1 1 1 1  33 TYR QD   .  33 . HD*  1 1 
       4301 1 2 1 1  35 ASP QB   .  35 . HB*  1 1 
       4302 1 1 1 1  33 TYR QD   .  33 . HD*  1 1 
       4302 1 2 1 1  41 ARG QG   .  41 . HG*  1 1 
       4303 1 1 1 1  33 TYR QE   .  33 . HE*  1 1 
       4303 1 2 1 1  35 ASP QB   .  35 . HB*  1 1 
       4304 1 1 1 1  33 TYR QE   .  33 . HE*  1 1 
       4304 1 2 1 1  41 ARG QG   .  41 . HG*  1 1 
       4305 1 1 1 1  33 TYR QE   .  33 . HE*  1 1 
       4305 1 2 1 1  44 ARG QD   .  44 . HD*  1 1 
       4306 1 1 1 1  35 ASP H    .  35 . HN   1 1 
       4306 1 2 1 1  41 ARG QG   .  41 . HG*  1 1 
       4307 1 1 1 1  35 ASP H    .  35 . HN   1 1 
       4307 1 2 1 1  41 ARG QD   .  41 . HD*  1 1 
       4308 1 1 1 1  35 ASP HA   .  35 . HA   1 1 
       4308 1 2 1 1  36 GLN QE   .  36 . HE*  1 1 
       4309 1 1 1 1  35 ASP QB   .  35 . HB*  1 1 
       4309 1 2 1 1  36 GLN H    .  36 . HN   1 1 
       4310 1 1 1 1  35 ASP QB   .  35 . HB*  1 1 
       4310 1 2 1 1  37 ASP H    .  37 . HN   1 1 
       4311 1 1 1 1  35 ASP QB   .  35 . HB*  1 1 
       4311 1 2 1 1  41 ARG HB2  .  41 . HB2  1 1 
       4312 1 1 1 1  35 ASP QB   .  35 . HB*  1 1 
       4312 1 2 1 1  41 ARG QG   .  41 . HG*  1 1 
       4313 1 1 1 1  35 ASP QB   .  35 . HB*  1 1 
       4313 1 2 1 1  41 ARG QD   .  41 . HD*  1 1 
       4314 1 1 1 1  35 ASP QB   .  35 . HB*  1 1 
       4314 1 2 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       4315 1 1 1 1  35 ASP QB   .  35 . HB*  1 1 
       4315 1 2 1 1  57 THR MG   .  57 . HG2* 1 1 
       4316 1 1 1 1  36 GLN H    .  36 . HN   1 1 
       4316 1 2 1 1  36 GLN QB   .  36 . HB*  1 1 
       4317 1 1 1 1  36 GLN H    .  36 . HN   1 1 
       4317 1 2 1 1  36 GLN QG   .  36 . HG*  1 1 
       4318 1 1 1 1  36 GLN H    .  36 . HN   1 1 
       4318 1 2 1 1  36 GLN QE   .  36 . HE*  1 1 
       4319 1 1 1 1  36 GLN HA   .  36 . HA   1 1 
       4319 1 2 1 1  36 GLN QG   .  36 . HG*  1 1 
       4320 1 1 1 1  36 GLN QG   .  36 . HG*  1 1 
       4320 1 2 1 1  37 ASP H    .  37 . HN   1 1 
       4321 1 1 1 1  37 ASP H    .  37 . HN   1 1 
       4321 1 2 1 1  37 ASP QB   .  37 . HB*  1 1 
       4322 1 1 1 1  37 ASP H    .  37 . HN   1 1 
       4322 1 2 1 1  40 ARG QB   .  40 . HB*  1 1 
       4323 1 1 1 1  37 ASP QB   .  37 . HB*  1 1 
       4323 1 2 1 1  38 GLU H    .  38 . HN   1 1 
       4324 1 1 1 1  37 ASP QB   .  37 . HB*  1 1 
       4324 1 2 1 1  38 GLU QG   .  38 . HG*  1 1 
       4325 1 1 1 1  37 ASP QB   .  37 . HB*  1 1 
       4325 1 2 1 1  40 ARG H    .  40 . HN   1 1 
       4326 1 1 1 1  37 ASP QB   .  37 . HB*  1 1 
       4326 1 2 1 1  40 ARG QB   .  40 . HB*  1 1 
       4327 1 1 1 1  37 ASP QB   .  37 . HB*  1 1 
       4327 1 2 1 1  41 ARG H    .  41 . HN   1 1 
       4328 1 1 1 1  38 GLU H    .  38 . HN   1 1 
       4328 1 2 1 1  39 LYS QB   .  39 . HB*  1 1 
       4329 1 1 1 1  38 GLU HA   .  38 . HA   1 1 
       4329 1 2 1 1  38 GLU QG   .  38 . HG*  1 1 
       4330 1 1 1 1  38 GLU HB2  .  38 . HB2  1 1 
       4330 1 2 1 1  38 GLU QG   .  38 . HG*  1 1 
       4331 1 1 1 1  38 GLU HB3  .  38 . HB1  1 1 
       4331 1 2 1 1  38 GLU QG   .  38 . HG*  1 1 
       4332 1 1 1 1  38 GLU QG   .  38 . HG*  1 1 
       4332 1 2 1 1  39 LYS H    .  39 . HN   1 1 
       4333 1 1 1 1  39 LYS H    .  39 . HN   1 1 
       4333 1 2 1 1  39 LYS QB   .  39 . HB*  1 1 
       4334 1 1 1 1  39 LYS H    .  39 . HN   1 1 
       4334 1 2 1 1  39 LYS QG   .  39 . HG*  1 1 
       4335 1 1 1 1  39 LYS H    .  39 . HN   1 1 
       4335 1 2 1 1  39 LYS QD   .  39 . HD*  1 1 
       4336 1 1 1 1  39 LYS H    .  39 . HN   1 1 
       4336 1 2 1 1  39 LYS QE   .  39 . HE*  1 1 
       4337 1 1 1 1  39 LYS HA   .  39 . HA   1 1 
       4337 1 2 1 1  39 LYS QG   .  39 . HG*  1 1 
       4338 1 1 1 1  39 LYS HA   .  39 . HA   1 1 
       4338 1 2 1 1  40 ARG QB   .  40 . HB*  1 1 
       4339 1 1 1 1  39 LYS HA   .  39 . HA   1 1 
       4339 1 2 1 1  42 ARG QB   .  42 . HB*  1 1 
       4340 1 1 1 1  39 LYS QB   .  39 . HB*  1 1 
       4340 1 2 1 1  39 LYS QD   .  39 . HD*  1 1 
       4341 1 1 1 1  39 LYS QB   .  39 . HB*  1 1 
       4341 1 2 1 1  39 LYS QE   .  39 . HE*  1 1 
       4342 1 1 1 1  39 LYS QB   .  39 . HB*  1 1 
       4342 1 2 1 1  40 ARG H    .  40 . HN   1 1 
       4343 1 1 1 1  39 LYS QE   .  39 . HE*  1 1 
       4343 1 2 1 1  39 LYS QG   .  39 . HG*  1 1 
       4344 1 1 1 1  39 LYS QG   .  39 . HG*  1 1 
       4344 1 2 1 1  40 ARG H    .  40 . HN   1 1 
       4345 1 1 1 1  39 LYS QD   .  39 . HD*  1 1 
       4345 1 2 1 1  40 ARG H    .  40 . HN   1 1 
       4346 1 1 1 1  40 ARG H    .  40 . HN   1 1 
       4346 1 2 1 1  40 ARG QB   .  40 . HB*  1 1 
       4347 1 1 1 1  40 ARG H    .  40 . HN   1 1 
       4347 1 2 1 1  40 ARG QG   .  40 . HG*  1 1 
       4348 1 1 1 1  40 ARG H    .  40 . HN   1 1 
       4348 1 2 1 1  40 ARG QD   .  40 . HD*  1 1 
       4349 1 1 1 1  40 ARG HA   .  40 . HA   1 1 
       4349 1 2 1 1  40 ARG QG   .  40 . HG*  1 1 
       4350 1 1 1 1  40 ARG HA   .  40 . HA   1 1 
       4350 1 2 1 1  40 ARG QD   .  40 . HD*  1 1 
       4351 1 1 1 1  40 ARG HA   .  40 . HA   1 1 
       4351 1 2 1 1  43 GLU QB   .  43 . HB*  1 1 
       4352 1 1 1 1  40 ARG QB   .  40 . HB*  1 1 
       4352 1 2 1 1  40 ARG QD   .  40 . HD*  1 1 
       4353 1 1 1 1  40 ARG QG   .  40 . HG*  1 1 
       4353 1 2 1 1  41 ARG H    .  41 . HN   1 1 
       4354 1 1 1 1  41 ARG H    .  41 . HN   1 1 
       4354 1 2 1 1  41 ARG QG   .  41 . HG*  1 1 
       4355 1 1 1 1  41 ARG H    .  41 . HN   1 1 
       4355 1 2 1 1  41 ARG QD   .  41 . HD*  1 1 
       4356 1 1 1 1  41 ARG HB2  .  41 . HB2  1 1 
       4356 1 2 1 1  41 ARG QD   .  41 . HD*  1 1 
       4357 1 1 1 1  41 ARG QG   .  41 . HG*  1 1 
       4357 1 2 1 1  42 ARG H    .  42 . HN   1 1 
       4358 1 1 1 1  41 ARG QG   .  41 . HG*  1 1 
       4358 1 2 1 1  45 LEU MD1  .  45 . HD1* 1 1 
       4359 1 1 1 1  41 ARG QG   .  41 . HG*  1 1 
       4359 1 2 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       4360 1 1 1 1  41 ARG QG   .  41 . HG*  1 1 
       4360 1 2 1 1  57 THR MG   .  57 . HG2* 1 1 
       4361 1 1 1 1  41 ARG QD   .  41 . HD*  1 1 
       4361 1 2 1 1  42 ARG H    .  42 . HN   1 1 
       4362 1 1 1 1  41 ARG QD   .  41 . HD*  1 1 
       4362 1 2 1 1  45 LEU MD2  .  45 . HD2* 1 1 
       4363 1 1 1 1  41 ARG QD   .  41 . HD*  1 1 
       4363 1 2 1 1  57 THR HB   .  57 . HB   1 1 
       4364 1 1 1 1  41 ARG QD   .  41 . HD*  1 1 
       4364 1 2 1 1  57 THR MG   .  57 . HG2* 1 1 
       4365 1 1 1 1  42 ARG HA   .  42 . HA   1 1 
       4365 1 2 1 1  42 ARG QG   .  42 . HG*  1 1 
       4366 1 1 1 1  42 ARG HA   .  42 . HA   1 1 
       4366 1 2 1 1  42 ARG QD   .  42 . HD*  1 1 
       4367 1 1 1 1  42 ARG QB   .  42 . HB*  1 1 
       4367 1 2 1 1  42 ARG QD   .  42 . HD*  1 1 
       4368 1 1 1 1  42 ARG QB   .  42 . HB*  1 1 
       4368 1 2 1 1  43 GLU H    .  43 . HN   1 1 
       4369 1 1 1 1  42 ARG QG   .  42 . HG*  1 1 
       4369 1 2 1 1  43 GLU H    .  43 . HN   1 1 
       4370 1 1 1 1  43 GLU H    .  43 . HN   1 1 
       4370 1 2 1 1  43 GLU QB   .  43 . HB*  1 1 
       4371 1 1 1 1  43 GLU H    .  43 . HN   1 1 
       4371 1 2 1 1  43 GLU QG   .  43 . HG*  1 1 
       4372 1 1 1 1  43 GLU HA   .  43 . HA   1 1 
       4372 1 2 1 1  43 GLU QG   .  43 . HG*  1 1 
       4373 1 1 1 1  43 GLU QB   .  43 . HB*  1 1 
       4373 1 2 1 1  44 ARG H    .  44 . HN   1 1 
       4374 1 1 1 1  44 ARG H    .  44 . HN   1 1 
       4374 1 2 1 1  44 ARG QD   .  44 . HD*  1 1 
       4375 1 1 1 1  44 ARG HA   .  44 . HA   1 1 
       4375 1 2 1 1  44 ARG QD   .  44 . HD*  1 1 
       4376 1 1 1 1  44 ARG HA   .  44 . HA   1 1 
       4376 1 2 1 1  47 GLU QB   .  47 . HB*  1 1 
       4377 1 1 1 1  44 ARG HA   .  44 . HA   1 1 
       4377 1 2 1 1  47 GLU QG   .  47 . HG*  1 1 
       4378 1 1 1 1  44 ARG HB3  .  44 . HB1  1 1 
       4378 1 2 1 1  44 ARG QD   .  44 . HD*  1 1 
       4379 1 1 1 1  46 GLU H    .  46 . HN   1 1 
       4379 1 2 1 1  46 GLU QG   .  46 . HG*  1 1 
       4380 1 1 1 1  46 GLU H    .  46 . HN   1 1 
       4380 1 2 1 1  47 GLU QB   .  47 . HB*  1 1 
       4381 1 1 1 1  46 GLU H    .  46 . HN   1 1 
       4381 1 2 1 1  47 GLU QG   .  47 . HG*  1 1 
       4382 1 1 1 1  46 GLU HA   .  46 . HA   1 1 
       4382 1 2 1 1  46 GLU QG   .  46 . HG*  1 1 
       4383 1 1 1 1  46 GLU QG   .  46 . HG*  1 1 
       4383 1 2 1 1  47 GLU H    .  47 . HN   1 1 
       4384 1 1 1 1  46 GLU QG   .  46 . HG*  1 1 
       4384 1 2 1 1  50 LYS H    .  50 . HN   1 1 
       4385 1 1 1 1  46 GLU QG   .  46 . HG*  1 1 
       4385 1 2 1 1  50 LYS HG2  .  50 . HG2  1 1 
       4386 1 1 1 1  47 GLU H    .  47 . HN   1 1 
       4386 1 2 1 1  47 GLU QB   .  47 . HB*  1 1 
       4387 1 1 1 1  47 GLU HA   .  47 . HA   1 1 
       4387 1 2 1 1  47 GLU QB   .  47 . HB*  1 1 
       4388 1 1 1 1  47 GLU HA   .  47 . HA   1 1 
       4388 1 2 1 1  47 GLU QG   .  47 . HG*  1 1 
       4389 1 1 1 1  47 GLU HA   .  47 . HA   1 1 
       4389 1 2 1 1  50 LYS QE   .  50 . HE*  1 1 
       4390 1 1 1 1  47 GLU QB   .  47 . HB*  1 1 
       4390 1 2 1 1  47 GLU QG   .  47 . HG*  1 1 
       4391 1 1 1 1  47 GLU QB   .  47 . HB*  1 1 
       4391 1 2 1 1  48 PHE QD   .  48 . HD*  1 1 
       4392 1 1 1 1  47 GLU QB   .  47 . HB*  1 1 
       4392 1 2 1 1  49 GLU H    .  49 . HN   1 1 
       4393 1 1 1 1  47 GLU QB   .  47 . HB*  1 1 
       4393 1 2 1 1  51 GLN HE21 .  51 . HE21 1 1 
       4394 1 1 1 1  47 GLU QB   .  47 . HB*  1 1 
       4394 1 2 1 1  51 GLN HE22 .  51 . HE22 1 1 
       4395 1 1 1 1  47 GLU QG   .  47 . HG*  1 1 
       4395 1 2 1 1  48 PHE H    .  48 . HN   1 1 
       4396 1 1 1 1  47 GLU QG   .  47 . HG*  1 1 
       4396 1 2 1 1  48 PHE QE   .  48 . HE*  1 1 
       4397 1 1 1 1  47 GLU QG   .  47 . HG*  1 1 
       4397 1 2 1 1  51 GLN HE21 .  51 . HE21 1 1 
       4398 1 1 1 1  47 GLU QG   .  47 . HG*  1 1 
       4398 1 2 1 1  51 GLN HE22 .  51 . HE22 1 1 
       4399 1 1 1 1  50 LYS HB2  .  50 . HB2  1 1 
       4399 1 2 1 1  50 LYS QE   .  50 . HE*  1 1 
       4400 1 1 1 1  50 LYS QE   .  50 . HE*  1 1 
       4400 1 2 1 1  50 LYS HG3  .  50 . HG1  1 1 
       4401 1 1 1 1  52 GLY QA   .  52 . HA*  1 1 
       4401 1 2 1 1  53 VAL H    .  53 . HN   1 1 
       4402 1 1 1 1  52 GLY QA   .  52 . HA*  1 1 
       4402 1 2 1 1  53 VAL MG2  .  53 . HG2* 1 1 
       4403 1 1 1 1  56 ARG H    .  56 . HN   1 1 
       4403 1 2 1 1  56 ARG QB   .  56 . HB*  1 1 
       4404 1 1 1 1  56 ARG H    .  56 . HN   1 1 
       4404 1 2 1 1  56 ARG QD   .  56 . HD*  1 1 
       4405 1 1 1 1  56 ARG HA   .  56 . HA   1 1 
       4405 1 2 1 1  56 ARG QG   .  56 . HG*  1 1 
       4406 1 1 1 1  56 ARG HA   .  56 . HA   1 1 
       4406 1 2 1 1  56 ARG QD   .  56 . HD*  1 1 
       4407 1 1 1 1  56 ARG QB   .  56 . HB*  1 1 
       4407 1 2 1 1  56 ARG QG   .  56 . HG*  1 1 
       4408 1 1 1 1  56 ARG QB   .  56 . HB*  1 1 
       4408 1 2 1 1  56 ARG HE   .  56 . HE   1 1 
       4409 1 1 1 1  56 ARG QB   .  56 . HB*  1 1 
       4409 1 2 1 1  57 THR H    .  57 . HN   1 1 
       4410 1 1 1 1  56 ARG QB   .  56 . HB*  1 1 
       4410 1 2 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       4411 1 1 1 1  56 ARG QB   .  56 . HB*  1 1 
       4411 1 2 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       4412 1 1 1 1  56 ARG QB   .  56 . HB*  1 1 
       4412 1 2 1 1  67 ASN HB3  .  67 . HB1  1 1 
       4413 1 1 1 1  56 ARG QG   .  56 . HG*  1 1 
       4413 1 2 1 1  57 THR H    .  57 . HN   1 1 
       4414 1 1 1 1  56 ARG QG   .  56 . HG*  1 1 
       4414 1 2 1 1  67 ASN HB2  .  67 . HB2  1 1 
       4415 1 1 1 1  56 ARG QG   .  56 . HG*  1 1 
       4415 1 2 1 1  67 ASN HB3  .  67 . HB1  1 1 
       4416 1 1 1 1  56 ARG QD   .  56 . HD*  1 1 
       4416 1 2 1 1  57 THR H    .  57 . HN   1 1 
       4417 1 1 1 1  58 VAL HB   .  58 . HB   1 1 
       4417 1 2 1 1  64 PHE QB   .  64 . HB*  1 1 
       4418 1 1 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       4418 1 2 1 1  59 GLU QG   .  59 . HG*  1 1 
       4419 1 1 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       4419 1 2 1 1  64 PHE QB   .  64 . HB*  1 1 
       4420 1 1 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       4420 1 2 1 1  64 PHE QB   .  64 . HB*  1 1 
       4421 1 1 1 1  59 GLU QB   .  59 . HB*  1 1 
       4421 1 2 1 1  60 ASP H    .  60 . HN   1 1 
       4422 1 1 1 1  59 GLU QB   .  59 . HB*  1 1 
       4422 1 2 1 1  63 ASP H    .  63 . HN   1 1 
       4423 1 1 1 1  59 GLU QB   .  59 . HB*  1 1 
       4423 1 2 1 1  63 ASP HB3  .  63 . HB1  1 1 
       4424 1 1 1 1  59 GLU QG   .  59 . HG*  1 1 
       4424 1 2 1 1  63 ASP H    .  63 . HN   1 1 
       4425 1 1 1 1  59 GLU QG   .  59 . HG*  1 1 
       4425 1 2 1 1  63 ASP HB3  .  63 . HB1  1 1 
       4426 1 1 1 1  60 ASP H    .  60 . HN   1 1 
       4426 1 2 1 1  60 ASP QB   .  60 . HB*  1 1 
       4427 1 1 1 1  60 ASP HA   .  60 . HA   1 1 
       4427 1 2 1 1  61 LYS QB   .  61 . HB*  1 1 
       4428 1 1 1 1  60 ASP QB   .  60 . HB*  1 1 
       4428 1 2 1 1  61 LYS H    .  61 . HN   1 1 
       4429 1 1 1 1  60 ASP QB   .  60 . HB*  1 1 
       4429 1 2 1 1  61 LYS QB   .  61 . HB*  1 1 
       4430 1 1 1 1  60 ASP QB   .  60 . HB*  1 1 
       4430 1 2 1 1  62 GLU H    .  62 . HN   1 1 
       4431 1 1 1 1  60 ASP QB   .  60 . HB*  1 1 
       4431 1 2 1 1  62 GLU HB2  .  62 . HB2  1 1 
       4432 1 1 1 1  60 ASP QB   .  60 . HB*  1 1 
       4432 1 2 1 1  91 TRP HZ2  .  91 . HZ2  1 1 
       4433 1 1 1 1  61 LYS H    .  61 . HN   1 1 
       4433 1 2 1 1  61 LYS QG   .  61 . HG*  1 1 
       4434 1 1 1 1  61 LYS H    .  61 . HN   1 1 
       4434 1 2 1 1  61 LYS QD   .  61 . HD*  1 1 
       4435 1 1 1 1  61 LYS H    .  61 . HN   1 1 
       4435 1 2 1 1  61 LYS QE   .  61 . HE*  1 1 
       4436 1 1 1 1  61 LYS HA   .  61 . HA   1 1 
       4436 1 2 1 1  61 LYS QD   .  61 . HD*  1 1 
       4437 1 1 1 1  61 LYS HA   .  61 . HA   1 1 
       4437 1 2 1 1  61 LYS QE   .  61 . HE*  1 1 
       4438 1 1 1 1  61 LYS HA   .  61 . HA   1 1 
       4438 1 2 1 1  64 PHE QB   .  64 . HB*  1 1 
       4439 1 1 1 1  61 LYS QB   .  61 . HB*  1 1 
       4439 1 2 1 1  61 LYS QD   .  61 . HD*  1 1 
       4440 1 1 1 1  61 LYS QB   .  61 . HB*  1 1 
       4440 1 2 1 1  61 LYS QE   .  61 . HE*  1 1 
       4441 1 1 1 1  61 LYS QB   .  61 . HB*  1 1 
       4441 1 2 1 1  62 GLU QG   .  62 . HG*  1 1 
       4442 1 1 1 1  61 LYS QB   .  61 . HB*  1 1 
       4442 1 2 1 1  65 ARG H    .  65 . HN   1 1 
       4443 1 1 1 1  61 LYS QB   .  61 . HB*  1 1 
       4443 1 2 1 1  90 GLU HB2  .  90 . HB2  1 1 
       4444 1 1 1 1  61 LYS QB   .  61 . HB*  1 1 
       4444 1 2 1 1  91 TRP H    .  91 . HN   1 1 
       4445 1 1 1 1  61 LYS QB   .  61 . HB*  1 1 
       4445 1 2 1 1  91 TRP HA   .  91 . HA   1 1 
       4446 1 1 1 1  61 LYS QB   .  61 . HB*  1 1 
       4446 1 2 1 1  91 TRP HD1  .  91 . HD1  1 1 
       4447 1 1 1 1  61 LYS QB   .  61 . HB*  1 1 
       4447 1 2 1 1  91 TRP HE1  .  91 . HE1  1 1 
       4448 1 1 1 1  61 LYS QB   .  61 . HB*  1 1 
       4448 1 2 1 1  91 TRP HZ2  .  91 . HZ2  1 1 
       4449 1 1 1 1  61 LYS QE   .  61 . HE*  1 1 
       4449 1 2 1 1  61 LYS QG   .  61 . HG*  1 1 
       4450 1 1 1 1  61 LYS QG   .  61 . HG*  1 1 
       4450 1 2 1 1  62 GLU H    .  62 . HN   1 1 
       4451 1 1 1 1  61 LYS QG   .  61 . HG*  1 1 
       4451 1 2 1 1  62 GLU QG   .  62 . HG*  1 1 
       4452 1 1 1 1  61 LYS QG   .  61 . HG*  1 1 
       4452 1 2 1 1  90 GLU HB3  .  90 . HB1  1 1 
       4453 1 1 1 1  61 LYS QG   .  61 . HG*  1 1 
       4453 1 2 1 1  91 TRP HD1  .  91 . HD1  1 1 
       4454 1 1 1 1  61 LYS QG   .  61 . HG*  1 1 
       4454 1 2 1 1  91 TRP HE1  .  91 . HE1  1 1 
       4455 1 1 1 1  61 LYS QD   .  61 . HD*  1 1 
       4455 1 2 1 1  62 GLU H    .  62 . HN   1 1 
       4456 1 1 1 1  61 LYS QD   .  61 . HD*  1 1 
       4456 1 2 1 1  91 TRP HD1  .  91 . HD1  1 1 
       4457 1 1 1 1  61 LYS QD   .  61 . HD*  1 1 
       4457 1 2 1 1  91 TRP HE1  .  91 . HE1  1 1 
       4458 1 1 1 1  61 LYS QD   .  61 . HD*  1 1 
       4458 1 2 1 1  91 TRP HZ2  .  91 . HZ2  1 1 
       4459 1 1 1 1  61 LYS QE   .  61 . HE*  1 1 
       4459 1 2 1 1  91 TRP HD1  .  91 . HD1  1 1 
       4460 1 1 1 1  61 LYS QE   .  61 . HE*  1 1 
       4460 1 2 1 1  91 TRP HE1  .  91 . HE1  1 1 
       4461 1 1 1 1  62 GLU H    .  62 . HN   1 1 
       4461 1 2 1 1  62 GLU QG   .  62 . HG*  1 1 
       4462 1 1 1 1  62 GLU HA   .  62 . HA   1 1 
       4462 1 2 1 1  62 GLU QG   .  62 . HG*  1 1 
       4463 1 1 1 1  62 GLU HA   .  62 . HA   1 1 
       4463 1 2 1 1  65 ARG QG   .  65 . HG*  1 1 
       4464 1 1 1 1  62 GLU HA   .  62 . HA   1 1 
       4464 1 2 1 1  65 ARG QD   .  65 . HD*  1 1 
       4465 1 1 1 1  62 GLU HB2  .  62 . HB2  1 1 
       4465 1 2 1 1  62 GLU QG   .  62 . HG*  1 1 
       4466 1 1 1 1  62 GLU HB3  .  62 . HB1  1 1 
       4466 1 2 1 1  62 GLU QG   .  62 . HG*  1 1 
       4467 1 1 1 1  62 GLU QG   .  62 . HG*  1 1 
       4467 1 2 1 1  63 ASP H    .  63 . HN   1 1 
       4468 1 1 1 1  63 ASP HA   .  63 . HA   1 1 
       4468 1 2 1 1  66 GLU QB   .  66 . HB*  1 1 
       4469 1 1 1 1  63 ASP HA   .  63 . HA   1 1 
       4469 1 2 1 1  66 GLU QG   .  66 . HG*  1 1 
       4470 1 1 1 1  64 PHE H    .  64 . HN   1 1 
       4470 1 2 1 1  64 PHE QB   .  64 . HB*  1 1 
       4471 1 1 1 1  64 PHE H    .  64 . HN   1 1 
       4471 1 2 1 1  65 ARG QG   .  65 . HG*  1 1 
       4472 1 1 1 1  64 PHE QB   .  64 . HB*  1 1 
       4472 1 2 1 1  65 ARG H    .  65 . HN   1 1 
       4473 1 1 1 1  64 PHE QB   .  64 . HB*  1 1 
       4473 1 2 1 1  91 TRP HZ3  .  91 . HZ3  1 1 
       4474 1 1 1 1  64 PHE QB   .  64 . HB*  1 1 
       4474 1 2 1 1  91 TRP HH2  .  91 . HH2  1 1 
       4475 1 1 1 1  64 PHE QD   .  64 . HD*  1 1 
       4475 1 2 1 1  65 ARG QG   .  65 . HG*  1 1 
       4476 1 1 1 1  64 PHE QD   .  64 . HD*  1 1 
       4476 1 2 1 1  94 ASP QB   .  94 . HB*  1 1 
       4477 1 1 1 1  64 PHE QE   .  64 . HE*  1 1 
       4477 1 2 1 1  94 ASP QB   .  94 . HB*  1 1 
       4478 1 1 1 1  65 ARG H    .  65 . HN   1 1 
       4478 1 2 1 1  65 ARG QG   .  65 . HG*  1 1 
       4479 1 1 1 1  65 ARG H    .  65 . HN   1 1 
       4479 1 2 1 1  65 ARG QD   .  65 . HD*  1 1 
       4480 1 1 1 1  65 ARG H    .  65 . HN   1 1 
       4480 1 2 1 1  66 GLU QB   .  66 . HB*  1 1 
       4481 1 1 1 1  65 ARG H    .  65 . HN   1 1 
       4481 1 2 1 1  66 GLU QG   .  66 . HG*  1 1 
       4482 1 1 1 1  65 ARG HA   .  65 . HA   1 1 
       4482 1 2 1 1  98 GLU QG   .  98 . HG*  1 1 
       4483 1 1 1 1  65 ARG HB2  .  65 . HB2  1 1 
       4483 1 2 1 1  94 ASP QB   .  94 . HB*  1 1 
       4484 1 1 1 1  65 ARG HB3  .  65 . HB1  1 1 
       4484 1 2 1 1  65 ARG QG   .  65 . HG*  1 1 
       4485 1 1 1 1  65 ARG HB3  .  65 . HB1  1 1 
       4485 1 2 1 1  65 ARG QD   .  65 . HD*  1 1 
       4486 1 1 1 1  65 ARG HB3  .  65 . HB1  1 1 
       4486 1 2 1 1  98 GLU QG   .  98 . HG*  1 1 
       4487 1 1 1 1  65 ARG QG   .  65 . HG*  1 1 
       4487 1 2 1 1  66 GLU H    .  66 . HN   1 1 
       4488 1 1 1 1  65 ARG QG   .  65 . HG*  1 1 
       4488 1 2 1 1  66 GLU QG   .  66 . HG*  1 1 
       4489 1 1 1 1  65 ARG QD   .  65 . HD*  1 1 
       4489 1 2 1 1  66 GLU H    .  66 . HN   1 1 
       4490 1 1 1 1  65 ARG HE   .  65 . HE   1 1 
       4490 1 2 1 1  98 GLU QG   .  98 . HG*  1 1 
       4491 1 1 1 1  66 GLU H    .  66 . HN   1 1 
       4491 1 2 1 1  66 GLU QB   .  66 . HB*  1 1 
       4492 1 1 1 1  66 GLU H    .  66 . HN   1 1 
       4492 1 2 1 1  66 GLU QG   .  66 . HG*  1 1 
       4493 1 1 1 1  66 GLU HA   .  66 . HA   1 1 
       4493 1 2 1 1  66 GLU QG   .  66 . HG*  1 1 
       4494 1 1 1 1  66 GLU QB   .  66 . HB*  1 1 
       4494 1 2 1 1  66 GLU QG   .  66 . HG*  1 1 
       4495 1 1 1 1  66 GLU QB   .  66 . HB*  1 1 
       4495 1 2 1 1  67 ASN H    .  67 . HN   1 1 
       4496 1 1 1 1  66 GLU QB   .  66 . HB*  1 1 
       4496 1 2 1 1  67 ASN HD22 .  67 . HD22 1 1 
       4497 1 1 1 1  66 GLU QB   .  66 . HB*  1 1 
       4497 1 2 1 1  69 ARG H    .  69 . HN   1 1 
       4498 1 1 1 1  66 GLU QG   .  66 . HG*  1 1 
       4498 1 2 1 1  67 ASN H    .  67 . HN   1 1 
       4499 1 1 1 1  67 ASN H    .  67 . HN   1 1 
       4499 1 2 1 1  70 GLU QG   .  70 . HG*  1 1 
       4500 1 1 1 1  67 ASN HA   .  67 . HA   1 1 
       4500 1 2 1 1  70 GLU QB   .  70 . HB*  1 1 
       4501 1 1 1 1  67 ASN HA   .  67 . HA   1 1 
       4501 1 2 1 1  70 GLU QG   .  70 . HG*  1 1 
       4502 1 1 1 1  68 ILE HA   .  68 . HA   1 1 
       4502 1 2 1 1  71 ILE QG   .  71 . HG1* 1 1 
       4503 1 1 1 1  68 ILE HB   .  68 . HB   1 1 
       4503 1 2 1 1  98 GLU QG   .  98 . HG*  1 1 
       4504 1 1 1 1  68 ILE MG   .  68 . HG2* 1 1 
       4504 1 2 1 1  98 GLU QG   .  98 . HG*  1 1 
       4505 1 1 1 1  68 ILE MD   .  68 . HD1* 1 1 
       4505 1 2 1 1  98 GLU QG   .  98 . HG*  1 1 
       4506 1 1 1 1  69 ARG H    .  69 . HN   1 1 
       4506 1 2 1 1  69 ARG QD   .  69 . HD*  1 1 
       4507 1 1 1 1  69 ARG HA   .  69 . HA   1 1 
       4507 1 2 1 1  72 TRP QB   .  72 . HB*  1 1 
       4508 1 1 1 1  69 ARG HB2  .  69 . HB2  1 1 
       4508 1 2 1 1  69 ARG QD   .  69 . HD*  1 1 
       4509 1 1 1 1  69 ARG HG3  .  69 . HG1  1 1 
       4509 1 2 1 1  98 GLU QG   .  98 . HG*  1 1 
       4510 1 1 1 1  69 ARG QD   .  69 . HD*  1 1 
       4510 1 2 1 1  70 GLU H    .  70 . HN   1 1 
       4511 1 1 1 1  69 ARG HE   .  69 . HE   1 1 
       4511 1 2 1 1  98 GLU QG   .  98 . HG*  1 1 
       4512 1 1 1 1  70 GLU H    .  70 . HN   1 1 
       4512 1 2 1 1  70 GLU QB   .  70 . HB*  1 1 
       4513 1 1 1 1  70 GLU H    .  70 . HN   1 1 
       4513 1 2 1 1  70 GLU QG   .  70 . HG*  1 1 
       4514 1 1 1 1  70 GLU HA   .  70 . HA   1 1 
       4514 1 2 1 1  70 GLU QB   .  70 . HB*  1 1 
       4515 1 1 1 1  70 GLU HA   .  70 . HA   1 1 
       4515 1 2 1 1  70 GLU QG   .  70 . HG*  1 1 
       4516 1 1 1 1  70 GLU HA   .  70 . HA   1 1 
       4516 1 2 1 1  73 GLU QB   .  73 . HB*  1 1 
       4517 1 1 1 1  70 GLU QB   .  70 . HB*  1 1 
       4517 1 2 1 1  70 GLU QG   .  70 . HG*  1 1 
       4518 1 1 1 1  70 GLU QB   .  70 . HB*  1 1 
       4518 1 2 1 1  73 GLU H    .  73 . HN   1 1 
       4519 1 1 1 1  70 GLU QB   .  70 . HB*  1 1 
       4519 1 2 1 1  74 ARG QG   .  74 . HG*  1 1 
       4520 1 1 1 1  70 GLU QG   .  70 . HG*  1 1 
       4520 1 2 1 1  71 ILE H    .  71 . HN   1 1 
       4521 1 1 1 1  71 ILE H    .  71 . HN   1 1 
       4521 1 2 1 1  71 ILE QG   .  71 . HG1* 1 1 
       4522 1 1 1 1  71 ILE HA   .  71 . HA   1 1 
       4522 1 2 1 1  71 ILE QG   .  71 . HG1* 1 1 
       4523 1 1 1 1  71 ILE HA   .  71 . HA   1 1 
       4523 1 2 1 1  74 ARG QG   .  74 . HG*  1 1 
       4524 1 1 1 1  71 ILE HA   .  71 . HA   1 1 
       4524 1 2 1 1  75 TYR QB   .  75 . HB*  1 1 
       4525 1 1 1 1  71 ILE MG   .  71 . HG2* 1 1 
       4525 1 2 1 1  75 TYR QB   .  75 . HB*  1 1 
       4526 1 1 1 1  71 ILE QG   .  71 . HG1* 1 1 
       4526 1 2 1 1  72 TRP H    .  72 . HN   1 1 
       4527 1 1 1 1  71 ILE QG   .  71 . HG1* 1 1 
       4527 1 2 1 1  75 TYR QD   .  75 . HD*  1 1 
       4528 1 1 1 1  72 TRP H    .  72 . HN   1 1 
       4528 1 2 1 1  72 TRP QB   .  72 . HB*  1 1 
       4529 1 1 1 1  72 TRP H    .  72 . HN   1 1 
       4529 1 2 1 1  73 GLU QB   .  73 . HB*  1 1 
       4530 1 1 1 1  72 TRP QB   .  72 . HB*  1 1 
       4530 1 2 1 1  72 TRP HD1  .  72 . HD1  1 1 
       4531 1 1 1 1  72 TRP QB   .  72 . HB*  1 1 
       4531 1 2 1 1  72 TRP HE1  .  72 . HE1  1 1 
       4532 1 1 1 1  72 TRP QB   .  72 . HB*  1 1 
       4532 1 2 1 1  73 GLU H    .  73 . HN   1 1 
       4533 1 1 1 1  72 TRP QB   .  72 . HB*  1 1 
       4533 1 2 1 1 102 ARG HE   . 102 . HE   1 1 
       4534 1 1 1 1  72 TRP HD1  .  72 . HD1  1 1 
       4534 1 2 1 1 102 ARG QG   . 102 . HG*  1 1 
       4535 1 1 1 1  72 TRP HD1  .  72 . HD1  1 1 
       4535 1 2 1 1 102 ARG QD   . 102 . HD*  1 1 
       4536 1 1 1 1  72 TRP HE1  .  72 . HE1  1 1 
       4536 1 2 1 1  98 GLU QG   .  98 . HG*  1 1 
       4537 1 1 1 1  72 TRP HE1  .  72 . HE1  1 1 
       4537 1 2 1 1 102 ARG QG   . 102 . HG*  1 1 
       4538 1 1 1 1  72 TRP HE1  .  72 . HE1  1 1 
       4538 1 2 1 1 102 ARG QD   . 102 . HD*  1 1 
       4539 1 1 1 1  72 TRP HZ2  .  72 . HZ2  1 1 
       4539 1 2 1 1  98 GLU QG   .  98 . HG*  1 1 
       4540 1 1 1 1  73 GLU H    .  73 . HN   1 1 
       4540 1 2 1 1  73 GLU QB   .  73 . HB*  1 1 
       4541 1 1 1 1  73 GLU H    .  73 . HN   1 1 
       4541 1 2 1 1  73 GLU QG   .  73 . HG*  1 1 
       4542 1 1 1 1  73 GLU H    .  73 . HN   1 1 
       4542 1 2 1 1  74 ARG QG   .  74 . HG*  1 1 
       4543 1 1 1 1  73 GLU HA   .  73 . HA   1 1 
       4543 1 2 1 1  73 GLU QG   .  73 . HG*  1 1 
       4544 1 1 1 1  73 GLU QB   .  73 . HB*  1 1 
       4544 1 2 1 1  73 GLU QG   .  73 . HG*  1 1 
       4545 1 1 1 1  73 GLU QB   .  73 . HB*  1 1 
       4545 1 2 1 1  74 ARG H    .  74 . HN   1 1 
       4546 1 1 1 1  73 GLU QB   .  73 . HB*  1 1 
       4546 1 2 1 1  75 TYR H    .  75 . HN   1 1 
       4547 1 1 1 1  73 GLU QG   .  73 . HG*  1 1 
       4547 1 2 1 1  74 ARG H    .  74 . HN   1 1 
       4548 1 1 1 1  73 GLU QG   .  73 . HG*  1 1 
       4548 1 2 1 1  74 ARG QG   .  74 . HG*  1 1 
       4549 1 1 1 1  74 ARG H    .  74 . HN   1 1 
       4549 1 2 1 1  74 ARG QG   .  74 . HG*  1 1 
       4550 1 1 1 1  74 ARG H    .  74 . HN   1 1 
       4550 1 2 1 1  74 ARG QD   .  74 . HD*  1 1 
       4551 1 1 1 1  74 ARG HA   .  74 . HA   1 1 
       4551 1 2 1 1  74 ARG QD   .  74 . HD*  1 1 
       4552 1 1 1 1  74 ARG HA   .  74 . HA   1 1 
       4552 1 2 1 1  76 PRO QD   .  76 . HD*  1 1 
       4553 1 1 1 1  74 ARG HB2  .  74 . HB2  1 1 
       4553 1 2 1 1  74 ARG QD   .  74 . HD*  1 1 
       4554 1 1 1 1  74 ARG HB3  .  74 . HB1  1 1 
       4554 1 2 1 1  74 ARG QD   .  74 . HD*  1 1 
       4555 1 1 1 1  74 ARG QG   .  74 . HG*  1 1 
       4555 1 2 1 1  75 TYR QD   .  75 . HD*  1 1 
       4556 1 1 1 1  74 ARG QG   .  74 . HG*  1 1 
       4556 1 2 1 1  75 TYR QE   .  75 . HE*  1 1 
       4557 1 1 1 1  74 ARG QD   .  74 . HD*  1 1 
       4557 1 2 1 1  75 TYR H    .  75 . HN   1 1 
       4558 1 1 1 1  74 ARG QD   .  74 . HD*  1 1 
       4558 1 2 1 1  75 TYR QE   .  75 . HE*  1 1 
       4559 1 1 1 1  75 TYR H    .  75 . HN   1 1 
       4559 1 2 1 1  75 TYR QB   .  75 . HB*  1 1 
       4560 1 1 1 1  75 TYR H    .  75 . HN   1 1 
       4560 1 2 1 1  76 PRO QD   .  76 . HD*  1 1 
       4561 1 1 1 1  75 TYR HA   .  75 . HA   1 1 
       4561 1 2 1 1  76 PRO QD   .  76 . HD*  1 1 
       4562 1 1 1 1  75 TYR QB   .  75 . HB*  1 1 
       4562 1 2 1 1  76 PRO QD   .  76 . HD*  1 1 
       4563 1 1 1 1  75 TYR QD   .  75 . HD*  1 1 
       4563 1 2 1 1  76 PRO QD   .  76 . HD*  1 1 
       4564 1 1 1 1  76 PRO QD   .  76 . HD*  1 1 
       4564 1 2 1 1  77 GLN H    .  77 . HN   1 1 
       4565 1 1 1 1  77 GLN H    .  77 . HN   1 1 
       4565 1 2 1 1  77 GLN QG   .  77 . HG*  1 1 
       4566 1 1 1 1  77 GLN HA   .  77 . HA   1 1 
       4566 1 2 1 1  77 GLN QG   .  77 . HG*  1 1 
       4567 1 1 1 1  77 GLN HA   .  77 . HA   1 1 
       4567 1 2 1 1  77 GLN QE   .  77 . HE*  1 1 
       4568 1 1 1 1  77 GLN QB   .  77 . HB*  1 1 
       4568 1 2 1 1  77 GLN QE   .  77 . HE*  1 1 
       4569 1 1 1 1  77 GLN QB   .  77 . HB*  1 1 
       4569 1 2 1 1  79 ASP H    .  79 . HN   1 1 
       4570 1 1 1 1  77 GLN QG   .  77 . HG*  1 1 
       4570 1 2 1 1  78 LEU H    .  78 . HN   1 1 
       4571 1 1 1 1  78 LEU QB   .  78 . HB*  1 1 
       4571 1 2 1 1  78 LEU MD1  .  78 . HD1* 1 1 
       4572 1 1 1 1  79 ASP QB   .  79 . HB*  1 1 
       4572 1 2 1 1 152 VAL MG1  . 152 . HG1* 1 1 
       4573 1 1 1 1  79 ASP QB   .  79 . HB*  1 1 
       4573 1 2 1 1 152 VAL MG2  . 152 . HG2* 1 1 
       4574 1 1 1 1  81 VAL MG1  .  81 . HG1* 1 1 
       4574 1 2 1 1 148 PHE QB   . 148 . HB*  1 1 
       4575 1 1 1 1  81 VAL MG2  .  81 . HG2* 1 1 
       4575 1 2 1 1 148 PHE QB   . 148 . HB*  1 1 
       4576 1 1 1 1  86 THR MG   .  86 . HG2* 1 1 
       4576 1 2 1 1  88 ASP QB   .  88 . HB*  1 1 
       4577 1 1 1 1  87 ASP H    .  87 . HN   1 1 
       4577 1 2 1 1  88 ASP QB   .  88 . HB*  1 1 
       4578 1 1 1 1  87 ASP QB   .  87 . HB*  1 1 
       4578 1 2 1 1  92 ILE MD   .  92 . HD1* 1 1 
       4579 1 1 1 1  87 ASP QB   .  87 . HB*  1 1 
       4579 1 2 1 1 112 ASN QD   . 112 . HD2* 1 1 
       4580 1 1 1 1  88 ASP QB   .  88 . HB*  1 1 
       4580 1 2 1 1  90 GLU H    .  90 . HN   1 1 
       4581 1 1 1 1  88 ASP QB   .  88 . HB*  1 1 
       4581 1 2 1 1  91 TRP H    .  91 . HN   1 1 
       4582 1 1 1 1  88 ASP QB   .  88 . HB*  1 1 
       4582 1 2 1 1  91 TRP HB2  .  91 . HB2  1 1 
       4583 1 1 1 1  88 ASP QB   .  88 . HB*  1 1 
       4583 1 2 1 1  91 TRP HB3  .  91 . HB1  1 1 
       4584 1 1 1 1  88 ASP QB   .  88 . HB*  1 1 
       4584 1 2 1 1  91 TRP HD1  .  91 . HD1  1 1 
       4585 1 1 1 1  88 ASP QB   .  88 . HB*  1 1 
       4585 1 2 1 1  91 TRP HE1  .  91 . HE1  1 1 
       4586 1 1 1 1  89 LYS H    .  89 . HN   1 1 
       4586 1 2 1 1  89 LYS QB   .  89 . HB*  1 1 
       4587 1 1 1 1  89 LYS H    .  89 . HN   1 1 
       4587 1 2 1 1  89 LYS QG   .  89 . HG*  1 1 
       4588 1 1 1 1  89 LYS H    .  89 . HN   1 1 
       4588 1 2 1 1  89 LYS QD   .  89 . HD*  1 1 
       4589 1 1 1 1  89 LYS H    .  89 . HN   1 1 
       4589 1 2 1 1  89 LYS QE   .  89 . HE*  1 1 
       4590 1 1 1 1  89 LYS HA   .  89 . HA   1 1 
       4590 1 2 1 1  89 LYS QE   .  89 . HE*  1 1 
       4591 1 1 1 1  89 LYS QB   .  89 . HB*  1 1 
       4591 1 2 1 1  89 LYS QD   .  89 . HD*  1 1 
       4592 1 1 1 1  89 LYS QB   .  89 . HB*  1 1 
       4592 1 2 1 1  90 GLU H    .  90 . HN   1 1 
       4593 1 1 1 1  89 LYS QB   .  89 . HB*  1 1 
       4593 1 2 1 1  92 ILE MD   .  92 . HD1* 1 1 
       4594 1 1 1 1  89 LYS QB   .  89 . HB*  1 1 
       4594 1 2 1 1 125 PHE QE   . 125 . HE*  1 1 
       4595 1 1 1 1  89 LYS QB   .  89 . HB*  1 1 
       4595 1 2 1 1 125 PHE HZ   . 125 . HZ   1 1 
       4596 1 1 1 1  89 LYS QE   .  89 . HE*  1 1 
       4596 1 2 1 1  89 LYS QG   .  89 . HG*  1 1 
       4597 1 1 1 1  89 LYS QG   .  89 . HG*  1 1 
       4597 1 2 1 1  90 GLU H    .  90 . HN   1 1 
       4598 1 1 1 1  89 LYS QG   .  89 . HG*  1 1 
       4598 1 2 1 1 125 PHE HZ   . 125 . HZ   1 1 
       4599 1 1 1 1  89 LYS QD   .  89 . HD*  1 1 
       4599 1 2 1 1  89 LYS QE   .  89 . HE*  1 1 
       4600 1 1 1 1  89 LYS QD   .  89 . HD*  1 1 
       4600 1 2 1 1 125 PHE HZ   . 125 . HZ   1 1 
       4601 1 1 1 1  89 LYS QE   .  89 . HE*  1 1 
       4601 1 2 1 1  90 GLU H    .  90 . HN   1 1 
       4602 1 1 1 1  90 GLU H    .  90 . HN   1 1 
       4602 1 2 1 1  90 GLU QG   .  90 . HG*  1 1 
       4603 1 1 1 1  90 GLU HA   .  90 . HA   1 1 
       4603 1 2 1 1  90 GLU QG   .  90 . HG*  1 1 
       4604 1 1 1 1  90 GLU HA   .  90 . HA   1 1 
       4604 1 2 1 1  93 LYS QB   .  93 . HB*  1 1 
       4605 1 1 1 1  90 GLU QG   .  90 . HG*  1 1 
       4605 1 2 1 1  91 TRP H    .  91 . HN   1 1 
       4606 1 1 1 1  90 GLU QG   .  90 . HG*  1 1 
       4606 1 2 1 1  91 TRP HD1  .  91 . HD1  1 1 
       4607 1 1 1 1  90 GLU QG   .  90 . HG*  1 1 
       4607 1 2 1 1  91 TRP HE1  .  91 . HE1  1 1 
       4608 1 1 1 1  91 TRP HA   .  91 . HA   1 1 
       4608 1 2 1 1  94 ASP QB   .  94 . HB*  1 1 
       4609 1 1 1 1  92 ILE H    .  92 . HN   1 1 
       4609 1 2 1 1  93 LYS QB   .  93 . HB*  1 1 
       4610 1 1 1 1  92 ILE HB   .  92 . HB   1 1 
       4610 1 2 1 1  93 LYS QB   .  93 . HB*  1 1 
       4611 1 1 1 1  92 ILE MG   .  92 . HG2* 1 1 
       4611 1 2 1 1  93 LYS QB   .  93 . HB*  1 1 
       4612 1 1 1 1  93 LYS H    .  93 . HN   1 1 
       4612 1 2 1 1  93 LYS QB   .  93 . HB*  1 1 
       4613 1 1 1 1  93 LYS H    .  93 . HN   1 1 
       4613 1 2 1 1  93 LYS QG   .  93 . HG*  1 1 
       4614 1 1 1 1  93 LYS H    .  93 . HN   1 1 
       4614 1 2 1 1  93 LYS QD   .  93 . HD*  1 1 
       4615 1 1 1 1  93 LYS H    .  93 . HN   1 1 
       4615 1 2 1 1  93 LYS QE   .  93 . HE*  1 1 
       4616 1 1 1 1  93 LYS HA   .  93 . HA   1 1 
       4616 1 2 1 1  93 LYS QG   .  93 . HG*  1 1 
       4617 1 1 1 1  93 LYS HA   .  93 . HA   1 1 
       4617 1 2 1 1  93 LYS QD   .  93 . HD*  1 1 
       4618 1 1 1 1  93 LYS QB   .  93 . HB*  1 1 
       4618 1 2 1 1  93 LYS QD   .  93 . HD*  1 1 
       4619 1 1 1 1  93 LYS QB   .  93 . HB*  1 1 
       4619 1 2 1 1  93 LYS QE   .  93 . HE*  1 1 
       4620 1 1 1 1  93 LYS QB   .  93 . HB*  1 1 
       4620 1 2 1 1  94 ASP H    .  94 . HN   1 1 
       4621 1 1 1 1  93 LYS QB   .  93 . HB*  1 1 
       4621 1 2 1 1  95 PHE H    .  95 . HN   1 1 
       4622 1 1 1 1  93 LYS QB   .  93 . HB*  1 1 
       4622 1 2 1 1 125 PHE QD   . 125 . HD*  1 1 
       4623 1 1 1 1  93 LYS QB   .  93 . HB*  1 1 
       4623 1 2 1 1 125 PHE QE   . 125 . HE*  1 1 
       4624 1 1 1 1  93 LYS QB   .  93 . HB*  1 1 
       4624 1 2 1 1 125 PHE HZ   . 125 . HZ   1 1 
       4625 1 1 1 1  93 LYS QD   .  93 . HD*  1 1 
       4625 1 2 1 1  93 LYS QG   .  93 . HG*  1 1 
       4626 1 1 1 1  93 LYS QE   .  93 . HE*  1 1 
       4626 1 2 1 1  93 LYS QG   .  93 . HG*  1 1 
       4627 1 1 1 1  93 LYS QG   .  93 . HG*  1 1 
       4627 1 2 1 1  94 ASP H    .  94 . HN   1 1 
       4628 1 1 1 1  93 LYS QG   .  93 . HG*  1 1 
       4628 1 2 1 1 125 PHE QD   . 125 . HD*  1 1 
       4629 1 1 1 1  93 LYS QG   .  93 . HG*  1 1 
       4629 1 2 1 1 125 PHE QE   . 125 . HE*  1 1 
       4630 1 1 1 1  93 LYS QD   .  93 . HD*  1 1 
       4630 1 2 1 1  94 ASP H    .  94 . HN   1 1 
       4631 1 1 1 1  93 LYS QE   .  93 . HE*  1 1 
       4631 1 2 1 1  94 ASP H    .  94 . HN   1 1 
       4632 1 1 1 1  94 ASP H    .  94 . HN   1 1 
       4632 1 2 1 1  94 ASP QB   .  94 . HB*  1 1 
       4633 1 1 1 1  94 ASP QB   .  94 . HB*  1 1 
       4633 1 2 1 1  95 PHE H    .  95 . HN   1 1 
       4634 1 1 1 1  94 ASP QB   .  94 . HB*  1 1 
       4634 1 2 1 1  95 PHE HB2  .  95 . HB2  1 1 
       4635 1 1 1 1  95 PHE H    .  95 . HN   1 1 
       4635 1 2 1 1  98 GLU QG   .  98 . HG*  1 1 
       4636 1 1 1 1  96 ILE HA   .  96 . HA   1 1 
       4636 1 2 1 1 130 VAL QG   . 130 . HG*  1 1 
       4637 1 1 1 1  96 ILE MG   .  96 . HG2* 1 1 
       4637 1 2 1 1 100 LYS QG   . 100 . HG*  1 1 
       4638 1 1 1 1  96 ILE MG   .  96 . HG2* 1 1 
       4638 1 2 1 1 100 LYS QD   . 100 . HD*  1 1 
       4639 1 1 1 1  96 ILE MG   .  96 . HG2* 1 1 
       4639 1 2 1 1 100 LYS QE   . 100 . HE*  1 1 
       4640 1 1 1 1  96 ILE MG   .  96 . HG2* 1 1 
       4640 1 2 1 1 127 SER QB   . 127 . HB*  1 1 
       4641 1 1 1 1  96 ILE MD   .  96 . HD1* 1 1 
       4641 1 2 1 1 100 LYS QE   . 100 . HE*  1 1 
       4642 1 1 1 1  96 ILE MD   .  96 . HD1* 1 1 
       4642 1 2 1 1 127 SER QB   . 127 . HB*  1 1 
       4643 1 1 1 1  97 GLU HA   .  97 . HA   1 1 
       4643 1 2 1 1 100 LYS QG   . 100 . HG*  1 1 
       4644 1 1 1 1  98 GLU H    .  98 . HN   1 1 
       4644 1 2 1 1  98 GLU QG   .  98 . HG*  1 1 
       4645 1 1 1 1  98 GLU HA   .  98 . HA   1 1 
       4645 1 2 1 1  98 GLU QG   .  98 . HG*  1 1 
       4646 1 1 1 1  98 GLU HA   .  98 . HA   1 1 
       4646 1 2 1 1 101 GLU QB   . 101 . HB*  1 1 
       4647 1 1 1 1  98 GLU HB2  .  98 . HB2  1 1 
       4647 1 2 1 1  98 GLU QG   .  98 . HG*  1 1 
       4648 1 1 1 1  98 GLU QG   .  98 . HG*  1 1 
       4648 1 2 1 1  99 ALA H    .  99 . HN   1 1 
       4649 1 1 1 1  99 ALA H    .  99 . HN   1 1 
       4649 1 2 1 1 100 LYS QG   . 100 . HG*  1 1 
       4650 1 1 1 1  99 ALA HA   .  99 . HA   1 1 
       4650 1 2 1 1 102 ARG QG   . 102 . HG*  1 1 
       4651 1 1 1 1 100 LYS H    . 100 . HN   1 1 
       4651 1 2 1 1 100 LYS QG   . 100 . HG*  1 1 
       4652 1 1 1 1 100 LYS H    . 100 . HN   1 1 
       4652 1 2 1 1 100 LYS QD   . 100 . HD*  1 1 
       4653 1 1 1 1 100 LYS H    . 100 . HN   1 1 
       4653 1 2 1 1 101 GLU QB   . 101 . HB*  1 1 
       4654 1 1 1 1 100 LYS HA   . 100 . HA   1 1 
       4654 1 2 1 1 100 LYS QG   . 100 . HG*  1 1 
       4655 1 1 1 1 100 LYS HA   . 100 . HA   1 1 
       4655 1 2 1 1 100 LYS QD   . 100 . HD*  1 1 
       4656 1 1 1 1 100 LYS HA   . 100 . HA   1 1 
       4656 1 2 1 1 100 LYS QE   . 100 . HE*  1 1 
       4657 1 1 1 1 100 LYS HB2  . 100 . HB2  1 1 
       4657 1 2 1 1 101 GLU QG   . 101 . HG*  1 1 
       4658 1 1 1 1 100 LYS HB3  . 100 . HB1  1 1 
       4658 1 2 1 1 100 LYS QD   . 100 . HD*  1 1 
       4659 1 1 1 1 100 LYS QE   . 100 . HE*  1 1 
       4659 1 2 1 1 100 LYS QG   . 100 . HG*  1 1 
       4660 1 1 1 1 100 LYS QG   . 100 . HG*  1 1 
       4660 1 2 1 1 101 GLU H    . 101 . HN   1 1 
       4661 1 1 1 1 100 LYS QD   . 100 . HD*  1 1 
       4661 1 2 1 1 100 LYS QE   . 100 . HE*  1 1 
       4662 1 1 1 1 100 LYS QD   . 100 . HD*  1 1 
       4662 1 2 1 1 101 GLU H    . 101 . HN   1 1 
       4663 1 1 1 1 100 LYS QD   . 100 . HD*  1 1 
       4663 1 2 1 1 127 SER QB   . 127 . HB*  1 1 
       4664 1 1 1 1 100 LYS QE   . 100 . HE*  1 1 
       4664 1 2 1 1 127 SER QB   . 127 . HB*  1 1 
       4665 1 1 1 1 100 LYS QE   . 100 . HE*  1 1 
       4665 1 2 1 1 130 VAL QG   . 130 . HG*  1 1 
       4666 1 1 1 1 101 GLU H    . 101 . HN   1 1 
       4666 1 2 1 1 102 ARG QG   . 102 . HG*  1 1 
       4667 1 1 1 1 101 GLU HA   . 101 . HA   1 1 
       4667 1 2 1 1 101 GLU QB   . 101 . HB*  1 1 
       4668 1 1 1 1 101 GLU HA   . 101 . HA   1 1 
       4668 1 2 1 1 101 GLU QG   . 101 . HG*  1 1 
       4669 1 1 1 1 101 GLU QB   . 101 . HB*  1 1 
       4669 1 2 1 1 102 ARG H    . 102 . HN   1 1 
       4670 1 1 1 1 101 GLU QB   . 101 . HB*  1 1 
       4670 1 2 1 1 102 ARG HA   . 102 . HA   1 1 
       4671 1 1 1 1 101 GLU QB   . 101 . HB*  1 1 
       4671 1 2 1 1 102 ARG HB2  . 102 . HB2  1 1 
       4672 1 1 1 1 101 GLU QB   . 101 . HB*  1 1 
       4672 1 2 1 1 103 GLY H    . 103 . HN   1 1 
       4673 1 1 1 1 101 GLU QG   . 101 . HG*  1 1 
       4673 1 2 1 1 102 ARG H    . 102 . HN   1 1 
       4674 1 1 1 1 102 ARG H    . 102 . HN   1 1 
       4674 1 2 1 1 102 ARG QG   . 102 . HG*  1 1 
       4675 1 1 1 1 102 ARG H    . 102 . HN   1 1 
       4675 1 2 1 1 102 ARG QD   . 102 . HD*  1 1 
       4676 1 1 1 1 102 ARG H    . 102 . HN   1 1 
       4676 1 2 1 1 103 GLY QA   . 103 . HA*  1 1 
       4677 1 1 1 1 102 ARG HA   . 102 . HA   1 1 
       4677 1 2 1 1 102 ARG QD   . 102 . HD*  1 1 
       4678 1 1 1 1 102 ARG QG   . 102 . HG*  1 1 
       4678 1 2 1 1 103 GLY H    . 103 . HN   1 1 
       4679 1 1 1 1 102 ARG QG   . 102 . HG*  1 1 
       4679 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       4680 1 1 1 1 102 ARG QD   . 102 . HD*  1 1 
       4680 1 2 1 1 104 VAL MG2  . 104 . HG2* 1 1 
       4681 1 1 1 1 104 VAL HA   . 104 . HA   1 1 
       4681 1 2 1 1 105 GLU QG   . 105 . HG*  1 1 
       4682 1 1 1 1 105 GLU H    . 105 . HN   1 1 
       4682 1 2 1 1 105 GLU QG   . 105 . HG*  1 1 
       4683 1 1 1 1 105 GLU HA   . 105 . HA   1 1 
       4683 1 2 1 1 105 GLU QG   . 105 . HG*  1 1 
       4684 1 1 1 1 105 GLU HA   . 105 . HA   1 1 
       4684 1 2 1 1 129 GLY QA   . 129 . HA*  1 1 
       4685 1 1 1 1 105 GLU HA   . 105 . HA   1 1 
       4685 1 2 1 1 130 VAL QG   . 130 . HG*  1 1 
       4686 1 1 1 1 105 GLU HB2  . 105 . HB2  1 1 
       4686 1 2 1 1 129 GLY QA   . 129 . HA*  1 1 
       4687 1 1 1 1 105 GLU QG   . 105 . HG*  1 1 
       4687 1 2 1 1 106 VAL H    . 106 . HN   1 1 
       4688 1 1 1 1 105 GLU QG   . 105 . HG*  1 1 
       4688 1 2 1 1 129 GLY QA   . 129 . HA*  1 1 
       4689 1 1 1 1 106 VAL HB   . 106 . HB   1 1 
       4689 1 2 1 1 130 VAL QG   . 130 . HG*  1 1 
       4690 1 1 1 1 107 PHE H    . 107 . HN   1 1 
       4690 1 2 1 1 130 VAL QG   . 130 . HG*  1 1 
       4691 1 1 1 1 107 PHE HA   . 107 . HA   1 1 
       4691 1 2 1 1 130 VAL QG   . 130 . HG*  1 1 
       4692 1 1 1 1 107 PHE HB2  . 107 . HB2  1 1 
       4692 1 2 1 1 130 VAL QG   . 130 . HG*  1 1 
       4693 1 1 1 1 107 PHE QD   . 107 . HD*  1 1 
       4693 1 2 1 1 133 ARG QG   . 133 . HG*  1 1 
       4694 1 1 1 1 107 PHE QD   . 107 . HD*  1 1 
       4694 1 2 1 1 151 LYS QD   . 151 . HD*  1 1 
       4695 1 1 1 1 107 PHE QD   . 107 . HD*  1 1 
       4695 1 2 1 1 151 LYS QE   . 151 . HE*  1 1 
       4696 1 1 1 1 107 PHE QE   . 107 . HE*  1 1 
       4696 1 2 1 1 133 ARG QG   . 133 . HG*  1 1 
       4697 1 1 1 1 107 PHE QE   . 107 . HE*  1 1 
       4697 1 2 1 1 151 LYS QD   . 151 . HD*  1 1 
       4698 1 1 1 1 107 PHE QE   . 107 . HE*  1 1 
       4698 1 2 1 1 151 LYS QE   . 151 . HE*  1 1 
       4699 1 1 1 1 108 VAL H    . 108 . HN   1 1 
       4699 1 2 1 1 130 VAL QG   . 130 . HG*  1 1 
       4700 1 1 1 1 109 VAL MG1  . 109 . HG1* 1 1 
       4700 1 2 1 1 133 ARG QG   . 133 . HG*  1 1 
       4701 1 1 1 1 109 VAL MG1  . 109 . HG1* 1 1 
       4701 1 2 1 1 133 ARG QD   . 133 . HD*  1 1 
       4702 1 1 1 1 109 VAL MG2  . 109 . HG2* 1 1 
       4702 1 2 1 1 133 ARG QG   . 133 . HG*  1 1 
       4703 1 1 1 1 109 VAL MG2  . 109 . HG2* 1 1 
       4703 1 2 1 1 133 ARG QD   . 133 . HD*  1 1 
       4704 1 1 1 1 110 TYR HB2  . 110 . HB2  1 1 
       4704 1 2 1 1 112 ASN QD   . 112 . HD2* 1 1 
       4705 1 1 1 1 110 TYR HB2  . 110 . HB2  1 1 
       4705 1 2 1 1 132 VAL QG   . 132 . HG*  1 1 
       4706 1 1 1 1 110 TYR QD   . 110 . HD*  1 1 
       4706 1 2 1 1 112 ASN QB   . 112 . HB*  1 1 
       4707 1 1 1 1 110 TYR QD   . 110 . HD*  1 1 
       4707 1 2 1 1 118 ARG QG   . 118 . HG*  1 1 
       4708 1 1 1 1 110 TYR QD   . 110 . HD*  1 1 
       4708 1 2 1 1 118 ARG QD   . 118 . HD*  1 1 
       4709 1 1 1 1 110 TYR QD   . 110 . HD*  1 1 
       4709 1 2 1 1 132 VAL QG   . 132 . HG*  1 1 
       4710 1 1 1 1 110 TYR QE   . 110 . HE*  1 1 
       4710 1 2 1 1 112 ASN QB   . 112 . HB*  1 1 
       4711 1 1 1 1 110 TYR QE   . 110 . HE*  1 1 
       4711 1 2 1 1 112 ASN QD   . 112 . HD2* 1 1 
       4712 1 1 1 1 110 TYR QE   . 110 . HE*  1 1 
       4712 1 2 1 1 118 ARG QB   . 118 . HB*  1 1 
       4713 1 1 1 1 110 TYR QE   . 110 . HE*  1 1 
       4713 1 2 1 1 118 ARG QG   . 118 . HG*  1 1 
       4714 1 1 1 1 110 TYR QE   . 110 . HE*  1 1 
       4714 1 2 1 1 118 ARG QD   . 118 . HD*  1 1 
       4715 1 1 1 1 110 TYR QE   . 110 . HE*  1 1 
       4715 1 2 1 1 122 GLN QG   . 122 . HG*  1 1 
       4716 1 1 1 1 110 TYR QE   . 110 . HE*  1 1 
       4716 1 2 1 1 132 VAL QG   . 132 . HG*  1 1 
       4717 1 1 1 1 112 ASN H    . 112 . HN   1 1 
       4717 1 2 1 1 118 ARG QG   . 118 . HG*  1 1 
       4718 1 1 1 1 112 ASN HA   . 112 . HA   1 1 
       4718 1 2 1 1 112 ASN QD   . 112 . HD2* 1 1 
       4719 1 1 1 1 112 ASN HA   . 112 . HA   1 1 
       4719 1 2 1 1 118 ARG QD   . 118 . HD*  1 1 
       4720 1 1 1 1 112 ASN QB   . 112 . HB*  1 1 
       4720 1 2 1 1 114 ASP H    . 114 . HN   1 1 
       4721 1 1 1 1 112 ASN QB   . 112 . HB*  1 1 
       4721 1 2 1 1 118 ARG QG   . 118 . HG*  1 1 
       4722 1 1 1 1 112 ASN QB   . 112 . HB*  1 1 
       4722 1 2 1 1 118 ARG QD   . 118 . HD*  1 1 
       4723 1 1 1 1 112 ASN QD   . 112 . HD2* 1 1 
       4723 1 2 1 1 117 ARG HB2  . 117 . HB2  1 1 
       4724 1 1 1 1 112 ASN QD   . 112 . HD2* 1 1 
       4724 1 2 1 1 117 ARG QG   . 117 . HG*  1 1 
       4725 1 1 1 1 112 ASN QD   . 112 . HD2* 1 1 
       4725 1 2 1 1 117 ARG QD   . 117 . HD*  1 1 
       4726 1 1 1 1 113 LYS H    . 113 . HN   1 1 
       4726 1 2 1 1 113 LYS QG   . 113 . HG*  1 1 
       4727 1 1 1 1 113 LYS H    . 113 . HN   1 1 
       4727 1 2 1 1 113 LYS QD   . 113 . HD*  1 1 
       4728 1 1 1 1 113 LYS HA   . 113 . HA   1 1 
       4728 1 2 1 1 113 LYS QG   . 113 . HG*  1 1 
       4729 1 1 1 1 113 LYS HA   . 113 . HA   1 1 
       4729 1 2 1 1 113 LYS QD   . 113 . HD*  1 1 
       4730 1 1 1 1 113 LYS HA   . 113 . HA   1 1 
       4730 1 2 1 1 113 LYS QE   . 113 . HE*  1 1 
       4731 1 1 1 1 113 LYS QB   . 113 . HB*  1 1 
       4731 1 2 1 1 113 LYS QD   . 113 . HD*  1 1 
       4732 1 1 1 1 113 LYS QB   . 113 . HB*  1 1 
       4732 1 2 1 1 113 LYS QE   . 113 . HE*  1 1 
       4733 1 1 1 1 113 LYS QB   . 113 . HB*  1 1 
       4733 1 2 1 1 136 SER HB2  . 136 . HB2  1 1 
       4734 1 1 1 1 113 LYS QD   . 113 . HD*  1 1 
       4734 1 2 1 1 113 LYS QG   . 113 . HG*  1 1 
       4735 1 1 1 1 113 LYS QE   . 113 . HE*  1 1 
       4735 1 2 1 1 113 LYS QG   . 113 . HG*  1 1 
       4736 1 1 1 1 113 LYS QG   . 113 . HG*  1 1 
       4736 1 2 1 1 114 ASP H    . 114 . HN   1 1 
       4737 1 1 1 1 113 LYS QG   . 113 . HG*  1 1 
       4737 1 2 1 1 136 SER HB2  . 136 . HB2  1 1 
       4738 1 1 1 1 113 LYS QG   . 113 . HG*  1 1 
       4738 1 2 1 1 136 SER HB3  . 136 . HB1  1 1 
       4739 1 1 1 1 114 ASP H    . 114 . HN   1 1 
       4739 1 2 1 1 114 ASP QB   . 114 . HB*  1 1 
       4740 1 1 1 1 114 ASP HA   . 114 . HA   1 1 
       4740 1 2 1 1 115 ASP QB   . 115 . HB*  1 1 
       4741 1 1 1 1 114 ASP QB   . 114 . HB*  1 1 
       4741 1 2 1 1 115 ASP H    . 115 . HN   1 1 
       4742 1 1 1 1 114 ASP QB   . 114 . HB*  1 1 
       4742 1 2 1 1 116 ASP H    . 116 . HN   1 1 
       4743 1 1 1 1 114 ASP QB   . 114 . HB*  1 1 
       4743 1 2 1 1 117 ARG H    . 117 . HN   1 1 
       4744 1 1 1 1 114 ASP QB   . 114 . HB*  1 1 
       4744 1 2 1 1 117 ARG HA   . 117 . HA   1 1 
       4745 1 1 1 1 114 ASP QB   . 114 . HB*  1 1 
       4745 1 2 1 1 117 ARG HB2  . 117 . HB2  1 1 
       4746 1 1 1 1 114 ASP QB   . 114 . HB*  1 1 
       4746 1 2 1 1 117 ARG QG   . 117 . HG*  1 1 
       4747 1 1 1 1 114 ASP QB   . 114 . HB*  1 1 
       4747 1 2 1 1 117 ARG QD   . 117 . HD*  1 1 
       4748 1 1 1 1 114 ASP QB   . 114 . HB*  1 1 
       4748 1 2 1 1 118 ARG H    . 118 . HN   1 1 
       4749 1 1 1 1 115 ASP H    . 115 . HN   1 1 
       4749 1 2 1 1 115 ASP QB   . 115 . HB*  1 1 
       4750 1 1 1 1 115 ASP HA   . 115 . HA   1 1 
       4750 1 2 1 1 116 ASP QB   . 116 . HB*  1 1 
       4751 1 1 1 1 115 ASP HA   . 115 . HA   1 1 
       4751 1 2 1 1 118 ARG QB   . 118 . HB*  1 1 
       4752 1 1 1 1 115 ASP HA   . 115 . HA   1 1 
       4752 1 2 1 1 118 ARG QG   . 118 . HG*  1 1 
       4753 1 1 1 1 115 ASP QB   . 115 . HB*  1 1 
       4753 1 2 1 1 116 ASP H    . 116 . HN   1 1 
       4754 1 1 1 1 115 ASP QB   . 115 . HB*  1 1 
       4754 1 2 1 1 116 ASP HA   . 116 . HA   1 1 
       4755 1 1 1 1 115 ASP QB   . 115 . HB*  1 1 
       4755 1 2 1 1 118 ARG H    . 118 . HN   1 1 
       4756 1 1 1 1 115 ASP QB   . 115 . HB*  1 1 
       4756 1 2 1 1 118 ARG QB   . 118 . HB*  1 1 
       4757 1 1 1 1 116 ASP H    . 116 . HN   1 1 
       4757 1 2 1 1 116 ASP QB   . 116 . HB*  1 1 
       4758 1 1 1 1 116 ASP H    . 116 . HN   1 1 
       4758 1 2 1 1 117 ARG QG   . 117 . HG*  1 1 
       4759 1 1 1 1 116 ASP H    . 116 . HN   1 1 
       4759 1 2 1 1 118 ARG QB   . 118 . HB*  1 1 
       4760 1 1 1 1 116 ASP H    . 116 . HN   1 1 
       4760 1 2 1 1 119 LYS QB   . 119 . HB*  1 1 
       4761 1 1 1 1 116 ASP HA   . 116 . HA   1 1 
       4761 1 2 1 1 119 LYS QB   . 119 . HB*  1 1 
       4762 1 1 1 1 116 ASP HA   . 116 . HA   1 1 
       4762 1 2 1 1 119 LYS QG   . 119 . HG*  1 1 
       4763 1 1 1 1 116 ASP QB   . 116 . HB*  1 1 
       4763 1 2 1 1 117 ARG HA   . 117 . HA   1 1 
       4764 1 1 1 1 116 ASP QB   . 116 . HB*  1 1 
       4764 1 2 1 1 117 ARG QG   . 117 . HG*  1 1 
       4765 1 1 1 1 117 ARG H    . 117 . HN   1 1 
       4765 1 2 1 1 117 ARG QG   . 117 . HG*  1 1 
       4766 1 1 1 1 117 ARG H    . 117 . HN   1 1 
       4766 1 2 1 1 117 ARG QD   . 117 . HD*  1 1 
       4767 1 1 1 1 117 ARG H    . 117 . HN   1 1 
       4767 1 2 1 1 118 ARG QG   . 118 . HG*  1 1 
       4768 1 1 1 1 117 ARG HA   . 117 . HA   1 1 
       4768 1 2 1 1 117 ARG QG   . 117 . HG*  1 1 
       4769 1 1 1 1 117 ARG HA   . 117 . HA   1 1 
       4769 1 2 1 1 117 ARG QD   . 117 . HD*  1 1 
       4770 1 1 1 1 117 ARG HA   . 117 . HA   1 1 
       4770 1 2 1 1 120 GLU QG   . 120 . HG*  1 1 
       4771 1 1 1 1 117 ARG HB3  . 117 . HB1  1 1 
       4771 1 2 1 1 117 ARG QG   . 117 . HG*  1 1 
       4772 1 1 1 1 117 ARG HB3  . 117 . HB1  1 1 
       4772 1 2 1 1 117 ARG QD   . 117 . HD*  1 1 
       4773 1 1 1 1 117 ARG HB3  . 117 . HB1  1 1 
       4773 1 2 1 1 120 GLU QG   . 120 . HG*  1 1 
       4774 1 1 1 1 117 ARG QG   . 117 . HG*  1 1 
       4774 1 2 1 1 118 ARG H    . 118 . HN   1 1 
       4775 1 1 1 1 118 ARG H    . 118 . HN   1 1 
       4775 1 2 1 1 118 ARG QB   . 118 . HB*  1 1 
       4776 1 1 1 1 118 ARG H    . 118 . HN   1 1 
       4776 1 2 1 1 118 ARG QG   . 118 . HG*  1 1 
       4777 1 1 1 1 118 ARG H    . 118 . HN   1 1 
       4777 1 2 1 1 118 ARG QD   . 118 . HD*  1 1 
       4778 1 1 1 1 118 ARG HA   . 118 . HA   1 1 
       4778 1 2 1 1 118 ARG QD   . 118 . HD*  1 1 
       4779 1 1 1 1 118 ARG QB   . 118 . HB*  1 1 
       4779 1 2 1 1 118 ARG QD   . 118 . HD*  1 1 
       4780 1 1 1 1 118 ARG QB   . 118 . HB*  1 1 
       4780 1 2 1 1 134 THR HB   . 134 . HB   1 1 
       4781 1 1 1 1 118 ARG QB   . 118 . HB*  1 1 
       4781 1 2 1 1 134 THR MG   . 134 . HG2* 1 1 
       4782 1 1 1 1 118 ARG QG   . 118 . HG*  1 1 
       4782 1 2 1 1 121 ALA H    . 121 . HN   1 1 
       4783 1 1 1 1 118 ARG QG   . 118 . HG*  1 1 
       4783 1 2 1 1 134 THR HB   . 134 . HB   1 1 
       4784 1 1 1 1 118 ARG QD   . 118 . HD*  1 1 
       4784 1 2 1 1 134 THR HB   . 134 . HB   1 1 
       4785 1 1 1 1 118 ARG QD   . 118 . HD*  1 1 
       4785 1 2 1 1 134 THR MG   . 134 . HG2* 1 1 
       4786 1 1 1 1 119 LYS HA   . 119 . HA   1 1 
       4786 1 2 1 1 119 LYS QB   . 119 . HB*  1 1 
       4787 1 1 1 1 119 LYS HA   . 119 . HA   1 1 
       4787 1 2 1 1 119 LYS QE   . 119 . HE*  1 1 
       4788 1 1 1 1 119 LYS HA   . 119 . HA   1 1 
       4788 1 2 1 1 122 GLN QG   . 122 . HG*  1 1 
       4789 1 1 1 1 119 LYS HA   . 119 . HA   1 1 
       4789 1 2 1 1 122 GLN QE   . 122 . HE*  1 1 
       4790 1 1 1 1 119 LYS QB   . 119 . HB*  1 1 
       4790 1 2 1 1 119 LYS QD   . 119 . HD*  1 1 
       4791 1 1 1 1 119 LYS QB   . 119 . HB*  1 1 
       4791 1 2 1 1 120 GLU H    . 120 . HN   1 1 
       4792 1 1 1 1 119 LYS QE   . 119 . HE*  1 1 
       4792 1 2 1 1 119 LYS QG   . 119 . HG*  1 1 
       4793 1 1 1 1 119 LYS QG   . 119 . HG*  1 1 
       4793 1 2 1 1 120 GLU H    . 120 . HN   1 1 
       4794 1 1 1 1 120 GLU HA   . 120 . HA   1 1 
       4794 1 2 1 1 120 GLU QG   . 120 . HG*  1 1 
       4795 1 1 1 1 120 GLU HA   . 120 . HA   1 1 
       4795 1 2 1 1 123 GLN QB   . 123 . HB*  1 1 
       4796 1 1 1 1 120 GLU HB3  . 120 . HB1  1 1 
       4796 1 2 1 1 120 GLU QG   . 120 . HG*  1 1 
       4797 1 1 1 1 120 GLU QG   . 120 . HG*  1 1 
       4797 1 2 1 1 121 ALA H    . 121 . HN   1 1 
       4798 1 1 1 1 120 GLU QG   . 120 . HG*  1 1 
       4798 1 2 1 1 121 ALA MB   . 121 . HB*  1 1 
       4799 1 1 1 1 121 ALA H    . 121 . HN   1 1 
       4799 1 2 1 1 124 GLU QB   . 124 . HB*  1 1 
       4800 1 1 1 1 121 ALA HA   . 121 . HA   1 1 
       4800 1 2 1 1 124 GLU QB   . 124 . HB*  1 1 
       4801 1 1 1 1 121 ALA HA   . 121 . HA   1 1 
       4801 1 2 1 1 124 GLU QG   . 124 . HG*  1 1 
       4802 1 1 1 1 121 ALA MB   . 121 . HB*  1 1 
       4802 1 2 1 1 122 GLN QG   . 122 . HG*  1 1 
       4803 1 1 1 1 122 GLN H    . 122 . HN   1 1 
       4803 1 2 1 1 122 GLN QG   . 122 . HG*  1 1 
       4804 1 1 1 1 122 GLN HA   . 122 . HA   1 1 
       4804 1 2 1 1 122 GLN QG   . 122 . HG*  1 1 
       4805 1 1 1 1 122 GLN HA   . 122 . HA   1 1 
       4805 1 2 1 1 122 GLN QE   . 122 . HE*  1 1 
       4806 1 1 1 1 122 GLN HA   . 122 . HA   1 1 
       4806 1 2 1 1 132 VAL QG   . 132 . HG*  1 1 
       4807 1 1 1 1 122 GLN HB2  . 122 . HB2  1 1 
       4807 1 2 1 1 122 GLN QG   . 122 . HG*  1 1 
       4808 1 1 1 1 122 GLN HB3  . 122 . HB1  1 1 
       4808 1 2 1 1 122 GLN QE   . 122 . HE*  1 1 
       4809 1 1 1 1 122 GLN HB3  . 122 . HB1  1 1 
       4809 1 2 1 1 132 VAL QG   . 132 . HG*  1 1 
       4810 1 1 1 1 122 GLN QG   . 122 . HG*  1 1 
       4810 1 2 1 1 123 GLN H    . 123 . HN   1 1 
       4811 1 1 1 1 122 GLN QG   . 122 . HG*  1 1 
       4811 1 2 1 1 132 VAL QG   . 132 . HG*  1 1 
       4812 1 1 1 1 122 GLN QE   . 122 . HE*  1 1 
       4812 1 2 1 1 132 VAL H    . 132 . HN   1 1 
       4813 1 1 1 1 122 GLN QE   . 122 . HE*  1 1 
       4813 1 2 1 1 132 VAL QG   . 132 . HG*  1 1 
       4814 1 1 1 1 122 GLN QE   . 122 . HE*  1 1 
       4814 1 2 1 1 133 ARG HA   . 133 . HA   1 1 
       4815 1 1 1 1 122 GLN QE   . 122 . HE*  1 1 
       4815 1 2 1 1 133 ARG QD   . 133 . HD*  1 1 
       4816 1 1 1 1 122 GLN QE   . 122 . HE*  1 1 
       4816 1 2 1 1 134 THR H    . 134 . HN   1 1 
       4817 1 1 1 1 122 GLN QE   . 122 . HE*  1 1 
       4817 1 2 1 1 134 THR MG   . 134 . HG2* 1 1 
       4818 1 1 1 1 123 GLN H    . 123 . HN   1 1 
       4818 1 2 1 1 123 GLN QB   . 123 . HB*  1 1 
       4819 1 1 1 1 123 GLN H    . 123 . HN   1 1 
       4819 1 2 1 1 123 GLN QG   . 123 . HG*  1 1 
       4820 1 1 1 1 123 GLN HA   . 123 . HA   1 1 
       4820 1 2 1 1 123 GLN QG   . 123 . HG*  1 1 
       4821 1 1 1 1 123 GLN QB   . 123 . HB*  1 1 
       4821 1 2 1 1 124 GLU H    . 124 . HN   1 1 
       4822 1 1 1 1 123 GLN QG   . 123 . HG*  1 1 
       4822 1 2 1 1 124 GLU H    . 124 . HN   1 1 
       4823 1 1 1 1 124 GLU H    . 124 . HN   1 1 
       4823 1 2 1 1 124 GLU QB   . 124 . HB*  1 1 
       4824 1 1 1 1 124 GLU H    . 124 . HN   1 1 
       4824 1 2 1 1 124 GLU QG   . 124 . HG*  1 1 
       4825 1 1 1 1 124 GLU H    . 124 . HN   1 1 
       4825 1 2 1 1 132 VAL QG   . 132 . HG*  1 1 
       4826 1 1 1 1 124 GLU HA   . 124 . HA   1 1 
       4826 1 2 1 1 124 GLU QG   . 124 . HG*  1 1 
       4827 1 1 1 1 124 GLU QB   . 124 . HB*  1 1 
       4827 1 2 1 1 125 PHE H    . 125 . HN   1 1 
       4828 1 1 1 1 124 GLU QB   . 124 . HB*  1 1 
       4828 1 2 1 1 125 PHE QD   . 125 . HD*  1 1 
       4829 1 1 1 1 124 GLU QB   . 124 . HB*  1 1 
       4829 1 2 1 1 125 PHE QE   . 125 . HE*  1 1 
       4830 1 1 1 1 124 GLU QG   . 124 . HG*  1 1 
       4830 1 2 1 1 125 PHE H    . 125 . HN   1 1 
       4831 1 1 1 1 124 GLU QG   . 124 . HG*  1 1 
       4831 1 2 1 1 125 PHE HB2  . 125 . HB2  1 1 
       4832 1 1 1 1 124 GLU QG   . 124 . HG*  1 1 
       4832 1 2 1 1 125 PHE HB3  . 125 . HB1  1 1 
       4833 1 1 1 1 124 GLU QG   . 124 . HG*  1 1 
       4833 1 2 1 1 125 PHE QD   . 125 . HD*  1 1 
       4834 1 1 1 1 124 GLU QG   . 124 . HG*  1 1 
       4834 1 2 1 1 125 PHE QE   . 125 . HE*  1 1 
       4835 1 1 1 1 125 PHE H    . 125 . HN   1 1 
       4835 1 2 1 1 126 ARG QB   . 126 . HB*  1 1 
       4836 1 1 1 1 125 PHE H    . 125 . HN   1 1 
       4836 1 2 1 1 132 VAL QG   . 132 . HG*  1 1 
       4837 1 1 1 1 125 PHE HB2  . 125 . HB2  1 1 
       4837 1 2 1 1 130 VAL QG   . 130 . HG*  1 1 
       4838 1 1 1 1 125 PHE HB2  . 125 . HB2  1 1 
       4838 1 2 1 1 132 VAL QG   . 132 . HG*  1 1 
       4839 1 1 1 1 125 PHE HB3  . 125 . HB1  1 1 
       4839 1 2 1 1 130 VAL QG   . 130 . HG*  1 1 
       4840 1 1 1 1 125 PHE HB3  . 125 . HB1  1 1 
       4840 1 2 1 1 132 VAL QG   . 132 . HG*  1 1 
       4841 1 1 1 1 125 PHE QD   . 125 . HD*  1 1 
       4841 1 2 1 1 132 VAL QG   . 132 . HG*  1 1 
       4842 1 1 1 1 126 ARG H    . 126 . HN   1 1 
       4842 1 2 1 1 126 ARG QG   . 126 . HG*  1 1 
       4843 1 1 1 1 126 ARG H    . 126 . HN   1 1 
       4843 1 2 1 1 132 VAL QG   . 132 . HG*  1 1 
       4844 1 1 1 1 126 ARG HA   . 126 . HA   1 1 
       4844 1 2 1 1 126 ARG QD   . 126 . HD*  1 1 
       4845 1 1 1 1 126 ARG HA   . 126 . HA   1 1 
       4845 1 2 1 1 130 VAL QG   . 130 . HG*  1 1 
       4846 1 1 1 1 126 ARG HA   . 126 . HA   1 1 
       4846 1 2 1 1 132 VAL QG   . 132 . HG*  1 1 
       4847 1 1 1 1 126 ARG QB   . 126 . HB*  1 1 
       4847 1 2 1 1 126 ARG QG   . 126 . HG*  1 1 
       4848 1 1 1 1 126 ARG QB   . 126 . HB*  1 1 
       4848 1 2 1 1 126 ARG QD   . 126 . HD*  1 1 
       4849 1 1 1 1 126 ARG QB   . 126 . HB*  1 1 
       4849 1 2 1 1 127 SER H    . 127 . HN   1 1 
       4850 1 1 1 1 126 ARG QB   . 126 . HB*  1 1 
       4850 1 2 1 1 130 VAL QG   . 130 . HG*  1 1 
       4851 1 1 1 1 126 ARG QG   . 126 . HG*  1 1 
       4851 1 2 1 1 127 SER H    . 127 . HN   1 1 
       4852 1 1 1 1 126 ARG QG   . 126 . HG*  1 1 
       4852 1 2 1 1 132 VAL H    . 132 . HN   1 1 
       4853 1 1 1 1 126 ARG QG   . 126 . HG*  1 1 
       4853 1 2 1 1 132 VAL QG   . 132 . HG*  1 1 
       4854 1 1 1 1 126 ARG QD   . 126 . HD*  1 1 
       4854 1 2 1 1 127 SER H    . 127 . HN   1 1 
       4855 1 1 1 1 126 ARG QD   . 126 . HD*  1 1 
       4855 1 2 1 1 132 VAL H    . 132 . HN   1 1 
       4856 1 1 1 1 127 SER H    . 127 . HN   1 1 
       4856 1 2 1 1 127 SER QB   . 127 . HB*  1 1 
       4857 1 1 1 1 127 SER H    . 127 . HN   1 1 
       4857 1 2 1 1 130 VAL QG   . 130 . HG*  1 1 
       4858 1 1 1 1 127 SER H    . 127 . HN   1 1 
       4858 1 2 1 1 132 VAL QG   . 132 . HG*  1 1 
       4859 1 1 1 1 127 SER QB   . 127 . HB*  1 1 
       4859 1 2 1 1 128 ASP H    . 128 . HN   1 1 
       4860 1 1 1 1 127 SER QB   . 127 . HB*  1 1 
       4860 1 2 1 1 128 ASP QB   . 128 . HB*  1 1 
       4861 1 1 1 1 127 SER QB   . 127 . HB*  1 1 
       4861 1 2 1 1 130 VAL HB   . 130 . HB   1 1 
       4862 1 1 1 1 127 SER QB   . 127 . HB*  1 1 
       4862 1 2 1 1 130 VAL QG   . 130 . HG*  1 1 
       4863 1 1 1 1 128 ASP H    . 128 . HN   1 1 
       4863 1 2 1 1 128 ASP QB   . 128 . HB*  1 1 
       4864 1 1 1 1 128 ASP HA   . 128 . HA   1 1 
       4864 1 2 1 1 129 GLY QA   . 129 . HA*  1 1 
       4865 1 1 1 1 128 ASP HA   . 128 . HA   1 1 
       4865 1 2 1 1 130 VAL QG   . 130 . HG*  1 1 
       4866 1 1 1 1 128 ASP QB   . 128 . HB*  1 1 
       4866 1 2 1 1 130 VAL H    . 130 . HN   1 1 
       4867 1 1 1 1 130 VAL H    . 130 . HN   1 1 
       4867 1 2 1 1 130 VAL QG   . 130 . HG*  1 1 
       4868 1 1 1 1 130 VAL HA   . 130 . HA   1 1 
       4868 1 2 1 1 130 VAL QG   . 130 . HG*  1 1 
       4869 1 1 1 1 130 VAL HB   . 130 . HB   1 1 
       4869 1 2 1 1 132 VAL QG   . 132 . HG*  1 1 
       4870 1 1 1 1 130 VAL QG   . 130 . HG*  1 1 
       4870 1 2 1 1 131 ASP H    . 131 . HN   1 1 
       4871 1 1 1 1 130 VAL QG   . 130 . HG*  1 1 
       4871 1 2 1 1 131 ASP HB2  . 131 . HB2  1 1 
       4872 1 1 1 1 130 VAL QG   . 130 . HG*  1 1 
       4872 1 2 1 1 131 ASP HB3  . 131 . HB1  1 1 
       4873 1 1 1 1 131 ASP H    . 131 . HN   1 1 
       4873 1 2 1 1 132 VAL QG   . 132 . HG*  1 1 
       4874 1 1 1 1 131 ASP HB3  . 131 . HB1  1 1 
       4874 1 2 1 1 132 VAL QG   . 132 . HG*  1 1 
       4875 1 1 1 1 132 VAL H    . 132 . HN   1 1 
       4875 1 2 1 1 132 VAL QG   . 132 . HG*  1 1 
       4876 1 1 1 1 132 VAL QG   . 132 . HG*  1 1 
       4876 1 2 1 1 133 ARG H    . 133 . HN   1 1 
       4877 1 1 1 1 132 VAL QG   . 132 . HG*  1 1 
       4877 1 2 1 1 134 THR H    . 134 . HN   1 1 
       4878 1 1 1 1 132 VAL QG   . 132 . HG*  1 1 
       4878 1 2 1 1 134 THR MG   . 134 . HG2* 1 1 
       4879 1 1 1 1 133 ARG H    . 133 . HN   1 1 
       4879 1 2 1 1 133 ARG QG   . 133 . HG*  1 1 
       4880 1 1 1 1 133 ARG H    . 133 . HN   1 1 
       4880 1 2 1 1 133 ARG QD   . 133 . HD*  1 1 
       4881 1 1 1 1 133 ARG HB2  . 133 . HB2  1 1 
       4881 1 2 1 1 144 GLN QE   . 144 . HE*  1 1 
       4882 1 1 1 1 133 ARG HB3  . 133 . HB1  1 1 
       4882 1 2 1 1 133 ARG QD   . 133 . HD*  1 1 
       4883 1 1 1 1 133 ARG HB3  . 133 . HB1  1 1 
       4883 1 2 1 1 144 GLN QE   . 144 . HE*  1 1 
       4884 1 1 1 1 133 ARG QG   . 133 . HG*  1 1 
       4884 1 2 1 1 144 GLN HG3  . 144 . HG1  1 1 
       4885 1 1 1 1 133 ARG QG   . 133 . HG*  1 1 
       4885 1 2 1 1 144 GLN QE   . 144 . HE*  1 1 
       4886 1 1 1 1 133 ARG QD   . 133 . HD*  1 1 
       4886 1 2 1 1 134 THR H    . 134 . HN   1 1 
       4887 1 1 1 1 133 ARG QD   . 133 . HD*  1 1 
       4887 1 2 1 1 135 VAL MG1  . 135 . HG1* 1 1 
       4888 1 1 1 1 133 ARG QD   . 133 . HD*  1 1 
       4888 1 2 1 1 144 GLN QE   . 144 . HE*  1 1 
       4889 1 1 1 1 135 VAL MG1  . 135 . HG1* 1 1 
       4889 1 2 1 1 144 GLN QE   . 144 . HE*  1 1 
       4890 1 1 1 1 138 LYS H    . 138 . HN   1 1 
       4890 1 2 1 1 138 LYS QG   . 138 . HG*  1 1 
       4891 1 1 1 1 138 LYS H    . 138 . HN   1 1 
       4891 1 2 1 1 138 LYS QD   . 138 . HD*  1 1 
       4892 1 1 1 1 138 LYS HA   . 138 . HA   1 1 
       4892 1 2 1 1 138 LYS QG   . 138 . HG*  1 1 
       4893 1 1 1 1 138 LYS HA   . 138 . HA   1 1 
       4893 1 2 1 1 138 LYS QD   . 138 . HD*  1 1 
       4894 1 1 1 1 138 LYS HB2  . 138 . HB2  1 1 
       4894 1 2 1 1 138 LYS QD   . 138 . HD*  1 1 
       4895 1 1 1 1 138 LYS HB3  . 138 . HB1  1 1 
       4895 1 2 1 1 138 LYS QD   . 138 . HD*  1 1 
       4896 1 1 1 1 138 LYS HB3  . 138 . HB1  1 1 
       4896 1 2 1 1 138 LYS QE   . 138 . HE*  1 1 
       4897 1 1 1 1 138 LYS QE   . 138 . HE*  1 1 
       4897 1 2 1 1 138 LYS QG   . 138 . HG*  1 1 
       4898 1 1 1 1 138 LYS QG   . 138 . HG*  1 1 
       4898 1 2 1 1 139 GLU H    . 139 . HN   1 1 
       4899 1 1 1 1 138 LYS QG   . 138 . HG*  1 1 
       4899 1 2 1 1 139 GLU HA   . 139 . HA   1 1 
       4900 1 1 1 1 138 LYS QG   . 138 . HG*  1 1 
       4900 1 2 1 1 142 ILE MD   . 142 . HD1* 1 1 
       4901 1 1 1 1 138 LYS QE   . 138 . HE*  1 1 
       4901 1 2 1 1 142 ILE MD   . 142 . HD1* 1 1 
       4902 1 1 1 1 139 GLU H    . 139 . HN   1 1 
       4902 1 2 1 1 139 GLU QB   . 139 . HB*  1 1 
       4903 1 1 1 1 139 GLU HA   . 139 . HA   1 1 
       4903 1 2 1 1 139 GLU QG   . 139 . HG*  1 1 
       4904 1 1 1 1 139 GLU QB   . 139 . HB*  1 1 
       4904 1 2 1 1 139 GLU QG   . 139 . HG*  1 1 
       4905 1 1 1 1 139 GLU QB   . 139 . HB*  1 1 
       4905 1 2 1 1 140 GLU H    . 140 . HN   1 1 
       4906 1 1 1 1 139 GLU QB   . 139 . HB*  1 1 
       4906 1 2 1 1 142 ILE HG12 . 142 . HG12 1 1 
       4907 1 1 1 1 139 GLU QB   . 139 . HB*  1 1 
       4907 1 2 1 1 142 ILE MD   . 142 . HD1* 1 1 
       4908 1 1 1 1 139 GLU QG   . 139 . HG*  1 1 
       4908 1 2 1 1 142 ILE MG   . 142 . HG2* 1 1 
       4909 1 1 1 1 139 GLU QG   . 139 . HG*  1 1 
       4909 1 2 1 1 142 ILE HG12 . 142 . HG12 1 1 
       4910 1 1 1 1 140 GLU H    . 140 . HN   1 1 
       4910 1 2 1 1 143 GLU QG   . 143 . HG*  1 1 
       4911 1 1 1 1 140 GLU HA   . 140 . HA   1 1 
       4911 1 2 1 1 143 GLU QG   . 143 . HG*  1 1 
       4912 1 1 1 1 143 GLU H    . 143 . HN   1 1 
       4912 1 2 1 1 143 GLU QB   . 143 . HB*  1 1 
       4913 1 1 1 1 143 GLU H    . 143 . HN   1 1 
       4913 1 2 1 1 143 GLU QG   . 143 . HG*  1 1 
       4914 1 1 1 1 143 GLU HA   . 143 . HA   1 1 
       4914 1 2 1 1 143 GLU QG   . 143 . HG*  1 1 
       4915 1 1 1 1 143 GLU QB   . 143 . HB*  1 1 
       4915 1 2 1 1 143 GLU QG   . 143 . HG*  1 1 
       4916 1 1 1 1 143 GLU QB   . 143 . HB*  1 1 
       4916 1 2 1 1 144 GLN H    . 144 . HN   1 1 
       4917 1 1 1 1 143 GLU QB   . 143 . HB*  1 1 
       4917 1 2 1 1 144 GLN QE   . 144 . HE*  1 1 
       4918 1 1 1 1 143 GLU QG   . 143 . HG*  1 1 
       4918 1 2 1 1 144 GLN H    . 144 . HN   1 1 
       4919 1 1 1 1 143 GLU QG   . 143 . HG*  1 1 
       4919 1 2 1 1 144 GLN QE   . 144 . HE*  1 1 
       4920 1 1 1 1 143 GLU QG   . 143 . HG*  1 1 
       4920 1 2 1 1 146 ARG HG3  . 146 . HG1  1 1 
       4921 1 1 1 1 143 GLU QG   . 143 . HG*  1 1 
       4921 1 2 1 1 146 ARG HD2  . 146 . HD2  1 1 
       4922 1 1 1 1 144 GLN H    . 144 . HN   1 1 
       4922 1 2 1 1 144 GLN QE   . 144 . HE*  1 1 
       4923 1 1 1 1 144 GLN HA   . 144 . HA   1 1 
       4923 1 2 1 1 144 GLN QE   . 144 . HE*  1 1 
       4924 1 1 1 1 144 GLN QE   . 144 . HE*  1 1 
       4924 1 2 1 1 147 ARG HB2  . 147 . HB2  1 1 
       4925 1 1 1 1 144 GLN QE   . 144 . HE*  1 1 
       4925 1 2 1 1 147 ARG HG2  . 147 . HG2  1 1 
       4926 1 1 1 1 144 GLN QE   . 144 . HE*  1 1 
       4926 1 2 1 1 147 ARG HD2  . 147 . HD2  1 1 
       4927 1 1 1 1 145 VAL HA   . 145 . HA   1 1 
       4927 1 2 1 1 148 PHE QB   . 148 . HB*  1 1 
       4928 1 1 1 1 145 VAL MG1  . 145 . HG1* 1 1 
       4928 1 2 1 1 148 PHE QB   . 148 . HB*  1 1 
       4929 1 1 1 1 147 ARG HA   . 147 . HA   1 1 
       4929 1 2 1 1 150 ARG QG   . 150 . HG*  1 1 
       4930 1 1 1 1 147 ARG HA   . 147 . HA   1 1 
       4930 1 2 1 1 150 ARG QD   . 150 . HD*  1 1 
       4931 1 1 1 1 147 ARG HB2  . 147 . HB2  1 1 
       4931 1 2 1 1 148 PHE QB   . 148 . HB*  1 1 
       4932 1 1 1 1 148 PHE H    . 148 . HN   1 1 
       4932 1 2 1 1 151 LYS QD   . 151 . HD*  1 1 
       4933 1 1 1 1 148 PHE HA   . 148 . HA   1 1 
       4933 1 2 1 1 151 LYS QB   . 151 . HB*  1 1 
       4934 1 1 1 1 148 PHE HA   . 148 . HA   1 1 
       4934 1 2 1 1 151 LYS QG   . 151 . HG*  1 1 
       4935 1 1 1 1 148 PHE HA   . 148 . HA   1 1 
       4935 1 2 1 1 151 LYS QD   . 151 . HD*  1 1 
       4936 1 1 1 1 148 PHE HA   . 148 . HA   1 1 
       4936 1 2 1 1 151 LYS QE   . 151 . HE*  1 1 
       4937 1 1 1 1 148 PHE QB   . 148 . HB*  1 1 
       4937 1 2 1 1 149 VAL H    . 149 . HN   1 1 
       4938 1 1 1 1 148 PHE QB   . 148 . HB*  1 1 
       4938 1 2 1 1 149 VAL MG2  . 149 . HG2* 1 1 
       4939 1 1 1 1 148 PHE QB   . 148 . HB*  1 1 
       4939 1 2 1 1 152 VAL MG2  . 152 . HG2* 1 1 
       4940 1 1 1 1 148 PHE QD   . 148 . HD*  1 1 
       4940 1 2 1 1 151 LYS QB   . 151 . HB*  1 1 
       4941 1 1 1 1 148 PHE QD   . 148 . HD*  1 1 
       4941 1 2 1 1 151 LYS QG   . 151 . HG*  1 1 
       4942 1 1 1 1 148 PHE QD   . 148 . HD*  1 1 
       4942 1 2 1 1 151 LYS QD   . 151 . HD*  1 1 
       4943 1 1 1 1 149 VAL MG1  . 149 . HG1* 1 1 
       4943 1 2 1 1 153 GLY QA   . 153 . HA*  1 1 
       4944 1 1 1 1 149 VAL MG2  . 149 . HG2* 1 1 
       4944 1 2 1 1 150 ARG QG   . 150 . HG*  1 1 
       4945 1 1 1 1 150 ARG H    . 150 . HN   1 1 
       4945 1 2 1 1 150 ARG QG   . 150 . HG*  1 1 
       4946 1 1 1 1 150 ARG H    . 150 . HN   1 1 
       4946 1 2 1 1 150 ARG QD   . 150 . HD*  1 1 
       4947 1 1 1 1 150 ARG HA   . 150 . HA   1 1 
       4947 1 2 1 1 150 ARG QG   . 150 . HG*  1 1 
       4948 1 1 1 1 150 ARG HA   . 150 . HA   1 1 
       4948 1 2 1 1 150 ARG QD   . 150 . HD*  1 1 
       4949 1 1 1 1 150 ARG HB2  . 150 . HB2  1 1 
       4949 1 2 1 1 150 ARG QD   . 150 . HD*  1 1 
       4950 1 1 1 1 150 ARG HB3  . 150 . HB1  1 1 
       4950 1 2 1 1 150 ARG QG   . 150 . HG*  1 1 
       4951 1 1 1 1 151 LYS H    . 151 . HN   1 1 
       4951 1 2 1 1 151 LYS QB   . 151 . HB*  1 1 
       4952 1 1 1 1 151 LYS H    . 151 . HN   1 1 
       4952 1 2 1 1 151 LYS QG   . 151 . HG*  1 1 
       4953 1 1 1 1 151 LYS H    . 151 . HN   1 1 
       4953 1 2 1 1 151 LYS QD   . 151 . HD*  1 1 
       4954 1 1 1 1 151 LYS H    . 151 . HN   1 1 
       4954 1 2 1 1 151 LYS QE   . 151 . HE*  1 1 
       4955 1 1 1 1 151 LYS HA   . 151 . HA   1 1 
       4955 1 2 1 1 151 LYS QG   . 151 . HG*  1 1 
       4956 1 1 1 1 151 LYS HA   . 151 . HA   1 1 
       4956 1 2 1 1 151 LYS QD   . 151 . HD*  1 1 
       4957 1 1 1 1 151 LYS QB   . 151 . HB*  1 1 
       4957 1 2 1 1 151 LYS QD   . 151 . HD*  1 1 
       4958 1 1 1 1 151 LYS QB   . 151 . HB*  1 1 
       4958 1 2 1 1 151 LYS QE   . 151 . HE*  1 1 
       4959 1 1 1 1 151 LYS QB   . 151 . HB*  1 1 
       4959 1 2 1 1 152 VAL H    . 152 . HN   1 1 
       4960 1 1 1 1 151 LYS QB   . 151 . HB*  1 1 
       4960 1 2 1 1 152 VAL HA   . 152 . HA   1 1 
       4961 1 1 1 1 151 LYS QB   . 151 . HB*  1 1 
       4961 1 2 1 1 152 VAL MG1  . 152 . HG1* 1 1 
       4962 1 1 1 1 151 LYS QB   . 151 . HB*  1 1 
       4962 1 2 1 1 152 VAL MG2  . 152 . HG2* 1 1 
       4963 1 1 1 1 151 LYS QE   . 151 . HE*  1 1 
       4963 1 2 1 1 151 LYS QG   . 151 . HG*  1 1 
       4964 1 1 1 1 151 LYS QG   . 151 . HG*  1 1 
       4964 1 2 1 1 152 VAL H    . 152 . HN   1 1 
       4965 1 1 1 1 151 LYS QG   . 151 . HG*  1 1 
       4965 1 2 1 1 152 VAL MG1  . 152 . HG1* 1 1 
       4966 1 1 1 1 151 LYS QG   . 151 . HG*  1 1 
       4966 1 2 1 1 152 VAL MG2  . 152 . HG2* 1 1 
       4967 1 1 1 1 151 LYS QD   . 151 . HD*  1 1 
       4967 1 2 1 1 152 VAL H    . 152 . HN   1 1 
       4968 1 1 1 1 152 VAL H    . 152 . HN   1 1 
       4968 1 2 1 1 153 GLY QA   . 153 . HA*  1 1 
       4969 1 1 1 1 152 VAL HB   . 152 . HB   1 1 
       4969 1 2 1 1 153 GLY QA   . 153 . HA*  1 1 
       4970 1 1 1 1 152 VAL MG2  . 152 . HG2* 1 1 
       4970 1 2 1 1 153 GLY QA   . 153 . HA*  1 1 
       4971 1 1 1 1 153 GLY QA   . 153 . HA*  1 1 
       4971 1 2 1 1 155 LEU H    . 155 . HN   1 1 
       4972 1 1 1 1 154 SER H    . 154 . HN   1 1 
       4972 1 2 1 1 154 SER QB   . 154 . HB*  1 1 
       4973 1 1 1 1 154 SER QB   . 154 . HB*  1 1 
       4973 1 2 1 1 155 LEU H    . 155 . HN   1 1 
       4974 1 1 1 1 155 LEU QB   . 155 . HB*  1 1 
       4974 1 2 1 1 155 LEU HG   . 155 . HG   1 1 
       4975 1 1 1 1 155 LEU QB   . 155 . HB*  1 1 
       4975 1 2 1 1 156 GLU H    . 156 . HN   1 1 
       4976 1 1 1 1 155 LEU MD2  . 155 . HD2* 1 1 
       4976 1 2 1 1 156 GLU QB   . 156 . HB*  1 1 
       4977 1 1 1 1 156 GLU H    . 156 . HN   1 1 
       4977 1 2 1 1 156 GLU QB   . 156 . HB*  1 1 
       4978 1 1 1 1 156 GLU HA   . 156 . HA   1 1 
       4978 1 2 1 1 156 GLU QG   . 156 . HG*  1 1 
       4979 1 1 1 1 156 GLU QB   . 156 . HB*  1 1 
       4979 1 2 1 1 157 HIS H    . 157 . HN   1 1 
       4980 1 1 1 1 156 GLU QG   . 156 . HG*  1 1 
       4980 1 2 1 1 157 HIS H    . 157 . HN   1 1 
       4981 1 1 1 1 158 HIS QB   . 158 . HB*  1 1 
       4981 1 2 1 1 158 HIS HD2  . 158 . HD2  1 1 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

          1 1 . . . . . 4.99 1.8 5.49 1 1 
          2 1 . . . . . 3.01 1.8 3.31 1 1 
          3 1 . . . . . 4.42 1.8 4.86 1 1 
          4 1 . . . . .  4.8 1.8 5.28 1 1 
          5 1 . . . . . 4.04 1.8 4.44 1 1 
          6 1 . . . . . 3.41 1.8 3.75 1 1 
          7 1 . . . . . 4.21 1.8 4.63 1 1 
          8 1 . . . . . 4.21 1.8 4.63 1 1 
          9 1 . . . . . 4.46 1.8 4.91 1 1 
         10 1 . . . . . 3.23 1.8 3.55 1 1 
         11 1 . . . . . 3.23 1.8 3.55 1 1 
         12 1 . . . . . 4.29 1.8 4.72 1 1 
         13 1 . . . . . 4.06 1.8 4.47 1 1 
         14 1 . . . . . 3.79 1.8 4.17 1 1 
         15 1 . . . . . 3.17 1.8 3.49 1 1 
         16 1 . . . . . 4.28 1.8 4.71 1 1 
         17 1 . . . . . 3.38 1.8 3.72 1 1 
         18 1 . . . . .  4.6 1.8 5.06 1 1 
         19 1 . . . . . 2.99 1.8 3.29 1 1 
         20 1 . . . . . 4.52 1.8 4.97 1 1 
         21 1 . . . . . 4.25 1.8 4.68 1 1 
         22 1 . . . . .  4.6 1.8 5.06 1 1 
         23 1 . . . . . 4.83 1.8 5.31 1 1 
         24 1 . . . . .  5.3 1.8 5.83 1 1 
         25 1 . . . . . 3.88 1.8 4.27 1 1 
         26 1 . . . . . 3.64 1.8  4.0 1 1 
         27 1 . . . . . 3.68 1.8 4.05 1 1 
         28 1 . . . . . 4.05 1.8 4.46 1 1 
         29 1 . . . . . 4.95 1.8 5.44 1 1 
         30 1 . . . . . 4.69 1.8 5.16 1 1 
         31 1 . . . . . 3.95 1.8 4.35 1 1 
         32 1 . . . . . 4.41 1.8 4.85 1 1 
         33 1 . . . . . 4.42 1.8 4.86 1 1 
         34 1 . . . . . 3.32 1.8 3.65 1 1 
         35 1 . . . . . 3.63 1.8 3.99 1 1 
         36 1 . . . . . 3.63 1.8 3.99 1 1 
         37 1 . . . . . 3.99 1.8 4.39 1 1 
         38 1 . . . . . 3.59 1.8 3.95 1 1 
         39 1 . . . . . 3.96 1.8 4.36 1 1 
         40 1 . . . . . 4.56 1.8 5.02 1 1 
         41 1 . . . . . 3.31 1.8 3.64 1 1 
         42 1 . . . . . 3.39 1.8 3.73 1 1 
         43 1 . . . . . 3.64 1.8  4.0 1 1 
         44 1 . . . . . 4.24 1.8 4.66 1 1 
         45 1 . . . . . 3.83 1.8 4.21 1 1 
         46 1 . . . . .  3.1 1.8 3.41 1 1 
         47 1 . . . . . 2.86 1.8 3.15 1 1 
         48 1 . . . . . 3.74 1.8 4.11 1 1 
         49 1 . . . . . 3.64 1.8  4.0 1 1 
         50 1 . . . . . 4.35 1.8 4.79 1 1 
         51 1 . . . . . 3.76 1.8 4.14 1 1 
         52 1 . . . . . 3.31 1.8 3.64 1 1 
         53 1 . . . . . 3.75 1.8 4.13 1 1 
         54 1 . . . . . 3.21 1.8 3.53 1 1 
         55 1 . . . . . 2.83 1.8 3.11 1 1 
         56 1 . . . . . 4.43 1.8 4.87 1 1 
         57 1 . . . . . 4.68 1.8 5.15 1 1 
         58 1 . . . . . 3.04 1.8 3.34 1 1 
         59 1 . . . . . 4.54 1.8 4.99 1 1 
         60 1 . . . . . 4.54 1.8 4.99 1 1 
         61 1 . . . . . 4.47 1.8 4.92 1 1 
         62 1 . . . . . 3.96 1.8 4.36 1 1 
         63 1 . . . . . 5.19 1.8 5.71 1 1 
         64 1 . . . . . 4.82 1.8  5.3 1 1 
         65 1 . . . . . 4.55 1.8 5.01 1 1 
         66 1 . . . . . 2.82 1.8  3.1 1 1 
         67 1 . . . . . 4.02 1.8 4.42 1 1 
         68 1 . . . . . 3.12 1.8 3.43 1 1 
         69 1 . . . . . 2.89 1.8 3.18 1 1 
         70 1 . . . . .  3.7 1.8 4.07 1 1 
         71 1 . . . . . 3.29 1.8 3.62 1 1 
         72 1 . . . . .  3.3 1.8 3.63 1 1 
         73 1 . . . . . 5.12 1.8 5.63 1 1 
         74 1 . . . . . 3.19 1.8 3.51 1 1 
         75 1 . . . . . 4.79 1.8 5.27 1 1 
         76 1 . . . . . 4.78 1.8 5.26 1 1 
         77 1 . . . . . 2.99 1.8 3.29 1 1 
         78 1 . . . . . 4.41 1.8 4.85 1 1 
         79 1 . . . . . 3.31 1.8 3.64 1 1 
         80 1 . . . . . 3.12 1.8 3.43 1 1 
         81 1 . . . . . 4.56 1.8 5.02 1 1 
         82 1 . . . . . 3.03 1.8 3.33 1 1 
         83 1 . . . . . 4.13 1.8 4.54 1 1 
         84 1 . . . . . 4.35 1.8 4.79 1 1 
         85 1 . . . . . 4.41 1.8 4.85 1 1 
         86 1 . . . . . 4.68 1.8 5.15 1 1 
         87 1 . . . . . 3.48 1.8 3.83 1 1 
         88 1 . . . . . 4.48 1.8 4.93 1 1 
         89 1 . . . . . 2.91 1.8  3.2 1 1 
         90 1 . . . . . 4.49 1.8 4.94 1 1 
         91 1 . . . . . 4.97 1.8 5.47 1 1 
         92 1 . . . . . 5.65 1.8 6.21 1 1 
         93 1 . . . . . 4.06 1.8 4.47 1 1 
         94 1 . . . . . 4.87 1.8 5.36 1 1 
         95 1 . . . . .  3.2 1.8 3.52 1 1 
         96 1 . . . . . 4.93 1.8 5.42 1 1 
         97 1 . . . . . 4.81 1.8 5.29 1 1 
         98 1 . . . . . 4.02 1.8 4.42 1 1 
         99 1 . . . . . 4.44 1.8 4.88 1 1 
        100 1 . . . . . 4.78 1.8 5.26 1 1 
        101 1 . . . . . 3.12 1.8 3.43 1 1 
        102 1 . . . . . 4.16 1.8 4.58 1 1 
        103 1 . . . . . 3.07 1.8 3.38 1 1 
        104 1 . . . . .  4.1 1.8 4.51 1 1 
        105 1 . . . . . 3.44 1.8 3.78 1 1 
        106 1 . . . . . 3.89 1.8 4.28 1 1 
        107 1 . . . . . 3.89 1.8 4.28 1 1 
        108 1 . . . . . 4.63 1.8 5.09 1 1 
        109 1 . . . . . 3.04 1.8 3.34 1 1 
        110 1 . . . . . 4.53 1.8 4.98 1 1 
        111 1 . . . . . 4.53 1.8 4.98 1 1 
        112 1 . . . . . 3.39 1.8 3.73 1 1 
        113 1 . . . . . 2.96 1.8 3.26 1 1 
        114 1 . . . . .  4.9 1.8 5.39 1 1 
        115 1 . . . . .  5.2 1.8 5.72 1 1 
        116 1 . . . . .  4.9 1.8 5.39 1 1 
        117 1 . . . . . 3.36 1.8  3.7 1 1 
        118 1 . . . . . 5.59 1.8 6.15 1 1 
        119 1 . . . . . 4.15 1.8 4.57 1 1 
        120 1 . . . . . 3.33 1.8 3.66 1 1 
        121 1 . . . . . 5.44 1.8 5.98 1 1 
        122 1 . . . . .  6.2 1.8 6.82 1 1 
        123 1 . . . . .  6.2 1.8 6.82 1 1 
        124 1 . . . . .  6.2 1.8 6.82 1 1 
        125 1 . . . . . 2.85 1.8 3.13 1 1 
        126 1 . . . . .  6.2 1.8 6.82 1 1 
        127 1 . . . . .  6.2 1.8 6.82 1 1 
        128 1 . . . . . 3.21 1.8 3.53 1 1 
        129 1 . . . . . 3.88 1.8 4.27 1 1 
        130 1 . . . . . 3.88 1.8 4.27 1 1 
        131 1 . . . . . 2.84 1.8 3.12 1 1 
        132 1 . . . . . 3.44 1.8 3.78 1 1 
        133 1 . . . . . 4.15 1.8 4.57 1 1 
        134 1 . . . . . 4.96 1.8 5.46 1 1 
        135 1 . . . . . 4.15 1.8 4.57 1 1 
        136 1 . . . . . 3.48 1.8 3.83 1 1 
        137 1 . . . . . 4.14 1.8 4.55 1 1 
        138 1 . . . . . 3.28 1.8 3.61 1 1 
        139 1 . . . . . 3.32 1.8 3.65 1 1 
        140 1 . . . . . 3.52 1.8 3.87 1 1 
        141 1 . . . . . 4.48 1.8 4.93 1 1 
        142 1 . . . . . 3.68 1.8 4.05 1 1 
        143 1 . . . . . 3.68 1.8 4.05 1 1 
        144 1 . . . . . 3.35 1.8 3.69 1 1 
        145 1 . . . . .  3.8 1.8 4.18 1 1 
        146 1 . . . . . 4.03 1.8 4.43 1 1 
        147 1 . . . . . 4.58 1.8 5.04 1 1 
        148 1 . . . . .  3.2 1.8 3.52 1 1 
        149 1 . . . . . 3.58 1.8 3.94 1 1 
        150 1 . . . . . 5.34 1.8 5.87 1 1 
        151 1 . . . . .  3.0 1.8  3.3 1 1 
        152 1 . . . . . 3.53 1.8 3.88 1 1 
        153 1 . . . . . 4.54 1.8 4.99 1 1 
        154 1 . . . . . 4.08 1.8 4.49 1 1 
        155 1 . . . . . 5.19 1.8 5.71 1 1 
        156 1 . . . . . 5.39 1.8 5.93 1 1 
        157 1 . . . . .  3.1 1.8 3.41 1 1 
        158 1 . . . . . 4.55 1.8 5.01 1 1 
        159 1 . . . . . 2.99 1.8 3.29 1 1 
        160 1 . . . . . 4.73 1.8  5.2 1 1 
        161 1 . . . . . 3.23 1.8 3.55 1 1 
        162 1 . . . . . 2.93 1.8 3.22 1 1 
        163 1 . . . . . 4.68 1.8 5.15 1 1 
        164 1 . . . . . 2.84 1.8 3.12 1 1 
        165 1 . . . . . 4.25 1.8 4.68 1 1 
        166 1 . . . . . 4.06 1.8 4.47 1 1 
        167 1 . . . . . 3.49 1.8 3.84 1 1 
        168 1 . . . . . 5.38 1.8 5.92 1 1 
        169 1 . . . . . 5.38 1.8 5.92 1 1 
        170 1 . . . . . 2.85 1.8 3.13 1 1 
        171 1 . . . . . 2.95 1.8 3.25 1 1 
        172 1 . . . . . 3.75 1.8 4.13 1 1 
        173 1 . . . . . 4.37 1.8 4.81 1 1 
        174 1 . . . . . 3.08 1.8 3.39 1 1 
        175 1 . . . . . 4.18 1.8  4.6 1 1 
        176 1 . . . . . 3.41 1.8 3.75 1 1 
        177 1 . . . . . 4.38 1.8 4.82 1 1 
        178 1 . . . . . 3.17 1.8 3.49 1 1 
        179 1 . . . . . 3.18 1.8  3.5 1 1 
        180 1 . . . . . 3.91 1.8  4.3 1 1 
        181 1 . . . . . 3.97 1.8 4.37 1 1 
        182 1 . . . . . 3.72 1.8 4.09 1 1 
        183 1 . . . . .  3.4 1.8 3.74 1 1 
        184 1 . . . . . 3.89 1.8 4.28 1 1 
        185 1 . . . . . 4.18 1.8  4.6 1 1 
        186 1 . . . . . 3.92 1.8 4.31 1 1 
        187 1 . . . . . 4.91 1.8  5.4 1 1 
        188 1 . . . . . 4.12 1.8 4.53 1 1 
        189 1 . . . . . 4.02 1.8 4.42 1 1 
        190 1 . . . . . 3.39 1.8 3.73 1 1 
        191 1 . . . . . 3.53 1.8 3.88 1 1 
        192 1 . . . . . 3.87 1.8 4.26 1 1 
        193 1 . . . . . 5.39 1.8 5.93 1 1 
        194 1 . . . . . 4.74 1.8 5.21 1 1 
        195 1 . . . . . 3.37 1.8 3.71 1 1 
        196 1 . . . . . 3.61 1.8 3.97 1 1 
        197 1 . . . . . 3.83 1.8 4.21 1 1 
        198 1 . . . . . 5.06 1.8 5.57 1 1 
        199 1 . . . . . 4.16 1.8 4.58 1 1 
        200 1 . . . . . 5.18 1.8  5.7 1 1 
        201 1 . . . . . 3.46 1.8 3.81 1 1 
        202 1 . . . . . 3.67 1.8 4.04 1 1 
        203 1 . . . . . 3.63 1.8 3.99 1 1 
        204 1 . . . . . 5.11 1.8 5.62 1 1 
        205 1 . . . . . 5.11 1.8 5.62 1 1 
        206 1 . . . . . 4.25 1.8 4.68 1 1 
        207 1 . . . . . 4.25 1.8 4.68 1 1 
        208 1 . . . . .  3.1 1.8 3.41 1 1 
        209 1 . . . . . 4.49 1.8 4.94 1 1 
        210 1 . . . . . 3.13 1.8 3.44 1 1 
        211 1 . . . . . 4.04 1.8 4.44 1 1 
        212 1 . . . . . 3.69 1.8 4.06 1 1 
        213 1 . . . . . 5.03 1.8 5.53 1 1 
        214 1 . . . . . 3.66 1.8 4.03 1 1 
        215 1 . . . . .  4.4 1.8 4.84 1 1 
        216 1 . . . . .  4.4 1.8 4.84 1 1 
        217 1 . . . . . 5.21 1.8 5.73 1 1 
        218 1 . . . . . 5.05 1.8 5.56 1 1 
        219 1 . . . . .  5.1 1.8 5.61 1 1 
        220 1 . . . . . 5.83 1.8 6.41 1 1 
        221 1 . . . . . 5.29 1.8 5.82 1 1 
        222 1 . . . . . 3.53 1.8 3.88 1 1 
        223 1 . . . . . 4.41 1.8 4.85 1 1 
        224 1 . . . . . 3.25 1.8 3.58 1 1 
        225 1 . . . . . 3.25 1.8 3.58 1 1 
        226 1 . . . . . 3.04 1.8 3.34 1 1 
        227 1 . . . . . 3.19 1.8 3.51 1 1 
        228 1 . . . . . 4.11 1.8 4.52 1 1 
        229 1 . . . . . 4.95 1.8 5.44 1 1 
        230 1 . . . . . 3.22 1.8 3.54 1 1 
        231 1 . . . . . 4.53 1.8 4.98 1 1 
        232 1 . . . . . 2.99 1.8 3.29 1 1 
        233 1 . . . . . 4.66 1.8 5.13 1 1 
        234 1 . . . . . 3.33 1.8 3.66 1 1 
        235 1 . . . . . 4.14 1.8 4.55 1 1 
        236 1 . . . . . 3.52 1.8 3.87 1 1 
        237 1 . . . . . 3.05 1.8 3.36 1 1 
        238 1 . . . . . 3.21 1.8 3.53 1 1 
        239 1 . . . . . 4.87 1.8 5.36 1 1 
        240 1 . . . . . 4.87 1.8 5.36 1 1 
        241 1 . . . . . 2.88 1.8 3.17 1 1 
        242 1 . . . . . 4.41 1.8 4.85 1 1 
        243 1 . . . . . 4.41 1.8 4.85 1 1 
        244 1 . . . . . 3.47 1.8 3.82 1 1 
        245 1 . . . . . 4.81 1.8 5.29 1 1 
        246 1 . . . . . 4.81 1.8 5.29 1 1 
        247 1 . . . . . 3.72 1.8 4.09 1 1 
        248 1 . . . . . 3.48 1.8 3.83 1 1 
        249 1 . . . . . 4.33 1.8 4.76 1 1 
        250 1 . . . . . 4.46 1.8 4.91 1 1 
        251 1 . . . . . 3.67 1.8 4.04 1 1 
        252 1 . . . . . 3.64 1.8  4.0 1 1 
        253 1 . . . . . 4.12 1.8 4.53 1 1 
        254 1 . . . . . 5.13 1.8 5.64 1 1 
        255 1 . . . . . 4.26 1.8 4.69 1 1 
        256 1 . . . . . 4.67 1.8 5.14 1 1 
        257 1 . . . . . 3.94 1.8 4.33 1 1 
        258 1 . . . . . 3.94 1.8 4.33 1 1 
        259 1 . . . . . 4.91 1.8  5.4 1 1 
        260 1 . . . . . 4.91 1.8  5.4 1 1 
        261 1 . . . . . 4.05 1.8 4.46 1 1 
        262 1 . . . . . 4.05 1.8 4.46 1 1 
        263 1 . . . . . 3.84 1.8 4.22 1 1 
        264 1 . . . . . 4.19 1.8 4.61 1 1 
        265 1 . . . . . 3.42 1.8 3.76 1 1 
        266 1 . . . . . 3.32 1.8 3.65 1 1 
        267 1 . . . . . 3.82 1.8  4.2 1 1 
        268 1 . . . . . 4.09 1.8  4.5 1 1 
        269 1 . . . . . 3.03 1.8 3.33 1 1 
        270 1 . . . . . 4.81 1.8 5.29 1 1 
        271 1 . . . . . 4.67 1.8 5.14 1 1 
        272 1 . . . . . 3.66 1.8 4.03 1 1 
        273 1 . . . . . 5.03 1.8 5.53 1 1 
        274 1 . . . . . 3.83 1.8 4.21 1 1 
        275 1 . . . . . 3.56 1.8 3.92 1 1 
        276 1 . . . . . 3.82 1.8  4.2 1 1 
        277 1 . . . . . 3.86 1.8 4.25 1 1 
        278 1 . . . . . 5.21 1.8 5.73 1 1 
        279 1 . . . . . 5.21 1.8 5.73 1 1 
        280 1 . . . . . 3.56 1.8 3.92 1 1 
        281 1 . . . . . 3.22 1.8 3.54 1 1 
        282 1 . . . . . 3.94 1.8 4.33 1 1 
        283 1 . . . . . 4.17 1.8 4.59 1 1 
        284 1 . . . . . 5.66 1.8 6.23 1 1 
        285 1 . . . . . 5.66 1.8 6.23 1 1 
        286 1 . . . . . 5.51 1.8 6.06 1 1 
        287 1 . . . . . 3.89 1.8 4.28 1 1 
        288 1 . . . . . 4.54 1.8 4.99 1 1 
        289 1 . . . . . 2.93 1.8 3.22 1 1 
        290 1 . . . . . 3.76 1.8 4.14 1 1 
        291 1 . . . . . 3.43 1.8 3.77 1 1 
        292 1 . . . . . 4.17 1.8 4.59 1 1 
        293 1 . . . . .  3.2 1.8 3.52 1 1 
        294 1 . . . . . 3.89 1.8 4.28 1 1 
        295 1 . . . . . 4.95 1.8 5.44 1 1 
        296 1 . . . . . 3.31 1.8 3.64 1 1 
        297 1 . . . . . 4.71 1.8 5.18 1 1 
        298 1 . . . . . 4.99 1.8 5.49 1 1 
        299 1 . . . . .  4.4 1.8 4.84 1 1 
        300 1 . . . . . 3.18 1.8  3.5 1 1 
        301 1 . . . . . 4.65 1.8 5.12 1 1 
        302 1 . . . . . 4.89 1.8 5.38 1 1 
        303 1 . . . . . 3.83 1.8 4.21 1 1 
        304 1 . . . . . 2.99 1.8 3.29 1 1 
        305 1 . . . . . 4.23 1.8 4.65 1 1 
        306 1 . . . . . 3.82 1.8  4.2 1 1 
        307 1 . . . . . 5.96 1.8 6.56 1 1 
        308 1 . . . . . 5.24 1.8 5.76 1 1 
        309 1 . . . . . 4.88 1.8 5.37 1 1 
        310 1 . . . . . 3.23 1.8 3.55 1 1 
        311 1 . . . . . 4.59 1.8 5.05 1 1 
        312 1 . . . . . 5.22 1.8 5.74 1 1 
        313 1 . . . . . 4.43 1.8 4.87 1 1 
        314 1 . . . . . 3.55 1.8  3.9 1 1 
        315 1 . . . . . 4.07 1.8 4.48 1 1 
        316 1 . . . . . 4.27 1.8  4.7 1 1 
        317 1 . . . . . 4.27 1.8  4.7 1 1 
        318 1 . . . . .  6.2 1.8 6.82 1 1 
        319 1 . . . . .  6.2 1.8 6.82 1 1 
        320 1 . . . . . 3.43 1.8 3.77 1 1 
        321 1 . . . . . 3.69 1.8 4.06 1 1 
        322 1 . . . . . 4.28 1.8 4.71 1 1 
        323 1 . . . . . 4.28 1.8 4.71 1 1 
        324 1 . . . . . 3.91 1.8  4.3 1 1 
        325 1 . . . . . 3.91 1.8  4.3 1 1 
        326 1 . . . . . 5.37 1.8 5.91 1 1 
        327 1 . . . . . 5.37 1.8 5.91 1 1 
        328 1 . . . . . 3.47 1.8 3.82 1 1 
        329 1 . . . . . 4.16 1.8 4.58 1 1 
        330 1 . . . . . 4.19 1.8 4.61 1 1 
        331 1 . . . . . 4.06 1.8 4.47 1 1 
        332 1 . . . . . 3.79 1.8 4.17 1 1 
        333 1 . . . . . 3.13 1.8 3.44 1 1 
        334 1 . . . . . 3.43 1.8 3.77 1 1 
        335 1 . . . . . 3.49 1.8 3.84 1 1 
        336 1 . . . . . 4.32 1.8 4.75 1 1 
        337 1 . . . . .  4.7 1.8 5.17 1 1 
        338 1 . . . . . 2.94 1.8 3.23 1 1 
        339 1 . . . . . 4.48 1.8 4.93 1 1 
        340 1 . . . . . 3.32 1.8 3.65 1 1 
        341 1 . . . . . 3.61 1.8 3.97 1 1 
        342 1 . . . . . 3.82 1.8  4.2 1 1 
        343 1 . . . . . 4.34 1.8 4.77 1 1 
        344 1 . . . . . 4.34 1.8 4.77 1 1 
        345 1 . . . . . 5.03 1.8 5.53 1 1 
        346 1 . . . . . 3.49 1.8 3.84 1 1 
        347 1 . . . . . 4.58 1.8 5.04 1 1 
        348 1 . . . . . 4.58 1.8 5.04 1 1 
        349 1 . . . . . 4.56 1.8 5.02 1 1 
        350 1 . . . . . 3.02 1.8 3.32 1 1 
        351 1 . . . . . 4.43 1.8 4.87 1 1 
        352 1 . . . . . 3.96 1.8 4.36 1 1 
        353 1 . . . . . 3.96 1.8 4.36 1 1 
        354 1 . . . . . 4.51 1.8 4.96 1 1 
        355 1 . . . . . 2.74 1.8 3.01 1 1 
        356 1 . . . . . 4.02 1.8 4.42 1 1 
        357 1 . . . . . 4.42 1.8 4.86 1 1 
        358 1 . . . . . 3.17 1.8 3.49 1 1 
        359 1 . . . . . 4.28 1.8 4.71 1 1 
        360 1 . . . . . 3.21 1.8 3.53 1 1 
        361 1 . . . . . 4.17 1.8 4.59 1 1 
        362 1 . . . . . 5.49 1.8 6.04 1 1 
        363 1 . . . . . 3.33 1.8 3.66 1 1 
        364 1 . . . . . 4.15 1.8 4.57 1 1 
        365 1 . . . . . 4.16 1.8 4.58 1 1 
        366 1 . . . . . 3.96 1.8 4.36 1 1 
        367 1 . . . . . 4.64 1.8  5.1 1 1 
        368 1 . . . . .  4.3 1.8 4.73 1 1 
        369 1 . . . . . 3.32 1.8 3.65 1 1 
        370 1 . . . . . 4.18 1.8  4.6 1 1 
        371 1 . . . . . 3.38 1.8 3.72 1 1 
        372 1 . . . . . 3.67 1.8 4.04 1 1 
        373 1 . . . . .  4.3 1.8 4.73 1 1 
        374 1 . . . . . 3.36 1.8  3.7 1 1 
        375 1 . . . . . 4.51 1.8 4.96 1 1 
        376 1 . . . . . 3.86 1.8 4.25 1 1 
        377 1 . . . . . 3.11 1.8 3.42 1 1 
        378 1 . . . . . 3.11 1.8 3.42 1 1 
        379 1 . . . . . 3.47 1.8 3.82 1 1 
        380 1 . . . . .  4.3 1.8 4.73 1 1 
        381 1 . . . . .  5.2 1.8 5.72 1 1 
        382 1 . . . . . 4.09 1.8  4.5 1 1 
        383 1 . . . . . 3.72 1.8 4.09 1 1 
        384 1 . . . . .  3.8 1.8 4.18 1 1 
        385 1 . . . . . 4.75 1.8 5.22 1 1 
        386 1 . . . . . 4.68 1.8 5.15 1 1 
        387 1 . . . . . 3.23 1.8 3.55 1 1 
        388 1 . . . . . 4.05 1.8 4.46 1 1 
        389 1 . . . . . 4.68 1.8 5.15 1 1 
        390 1 . . . . . 3.18 1.8  3.5 1 1 
        391 1 . . . . . 4.61 1.8 5.07 1 1 
        392 1 . . . . . 3.42 1.8 3.76 1 1 
        393 1 . . . . .  3.6 1.8 3.96 1 1 
        394 1 . . . . . 4.01 1.8 4.41 1 1 
        395 1 . . . . . 3.61 1.8 3.97 1 1 
        396 1 . . . . . 4.15 1.8 4.57 1 1 
        397 1 . . . . . 4.56 1.8 5.02 1 1 
        398 1 . . . . . 3.48 1.8 3.83 1 1 
        399 1 . . . . .  4.9 1.8 5.39 1 1 
        400 1 . . . . . 3.11 1.8 3.42 1 1 
        401 1 . . . . . 4.23 1.8 4.65 1 1 
        402 1 . . . . . 4.23 1.8 4.65 1 1 
        403 1 . . . . . 4.05 1.8 4.46 1 1 
        404 1 . . . . . 3.26 1.8 3.59 1 1 
        405 1 . . . . . 3.49 1.8 3.84 1 1 
        406 1 . . . . . 2.97 1.8 3.27 1 1 
        407 1 . . . . . 3.55 1.8  3.9 1 1 
        408 1 . . . . . 3.12 1.8 3.43 1 1 
        409 1 . . . . . 4.89 1.8 5.38 1 1 
        410 1 . . . . . 5.41 1.8 5.95 1 1 
        411 1 . . . . .  4.8 1.8 5.28 1 1 
        412 1 . . . . .  3.5 1.8 3.85 1 1 
        413 1 . . . . . 4.06 1.8 4.47 1 1 
        414 1 . . . . . 4.19 1.8 4.61 1 1 
        415 1 . . . . . 3.61 1.8 3.97 1 1 
        416 1 . . . . . 3.86 1.8 4.25 1 1 
        417 1 . . . . . 3.27 1.8  3.6 1 1 
        418 1 . . . . . 4.58 1.8 5.04 1 1 
        419 1 . . . . . 3.32 1.8 3.65 1 1 
        420 1 . . . . . 4.22 1.8 4.64 1 1 
        421 1 . . . . . 4.22 1.8 4.64 1 1 
        422 1 . . . . . 4.91 1.8  5.4 1 1 
        423 1 . . . . . 4.15 1.8 4.57 1 1 
        424 1 . . . . .  4.6 1.8 5.06 1 1 
        425 1 . . . . .  4.6 1.8 5.06 1 1 
        426 1 . . . . . 4.29 1.8 4.72 1 1 
        427 1 . . . . . 5.51 1.8 6.06 1 1 
        428 1 . . . . . 3.96 1.8 4.36 1 1 
        429 1 . . . . . 4.96 1.8 5.46 1 1 
        430 1 . . . . . 4.61 1.8 5.07 1 1 
        431 1 . . . . . 5.15 1.8 5.67 1 1 
        432 1 . . . . . 4.68 1.8 5.15 1 1 
        433 1 . . . . . 4.83 1.8 5.31 1 1 
        434 1 . . . . .  6.2 1.8 6.82 1 1 
        435 1 . . . . .  6.2 1.8 6.82 1 1 
        436 1 . . . . .  6.2 1.8 6.82 1 1 
        437 1 . . . . . 3.88 1.8 4.27 1 1 
        438 1 . . . . . 5.06 1.8 5.57 1 1 
        439 1 . . . . . 5.06 1.8 5.57 1 1 
        440 1 . . . . . 4.77 1.8 5.25 1 1 
        441 1 . . . . . 4.26 1.8 4.69 1 1 
        442 1 . . . . . 5.45 1.8  6.0 1 1 
        443 1 . . . . . 4.95 1.8 5.44 1 1 
        444 1 . . . . . 4.83 1.8 5.31 1 1 
        445 1 . . . . . 4.05 1.8 4.46 1 1 
        446 1 . . . . . 3.74 1.8 4.11 1 1 
        447 1 . . . . . 4.88 1.8 5.37 1 1 
        448 1 . . . . . 5.87 1.8 6.46 1 1 
        449 1 . . . . . 4.89 1.8 5.38 1 1 
        450 1 . . . . . 4.69 1.8 5.16 1 1 
        451 1 . . . . . 5.23 1.8 5.75 1 1 
        452 1 . . . . . 3.75 1.8 4.13 1 1 
        453 1 . . . . . 5.75 1.8 6.32 1 1 
        454 1 . . . . . 5.23 1.8 5.75 1 1 
        455 1 . . . . .  5.2 1.8 5.72 1 1 
        456 1 . . . . . 4.16 1.8 4.58 1 1 
        457 1 . . . . .  3.7 1.8 4.07 1 1 
        458 1 . . . . . 3.14 1.8 3.45 1 1 
        459 1 . . . . . 5.41 1.8 5.95 1 1 
        460 1 . . . . .  3.9 1.8 4.29 1 1 
        461 1 . . . . . 4.46 1.8 4.91 1 1 
        462 1 . . . . . 4.29 1.8 4.72 1 1 
        463 1 . . . . . 3.69 1.8 4.06 1 1 
        464 1 . . . . . 3.39 1.8 3.73 1 1 
        465 1 . . . . . 3.93 1.8 4.32 1 1 
        466 1 . . . . . 4.18 1.8  4.6 1 1 
        467 1 . . . . . 3.99 1.8 4.39 1 1 
        468 1 . . . . . 3.65 1.8 4.02 1 1 
        469 1 . . . . . 3.65 1.8 4.02 1 1 
        470 1 . . . . . 3.09 1.8  3.4 1 1 
        471 1 . . . . . 3.25 1.8 3.58 1 1 
        472 1 . . . . . 3.48 1.8 3.83 1 1 
        473 1 . . . . . 3.48 1.8 3.83 1 1 
        474 1 . . . . . 3.75 1.8 4.13 1 1 
        475 1 . . . . . 4.01 1.8 4.41 1 1 
        476 1 . . . . . 3.88 1.8 4.27 1 1 
        477 1 . . . . . 4.02 1.8 4.42 1 1 
        478 1 . . . . . 3.51 1.8 3.86 1 1 
        479 1 . . . . . 3.47 1.8 3.82 1 1 
        480 1 . . . . . 3.59 1.8 3.95 1 1 
        481 1 . . . . . 3.42 1.8 3.76 1 1 
        482 1 . . . . . 3.42 1.8 3.76 1 1 
        483 1 . . . . . 3.44 1.8 3.78 1 1 
        484 1 . . . . . 4.57 1.8 5.03 1 1 
        485 1 . . . . . 5.45 1.8  6.0 1 1 
        486 1 . . . . . 3.17 1.8 3.49 1 1 
        487 1 . . . . . 3.64 1.8  4.0 1 1 
        488 1 . . . . . 4.01 1.8 4.41 1 1 
        489 1 . . . . . 3.55 1.8  3.9 1 1 
        490 1 . . . . .  3.3 1.8 3.63 1 1 
        491 1 . . . . . 3.86 1.8 4.25 1 1 
        492 1 . . . . . 3.47 1.8 3.82 1 1 
        493 1 . . . . . 3.61 1.8 3.97 1 1 
        494 1 . . . . . 3.97 1.8 4.37 1 1 
        495 1 . . . . . 4.19 1.8 4.61 1 1 
        496 1 . . . . . 3.03 1.8 3.33 1 1 
        497 1 . . . . . 4.43 1.8 4.87 1 1 
        498 1 . . . . . 2.91 1.8  3.2 1 1 
        499 1 . . . . . 2.73 1.8  3.0 1 1 
        500 1 . . . . .  3.4 1.8 3.74 1 1 
        501 1 . . . . . 3.79 1.8 4.17 1 1 
        502 1 . . . . . 3.23 1.8 3.55 1 1 
        503 1 . . . . . 3.68 1.8 4.05 1 1 
        504 1 . . . . . 3.82 1.8  4.2 1 1 
        505 1 . . . . . 3.82 1.8  4.2 1 1 
        506 1 . . . . . 3.27 1.8  3.6 1 1 
        507 1 . . . . . 4.26 1.8 4.69 1 1 
        508 1 . . . . . 3.33 1.8 3.66 1 1 
        509 1 . . . . . 3.22 1.8 3.54 1 1 
        510 1 . . . . . 2.79 1.8 3.07 1 1 
        511 1 . . . . . 3.47 1.8 3.82 1 1 
        512 1 . . . . . 5.56 1.8 6.12 1 1 
        513 1 . . . . . 3.23 1.8 3.55 1 1 
        514 1 . . . . . 4.16 1.8 4.58 1 1 
        515 1 . . . . . 4.16 1.8 4.58 1 1 
        516 1 . . . . . 3.78 1.8 4.16 1 1 
        517 1 . . . . . 3.19 1.8 3.51 1 1 
        518 1 . . . . . 3.37 1.8 3.71 1 1 
        519 1 . . . . . 3.16 1.8 3.48 1 1 
        520 1 . . . . . 3.19 1.8 3.51 1 1 
        521 1 . . . . . 3.22 1.8 3.54 1 1 
        522 1 . . . . .  3.1 1.8 3.41 1 1 
        523 1 . . . . . 3.54 1.8 3.89 1 1 
        524 1 . . . . . 4.38 1.8 4.82 1 1 
        525 1 . . . . . 4.65 1.8 5.12 1 1 
        526 1 . . . . . 4.38 1.8 4.82 1 1 
        527 1 . . . . . 3.78 1.8 4.16 1 1 
        528 1 . . . . . 4.55 1.8 5.01 1 1 
        529 1 . . . . . 4.19 1.8 4.61 1 1 
        530 1 . . . . . 3.69 1.8 4.06 1 1 
        531 1 . . . . . 3.51 1.8 3.86 1 1 
        532 1 . . . . .  4.7 1.8 5.17 1 1 
        533 1 . . . . . 4.38 1.8 4.82 1 1 
        534 1 . . . . . 3.93 1.8 4.32 1 1 
        535 1 . . . . . 3.76 1.8 4.14 1 1 
        536 1 . . . . . 3.73 1.8  4.1 1 1 
        537 1 . . . . . 4.12 1.8 4.53 1 1 
        538 1 . . . . . 3.89 1.8 4.28 1 1 
        539 1 . . . . . 3.45 1.8 3.79 1 1 
        540 1 . . . . . 3.59 1.8 3.95 1 1 
        541 1 . . . . . 4.09 1.8  4.5 1 1 
        542 1 . . . . . 3.68 1.8 4.05 1 1 
        543 1 . . . . . 3.68 1.8 4.05 1 1 
        544 1 . . . . .  4.1 1.8 4.51 1 1 
        545 1 . . . . .  3.7 1.8 4.07 1 1 
        546 1 . . . . .  3.7 1.8 4.07 1 1 
        547 1 . . . . . 2.93 1.8 3.22 1 1 
        548 1 . . . . . 3.92 1.8 4.31 1 1 
        549 1 . . . . . 4.01 1.8 4.41 1 1 
        550 1 . . . . . 4.29 1.8 4.72 1 1 
        551 1 . . . . . 4.01 1.8 4.41 1 1 
        552 1 . . . . .  4.8 1.8 5.28 1 1 
        553 1 . . . . .  4.8 1.8 5.28 1 1 
        554 1 . . . . . 3.38 1.8 3.72 1 1 
        555 1 . . . . . 3.99 1.8 4.39 1 1 
        556 1 . . . . . 5.28 1.8 5.81 1 1 
        557 1 . . . . . 4.67 1.8 5.14 1 1 
        558 1 . . . . . 4.67 1.8 5.14 1 1 
        559 1 . . . . . 3.11 1.8 3.42 1 1 
        560 1 . . . . . 3.11 1.8 3.42 1 1 
        561 1 . . . . . 5.49 1.8 6.04 1 1 
        562 1 . . . . . 3.63 1.8 3.99 1 1 
        563 1 . . . . . 3.63 1.8 3.99 1 1 
        564 1 . . . . . 3.72 1.8 4.09 1 1 
        565 1 . . . . . 4.09 1.8  4.5 1 1 
        566 1 . . . . . 3.54 1.8 3.89 1 1 
        567 1 . . . . . 5.35 1.8 5.89 1 1 
        568 1 . . . . .  3.6 1.8 3.96 1 1 
        569 1 . . . . . 3.43 1.8 3.77 1 1 
        570 1 . . . . . 3.57 1.8 3.93 1 1 
        571 1 . . . . . 3.99 1.8 4.39 1 1 
        572 1 . . . . . 4.12 1.8 4.53 1 1 
        573 1 . . . . . 2.94 1.8 3.23 1 1 
        574 1 . . . . . 4.67 1.8 5.14 1 1 
        575 1 . . . . . 3.72 1.8 4.09 1 1 
        576 1 . . . . .  3.5 1.8 3.85 1 1 
        577 1 . . . . .  3.5 1.8 3.85 1 1 
        578 1 . . . . . 3.64 1.8  4.0 1 1 
        579 1 . . . . . 3.82 1.8  4.2 1 1 
        580 1 . . . . .  4.0 1.8  4.4 1 1 
        581 1 . . . . . 3.06 1.8 3.37 1 1 
        582 1 . . . . . 3.42 1.8 3.76 1 1 
        583 1 . . . . . 2.72 1.8 2.99 1 1 
        584 1 . . . . . 3.62 1.8 3.98 1 1 
        585 1 . . . . . 3.47 1.8 3.82 1 1 
        586 1 . . . . .  6.2 1.8 6.82 1 1 
        587 1 . . . . .  6.2 1.8 6.82 1 1 
        588 1 . . . . .  6.2 1.8 6.82 1 1 
        589 1 . . . . . 3.33 1.8 3.66 1 1 
        590 1 . . . . . 4.08 1.8 4.49 1 1 
        591 1 . . . . . 3.25 1.8 3.58 1 1 
        592 1 . . . . . 2.94 1.8 3.23 1 1 
        593 1 . . . . . 2.79 1.8 3.07 1 1 
        594 1 . . . . . 3.69 1.8 4.06 1 1 
        595 1 . . . . . 3.53 1.8 3.88 1 1 
        596 1 . . . . . 3.46 1.8 3.81 1 1 
        597 1 . . . . . 3.47 1.8 3.82 1 1 
        598 1 . . . . . 3.02 1.8 3.32 1 1 
        599 1 . . . . . 3.83 1.8 4.21 1 1 
        600 1 . . . . . 3.83 1.8 4.21 1 1 
        601 1 . . . . . 4.29 1.8 4.72 1 1 
        602 1 . . . . .  4.7 1.8 5.17 1 1 
        603 1 . . . . .  4.7 1.8 5.17 1 1 
        604 1 . . . . . 2.82 1.8  3.1 1 1 
        605 1 . . . . .  3.4 1.8 3.74 1 1 
        606 1 . . . . . 3.75 1.8 4.13 1 1 
        607 1 . . . . . 3.54 1.8 3.89 1 1 
        608 1 . . . . . 3.25 1.8 3.58 1 1 
        609 1 . . . . . 3.86 1.8 4.25 1 1 
        610 1 . . . . . 3.33 1.8 3.66 1 1 
        611 1 . . . . . 3.86 1.8 4.25 1 1 
        612 1 . . . . . 3.62 1.8 3.98 1 1 
        613 1 . . . . . 3.62 1.8 3.98 1 1 
        614 1 . . . . . 4.11 1.8 4.52 1 1 
        615 1 . . . . . 4.11 1.8 4.52 1 1 
        616 1 . . . . . 4.09 1.8  4.5 1 1 
        617 1 . . . . . 2.83 1.8 3.11 1 1 
        618 1 . . . . . 3.04 1.8 3.34 1 1 
        619 1 . . . . .  3.2 1.8 3.52 1 1 
        620 1 . . . . . 3.63 1.8 3.99 1 1 
        621 1 . . . . . 4.25 1.8 4.68 1 1 
        622 1 . . . . . 3.13 1.8 3.44 1 1 
        623 1 . . . . . 3.62 1.8 3.98 1 1 
        624 1 . . . . . 3.62 1.8 3.98 1 1 
        625 1 . . . . . 3.45 1.8 3.79 1 1 
        626 1 . . . . . 3.45 1.8 3.79 1 1 
        627 1 . . . . . 3.39 1.8 3.73 1 1 
        628 1 . . . . . 3.43 1.8 3.77 1 1 
        629 1 . . . . . 3.98 1.8 4.38 1 1 
        630 1 . . . . .  3.5 1.8 3.85 1 1 
        631 1 . . . . . 3.85 1.8 4.23 1 1 
        632 1 . . . . . 3.87 1.8 4.26 1 1 
        633 1 . . . . . 3.58 1.8 3.94 1 1 
        634 1 . . . . . 3.54 1.8 3.89 1 1 
        635 1 . . . . . 3.65 1.8 4.02 1 1 
        636 1 . . . . . 3.71 1.8 4.08 1 1 
        637 1 . . . . .  3.7 1.8 4.07 1 1 
        638 1 . . . . .  3.7 1.8 4.07 1 1 
        639 1 . . . . . 3.61 1.8 3.97 1 1 
        640 1 . . . . . 3.61 1.8 3.97 1 1 
        641 1 . . . . . 3.23 1.8 3.55 1 1 
        642 1 . . . . . 3.77 1.8 4.15 1 1 
        643 1 . . . . . 3.77 1.8 4.15 1 1 
        644 1 . . . . . 4.01 1.8 4.41 1 1 
        645 1 . . . . . 3.76 1.8 4.14 1 1 
        646 1 . . . . . 3.76 1.8 4.14 1 1 
        647 1 . . . . . 4.19 1.8 4.61 1 1 
        648 1 . . . . . 4.32 1.8 4.75 1 1 
        649 1 . . . . . 4.98 1.8 5.48 1 1 
        650 1 . . . . . 3.36 1.8  3.7 1 1 
        651 1 . . . . . 3.88 1.8 4.27 1 1 
        652 1 . . . . . 4.13 1.8 4.54 1 1 
        653 1 . . . . . 3.81 1.8 4.19 1 1 
        654 1 . . . . . 3.81 1.8 4.19 1 1 
        655 1 . . . . . 4.67 1.8 5.14 1 1 
        656 1 . . . . .  3.5 1.8 3.85 1 1 
        657 1 . . . . . 3.66 1.8 4.03 1 1 
        658 1 . . . . . 3.43 1.8 3.77 1 1 
        659 1 . . . . . 3.93 1.8 4.32 1 1 
        660 1 . . . . . 3.45 1.8 3.79 1 1 
        661 1 . . . . . 3.27 1.8  3.6 1 1 
        662 1 . . . . . 4.01 1.8 4.41 1 1 
        663 1 . . . . . 3.27 1.8  3.6 1 1 
        664 1 . . . . . 4.08 1.8 4.49 1 1 
        665 1 . . . . . 3.85 1.8 4.23 1 1 
        666 1 . . . . .  4.7 1.8 5.17 1 1 
        667 1 . . . . . 3.58 1.8 3.94 1 1 
        668 1 . . . . . 4.03 1.8 4.43 1 1 
        669 1 . . . . .  3.0 1.8  3.3 1 1 
        670 1 . . . . . 4.02 1.8 4.42 1 1 
        671 1 . . . . . 3.12 1.8 3.43 1 1 
        672 1 . . . . . 3.51 1.8 3.86 1 1 
        673 1 . . . . . 3.51 1.8 3.86 1 1 
        674 1 . . . . . 3.81 1.8 4.19 1 1 
        675 1 . . . . . 3.81 1.8 4.19 1 1 
        676 1 . . . . . 3.15 1.8 3.47 1 1 
        677 1 . . . . . 3.77 1.8 4.15 1 1 
        678 1 . . . . . 3.77 1.8 4.15 1 1 
        679 1 . . . . . 3.77 1.8 4.15 1 1 
        680 1 . . . . . 3.81 1.8 4.19 1 1 
        681 1 . . . . . 3.92 1.8 4.31 1 1 
        682 1 . . . . . 4.81 1.8 5.29 1 1 
        683 1 . . . . .  3.7 1.8 4.07 1 1 
        684 1 . . . . . 4.25 1.8 4.68 1 1 
        685 1 . . . . . 4.13 1.8 4.54 1 1 
        686 1 . . . . . 3.64 1.8  4.0 1 1 
        687 1 . . . . . 4.02 1.8 4.42 1 1 
        688 1 . . . . . 3.36 1.8  3.7 1 1 
        689 1 . . . . . 3.36 1.8  3.7 1 1 
        690 1 . . . . . 4.82 1.8  5.3 1 1 
        691 1 . . . . . 3.65 1.8 4.02 1 1 
        692 1 . . . . . 3.65 1.8 4.02 1 1 
        693 1 . . . . . 3.37 1.8 3.71 1 1 
        694 1 . . . . . 3.46 1.8 3.81 1 1 
        695 1 . . . . . 4.35 1.8 4.79 1 1 
        696 1 . . . . . 3.12 1.8 3.43 1 1 
        697 1 . . . . . 3.24 1.8 3.56 1 1 
        698 1 . . . . . 3.32 1.8 3.65 1 1 
        699 1 . . . . . 3.77 1.8 4.15 1 1 
        700 1 . . . . . 3.08 1.8 3.39 1 1 
        701 1 . . . . . 2.92 1.8 3.21 1 1 
        702 1 . . . . . 2.91 1.8  3.2 1 1 
        703 1 . . . . . 3.68 1.8 4.05 1 1 
        704 1 . . . . . 3.93 1.8 4.32 1 1 
        705 1 . . . . . 4.31 1.8 4.74 1 1 
        706 1 . . . . . 3.58 1.8 3.94 1 1 
        707 1 . . . . . 3.58 1.8 3.94 1 1 
        708 1 . . . . . 4.37 1.8 4.81 1 1 
        709 1 . . . . . 3.67 1.8 4.04 1 1 
        710 1 . . . . .  3.4 1.8 3.74 1 1 
        711 1 . . . . .  4.5 1.8 4.95 1 1 
        712 1 . . . . .  4.5 1.8 4.95 1 1 
        713 1 . . . . . 5.28 1.8 5.81 1 1 
        714 1 . . . . . 3.69 1.8 4.06 1 1 
        715 1 . . . . . 3.22 1.8 3.54 1 1 
        716 1 . . . . . 3.33 1.8 3.66 1 1 
        717 1 . . . . . 3.71 1.8 4.08 1 1 
        718 1 . . . . . 3.88 1.8 4.27 1 1 
        719 1 . . . . . 3.88 1.8 4.27 1 1 
        720 1 . . . . . 3.63 1.8 3.99 1 1 
        721 1 . . . . . 4.12 1.8 4.53 1 1 
        722 1 . . . . . 4.71 1.8 5.18 1 1 
        723 1 . . . . . 3.58 1.8 3.94 1 1 
        724 1 . . . . . 3.83 1.8 4.21 1 1 
        725 1 . . . . .  4.3 1.8 4.73 1 1 
        726 1 . . . . . 3.42 1.8 3.76 1 1 
        727 1 . . . . . 3.05 1.8 3.36 1 1 
        728 1 . . . . . 3.52 1.8 3.87 1 1 
        729 1 . . . . . 3.81 1.8 4.19 1 1 
        730 1 . . . . . 3.81 1.8 4.19 1 1 
        731 1 . . . . . 5.38 1.8 5.92 1 1 
        732 1 . . . . . 5.38 1.8 5.92 1 1 
        733 1 . . . . . 3.66 1.8 4.03 1 1 
        734 1 . . . . . 3.66 1.8 4.03 1 1 
        735 1 . . . . . 3.82 1.8  4.2 1 1 
        736 1 . . . . . 3.05 1.8 3.36 1 1 
        737 1 . . . . . 5.52 1.8 6.07 1 1 
        738 1 . . . . . 5.52 1.8 6.07 1 1 
        739 1 . . . . . 3.82 1.8  4.2 1 1 
        740 1 . . . . . 3.14 1.8 3.45 1 1 
        741 1 . . . . . 3.62 1.8 3.98 1 1 
        742 1 . . . . . 3.62 1.8 3.98 1 1 
        743 1 . . . . . 3.04 1.8 3.34 1 1 
        744 1 . . . . . 4.06 1.8 4.47 1 1 
        745 1 . . . . . 3.66 1.8 4.03 1 1 
        746 1 . . . . . 4.71 1.8 5.18 1 1 
        747 1 . . . . . 3.78 1.8 4.16 1 1 
        748 1 . . . . . 3.78 1.8 4.16 1 1 
        749 1 . . . . . 5.03 1.8 5.53 1 1 
        750 1 . . . . . 5.03 1.8 5.53 1 1 
        751 1 . . . . . 3.98 1.8 4.38 1 1 
        752 1 . . . . . 3.98 1.8 4.38 1 1 
        753 1 . . . . . 4.02 1.8 4.42 1 1 
        754 1 . . . . . 4.02 1.8 4.42 1 1 
        755 1 . . . . . 3.36 1.8  3.7 1 1 
        756 1 . . . . .  4.0 1.8  4.4 1 1 
        757 1 . . . . .  4.0 1.8  4.4 1 1 
        758 1 . . . . .  3.7 1.8 4.07 1 1 
        759 1 . . . . . 3.48 1.8 3.83 1 1 
        760 1 . . . . . 3.56 1.8 3.92 1 1 
        761 1 . . . . . 3.73 1.8  4.1 1 1 
        762 1 . . . . . 4.67 1.8 5.14 1 1 
        763 1 . . . . . 4.67 1.8 5.14 1 1 
        764 1 . . . . . 3.91 1.8  4.3 1 1 
        765 1 . . . . . 5.13 1.8 5.64 1 1 
        766 1 . . . . . 3.82 1.8  4.2 1 1 
        767 1 . . . . . 3.87 1.8 4.26 1 1 
        768 1 . . . . . 3.62 1.8 3.98 1 1 
        769 1 . . . . . 3.64 1.8  4.0 1 1 
        770 1 . . . . . 3.97 1.8 4.37 1 1 
        771 1 . . . . . 2.83 1.8 3.11 1 1 
        772 1 . . . . . 3.61 1.8 3.97 1 1 
        773 1 . . . . .  3.3 1.8 3.63 1 1 
        774 1 . . . . . 3.11 1.8 3.42 1 1 
        775 1 . . . . . 3.23 1.8 3.55 1 1 
        776 1 . . . . . 4.63 1.8 5.09 1 1 
        777 1 . . . . . 3.14 1.8 3.45 1 1 
        778 1 . . . . . 3.91 1.8  4.3 1 1 
        779 1 . . . . . 3.75 1.8 4.13 1 1 
        780 1 . . . . . 3.23 1.8 3.55 1 1 
        781 1 . . . . . 3.58 1.8 3.94 1 1 
        782 1 . . . . .  3.8 1.8 4.18 1 1 
        783 1 . . . . . 3.95 1.8 4.35 1 1 
        784 1 . . . . . 3.95 1.8 4.35 1 1 
        785 1 . . . . . 3.21 1.8 3.53 1 1 
        786 1 . . . . . 3.52 1.8 3.87 1 1 
        787 1 . . . . . 4.89 1.8 5.38 1 1 
        788 1 . . . . . 3.06 1.8 3.37 1 1 
        789 1 . . . . . 4.12 1.8 4.53 1 1 
        790 1 . . . . . 3.05 1.8 3.36 1 1 
        791 1 . . . . . 3.49 1.8 3.84 1 1 
        792 1 . . . . . 3.64 1.8  4.0 1 1 
        793 1 . . . . . 3.81 1.8 4.19 1 1 
        794 1 . . . . . 3.32 1.8 3.65 1 1 
        795 1 . . . . . 4.54 1.8 4.99 1 1 
        796 1 . . . . . 4.92 1.8 5.41 1 1 
        797 1 . . . . . 3.32 1.8 3.65 1 1 
        798 1 . . . . . 3.63 1.8 3.99 1 1 
        799 1 . . . . . 3.88 1.8 4.27 1 1 
        800 1 . . . . . 2.98 1.8 3.28 1 1 
        801 1 . . . . . 4.44 1.8 4.88 1 1 
        802 1 . . . . . 5.03 1.8 5.53 1 1 
        803 1 . . . . . 3.47 1.8 3.82 1 1 
        804 1 . . . . . 3.47 1.8 3.82 1 1 
        805 1 . . . . . 4.26 1.8 4.69 1 1 
        806 1 . . . . . 3.18 1.8  3.5 1 1 
        807 1 . . . . . 3.04 1.8 3.34 1 1 
        808 1 . . . . . 3.89 1.8 4.28 1 1 
        809 1 . . . . . 2.98 1.8 3.28 1 1 
        810 1 . . . . . 3.82 1.8  4.2 1 1 
        811 1 . . . . . 3.55 1.8  3.9 1 1 
        812 1 . . . . . 3.55 1.8  3.9 1 1 
        813 1 . . . . . 4.22 1.8 4.64 1 1 
        814 1 . . . . . 4.15 1.8 4.57 1 1 
        815 1 . . . . . 4.15 1.8 4.57 1 1 
        816 1 . . . . . 3.82 1.8  4.2 1 1 
        817 1 . . . . . 2.95 1.8 3.25 1 1 
        818 1 . . . . . 3.37 1.8 3.71 1 1 
        819 1 . . . . .  4.1 1.8 4.51 1 1 
        820 1 . . . . . 3.85 1.8 4.23 1 1 
        821 1 . . . . .  3.5 1.8 3.85 1 1 
        822 1 . . . . . 4.27 1.8  4.7 1 1 
        823 1 . . . . .  4.3 1.8 4.73 1 1 
        824 1 . . . . .  4.0 1.8  4.4 1 1 
        825 1 . . . . .  4.0 1.8  4.4 1 1 
        826 1 . . . . . 4.36 1.8  4.8 1 1 
        827 1 . . . . . 3.65 1.8 4.02 1 1 
        828 1 . . . . . 3.79 1.8 4.17 1 1 
        829 1 . . . . . 3.24 1.8 3.56 1 1 
        830 1 . . . . . 3.19 1.8 3.51 1 1 
        831 1 . . . . . 3.19 1.8 3.51 1 1 
        832 1 . . . . . 3.23 1.8 3.55 1 1 
        833 1 . . . . . 3.06 1.8 3.37 1 1 
        834 1 . . . . . 3.23 1.8 3.55 1 1 
        835 1 . . . . . 4.43 1.8 4.87 1 1 
        836 1 . . . . . 4.63 1.8 5.09 1 1 
        837 1 . . . . . 3.16 1.8 3.48 1 1 
        838 1 . . . . . 3.48 1.8 3.83 1 1 
        839 1 . . . . .  3.5 1.8 3.85 1 1 
        840 1 . . . . . 3.39 1.8 3.73 1 1 
        841 1 . . . . . 3.04 1.8 3.34 1 1 
        842 1 . . . . . 4.13 1.8 4.54 1 1 
        843 1 . . . . . 4.58 1.8 5.04 1 1 
        844 1 . . . . . 4.45 1.8 4.89 1 1 
        845 1 . . . . .  4.6 1.8 5.06 1 1 
        846 1 . . . . . 4.63 1.8 5.09 1 1 
        847 1 . . . . . 4.44 1.8 4.88 1 1 
        848 1 . . . . . 3.46 1.8 3.81 1 1 
        849 1 . . . . . 2.88 1.8 3.17 1 1 
        850 1 . . . . . 3.23 1.8 3.55 1 1 
        851 1 . . . . . 3.08 1.8 3.39 1 1 
        852 1 . . . . . 3.35 1.8 3.69 1 1 
        853 1 . . . . . 3.41 1.8 3.75 1 1 
        854 1 . . . . . 3.23 1.8 3.55 1 1 
        855 1 . . . . . 4.67 1.8 5.14 1 1 
        856 1 . . . . . 3.11 1.8 3.42 1 1 
        857 1 . . . . . 3.16 1.8 3.48 1 1 
        858 1 . . . . . 3.35 1.8 3.69 1 1 
        859 1 . . . . . 3.42 1.8 3.76 1 1 
        860 1 . . . . . 3.35 1.8 3.69 1 1 
        861 1 . . . . . 3.29 1.8 3.62 1 1 
        862 1 . . . . . 3.44 1.8 3.78 1 1 
        863 1 . . . . . 3.25 1.8 3.58 1 1 
        864 1 . . . . . 3.12 1.8 3.43 1 1 
        865 1 . . . . . 4.82 1.8  5.3 1 1 
        866 1 . . . . . 4.64 1.8  5.1 1 1 
        867 1 . . . . . 4.68 1.8 5.15 1 1 
        868 1 . . . . . 5.03 1.8 5.53 1 1 
        869 1 . . . . . 3.05 1.8 3.36 1 1 
        870 1 . . . . . 2.95 1.8 3.25 1 1 
        871 1 . . . . . 3.52 1.8 3.87 1 1 
        872 1 . . . . . 3.51 1.8 3.86 1 1 
        873 1 . . . . .  4.5 1.8 4.95 1 1 
        874 1 . . . . .  3.6 1.8 3.96 1 1 
        875 1 . . . . . 4.34 1.8 4.77 1 1 
        876 1 . . . . . 4.59 1.8 5.05 1 1 
        877 1 . . . . . 4.53 1.8 4.98 1 1 
        878 1 . . . . . 4.57 1.8 5.03 1 1 
        879 1 . . . . . 3.14 1.8 3.45 1 1 
        880 1 . . . . .  3.5 1.8 3.85 1 1 
        881 1 . . . . . 3.31 1.8 3.64 1 1 
        882 1 . . . . . 3.34 1.8 3.67 1 1 
        883 1 . . . . . 3.06 1.8 3.37 1 1 
        884 1 . . . . . 2.93 1.8 3.22 1 1 
        885 1 . . . . . 3.45 1.8 3.79 1 1 
        886 1 . . . . . 4.08 1.8 4.49 1 1 
        887 1 . . . . . 3.04 1.8 3.34 1 1 
        888 1 . . . . . 5.04 1.8 5.54 1 1 
        889 1 . . . . . 4.45 1.8 4.89 1 1 
        890 1 . . . . . 4.29 1.8 4.72 1 1 
        891 1 . . . . . 5.11 1.8 5.62 1 1 
        892 1 . . . . . 4.56 1.8 5.02 1 1 
        893 1 . . . . .  4.6 1.8 5.06 1 1 
        894 1 . . . . . 4.09 1.8  4.5 1 1 
        895 1 . . . . . 5.55 1.8 6.11 1 1 
        896 1 . . . . . 4.05 1.8 4.46 1 1 
        897 1 . . . . . 5.53 1.8 6.08 1 1 
        898 1 . . . . . 4.41 1.8 4.85 1 1 
        899 1 . . . . . 4.01 1.8 4.41 1 1 
        900 1 . . . . .  4.9 1.8 5.39 1 1 
        901 1 . . . . .  5.0 1.8  5.5 1 1 
        902 1 . . . . . 5.36 1.8  5.9 1 1 
        903 1 . . . . . 4.79 1.8 5.27 1 1 
        904 1 . . . . .  3.9 1.8 4.29 1 1 
        905 1 . . . . . 4.72 1.8 5.19 1 1 
        906 1 . . . . . 5.17 1.8 5.69 1 1 
        907 1 . . . . . 5.03 1.8 5.53 1 1 
        908 1 . . . . . 3.96 1.8 4.36 1 1 
        909 1 . . . . . 4.45 1.8 4.89 1 1 
        910 1 . . . . . 4.44 1.8 4.88 1 1 
        911 1 . . . . . 5.11 1.8 5.62 1 1 
        912 1 . . . . . 4.78 1.8 5.26 1 1 
        913 1 . . . . . 4.16 1.8 4.58 1 1 
        914 1 . . . . .  5.0 1.8  5.5 1 1 
        915 1 . . . . . 4.64 1.8  5.1 1 1 
        916 1 . . . . . 4.67 1.8 5.14 1 1 
        917 1 . . . . . 3.71 1.8 4.08 1 1 
        918 1 . . . . . 5.06 1.8 5.57 1 1 
        919 1 . . . . . 5.39 1.8 5.93 1 1 
        920 1 . . . . . 4.58 1.8 5.04 1 1 
        921 1 . . . . . 4.17 1.8 4.59 1 1 
        922 1 . . . . . 4.63 1.8 5.09 1 1 
        923 1 . . . . .  4.4 1.8 4.84 1 1 
        924 1 . . . . . 4.78 1.8 5.26 1 1 
        925 1 . . . . . 4.71 1.8 5.18 1 1 
        926 1 . . . . . 4.41 1.8 4.85 1 1 
        927 1 . . . . . 4.47 1.8 4.92 1 1 
        928 1 . . . . . 3.83 1.8 4.21 1 1 
        929 1 . . . . . 4.62 1.8 5.08 1 1 
        930 1 . . . . . 4.08 1.8 4.49 1 1 
        931 1 . . . . .  4.5 1.8 4.95 1 1 
        932 1 . . . . . 4.23 1.8 4.65 1 1 
        933 1 . . . . .  3.8 1.8 4.18 1 1 
        934 1 . . . . . 4.45 1.8 4.89 1 1 
        935 1 . . . . . 4.09 1.8  4.5 1 1 
        936 1 . . . . . 4.06 1.8 4.47 1 1 
        937 1 . . . . . 3.46 1.8 3.81 1 1 
        938 1 . . . . . 3.63 1.8 3.99 1 1 
        939 1 . . . . . 4.93 1.8 5.42 1 1 
        940 1 . . . . . 4.41 1.8 4.85 1 1 
        941 1 . . . . . 3.82 1.8  4.2 1 1 
        942 1 . . . . . 4.55 1.8 5.01 1 1 
        943 1 . . . . . 4.82 1.8  5.3 1 1 
        944 1 . . . . . 4.27 1.8  4.7 1 1 
        945 1 . . . . . 3.68 1.8 4.05 1 1 
        946 1 . . . . . 5.16 1.8 5.68 1 1 
        947 1 . . . . . 4.89 1.8 5.38 1 1 
        948 1 . . . . . 4.47 1.8 4.92 1 1 
        949 1 . . . . . 5.07 1.8 5.58 1 1 
        950 1 . . . . . 4.96 1.8 5.46 1 1 
        951 1 . . . . . 3.63 1.8 3.99 1 1 
        952 1 . . . . . 4.92 1.8 5.41 1 1 
        953 1 . . . . . 4.34 1.8 4.77 1 1 
        954 1 . . . . . 3.86 1.8 4.25 1 1 
        955 1 . . . . .  4.9 1.8 5.39 1 1 
        956 1 . . . . . 4.53 1.8 4.98 1 1 
        957 1 . . . . .  4.8 1.8 5.28 1 1 
        958 1 . . . . . 4.55 1.8 5.01 1 1 
        959 1 . . . . . 4.11 1.8 4.52 1 1 
        960 1 . . . . . 5.09 1.8  5.6 1 1 
        961 1 . . . . . 4.62 1.8 5.08 1 1 
        962 1 . . . . . 4.75 1.8 5.22 1 1 
        963 1 . . . . . 4.34 1.8 4.77 1 1 
        964 1 . . . . . 5.14 1.8 5.65 1 1 
        965 1 . . . . . 4.29 1.8 4.72 1 1 
        966 1 . . . . . 4.87 1.8 5.36 1 1 
        967 1 . . . . . 4.81 1.8 5.29 1 1 
        968 1 . . . . . 5.01 1.8 5.51 1 1 
        969 1 . . . . . 4.43 1.8 4.87 1 1 
        970 1 . . . . . 5.92 1.8 6.51 1 1 
        971 1 . . . . . 4.02 1.8 4.42 1 1 
        972 1 . . . . . 5.48 1.8 6.03 1 1 
        973 1 . . . . .  4.1 1.8 4.51 1 1 
        974 1 . . . . . 4.53 1.8 4.98 1 1 
        975 1 . . . . . 4.49 1.8 4.94 1 1 
        976 1 . . . . . 4.63 1.8 5.09 1 1 
        977 1 . . . . . 4.22 1.8 4.64 1 1 
        978 1 . . . . . 4.85 1.8 5.33 1 1 
        979 1 . . . . . 5.28 1.8 5.81 1 1 
        980 1 . . . . .  3.9 1.8 4.29 1 1 
        981 1 . . . . . 5.05 1.8 5.56 1 1 
        982 1 . . . . .  5.1 1.8 5.61 1 1 
        983 1 . . . . . 4.22 1.8 4.64 1 1 
        984 1 . . . . . 4.03 1.8 4.43 1 1 
        985 1 . . . . . 4.99 1.8 5.49 1 1 
        986 1 . . . . . 4.06 1.8 4.47 1 1 
        987 1 . . . . . 4.31 1.8 4.74 1 1 
        988 1 . . . . . 4.86 1.8 5.35 1 1 
        989 1 . . . . . 4.85 1.8 5.33 1 1 
        990 1 . . . . .  4.2 1.8 4.62 1 1 
        991 1 . . . . . 4.52 1.8 4.97 1 1 
        992 1 . . . . .  4.3 1.8 4.73 1 1 
        993 1 . . . . . 3.63 1.8 3.99 1 1 
        994 1 . . . . . 4.69 1.8 5.16 1 1 
        995 1 . . . . . 4.02 1.8 4.42 1 1 
        996 1 . . . . . 4.02 1.8 4.42 1 1 
        997 1 . . . . . 4.72 1.8 5.19 1 1 
        998 1 . . . . . 4.92 1.8 5.41 1 1 
        999 1 . . . . . 4.44 1.8 4.88 1 1 
       1000 1 . . . . . 4.38 1.8 4.82 1 1 
       1001 1 . . . . .  5.5 1.8 6.05 1 1 
       1002 1 . . . . . 4.24 1.8 4.66 1 1 
       1003 1 . . . . . 4.12 1.8 4.53 1 1 
       1004 1 . . . . . 4.38 1.8 4.82 1 1 
       1005 1 . . . . .  3.8 1.8 4.18 1 1 
       1006 1 . . . . . 4.24 1.8 4.66 1 1 
       1007 1 . . . . . 3.77 1.8 4.15 1 1 
       1008 1 . . . . . 4.43 1.8 4.87 1 1 
       1009 1 . . . . . 4.65 1.8 5.12 1 1 
       1010 1 . . . . . 3.38 1.8 3.72 1 1 
       1011 1 . . . . . 5.01 1.8 5.51 1 1 
       1012 1 . . . . . 4.67 1.8 5.14 1 1 
       1013 1 . . . . . 4.26 1.8 4.69 1 1 
       1014 1 . . . . .  3.9 1.8 4.29 1 1 
       1015 1 . . . . . 5.23 1.8 5.75 1 1 
       1016 1 . . . . . 5.33 1.8 5.86 1 1 
       1017 1 . . . . . 4.81 1.8 5.29 1 1 
       1018 1 . . . . . 3.98 1.8 4.38 1 1 
       1019 1 . . . . . 4.89 1.8 5.38 1 1 
       1020 1 . . . . . 5.23 1.8 5.75 1 1 
       1021 1 . . . . . 4.48 1.8 4.93 1 1 
       1022 1 . . . . . 4.23 1.8 4.65 1 1 
       1023 1 . . . . .  4.7 1.8 5.17 1 1 
       1024 1 . . . . . 4.22 1.8 4.64 1 1 
       1025 1 . . . . . 4.73 1.8  5.2 1 1 
       1026 1 . . . . . 4.55 1.8 5.01 1 1 
       1027 1 . . . . . 4.36 1.8  4.8 1 1 
       1028 1 . . . . . 5.39 1.8 5.93 1 1 
       1029 1 . . . . . 4.43 1.8 4.87 1 1 
       1030 1 . . . . . 4.14 1.8 4.55 1 1 
       1031 1 . . . . . 4.18 1.8  4.6 1 1 
       1032 1 . . . . . 5.31 1.8 5.84 1 1 
       1033 1 . . . . . 5.33 1.8 5.86 1 1 
       1034 1 . . . . . 4.77 1.8 5.25 1 1 
       1035 1 . . . . . 4.77 1.8 5.25 1 1 
       1036 1 . . . . . 4.49 1.8 4.94 1 1 
       1037 1 . . . . . 4.96 1.8 5.46 1 1 
       1038 1 . . . . . 5.43 1.8 5.97 1 1 
       1039 1 . . . . . 3.84 1.8 4.22 1 1 
       1040 1 . . . . . 5.62 1.8 6.18 1 1 
       1041 1 . . . . . 3.63 1.8 3.99 1 1 
       1042 1 . . . . . 4.37 1.8 4.81 1 1 
       1043 1 . . . . . 4.93 1.8 5.42 1 1 
       1044 1 . . . . . 4.56 1.8 5.02 1 1 
       1045 1 . . . . . 4.79 1.8 5.27 1 1 
       1046 1 . . . . . 4.17 1.8 4.59 1 1 
       1047 1 . . . . .  3.7 1.8 4.07 1 1 
       1048 1 . . . . . 4.35 1.8 4.79 1 1 
       1049 1 . . . . . 4.17 1.8 4.59 1 1 
       1050 1 . . . . . 4.19 1.8 4.61 1 1 
       1051 1 . . . . .  4.2 1.8 4.62 1 1 
       1052 1 . . . . . 5.34 1.8 5.87 1 1 
       1053 1 . . . . . 5.66 1.8 6.23 1 1 
       1054 1 . . . . . 5.12 1.8 5.63 1 1 
       1055 1 . . . . . 4.55 1.8 5.01 1 1 
       1056 1 . . . . . 4.68 1.8 5.15 1 1 
       1057 1 . . . . . 4.53 1.8 4.98 1 1 
       1058 1 . . . . . 5.35 1.8 5.89 1 1 
       1059 1 . . . . . 4.14 1.8 4.55 1 1 
       1060 1 . . . . . 4.13 1.8 4.54 1 1 
       1061 1 . . . . . 5.82 1.8  6.4 1 1 
       1062 1 . . . . .  6.2 1.8 6.82 1 1 
       1063 1 . . . . .  3.9 1.8 4.29 1 1 
       1064 1 . . . . .  4.2 1.8 4.62 1 1 
       1065 1 . . . . . 4.98 1.8 5.48 1 1 
       1066 1 . . . . . 5.19 1.8 5.71 1 1 
       1067 1 . . . . .  5.0 1.8  5.5 1 1 
       1068 1 . . . . . 5.46 1.8 6.01 1 1 
       1069 1 . . . . . 4.49 1.8 4.94 1 1 
       1070 1 . . . . . 4.69 1.8 5.16 1 1 
       1071 1 . . . . . 4.15 1.8 4.57 1 1 
       1072 1 . . . . . 4.58 1.8 5.04 1 1 
       1073 1 . . . . . 5.17 1.8 5.69 1 1 
       1074 1 . . . . . 5.17 1.8 5.69 1 1 
       1075 1 . . . . . 4.81 1.8 5.29 1 1 
       1076 1 . . . . . 5.07 1.8 5.58 1 1 
       1077 1 . . . . . 5.53 1.8 6.08 1 1 
       1078 1 . . . . .  4.3 1.8 4.73 1 1 
       1079 1 . . . . . 5.51 1.8 6.06 1 1 
       1080 1 . . . . . 5.25 1.8 5.78 1 1 
       1081 1 . . . . . 5.13 1.8 5.64 1 1 
       1082 1 . . . . .  5.2 1.8 5.72 1 1 
       1083 1 . . . . . 4.39 1.8 4.83 1 1 
       1084 1 . . . . . 4.51 1.8 4.96 1 1 
       1085 1 . . . . .  4.3 1.8 4.73 1 1 
       1086 1 . . . . . 5.79 1.8 6.37 1 1 
       1087 1 . . . . . 5.19 1.8 5.71 1 1 
       1088 1 . . . . . 5.65 1.8 6.21 1 1 
       1089 1 . . . . . 4.83 1.8 5.31 1 1 
       1090 1 . . . . . 3.81 1.8 4.19 1 1 
       1091 1 . . . . . 4.55 1.8 5.01 1 1 
       1092 1 . . . . . 4.02 1.8 4.42 1 1 
       1093 1 . . . . . 4.25 1.8 4.68 1 1 
       1094 1 . . . . . 4.94 1.8 5.43 1 1 
       1095 1 . . . . . 4.95 1.8 5.44 1 1 
       1096 1 . . . . .  6.2 1.8 6.82 1 1 
       1097 1 . . . . .  6.2 1.8 6.82 1 1 
       1098 1 . . . . . 5.26 1.8 5.79 1 1 
       1099 1 . . . . . 5.07 1.8 5.58 1 1 
       1100 1 . . . . . 4.38 1.8 4.82 1 1 
       1101 1 . . . . . 4.82 1.8  5.3 1 1 
       1102 1 . . . . . 5.25 1.8 5.78 1 1 
       1103 1 . . . . . 4.69 1.8 5.16 1 1 
       1104 1 . . . . . 4.91 1.8  5.4 1 1 
       1105 1 . . . . .  4.6 1.8 5.06 1 1 
       1106 1 . . . . . 5.89 1.8 6.48 1 1 
       1107 1 . . . . . 4.88 1.8 5.37 1 1 
       1108 1 . . . . . 5.88 1.8 6.47 1 1 
       1109 1 . . . . .  6.2 1.8 6.82 1 1 
       1110 1 . . . . . 4.26 1.8 4.69 1 1 
       1111 1 . . . . . 4.91 1.8  5.4 1 1 
       1112 1 . . . . . 4.05 1.8 4.46 1 1 
       1113 1 . . . . . 4.63 1.8 5.09 1 1 
       1114 1 . . . . . 5.23 1.8 5.75 1 1 
       1115 1 . . . . . 4.45 1.8 4.89 1 1 
       1116 1 . . . . .  4.6 1.8 5.06 1 1 
       1117 1 . . . . . 5.72 1.8 6.29 1 1 
       1118 1 . . . . . 4.72 1.8 5.19 1 1 
       1119 1 . . . . . 4.47 1.8 4.92 1 1 
       1120 1 . . . . . 4.48 1.8 4.93 1 1 
       1121 1 . . . . . 4.31 1.8 4.74 1 1 
       1122 1 . . . . . 4.85 1.8 5.33 1 1 
       1123 1 . . . . . 4.41 1.8 4.85 1 1 
       1124 1 . . . . . 5.77 1.8 6.35 1 1 
       1125 1 . . . . . 5.08 1.8 5.59 1 1 
       1126 1 . . . . .  4.9 1.8 5.39 1 1 
       1127 1 . . . . . 3.62 1.8 3.98 1 1 
       1128 1 . . . . . 4.21 1.8 4.63 1 1 
       1129 1 . . . . . 4.97 1.8 5.47 1 1 
       1130 1 . . . . . 4.01 1.8 4.41 1 1 
       1131 1 . . . . . 4.52 1.8 4.97 1 1 
       1132 1 . . . . . 6.19 1.8 6.81 1 1 
       1133 1 . . . . .  6.2 1.8 6.82 1 1 
       1134 1 . . . . .  4.2 1.8 4.62 1 1 
       1135 1 . . . . . 4.95 1.8 5.44 1 1 
       1136 1 . . . . . 4.75 1.8 5.22 1 1 
       1137 1 . . . . . 4.57 1.8 5.03 1 1 
       1138 1 . . . . . 3.86 1.8 4.25 1 1 
       1139 1 . . . . . 4.26 1.8 4.69 1 1 
       1140 1 . . . . . 4.36 1.8  4.8 1 1 
       1141 1 . . . . . 5.61 1.8 6.17 1 1 
       1142 1 . . . . . 3.71 1.8 4.08 1 1 
       1143 1 . . . . . 4.12 1.8 4.53 1 1 
       1144 1 . . . . . 3.43 1.8 3.77 1 1 
       1145 1 . . . . . 5.09 1.8  5.6 1 1 
       1146 1 . . . . . 5.19 1.8 5.71 1 1 
       1147 1 . . . . . 4.52 1.8 4.97 1 1 
       1148 1 . . . . . 3.93 1.8 4.32 1 1 
       1149 1 . . . . .  4.9 1.8 5.39 1 1 
       1150 1 . . . . .  6.0 1.8  6.6 1 1 
       1151 1 . . . . . 4.87 1.8 5.36 1 1 
       1152 1 . . . . . 5.55 1.8 6.11 1 1 
       1153 1 . . . . . 5.24 1.8 5.76 1 1 
       1154 1 . . . . .  4.6 1.8 5.06 1 1 
       1155 1 . . . . . 4.78 1.8 5.26 1 1 
       1156 1 . . . . . 4.85 1.8 5.33 1 1 
       1157 1 . . . . . 4.43 1.8 4.87 1 1 
       1158 1 . . . . . 5.45 1.8  6.0 1 1 
       1159 1 . . . . . 4.95 1.8 5.44 1 1 
       1160 1 . . . . . 5.24 1.8 5.76 1 1 
       1161 1 . . . . . 4.95 1.8 5.44 1 1 
       1162 1 . . . . . 4.77 1.8 5.25 1 1 
       1163 1 . . . . . 6.01 1.8 6.61 1 1 
       1164 1 . . . . .  6.2 1.8 6.82 1 1 
       1165 1 . . . . .  4.8 1.8 5.28 1 1 
       1166 1 . . . . . 4.79 1.8 5.27 1 1 
       1167 1 . . . . . 4.72 1.8 5.19 1 1 
       1168 1 . . . . . 5.24 1.8 5.76 1 1 
       1169 1 . . . . . 4.36 1.8  4.8 1 1 
       1170 1 . . . . . 4.17 1.8 4.59 1 1 
       1171 1 . . . . . 4.58 1.8 5.04 1 1 
       1172 1 . . . . . 5.08 1.8 5.59 1 1 
       1173 1 . . . . . 4.39 1.8 4.83 1 1 
       1174 1 . . . . . 3.98 1.8 4.38 1 1 
       1175 1 . . . . . 3.68 1.8 4.05 1 1 
       1176 1 . . . . . 4.67 1.8 5.14 1 1 
       1177 1 . . . . . 5.54 1.8 6.09 1 1 
       1178 1 . . . . .  4.0 1.8  4.4 1 1 
       1179 1 . . . . . 5.96 1.8 6.56 1 1 
       1180 1 . . . . .  6.2 1.8 6.82 1 1 
       1181 1 . . . . . 4.97 1.8 5.47 1 1 
       1182 1 . . . . . 4.38 1.8 4.82 1 1 
       1183 1 . . . . . 4.89 1.8 5.38 1 1 
       1184 1 . . . . . 4.61 1.8 5.07 1 1 
       1185 1 . . . . . 3.42 1.8 3.76 1 1 
       1186 1 . . . . . 5.05 1.8 5.56 1 1 
       1187 1 . . . . . 5.11 1.8 5.62 1 1 
       1188 1 . . . . . 5.03 1.8 5.53 1 1 
       1189 1 . . . . . 5.26 1.8 5.79 1 1 
       1190 1 . . . . . 4.72 1.8 5.19 1 1 
       1191 1 . . . . . 4.33 1.8 4.76 1 1 
       1192 1 . . . . . 4.07 1.8 4.48 1 1 
       1193 1 . . . . . 4.71 1.8 5.18 1 1 
       1194 1 . . . . . 5.63 1.8 6.19 1 1 
       1195 1 . . . . . 6.01 1.8 6.61 1 1 
       1196 1 . . . . . 5.44 1.8 5.98 1 1 
       1197 1 . . . . . 4.76 1.8 5.24 1 1 
       1198 1 . . . . . 5.62 1.8 6.18 1 1 
       1199 1 . . . . .  5.3 1.8 5.83 1 1 
       1200 1 . . . . .  4.3 1.8 4.73 1 1 
       1201 1 . . . . . 5.66 1.8 6.23 1 1 
       1202 1 . . . . . 3.76 1.8 4.14 1 1 
       1203 1 . . . . . 3.86 1.8 4.25 1 1 
       1204 1 . . . . . 3.72 1.8 4.09 1 1 
       1205 1 . . . . . 4.18 1.8  4.6 1 1 
       1206 1 . . . . . 4.21 1.8 4.63 1 1 
       1207 1 . . . . .  3.1 1.8 3.41 1 1 
       1208 1 . . . . . 3.24 1.8 3.56 1 1 
       1209 1 . . . . . 3.84 1.8 4.22 1 1 
       1210 1 . . . . . 5.45 1.8  6.0 1 1 
       1211 1 . . . . . 4.75 1.8 5.22 1 1 
       1212 1 . . . . . 4.86 1.8 5.35 1 1 
       1213 1 . . . . . 5.01 1.8 5.51 1 1 
       1214 1 . . . . . 5.19 1.8 5.71 1 1 
       1215 1 . . . . . 4.29 1.8 4.72 1 1 
       1216 1 . . . . . 4.98 1.8 5.48 1 1 
       1217 1 . . . . . 4.75 1.8 5.22 1 1 
       1218 1 . . . . . 3.58 1.8 3.94 1 1 
       1219 1 . . . . . 5.31 1.8 5.84 1 1 
       1220 1 . . . . .  5.7 1.8 6.27 1 1 
       1221 1 . . . . . 4.69 1.8 5.16 1 1 
       1222 1 . . . . . 5.34 1.8 5.87 1 1 
       1223 1 . . . . . 4.75 1.8 5.22 1 1 
       1224 1 . . . . . 5.23 1.8 5.75 1 1 
       1225 1 . . . . . 4.97 1.8 5.47 1 1 
       1226 1 . . . . . 5.05 1.8 5.56 1 1 
       1227 1 . . . . . 4.56 1.8 5.02 1 1 
       1228 1 . . . . .  4.1 1.8 4.51 1 1 
       1229 1 . . . . . 4.08 1.8 4.49 1 1 
       1230 1 . . . . . 5.16 1.8 5.68 1 1 
       1231 1 . . . . . 5.36 1.8  5.9 1 1 
       1232 1 . . . . . 4.68 1.8 5.15 1 1 
       1233 1 . . . . . 5.49 1.8 6.04 1 1 
       1234 1 . . . . .  5.8 1.8 6.38 1 1 
       1235 1 . . . . . 4.93 1.8 5.42 1 1 
       1236 1 . . . . . 5.11 1.8 5.62 1 1 
       1237 1 . . . . . 5.16 1.8 5.68 1 1 
       1238 1 . . . . . 4.27 1.8  4.7 1 1 
       1239 1 . . . . . 6.06 1.8 6.67 1 1 
       1240 1 . . . . . 5.01 1.8 5.51 1 1 
       1241 1 . . . . . 5.41 1.8 5.95 1 1 
       1242 1 . . . . . 3.86 1.8 4.25 1 1 
       1243 1 . . . . . 4.41 1.8 4.85 1 1 
       1244 1 . . . . . 5.06 1.8 5.57 1 1 
       1245 1 . . . . . 4.58 1.8 5.04 1 1 
       1246 1 . . . . . 5.69 1.8 6.26 1 1 
       1247 1 . . . . . 4.58 1.8 5.04 1 1 
       1248 1 . . . . .  5.6 1.8 6.16 1 1 
       1249 1 . . . . . 4.63 1.8 5.09 1 1 
       1250 1 . . . . . 3.75 1.8 4.13 1 1 
       1251 1 . . . . . 4.34 1.8 4.77 1 1 
       1252 1 . . . . .  6.2 1.8 6.82 1 1 
       1253 1 . . . . . 4.21 1.8 4.63 1 1 
       1254 1 . . . . . 5.58 1.8 6.14 1 1 
       1255 1 . . . . . 4.21 1.8 4.63 1 1 
       1256 1 . . . . . 4.21 1.8 4.63 1 1 
       1257 1 . . . . . 4.93 1.8 5.42 1 1 
       1258 1 . . . . . 4.24 1.8 4.66 1 1 
       1259 1 . . . . . 5.72 1.8 6.29 1 1 
       1260 1 . . . . . 4.81 1.8 5.29 1 1 
       1261 1 . . . . . 4.25 1.8 4.68 1 1 
       1262 1 . . . . . 5.15 1.8 5.67 1 1 
       1263 1 . . . . . 3.46 1.8 3.81 1 1 
       1264 1 . . . . . 4.82 1.8  5.3 1 1 
       1265 1 . . . . . 4.55 1.8 5.01 1 1 
       1266 1 . . . . . 5.77 1.8 6.35 1 1 
       1267 1 . . . . . 5.33 1.8 5.86 1 1 
       1268 1 . . . . . 5.19 1.8 5.71 1 1 
       1269 1 . . . . . 5.07 1.8 5.58 1 1 
       1270 1 . . . . . 4.73 1.8  5.2 1 1 
       1271 1 . . . . . 3.12 1.8 3.43 1 1 
       1272 1 . . . . . 3.73 1.8  4.1 1 1 
       1273 1 . . . . . 3.95 1.8 4.35 1 1 
       1274 1 . . . . . 3.58 1.8 3.94 1 1 
       1275 1 . . . . . 4.16 1.8 4.58 1 1 
       1276 1 . . . . . 3.65 1.8 4.02 1 1 
       1277 1 . . . . . 3.58 1.8 3.94 1 1 
       1278 1 . . . . . 5.55 1.8 6.11 1 1 
       1279 1 . . . . .  6.1 1.8 6.71 1 1 
       1280 1 . . . . . 4.06 1.8 4.47 1 1 
       1281 1 . . . . . 4.23 1.8 4.65 1 1 
       1282 1 . . . . . 3.85 1.8 4.23 1 1 
       1283 1 . . . . . 4.44 1.8 4.88 1 1 
       1284 1 . . . . . 4.74 1.8 5.21 1 1 
       1285 1 . . . . . 4.13 1.8 4.54 1 1 
       1286 1 . . . . . 4.46 1.8 4.91 1 1 
       1287 1 . . . . . 4.02 1.8 4.42 1 1 
       1288 1 . . . . . 5.14 1.8 5.65 1 1 
       1289 1 . . . . . 4.02 1.8 4.42 1 1 
       1290 1 . . . . . 4.21 1.8 4.63 1 1 
       1291 1 . . . . . 4.38 1.8 4.82 1 1 
       1292 1 . . . . .  4.3 1.8 4.73 1 1 
       1293 1 . . . . . 5.51 1.8 6.06 1 1 
       1294 1 . . . . . 5.14 1.8 5.65 1 1 
       1295 1 . . . . .  4.7 1.8 5.17 1 1 
       1296 1 . . . . . 5.91 1.8  6.5 1 1 
       1297 1 . . . . . 3.45 1.8 3.79 1 1 
       1298 1 . . . . . 4.98 1.8 5.48 1 1 
       1299 1 . . . . . 4.65 1.8 5.12 1 1 
       1300 1 . . . . . 4.65 1.8 5.12 1 1 
       1301 1 . . . . . 4.59 1.8 5.05 1 1 
       1302 1 . . . . .  3.5 1.8 3.85 1 1 
       1303 1 . . . . . 4.89 1.8 5.38 1 1 
       1304 1 . . . . .  4.8 1.8 5.28 1 1 
       1305 1 . . . . . 4.13 1.8 4.54 1 1 
       1306 1 . . . . . 4.08 1.8 4.49 1 1 
       1307 1 . . . . . 4.87 1.8 5.36 1 1 
       1308 1 . . . . . 4.93 1.8 5.42 1 1 
       1309 1 . . . . . 4.93 1.8 5.42 1 1 
       1310 1 . . . . . 4.77 1.8 5.25 1 1 
       1311 1 . . . . . 4.47 1.8 4.92 1 1 
       1312 1 . . . . . 5.17 1.8 5.69 1 1 
       1313 1 . . . . . 4.59 1.8 5.05 1 1 
       1314 1 . . . . . 4.59 1.8 5.05 1 1 
       1315 1 . . . . . 5.04 1.8 5.54 1 1 
       1316 1 . . . . . 5.04 1.8 5.54 1 1 
       1317 1 . . . . . 4.95 1.8 5.44 1 1 
       1318 1 . . . . . 5.79 1.8 6.37 1 1 
       1319 1 . . . . . 4.52 1.8 4.97 1 1 
       1320 1 . . . . . 5.04 1.8 5.54 1 1 
       1321 1 . . . . .  6.2 1.8 6.82 1 1 
       1322 1 . . . . . 4.56 1.8 5.02 1 1 
       1323 1 . . . . . 5.47 1.8 6.02 1 1 
       1324 1 . . . . . 5.72 1.8 6.29 1 1 
       1325 1 . . . . .  6.2 1.8 6.82 1 1 
       1326 1 . . . . . 4.64 1.8  5.1 1 1 
       1327 1 . . . . . 4.03 1.8 4.43 1 1 
       1328 1 . . . . .  4.7 1.8 5.17 1 1 
       1329 1 . . . . . 5.17 1.8 5.69 1 1 
       1330 1 . . . . . 5.61 1.8 6.17 1 1 
       1331 1 . . . . . 4.69 1.8 5.16 1 1 
       1332 1 . . . . . 5.07 1.8 5.58 1 1 
       1333 1 . . . . . 5.17 1.8 5.69 1 1 
       1334 1 . . . . . 4.29 1.8 4.72 1 1 
       1335 1 . . . . . 4.66 1.8 5.13 1 1 
       1336 1 . . . . . 5.69 1.8 6.26 1 1 
       1337 1 . . . . . 4.48 1.8 4.93 1 1 
       1338 1 . . . . . 4.25 1.8 4.68 1 1 
       1339 1 . . . . . 4.75 1.8 5.22 1 1 
       1340 1 . . . . . 4.11 1.8 4.52 1 1 
       1341 1 . . . . . 6.15 1.8 6.77 1 1 
       1342 1 . . . . . 6.15 1.8 6.77 1 1 
       1343 1 . . . . . 5.22 1.8 5.74 1 1 
       1344 1 . . . . .  4.1 1.8 4.51 1 1 
       1345 1 . . . . . 4.87 1.8 5.36 1 1 
       1346 1 . . . . . 4.13 1.8 4.54 1 1 
       1347 1 . . . . . 4.74 1.8 5.21 1 1 
       1348 1 . . . . . 3.66 1.8 4.03 1 1 
       1349 1 . . . . . 4.58 1.8 5.04 1 1 
       1350 1 . . . . . 5.66 1.8 6.23 1 1 
       1351 1 . . . . . 6.07 1.8 6.68 1 1 
       1352 1 . . . . . 4.57 1.8 5.03 1 1 
       1353 1 . . . . . 4.29 1.8 4.72 1 1 
       1354 1 . . . . . 5.01 1.8 5.51 1 1 
       1355 1 . . . . . 4.49 1.8 4.94 1 1 
       1356 1 . . . . . 4.96 1.8 5.46 1 1 
       1357 1 . . . . . 4.91 1.8  5.4 1 1 
       1358 1 . . . . . 3.94 1.8 4.33 1 1 
       1359 1 . . . . . 4.75 1.8 5.22 1 1 
       1360 1 . . . . .  5.2 1.8 5.72 1 1 
       1361 1 . . . . . 4.53 1.8 4.98 1 1 
       1362 1 . . . . .  5.5 1.8 6.05 1 1 
       1363 1 . . . . . 5.13 1.8 5.64 1 1 
       1364 1 . . . . . 5.28 1.8 5.81 1 1 
       1365 1 . . . . .  6.2 1.8 6.82 1 1 
       1366 1 . . . . . 5.46 1.8 6.01 1 1 
       1367 1 . . . . . 4.74 1.8 5.21 1 1 
       1368 1 . . . . . 5.03 1.8 5.53 1 1 
       1369 1 . . . . . 5.19 1.8 5.71 1 1 
       1370 1 . . . . . 5.26 1.8 5.79 1 1 
       1371 1 . . . . . 4.92 1.8 5.41 1 1 
       1372 1 . . . . . 3.77 1.8 4.15 1 1 
       1373 1 . . . . . 3.95 1.8 4.35 1 1 
       1374 1 . . . . . 4.02 1.8 4.42 1 1 
       1375 1 . . . . .  6.2 1.8 6.82 1 1 
       1376 1 . . . . .  6.2 1.8 6.82 1 1 
       1377 1 . . . . . 4.97 1.8 5.47 1 1 
       1378 1 . . . . . 4.34 1.8 4.77 1 1 
       1379 1 . . . . . 4.97 1.8 5.47 1 1 
       1380 1 . . . . .  5.5 1.8 6.05 1 1 
       1381 1 . . . . .  6.2 1.8 6.82 1 1 
       1382 1 . . . . . 5.47 1.8 6.02 1 1 
       1383 1 . . . . .  6.2 1.8 6.82 1 1 
       1384 1 . . . . . 4.86 1.8 5.35 1 1 
       1385 1 . . . . . 4.86 1.8 5.35 1 1 
       1386 1 . . . . . 4.86 1.8 5.35 1 1 
       1387 1 . . . . . 4.86 1.8 5.35 1 1 
       1388 1 . . . . . 4.94 1.8 5.43 1 1 
       1389 1 . . . . . 4.55 1.8 5.01 1 1 
       1390 1 . . . . . 4.86 1.8 5.35 1 1 
       1391 1 . . . . .  6.2 1.8 6.82 1 1 
       1392 1 . . . . .  6.2 1.8 6.82 1 1 
       1393 1 . . . . .  4.9 1.8 5.39 1 1 
       1394 1 . . . . . 5.07 1.8 5.58 1 1 
       1395 1 . . . . . 5.68 1.8 6.25 1 1 
       1396 1 . . . . . 5.68 1.8 6.25 1 1 
       1397 1 . . . . . 5.58 1.8 6.14 1 1 
       1398 1 . . . . . 4.07 1.8 4.48 1 1 
       1399 1 . . . . .  4.5 1.8 4.95 1 1 
       1400 1 . . . . . 4.26 1.8 4.69 1 1 
       1401 1 . . . . . 4.18 1.8  4.6 1 1 
       1402 1 . . . . . 3.77 1.8 4.15 1 1 
       1403 1 . . . . . 5.08 1.8 5.59 1 1 
       1404 1 . . . . . 4.34 1.8 4.77 1 1 
       1405 1 . . . . . 5.32 1.8 5.85 1 1 
       1406 1 . . . . . 4.87 1.8 5.36 1 1 
       1407 1 . . . . . 4.87 1.8 5.36 1 1 
       1408 1 . . . . . 3.76 1.8 4.14 1 1 
       1409 1 . . . . . 4.78 1.8 5.26 1 1 
       1410 1 . . . . . 4.98 1.8 5.48 1 1 
       1411 1 . . . . .  5.0 1.8  5.5 1 1 
       1412 1 . . . . . 5.16 1.8 5.68 1 1 
       1413 1 . . . . .  3.9 1.8 4.29 1 1 
       1414 1 . . . . . 4.93 1.8 5.42 1 1 
       1415 1 . . . . . 4.32 1.8 4.75 1 1 
       1416 1 . . . . . 3.17 1.8 3.49 1 1 
       1417 1 . . . . .  3.6 1.8 3.96 1 1 
       1418 1 . . . . . 3.87 1.8 4.26 1 1 
       1419 1 . . . . . 3.51 1.8 3.86 1 1 
       1420 1 . . . . .  4.5 1.8 4.95 1 1 
       1421 1 . . . . . 4.04 1.8 4.44 1 1 
       1422 1 . . . . . 4.49 1.8 4.94 1 1 
       1423 1 . . . . . 4.71 1.8 5.18 1 1 
       1424 1 . . . . . 4.88 1.8 5.37 1 1 
       1425 1 . . . . . 3.53 1.8 3.88 1 1 
       1426 1 . . . . . 4.15 1.8 4.57 1 1 
       1427 1 . . . . .  6.2 1.8 6.82 1 1 
       1428 1 . . . . . 5.35 1.8 5.89 1 1 
       1429 1 . . . . . 5.64 1.8  6.2 1 1 
       1430 1 . . . . . 4.39 1.8 4.83 1 1 
       1431 1 . . . . . 5.17 1.8 5.69 1 1 
       1432 1 . . . . . 5.28 1.8 5.81 1 1 
       1433 1 . . . . . 4.76 1.8 5.24 1 1 
       1434 1 . . . . . 5.28 1.8 5.81 1 1 
       1435 1 . . . . . 4.33 1.8 4.76 1 1 
       1436 1 . . . . . 4.21 1.8 4.63 1 1 
       1437 1 . . . . . 4.58 1.8 5.04 1 1 
       1438 1 . . . . . 5.52 1.8 6.07 1 1 
       1439 1 . . . . . 4.32 1.8 4.75 1 1 
       1440 1 . . . . . 5.45 1.8  6.0 1 1 
       1441 1 . . . . . 5.57 1.8 6.13 1 1 
       1442 1 . . . . . 5.82 1.8  6.4 1 1 
       1443 1 . . . . . 6.19 1.8 6.81 1 1 
       1444 1 . . . . . 4.81 1.8 5.29 1 1 
       1445 1 . . . . . 5.72 1.8 6.29 1 1 
       1446 1 . . . . .  6.2 1.8 6.82 1 1 
       1447 1 . . . . .  5.0 1.8  5.5 1 1 
       1448 1 . . . . . 4.75 1.8 5.22 1 1 
       1449 1 . . . . . 4.45 1.8 4.89 1 1 
       1450 1 . . . . . 5.51 1.8 6.06 1 1 
       1451 1 . . . . . 5.06 1.8 5.57 1 1 
       1452 1 . . . . . 5.45 1.8  6.0 1 1 
       1453 1 . . . . . 5.72 1.8 6.29 1 1 
       1454 1 . . . . . 5.04 1.8 5.54 1 1 
       1455 1 . . . . . 5.66 1.8 6.23 1 1 
       1456 1 . . . . . 6.12 1.8 6.73 1 1 
       1457 1 . . . . . 3.97 1.8 4.37 1 1 
       1458 1 . . . . . 5.75 1.8 6.32 1 1 
       1459 1 . . . . .  6.2 1.8 6.82 1 1 
       1460 1 . . . . . 5.06 1.8 5.57 1 1 
       1461 1 . . . . . 5.64 1.8  6.2 1 1 
       1462 1 . . . . . 4.98 1.8 5.48 1 1 
       1463 1 . . . . . 5.42 1.8 5.96 1 1 
       1464 1 . . . . . 4.46 1.8 4.91 1 1 
       1465 1 . . . . . 4.71 1.8 5.18 1 1 
       1466 1 . . . . . 5.32 1.8 5.85 1 1 
       1467 1 . . . . . 5.32 1.8 5.85 1 1 
       1468 1 . . . . . 4.68 1.8 5.15 1 1 
       1469 1 . . . . . 4.83 1.8 5.31 1 1 
       1470 1 . . . . . 5.08 1.8 5.59 1 1 
       1471 1 . . . . . 5.36 1.8  5.9 1 1 
       1472 1 . . . . . 5.27 1.8  5.8 1 1 
       1473 1 . . . . . 5.97 1.8 6.57 1 1 
       1474 1 . . . . . 5.19 1.8 5.71 1 1 
       1475 1 . . . . .  6.2 1.8 6.82 1 1 
       1476 1 . . . . . 4.09 1.8  4.5 1 1 
       1477 1 . . . . . 5.43 1.8 5.97 1 1 
       1478 1 . . . . .  5.1 1.8 5.61 1 1 
       1479 1 . . . . . 5.19 1.8 5.71 1 1 
       1480 1 . . . . . 3.48 1.8 3.83 1 1 
       1481 1 . . . . . 6.19 1.8 6.81 1 1 
       1482 1 . . . . . 3.23 1.8 3.55 1 1 
       1483 1 . . . . . 4.24 1.8 4.66 1 1 
       1484 1 . . . . . 4.78 1.8 5.26 1 1 
       1485 1 . . . . . 3.96 1.8 4.36 1 1 
       1486 1 . . . . . 4.08 1.8 4.49 1 1 
       1487 1 . . . . . 4.94 1.8 5.43 1 1 
       1488 1 . . . . . 4.79 1.8 5.27 1 1 
       1489 1 . . . . . 5.84 1.8 6.42 1 1 
       1490 1 . . . . . 6.04 1.8 6.64 1 1 
       1491 1 . . . . . 5.92 1.8 6.51 1 1 
       1492 1 . . . . . 5.15 1.8 5.67 1 1 
       1493 1 . . . . . 4.72 1.8 5.19 1 1 
       1494 1 . . . . . 5.13 1.8 5.64 1 1 
       1495 1 . . . . . 5.15 1.8 5.67 1 1 
       1496 1 . . . . . 5.32 1.8 5.85 1 1 
       1497 1 . . . . . 4.14 1.8 4.55 1 1 
       1498 1 . . . . . 5.65 1.8 6.21 1 1 
       1499 1 . . . . . 5.45 1.8  6.0 1 1 
       1500 1 . . . . . 5.33 1.8 5.86 1 1 
       1501 1 . . . . . 6.15 1.8 6.77 1 1 
       1502 1 . . . . . 6.15 1.8 6.77 1 1 
       1503 1 . . . . . 5.55 1.8 6.11 1 1 
       1504 1 . . . . .  3.8 1.8 4.18 1 1 
       1505 1 . . . . . 4.49 1.8 4.94 1 1 
       1506 1 . . . . . 5.56 1.8 6.12 1 1 
       1507 1 . . . . . 3.86 1.8 4.25 1 1 
       1508 1 . . . . . 5.53 1.8 6.08 1 1 
       1509 1 . . . . . 3.51 1.8 3.86 1 1 
       1510 1 . . . . . 3.82 1.8  4.2 1 1 
       1511 1 . . . . . 4.06 1.8 4.47 1 1 
       1512 1 . . . . .  6.2 1.8 6.82 1 1 
       1513 1 . . . . . 5.43 1.8 5.97 1 1 
       1514 1 . . . . . 5.23 1.8 5.75 1 1 
       1515 1 . . . . .  6.0 1.8  6.6 1 1 
       1516 1 . . . . . 4.22 1.8 4.64 1 1 
       1517 1 . . . . . 6.16 1.8 6.78 1 1 
       1518 1 . . . . . 5.22 1.8 5.74 1 1 
       1519 1 . . . . . 5.49 1.8 6.04 1 1 
       1520 1 . . . . . 5.66 1.8 6.23 1 1 
       1521 1 . . . . . 5.77 1.8 6.35 1 1 
       1522 1 . . . . . 5.67 1.8 6.24 1 1 
       1523 1 . . . . . 4.24 1.8 4.66 1 1 
       1524 1 . . . . . 4.01 1.8 4.41 1 1 
       1525 1 . . . . .  5.7 1.8 6.27 1 1 
       1526 1 . . . . . 6.11 1.8 6.72 1 1 
       1527 1 . . . . . 4.14 1.8 4.55 1 1 
       1528 1 . . . . . 4.14 1.8 4.55 1 1 
       1529 1 . . . . .  3.8 1.8 4.18 1 1 
       1530 1 . . . . . 5.18 1.8  5.7 1 1 
       1531 1 . . . . .  3.9 1.8 4.29 1 1 
       1532 1 . . . . . 4.09 1.8  4.5 1 1 
       1533 1 . . . . . 6.03 1.8 6.63 1 1 
       1534 1 . . . . .  6.1 1.8 6.71 1 1 
       1535 1 . . . . . 4.58 1.8 5.04 1 1 
       1536 1 . . . . .  4.0 1.8  4.4 1 1 
       1537 1 . . . . . 4.23 1.8 4.65 1 1 
       1538 1 . . . . . 4.33 1.8 4.76 1 1 
       1539 1 . . . . . 5.26 1.8 5.79 1 1 
       1540 1 . . . . . 5.37 1.8 5.91 1 1 
       1541 1 . . . . . 3.13 1.8 3.44 1 1 
       1542 1 . . . . . 3.75 1.8 4.13 1 1 
       1543 1 . . . . . 3.36 1.8  3.7 1 1 
       1544 1 . . . . . 3.98 1.8 4.38 1 1 
       1545 1 . . . . . 5.78 1.8 6.36 1 1 
       1546 1 . . . . . 5.94 1.8 6.53 1 1 
       1547 1 . . . . . 6.16 1.8 6.78 1 1 
       1548 1 . . . . .  6.2 1.8 6.82 1 1 
       1549 1 . . . . . 5.39 1.8 5.93 1 1 
       1550 1 . . . . .  6.2 1.8 6.82 1 1 
       1551 1 . . . . . 5.25 1.8 5.78 1 1 
       1552 1 . . . . .  6.2 1.8 6.82 1 1 
       1553 1 . . . . . 5.25 1.8 5.78 1 1 
       1554 1 . . . . . 5.64 1.8  6.2 1 1 
       1555 1 . . . . .  4.0 1.8  4.4 1 1 
       1556 1 . . . . . 5.09 1.8  5.6 1 1 
       1557 1 . . . . .  4.0 1.8  4.4 1 1 
       1558 1 . . . . . 3.98 1.8 4.38 1 1 
       1559 1 . . . . .  6.2 1.8 6.82 1 1 
       1560 1 . . . . .  6.2 1.8 6.82 1 1 
       1561 1 . . . . . 4.61 1.8 5.07 1 1 
       1562 1 . . . . . 5.02 1.8 5.52 1 1 
       1563 1 . . . . . 5.44 1.8 5.98 1 1 
       1564 1 . . . . . 5.03 1.8 5.53 1 1 
       1565 1 . . . . . 6.05 1.8 6.66 1 1 
       1566 1 . . . . .  6.2 1.8 6.82 1 1 
       1567 1 . . . . . 5.07 1.8 5.58 1 1 
       1568 1 . . . . . 5.63 1.8 6.19 1 1 
       1569 1 . . . . . 4.98 1.8 5.48 1 1 
       1570 1 . . . . .  4.1 1.8 4.51 1 1 
       1571 1 . . . . . 3.67 1.8 4.04 1 1 
       1572 1 . . . . . 2.99 1.8 3.29 1 1 
       1573 1 . . . . . 4.95 1.8 5.44 1 1 
       1574 1 . . . . . 4.95 1.8 5.44 1 1 
       1575 1 . . . . . 4.61 1.8 5.07 1 1 
       1576 1 . . . . . 3.67 1.8 4.04 1 1 
       1577 1 . . . . . 2.98 1.8 3.28 1 1 
       1578 1 . . . . . 3.36 1.8  3.7 1 1 
       1579 1 . . . . . 3.56 1.8 3.92 1 1 
       1580 1 . . . . . 5.09 1.8  5.6 1 1 
       1581 1 . . . . . 3.76 1.8 4.14 1 1 
       1582 1 . . . . . 3.76 1.8 4.14 1 1 
       1583 1 . . . . . 3.94 1.8 4.33 1 1 
       1584 1 . . . . . 3.27 1.8  3.6 1 1 
       1585 1 . . . . . 3.33 1.8 3.66 1 1 
       1586 1 . . . . . 3.53 1.8 3.88 1 1 
       1587 1 . . . . . 4.21 1.8 4.63 1 1 
       1588 1 . . . . . 3.43 1.8 3.77 1 1 
       1589 1 . . . . . 2.52 1.8 2.77 1 1 
       1590 1 . . . . .  3.7 1.8 4.07 1 1 
       1591 1 . . . . . 3.21 1.8 3.53 1 1 
       1592 1 . . . . . 3.82 1.8  4.2 1 1 
       1593 1 . . . . .  3.0 1.8  3.3 1 1 
       1594 1 . . . . . 4.29 1.8 4.72 1 1 
       1595 1 . . . . . 3.35 1.8 3.69 1 1 
       1596 1 . . . . . 3.45 1.8 3.79 1 1 
       1597 1 . . . . . 3.22 1.8 3.54 1 1 
       1598 1 . . . . . 4.24 1.8 4.66 1 1 
       1599 1 . . . . . 4.15 1.8 4.57 1 1 
       1600 1 . . . . . 3.04 1.8 3.34 1 1 
       1601 1 . . . . . 3.83 1.8 4.21 1 1 
       1602 1 . . . . . 3.83 1.8 4.21 1 1 
       1603 1 . . . . . 5.21 1.8 5.73 1 1 
       1604 1 . . . . . 5.21 1.8 5.73 1 1 
       1605 1 . . . . .  6.2 1.8 6.82 1 1 
       1606 1 . . . . .  6.2 1.8 6.82 1 1 
       1607 1 . . . . . 4.57 1.8 5.03 1 1 
       1608 1 . . . . .  6.2 1.8 6.82 1 1 
       1609 1 . . . . .  6.2 1.8 6.82 1 1 
       1610 1 . . . . . 3.06 1.8 3.37 1 1 
       1611 1 . . . . . 3.83 1.8 4.21 1 1 
       1612 1 . . . . . 2.51 1.8 2.76 1 1 
       1613 1 . . . . . 4.38 1.8 4.82 1 1 
       1614 1 . . . . . 3.63 1.8 3.99 1 1 
       1615 1 . . . . . 3.24 1.8 3.56 1 1 
       1616 1 . . . . . 4.04 1.8 4.44 1 1 
       1617 1 . . . . . 2.89 1.8 3.18 1 1 
       1618 1 . . . . . 3.22 1.8 3.54 1 1 
       1619 1 . . . . . 3.51 1.8 3.86 1 1 
       1620 1 . . . . . 3.17 1.8 3.49 1 1 
       1621 1 . . . . .  2.8 1.8 3.08 1 1 
       1622 1 . . . . .  4.5 1.8 4.95 1 1 
       1623 1 . . . . . 4.02 1.8 4.42 1 1 
       1624 1 . . . . . 3.87 1.8 4.26 1 1 
       1625 1 . . . . . 5.24 1.8 5.76 1 1 
       1626 1 . . . . . 5.24 1.8 5.76 1 1 
       1627 1 . . . . . 3.93 1.8 4.32 1 1 
       1628 1 . . . . . 3.92 1.8 4.31 1 1 
       1629 1 . . . . . 3.93 1.8 4.32 1 1 
       1630 1 . . . . . 3.36 1.8  3.7 1 1 
       1631 1 . . . . .  4.0 1.8  4.4 1 1 
       1632 1 . . . . . 3.59 1.8 3.95 1 1 
       1633 1 . . . . . 3.58 1.8 3.94 1 1 
       1634 1 . . . . . 3.93 1.8 4.32 1 1 
       1635 1 . . . . . 3.55 1.8  3.9 1 1 
       1636 1 . . . . . 2.55 1.8  2.8 1 1 
       1637 1 . . . . . 2.77 1.8 3.05 1 1 
       1638 1 . . . . . 4.25 1.8 4.68 1 1 
       1639 1 . . . . . 4.54 1.8 4.99 1 1 
       1640 1 . . . . . 3.84 1.8 4.22 1 1 
       1641 1 . . . . . 3.77 1.8 4.15 1 1 
       1642 1 . . . . . 4.77 1.8 5.25 1 1 
       1643 1 . . . . . 4.77 1.8 5.25 1 1 
       1644 1 . . . . . 5.88 1.8 6.47 1 1 
       1645 1 . . . . . 5.88 1.8 6.47 1 1 
       1646 1 . . . . . 3.55 1.8  3.9 1 1 
       1647 1 . . . . . 4.89 1.8 5.38 1 1 
       1648 1 . . . . .  3.8 1.8 4.18 1 1 
       1649 1 . . . . . 3.92 1.8 4.31 1 1 
       1650 1 . . . . . 2.54 1.8 2.79 1 1 
       1651 1 . . . . . 3.32 1.8 3.65 1 1 
       1652 1 . . . . . 3.21 1.8 3.53 1 1 
       1653 1 . . . . . 3.87 1.8 4.26 1 1 
       1654 1 . . . . . 3.69 1.8 4.06 1 1 
       1655 1 . . . . . 4.14 1.8 4.55 1 1 
       1656 1 . . . . . 2.83 1.8 3.11 1 1 
       1657 1 . . . . . 4.93 1.8 5.42 1 1 
       1658 1 . . . . . 3.71 1.8 4.08 1 1 
       1659 1 . . . . . 4.93 1.8 5.42 1 1 
       1660 1 . . . . . 3.71 1.8 4.08 1 1 
       1661 1 . . . . . 3.81 1.8 4.19 1 1 
       1662 1 . . . . . 3.24 1.8 3.56 1 1 
       1663 1 . . . . . 3.24 1.8 3.56 1 1 
       1664 1 . . . . . 3.21 1.8 3.53 1 1 
       1665 1 . . . . . 3.44 1.8 3.78 1 1 
       1666 1 . . . . .  4.1 1.8 4.51 1 1 
       1667 1 . . . . . 3.36 1.8  3.7 1 1 
       1668 1 . . . . . 3.12 1.8 3.43 1 1 
       1669 1 . . . . . 3.53 1.8 3.88 1 1 
       1670 1 . . . . . 4.36 1.8  4.8 1 1 
       1671 1 . . . . . 3.26 1.8 3.59 1 1 
       1672 1 . . . . . 2.98 1.8 3.28 1 1 
       1673 1 . . . . . 3.42 1.8 3.76 1 1 
       1674 1 . . . . . 4.06 1.8 4.47 1 1 
       1675 1 . . . . . 5.04 1.8 5.54 1 1 
       1676 1 . . . . . 4.04 1.8 4.44 1 1 
       1677 1 . . . . .  3.9 1.8 4.29 1 1 
       1678 1 . . . . . 3.35 1.8 3.69 1 1 
       1679 1 . . . . . 3.46 1.8 3.81 1 1 
       1680 1 . . . . . 4.16 1.8 4.58 1 1 
       1681 1 . . . . . 3.85 1.8 4.23 1 1 
       1682 1 . . . . . 5.07 1.8 5.58 1 1 
       1683 1 . . . . . 5.07 1.8 5.58 1 1 
       1684 1 . . . . . 3.62 1.8 3.98 1 1 
       1685 1 . . . . . 3.92 1.8 4.31 1 1 
       1686 1 . . . . . 3.62 1.8 3.98 1 1 
       1687 1 . . . . .  4.0 1.8  4.4 1 1 
       1688 1 . . . . .  4.0 1.8  4.4 1 1 
       1689 1 . . . . . 4.19 1.8 4.61 1 1 
       1690 1 . . . . .  6.2 1.8 6.82 1 1 
       1691 1 . . . . .  6.2 1.8 6.82 1 1 
       1692 1 . . . . .  6.2 1.8 6.82 1 1 
       1693 1 . . . . . 3.93 1.8 4.32 1 1 
       1694 1 . . . . . 3.99 1.8 4.39 1 1 
       1695 1 . . . . . 5.12 1.8 5.63 1 1 
       1696 1 . . . . . 5.12 1.8 5.63 1 1 
       1697 1 . . . . . 3.93 1.8 4.32 1 1 
       1698 1 . . . . . 5.74 1.8 6.31 1 1 
       1699 1 . . . . . 4.88 1.8 5.37 1 1 
       1700 1 . . . . . 4.95 1.8 5.44 1 1 
       1701 1 . . . . . 4.95 1.8 5.44 1 1 
       1702 1 . . . . . 3.83 1.8 4.21 1 1 
       1703 1 . . . . . 3.83 1.8 4.21 1 1 
       1704 1 . . . . . 3.66 1.8 4.03 1 1 
       1705 1 . . . . . 2.75 1.8 3.03 1 1 
       1706 1 . . . . . 5.36 1.8  5.9 1 1 
       1707 1 . . . . . 5.36 1.8  5.9 1 1 
       1708 1 . . . . . 3.63 1.8 3.99 1 1 
       1709 1 . . . . . 4.07 1.8 4.48 1 1 
       1710 1 . . . . . 4.07 1.8 4.48 1 1 
       1711 1 . . . . . 3.74 1.8 4.11 1 1 
       1712 1 . . . . . 3.63 1.8 3.99 1 1 
       1713 1 . . . . . 4.08 1.8 4.49 1 1 
       1714 1 . . . . . 4.09 1.8  4.5 1 1 
       1715 1 . . . . . 4.08 1.8 4.49 1 1 
       1716 1 . . . . . 4.09 1.8  4.5 1 1 
       1717 1 . . . . . 3.39 1.8 3.73 1 1 
       1718 1 . . . . . 3.42 1.8 3.76 1 1 
       1719 1 . . . . . 3.35 1.8 3.69 1 1 
       1720 1 . . . . . 3.22 1.8 3.54 1 1 
       1721 1 . . . . . 3.95 1.8 4.35 1 1 
       1722 1 . . . . . 3.11 1.8 3.42 1 1 
       1723 1 . . . . . 3.36 1.8  3.7 1 1 
       1724 1 . . . . . 4.67 1.8 5.14 1 1 
       1725 1 . . . . .  2.8 1.8 3.08 1 1 
       1726 1 . . . . . 3.51 1.8 3.86 1 1 
       1727 1 . . . . . 3.87 1.8 4.26 1 1 
       1728 1 . . . . . 3.72 1.8 4.09 1 1 
       1729 1 . . . . . 3.87 1.8 4.26 1 1 
       1730 1 . . . . . 3.36 1.8  3.7 1 1 
       1731 1 . . . . . 3.46 1.8 3.81 1 1 
       1732 1 . . . . . 3.72 1.8 4.09 1 1 
       1733 1 . . . . . 3.84 1.8 4.22 1 1 
       1734 1 . . . . . 3.73 1.8  4.1 1 1 
       1735 1 . . . . .  6.2 1.8 6.82 1 1 
       1736 1 . . . . .  6.2 1.8 6.82 1 1 
       1737 1 . . . . . 3.55 1.8  3.9 1 1 
       1738 1 . . . . . 3.68 1.8 4.05 1 1 
       1739 1 . . . . .  4.0 1.8  4.4 1 1 
       1740 1 . . . . .  4.0 1.8  4.4 1 1 
       1741 1 . . . . . 3.92 1.8 4.31 1 1 
       1742 1 . . . . . 4.99 1.8 5.49 1 1 
       1743 1 . . . . . 3.43 1.8 3.77 1 1 
       1744 1 . . . . . 3.21 1.8 3.53 1 1 
       1745 1 . . . . . 3.51 1.8 3.86 1 1 
       1746 1 . . . . . 3.62 1.8 3.98 1 1 
       1747 1 . . . . . 3.17 1.8 3.49 1 1 
       1748 1 . . . . . 3.89 1.8 4.28 1 1 
       1749 1 . . . . . 3.38 1.8 3.72 1 1 
       1750 1 . . . . . 3.82 1.8  4.2 1 1 
       1751 1 . . . . . 3.27 1.8  3.6 1 1 
       1752 1 . . . . . 4.24 1.8 4.66 1 1 
       1753 1 . . . . .  4.8 1.8 5.28 1 1 
       1754 1 . . . . . 4.83 1.8 5.31 1 1 
       1755 1 . . . . . 4.83 1.8 5.31 1 1 
       1756 1 . . . . . 4.24 1.8 4.66 1 1 
       1757 1 . . . . .  4.8 1.8 5.28 1 1 
       1758 1 . . . . . 3.56 1.8 3.92 1 1 
       1759 1 . . . . .  3.1 1.8 3.41 1 1 
       1760 1 . . . . . 3.37 1.8 3.71 1 1 
       1761 1 . . . . . 3.43 1.8 3.77 1 1 
       1762 1 . . . . . 3.88 1.8 4.27 1 1 
       1763 1 . . . . . 3.88 1.8 4.27 1 1 
       1764 1 . . . . . 5.82 1.8  6.4 1 1 
       1765 1 . . . . . 5.82 1.8  6.4 1 1 
       1766 1 . . . . . 3.74 1.8 4.11 1 1 
       1767 1 . . . . . 3.74 1.8 4.11 1 1 
       1768 1 . . . . . 4.14 1.8 4.55 1 1 
       1769 1 . . . . . 4.14 1.8 4.55 1 1 
       1770 1 . . . . . 3.53 1.8 3.88 1 1 
       1771 1 . . . . . 3.65 1.8 4.02 1 1 
       1772 1 . . . . . 3.53 1.8 3.88 1 1 
       1773 1 . . . . . 3.75 1.8 4.13 1 1 
       1774 1 . . . . . 3.34 1.8 3.67 1 1 
       1775 1 . . . . . 2.86 1.8 3.15 1 1 
       1776 1 . . . . . 4.13 1.8 4.54 1 1 
       1777 1 . . . . . 4.13 1.8 4.54 1 1 
       1778 1 . . . . . 3.86 1.8 4.25 1 1 
       1779 1 . . . . . 4.05 1.8 4.46 1 1 
       1780 1 . . . . . 3.27 1.8  3.6 1 1 
       1781 1 . . . . . 4.14 1.8 4.55 1 1 
       1782 1 . . . . .  3.9 1.8 4.29 1 1 
       1783 1 . . . . . 4.53 1.8 4.98 1 1 
       1784 1 . . . . . 3.38 1.8 3.72 1 1 
       1785 1 . . . . . 4.53 1.8 4.98 1 1 
       1786 1 . . . . . 3.38 1.8 3.72 1 1 
       1787 1 . . . . . 3.86 1.8 4.25 1 1 
       1788 1 . . . . . 3.86 1.8 4.25 1 1 
       1789 1 . . . . . 3.83 1.8 4.21 1 1 
       1790 1 . . . . . 3.83 1.8 4.21 1 1 
       1791 1 . . . . . 3.33 1.8 3.66 1 1 
       1792 1 . . . . .  3.8 1.8 4.18 1 1 
       1793 1 . . . . . 3.42 1.8 3.76 1 1 
       1794 1 . . . . . 4.09 1.8  4.5 1 1 
       1795 1 . . . . . 3.87 1.8 4.26 1 1 
       1796 1 . . . . . 4.53 1.8 4.98 1 1 
       1797 1 . . . . . 4.53 1.8 4.98 1 1 
       1798 1 . . . . . 3.87 1.8 4.26 1 1 
       1799 1 . . . . . 3.77 1.8 4.15 1 1 
       1800 1 . . . . . 4.13 1.8 4.54 1 1 
       1801 1 . . . . . 3.77 1.8 4.15 1 1 
       1802 1 . . . . . 4.74 1.8 5.21 1 1 
       1803 1 . . . . . 3.89 1.8 4.28 1 1 
       1804 1 . . . . . 4.74 1.8 5.21 1 1 
       1805 1 . . . . . 3.89 1.8 4.28 1 1 
       1806 1 . . . . . 3.79 1.8 4.17 1 1 
       1807 1 . . . . . 3.79 1.8 4.17 1 1 
       1808 1 . . . . . 4.25 1.8 4.68 1 1 
       1809 1 . . . . .  3.6 1.8 3.96 1 1 
       1810 1 . . . . . 3.64 1.8  4.0 1 1 
       1811 1 . . . . . 4.14 1.8 4.55 1 1 
       1812 1 . . . . . 3.46 1.8 3.81 1 1 
       1813 1 . . . . . 3.46 1.8 3.81 1 1 
       1814 1 . . . . . 3.71 1.8 4.08 1 1 
       1815 1 . . . . . 3.68 1.8 4.05 1 1 
       1816 1 . . . . .  3.0 1.8  3.3 1 1 
       1817 1 . . . . . 2.72 1.8 2.99 1 1 
       1818 1 . . . . . 3.48 1.8 3.83 1 1 
       1819 1 . . . . . 3.39 1.8 3.73 1 1 
       1820 1 . . . . . 4.32 1.8 4.75 1 1 
       1821 1 . . . . . 3.58 1.8 3.94 1 1 
       1822 1 . . . . . 4.05 1.8 4.46 1 1 
       1823 1 . . . . . 4.23 1.8 4.65 1 1 
       1824 1 . . . . . 2.55 1.8  2.8 1 1 
       1825 1 . . . . . 3.36 1.8  3.7 1 1 
       1826 1 . . . . . 3.46 1.8 3.81 1 1 
       1827 1 . . . . .  3.5 1.8 3.85 1 1 
       1828 1 . . . . . 3.19 1.8 3.51 1 1 
       1829 1 . . . . . 4.02 1.8 4.42 1 1 
       1830 1 . . . . . 4.02 1.8 4.42 1 1 
       1831 1 . . . . . 5.97 1.8 6.57 1 1 
       1832 1 . . . . . 5.97 1.8 6.57 1 1 
       1833 1 . . . . . 6.15 1.8 6.77 1 1 
       1834 1 . . . . . 6.15 1.8 6.77 1 1 
       1835 1 . . . . .  3.9 1.8 4.29 1 1 
       1836 1 . . . . .  3.9 1.8 4.29 1 1 
       1837 1 . . . . .  4.1 1.8 4.51 1 1 
       1838 1 . . . . . 4.38 1.8 4.82 1 1 
       1839 1 . . . . . 3.56 1.8 3.92 1 1 
       1840 1 . . . . .  3.4 1.8 3.74 1 1 
       1841 1 . . . . . 4.82 1.8  5.3 1 1 
       1842 1 . . . . . 3.72 1.8 4.09 1 1 
       1843 1 . . . . .  3.3 1.8 3.63 1 1 
       1844 1 . . . . . 3.75 1.8 4.13 1 1 
       1845 1 . . . . . 3.78 1.8 4.16 1 1 
       1846 1 . . . . . 3.91 1.8  4.3 1 1 
       1847 1 . . . . . 3.56 1.8 3.92 1 1 
       1848 1 . . . . . 2.97 1.8 3.27 1 1 
       1849 1 . . . . . 2.55 1.8  2.8 1 1 
       1850 1 . . . . . 4.07 1.8 4.48 1 1 
       1851 1 . . . . . 3.47 1.8 3.82 1 1 
       1852 1 . . . . . 3.59 1.8 3.95 1 1 
       1853 1 . . . . . 3.51 1.8 3.86 1 1 
       1854 1 . . . . . 3.92 1.8 4.31 1 1 
       1855 1 . . . . . 2.63 1.8 2.89 1 1 
       1856 1 . . . . . 3.94 1.8 4.33 1 1 
       1857 1 . . . . . 3.94 1.8 4.33 1 1 
       1858 1 . . . . . 2.99 1.8 3.29 1 1 
       1859 1 . . . . . 3.09 1.8  3.4 1 1 
       1860 1 . . . . . 3.87 1.8 4.26 1 1 
       1861 1 . . . . . 3.56 1.8 3.92 1 1 
       1862 1 . . . . . 3.87 1.8 4.26 1 1 
       1863 1 . . . . . 6.03 1.8 6.63 1 1 
       1864 1 . . . . . 6.03 1.8 6.63 1 1 
       1865 1 . . . . . 4.31 1.8 4.74 1 1 
       1866 1 . . . . .  5.7 1.8 6.27 1 1 
       1867 1 . . . . .  5.7 1.8 6.27 1 1 
       1868 1 . . . . .  6.2 1.8 6.82 1 1 
       1869 1 . . . . .  6.2 1.8 6.82 1 1 
       1870 1 . . . . . 3.85 1.8 4.23 1 1 
       1871 1 . . . . . 3.85 1.8 4.23 1 1 
       1872 1 . . . . . 4.73 1.8  5.2 1 1 
       1873 1 . . . . . 4.73 1.8  5.2 1 1 
       1874 1 . . . . . 4.07 1.8 4.48 1 1 
       1875 1 . . . . . 4.07 1.8 4.48 1 1 
       1876 1 . . . . . 4.08 1.8 4.49 1 1 
       1877 1 . . . . . 4.08 1.8 4.49 1 1 
       1878 1 . . . . . 5.28 1.8 5.81 1 1 
       1879 1 . . . . . 3.77 1.8 4.15 1 1 
       1880 1 . . . . . 3.38 1.8 3.72 1 1 
       1881 1 . . . . . 3.41 1.8 3.75 1 1 
       1882 1 . . . . . 3.78 1.8 4.16 1 1 
       1883 1 . . . . . 3.78 1.8 4.16 1 1 
       1884 1 . . . . . 3.48 1.8 3.83 1 1 
       1885 1 . . . . .  4.1 1.8 4.51 1 1 
       1886 1 . . . . . 3.59 1.8 3.95 1 1 
       1887 1 . . . . . 3.99 1.8 4.39 1 1 
       1888 1 . . . . . 3.34 1.8 3.67 1 1 
       1889 1 . . . . . 4.08 1.8 4.49 1 1 
       1890 1 . . . . . 3.83 1.8 4.21 1 1 
       1891 1 . . . . . 3.45 1.8 3.79 1 1 
       1892 1 . . . . . 3.79 1.8 4.17 1 1 
       1893 1 . . . . . 3.54 1.8 3.89 1 1 
       1894 1 . . . . . 3.21 1.8 3.53 1 1 
       1895 1 . . . . . 2.75 1.8 3.03 1 1 
       1896 1 . . . . . 4.21 1.8 4.63 1 1 
       1897 1 . . . . . 5.11 1.8 5.62 1 1 
       1898 1 . . . . .  6.2 1.8 6.82 1 1 
       1899 1 . . . . .  6.2 1.8 6.82 1 1 
       1900 1 . . . . . 4.08 1.8 4.49 1 1 
       1901 1 . . . . . 4.08 1.8 4.49 1 1 
       1902 1 . . . . . 3.82 1.8  4.2 1 1 
       1903 1 . . . . . 4.16 1.8 4.58 1 1 
       1904 1 . . . . . 3.82 1.8  4.2 1 1 
       1905 1 . . . . . 4.91 1.8  5.4 1 1 
       1906 1 . . . . . 4.91 1.8  5.4 1 1 
       1907 1 . . . . . 3.94 1.8 4.33 1 1 
       1908 1 . . . . . 3.94 1.8 4.33 1 1 
       1909 1 . . . . . 4.19 1.8 4.61 1 1 
       1910 1 . . . . . 5.79 1.8 6.37 1 1 
       1911 1 . . . . . 5.79 1.8 6.37 1 1 
       1912 1 . . . . . 4.19 1.8 4.61 1 1 
       1913 1 . . . . . 3.24 1.8 3.56 1 1 
       1914 1 . . . . . 3.67 1.8 4.04 1 1 
       1915 1 . . . . . 3.23 1.8 3.55 1 1 
       1916 1 . . . . . 4.06 1.8 4.47 1 1 
       1917 1 . . . . . 4.14 1.8 4.55 1 1 
       1918 1 . . . . . 4.14 1.8 4.55 1 1 
       1919 1 . . . . . 3.94 1.8 4.33 1 1 
       1920 1 . . . . . 3.94 1.8 4.33 1 1 
       1921 1 . . . . . 4.04 1.8 4.44 1 1 
       1922 1 . . . . . 3.66 1.8 4.03 1 1 
       1923 1 . . . . . 4.62 1.8 5.08 1 1 
       1924 1 . . . . . 4.62 1.8 5.08 1 1 
       1925 1 . . . . . 4.04 1.8 4.44 1 1 
       1926 1 . . . . . 3.99 1.8 4.39 1 1 
       1927 1 . . . . . 3.99 1.8 4.39 1 1 
       1928 1 . . . . . 3.67 1.8 4.04 1 1 
       1929 1 . . . . . 3.79 1.8 4.17 1 1 
       1930 1 . . . . . 3.67 1.8 4.04 1 1 
       1931 1 . . . . . 3.79 1.8 4.17 1 1 
       1932 1 . . . . . 3.42 1.8 3.76 1 1 
       1933 1 . . . . . 4.16 1.8 4.58 1 1 
       1934 1 . . . . .  3.3 1.8 3.63 1 1 
       1935 1 . . . . . 3.49 1.8 3.84 1 1 
       1936 1 . . . . . 4.18 1.8  4.6 1 1 
       1937 1 . . . . . 4.16 1.8 4.58 1 1 
       1938 1 . . . . . 4.21 1.8 4.63 1 1 
       1939 1 . . . . . 4.86 1.8 5.35 1 1 
       1940 1 . . . . . 4.86 1.8 5.35 1 1 
       1941 1 . . . . . 4.16 1.8 4.58 1 1 
       1942 1 . . . . .  6.2 1.8 6.82 1 1 
       1943 1 . . . . .  6.2 1.8 6.82 1 1 
       1944 1 . . . . . 4.21 1.8 4.63 1 1 
       1945 1 . . . . .  3.9 1.8 4.29 1 1 
       1946 1 . . . . .  3.9 1.8 4.29 1 1 
       1947 1 . . . . .  2.5 1.8 2.75 1 1 
       1948 1 . . . . . 2.96 1.8 3.26 1 1 
       1949 1 . . . . . 2.84 1.8 3.12 1 1 
       1950 1 . . . . . 2.96 1.8 3.26 1 1 
       1951 1 . . . . . 2.59 1.8 2.85 1 1 
       1952 1 . . . . . 2.55 1.8  2.8 1 1 
       1953 1 . . . . . 3.85 1.8 4.23 1 1 
       1954 1 . . . . . 3.31 1.8 3.64 1 1 
       1955 1 . . . . . 5.17 1.8 5.69 1 1 
       1956 1 . . . . . 3.61 1.8 3.97 1 1 
       1957 1 . . . . . 4.57 1.8 5.03 1 1 
       1958 1 . . . . .  5.0 1.8  5.5 1 1 
       1959 1 . . . . . 3.28 1.8 3.61 1 1 
       1960 1 . . . . . 4.22 1.8 4.64 1 1 
       1961 1 . . . . . 3.85 1.8 4.23 1 1 
       1962 1 . . . . . 3.17 1.8 3.49 1 1 
       1963 1 . . . . . 4.36 1.8  4.8 1 1 
       1964 1 . . . . . 3.31 1.8 3.64 1 1 
       1965 1 . . . . . 3.28 1.8 3.61 1 1 
       1966 1 . . . . . 3.31 1.8 3.64 1 1 
       1967 1 . . . . . 3.95 1.8 4.35 1 1 
       1968 1 . . . . . 3.95 1.8 4.35 1 1 
       1969 1 . . . . . 3.23 1.8 3.55 1 1 
       1970 1 . . . . . 3.31 1.8 3.64 1 1 
       1971 1 . . . . . 3.06 1.8 3.37 1 1 
       1972 1 . . . . . 2.78 1.8 3.06 1 1 
       1973 1 . . . . . 3.33 1.8 3.66 1 1 
       1974 1 . . . . .  3.8 1.8 4.18 1 1 
       1975 1 . . . . .  2.5 1.8 2.75 1 1 
       1976 1 . . . . . 3.23 1.8 3.55 1 1 
       1977 1 . . . . . 4.19 1.8 4.61 1 1 
       1978 1 . . . . . 4.69 1.8 5.16 1 1 
       1979 1 . . . . . 4.34 1.8 4.77 1 1 
       1980 1 . . . . . 3.53 1.8 3.88 1 1 
       1981 1 . . . . .  3.9 1.8 4.29 1 1 
       1982 1 . . . . . 3.45 1.8 3.79 1 1 
       1983 1 . . . . . 3.75 1.8 4.13 1 1 
       1984 1 . . . . . 3.58 1.8 3.94 1 1 
       1985 1 . . . . . 2.55 1.8  2.8 1 1 
       1986 1 . . . . . 5.02 1.8 5.52 1 1 
       1987 1 . . . . . 2.86 1.8 3.15 1 1 
       1988 1 . . . . . 3.61 1.8 3.97 1 1 
       1989 1 . . . . . 3.45 1.8 3.79 1 1 
       1990 1 . . . . . 2.86 1.8 3.15 1 1 
       1991 1 . . . . . 3.75 1.8 4.13 1 1 
       1992 1 . . . . . 3.58 1.8 3.94 1 1 
       1993 1 . . . . . 4.66 1.8 5.13 1 1 
       1994 1 . . . . . 3.58 1.8 3.94 1 1 
       1995 1 . . . . . 3.86 1.8 4.25 1 1 
       1996 1 . . . . . 3.84 1.8 4.22 1 1 
       1997 1 . . . . . 2.76 1.8 3.04 1 1 
       1998 1 . . . . . 2.87 1.8 3.16 1 1 
       1999 1 . . . . . 5.21 1.8 5.73 1 1 
       2000 1 . . . . . 3.58 1.8 3.94 1 1 
       2001 1 . . . . .  3.2 1.8 3.52 1 1 
       2002 1 . . . . . 3.11 1.8 3.42 1 1 
       2003 1 . . . . . 3.66 1.8 4.03 1 1 
       2004 1 . . . . . 3.66 1.8 4.03 1 1 
       2005 1 . . . . . 4.01 1.8 4.41 1 1 
       2006 1 . . . . . 4.01 1.8 4.41 1 1 
       2007 1 . . . . . 3.46 1.8 3.81 1 1 
       2008 1 . . . . . 5.47 1.8 6.02 1 1 
       2009 1 . . . . . 5.47 1.8 6.02 1 1 
       2010 1 . . . . . 3.34 1.8 3.67 1 1 
       2011 1 . . . . . 3.85 1.8 4.23 1 1 
       2012 1 . . . . . 3.85 1.8 4.23 1 1 
       2013 1 . . . . . 5.47 1.8 6.02 1 1 
       2014 1 . . . . . 5.47 1.8 6.02 1 1 
       2015 1 . . . . . 4.21 1.8 4.63 1 1 
       2016 1 . . . . . 4.21 1.8 4.63 1 1 
       2017 1 . . . . . 5.41 1.8 5.95 1 1 
       2018 1 . . . . . 4.93 1.8 5.42 1 1 
       2019 1 . . . . . 4.93 1.8 5.42 1 1 
       2020 1 . . . . . 5.47 1.8 6.02 1 1 
       2021 1 . . . . . 5.47 1.8 6.02 1 1 
       2022 1 . . . . . 3.16 1.8 3.48 1 1 
       2023 1 . . . . .  4.1 1.8 4.51 1 1 
       2024 1 . . . . . 3.85 1.8 4.23 1 1 
       2025 1 . . . . . 4.12 1.8 4.53 1 1 
       2026 1 . . . . . 3.92 1.8 4.31 1 1 
       2027 1 . . . . . 3.18 1.8  3.5 1 1 
       2028 1 . . . . . 3.18 1.8  3.5 1 1 
       2029 1 . . . . . 2.91 1.8  3.2 1 1 
       2030 1 . . . . . 3.23 1.8 3.55 1 1 
       2031 1 . . . . . 3.23 1.8 3.55 1 1 
       2032 1 . . . . . 3.88 1.8 4.27 1 1 
       2033 1 . . . . . 3.88 1.8 4.27 1 1 
       2034 1 . . . . . 4.99 1.8 5.49 1 1 
       2035 1 . . . . . 4.34 1.8 4.77 1 1 
       2036 1 . . . . . 3.95 1.8 4.35 1 1 
       2037 1 . . . . . 4.18 1.8  4.6 1 1 
       2038 1 . . . . . 3.41 1.8 3.75 1 1 
       2039 1 . . . . .  5.4 1.8 5.94 1 1 
       2040 1 . . . . . 4.32 1.8 4.75 1 1 
       2041 1 . . . . . 3.62 1.8 3.98 1 1 
       2042 1 . . . . .  3.7 1.8 4.07 1 1 
       2043 1 . . . . . 4.38 1.8 4.82 1 1 
       2044 1 . . . . . 5.22 1.8 5.74 1 1 
       2045 1 . . . . . 5.22 1.8 5.74 1 1 
       2046 1 . . . . .  6.2 1.8 6.82 1 1 
       2047 1 . . . . .  6.2 1.8 6.82 1 1 
       2048 1 . . . . . 5.52 1.8 6.07 1 1 
       2049 1 . . . . . 4.98 1.8 5.48 1 1 
       2050 1 . . . . . 4.52 1.8 4.97 1 1 
       2051 1 . . . . .  4.5 1.8 4.95 1 1 
       2052 1 . . . . . 3.54 1.8 3.89 1 1 
       2053 1 . . . . . 4.79 1.8 5.27 1 1 
       2054 1 . . . . . 4.79 1.8 5.27 1 1 
       2055 1 . . . . . 4.43 1.8 4.87 1 1 
       2056 1 . . . . . 5.08 1.8 5.59 1 1 
       2057 1 . . . . . 4.75 1.8 5.22 1 1 
       2058 1 . . . . . 4.75 1.8 5.22 1 1 
       2059 1 . . . . .  6.2 1.8 6.82 1 1 
       2060 1 . . . . .  6.2 1.8 6.82 1 1 
       2061 1 . . . . . 5.74 1.8 6.31 1 1 
       2062 1 . . . . . 5.33 1.8 5.86 1 1 
       2063 1 . . . . . 3.98 1.8 4.38 1 1 
       2064 1 . . . . . 5.12 1.8 5.63 1 1 
       2065 1 . . . . . 4.19 1.8 4.61 1 1 
       2066 1 . . . . . 5.45 1.8  6.0 1 1 
       2067 1 . . . . . 4.65 1.8 5.12 1 1 
       2068 1 . . . . . 4.22 1.8 4.64 1 1 
       2069 1 . . . . . 4.22 1.8 4.64 1 1 
       2070 1 . . . . . 5.59 1.8 6.15 1 1 
       2071 1 . . . . . 5.44 1.8 5.98 1 1 
       2072 1 . . . . . 5.25 1.8 5.78 1 1 
       2073 1 . . . . . 5.56 1.8 6.12 1 1 
       2074 1 . . . . . 5.25 1.8 5.78 1 1 
       2075 1 . . . . .  5.3 1.8 5.83 1 1 
       2076 1 . . . . .  5.3 1.8 5.83 1 1 
       2077 1 . . . . . 4.77 1.8 5.25 1 1 
       2078 1 . . . . . 4.49 1.8 4.94 1 1 
       2079 1 . . . . . 4.32 1.8 4.75 1 1 
       2080 1 . . . . . 4.53 1.8 4.98 1 1 
       2081 1 . . . . . 4.39 1.8 4.83 1 1 
       2082 1 . . . . . 4.48 1.8 4.93 1 1 
       2083 1 . . . . . 4.76 1.8 5.24 1 1 
       2084 1 . . . . . 4.76 1.8 5.24 1 1 
       2085 1 . . . . . 3.25 1.8 3.58 1 1 
       2086 1 . . . . . 4.15 1.8 4.57 1 1 
       2087 1 . . . . . 4.55 1.8 5.01 1 1 
       2088 1 . . . . . 4.49 1.8 4.94 1 1 
       2089 1 . . . . . 4.82 1.8  5.3 1 1 
       2090 1 . . . . . 4.47 1.8 4.92 1 1 
       2091 1 . . . . . 5.07 1.8 5.58 1 1 
       2092 1 . . . . . 4.74 1.8 5.21 1 1 
       2093 1 . . . . .  4.2 1.8 4.62 1 1 
       2094 1 . . . . . 5.21 1.8 5.73 1 1 
       2095 1 . . . . . 4.66 1.8 5.13 1 1 
       2096 1 . . . . . 3.65 1.8 4.02 1 1 
       2097 1 . . . . . 3.54 1.8 3.89 1 1 
       2098 1 . . . . . 4.18 1.8  4.6 1 1 
       2099 1 . . . . . 4.21 1.8 4.63 1 1 
       2100 1 . . . . . 4.21 1.8 4.63 1 1 
       2101 1 . . . . .  6.2 1.8 6.82 1 1 
       2102 1 . . . . .  6.2 1.8 6.82 1 1 
       2103 1 . . . . . 3.79 1.8 4.17 1 1 
       2104 1 . . . . . 4.91 1.8  5.4 1 1 
       2105 1 . . . . . 4.08 1.8 4.49 1 1 
       2106 1 . . . . . 4.76 1.8 5.24 1 1 
       2107 1 . . . . .  6.1 1.8 6.71 1 1 
       2108 1 . . . . . 4.16 1.8 4.58 1 1 
       2109 1 . . . . . 5.18 1.8  5.7 1 1 
       2110 1 . . . . . 4.86 1.8 5.35 1 1 
       2111 1 . . . . . 4.49 1.8 4.94 1 1 
       2112 1 . . . . . 5.03 1.8 5.53 1 1 
       2113 1 . . . . . 4.49 1.8 4.94 1 1 
       2114 1 . . . . . 4.63 1.8 5.09 1 1 
       2115 1 . . . . . 4.95 1.8 5.44 1 1 
       2116 1 . . . . . 4.39 1.8 4.83 1 1 
       2117 1 . . . . . 4.66 1.8 5.13 1 1 
       2118 1 . . . . . 5.11 1.8 5.62 1 1 
       2119 1 . . . . .  3.6 1.8 3.96 1 1 
       2120 1 . . . . . 4.56 1.8 5.02 1 1 
       2121 1 . . . . . 4.31 1.8 4.74 1 1 
       2122 1 . . . . .  4.2 1.8 4.62 1 1 
       2123 1 . . . . . 3.74 1.8 4.11 1 1 
       2124 1 . . . . . 3.65 1.8 4.02 1 1 
       2125 1 . . . . .  6.2 1.8 6.82 1 1 
       2126 1 . . . . . 5.91 1.8  6.5 1 1 
       2127 1 . . . . .  6.2 1.8 6.82 1 1 
       2128 1 . . . . . 4.98 1.8 5.48 1 1 
       2129 1 . . . . . 4.68 1.8 5.15 1 1 
       2130 1 . . . . . 5.99 1.8 6.59 1 1 
       2131 1 . . . . . 4.71 1.8 5.18 1 1 
       2132 1 . . . . . 5.03 1.8 5.53 1 1 
       2133 1 . . . . . 4.28 1.8 4.71 1 1 
       2134 1 . . . . .  6.2 1.8 6.82 1 1 
       2135 1 . . . . .  6.2 1.8 6.82 1 1 
       2136 1 . . . . . 4.37 1.8 4.81 1 1 
       2137 1 . . . . . 4.55 1.8 5.01 1 1 
       2138 1 . . . . . 4.59 1.8 5.05 1 1 
       2139 1 . . . . . 3.38 1.8 3.72 1 1 
       2140 1 . . . . . 4.68 1.8 5.15 1 1 
       2141 1 . . . . . 4.16 1.8 4.58 1 1 
       2142 1 . . . . . 5.78 1.8 6.36 1 1 
       2143 1 . . . . . 4.28 1.8 4.71 1 1 
       2144 1 . . . . . 4.96 1.8 5.46 1 1 
       2145 1 . . . . . 5.45 1.8  6.0 1 1 
       2146 1 . . . . . 5.45 1.8  6.0 1 1 
       2147 1 . . . . .  6.2 1.8 6.82 1 1 
       2148 1 . . . . .  6.2 1.8 6.82 1 1 
       2149 1 . . . . . 4.06 1.8 4.47 1 1 
       2150 1 . . . . .  3.8 1.8 4.18 1 1 
       2151 1 . . . . . 4.77 1.8 5.25 1 1 
       2152 1 . . . . . 4.77 1.8 5.25 1 1 
       2153 1 . . . . . 5.53 1.8 6.08 1 1 
       2154 1 . . . . . 5.53 1.8 6.08 1 1 
       2155 1 . . . . . 4.48 1.8 4.93 1 1 
       2156 1 . . . . . 5.23 1.8 5.75 1 1 
       2157 1 . . . . . 5.49 1.8 6.04 1 1 
       2158 1 . . . . . 4.94 1.8 5.43 1 1 
       2159 1 . . . . . 4.94 1.8 5.43 1 1 
       2160 1 . . . . . 4.78 1.8 5.26 1 1 
       2161 1 . . . . . 4.91 1.8  5.4 1 1 
       2162 1 . . . . .  6.2 1.8 6.82 1 1 
       2163 1 . . . . .  6.2 1.8 6.82 1 1 
       2164 1 . . . . .  6.2 1.8 6.82 1 1 
       2165 1 . . . . .  6.2 1.8 6.82 1 1 
       2166 1 . . . . . 3.15 1.8 3.47 1 1 
       2167 1 . . . . . 4.36 1.8  4.8 1 1 
       2168 1 . . . . . 4.95 1.8 5.44 1 1 
       2169 1 . . . . . 4.81 1.8 5.29 1 1 
       2170 1 . . . . . 4.27 1.8  4.7 1 1 
       2171 1 . . . . . 5.57 1.8 6.13 1 1 
       2172 1 . . . . . 4.77 1.8 5.25 1 1 
       2173 1 . . . . . 5.06 1.8 5.57 1 1 
       2174 1 . . . . . 4.05 1.8 4.46 1 1 
       2175 1 . . . . . 4.68 1.8 5.15 1 1 
       2176 1 . . . . . 5.41 1.8 5.95 1 1 
       2177 1 . . . . . 4.76 1.8 5.24 1 1 
       2178 1 . . . . . 5.34 1.8 5.87 1 1 
       2179 1 . . . . . 5.08 1.8 5.59 1 1 
       2180 1 . . . . . 3.87 1.8 4.26 1 1 
       2181 1 . . . . . 3.91 1.8  4.3 1 1 
       2182 1 . . . . . 4.89 1.8 5.38 1 1 
       2183 1 . . . . . 4.49 1.8 4.94 1 1 
       2184 1 . . . . . 4.49 1.8 4.94 1 1 
       2185 1 . . . . .  4.8 1.8 5.28 1 1 
       2186 1 . . . . . 4.58 1.8 5.04 1 1 
       2187 1 . . . . .  5.2 1.8 5.72 1 1 
       2188 1 . . . . . 4.83 1.8 5.31 1 1 
       2189 1 . . . . . 4.18 1.8  4.6 1 1 
       2190 1 . . . . . 4.52 1.8 4.97 1 1 
       2191 1 . . . . .  6.2 1.8 6.82 1 1 
       2192 1 . . . . . 4.08 1.8 4.49 1 1 
       2193 1 . . . . . 5.18 1.8  5.7 1 1 
       2194 1 . . . . . 4.45 1.8 4.89 1 1 
       2195 1 . . . . . 3.68 1.8 4.05 1 1 
       2196 1 . . . . . 4.83 1.8 5.31 1 1 
       2197 1 . . . . . 3.74 1.8 4.11 1 1 
       2198 1 . . . . . 4.99 1.8 5.49 1 1 
       2199 1 . . . . . 4.61 1.8 5.07 1 1 
       2200 1 . . . . . 4.61 1.8 5.07 1 1 
       2201 1 . . . . . 4.19 1.8 4.61 1 1 
       2202 1 . . . . . 4.18 1.8  4.6 1 1 
       2203 1 . . . . . 4.91 1.8  5.4 1 1 
       2204 1 . . . . . 4.03 1.8 4.43 1 1 
       2205 1 . . . . . 4.62 1.8 5.08 1 1 
       2206 1 . . . . . 3.94 1.8 4.33 1 1 
       2207 1 . . . . . 3.11 1.8 3.42 1 1 
       2208 1 . . . . . 4.67 1.8 5.14 1 1 
       2209 1 . . . . . 3.21 1.8 3.53 1 1 
       2210 1 . . . . . 4.25 1.8 4.68 1 1 
       2211 1 . . . . . 4.48 1.8 4.93 1 1 
       2212 1 . . . . . 3.75 1.8 4.13 1 1 
       2213 1 . . . . . 4.07 1.8 4.48 1 1 
       2214 1 . . . . . 4.07 1.8 4.48 1 1 
       2215 1 . . . . . 4.06 1.8 4.47 1 1 
       2216 1 . . . . . 4.92 1.8 5.41 1 1 
       2217 1 . . . . . 4.31 1.8 4.74 1 1 
       2218 1 . . . . . 4.28 1.8 4.71 1 1 
       2219 1 . . . . . 4.47 1.8 4.92 1 1 
       2220 1 . . . . . 4.44 1.8 4.88 1 1 
       2221 1 . . . . . 3.19 1.8 3.51 1 1 
       2222 1 . . . . . 2.83 1.8 3.11 1 1 
       2223 1 . . . . . 4.25 1.8 4.68 1 1 
       2224 1 . . . . . 4.37 1.8 4.81 1 1 
       2225 1 . . . . . 4.53 1.8 4.98 1 1 
       2226 1 . . . . . 5.27 1.8  5.8 1 1 
       2227 1 . . . . .  4.5 1.8 4.95 1 1 
       2228 1 . . . . . 3.13 1.8 3.44 1 1 
       2229 1 . . . . . 3.04 1.8 3.34 1 1 
       2230 1 . . . . . 4.27 1.8  4.7 1 1 
       2231 1 . . . . .  3.9 1.8 4.29 1 1 
       2232 1 . . . . .  4.4 1.8 4.84 1 1 
       2233 1 . . . . . 4.99 1.8 5.49 1 1 
       2234 1 . . . . . 4.71 1.8 5.18 1 1 
       2235 1 . . . . .  4.5 1.8 4.95 1 1 
       2236 1 . . . . .  4.8 1.8 5.28 1 1 
       2237 1 . . . . . 5.03 1.8 5.53 1 1 
       2238 1 . . . . . 4.53 1.8 4.98 1 1 
       2239 1 . . . . . 4.28 1.8 4.71 1 1 
       2240 1 . . . . . 3.24 1.8 3.56 1 1 
       2241 1 . . . . . 4.38 1.8 4.82 1 1 
       2242 1 . . . . . 4.39 1.8 4.83 1 1 
       2243 1 . . . . . 4.25 1.8 4.68 1 1 
       2244 1 . . . . . 4.12 1.8 4.53 1 1 
       2245 1 . . . . . 5.49 1.8 6.04 1 1 
       2246 1 . . . . . 4.23 1.8 4.65 1 1 
       2247 1 . . . . . 5.75 1.8 6.32 1 1 
       2248 1 . . . . . 5.71 1.8 6.28 1 1 
       2249 1 . . . . . 3.98 1.8 4.38 1 1 
       2250 1 . . . . . 4.34 1.8 4.77 1 1 
       2251 1 . . . . . 4.25 1.8 4.68 1 1 
       2252 1 . . . . .  4.0 1.8  4.4 1 1 
       2253 1 . . . . . 4.12 1.8 4.53 1 1 
       2254 1 . . . . . 4.76 1.8 5.24 1 1 
       2255 1 . . . . .  4.6 1.8 5.06 1 1 
       2256 1 . . . . . 3.59 1.8 3.95 1 1 
       2257 1 . . . . . 4.57 1.8 5.03 1 1 
       2258 1 . . . . . 3.95 1.8 4.35 1 1 
       2259 1 . . . . . 3.57 1.8 3.93 1 1 
       2260 1 . . . . . 5.32 1.8 5.85 1 1 
       2261 1 . . . . . 3.94 1.8 4.33 1 1 
       2262 1 . . . . . 4.67 1.8 5.14 1 1 
       2263 1 . . . . . 3.76 1.8 4.14 1 1 
       2264 1 . . . . . 5.42 1.8 5.96 1 1 
       2265 1 . . . . . 5.07 1.8 5.58 1 1 
       2266 1 . . . . . 4.41 1.8 4.85 1 1 
       2267 1 . . . . . 5.32 1.8 5.85 1 1 
       2268 1 . . . . . 3.84 1.8 4.22 1 1 
       2269 1 . . . . . 6.04 1.8 6.64 1 1 
       2270 1 . . . . . 4.51 1.8 4.96 1 1 
       2271 1 . . . . . 3.98 1.8 4.38 1 1 
       2272 1 . . . . . 3.98 1.8 4.38 1 1 
       2273 1 . . . . . 4.88 1.8 5.37 1 1 
       2274 1 . . . . . 4.59 1.8 5.05 1 1 
       2275 1 . . . . . 4.11 1.8 4.52 1 1 
       2276 1 . . . . . 4.77 1.8 5.25 1 1 
       2277 1 . . . . . 4.37 1.8 4.81 1 1 
       2278 1 . . . . . 4.04 1.8 4.44 1 1 
       2279 1 . . . . . 3.06 1.8 3.37 1 1 
       2280 1 . . . . . 4.66 1.8 5.13 1 1 
       2281 1 . . . . . 4.61 1.8 5.07 1 1 
       2282 1 . . . . . 4.44 1.8 4.88 1 1 
       2283 1 . . . . . 5.01 1.8 5.51 1 1 
       2284 1 . . . . . 4.93 1.8 5.42 1 1 
       2285 1 . . . . . 4.93 1.8 5.42 1 1 
       2286 1 . . . . . 3.56 1.8 3.92 1 1 
       2287 1 . . . . . 3.76 1.8 4.14 1 1 
       2288 1 . . . . . 4.85 1.8 5.33 1 1 
       2289 1 . . . . . 4.21 1.8 4.63 1 1 
       2290 1 . . . . . 3.88 1.8 4.27 1 1 
       2291 1 . . . . . 3.56 1.8 3.92 1 1 
       2292 1 . . . . . 4.78 1.8 5.26 1 1 
       2293 1 . . . . .  4.8 1.8 5.28 1 1 
       2294 1 . . . . . 4.86 1.8 5.35 1 1 
       2295 1 . . . . .  4.2 1.8 4.62 1 1 
       2296 1 . . . . . 3.91 1.8  4.3 1 1 
       2297 1 . . . . . 4.67 1.8 5.14 1 1 
       2298 1 . . . . . 4.02 1.8 4.42 1 1 
       2299 1 . . . . . 3.66 1.8 4.03 1 1 
       2300 1 . . . . . 3.88 1.8 4.27 1 1 
       2301 1 . . . . . 3.43 1.8 3.77 1 1 
       2302 1 . . . . . 3.92 1.8 4.31 1 1 
       2303 1 . . . . . 4.15 1.8 4.57 1 1 
       2304 1 . . . . . 5.11 1.8 5.62 1 1 
       2305 1 . . . . . 5.11 1.8 5.62 1 1 
       2306 1 . . . . . 3.88 1.8 4.27 1 1 
       2307 1 . . . . . 4.53 1.8 4.98 1 1 
       2308 1 . . . . . 4.77 1.8 5.25 1 1 
       2309 1 . . . . . 3.52 1.8 3.87 1 1 
       2310 1 . . . . . 4.26 1.8 4.69 1 1 
       2311 1 . . . . . 4.21 1.8 4.63 1 1 
       2312 1 . . . . . 4.72 1.8 5.19 1 1 
       2313 1 . . . . . 3.84 1.8 4.22 1 1 
       2314 1 . . . . .  5.1 1.8 5.61 1 1 
       2315 1 . . . . .  6.2 1.8 6.82 1 1 
       2316 1 . . . . . 3.82 1.8  4.2 1 1 
       2317 1 . . . . .  6.2 1.8 6.82 1 1 
       2318 1 . . . . . 3.82 1.8  4.2 1 1 
       2319 1 . . . . . 5.73 1.8  6.3 1 1 
       2320 1 . . . . . 6.05 1.8 6.66 1 1 
       2321 1 . . . . . 5.68 1.8 6.25 1 1 
       2322 1 . . . . . 4.72 1.8 5.19 1 1 
       2323 1 . . . . . 5.35 1.8 5.89 1 1 
       2324 1 . . . . . 5.41 1.8 5.95 1 1 
       2325 1 . . . . . 5.44 1.8 5.98 1 1 
       2326 1 . . . . . 5.74 1.8 6.31 1 1 
       2327 1 . . . . . 5.72 1.8 6.29 1 1 
       2328 1 . . . . .  2.9 1.8 3.19 1 1 
       2329 1 . . . . . 5.61 1.8 6.17 1 1 
       2330 1 . . . . . 6.01 1.8 6.61 1 1 
       2331 1 . . . . . 3.99 1.8 4.39 1 1 
       2332 1 . . . . . 3.14 1.8 3.45 1 1 
       2333 1 . . . . . 3.44 1.8 3.78 1 1 
       2334 1 . . . . . 3.86 1.8 4.25 1 1 
       2335 1 . . . . . 5.28 1.8 5.81 1 1 
       2336 1 . . . . . 5.54 1.8 6.09 1 1 
       2337 1 . . . . . 3.81 1.8 4.19 1 1 
       2338 1 . . . . . 3.83 1.8 4.21 1 1 
       2339 1 . . . . . 4.61 1.8 5.07 1 1 
       2340 1 . . . . . 4.91 1.8  5.4 1 1 
       2341 1 . . . . . 6.07 1.8 6.68 1 1 
       2342 1 . . . . .  6.2 1.8 6.82 1 1 
       2343 1 . . . . . 4.95 1.8 5.44 1 1 
       2344 1 . . . . . 4.63 1.8 5.09 1 1 
       2345 1 . . . . . 3.55 1.8  3.9 1 1 
       2346 1 . . . . .  5.1 1.8 5.61 1 1 
       2347 1 . . . . . 5.64 1.8  6.2 1 1 
       2348 1 . . . . . 4.78 1.8 5.26 1 1 
       2349 1 . . . . . 4.17 1.8 4.59 1 1 
       2350 1 . . . . . 4.46 1.8 4.91 1 1 
       2351 1 . . . . . 3.64 1.8  4.0 1 1 
       2352 1 . . . . . 3.92 1.8 4.31 1 1 
       2353 1 . . . . . 3.77 1.8 4.15 1 1 
       2354 1 . . . . . 3.55 1.8  3.9 1 1 
       2355 1 . . . . . 5.43 1.8 5.97 1 1 
       2356 1 . . . . . 5.47 1.8 6.02 1 1 
       2357 1 . . . . . 4.61 1.8 5.07 1 1 
       2358 1 . . . . . 5.05 1.8 5.56 1 1 
       2359 1 . . . . . 5.04 1.8 5.54 1 1 
       2360 1 . . . . .  6.2 1.8 6.82 1 1 
       2361 1 . . . . . 4.83 1.8 5.31 1 1 
       2362 1 . . . . .  4.6 1.8 5.06 1 1 
       2363 1 . . . . . 4.27 1.8  4.7 1 1 
       2364 1 . . . . . 5.32 1.8 5.85 1 1 
       2365 1 . . . . . 4.59 1.8 5.05 1 1 
       2366 1 . . . . . 4.56 1.8 5.02 1 1 
       2367 1 . . . . .  3.4 1.8 3.74 1 1 
       2368 1 . . . . . 4.65 1.8 5.12 1 1 
       2369 1 . . . . . 3.71 1.8 4.08 1 1 
       2370 1 . . . . . 3.69 1.8 4.06 1 1 
       2371 1 . . . . . 5.32 1.8 5.85 1 1 
       2372 1 . . . . . 4.82 1.8  5.3 1 1 
       2373 1 . . . . . 5.47 1.8 6.02 1 1 
       2374 1 . . . . . 3.97 1.8 4.37 1 1 
       2375 1 . . . . . 4.35 1.8 4.79 1 1 
       2376 1 . . . . . 5.47 1.8 6.02 1 1 
       2377 1 . . . . . 5.39 1.8 5.93 1 1 
       2378 1 . . . . . 4.83 1.8 5.31 1 1 
       2379 1 . . . . . 5.41 1.8 5.95 1 1 
       2380 1 . . . . . 4.16 1.8 4.58 1 1 
       2381 1 . . . . . 3.55 1.8  3.9 1 1 
       2382 1 . . . . . 5.36 1.8  5.9 1 1 
       2383 1 . . . . . 5.84 1.8 6.42 1 1 
       2384 1 . . . . . 4.12 1.8 4.53 1 1 
       2385 1 . . . . .  6.2 1.8 6.82 1 1 
       2386 1 . . . . . 4.32 1.8 4.75 1 1 
       2387 1 . . . . . 4.66 1.8 5.13 1 1 
       2388 1 . . . . .  4.6 1.8 5.06 1 1 
       2389 1 . . . . . 4.99 1.8 5.49 1 1 
       2390 1 . . . . . 4.92 1.8 5.41 1 1 
       2391 1 . . . . . 5.04 1.8 5.54 1 1 
       2392 1 . . . . . 5.36 1.8  5.9 1 1 
       2393 1 . . . . . 4.29 1.8 4.72 1 1 
       2394 1 . . . . . 4.99 1.8 5.49 1 1 
       2395 1 . . . . . 5.81 1.8 6.39 1 1 
       2396 1 . . . . . 5.27 1.8  5.8 1 1 
       2397 1 . . . . . 5.56 1.8 6.12 1 1 
       2398 1 . . . . .  5.1 1.8 5.61 1 1 
       2399 1 . . . . . 6.14 1.8 6.75 1 1 
       2400 1 . . . . .  6.2 1.8 6.82 1 1 
       2401 1 . . . . . 5.42 1.8 5.96 1 1 
       2402 1 . . . . . 5.26 1.8 5.79 1 1 
       2403 1 . . . . . 6.02 1.8 6.62 1 1 
       2404 1 . . . . .  5.2 1.8 5.72 1 1 
       2405 1 . . . . . 4.99 1.8 5.49 1 1 
       2406 1 . . . . . 5.38 1.8 5.92 1 1 
       2407 1 . . . . . 4.06 1.8 4.47 1 1 
       2408 1 . . . . . 4.48 1.8 4.93 1 1 
       2409 1 . . . . . 4.34 1.8 4.77 1 1 
       2410 1 . . . . . 4.78 1.8 5.26 1 1 
       2411 1 . . . . . 5.71 1.8 6.28 1 1 
       2412 1 . . . . . 5.37 1.8 5.91 1 1 
       2413 1 . . . . . 5.09 1.8  5.6 1 1 
       2414 1 . . . . . 5.25 1.8 5.78 1 1 
       2415 1 . . . . . 3.25 1.8 3.58 1 1 
       2416 1 . . . . . 3.24 1.8 3.56 1 1 
       2417 1 . . . . . 4.52 1.8 4.97 1 1 
       2418 1 . . . . . 4.91 1.8  5.4 1 1 
       2419 1 . . . . . 4.97 1.8 5.47 1 1 
       2420 1 . . . . . 5.21 1.8 5.73 1 1 
       2421 1 . . . . . 5.21 1.8 5.73 1 1 
       2422 1 . . . . . 4.34 1.8 4.77 1 1 
       2423 1 . . . . . 4.24 1.8 4.66 1 1 
       2424 1 . . . . .  6.2 1.8 6.82 1 1 
       2425 1 . . . . . 5.16 1.8 5.68 1 1 
       2426 1 . . . . .  5.3 1.8 5.83 1 1 
       2427 1 . . . . .  5.5 1.8 6.05 1 1 
       2428 1 . . . . . 5.95 1.8 6.54 1 1 
       2429 1 . . . . .  6.2 1.8 6.82 1 1 
       2430 1 . . . . .  6.2 1.8 6.82 1 1 
       2431 1 . . . . .  6.2 1.8 6.82 1 1 
       2432 1 . . . . .  4.6 1.8 5.06 1 1 
       2433 1 . . . . .  4.4 1.8 4.84 1 1 
       2434 1 . . . . . 4.44 1.8 4.88 1 1 
       2435 1 . . . . . 4.82 1.8  5.3 1 1 
       2436 1 . . . . . 4.82 1.8  5.3 1 1 
       2437 1 . . . . . 5.17 1.8 5.69 1 1 
       2438 1 . . . . . 4.86 1.8 5.35 1 1 
       2439 1 . . . . . 5.31 1.8 5.84 1 1 
       2440 1 . . . . . 5.31 1.8 5.84 1 1 
       2441 1 . . . . . 5.84 1.8 6.42 1 1 
       2442 1 . . . . . 5.84 1.8 6.42 1 1 
       2443 1 . . . . . 5.19 1.8 5.71 1 1 
       2444 1 . . . . . 5.19 1.8 5.71 1 1 
       2445 1 . . . . . 4.54 1.8 4.99 1 1 
       2446 1 . . . . .  5.2 1.8 5.72 1 1 
       2447 1 . . . . . 4.84 1.8 5.32 1 1 
       2448 1 . . . . . 4.84 1.8 5.32 1 1 
       2449 1 . . . . . 4.56 1.8 5.02 1 1 
       2450 1 . . . . . 4.56 1.8 5.02 1 1 
       2451 1 . . . . . 4.74 1.8 5.21 1 1 
       2452 1 . . . . . 3.55 1.8  3.9 1 1 
       2453 1 . . . . . 4.93 1.8 5.42 1 1 
       2454 1 . . . . . 5.14 1.8 5.65 1 1 
       2455 1 . . . . . 5.14 1.8 5.65 1 1 
       2456 1 . . . . . 3.23 1.8 3.55 1 1 
       2457 1 . . . . . 3.72 1.8 4.09 1 1 
       2458 1 . . . . . 4.43 1.8 4.87 1 1 
       2459 1 . . . . . 4.63 1.8 5.09 1 1 
       2460 1 . . . . . 4.89 1.8 5.38 1 1 
       2461 1 . . . . . 4.79 1.8 5.27 1 1 
       2462 1 . . . . . 5.64 1.8  6.2 1 1 
       2463 1 . . . . . 5.54 1.8 6.09 1 1 
       2464 1 . . . . . 4.11 1.8 4.52 1 1 
       2465 1 . . . . . 4.52 1.8 4.97 1 1 
       2466 1 . . . . . 3.87 1.8 4.26 1 1 
       2467 1 . . . . . 3.75 1.8 4.13 1 1 
       2468 1 . . . . . 3.76 1.8 4.14 1 1 
       2469 1 . . . . . 4.93 1.8 5.42 1 1 
       2470 1 . . . . . 4.93 1.8 5.42 1 1 
       2471 1 . . . . . 3.82 1.8  4.2 1 1 
       2472 1 . . . . .  4.2 1.8 4.62 1 1 
       2473 1 . . . . .  4.3 1.8 4.73 1 1 
       2474 1 . . . . . 4.07 1.8 4.48 1 1 
       2475 1 . . . . .  4.3 1.8 4.73 1 1 
       2476 1 . . . . . 4.87 1.8 5.36 1 1 
       2477 1 . . . . . 5.11 1.8 5.62 1 1 
       2478 1 . . . . . 4.88 1.8 5.37 1 1 
       2479 1 . . . . .  4.9 1.8 5.39 1 1 
       2480 1 . . . . . 4.49 1.8 4.94 1 1 
       2481 1 . . . . . 4.07 1.8 4.48 1 1 
       2482 1 . . . . . 5.62 1.8 6.18 1 1 
       2483 1 . . . . . 5.79 1.8 6.37 1 1 
       2484 1 . . . . . 5.98 1.8 6.58 1 1 
       2485 1 . . . . .  6.2 1.8 6.82 1 1 
       2486 1 . . . . . 5.12 1.8 5.63 1 1 
       2487 1 . . . . . 4.61 1.8 5.07 1 1 
       2488 1 . . . . . 3.19 1.8 3.51 1 1 
       2489 1 . . . . . 4.17 1.8 4.59 1 1 
       2490 1 . . . . . 4.16 1.8 4.58 1 1 
       2491 1 . . . . . 3.61 1.8 3.97 1 1 
       2492 1 . . . . . 5.55 1.8 6.11 1 1 
       2493 1 . . . . . 3.93 1.8 4.32 1 1 
       2494 1 . . . . . 4.04 1.8 4.44 1 1 
       2495 1 . . . . . 5.68 1.8 6.25 1 1 
       2496 1 . . . . . 4.17 1.8 4.59 1 1 
       2497 1 . . . . . 4.19 1.8 4.61 1 1 
       2498 1 . . . . . 4.82 1.8  5.3 1 1 
       2499 1 . . . . .  4.7 1.8 5.17 1 1 
       2500 1 . . . . . 5.06 1.8 5.57 1 1 
       2501 1 . . . . . 4.49 1.8 4.94 1 1 
       2502 1 . . . . .  5.5 1.8 6.05 1 1 
       2503 1 . . . . .  6.2 1.8 6.82 1 1 
       2504 1 . . . . . 6.06 1.8 6.67 1 1 
       2505 1 . . . . . 5.05 1.8 5.56 1 1 
       2506 1 . . . . . 4.23 1.8 4.65 1 1 
       2507 1 . . . . . 4.67 1.8 5.14 1 1 
       2508 1 . . . . . 4.58 1.8 5.04 1 1 
       2509 1 . . . . . 3.23 1.8 3.55 1 1 
       2510 1 . . . . . 3.87 1.8 4.26 1 1 
       2511 1 . . . . . 3.98 1.8 4.38 1 1 
       2512 1 . . . . . 4.55 1.8 5.01 1 1 
       2513 1 . . . . . 5.17 1.8 5.69 1 1 
       2514 1 . . . . . 3.81 1.8 4.19 1 1 
       2515 1 . . . . . 5.66 1.8 6.23 1 1 
       2516 1 . . . . . 5.49 1.8 6.04 1 1 
       2517 1 . . . . . 5.33 1.8 5.86 1 1 
       2518 1 . . . . . 4.31 1.8 4.74 1 1 
       2519 1 . . . . . 4.24 1.8 4.66 1 1 
       2520 1 . . . . . 4.24 1.8 4.66 1 1 
       2521 1 . . . . . 3.72 1.8 4.09 1 1 
       2522 1 . . . . . 4.46 1.8 4.91 1 1 
       2523 1 . . . . . 4.85 1.8 5.33 1 1 
       2524 1 . . . . . 5.51 1.8 6.06 1 1 
       2525 1 . . . . . 4.82 1.8  5.3 1 1 
       2526 1 . . . . . 4.14 1.8 4.55 1 1 
       2527 1 . . . . . 4.09 1.8  4.5 1 1 
       2528 1 . . . . . 4.23 1.8 4.65 1 1 
       2529 1 . . . . . 5.37 1.8 5.91 1 1 
       2530 1 . . . . . 4.78 1.8 5.26 1 1 
       2531 1 . . . . . 5.14 1.8 5.65 1 1 
       2532 1 . . . . .  4.8 1.8 5.28 1 1 
       2533 1 . . . . . 4.72 1.8 5.19 1 1 
       2534 1 . . . . . 5.45 1.8  6.0 1 1 
       2535 1 . . . . .  5.8 1.8 6.38 1 1 
       2536 1 . . . . . 5.99 1.8 6.59 1 1 
       2537 1 . . . . .  6.2 1.8 6.82 1 1 
       2538 1 . . . . .  6.2 1.8 6.82 1 1 
       2539 1 . . . . .  6.2 1.8 6.82 1 1 
       2540 1 . . . . . 4.42 1.8 4.86 1 1 
       2541 1 . . . . . 4.34 1.8 4.77 1 1 
       2542 1 . . . . . 4.03 1.8 4.43 1 1 
       2543 1 . . . . . 4.31 1.8 4.74 1 1 
       2544 1 . . . . . 3.87 1.8 4.26 1 1 
       2545 1 . . . . . 4.83 1.8 5.31 1 1 
       2546 1 . . . . . 5.03 1.8 5.53 1 1 
       2547 1 . . . . . 3.96 1.8 4.36 1 1 
       2548 1 . . . . . 5.03 1.8 5.53 1 1 
       2549 1 . . . . . 5.26 1.8 5.79 1 1 
       2550 1 . . . . . 5.24 1.8 5.76 1 1 
       2551 1 . . . . .  5.3 1.8 5.83 1 1 
       2552 1 . . . . . 5.64 1.8  6.2 1 1 
       2553 1 . . . . . 4.77 1.8 5.25 1 1 
       2554 1 . . . . .  6.2 1.8 6.82 1 1 
       2555 1 . . . . .  6.2 1.8 6.82 1 1 
       2556 1 . . . . . 4.94 1.8 5.43 1 1 
       2557 1 . . . . .  6.2 1.8 6.82 1 1 
       2558 1 . . . . .  6.2 1.8 6.82 1 1 
       2559 1 . . . . . 3.96 1.8 4.36 1 1 
       2560 1 . . . . . 5.93 1.8 6.52 1 1 
       2561 1 . . . . . 4.55 1.8 5.01 1 1 
       2562 1 . . . . . 3.89 1.8 4.28 1 1 
       2563 1 . . . . . 4.29 1.8 4.72 1 1 
       2564 1 . . . . . 3.73 1.8  4.1 1 1 
       2565 1 . . . . . 4.55 1.8 5.01 1 1 
       2566 1 . . . . . 4.09 1.8  4.5 1 1 
       2567 1 . . . . . 4.84 1.8 5.32 1 1 
       2568 1 . . . . .  4.4 1.8 4.84 1 1 
       2569 1 . . . . . 5.12 1.8 5.63 1 1 
       2570 1 . . . . .  6.2 1.8 6.82 1 1 
       2571 1 . . . . . 4.55 1.8 5.01 1 1 
       2572 1 . . . . . 3.52 1.8 3.87 1 1 
       2573 1 . . . . . 4.62 1.8 5.08 1 1 
       2574 1 . . . . . 4.99 1.8 5.49 1 1 
       2575 1 . . . . . 4.93 1.8 5.42 1 1 
       2576 1 . . . . . 4.87 1.8 5.36 1 1 
       2577 1 . . . . . 5.39 1.8 5.93 1 1 
       2578 1 . . . . . 6.07 1.8 6.68 1 1 
       2579 1 . . . . . 5.33 1.8 5.86 1 1 
       2580 1 . . . . .  6.2 1.8 6.82 1 1 
       2581 1 . . . . .  6.2 1.8 6.82 1 1 
       2582 1 . . . . . 5.07 1.8 5.58 1 1 
       2583 1 . . . . . 5.63 1.8 6.19 1 1 
       2584 1 . . . . . 5.75 1.8 6.32 1 1 
       2585 1 . . . . . 4.33 1.8 4.76 1 1 
       2586 1 . . . . . 4.31 1.8 4.74 1 1 
       2587 1 . . . . . 4.85 1.8 5.33 1 1 
       2588 1 . . . . . 5.13 1.8 5.64 1 1 
       2589 1 . . . . . 4.61 1.8 5.07 1 1 
       2590 1 . . . . . 4.35 1.8 4.79 1 1 
       2591 1 . . . . . 4.22 1.8 4.64 1 1 
       2592 1 . . . . . 3.99 1.8 4.39 1 1 
       2593 1 . . . . . 4.06 1.8 4.47 1 1 
       2594 1 . . . . . 5.26 1.8 5.79 1 1 
       2595 1 . . . . . 5.06 1.8 5.57 1 1 
       2596 1 . . . . . 4.82 1.8  5.3 1 1 
       2597 1 . . . . . 4.61 1.8 5.07 1 1 
       2598 1 . . . . .  6.2 1.8 6.82 1 1 
       2599 1 . . . . . 5.27 1.8  5.8 1 1 
       2600 1 . . . . .  5.7 1.8 6.27 1 1 
       2601 1 . . . . .  6.2 1.8 6.82 1 1 
       2602 1 . . . . . 4.22 1.8 4.64 1 1 
       2603 1 . . . . . 4.72 1.8 5.19 1 1 
       2604 1 . . . . . 5.48 1.8 6.03 1 1 
       2605 1 . . . . . 4.06 1.8 4.47 1 1 
       2606 1 . . . . . 5.23 1.8 5.75 1 1 
       2607 1 . . . . . 4.95 1.8 5.44 1 1 
       2608 1 . . . . . 4.53 1.8 4.98 1 1 
       2609 1 . . . . . 4.76 1.8 5.24 1 1 
       2610 1 . . . . . 4.07 1.8 4.48 1 1 
       2611 1 . . . . . 4.73 1.8  5.2 1 1 
       2612 1 . . . . . 5.12 1.8 5.63 1 1 
       2613 1 . . . . . 3.04 1.8 3.34 1 1 
       2614 1 . . . . . 5.38 1.8 5.92 1 1 
       2615 1 . . . . . 3.29 1.8 3.62 1 1 
       2616 1 . . . . .  4.3 1.8 4.73 1 1 
       2617 1 . . . . . 2.99 1.8 3.29 1 1 
       2618 1 . . . . . 3.21 1.8 3.53 1 1 
       2619 1 . . . . . 5.19 1.8 5.71 1 1 
       2620 1 . . . . . 5.16 1.8 5.68 1 1 
       2621 1 . . . . . 3.78 1.8 4.16 1 1 
       2622 1 . . . . . 5.27 1.8  5.8 1 1 
       2623 1 . . . . . 5.11 1.8 5.62 1 1 
       2624 1 . . . . . 3.07 1.8 3.38 1 1 
       2625 1 . . . . . 3.66 1.8 4.03 1 1 
       2626 1 . . . . .  2.9 1.8 3.19 1 1 
       2627 1 . . . . . 3.63 1.8 3.99 1 1 
       2628 1 . . . . . 4.53 1.8 4.98 1 1 
       2629 1 . . . . . 3.47 1.8 3.82 1 1 
       2630 1 . . . . .  3.9 1.8 4.29 1 1 
       2631 1 . . . . . 4.84 1.8 5.32 1 1 
       2632 1 . . . . . 5.79 1.8 6.37 1 1 
       2633 1 . . . . . 5.08 1.8 5.59 1 1 
       2634 1 . . . . . 5.19 1.8 5.71 1 1 
       2635 1 . . . . . 4.82 1.8  5.3 1 1 
       2636 1 . . . . . 5.44 1.8 5.98 1 1 
       2637 1 . . . . . 5.81 1.8 6.39 1 1 
       2638 1 . . . . . 4.77 1.8 5.25 1 1 
       2639 1 . . . . . 5.33 1.8 5.86 1 1 
       2640 1 . . . . .  5.6 1.8 6.16 1 1 
       2641 1 . . . . . 5.03 1.8 5.53 1 1 
       2642 1 . . . . . 3.82 1.8  4.2 1 1 
       2643 1 . . . . . 4.84 1.8 5.32 1 1 
       2644 1 . . . . . 5.51 1.8 6.06 1 1 
       2645 1 . . . . . 5.52 1.8 6.07 1 1 
       2646 1 . . . . . 4.62 1.8 5.08 1 1 
       2647 1 . . . . . 5.05 1.8 5.56 1 1 
       2648 1 . . . . . 4.59 1.8 5.05 1 1 
       2649 1 . . . . . 4.97 1.8 5.47 1 1 
       2650 1 . . . . . 5.16 1.8 5.68 1 1 
       2651 1 . . . . . 5.27 1.8  5.8 1 1 
       2652 1 . . . . .  4.7 1.8 5.17 1 1 
       2653 1 . . . . . 4.85 1.8 5.33 1 1 
       2654 1 . . . . . 4.53 1.8 4.98 1 1 
       2655 1 . . . . . 4.63 1.8 5.09 1 1 
       2656 1 . . . . . 3.75 1.8 4.13 1 1 
       2657 1 . . . . . 3.96 1.8 4.36 1 1 
       2658 1 . . . . . 4.58 1.8 5.04 1 1 
       2659 1 . . . . . 3.87 1.8 4.26 1 1 
       2660 1 . . . . .  5.5 1.8 6.05 1 1 
       2661 1 . . . . . 4.94 1.8 5.43 1 1 
       2662 1 . . . . . 5.12 1.8 5.63 1 1 
       2663 1 . . . . . 5.12 1.8 5.63 1 1 
       2664 1 . . . . . 5.28 1.8 5.81 1 1 
       2665 1 . . . . . 4.48 1.8 4.93 1 1 
       2666 1 . . . . . 4.48 1.8 4.93 1 1 
       2667 1 . . . . . 5.55 1.8 6.11 1 1 
       2668 1 . . . . .  6.2 1.8 6.82 1 1 
       2669 1 . . . . . 4.52 1.8 4.97 1 1 
       2670 1 . . . . . 4.88 1.8 5.37 1 1 
       2671 1 . . . . . 4.69 1.8 5.16 1 1 
       2672 1 . . . . . 4.95 1.8 5.44 1 1 
       2673 1 . . . . . 5.56 1.8 6.12 1 1 
       2674 1 . . . . . 4.84 1.8 5.32 1 1 
       2675 1 . . . . . 4.65 1.8 5.12 1 1 
       2676 1 . . . . .  3.8 1.8 4.18 1 1 
       2677 1 . . . . . 5.29 1.8 5.82 1 1 
       2678 1 . . . . . 4.66 1.8 5.13 1 1 
       2679 1 . . . . . 5.11 1.8 5.62 1 1 
       2680 1 . . . . . 5.69 1.8 6.26 1 1 
       2681 1 . . . . . 5.69 1.8 6.26 1 1 
       2682 1 . . . . . 6.09 1.8  6.7 1 1 
       2683 1 . . . . .  6.2 1.8 6.82 1 1 
       2684 1 . . . . .  6.2 1.8 6.82 1 1 
       2685 1 . . . . . 4.35 1.8 4.79 1 1 
       2686 1 . . . . . 5.15 1.8 5.67 1 1 
       2687 1 . . . . . 5.18 1.8  5.7 1 1 
       2688 1 . . . . . 5.79 1.8 6.37 1 1 
       2689 1 . . . . . 5.68 1.8 6.25 1 1 
       2690 1 . . . . . 5.98 1.8 6.58 1 1 
       2691 1 . . . . . 4.93 1.8 5.42 1 1 
       2692 1 . . . . . 5.11 1.8 5.62 1 1 
       2693 1 . . . . .  4.3 1.8 4.73 1 1 
       2694 1 . . . . . 5.23 1.8 5.75 1 1 
       2695 1 . . . . . 4.48 1.8 4.93 1 1 
       2696 1 . . . . . 4.62 1.8 5.08 1 1 
       2697 1 . . . . . 5.87 1.8 6.46 1 1 
       2698 1 . . . . . 4.79 1.8 5.27 1 1 
       2699 1 . . . . . 4.28 1.8 4.71 1 1 
       2700 1 . . . . . 4.26 1.8 4.69 1 1 
       2701 1 . . . . .  5.5 1.8 6.05 1 1 
       2702 1 . . . . . 6.01 1.8 6.61 1 1 
       2703 1 . . . . . 3.98 1.8 4.38 1 1 
       2704 1 . . . . . 4.13 1.8 4.54 1 1 
       2705 1 . . . . . 4.56 1.8 5.02 1 1 
       2706 1 . . . . . 5.52 1.8 6.07 1 1 
       2707 1 . . . . . 4.67 1.8 5.14 1 1 
       2708 1 . . . . . 4.62 1.8 5.08 1 1 
       2709 1 . . . . .  5.0 1.8  5.5 1 1 
       2710 1 . . . . . 5.04 1.8 5.54 1 1 
       2711 1 . . . . . 4.96 1.8 5.46 1 1 
       2712 1 . . . . . 5.25 1.8 5.78 1 1 
       2713 1 . . . . . 3.69 1.8 4.06 1 1 
       2714 1 . . . . . 4.69 1.8 5.16 1 1 
       2715 1 . . . . . 4.75 1.8 5.22 1 1 
       2716 1 . . . . . 5.21 1.8 5.73 1 1 
       2717 1 . . . . . 4.17 1.8 4.59 1 1 
       2718 1 . . . . . 5.26 1.8 5.79 1 1 
       2719 1 . . . . . 5.71 1.8 6.28 1 1 
       2720 1 . . . . . 4.86 1.8 5.35 1 1 
       2721 1 . . . . . 5.01 1.8 5.51 1 1 
       2722 1 . . . . .  4.5 1.8 4.95 1 1 
       2723 1 . . . . . 5.21 1.8 5.73 1 1 
       2724 1 . . . . .  4.1 1.8 4.51 1 1 
       2725 1 . . . . . 4.32 1.8 4.75 1 1 
       2726 1 . . . . . 4.63 1.8 5.09 1 1 
       2727 1 . . . . . 4.57 1.8 5.03 1 1 
       2728 1 . . . . . 4.13 1.8 4.54 1 1 
       2729 1 . . . . . 3.73 1.8  4.1 1 1 
       2730 1 . . . . .  6.2 1.8 6.82 1 1 
       2731 1 . . . . . 4.03 1.8 4.43 1 1 
       2732 1 . . . . . 4.21 1.8 4.63 1 1 
       2733 1 . . . . . 4.68 1.8 5.15 1 1 
       2734 1 . . . . .  4.7 1.8 5.17 1 1 
       2735 1 . . . . .  3.6 1.8 3.96 1 1 
       2736 1 . . . . . 3.22 1.8 3.54 1 1 
       2737 1 . . . . . 4.87 1.8 5.36 1 1 
       2738 1 . . . . . 5.73 1.8  6.3 1 1 
       2739 1 . . . . . 4.09 1.8  4.5 1 1 
       2740 1 . . . . . 5.07 1.8 5.58 1 1 
       2741 1 . . . . . 5.25 1.8 5.78 1 1 
       2742 1 . . . . . 3.99 1.8 4.39 1 1 
       2743 1 . . . . . 4.56 1.8 5.02 1 1 
       2744 1 . . . . .  4.5 1.8 4.95 1 1 
       2745 1 . . . . .  3.7 1.8 4.07 1 1 
       2746 1 . . . . .  3.2 1.8 3.52 1 1 
       2747 1 . . . . . 3.22 1.8 3.54 1 1 
       2748 1 . . . . . 4.26 1.8 4.69 1 1 
       2749 1 . . . . .  3.4 1.8 3.74 1 1 
       2750 1 . . . . . 3.86 1.8 4.25 1 1 
       2751 1 . . . . . 4.14 1.8 4.55 1 1 
       2752 1 . . . . . 4.71 1.8 5.18 1 1 
       2753 1 . . . . . 4.15 1.8 4.57 1 1 
       2754 1 . . . . . 4.53 1.8 4.98 1 1 
       2755 1 . . . . . 4.84 1.8 5.32 1 1 
       2756 1 . . . . .  5.0 1.8  5.5 1 1 
       2757 1 . . . . . 4.73 1.8  5.2 1 1 
       2758 1 . . . . .  4.4 1.8 4.84 1 1 
       2759 1 . . . . . 4.36 1.8  4.8 1 1 
       2760 1 . . . . . 4.12 1.8 4.53 1 1 
       2761 1 . . . . . 5.42 1.8 5.96 1 1 
       2762 1 . . . . . 4.55 1.8 5.01 1 1 
       2763 1 . . . . . 4.31 1.8 4.74 1 1 
       2764 1 . . . . . 5.39 1.8 5.93 1 1 
       2765 1 . . . . . 5.45 1.8  6.0 1 1 
       2766 1 . . . . . 5.59 1.8 6.15 1 1 
       2767 1 . . . . . 5.01 1.8 5.51 1 1 
       2768 1 . . . . . 4.36 1.8  4.8 1 1 
       2769 1 . . . . . 4.66 1.8 5.13 1 1 
       2770 1 . . . . . 4.54 1.8 4.99 1 1 
       2771 1 . . . . . 4.81 1.8 5.29 1 1 
       2772 1 . . . . .  6.2 1.8 6.82 1 1 
       2773 1 . . . . .  4.1 1.8 4.51 1 1 
       2774 1 . . . . . 4.43 1.8 4.87 1 1 
       2775 1 . . . . . 4.18 1.8  4.6 1 1 
       2776 1 . . . . . 3.59 1.8 3.95 1 1 
       2777 1 . . . . . 4.56 1.8 5.02 1 1 
       2778 1 . . . . . 5.33 1.8 5.86 1 1 
       2779 1 . . . . . 4.96 1.8 5.46 1 1 
       2780 1 . . . . .  6.0 1.8  6.6 1 1 
       2781 1 . . . . . 5.28 1.8 5.81 1 1 
       2782 1 . . . . . 3.69 1.8 4.06 1 1 
       2783 1 . . . . . 4.55 1.8 5.01 1 1 
       2784 1 . . . . . 3.43 1.8 3.77 1 1 
       2785 1 . . . . . 3.31 1.8 3.64 1 1 
       2786 1 . . . . . 5.04 1.8 5.54 1 1 
       2787 1 . . . . .  4.6 1.8 5.06 1 1 
       2788 1 . . . . . 5.02 1.8 5.52 1 1 
       2789 1 . . . . . 5.55 1.8 6.11 1 1 
       2790 1 . . . . . 4.46 1.8 4.91 1 1 
       2791 1 . . . . . 3.97 1.8 4.37 1 1 
       2792 1 . . . . . 3.69 1.8 4.06 1 1 
       2793 1 . . . . . 4.13 1.8 4.54 1 1 
       2794 1 . . . . . 4.13 1.8 4.54 1 1 
       2795 1 . . . . . 5.12 1.8 5.63 1 1 
       2796 1 . . . . . 5.88 1.8 6.47 1 1 
       2797 1 . . . . . 3.98 1.8 4.38 1 1 
       2798 1 . . . . . 3.52 1.8 3.87 1 1 
       2799 1 . . . . .  6.2 1.8 6.82 1 1 
       2800 1 . . . . .  5.2 1.8 5.72 1 1 
       2801 1 . . . . . 5.54 1.8 6.09 1 1 
       2802 1 . . . . . 5.26 1.8 5.79 1 1 
       2803 1 . . . . . 5.49 1.8 6.04 1 1 
       2804 1 . . . . . 5.92 1.8 6.51 1 1 
       2805 1 . . . . . 4.55 1.8 5.01 1 1 
       2806 1 . . . . . 6.05 1.8 6.66 1 1 
       2807 1 . . . . . 3.58 1.8 3.94 1 1 
       2808 1 . . . . . 5.28 1.8 5.81 1 1 
       2809 1 . . . . . 4.94 1.8 5.43 1 1 
       2810 1 . . . . . 5.38 1.8 5.92 1 1 
       2811 1 . . . . . 3.89 1.8 4.28 1 1 
       2812 1 . . . . . 4.34 1.8 4.77 1 1 
       2813 1 . . . . . 4.09 1.8  4.5 1 1 
       2814 1 . . . . . 5.28 1.8 5.81 1 1 
       2815 1 . . . . . 5.34 1.8 5.87 1 1 
       2816 1 . . . . . 3.38 1.8 3.72 1 1 
       2817 1 . . . . . 5.31 1.8 5.84 1 1 
       2818 1 . . . . . 5.04 1.8 5.54 1 1 
       2819 1 . . . . . 4.09 1.8  4.5 1 1 
       2820 1 . . . . . 3.63 1.8 3.99 1 1 
       2821 1 . . . . . 3.85 1.8 4.23 1 1 
       2822 1 . . . . . 4.84 1.8 5.32 1 1 
       2823 1 . . . . . 4.68 1.8 5.15 1 1 
       2824 1 . . . . . 5.16 1.8 5.68 1 1 
       2825 1 . . . . . 5.16 1.8 5.68 1 1 
       2826 1 . . . . . 3.91 1.8  4.3 1 1 
       2827 1 . . . . . 4.27 1.8  4.7 1 1 
       2828 1 . . . . .  3.8 1.8 4.18 1 1 
       2829 1 . . . . . 3.91 1.8  4.3 1 1 
       2830 1 . . . . . 5.36 1.8  5.9 1 1 
       2831 1 . . . . . 4.37 1.8 4.81 1 1 
       2832 1 . . . . . 3.47 1.8 3.82 1 1 
       2833 1 . . . . . 3.36 1.8  3.7 1 1 
       2834 1 . . . . . 4.03 1.8 4.43 1 1 
       2835 1 . . . . . 5.33 1.8 5.86 1 1 
       2836 1 . . . . . 3.83 1.8 4.21 1 1 
       2837 1 . . . . . 4.51 1.8 4.96 1 1 
       2838 1 . . . . . 5.92 1.8 6.51 1 1 
       2839 1 . . . . . 5.92 1.8 6.51 1 1 
       2840 1 . . . . . 4.95 1.8 5.44 1 1 
       2841 1 . . . . . 4.03 1.8 4.43 1 1 
       2842 1 . . . . . 3.89 1.8 4.28 1 1 
       2843 1 . . . . . 4.39 1.8 4.83 1 1 
       2844 1 . . . . .  6.2 1.8 6.82 1 1 
       2845 1 . . . . . 6.07 1.8 6.68 1 1 
       2846 1 . . . . . 4.72 1.8 5.19 1 1 
       2847 1 . . . . . 4.39 1.8 4.83 1 1 
       2848 1 . . . . . 4.98 1.8 5.48 1 1 
       2849 1 . . . . . 4.99 1.8 5.49 1 1 
       2850 1 . . . . . 4.93 1.8 5.42 1 1 
       2851 1 . . . . . 4.91 1.8  5.4 1 1 
       2852 1 . . . . . 5.39 1.8 5.93 1 1 
       2853 1 . . . . . 4.53 1.8 4.98 1 1 
       2854 1 . . . . . 5.46 1.8 6.01 1 1 
       2855 1 . . . . . 4.73 1.8  5.2 1 1 
       2856 1 . . . . . 5.08 1.8 5.59 1 1 
       2857 1 . . . . . 4.93 1.8 5.42 1 1 
       2858 1 . . . . . 5.45 1.8  6.0 1 1 
       2859 1 . . . . . 4.56 1.8 5.02 1 1 
       2860 1 . . . . . 4.14 1.8 4.55 1 1 
       2861 1 . . . . . 5.32 1.8 5.85 1 1 
       2862 1 . . . . . 5.41 1.8 5.95 1 1 
       2863 1 . . . . . 4.98 1.8 5.48 1 1 
       2864 1 . . . . . 4.53 1.8 4.98 1 1 
       2865 1 . . . . . 3.67 1.8 4.04 1 1 
       2866 1 . . . . . 4.78 1.8 5.26 1 1 
       2867 1 . . . . . 4.78 1.8 5.26 1 1 
       2868 1 . . . . . 4.35 1.8 4.79 1 1 
       2869 1 . . . . . 5.23 1.8 5.75 1 1 
       2870 1 . . . . . 5.23 1.8 5.75 1 1 
       2871 1 . . . . . 4.43 1.8 4.87 1 1 
       2872 1 . . . . . 4.34 1.8 4.77 1 1 
       2873 1 . . . . . 5.96 1.8 6.56 1 1 
       2874 1 . . . . .  6.2 1.8 6.82 1 1 
       2875 1 . . . . . 3.62 1.8 3.98 1 1 
       2876 1 . . . . . 4.28 1.8 4.71 1 1 
       2877 1 . . . . . 4.68 1.8 5.15 1 1 
       2878 1 . . . . . 3.68 1.8 4.05 1 1 
       2879 1 . . . . . 4.35 1.8 4.79 1 1 
       2880 1 . . . . . 4.08 1.8 4.49 1 1 
       2881 1 . . . . . 5.48 1.8 6.03 1 1 
       2882 1 . . . . . 3.81 1.8 4.19 1 1 
       2883 1 . . . . . 4.43 1.8 4.87 1 1 
       2884 1 . . . . . 5.01 1.8 5.51 1 1 
       2885 1 . . . . . 5.03 1.8 5.53 1 1 
       2886 1 . . . . . 5.87 1.8 6.46 1 1 
       2887 1 . . . . . 3.68 1.8 4.05 1 1 
       2888 1 . . . . . 3.95 1.8 4.35 1 1 
       2889 1 . . . . . 4.45 1.8 4.89 1 1 
       2890 1 . . . . . 5.49 1.8 6.04 1 1 
       2891 1 . . . . . 4.25 1.8 4.68 1 1 
       2892 1 . . . . . 5.65 1.8 6.21 1 1 
       2893 1 . . . . . 4.53 1.8 4.98 1 1 
       2894 1 . . . . . 5.47 1.8 6.02 1 1 
       2895 1 . . . . .  5.4 1.8 5.94 1 1 
       2896 1 . . . . . 4.75 1.8 5.22 1 1 
       2897 1 . . . . . 5.44 1.8 5.98 1 1 
       2898 1 . . . . .  4.1 1.8 4.51 1 1 
       2899 1 . . . . . 4.45 1.8 4.89 1 1 
       2900 1 . . . . . 5.12 1.8 5.63 1 1 
       2901 1 . . . . . 4.23 1.8 4.65 1 1 
       2902 1 . . . . . 3.99 1.8 4.39 1 1 
       2903 1 . . . . . 5.13 1.8 5.64 1 1 
       2904 1 . . . . . 5.74 1.8 6.31 1 1 
       2905 1 . . . . . 5.85 1.8 6.43 1 1 
       2906 1 . . . . . 6.13 1.8 6.74 1 1 
       2907 1 . . . . . 4.95 1.8 5.44 1 1 
       2908 1 . . . . .  6.2 1.8 6.82 1 1 
       2909 1 . . . . .  5.1 1.8 5.61 1 1 
       2910 1 . . . . . 5.08 1.8 5.59 1 1 
       2911 1 . . . . . 5.08 1.8 5.59 1 1 
       2912 1 . . . . . 3.46 1.8 3.81 1 1 
       2913 1 . . . . . 4.93 1.8 5.42 1 1 
       2914 1 . . . . . 6.09 1.8  6.7 1 1 
       2915 1 . . . . .  6.2 1.8 6.82 1 1 
       2916 1 . . . . . 4.38 1.8 4.82 1 1 
       2917 1 . . . . . 3.66 1.8 4.03 1 1 
       2918 1 . . . . . 4.95 1.8 5.44 1 1 
       2919 1 . . . . . 4.25 1.8 4.68 1 1 
       2920 1 . . . . . 4.01 1.8 4.41 1 1 
       2921 1 . . . . . 5.62 1.8 6.18 1 1 
       2922 1 . . . . .  5.1 1.8 5.61 1 1 
       2923 1 . . . . . 4.98 1.8 5.48 1 1 
       2924 1 . . . . . 4.76 1.8 5.24 1 1 
       2925 1 . . . . . 4.66 1.8 5.13 1 1 
       2926 1 . . . . . 5.44 1.8 5.98 1 1 
       2927 1 . . . . .  5.8 1.8 6.38 1 1 
       2928 1 . . . . .  5.5 1.8 6.05 1 1 
       2929 1 . . . . .  5.8 1.8 6.38 1 1 
       2930 1 . . . . .  5.5 1.8 6.05 1 1 
       2931 1 . . . . . 5.19 1.8 5.71 1 1 
       2932 1 . . . . . 4.72 1.8 5.19 1 1 
       2933 1 . . . . . 4.56 1.8 5.02 1 1 
       2934 1 . . . . . 4.73 1.8  5.2 1 1 
       2935 1 . . . . . 5.29 1.8 5.82 1 1 
       2936 1 . . . . . 5.29 1.8 5.82 1 1 
       2937 1 . . . . . 3.56 1.8 3.92 1 1 
       2938 1 . . . . .  5.1 1.8 5.61 1 1 
       2939 1 . . . . . 3.56 1.8 3.92 1 1 
       2940 1 . . . . . 5.37 1.8 5.91 1 1 
       2941 1 . . . . . 5.31 1.8 5.84 1 1 
       2942 1 . . . . . 5.77 1.8 6.35 1 1 
       2943 1 . . . . . 4.52 1.8 4.97 1 1 
       2944 1 . . . . . 4.42 1.8 4.86 1 1 
       2945 1 . . . . . 4.92 1.8 5.41 1 1 
       2946 1 . . . . . 5.78 1.8 6.36 1 1 
       2947 1 . . . . . 5.98 1.8 6.58 1 1 
       2948 1 . . . . . 4.94 1.8 5.43 1 1 
       2949 1 . . . . . 4.47 1.8 4.92 1 1 
       2950 1 . . . . . 4.24 1.8 4.66 1 1 
       2951 1 . . . . . 4.96 1.8 5.46 1 1 
       2952 1 . . . . . 4.02 1.8 4.42 1 1 
       2953 1 . . . . . 4.34 1.8 4.77 1 1 
       2954 1 . . . . . 5.13 1.8 5.64 1 1 
       2955 1 . . . . . 4.17 1.8 4.59 1 1 
       2956 1 . . . . . 4.66 1.8 5.13 1 1 
       2957 1 . . . . . 4.52 1.8 4.97 1 1 
       2958 1 . . . . . 3.75 1.8 4.13 1 1 
       2959 1 . . . . . 3.54 1.8 3.89 1 1 
       2960 1 . . . . . 4.09 1.8  4.5 1 1 
       2961 1 . . . . . 5.05 1.8 5.56 1 1 
       2962 1 . . . . . 5.17 1.8 5.69 1 1 
       2963 1 . . . . . 4.88 1.8 5.37 1 1 
       2964 1 . . . . . 5.52 1.8 6.07 1 1 
       2965 1 . . . . . 5.91 1.8  6.5 1 1 
       2966 1 . . . . .  5.4 1.8 5.94 1 1 
       2967 1 . . . . . 5.59 1.8 6.15 1 1 
       2968 1 . . . . . 4.11 1.8 4.52 1 1 
       2969 1 . . . . . 5.33 1.8 5.86 1 1 
       2970 1 . . . . . 3.14 1.8 3.45 1 1 
       2971 1 . . . . . 4.04 1.8 4.44 1 1 
       2972 1 . . . . . 4.63 1.8 5.09 1 1 
       2973 1 . . . . . 5.92 1.8 6.51 1 1 
       2974 1 . . . . .  6.2 1.8 6.82 1 1 
       2975 1 . . . . . 4.91 1.8  5.4 1 1 
       2976 1 . . . . . 4.37 1.8 4.81 1 1 
       2977 1 . . . . . 4.94 1.8 5.43 1 1 
       2978 1 . . . . .  5.0 1.8  5.5 1 1 
       2979 1 . . . . .  5.0 1.8  5.5 1 1 
       2980 1 . . . . . 5.34 1.8 5.87 1 1 
       2981 1 . . . . . 5.12 1.8 5.63 1 1 
       2982 1 . . . . . 5.12 1.8 5.63 1 1 
       2983 1 . . . . . 5.04 1.8 5.54 1 1 
       2984 1 . . . . . 5.09 1.8  5.6 1 1 
       2985 1 . . . . . 4.48 1.8 4.93 1 1 
       2986 1 . . . . . 4.87 1.8 5.36 1 1 
       2987 1 . . . . . 4.49 1.8 4.94 1 1 
       2988 1 . . . . . 4.39 1.8 4.83 1 1 
       2989 1 . . . . . 4.02 1.8 4.42 1 1 
       2990 1 . . . . .  3.9 1.8 4.29 1 1 
       2991 1 . . . . .  4.4 1.8 4.84 1 1 
       2992 1 . . . . . 4.44 1.8 4.88 1 1 
       2993 1 . . . . .  4.6 1.8 5.06 1 1 
       2994 1 . . . . .  4.9 1.8 5.39 1 1 
       2995 1 . . . . . 5.64 1.8  6.2 1 1 
       2996 1 . . . . . 4.93 1.8 5.42 1 1 
       2997 1 . . . . .  4.2 1.8 4.62 1 1 
       2998 1 . . . . . 4.61 1.8 5.07 1 1 
       2999 1 . . . . . 4.87 1.8 5.36 1 1 
       3000 1 . . . . .  5.2 1.8 5.72 1 1 
       3001 1 . . . . . 5.32 1.8 5.85 1 1 
       3002 1 . . . . . 5.31 1.8 5.84 1 1 
       3003 1 . . . . . 3.87 1.8 4.26 1 1 
       3004 1 . . . . .  5.1 1.8 5.61 1 1 
       3005 1 . . . . . 4.09 1.8  4.5 1 1 
       3006 1 . . . . . 5.21 1.8 5.73 1 1 
       3007 1 . . . . .  5.8 1.8 6.38 1 1 
       3008 1 . . . . . 5.73 1.8  6.3 1 1 
       3009 1 . . . . . 4.73 1.8  5.2 1 1 
       3010 1 . . . . . 4.52 1.8 4.97 1 1 
       3011 1 . . . . .  4.5 1.8 4.95 1 1 
       3012 1 . . . . . 4.17 1.8 4.59 1 1 
       3013 1 . . . . . 2.97 1.8 3.27 1 1 
       3014 1 . . . . . 3.37 1.8 3.71 1 1 
       3015 1 . . . . . 3.56 1.8 3.92 1 1 
       3016 1 . . . . . 4.83 1.8 5.31 1 1 
       3017 1 . . . . . 4.55 1.8 5.01 1 1 
       3018 1 . . . . . 4.88 1.8 5.37 1 1 
       3019 1 . . . . . 5.48 1.8 6.03 1 1 
       3020 1 . . . . . 3.12 1.8 3.43 1 1 
       3021 1 . . . . .  3.5 1.8 3.85 1 1 
       3022 1 . . . . . 4.36 1.8  4.8 1 1 
       3023 1 . . . . . 5.44 1.8 5.98 1 1 
       3024 1 . . . . . 4.15 1.8 4.57 1 1 
       3025 1 . . . . . 4.12 1.8 4.53 1 1 
       3026 1 . . . . . 4.76 1.8 5.24 1 1 
       3027 1 . . . . . 4.14 1.8 4.55 1 1 
       3028 1 . . . . . 4.68 1.8 5.15 1 1 
       3029 1 . . . . . 4.34 1.8 4.77 1 1 
       3030 1 . . . . . 4.83 1.8 5.31 1 1 
       3031 1 . . . . . 4.98 1.8 5.48 1 1 
       3032 1 . . . . . 4.68 1.8 5.15 1 1 
       3033 1 . . . . . 4.05 1.8 4.46 1 1 
       3034 1 . . . . . 4.29 1.8 4.72 1 1 
       3035 1 . . . . . 4.35 1.8 4.79 1 1 
       3036 1 . . . . . 3.98 1.8 4.38 1 1 
       3037 1 . . . . . 3.05 1.8 3.36 1 1 
       3038 1 . . . . .  3.3 1.8 3.63 1 1 
       3039 1 . . . . . 4.22 1.8 4.64 1 1 
       3040 1 . . . . . 3.62 1.8 3.98 1 1 
       3041 1 . . . . . 5.51 1.8 6.06 1 1 
       3042 1 . . . . . 6.14 1.8 6.75 1 1 
       3043 1 . . . . . 4.93 1.8 5.42 1 1 
       3044 1 . . . . .  4.1 1.8 4.51 1 1 
       3045 1 . . . . . 6.07 1.8 6.68 1 1 
       3046 1 . . . . . 3.47 1.8 3.82 1 1 
       3047 1 . . . . . 3.46 1.8 3.81 1 1 
       3048 1 . . . . . 3.78 1.8 4.16 1 1 
       3049 1 . . . . . 4.72 1.8 5.19 1 1 
       3050 1 . . . . . 5.07 1.8 5.58 1 1 
       3051 1 . . . . . 4.74 1.8 5.21 1 1 
       3052 1 . . . . . 4.94 1.8 5.43 1 1 
       3053 1 . . . . . 3.16 1.8 3.48 1 1 
       3054 1 . . . . . 4.51 1.8 4.96 1 1 
       3055 1 . . . . . 4.51 1.8 4.96 1 1 
       3056 1 . . . . . 4.75 1.8 5.22 1 1 
       3057 1 . . . . . 4.91 1.8  5.4 1 1 
       3058 1 . . . . . 4.53 1.8 4.98 1 1 
       3059 1 . . . . . 3.89 1.8 4.28 1 1 
       3060 1 . . . . . 3.97 1.8 4.37 1 1 
       3061 1 . . . . . 5.27 1.8  5.8 1 1 
       3062 1 . . . . . 4.04 1.8 4.44 1 1 
       3063 1 . . . . . 4.94 1.8 5.43 1 1 
       3064 1 . . . . . 3.92 1.8 4.31 1 1 
       3065 1 . . . . . 4.77 1.8 5.25 1 1 
       3066 1 . . . . . 4.85 1.8 5.33 1 1 
       3067 1 . . . . . 5.14 1.8 5.65 1 1 
       3068 1 . . . . . 4.23 1.8 4.65 1 1 
       3069 1 . . . . . 5.16 1.8 5.68 1 1 
       3070 1 . . . . . 5.26 1.8 5.79 1 1 
       3071 1 . . . . . 5.26 1.8 5.79 1 1 
       3072 1 . . . . . 5.15 1.8 5.67 1 1 
       3073 1 . . . . . 5.55 1.8 6.11 1 1 
       3074 1 . . . . . 4.51 1.8 4.96 1 1 
       3075 1 . . . . . 5.14 1.8 5.65 1 1 
       3076 1 . . . . . 5.51 1.8 6.06 1 1 
       3077 1 . . . . . 5.02 1.8 5.52 1 1 
       3078 1 . . . . . 5.11 1.8 5.62 1 1 
       3079 1 . . . . . 5.57 1.8 6.13 1 1 
       3080 1 . . . . . 4.44 1.8 4.88 1 1 
       3081 1 . . . . . 4.43 1.8 4.87 1 1 
       3082 1 . . . . . 4.73 1.8  5.2 1 1 
       3083 1 . . . . . 4.27 1.8  4.7 1 1 
       3084 1 . . . . . 4.13 1.8 4.54 1 1 
       3085 1 . . . . . 5.58 1.8 6.14 1 1 
       3086 1 . . . . .  5.0 1.8  5.5 1 1 
       3087 1 . . . . . 5.39 1.8 5.93 1 1 
       3088 1 . . . . . 4.72 1.8 5.19 1 1 
       3089 1 . . . . . 3.78 1.8 4.16 1 1 
       3090 1 . . . . . 4.68 1.8 5.15 1 1 
       3091 1 . . . . . 5.57 1.8 6.13 1 1 
       3092 1 . . . . .  5.7 1.8 6.27 1 1 
       3093 1 . . . . . 4.25 1.8 4.68 1 1 
       3094 1 . . . . . 5.79 1.8 6.37 1 1 
       3095 1 . . . . . 5.42 1.8 5.96 1 1 
       3096 1 . . . . .  5.3 1.8 5.83 1 1 
       3097 1 . . . . . 4.98 1.8 5.48 1 1 
       3098 1 . . . . . 4.56 1.8 5.02 1 1 
       3099 1 . . . . . 4.71 1.8 5.18 1 1 
       3100 1 . . . . . 4.95 1.8 5.44 1 1 
       3101 1 . . . . . 4.95 1.8 5.44 1 1 
       3102 1 . . . . .  5.1 1.8 5.61 1 1 
       3103 1 . . . . .  5.1 1.8 5.61 1 1 
       3104 1 . . . . . 4.75 1.8 5.22 1 1 
       3105 1 . . . . . 5.58 1.8 6.14 1 1 
       3106 1 . . . . . 5.34 1.8 5.87 1 1 
       3107 1 . . . . . 5.44 1.8 5.98 1 1 
       3108 1 . . . . . 4.96 1.8 5.46 1 1 
       3109 1 . . . . . 4.48 1.8 4.93 1 1 
       3110 1 . . . . . 5.77 1.8 6.35 1 1 
       3111 1 . . . . . 6.13 1.8 6.74 1 1 
       3112 1 . . . . . 4.99 1.8 5.49 1 1 
       3113 1 . . . . . 5.54 1.8 6.09 1 1 
       3114 1 . . . . . 5.79 1.8 6.37 1 1 
       3115 1 . . . . . 5.42 1.8 5.96 1 1 
       3116 1 . . . . .  5.4 1.8 5.94 1 1 
       3117 1 . . . . . 5.59 1.8 6.15 1 1 
       3118 1 . . . . . 3.44 1.8 3.78 1 1 
       3119 1 . . . . . 4.74 1.8 5.21 1 1 
       3120 1 . . . . . 5.49 1.8 6.04 1 1 
       3121 1 . . . . .  4.8 1.8 5.28 1 1 
       3122 1 . . . . . 4.01 1.8 4.41 1 1 
       3123 1 . . . . .  6.2 1.8 6.82 1 1 
       3124 1 . . . . .  6.2 1.8 6.82 1 1 
       3125 1 . . . . .  6.2 1.8 6.82 1 1 
       3126 1 . . . . .  6.2 1.8 6.82 1 1 
       3127 1 . . . . . 4.85 1.8 5.33 1 1 
       3128 1 . . . . . 4.28 1.8 4.71 1 1 
       3129 1 . . . . . 3.37 1.8 3.71 1 1 
       3130 1 . . . . . 5.57 1.8 6.13 1 1 
       3131 1 . . . . .  3.4 1.8 3.74 1 1 
       3132 1 . . . . . 4.86 1.8 5.35 1 1 
       3133 1 . . . . . 5.37 1.8 5.91 1 1 
       3134 1 . . . . . 4.68 1.8 5.15 1 1 
       3135 1 . . . . . 5.38 1.8 5.92 1 1 
       3136 1 . . . . .  5.0 1.8  5.5 1 1 
       3137 1 . . . . . 5.38 1.8 5.92 1 1 
       3138 1 . . . . . 5.42 1.8 5.96 1 1 
       3139 1 . . . . .  5.4 1.8 5.94 1 1 
       3140 1 . . . . . 4.37 1.8 4.81 1 1 
       3141 1 . . . . . 5.04 1.8 5.54 1 1 
       3142 1 . . . . . 4.74 1.8 5.21 1 1 
       3143 1 . . . . .  5.6 1.8 6.16 1 1 
       3144 1 . . . . .  5.6 1.8 6.16 1 1 
       3145 1 . . . . . 3.81 1.8 4.19 1 1 
       3146 1 . . . . . 4.02 1.8 4.42 1 1 
       3147 1 . . . . . 4.68 1.8 5.15 1 1 
       3148 1 . . . . . 4.65 1.8 5.12 1 1 
       3149 1 . . . . . 5.38 1.8 5.92 1 1 
       3150 1 . . . . . 5.02 1.8 5.52 1 1 
       3151 1 . . . . . 5.98 1.8 6.58 1 1 
       3152 1 . . . . . 5.59 1.8 6.15 1 1 
       3153 1 . . . . . 5.24 1.8 5.76 1 1 
       3154 1 . . . . . 5.18 1.8  5.7 1 1 
       3155 1 . . . . . 5.18 1.8  5.7 1 1 
       3156 1 . . . . . 5.98 1.8 6.58 1 1 
       3157 1 . . . . .  4.9 1.8 5.39 1 1 
       3158 1 . . . . . 4.44 1.8 4.88 1 1 
       3159 1 . . . . . 6.06 1.8 6.67 1 1 
       3160 1 . . . . . 4.82 1.8  5.3 1 1 
       3161 1 . . . . . 3.84 1.8 4.22 1 1 
       3162 1 . . . . . 4.28 1.8 4.71 1 1 
       3163 1 . . . . .  4.1 1.8 4.51 1 1 
       3164 1 . . . . . 4.84 1.8 5.32 1 1 
       3165 1 . . . . . 5.24 1.8 5.76 1 1 
       3166 1 . . . . . 3.73 1.8  4.1 1 1 
       3167 1 . . . . . 4.96 1.8 5.46 1 1 
       3168 1 . . . . . 5.08 1.8 5.59 1 1 
       3169 1 . . . . . 4.66 1.8 5.13 1 1 
       3170 1 . . . . . 4.37 1.8 4.81 1 1 
       3171 1 . . . . . 4.87 1.8 5.36 1 1 
       3172 1 . . . . . 3.81 1.8 4.19 1 1 
       3173 1 . . . . . 4.97 1.8 5.47 1 1 
       3174 1 . . . . . 3.26 1.8 3.59 1 1 
       3175 1 . . . . . 3.69 1.8 4.06 1 1 
       3176 1 . . . . . 4.26 1.8 4.69 1 1 
       3177 1 . . . . . 3.54 1.8 3.89 1 1 
       3178 1 . . . . . 4.69 1.8 5.16 1 1 
       3179 1 . . . . . 4.74 1.8 5.21 1 1 
       3180 1 . . . . . 5.24 1.8 5.76 1 1 
       3181 1 . . . . . 5.24 1.8 5.76 1 1 
       3182 1 . . . . . 5.52 1.8 6.07 1 1 
       3183 1 . . . . . 4.71 1.8 5.18 1 1 
       3184 1 . . . . . 5.01 1.8 5.51 1 1 
       3185 1 . . . . . 4.49 1.8 4.94 1 1 
       3186 1 . . . . . 4.07 1.8 4.48 1 1 
       3187 1 . . . . .  4.3 1.8 4.73 1 1 
       3188 1 . . . . . 4.94 1.8 5.43 1 1 
       3189 1 . . . . . 4.33 1.8 4.76 1 1 
       3190 1 . . . . . 4.21 1.8 4.63 1 1 
       3191 1 . . . . . 6.04 1.8 6.64 1 1 
       3192 1 . . . . .  6.2 1.8 6.82 1 1 
       3193 1 . . . . . 4.73 1.8  5.2 1 1 
       3194 1 . . . . . 4.26 1.8 4.69 1 1 
       3195 1 . . . . . 3.61 1.8 3.97 1 1 
       3196 1 . . . . . 4.26 1.8 4.69 1 1 
       3197 1 . . . . . 5.05 1.8 5.56 1 1 
       3198 1 . . . . . 3.42 1.8 3.76 1 1 
       3199 1 . . . . .  3.5 1.8 3.85 1 1 
       3200 1 . . . . . 3.65 1.8 4.02 1 1 
       3201 1 . . . . . 4.64 1.8  5.1 1 1 
       3202 1 . . . . . 4.68 1.8 5.15 1 1 
       3203 1 . . . . . 3.96 1.8 4.36 1 1 
       3204 1 . . . . .  5.0 1.8  5.5 1 1 
       3205 1 . . . . . 4.44 1.8 4.88 1 1 
       3206 1 . . . . . 5.07 1.8 5.58 1 1 
       3207 1 . . . . . 5.54 1.8 6.09 1 1 
       3208 1 . . . . .  6.2 1.8 6.82 1 1 
       3209 1 . . . . .  6.2 1.8 6.82 1 1 
       3210 1 . . . . . 5.03 1.8 5.53 1 1 
       3211 1 . . . . . 6.12 1.8 6.73 1 1 
       3212 1 . . . . .  6.2 1.8 6.82 1 1 
       3213 1 . . . . . 5.27 1.8  5.8 1 1 
       3214 1 . . . . . 4.45 1.8 4.89 1 1 
       3215 1 . . . . . 5.11 1.8 5.62 1 1 
       3216 1 . . . . . 5.08 1.8 5.59 1 1 
       3217 1 . . . . . 5.27 1.8  5.8 1 1 
       3218 1 . . . . . 5.37 1.8 5.91 1 1 
       3219 1 . . . . . 5.85 1.8 6.43 1 1 
       3220 1 . . . . . 5.41 1.8 5.95 1 1 
       3221 1 . . . . . 5.06 1.8 5.57 1 1 
       3222 1 . . . . . 5.66 1.8 6.23 1 1 
       3223 1 . . . . .  6.2 1.8 6.82 1 1 
       3224 1 . . . . . 5.32 1.8 5.85 1 1 
       3225 1 . . . . . 4.13 1.8 4.54 1 1 
       3226 1 . . . . . 4.21 1.8 4.63 1 1 
       3227 1 . . . . . 4.15 1.8 4.57 1 1 
       3228 1 . . . . . 4.14 1.8 4.55 1 1 
       3229 1 . . . . . 5.04 1.8 5.54 1 1 
       3230 1 . . . . . 5.04 1.8 5.54 1 1 
       3231 1 . . . . .  6.2 1.8 6.82 1 1 
       3232 1 . . . . .  6.2 1.8 6.82 1 1 
       3233 1 . . . . . 6.08 1.8 6.69 1 1 
       3234 1 . . . . . 6.08 1.8 6.69 1 1 
       3235 1 . . . . . 4.19 1.8 4.61 1 1 
       3236 1 . . . . . 4.71 1.8 5.18 1 1 
       3237 1 . . . . . 5.32 1.8 5.85 1 1 
       3238 1 . . . . .  4.6 1.8 5.06 1 1 
       3239 1 . . . . . 4.14 1.8 4.55 1 1 
       3240 1 . . . . . 5.01 1.8 5.51 1 1 
       3241 1 . . . . . 4.24 1.8 4.66 1 1 
       3242 1 . . . . . 4.24 1.8 4.66 1 1 
       3243 1 . . . . . 5.14 1.8 5.65 1 1 
       3244 1 . . . . . 5.54 1.8 6.09 1 1 
       3245 1 . . . . .  5.1 1.8 5.61 1 1 
       3246 1 . . . . .  5.1 1.8 5.61 1 1 
       3247 1 . . . . .  6.2 1.8 6.82 1 1 
       3248 1 . . . . . 4.22 1.8 4.64 1 1 
       3249 1 . . . . . 4.22 1.8 4.64 1 1 
       3250 1 . . . . . 6.15 1.8 6.77 1 1 
       3251 1 . . . . . 5.15 1.8 5.67 1 1 
       3252 1 . . . . . 3.98 1.8 4.38 1 1 
       3253 1 . . . . . 4.89 1.8 5.38 1 1 
       3254 1 . . . . . 4.51 1.8 4.96 1 1 
       3255 1 . . . . . 5.21 1.8 5.73 1 1 
       3256 1 . . . . . 5.21 1.8 5.73 1 1 
       3257 1 . . . . . 5.21 1.8 5.73 1 1 
       3258 1 . . . . . 5.04 1.8 5.54 1 1 
       3259 1 . . . . . 5.42 1.8 5.96 1 1 
       3260 1 . . . . . 5.04 1.8 5.54 1 1 
       3261 1 . . . . . 5.42 1.8 5.96 1 1 
       3262 1 . . . . .  6.2 1.8 6.82 1 1 
       3263 1 . . . . . 4.89 1.8 5.38 1 1 
       3264 1 . . . . . 5.76 1.8 6.34 1 1 
       3265 1 . . . . . 4.33 1.8 4.76 1 1 
       3266 1 . . . . . 4.53 1.8 4.98 1 1 
       3267 1 . . . . . 4.31 1.8 4.74 1 1 
       3268 1 . . . . . 4.25 1.8 4.68 1 1 
       3269 1 . . . . . 4.94 1.8 5.43 1 1 
       3270 1 . . . . .  5.2 1.8 5.72 1 1 
       3271 1 . . . . . 4.68 1.8 5.15 1 1 
       3272 1 . . . . . 4.68 1.8 5.15 1 1 
       3273 1 . . . . . 5.56 1.8 6.12 1 1 
       3274 1 . . . . . 5.97 1.8 6.57 1 1 
       3275 1 . . . . .  6.2 1.8 6.82 1 1 
       3276 1 . . . . . 5.56 1.8 6.12 1 1 
       3277 1 . . . . . 5.97 1.8 6.57 1 1 
       3278 1 . . . . . 4.78 1.8 5.26 1 1 
       3279 1 . . . . . 4.78 1.8 5.26 1 1 
       3280 1 . . . . . 5.37 1.8 5.91 1 1 
       3281 1 . . . . . 5.25 1.8 5.78 1 1 
       3282 1 . . . . . 5.66 1.8 6.23 1 1 
       3283 1 . . . . .  6.2 1.8 6.82 1 1 
       3284 1 . . . . . 5.71 1.8 6.28 1 1 
       3285 1 . . . . . 5.07 1.8 5.58 1 1 
       3286 1 . . . . . 4.75 1.8 5.22 1 1 
       3287 1 . . . . . 5.13 1.8 5.64 1 1 
       3288 1 . . . . .  5.3 1.8 5.83 1 1 
       3289 1 . . . . . 5.75 1.8 6.32 1 1 
       3290 1 . . . . . 4.75 1.8 5.22 1 1 
       3291 1 . . . . . 4.75 1.8 5.22 1 1 
       3292 1 . . . . . 5.93 1.8 6.52 1 1 
       3293 1 . . . . .  6.2 1.8 6.82 1 1 
       3294 1 . . . . . 4.91 1.8  5.4 1 1 
       3295 1 . . . . . 5.53 1.8 6.08 1 1 
       3296 1 . . . . . 4.91 1.8  5.4 1 1 
       3297 1 . . . . . 4.72 1.8 5.19 1 1 
       3298 1 . . . . . 6.17 1.8 6.79 1 1 
       3299 1 . . . . . 5.49 1.8 6.04 1 1 
       3300 1 . . . . . 4.44 1.8 4.88 1 1 
       3301 1 . . . . . 4.83 1.8 5.31 1 1 
       3302 1 . . . . . 5.35 1.8 5.89 1 1 
       3303 1 . . . . . 5.31 1.8 5.84 1 1 
       3304 1 . . . . . 3.59 1.8 3.95 1 1 
       3305 1 . . . . . 3.48 1.8 3.83 1 1 
       3306 1 . . . . . 4.56 1.8 5.02 1 1 
       3307 1 . . . . . 3.69 1.8 4.06 1 1 
       3308 1 . . . . .  5.0 1.8  5.5 1 1 
       3309 1 . . . . . 4.79 1.8 5.27 1 1 
       3310 1 . . . . .  3.6 1.8 3.96 1 1 
       3311 1 . . . . . 3.64 1.8  4.0 1 1 
       3312 1 . . . . . 4.28 1.8 4.71 1 1 
       3313 1 . . . . . 4.55 1.8 5.01 1 1 
       3314 1 . . . . . 4.78 1.8 5.26 1 1 
       3315 1 . . . . . 4.55 1.8 5.01 1 1 
       3316 1 . . . . . 4.93 1.8 5.42 1 1 
       3317 1 . . . . . 5.34 1.8 5.87 1 1 
       3318 1 . . . . . 4.78 1.8 5.26 1 1 
       3319 1 . . . . . 5.17 1.8 5.69 1 1 
       3320 1 . . . . . 5.47 1.8 6.02 1 1 
       3321 1 . . . . .  4.9 1.8 5.39 1 1 
       3322 1 . . . . .  6.2 1.8 6.82 1 1 
       3323 1 . . . . . 5.19 1.8 5.71 1 1 
       3324 1 . . . . . 4.14 1.8 4.55 1 1 
       3325 1 . . . . . 4.05 1.8 4.46 1 1 
       3326 1 . . . . . 3.97 1.8 4.37 1 1 
       3327 1 . . . . . 4.58 1.8 5.04 1 1 
       3328 1 . . . . . 4.51 1.8 4.96 1 1 
       3329 1 . . . . . 4.84 1.8 5.32 1 1 
       3330 1 . . . . . 5.53 1.8 6.08 1 1 
       3331 1 . . . . . 4.23 1.8 4.65 1 1 
       3332 1 . . . . . 4.78 1.8 5.26 1 1 
       3333 1 . . . . . 4.94 1.8 5.43 1 1 
       3334 1 . . . . . 4.64 1.8  5.1 1 1 
       3335 1 . . . . . 6.04 1.8 6.64 1 1 
       3336 1 . . . . . 3.78 1.8 4.16 1 1 
       3337 1 . . . . . 5.98 1.8 6.58 1 1 
       3338 1 . . . . .  4.4 1.8 4.84 1 1 
       3339 1 . . . . . 3.46 1.8 3.81 1 1 
       3340 1 . . . . . 3.71 1.8 4.08 1 1 
       3341 1 . . . . . 5.06 1.8 5.57 1 1 
       3342 1 . . . . . 4.74 1.8 5.21 1 1 
       3343 1 . . . . . 5.04 1.8 5.54 1 1 
       3344 1 . . . . . 4.42 1.8 4.86 1 1 
       3345 1 . . . . . 4.17 1.8 4.59 1 1 
       3346 1 . . . . .  4.8 1.8 5.28 1 1 
       3347 1 . . . . . 5.67 1.8 6.24 1 1 
       3348 1 . . . . . 5.04 1.8 5.54 1 1 
       3349 1 . . . . . 4.97 1.8 5.47 1 1 
       3350 1 . . . . . 4.03 1.8 4.43 1 1 
       3351 1 . . . . . 3.84 1.8 4.22 1 1 
       3352 1 . . . . . 5.23 1.8 5.75 1 1 
       3353 1 . . . . . 5.22 1.8 5.74 1 1 
       3354 1 . . . . . 5.58 1.8 6.14 1 1 
       3355 1 . . . . . 4.16 1.8 4.58 1 1 
       3356 1 . . . . . 4.16 1.8 4.58 1 1 
       3357 1 . . . . . 4.65 1.8 5.12 1 1 
       3358 1 . . . . .  4.9 1.8 5.39 1 1 
       3359 1 . . . . . 5.92 1.8 6.51 1 1 
       3360 1 . . . . . 5.92 1.8 6.51 1 1 
       3361 1 . . . . .  4.3 1.8 4.73 1 1 
       3362 1 . . . . . 4.89 1.8 5.38 1 1 
       3363 1 . . . . . 5.83 1.8 6.41 1 1 
       3364 1 . . . . . 6.07 1.8 6.68 1 1 
       3365 1 . . . . . 5.31 1.8 5.84 1 1 
       3366 1 . . . . . 5.13 1.8 5.64 1 1 
       3367 1 . . . . . 4.65 1.8 5.12 1 1 
       3368 1 . . . . .  5.6 1.8 6.16 1 1 
       3369 1 . . . . . 5.27 1.8  5.8 1 1 
       3370 1 . . . . . 5.26 1.8 5.79 1 1 
       3371 1 . . . . . 5.92 1.8 6.51 1 1 
       3372 1 . . . . . 5.63 1.8 6.19 1 1 
       3373 1 . . . . . 3.87 1.8 4.26 1 1 
       3374 1 . . . . . 3.95 1.8 4.35 1 1 
       3375 1 . . . . . 4.92 1.8 5.41 1 1 
       3376 1 . . . . . 4.29 1.8 4.72 1 1 
       3377 1 . . . . . 3.64 1.8  4.0 1 1 
       3378 1 . . . . .  4.6 1.8 5.06 1 1 
       3379 1 . . . . . 4.94 1.8 5.43 1 1 
       3380 1 . . . . . 4.76 1.8 5.24 1 1 
       3381 1 . . . . . 5.01 1.8 5.51 1 1 
       3382 1 . . . . . 3.57 1.8 3.93 1 1 
       3383 1 . . . . . 4.08 1.8 4.49 1 1 
       3384 1 . . . . . 4.27 1.8  4.7 1 1 
       3385 1 . . . . . 4.72 1.8 5.19 1 1 
       3386 1 . . . . . 4.08 1.8 4.49 1 1 
       3387 1 . . . . . 4.28 1.8 4.71 1 1 
       3388 1 . . . . . 5.26 1.8 5.79 1 1 
       3389 1 . . . . . 3.92 1.8 4.31 1 1 
       3390 1 . . . . .  4.4 1.8 4.84 1 1 
       3391 1 . . . . . 4.76 1.8 5.24 1 1 
       3392 1 . . . . .  5.3 1.8 5.83 1 1 
       3393 1 . . . . . 4.36 1.8  4.8 1 1 
       3394 1 . . . . . 4.55 1.8 5.01 1 1 
       3395 1 . . . . . 3.96 1.8 4.36 1 1 
       3396 1 . . . . . 4.36 1.8  4.8 1 1 
       3397 1 . . . . .  4.9 1.8 5.39 1 1 
       3398 1 . . . . . 4.02 1.8 4.42 1 1 
       3399 1 . . . . . 4.93 1.8 5.42 1 1 
       3400 1 . . . . . 4.78 1.8 5.26 1 1 
       3401 1 . . . . . 5.55 1.8 6.11 1 1 
       3402 1 . . . . . 5.85 1.8 6.43 1 1 
       3403 1 . . . . . 6.17 1.8 6.79 1 1 
       3404 1 . . . . . 4.89 1.8 5.38 1 1 
       3405 1 . . . . . 5.13 1.8 5.64 1 1 
       3406 1 . . . . . 4.97 1.8 5.47 1 1 
       3407 1 . . . . . 4.58 1.8 5.04 1 1 
       3408 1 . . . . . 4.92 1.8 5.41 1 1 
       3409 1 . . . . .  5.0 1.8  5.5 1 1 
       3410 1 . . . . . 4.03 1.8 4.43 1 1 
       3411 1 . . . . . 5.69 1.8 6.26 1 1 
       3412 1 . . . . . 5.86 1.8 6.45 1 1 
       3413 1 . . . . . 4.85 1.8 5.33 1 1 
       3414 1 . . . . . 5.45 1.8  6.0 1 1 
       3415 1 . . . . . 5.45 1.8  6.0 1 1 
       3416 1 . . . . . 5.71 1.8 6.28 1 1 
       3417 1 . . . . . 5.71 1.8 6.28 1 1 
       3418 1 . . . . . 5.22 1.8 5.74 1 1 
       3419 1 . . . . . 4.37 1.8 4.81 1 1 
       3420 1 . . . . . 4.04 1.8 4.44 1 1 
       3421 1 . . . . . 4.13 1.8 4.54 1 1 
       3422 1 . . . . . 5.51 1.8 6.06 1 1 
       3423 1 . . . . . 5.54 1.8 6.09 1 1 
       3424 1 . . . . .  6.0 1.8  6.6 1 1 
       3425 1 . . . . . 3.99 1.8 4.39 1 1 
       3426 1 . . . . . 5.59 1.8 6.15 1 1 
       3427 1 . . . . . 5.92 1.8 6.51 1 1 
       3428 1 . . . . . 5.84 1.8 6.42 1 1 
       3429 1 . . . . . 4.51 1.8 4.96 1 1 
       3430 1 . . . . . 4.67 1.8 5.14 1 1 
       3431 1 . . . . . 5.15 1.8 5.67 1 1 
       3432 1 . . . . . 5.35 1.8 5.89 1 1 
       3433 1 . . . . . 4.64 1.8  5.1 1 1 
       3434 1 . . . . .  6.2 1.8 6.82 1 1 
       3435 1 . . . . .  6.2 1.8 6.82 1 1 
       3436 1 . . . . . 5.44 1.8 5.98 1 1 
       3437 1 . . . . . 5.14 1.8 5.65 1 1 
       3438 1 . . . . . 4.45 1.8 4.89 1 1 
       3439 1 . . . . . 4.62 1.8 5.08 1 1 
       3440 1 . . . . . 5.91 1.8  6.5 1 1 
       3441 1 . . . . .  6.2 1.8 6.82 1 1 
       3442 1 . . . . .  5.2 1.8 5.72 1 1 
       3443 1 . . . . . 5.45 1.8  6.0 1 1 
       3444 1 . . . . . 5.66 1.8 6.23 1 1 
       3445 1 . . . . . 5.22 1.8 5.74 1 1 
       3446 1 . . . . . 4.36 1.8  4.8 1 1 
       3447 1 . . . . . 4.36 1.8  4.8 1 1 
       3448 1 . . . . . 5.15 1.8 5.67 1 1 
       3449 1 . . . . .  4.1 1.8 4.51 1 1 
       3450 1 . . . . .  3.9 1.8 4.29 1 1 
       3451 1 . . . . . 3.76 1.8 4.14 1 1 
       3452 1 . . . . . 3.87 1.8 4.26 1 1 
       3453 1 . . . . . 4.29 1.8 4.72 1 1 
       3454 1 . . . . .  6.2 1.8 6.82 1 1 
       3455 1 . . . . .  6.2 1.8 6.82 1 1 
       3456 1 . . . . . 4.85 1.8 5.33 1 1 
       3457 1 . . . . . 5.67 1.8 6.24 1 1 
       3458 1 . . . . .  6.2 1.8 6.82 1 1 
       3459 1 . . . . .  6.2 1.8 6.82 1 1 
       3460 1 . . . . . 5.65 1.8 6.21 1 1 
       3461 1 . . . . .  6.2 1.8 6.82 1 1 
       3462 1 . . . . .  6.2 1.8 6.82 1 1 
       3463 1 . . . . . 5.82 1.8  6.4 1 1 
       3464 1 . . . . .  6.2 1.8 6.82 1 1 
       3465 1 . . . . .  6.2 1.8 6.82 1 1 
       3466 1 . . . . . 5.98 1.8 6.58 1 1 
       3467 1 . . . . .  6.2 1.8 6.82 1 1 
       3468 1 . . . . . 5.73 1.8  6.3 1 1 
       3469 1 . . . . .  6.2 1.8 6.82 1 1 
       3470 1 . . . . . 5.85 1.8 6.43 1 1 
       3471 1 . . . . . 6.14 1.8 6.75 1 1 
       3472 1 . . . . . 5.69 1.8 6.26 1 1 
       3473 1 . . . . . 5.45 1.8  6.0 1 1 
       3474 1 . . . . . 6.01 1.8 6.61 1 1 
       3475 1 . . . . . 5.05 1.8 5.56 1 1 
       3476 1 . . . . . 5.05 1.8 5.56 1 1 
       3477 1 . . . . . 6.01 1.8 6.61 1 1 
       3478 1 . . . . .  6.2 1.8 6.82 1 1 
       3479 1 . . . . .  6.2 1.8 6.82 1 1 
       3480 1 . . . . .  6.2 1.8 6.82 1 1 
       3481 1 . . . . . 6.16 1.8 6.78 1 1 
       3482 1 . . . . .  6.2 1.8 6.82 1 1 
       3483 1 . . . . .  6.2 1.8 6.82 1 1 
       3484 1 . . . . .  5.3 1.8 5.83 1 1 
       3485 1 . . . . . 5.12 1.8 5.63 1 1 
       3486 1 . . . . .  6.2 1.8 6.82 1 1 
       3487 1 . . . . . 5.31 1.8 5.84 1 1 
       3488 1 . . . . . 5.14 1.8 5.65 1 1 
       3489 1 . . . . . 4.97 1.8 5.47 1 1 
       3490 1 . . . . . 4.14 1.8 4.55 1 1 
       3491 1 . . . . . 5.53 1.8 6.08 1 1 
       3492 1 . . . . . 4.62 1.8 5.08 1 1 
       3493 1 . . . . . 5.41 1.8 5.95 1 1 
       3494 1 . . . . . 5.76 1.8 6.34 1 1 
       3495 1 . . . . .  3.7 1.8 4.07 1 1 
       3496 1 . . . . . 4.63 1.8 5.09 1 1 
       3497 1 . . . . . 4.97 1.8 5.47 1 1 
       3498 1 . . . . . 3.31 1.8 3.64 1 1 
       3499 1 . . . . . 5.63 1.8 6.19 1 1 
       3500 1 . . . . . 4.14 1.8 4.55 1 1 
       3501 1 . . . . . 4.14 1.8 4.55 1 1 
       3502 1 . . . . . 4.95 1.8 5.44 1 1 
       3503 1 . . . . . 3.31 1.8 3.64 1 1 
       3504 1 . . . . . 3.75 1.8 4.13 1 1 
       3505 1 . . . . . 4.12 1.8 4.53 1 1 
       3506 1 . . . . . 5.27 1.8  5.8 1 1 
       3507 1 . . . . . 5.27 1.8  5.8 1 1 
       3508 1 . . . . . 5.79 1.8 6.37 1 1 
       3509 1 . . . . . 4.05 1.8 4.46 1 1 
       3510 1 . . . . . 4.05 1.8 4.46 1 1 
       3511 1 . . . . .  4.2 1.8 4.62 1 1 
       3512 1 . . . . . 4.29 1.8 4.72 1 1 
       3513 1 . . . . . 3.83 1.8 4.21 1 1 
       3514 1 . . . . .  5.7 1.8 6.27 1 1 
       3515 1 . . . . . 4.22 1.8 4.64 1 1 
       3516 1 . . . . . 4.86 1.8 5.35 1 1 
       3517 1 . . . . . 4.52 1.8 4.97 1 1 
       3518 1 . . . . . 4.98 1.8 5.48 1 1 
       3519 1 . . . . . 3.85 1.8 4.23 1 1 
       3520 1 . . . . . 5.11 1.8 5.62 1 1 
       3521 1 . . . . . 5.11 1.8 5.62 1 1 
       3522 1 . . . . . 5.83 1.8 6.41 1 1 
       3523 1 . . . . . 4.14 1.8 4.55 1 1 
       3524 1 . . . . . 4.14 1.8 4.55 1 1 
       3525 1 . . . . .  4.1 1.8 4.51 1 1 
       3526 1 . . . . . 4.75 1.8 5.22 1 1 
       3527 1 . . . . . 3.95 1.8 4.35 1 1 
       3528 1 . . . . . 3.68 1.8 4.05 1 1 
       3529 1 . . . . . 4.94 1.8 5.43 1 1 
       3530 1 . . . . . 4.55 1.8 5.01 1 1 
       3531 1 . . . . . 4.55 1.8 5.01 1 1 
       3532 1 . . . . .  6.2 1.8 6.82 1 1 
       3533 1 . . . . . 4.37 1.8 4.81 1 1 
       3534 1 . . . . .  4.5 1.8 4.95 1 1 
       3535 1 . . . . .  4.2 1.8 4.62 1 1 
       3536 1 . . . . . 4.25 1.8 4.68 1 1 
       3537 1 . . . . . 5.22 1.8 5.74 1 1 
       3538 1 . . . . . 5.89 1.8 6.48 1 1 
       3539 1 . . . . . 5.39 1.8 5.93 1 1 
       3540 1 . . . . . 5.45 1.8  6.0 1 1 
       3541 1 . . . . . 5.31 1.8 5.84 1 1 
       3542 1 . . . . .  6.2 1.8 6.82 1 1 
       3543 1 . . . . . 5.44 1.8 5.98 1 1 
       3544 1 . . . . .  5.6 1.8 6.16 1 1 
       3545 1 . . . . . 4.28 1.8 4.71 1 1 
       3546 1 . . . . . 4.01 1.8 4.41 1 1 
       3547 1 . . . . . 3.99 1.8 4.39 1 1 
       3548 1 . . . . . 5.17 1.8 5.69 1 1 
       3549 1 . . . . . 5.42 1.8 5.96 1 1 
       3550 1 . . . . . 5.52 1.8 6.07 1 1 
       3551 1 . . . . . 5.52 1.8 6.07 1 1 
       3552 1 . . . . . 5.52 1.8 6.07 1 1 
       3553 1 . . . . . 4.11 1.8 4.52 1 1 
       3554 1 . . . . . 4.11 1.8 4.52 1 1 
       3555 1 . . . . . 6.07 1.8 6.68 1 1 
       3556 1 . . . . . 4.07 1.8 4.48 1 1 
       3557 1 . . . . . 4.66 1.8 5.13 1 1 
       3558 1 . . . . . 3.35 1.8 3.69 1 1 
       3559 1 . . . . . 4.17 1.8 4.59 1 1 
       3560 1 . . . . . 4.54 1.8 4.99 1 1 
       3561 1 . . . . .  4.8 1.8 5.28 1 1 
       3562 1 . . . . . 5.69 1.8 6.26 1 1 
       3563 1 . . . . . 4.76 1.8 5.24 1 1 
       3564 1 . . . . . 5.22 1.8 5.74 1 1 
       3565 1 . . . . . 5.28 1.8 5.81 1 1 
       3566 1 . . . . . 6.19 1.8 6.81 1 1 
       3567 1 . . . . . 4.28 1.8 4.71 1 1 
       3568 1 . . . . . 4.89 1.8 5.38 1 1 
       3569 1 . . . . . 3.79 1.8 4.17 1 1 
       3570 1 . . . . . 4.41 1.8 4.85 1 1 
       3571 1 . . . . . 4.66 1.8 5.13 1 1 
       3572 1 . . . . .  3.2 1.8 3.52 1 1 
       3573 1 . . . . . 3.12 1.8 3.43 1 1 
       3574 1 . . . . .  4.7 1.8 5.17 1 1 
       3575 1 . . . . . 5.33 1.8 5.86 1 1 
       3576 1 . . . . . 5.48 1.8 6.03 1 1 
       3577 1 . . . . .  6.2 1.8 6.82 1 1 
       3578 1 . . . . .  6.2 1.8 6.82 1 1 
       3579 1 . . . . . 5.08 1.8 5.59 1 1 
       3580 1 . . . . . 5.41 1.8 5.95 1 1 
       3581 1 . . . . . 4.39 1.8 4.83 1 1 
       3582 1 . . . . .  6.2 1.8 6.82 1 1 
       3583 1 . . . . . 4.46 1.8 4.91 1 1 
       3584 1 . . . . . 5.47 1.8 6.02 1 1 
       3585 1 . . . . . 5.02 1.8 5.52 1 1 
       3586 1 . . . . . 5.02 1.8 5.52 1 1 
       3587 1 . . . . .  6.2 1.8 6.82 1 1 
       3588 1 . . . . .  6.2 1.8 6.82 1 1 
       3589 1 . . . . . 6.03 1.8 6.63 1 1 
       3590 1 . . . . . 3.59 1.8 3.95 1 1 
       3591 1 . . . . . 5.28 1.8 5.81 1 1 
       3592 1 . . . . . 6.07 1.8 6.68 1 1 
       3593 1 . . . . . 4.74 1.8 5.21 1 1 
       3594 1 . . . . . 3.85 1.8 4.23 1 1 
       3595 1 . . . . . 5.33 1.8 5.86 1 1 
       3596 1 . . . . . 4.37 1.8 4.81 1 1 
       3597 1 . . . . . 5.64 1.8  6.2 1 1 
       3598 1 . . . . . 5.55 1.8 6.11 1 1 
       3599 1 . . . . . 5.47 1.8 6.02 1 1 
       3600 1 . . . . .  5.7 1.8 6.27 1 1 
       3601 1 . . . . . 5.17 1.8 5.69 1 1 
       3602 1 . . . . . 5.55 1.8 6.11 1 1 
       3603 1 . . . . . 5.55 1.8 6.11 1 1 
       3604 1 . . . . . 5.41 1.8 5.95 1 1 
       3605 1 . . . . . 5.46 1.8 6.01 1 1 
       3606 1 . . . . . 5.46 1.8 6.01 1 1 
       3607 1 . . . . . 5.65 1.8 6.21 1 1 
       3608 1 . . . . .  5.8 1.8 6.38 1 1 
       3609 1 . . . . . 5.75 1.8 6.32 1 1 
       3610 1 . . . . . 5.22 1.8 5.74 1 1 
       3611 1 . . . . . 5.03 1.8 5.53 1 1 
       3612 1 . . . . .  5.4 1.8 5.94 1 1 
       3613 1 . . . . . 4.06 1.8 4.47 1 1 
       3614 1 . . . . .  6.2 1.8 6.82 1 1 
       3615 1 . . . . .  6.2 1.8 6.82 1 1 
       3616 1 . . . . . 5.69 1.8 6.26 1 1 
       3617 1 . . . . . 5.51 1.8 6.06 1 1 
       3618 1 . . . . . 4.97 1.8 5.47 1 1 
       3619 1 . . . . . 4.97 1.8 5.47 1 1 
       3620 1 . . . . .  5.4 1.8 5.94 1 1 
       3621 1 . . . . . 5.06 1.8 5.57 1 1 
       3622 1 . . . . . 5.87 1.8 6.46 1 1 
       3623 1 . . . . . 4.47 1.8 4.92 1 1 
       3624 1 . . . . . 5.85 1.8 6.43 1 1 
       3625 1 . . . . .  6.2 1.8 6.82 1 1 
       3626 1 . . . . .  6.2 1.8 6.82 1 1 
       3627 1 . . . . . 3.72 1.8 4.09 1 1 
       3628 1 . . . . . 4.31 1.8 4.74 1 1 
       3629 1 . . . . . 4.31 1.8 4.74 1 1 
       3630 1 . . . . . 5.87 1.8 6.46 1 1 
       3631 1 . . . . . 4.63 1.8 5.09 1 1 
       3632 1 . . . . . 4.26 1.8 4.69 1 1 
       3633 1 . . . . . 5.58 1.8 6.14 1 1 
       3634 1 . . . . . 4.04 1.8 4.44 1 1 
       3635 1 . . . . .  4.8 1.8 5.28 1 1 
       3636 1 . . . . . 4.89 1.8 5.38 1 1 
       3637 1 . . . . . 6.03 1.8 6.63 1 1 
       3638 1 . . . . . 5.03 1.8 5.53 1 1 
       3639 1 . . . . .  6.2 1.8 6.82 1 1 
       3640 1 . . . . . 5.93 1.8 6.52 1 1 
       3641 1 . . . . .  6.2 1.8 6.82 1 1 
       3642 1 . . . . .  6.2 1.8 6.82 1 1 
       3643 1 . . . . . 4.66 1.8 5.13 1 1 
       3644 1 . . . . . 4.32 1.8 4.75 1 1 
       3645 1 . . . . . 4.58 1.8 5.04 1 1 
       3646 1 . . . . . 3.66 1.8 4.03 1 1 
       3647 1 . . . . . 4.88 1.8 5.37 1 1 
       3648 1 . . . . .  6.2 1.8 6.82 1 1 
       3649 1 . . . . . 5.07 1.8 5.58 1 1 
       3650 1 . . . . . 4.87 1.8 5.36 1 1 
       3651 1 . . . . . 4.24 1.8 4.66 1 1 
       3652 1 . . . . . 4.24 1.8 4.66 1 1 
       3653 1 . . . . . 5.94 1.8 6.53 1 1 
       3654 1 . . . . . 4.22 1.8 4.64 1 1 
       3655 1 . . . . . 5.05 1.8 5.56 1 1 
       3656 1 . . . . . 6.09 1.8  6.7 1 1 
       3657 1 . . . . . 5.58 1.8 6.14 1 1 
       3658 1 . . . . . 5.95 1.8 6.54 1 1 
       3659 1 . . . . . 4.94 1.8 5.43 1 1 
       3660 1 . . . . .  6.2 1.8 6.82 1 1 
       3661 1 . . . . . 5.36 1.8  5.9 1 1 
       3662 1 . . . . . 3.82 1.8  4.2 1 1 
       3663 1 . . . . . 3.65 1.8 4.02 1 1 
       3664 1 . . . . . 4.76 1.8 5.24 1 1 
       3665 1 . . . . . 4.81 1.8 5.29 1 1 
       3666 1 . . . . . 5.66 1.8 6.23 1 1 
       3667 1 . . . . . 5.66 1.8 6.23 1 1 
       3668 1 . . . . . 4.75 1.8 5.22 1 1 
       3669 1 . . . . . 3.81 1.8 4.19 1 1 
       3670 1 . . . . . 5.56 1.8 6.12 1 1 
       3671 1 . . . . . 4.49 1.8 4.94 1 1 
       3672 1 . . . . . 4.49 1.8 4.94 1 1 
       3673 1 . . . . . 5.27 1.8  5.8 1 1 
       3674 1 . . . . . 5.36 1.8  5.9 1 1 
       3675 1 . . . . . 5.17 1.8 5.69 1 1 
       3676 1 . . . . . 5.21 1.8 5.73 1 1 
       3677 1 . . . . . 4.85 1.8 5.33 1 1 
       3678 1 . . . . .  5.2 1.8 5.72 1 1 
       3679 1 . . . . . 5.47 1.8 6.02 1 1 
       3680 1 . . . . . 5.72 1.8 6.29 1 1 
       3681 1 . . . . . 5.52 1.8 6.07 1 1 
       3682 1 . . . . . 5.47 1.8 6.02 1 1 
       3683 1 . . . . . 5.09 1.8  5.6 1 1 
       3684 1 . . . . . 5.95 1.8 6.54 1 1 
       3685 1 . . . . .  6.2 1.8 6.82 1 1 
       3686 1 . . . . . 4.51 1.8 4.96 1 1 
       3687 1 . . . . . 4.72 1.8 5.19 1 1 
       3688 1 . . . . .  3.4 1.8 3.74 1 1 
       3689 1 . . . . . 4.61 1.8 5.07 1 1 
       3690 1 . . . . . 4.61 1.8 5.07 1 1 
       3691 1 . . . . .  6.2 1.8 6.82 1 1 
       3692 1 . . . . . 6.08 1.8 6.69 1 1 
       3693 1 . . . . . 5.75 1.8 6.32 1 1 
       3694 1 . . . . . 4.65 1.8 5.12 1 1 
       3695 1 . . . . . 3.64 1.8  4.0 1 1 
       3696 1 . . . . . 5.68 1.8 6.25 1 1 
       3697 1 . . . . . 3.39 1.8 3.73 1 1 
       3698 1 . . . . . 3.31 1.8 3.64 1 1 
       3699 1 . . . . . 3.82 1.8  4.2 1 1 
       3700 1 . . . . .  5.3 1.8 5.83 1 1 
       3701 1 . . . . . 4.06 1.8 4.47 1 1 
       3702 1 . . . . . 5.55 1.8 6.11 1 1 
       3703 1 . . . . . 5.55 1.8 6.11 1 1 
       3704 1 . . . . . 4.86 1.8 5.35 1 1 
       3705 1 . . . . . 6.03 1.8 6.63 1 1 
       3706 1 . . . . .  6.0 1.8  6.6 1 1 
       3707 1 . . . . .  6.2 1.8 6.82 1 1 
       3708 1 . . . . .  5.8 1.8 6.38 1 1 
       3709 1 . . . . . 5.32 1.8 5.85 1 1 
       3710 1 . . . . . 5.75 1.8 6.32 1 1 
       3711 1 . . . . . 5.08 1.8 5.59 1 1 
       3712 1 . . . . . 5.08 1.8 5.59 1 1 
       3713 1 . . . . . 5.75 1.8 6.32 1 1 
       3714 1 . . . . . 4.41 1.8 4.85 1 1 
       3715 1 . . . . . 5.43 1.8 5.97 1 1 
       3716 1 . . . . . 5.77 1.8 6.35 1 1 
       3717 1 . . . . . 5.58 1.8 6.14 1 1 
       3718 1 . . . . . 5.68 1.8 6.25 1 1 
       3719 1 . . . . . 4.69 1.8 5.16 1 1 
       3720 1 . . . . . 4.69 1.8 5.16 1 1 
       3721 1 . . . . . 4.69 1.8 5.16 1 1 
       3722 1 . . . . . 4.63 1.8 5.09 1 1 
       3723 1 . . . . .  6.2 1.8 6.82 1 1 
       3724 1 . . . . . 5.06 1.8 5.57 1 1 
       3725 1 . . . . . 5.89 1.8 6.48 1 1 
       3726 1 . . . . . 3.34 1.8 3.67 1 1 
       3727 1 . . . . . 4.85 1.8 5.33 1 1 
       3728 1 . . . . . 5.32 1.8 5.85 1 1 
       3729 1 . . . . . 4.05 1.8 4.46 1 1 
       3730 1 . . . . . 4.81 1.8 5.29 1 1 
       3731 1 . . . . . 6.05 1.8 6.66 1 1 
       3732 1 . . . . . 3.72 1.8 4.09 1 1 
       3733 1 . . . . . 3.72 1.8 4.09 1 1 
       3734 1 . . . . . 4.42 1.8 4.86 1 1 
       3735 1 . . . . . 3.72 1.8 4.09 1 1 
       3736 1 . . . . . 4.42 1.8 4.86 1 1 
       3737 1 . . . . . 5.64 1.8  6.2 1 1 
       3738 1 . . . . . 5.64 1.8  6.2 1 1 
       3739 1 . . . . . 4.97 1.8 5.47 1 1 
       3740 1 . . . . . 5.69 1.8 6.26 1 1 
       3741 1 . . . . . 4.99 1.8 5.49 1 1 
       3742 1 . . . . . 4.22 1.8 4.64 1 1 
       3743 1 . . . . . 4.71 1.8 5.18 1 1 
       3744 1 . . . . . 4.56 1.8 5.02 1 1 
       3745 1 . . . . . 4.92 1.8 5.41 1 1 
       3746 1 . . . . . 3.76 1.8 4.14 1 1 
       3747 1 . . . . . 3.54 1.8 3.89 1 1 
       3748 1 . . . . . 5.08 1.8 5.59 1 1 
       3749 1 . . . . . 5.37 1.8 5.91 1 1 
       3750 1 . . . . . 5.99 1.8 6.59 1 1 
       3751 1 . . . . . 6.05 1.8 6.66 1 1 
       3752 1 . . . . .  6.2 1.8 6.82 1 1 
       3753 1 . . . . . 4.35 1.8 4.79 1 1 
       3754 1 . . . . . 5.63 1.8 6.19 1 1 
       3755 1 . . . . . 4.86 1.8 5.35 1 1 
       3756 1 . . . . . 4.15 1.8 4.57 1 1 
       3757 1 . . . . .  6.2 1.8 6.82 1 1 
       3758 1 . . . . . 3.82 1.8  4.2 1 1 
       3759 1 . . . . . 5.46 1.8 6.01 1 1 
       3760 1 . . . . . 4.69 1.8 5.16 1 1 
       3761 1 . . . . .  5.7 1.8 6.27 1 1 
       3762 1 . . . . .  5.0 1.8  5.5 1 1 
       3763 1 . . . . . 4.95 1.8 5.44 1 1 
       3764 1 . . . . .  4.2 1.8 4.62 1 1 
       3765 1 . . . . . 5.15 1.8 5.67 1 1 
       3766 1 . . . . . 5.15 1.8 5.67 1 1 
       3767 1 . . . . . 4.81 1.8 5.29 1 1 
       3768 1 . . . . . 5.32 1.8 5.85 1 1 
       3769 1 . . . . . 5.19 1.8 5.71 1 1 
       3770 1 . . . . . 5.71 1.8 6.28 1 1 
       3771 1 . . . . . 4.43 1.8 4.87 1 1 
       3772 1 . . . . . 5.05 1.8 5.56 1 1 
       3773 1 . . . . . 3.67 1.8 4.04 1 1 
       3774 1 . . . . . 5.47 1.8 6.02 1 1 
       3775 1 . . . . . 6.01 1.8 6.61 1 1 
       3776 1 . . . . . 3.36 1.8  3.7 1 1 
       3777 1 . . . . . 4.79 1.8 5.27 1 1 
       3778 1 . . . . . 4.79 1.8 5.27 1 1 
       3779 1 . . . . . 5.83 1.8 6.41 1 1 
       3780 1 . . . . .  6.2 1.8 6.82 1 1 
       3781 1 . . . . .  6.2 1.8 6.82 1 1 
       3782 1 . . . . . 4.86 1.8 5.35 1 1 
       3783 1 . . . . . 3.69 1.8 4.06 1 1 
       3784 1 . . . . .  6.2 1.8 6.82 1 1 
       3785 1 . . . . . 5.18 1.8  5.7 1 1 
       3786 1 . . . . . 4.37 1.8 4.81 1 1 
       3787 1 . . . . .  5.0 1.8  5.5 1 1 
       3788 1 . . . . . 4.55 1.8 5.01 1 1 
       3789 1 . . . . . 4.95 1.8 5.44 1 1 
       3790 1 . . . . . 5.32 1.8 5.85 1 1 
       3791 1 . . . . . 5.61 1.8 6.17 1 1 
       3792 1 . . . . .  4.9 1.8 5.39 1 1 
       3793 1 . . . . . 5.35 1.8 5.89 1 1 
       3794 1 . . . . . 5.61 1.8 6.17 1 1 
       3795 1 . . . . . 5.57 1.8 6.13 1 1 
       3796 1 . . . . . 5.29 1.8 5.82 1 1 
       3797 1 . . . . . 5.93 1.8 6.52 1 1 
       3798 1 . . . . . 5.93 1.8 6.52 1 1 
       3799 1 . . . . .  6.2 1.8 6.82 1 1 
       3800 1 . . . . .  6.2 1.8 6.82 1 1 
       3801 1 . . . . .  6.2 1.8 6.82 1 1 
       3802 1 . . . . .  6.2 1.8 6.82 1 1 
       3803 1 . . . . .  5.3 1.8 5.83 1 1 
       3804 1 . . . . .  4.1 1.8 4.51 1 1 
       3805 1 . . . . .  6.2 1.8 6.82 1 1 
       3806 1 . . . . .  6.2 1.8 6.82 1 1 
       3807 1 . . . . . 4.27 1.8  4.7 1 1 
       3808 1 . . . . . 5.72 1.8 6.29 1 1 
       3809 1 . . . . .  6.2 1.8 6.82 1 1 
       3810 1 . . . . . 4.24 1.8 4.66 1 1 
       3811 1 . . . . . 6.07 1.8 6.68 1 1 
       3812 1 . . . . .  6.2 1.8 6.82 1 1 
       3813 1 . . . . . 6.13 1.8 6.74 1 1 
       3814 1 . . . . . 4.51 1.8 4.96 1 1 
       3815 1 . . . . . 4.69 1.8 5.16 1 1 
       3816 1 . . . . . 5.39 1.8 5.93 1 1 
       3817 1 . . . . . 6.06 1.8 6.67 1 1 
       3818 1 . . . . .  5.9 1.8 6.49 1 1 
       3819 1 . . . . .  6.2 1.8 6.82 1 1 
       3820 1 . . . . . 5.24 1.8 5.76 1 1 
       3821 1 . . . . . 4.73 1.8  5.2 1 1 
       3822 1 . . . . . 4.74 1.8 5.21 1 1 
       3823 1 . . . . . 5.49 1.8 6.04 1 1 
       3824 1 . . . . . 4.04 1.8 4.44 1 1 
       3825 1 . . . . . 4.79 1.8 5.27 1 1 
       3826 1 . . . . . 3.48 1.8 3.83 1 1 
       3827 1 . . . . . 3.83 1.8 4.21 1 1 
       3828 1 . . . . . 3.28 1.8 3.61 1 1 
       3829 1 . . . . . 4.52 1.8 4.97 1 1 
       3830 1 . . . . . 3.85 1.8 4.23 1 1 
       3831 1 . . . . . 3.85 1.8 4.23 1 1 
       3832 1 . . . . . 3.48 1.8 3.83 1 1 
       3833 1 . . . . . 3.71 1.8 4.08 1 1 
       3834 1 . . . . . 3.89 1.8 4.28 1 1 
       3835 1 . . . . . 3.74 1.8 4.11 1 1 
       3836 1 . . . . . 3.78 1.8 4.16 1 1 
       3837 1 . . . . . 3.88 1.8 4.27 1 1 
       3838 1 . . . . . 4.16 1.8 4.58 1 1 
       3839 1 . . . . . 4.82 1.8  5.3 1 1 
       3840 1 . . . . . 4.24 1.8 4.66 1 1 
       3841 1 . . . . . 4.33 1.8 4.76 1 1 
       3842 1 . . . . . 4.12 1.8 4.53 1 1 
       3843 1 . . . . . 4.49 1.8 4.94 1 1 
       3844 1 . . . . . 4.58 1.8 5.04 1 1 
       3845 1 . . . . . 5.35 1.8 5.89 1 1 
       3846 1 . . . . . 5.69 1.8 6.26 1 1 
       3847 1 . . . . . 3.89 1.8 4.28 1 1 
       3848 1 . . . . . 4.12 1.8 4.53 1 1 
       3849 1 . . . . . 3.07 1.8 3.38 1 1 
       3850 1 . . . . . 3.25 1.8 3.58 1 1 
       3851 1 . . . . . 3.45 1.8 3.79 1 1 
       3852 1 . . . . . 3.75 1.8 4.13 1 1 
       3853 1 . . . . . 3.29 1.8 3.62 1 1 
       3854 1 . . . . . 3.15 1.8 3.47 1 1 
       3855 1 . . . . . 3.64 1.8  4.0 1 1 
       3856 1 . . . . . 3.39 1.8 3.73 1 1 
       3857 1 . . . . . 3.78 1.8 4.16 1 1 
       3858 1 . . . . . 3.75 1.8 4.13 1 1 
       3859 1 . . . . . 4.71 1.8 5.18 1 1 
       3860 1 . . . . . 4.92 1.8 5.41 1 1 
       3861 1 . . . . . 4.46 1.8 4.91 1 1 
       3862 1 . . . . . 4.16 1.8 4.58 1 1 
       3863 1 . . . . . 4.62 1.8 5.08 1 1 
       3864 1 . . . . . 4.27 1.8  4.7 1 1 
       3865 1 . . . . . 3.64 1.8  4.0 1 1 
       3866 1 . . . . . 3.58 1.8 3.94 1 1 
       3867 1 . . . . . 3.18 1.8  3.5 1 1 
       3868 1 . . . . . 3.81 1.8 4.19 1 1 
       3869 1 . . . . . 3.31 1.8 3.64 1 1 
       3870 1 . . . . . 3.86 1.8 4.25 1 1 
       3871 1 . . . . . 4.03 1.8 4.43 1 1 
       3872 1 . . . . . 4.42 1.8 4.86 1 1 
       3873 1 . . . . . 3.57 1.8 3.93 1 1 
       3874 1 . . . . . 3.41 1.8 3.75 1 1 
       3875 1 . . . . . 4.44 1.8 4.88 1 1 
       3876 1 . . . . . 4.65 1.8 5.12 1 1 
       3877 1 . . . . . 3.65 1.8 4.02 1 1 
       3878 1 . . . . . 3.35 1.8 3.69 1 1 
       3879 1 . . . . . 3.75 1.8 4.13 1 1 
       3880 1 . . . . . 4.29 1.8 4.72 1 1 
       3881 1 . . . . .  5.0 1.8  5.5 1 1 
       3882 1 . . . . . 4.09 1.8  4.5 1 1 
       3883 1 . . . . . 3.87 1.8 4.26 1 1 
       3884 1 . . . . . 4.14 1.8 4.55 1 1 
       3885 1 . . . . . 4.13 1.8 4.54 1 1 
       3886 1 . . . . . 4.25 1.8 4.68 1 1 
       3887 1 . . . . . 4.67 1.8 5.14 1 1 
       3888 1 . . . . .  4.5 1.8 4.95 1 1 
       3889 1 . . . . . 4.63 1.8 5.09 1 1 
       3890 1 . . . . . 4.76 1.8 5.24 1 1 
       3891 1 . . . . . 4.04 1.8 4.44 1 1 
       3892 1 . . . . . 3.93 1.8 4.32 1 1 
       3893 1 . . . . . 4.03 1.8 4.43 1 1 
       3894 1 . . . . .  4.1 1.8 4.51 1 1 
       3895 1 . . . . .  4.1 1.8 4.51 1 1 
       3896 1 . . . . . 3.85 1.8 4.23 1 1 
       3897 1 . . . . . 3.04 1.8 3.34 1 1 
       3898 1 . . . . . 4.04 1.8 4.44 1 1 
       3899 1 . . . . .  4.2 1.8 4.62 1 1 
       3900 1 . . . . . 3.97 1.8 4.37 1 1 
       3901 1 . . . . . 4.38 1.8 4.82 1 1 
       3902 1 . . . . . 3.89 1.8 4.28 1 1 
       3903 1 . . . . . 3.56 1.8 3.92 1 1 
       3904 1 . . . . . 3.23 1.8 3.55 1 1 
       3905 1 . . . . . 3.25 1.8 3.58 1 1 
       3906 1 . . . . . 3.61 1.8 3.97 1 1 
       3907 1 . . . . . 3.35 1.8 3.69 1 1 
       3908 1 . . . . . 3.42 1.8 3.76 1 1 
       3909 1 . . . . . 4.48 1.8 4.93 1 1 
       3910 1 . . . . . 4.85 1.8 5.33 1 1 
       3911 1 . . . . . 4.24 1.8 4.66 1 1 
       3912 1 . . . . . 4.11 1.8 4.52 1 1 
       3913 1 . . . . . 3.56 1.8 3.92 1 1 
       3914 1 . . . . . 3.89 1.8 4.28 1 1 
       3915 1 . . . . . 3.67 1.8 4.04 1 1 
       3916 1 . . . . . 4.13 1.8 4.54 1 1 
       3917 1 . . . . .  5.4 1.8 5.94 1 1 
       3918 1 . . . . . 6.09 1.8  6.7 1 1 
       3919 1 . . . . . 4.16 1.8 4.58 1 1 
       3920 1 . . . . . 4.64 1.8  5.1 1 1 
       3921 1 . . . . .  5.4 1.8 5.94 1 1 
       3922 1 . . . . . 5.04 1.8 5.54 1 1 
       3923 1 . . . . . 5.04 1.8 5.54 1 1 
       3924 1 . . . . . 4.05 1.8 4.46 1 1 
       3925 1 . . . . . 3.18 1.8  3.5 1 1 
       3926 1 . . . . . 3.21 1.8 3.53 1 1 
       3927 1 . . . . . 3.58 1.8 3.94 1 1 
       3928 1 . . . . . 3.47 1.8 3.82 1 1 
       3929 1 . . . . . 4.88 1.8 5.37 1 1 
       3930 1 . . . . . 3.53 1.8 3.88 1 1 
       3931 1 . . . . . 4.05 1.8 4.46 1 1 
       3932 1 . . . . . 3.62 1.8 3.98 1 1 
       3933 1 . . . . . 3.91 1.8  4.3 1 1 
       3934 1 . . . . . 5.04 1.8 5.54 1 1 
       3935 1 . . . . . 3.71 1.8 4.08 1 1 
       3936 1 . . . . . 4.06 1.8 4.47 1 1 
       3937 1 . . . . . 4.21 1.8 4.63 1 1 
       3938 1 . . . . . 4.07 1.8 4.48 1 1 
       3939 1 . . . . . 4.26 1.8 4.69 1 1 
       3940 1 . . . . . 5.77 1.8 6.35 1 1 
       3941 1 . . . . .  4.4 1.8 4.84 1 1 
       3942 1 . . . . . 4.29 1.8 4.72 1 1 
       3943 1 . . . . . 4.17 1.8 4.59 1 1 
       3944 1 . . . . . 4.34 1.8 4.77 1 1 
       3945 1 . . . . . 4.47 1.8 4.92 1 1 
       3946 1 . . . . . 3.76 1.8 4.14 1 1 
       3947 1 . . . . . 4.48 1.8 4.93 1 1 
       3948 1 . . . . . 3.28 1.8 3.61 1 1 
       3949 1 . . . . . 4.98 1.8 5.48 1 1 
       3950 1 . . . . . 5.45 1.8  6.0 1 1 
       3951 1 . . . . . 4.52 1.8 4.97 1 1 
       3952 1 . . . . . 4.33 1.8 4.76 1 1 
       3953 1 . . . . . 4.14 1.8 4.55 1 1 
       3954 1 . . . . .  3.5 1.8 3.85 1 1 
       3955 1 . . . . .  3.7 1.8 4.07 1 1 
       3956 1 . . . . . 4.14 1.8 4.55 1 1 
       3957 1 . . . . . 3.73 1.8  4.1 1 1 
       3958 1 . . . . . 5.74 1.8 6.31 1 1 
       3959 1 . . . . . 3.75 1.8 4.13 1 1 
       3960 1 . . . . . 4.24 1.8 4.66 1 1 
       3961 1 . . . . . 4.66 1.8 5.13 1 1 
       3962 1 . . . . . 4.23 1.8 4.65 1 1 
       3963 1 . . . . . 5.24 1.8 5.76 1 1 
       3964 1 . . . . . 3.63 1.8 3.99 1 1 
       3965 1 . . . . . 5.19 1.8 5.71 1 1 
       3966 1 . . . . . 4.44 1.8 4.88 1 1 
       3967 1 . . . . . 4.39 1.8 4.83 1 1 
       3968 1 . . . . . 4.39 1.8 4.83 1 1 
       3969 1 . . . . . 4.72 1.8 5.19 1 1 
       3970 1 . . . . . 4.86 1.8 5.35 1 1 
       3971 1 . . . . . 4.13 1.8 4.54 1 1 
       3972 1 . . . . . 4.89 1.8 5.38 1 1 
       3973 1 . . . . . 3.67 1.8 4.04 1 1 
       3974 1 . . . . . 4.47 1.8 4.92 1 1 
       3975 1 . . . . . 3.11 1.8 3.42 1 1 
       3976 1 . . . . . 4.56 1.8 5.02 1 1 
       3977 1 . . . . . 4.84 1.8 5.32 1 1 
       3978 1 . . . . . 5.09 1.8  5.6 1 1 
       3979 1 . . . . . 3.94 1.8 4.33 1 1 
       3980 1 . . . . . 3.08 1.8 3.39 1 1 
       3981 1 . . . . . 4.16 1.8 4.58 1 1 
       3982 1 . . . . . 4.69 1.8 5.16 1 1 
       3983 1 . . . . .  3.2 1.8 3.52 1 1 
       3984 1 . . . . .  3.5 1.8 3.85 1 1 
       3985 1 . . . . . 3.84 1.8 4.22 1 1 
       3986 1 . . . . . 4.85 1.8 5.33 1 1 
       3987 1 . . . . . 3.96 1.8 4.36 1 1 
       3988 1 . . . . . 3.76 1.8 4.14 1 1 
       3989 1 . . . . . 4.33 1.8 4.76 1 1 
       3990 1 . . . . . 4.48 1.8 4.93 1 1 
       3991 1 . . . . . 4.52 1.8 4.97 1 1 
       3992 1 . . . . .  5.3 1.8 5.83 1 1 
       3993 1 . . . . .  4.6 1.8 5.06 1 1 
       3994 1 . . . . . 3.49 1.8 3.84 1 1 
       3995 1 . . . . . 4.34 1.8 4.77 1 1 
       3996 1 . . . . . 4.29 1.8 4.72 1 1 
       3997 1 . . . . . 4.45 1.8 4.89 1 1 
       3998 1 . . . . . 5.05 1.8 5.56 1 1 
       3999 1 . . . . . 3.38 1.8 3.72 1 1 
       4000 1 . . . . . 4.33 1.8 4.76 1 1 
       4001 1 . . . . . 3.28 1.8 3.61 1 1 
       4002 1 . . . . . 4.39 1.8 4.83 1 1 
       4003 1 . . . . . 4.45 1.8 4.89 1 1 
       4004 1 . . . . . 5.13 1.8 5.64 1 1 
       4005 1 . . . . . 3.75 1.8 4.13 1 1 
       4006 1 . . . . . 3.79 1.8 4.17 1 1 
       4007 1 . . . . .  4.5 1.8 4.95 1 1 
       4008 1 . . . . . 4.25 1.8 4.68 1 1 
       4009 1 . . . . . 3.68 1.8 4.05 1 1 
       4010 1 . . . . . 3.31 1.8 3.64 1 1 
       4011 1 . . . . . 4.37 1.8 4.81 1 1 
       4012 1 . . . . . 4.13 1.8 4.54 1 1 
       4013 1 . . . . . 4.47 1.8 4.92 1 1 
       4014 1 . . . . . 4.27 1.8  4.7 1 1 
       4015 1 . . . . . 3.68 1.8 4.05 1 1 
       4016 1 . . . . . 5.37 1.8 5.91 1 1 
       4017 1 . . . . . 4.74 1.8 5.21 1 1 
       4018 1 . . . . . 4.74 1.8 5.21 1 1 
       4019 1 . . . . . 4.01 1.8 4.41 1 1 
       4020 1 . . . . . 5.76 1.8 6.34 1 1 
       4021 1 . . . . . 3.83 1.8 4.21 1 1 
       4022 1 . . . . . 3.58 1.8 3.94 1 1 
       4023 1 . . . . . 4.03 1.8 4.43 1 1 
       4024 1 . . . . . 4.01 1.8 4.41 1 1 
       4025 1 . . . . . 3.51 1.8 3.86 1 1 
       4026 1 . . . . . 3.42 1.8 3.76 1 1 
       4027 1 . . . . . 4.48 1.8 4.93 1 1 
       4028 1 . . . . .  4.4 1.8 4.84 1 1 
       4029 1 . . . . . 5.41 1.8 5.95 1 1 
       4030 1 . . . . . 3.59 1.8 3.95 1 1 
       4031 1 . . . . . 4.14 1.8 4.55 1 1 
       4032 1 . . . . . 4.61 1.8 5.07 1 1 
       4033 1 . . . . . 3.58 1.8 3.94 1 1 
       4034 1 . . . . . 3.57 1.8 3.93 1 1 
       4035 1 . . . . . 4.05 1.8 4.46 1 1 
       4036 1 . . . . . 3.99 1.8 4.39 1 1 
       4037 1 . . . . . 4.17 1.8 4.59 1 1 
       4038 1 . . . . . 4.55 1.8 5.01 1 1 
       4039 1 . . . . . 4.42 1.8 4.86 1 1 
       4040 1 . . . . .  5.5 1.8 6.05 1 1 
       4041 1 . . . . . 6.07 1.8 6.68 1 1 
       4042 1 . . . . .  6.2 1.8 6.82 1 1 
       4043 1 . . . . . 4.19 1.8 4.61 1 1 
       4044 1 . . . . . 4.19 1.8 4.61 1 1 
       4045 1 . . . . . 4.81 1.8 5.29 1 1 
       4046 1 . . . . .  6.2 1.8 6.82 1 1 
       4047 1 . . . . .  3.6 1.8 3.96 1 1 
       4048 1 . . . . . 5.42 1.8 5.96 1 1 
       4049 1 . . . . . 5.42 1.8 5.96 1 1 
       4050 1 . . . . . 5.05 1.8 5.56 1 1 
       4051 1 . . . . . 4.47 1.8 4.92 1 1 
       4052 1 . . . . . 4.17 1.8 4.59 1 1 
       4053 1 . . . . . 4.17 1.8 4.59 1 1 
       4054 1 . . . . . 3.69 1.8 4.06 1 1 
       4055 1 . . . . . 4.06 1.8 4.47 1 1 
       4056 1 . . . . . 4.62 1.8 5.08 1 1 
       4057 1 . . . . . 5.18 1.8  5.7 1 1 
       4058 1 . . . . . 4.52 1.8 4.97 1 1 
       4059 1 . . . . . 4.48 1.8 4.93 1 1 
       4060 1 . . . . . 4.29 1.8 4.72 1 1 
       4061 1 . . . . . 3.92 1.8 4.31 1 1 
       4062 1 . . . . . 3.62 1.8 3.98 1 1 
       4063 1 . . . . . 4.29 1.8 4.72 1 1 
       4064 1 . . . . . 4.47 1.8 4.92 1 1 
       4065 1 . . . . . 3.92 1.8 4.31 1 1 
       4066 1 . . . . . 4.51 1.8 4.96 1 1 
       4067 1 . . . . . 4.92 1.8 5.41 1 1 
       4068 1 . . . . . 4.43 1.8 4.87 1 1 
       4069 1 . . . . . 4.65 1.8 5.12 1 1 
       4070 1 . . . . .  4.1 1.8 4.51 1 1 
       4071 1 . . . . . 4.14 1.8 4.55 1 1 
       4072 1 . . . . . 4.72 1.8 5.19 1 1 
       4073 1 . . . . . 3.64 1.8  4.0 1 1 
       4074 1 . . . . . 3.46 1.8 3.81 1 1 
       4075 1 . . . . . 4.92 1.8 5.41 1 1 
       4076 1 . . . . .  4.0 1.8  4.4 1 1 
       4077 1 . . . . . 4.55 1.8 5.01 1 1 
       4078 1 . . . . . 4.83 1.8 5.31 1 1 
       4079 1 . . . . . 4.83 1.8 5.31 1 1 
       4080 1 . . . . . 5.24 1.8 5.76 1 1 
       4081 1 . . . . . 5.24 1.8 5.76 1 1 
       4082 1 . . . . . 4.75 1.8 5.22 1 1 
       4083 1 . . . . . 4.64 1.8  5.1 1 1 
       4084 1 . . . . . 4.71 1.8 5.18 1 1 
       4085 1 . . . . . 4.89 1.8 5.38 1 1 
       4086 1 . . . . . 4.89 1.8 5.38 1 1 
       4087 1 . . . . .  4.2 1.8 4.62 1 1 
       4088 1 . . . . . 4.19 1.8 4.61 1 1 
       4089 1 . . . . . 4.86 1.8 5.35 1 1 
       4090 1 . . . . . 5.47 1.8 6.02 1 1 
       4091 1 . . . . . 4.81 1.8 5.29 1 1 
       4092 1 . . . . . 3.97 1.8 4.37 1 1 
       4093 1 . . . . . 5.15 1.8 5.67 1 1 
       4094 1 . . . . . 4.77 1.8 5.25 1 1 
       4095 1 . . . . . 4.65 1.8 5.12 1 1 
       4096 1 . . . . . 4.16 1.8 4.58 1 1 
       4097 1 . . . . . 4.58 1.8 5.04 1 1 
       4098 1 . . . . . 4.08 1.8 4.49 1 1 
       4099 1 . . . . . 3.27 1.8  3.6 1 1 
       4100 1 . . . . . 4.28 1.8 4.71 1 1 
       4101 1 . . . . . 4.94 1.8 5.43 1 1 
       4102 1 . . . . . 4.23 1.8 4.65 1 1 
       4103 1 . . . . . 3.03 1.8 3.33 1 1 
       4104 1 . . . . . 4.89 1.8 5.38 1 1 
       4105 1 . . . . . 3.56 1.8 3.92 1 1 
       4106 1 . . . . . 4.57 1.8 5.03 1 1 
       4107 1 . . . . . 4.34 1.8 4.77 1 1 
       4108 1 . . . . . 4.32 1.8 4.75 1 1 
       4109 1 . . . . . 3.26 1.8 3.59 1 1 
       4110 1 . . . . . 5.18 1.8  5.7 1 1 
       4111 1 . . . . . 5.28 1.8 5.81 1 1 
       4112 1 . . . . . 5.92 1.8 6.51 1 1 
       4113 1 . . . . . 5.29 1.8 5.82 1 1 
       4114 1 . . . . . 4.81 1.8 5.29 1 1 
       4115 1 . . . . . 4.27 1.8  4.7 1 1 
       4116 1 . . . . . 5.05 1.8 5.56 1 1 
       4117 1 . . . . .  6.0 1.8  6.6 1 1 
       4118 1 . . . . . 4.63 1.8 5.09 1 1 
       4119 1 . . . . . 4.74 1.8 5.21 1 1 
       4120 1 . . . . . 3.28 1.8 3.61 1 1 
       4121 1 . . . . . 4.98 1.8 5.48 1 1 
       4122 1 . . . . . 3.13 1.8 3.44 1 1 
       4123 1 . . . . . 3.58 1.8 3.94 1 1 
       4124 1 . . . . . 5.14 1.8 5.65 1 1 
       4125 1 . . . . . 4.91 1.8  5.4 1 1 
       4126 1 . . . . . 4.68 1.8 5.15 1 1 
       4127 1 . . . . . 5.15 1.8 5.67 1 1 
       4128 1 . . . . . 5.65 1.8 6.21 1 1 
       4129 1 . . . . . 5.05 1.8 5.56 1 1 
       4130 1 . . . . .  6.0 1.8  6.6 1 1 
       4131 1 . . . . . 4.89 1.8 5.38 1 1 
       4132 1 . . . . . 3.89 1.8 4.28 1 1 
       4133 1 . . . . . 3.74 1.8 4.11 1 1 
       4134 1 . . . . . 5.84 1.8 6.42 1 1 
       4135 1 . . . . . 3.67 1.8 4.04 1 1 
       4136 1 . . . . .  4.2 1.8 4.62 1 1 
       4137 1 . . . . .  6.0 1.8  6.6 1 1 
       4138 1 . . . . . 4.42 1.8 4.86 1 1 
       4139 1 . . . . . 4.26 1.8 4.69 1 1 
       4140 1 . . . . . 5.25 1.8 5.78 1 1 
       4141 1 . . . . .  6.0 1.8  6.6 1 1 
       4142 1 . . . . .  6.0 1.8  6.6 1 1 
       4143 1 . . . . . 3.64 1.8  4.0 1 1 
       4144 1 . . . . . 4.46 1.8 4.91 1 1 
       4145 1 . . . . . 3.71 1.8 4.08 1 1 
       4146 1 . . . . .  6.0 1.8  6.6 1 1 
       4147 1 . . . . . 4.83 1.8 5.31 1 1 
       4148 1 . . . . . 5.49 1.8 6.04 1 1 
       4149 1 . . . . .  4.4 1.8 4.84 1 1 
       4150 1 . . . . . 5.67 1.8 6.24 1 1 
       4151 1 . . . . . 5.11 1.8 5.62 1 1 
       4152 1 . . . . . 4.09 1.8  4.5 1 1 
       4153 1 . . . . . 5.79 1.8 6.37 1 1 
       4154 1 . . . . . 5.66 1.8 6.23 1 1 
       4155 1 . . . . . 4.94 1.8 5.43 1 1 
       4156 1 . . . . . 3.83 1.8 4.21 1 1 
       4157 1 . . . . . 3.92 1.8 4.31 1 1 
       4158 1 . . . . . 3.16 1.8 3.48 1 1 
       4159 1 . . . . . 4.47 1.8 4.92 1 1 
       4160 1 . . . . . 4.55 1.8 5.01 1 1 
       4161 1 . . . . . 5.33 1.8 5.86 1 1 
       4162 1 . . . . . 5.24 1.8 5.76 1 1 
       4163 1 . . . . . 4.24 1.8 4.66 1 1 
       4164 1 . . . . . 4.54 1.8 4.99 1 1 
       4165 1 . . . . . 4.46 1.8 4.91 1 1 
       4166 1 . . . . . 4.14 1.8 4.55 1 1 
       4167 1 . . . . . 3.88 1.8 4.27 1 1 
       4168 1 . . . . . 3.53 1.8 3.88 1 1 
       4169 1 . . . . .  3.3 1.8 3.63 1 1 
       4170 1 . . . . . 3.63 1.8 3.99 1 1 
       4171 1 . . . . . 2.52 1.8 2.77 1 1 
       4172 1 . . . . . 2.52 1.8 2.77 1 1 
       4173 1 . . . . . 4.24 1.8 4.66 1 1 
       4174 1 . . . . .  6.0 1.8  6.6 1 1 
       4175 1 . . . . . 5.06 1.8 5.57 1 1 
       4176 1 . . . . . 4.89 1.8 5.38 1 1 
       4177 1 . . . . . 4.06 1.8 4.47 1 1 
       4178 1 . . . . . 4.97 1.8 5.47 1 1 
       4179 1 . . . . . 3.12 1.8 3.43 1 1 
       4180 1 . . . . . 5.17 1.8 5.69 1 1 
       4181 1 . . . . . 4.49 1.8 4.94 1 1 
       4182 1 . . . . . 4.26 1.8 4.69 1 1 
       4183 1 . . . . . 4.36 1.8  4.8 1 1 
       4184 1 . . . . .  6.0 1.8  6.6 1 1 
       4185 1 . . . . . 2.92 1.8 3.21 1 1 
       4186 1 . . . . . 3.75 1.8 4.13 1 1 
       4187 1 . . . . . 4.61 1.8 5.07 1 1 
       4188 1 . . . . . 3.33 1.8 3.66 1 1 
       4189 1 . . . . . 4.46 1.8 4.91 1 1 
       4190 1 . . . . . 2.56 1.8 2.82 1 1 
       4191 1 . . . . . 4.22 1.8 4.64 1 1 
       4192 1 . . . . . 3.18 1.8  3.5 1 1 
       4193 1 . . . . . 4.54 1.8 4.99 1 1 
       4194 1 . . . . . 4.39 1.8 4.83 1 1 
       4195 1 . . . . . 2.28 1.8 2.51 1 1 
       4196 1 . . . . .  3.3 1.8 3.63 1 1 
       4197 1 . . . . .  4.5 1.8 4.95 1 1 
       4198 1 . . . . . 4.39 1.8 4.83 1 1 
       4199 1 . . . . . 4.07 1.8 4.48 1 1 
       4200 1 . . . . . 3.35 1.8 3.69 1 1 
       4201 1 . . . . . 5.58 1.8 6.14 1 1 
       4202 1 . . . . . 5.08 1.8 5.59 1 1 
       4203 1 . . . . . 4.68 1.8 5.15 1 1 
       4204 1 . . . . .  5.6 1.8 6.16 1 1 
       4205 1 . . . . . 4.18 1.8  4.6 1 1 
       4206 1 . . . . . 5.18 1.8  5.7 1 1 
       4207 1 . . . . . 5.09 1.8  5.6 1 1 
       4208 1 . . . . . 3.83 1.8 4.21 1 1 
       4209 1 . . . . . 3.89 1.8 4.28 1 1 
       4210 1 . . . . . 5.86 1.8 6.45 1 1 
       4211 1 . . . . . 5.08 1.8 5.59 1 1 
       4212 1 . . . . . 4.21 1.8 4.63 1 1 
       4213 1 . . . . . 4.13 1.8 4.54 1 1 
       4214 1 . . . . .  4.9 1.8 5.39 1 1 
       4215 1 . . . . .  6.0 1.8  6.6 1 1 
       4216 1 . . . . . 4.11 1.8 4.52 1 1 
       4217 1 . . . . . 3.52 1.8 3.87 1 1 
       4218 1 . . . . . 4.46 1.8 4.91 1 1 
       4219 1 . . . . . 5.62 1.8 6.18 1 1 
       4220 1 . . . . . 4.79 1.8 5.27 1 1 
       4221 1 . . . . . 3.13 1.8 3.44 1 1 
       4222 1 . . . . . 3.28 1.8 3.61 1 1 
       4223 1 . . . . . 4.38 1.8 4.82 1 1 
       4224 1 . . . . . 4.65 1.8 5.12 1 1 
       4225 1 . . . . .  4.1 1.8 4.51 1 1 
       4226 1 . . . . . 4.58 1.8 5.04 1 1 
       4227 1 . . . . . 3.33 1.8 3.66 1 1 
       4228 1 . . . . . 3.36 1.8  3.7 1 1 
       4229 1 . . . . . 3.61 1.8 3.97 1 1 
       4230 1 . . . . . 3.84 1.8 4.22 1 1 
       4231 1 . . . . . 3.88 1.8 4.27 1 1 
       4232 1 . . . . . 2.45 1.8  2.7 1 1 
       4233 1 . . . . . 4.18 1.8  4.6 1 1 
       4234 1 . . . . . 5.54 1.8 6.09 1 1 
       4235 1 . . . . .  3.6 1.8 3.96 1 1 
       4236 1 . . . . . 5.14 1.8 5.65 1 1 
       4237 1 . . . . . 4.86 1.8 5.35 1 1 
       4238 1 . . . . . 3.38 1.8 3.72 1 1 
       4239 1 . . . . . 4.88 1.8 5.37 1 1 
       4240 1 . . . . . 3.51 1.8 3.86 1 1 
       4241 1 . . . . . 3.07 1.8 3.38 1 1 
       4242 1 . . . . . 5.02 1.8 5.52 1 1 
       4243 1 . . . . . 4.52 1.8 4.97 1 1 
       4244 1 . . . . . 3.31 1.8 3.64 1 1 
       4245 1 . . . . . 4.54 1.8 4.99 1 1 
       4246 1 . . . . . 4.45 1.8 4.89 1 1 
       4247 1 . . . . .  5.7 1.8 6.27 1 1 
       4248 1 . . . . . 2.99 1.8 3.29 1 1 
       4249 1 . . . . . 3.29 1.8 3.62 1 1 
       4250 1 . . . . . 6.11 1.8 6.72 1 1 
       4251 1 . . . . . 2.53 1.8 2.78 1 1 
       4252 1 . . . . .  3.7 1.8 4.07 1 1 
       4253 1 . . . . . 3.29 1.8 3.62 1 1 
       4254 1 . . . . . 4.18 1.8  4.6 1 1 
       4255 1 . . . . . 3.29 1.8 3.62 1 1 
       4256 1 . . . . . 3.75 1.8 4.13 1 1 
       4257 1 . . . . . 5.58 1.8 6.14 1 1 
       4258 1 . . . . .  5.9 1.8 6.49 1 1 
       4259 1 . . . . . 4.75 1.8 5.22 1 1 
       4260 1 . . . . . 5.33 1.8 5.86 1 1 
       4261 1 . . . . . 5.25 1.8 5.78 1 1 
       4262 1 . . . . . 3.68 1.8 4.05 1 1 
       4263 1 . . . . . 2.73 1.8  3.0 1 1 
       4264 1 . . . . . 3.57 1.8 3.93 1 1 
       4265 1 . . . . . 5.03 1.8 5.53 1 1 
       4266 1 . . . . . 3.68 1.8 4.05 1 1 
       4267 1 . . . . . 4.14 1.8 4.55 1 1 
       4268 1 . . . . .  3.2 1.8 3.52 1 1 
       4269 1 . . . . . 4.15 1.8 4.57 1 1 
       4270 1 . . . . . 5.05 1.8 5.56 1 1 
       4271 1 . . . . . 3.95 1.8 4.35 1 1 
       4272 1 . . . . . 5.42 1.8 5.96 1 1 
       4273 1 . . . . . 4.57 1.8 5.03 1 1 
       4274 1 . . . . . 5.21 1.8 5.73 1 1 
       4275 1 . . . . . 4.54 1.8 4.99 1 1 
       4276 1 . . . . . 4.49 1.8 4.94 1 1 
       4277 1 . . . . . 4.42 1.8 4.86 1 1 
       4278 1 . . . . . 4.18 1.8  4.6 1 1 
       4279 1 . . . . . 2.97 1.8 3.27 1 1 
       4280 1 . . . . . 5.95 1.8 6.54 1 1 
       4281 1 . . . . . 2.93 1.8 3.22 1 1 
       4282 1 . . . . . 6.11 1.8 6.72 1 1 
       4283 1 . . . . . 4.27 1.8  4.7 1 1 
       4284 1 . . . . . 4.88 1.8 5.37 1 1 
       4285 1 . . . . . 5.54 1.8 6.09 1 1 
       4286 1 . . . . . 3.18 1.8  3.5 1 1 
       4287 1 . . . . . 3.28 1.8 3.61 1 1 
       4288 1 . . . . . 3.67 1.8 4.04 1 1 
       4289 1 . . . . . 4.99 1.8 5.49 1 1 
       4290 1 . . . . . 4.06 1.8 4.47 1 1 
       4291 1 . . . . . 4.27 1.8  4.7 1 1 
       4292 1 . . . . . 4.37 1.8 4.81 1 1 
       4293 1 . . . . . 3.61 1.8 3.97 1 1 
       4294 1 . . . . .  2.8 1.8 3.08 1 1 
       4295 1 . . . . . 4.41 1.8 4.85 1 1 
       4296 1 . . . . .  4.7 1.8 5.17 1 1 
       4297 1 . . . . . 2.96 1.8 3.26 1 1 
       4298 1 . . . . . 4.57 1.8 5.03 1 1 
       4299 1 . . . . . 4.29 1.8 4.72 1 1 
       4300 1 . . . . . 5.67 1.8 6.24 1 1 
       4301 1 . . . . . 4.27 1.8  4.7 1 1 
       4302 1 . . . . . 3.57 1.8 3.93 1 1 
       4303 1 . . . . . 3.92 1.8 4.31 1 1 
       4304 1 . . . . . 4.11 1.8 4.52 1 1 
       4305 1 . . . . . 4.89 1.8 5.38 1 1 
       4306 1 . . . . . 5.26 1.8 5.79 1 1 
       4307 1 . . . . . 3.75 1.8 4.13 1 1 
       4308 1 . . . . . 4.56 1.8 5.02 1 1 
       4309 1 . . . . . 3.24 1.8 3.56 1 1 
       4310 1 . . . . .  3.6 1.8 3.96 1 1 
       4311 1 . . . . . 4.17 1.8 4.59 1 1 
       4312 1 . . . . . 4.76 1.8 5.24 1 1 
       4313 1 . . . . . 3.89 1.8 4.28 1 1 
       4314 1 . . . . .  5.6 1.8 6.16 1 1 
       4315 1 . . . . . 5.13 1.8 5.64 1 1 
       4316 1 . . . . . 3.25 1.8 3.58 1 1 
       4317 1 . . . . . 4.24 1.8 4.66 1 1 
       4318 1 . . . . . 5.39 1.8 5.93 1 1 
       4319 1 . . . . . 3.74 1.8 4.11 1 1 
       4320 1 . . . . . 5.17 1.8 5.69 1 1 
       4321 1 . . . . . 3.06 1.8 3.37 1 1 
       4322 1 . . . . . 5.68 1.8 6.25 1 1 
       4323 1 . . . . . 3.97 1.8 4.37 1 1 
       4324 1 . . . . . 4.84 1.8 5.32 1 1 
       4325 1 . . . . . 4.62 1.8 5.08 1 1 
       4326 1 . . . . . 3.78 1.8 4.16 1 1 
       4327 1 . . . . . 4.73 1.8  5.2 1 1 
       4328 1 . . . . . 4.97 1.8 5.47 1 1 
       4329 1 . . . . . 3.09 1.8  3.4 1 1 
       4330 1 . . . . . 2.38 1.8 2.62 1 1 
       4331 1 . . . . . 2.42 1.8 2.66 1 1 
       4332 1 . . . . . 3.82 1.8  4.2 1 1 
       4333 1 . . . . . 2.53 1.8 2.78 1 1 
       4334 1 . . . . . 3.29 1.8 3.62 1 1 
       4335 1 . . . . . 4.11 1.8 4.52 1 1 
       4336 1 . . . . . 5.28 1.8 5.81 1 1 
       4337 1 . . . . . 3.45 1.8 3.79 1 1 
       4338 1 . . . . . 5.66 1.8 6.23 1 1 
       4339 1 . . . . . 3.37 1.8 3.71 1 1 
       4340 1 . . . . . 2.95 1.8 3.25 1 1 
       4341 1 . . . . . 3.79 1.8 4.17 1 1 
       4342 1 . . . . . 3.44 1.8 3.78 1 1 
       4343 1 . . . . . 3.02 1.8 3.32 1 1 
       4344 1 . . . . . 4.25 1.8 4.68 1 1 
       4345 1 . . . . . 4.85 1.8 5.33 1 1 
       4346 1 . . . . .  3.3 1.8 3.63 1 1 
       4347 1 . . . . . 3.91 1.8  4.3 1 1 
       4348 1 . . . . . 4.27 1.8  4.7 1 1 
       4349 1 . . . . . 3.28 1.8 3.61 1 1 
       4350 1 . . . . . 3.73 1.8  4.1 1 1 
       4351 1 . . . . . 3.47 1.8 3.82 1 1 
       4352 1 . . . . . 2.94 1.8 3.23 1 1 
       4353 1 . . . . . 4.77 1.8 5.25 1 1 
       4354 1 . . . . . 4.07 1.8 4.48 1 1 
       4355 1 . . . . . 4.88 1.8 5.37 1 1 
       4356 1 . . . . . 3.35 1.8 3.69 1 1 
       4357 1 . . . . . 4.74 1.8 5.21 1 1 
       4358 1 . . . . . 4.89 1.8 5.38 1 1 
       4359 1 . . . . . 4.37 1.8 4.81 1 1 
       4360 1 . . . . . 4.52 1.8 4.97 1 1 
       4361 1 . . . . . 5.67 1.8 6.24 1 1 
       4362 1 . . . . . 3.94 1.8 4.33 1 1 
       4363 1 . . . . . 4.57 1.8 5.03 1 1 
       4364 1 . . . . . 3.63 1.8 3.99 1 1 
       4365 1 . . . . . 3.18 1.8  3.5 1 1 
       4366 1 . . . . . 4.57 1.8 5.03 1 1 
       4367 1 . . . . . 3.28 1.8 3.61 1 1 
       4368 1 . . . . . 3.14 1.8 3.45 1 1 
       4369 1 . . . . .  4.4 1.8 4.84 1 1 
       4370 1 . . . . . 2.89 1.8 3.18 1 1 
       4371 1 . . . . . 3.56 1.8 3.92 1 1 
       4372 1 . . . . . 2.88 1.8 3.17 1 1 
       4373 1 . . . . . 3.11 1.8 3.42 1 1 
       4374 1 . . . . . 4.61 1.8 5.07 1 1 
       4375 1 . . . . . 3.57 1.8 3.93 1 1 
       4376 1 . . . . . 4.69 1.8 5.16 1 1 
       4377 1 . . . . .  3.7 1.8 4.07 1 1 
       4378 1 . . . . . 3.49 1.8 3.84 1 1 
       4379 1 . . . . . 3.89 1.8 4.28 1 1 
       4380 1 . . . . . 5.23 1.8 5.75 1 1 
       4381 1 . . . . . 4.54 1.8 4.99 1 1 
       4382 1 . . . . . 3.33 1.8 3.66 1 1 
       4383 1 . . . . . 3.78 1.8 4.16 1 1 
       4384 1 . . . . .  4.5 1.8 4.95 1 1 
       4385 1 . . . . . 3.86 1.8 4.25 1 1 
       4386 1 . . . . .  3.0 1.8  3.3 1 1 
       4387 1 . . . . . 2.61 1.8 2.87 1 1 
       4388 1 . . . . . 3.19 1.8 3.51 1 1 
       4389 1 . . . . . 5.09 1.8  5.6 1 1 
       4390 1 . . . . . 2.35 1.8 2.58 1 1 
       4391 1 . . . . . 4.53 1.8 4.98 1 1 
       4392 1 . . . . . 5.16 1.8 5.68 1 1 
       4393 1 . . . . .  3.8 1.8 4.18 1 1 
       4394 1 . . . . . 3.74 1.8 4.11 1 1 
       4395 1 . . . . . 4.11 1.8 4.52 1 1 
       4396 1 . . . . .  6.0 1.8  6.6 1 1 
       4397 1 . . . . . 5.01 1.8 5.51 1 1 
       4398 1 . . . . . 5.43 1.8 5.97 1 1 
       4399 1 . . . . . 3.95 1.8 4.35 1 1 
       4400 1 . . . . . 3.38 1.8 3.72 1 1 
       4401 1 . . . . . 3.13 1.8 3.44 1 1 
       4402 1 . . . . . 4.47 1.8 4.92 1 1 
       4403 1 . . . . . 3.29 1.8 3.62 1 1 
       4404 1 . . . . . 4.02 1.8 4.42 1 1 
       4405 1 . . . . . 3.69 1.8 4.06 1 1 
       4406 1 . . . . . 4.08 1.8 4.49 1 1 
       4407 1 . . . . . 2.27 1.8  2.5 1 1 
       4408 1 . . . . . 4.76 1.8 5.24 1 1 
       4409 1 . . . . . 3.65 1.8 4.02 1 1 
       4410 1 . . . . . 5.38 1.8 5.92 1 1 
       4411 1 . . . . . 4.62 1.8 5.08 1 1 
       4412 1 . . . . . 5.49 1.8 6.04 1 1 
       4413 1 . . . . . 3.96 1.8 4.36 1 1 
       4414 1 . . . . .  6.0 1.8  6.6 1 1 
       4415 1 . . . . . 4.91 1.8  5.4 1 1 
       4416 1 . . . . . 4.74 1.8 5.21 1 1 
       4417 1 . . . . . 4.37 1.8 4.81 1 1 
       4418 1 . . . . .  6.0 1.8  6.6 1 1 
       4419 1 . . . . .  3.4 1.8 3.74 1 1 
       4420 1 . . . . . 4.41 1.8 4.85 1 1 
       4421 1 . . . . . 3.58 1.8 3.94 1 1 
       4422 1 . . . . .  5.6 1.8 6.16 1 1 
       4423 1 . . . . . 5.63 1.8 6.19 1 1 
       4424 1 . . . . . 4.74 1.8 5.21 1 1 
       4425 1 . . . . . 4.85 1.8 5.33 1 1 
       4426 1 . . . . . 3.25 1.8 3.58 1 1 
       4427 1 . . . . . 5.32 1.8 5.85 1 1 
       4428 1 . . . . . 2.85 1.8 3.13 1 1 
       4429 1 . . . . . 4.46 1.8 4.91 1 1 
       4430 1 . . . . .  3.5 1.8 3.85 1 1 
       4431 1 . . . . . 5.12 1.8 5.63 1 1 
       4432 1 . . . . . 4.93 1.8 5.42 1 1 
       4433 1 . . . . .  3.5 1.8 3.85 1 1 
       4434 1 . . . . .  3.1 1.8 3.41 1 1 
       4435 1 . . . . . 4.15 1.8 4.57 1 1 
       4436 1 . . . . . 4.47 1.8 4.92 1 1 
       4437 1 . . . . . 5.04 1.8 5.54 1 1 
       4438 1 . . . . . 4.18 1.8  4.6 1 1 
       4439 1 . . . . . 2.34 1.8 2.57 1 1 
       4440 1 . . . . . 3.99 1.8 4.39 1 1 
       4441 1 . . . . . 4.71 1.8 5.18 1 1 
       4442 1 . . . . . 5.04 1.8 5.54 1 1 
       4443 1 . . . . .  6.0 1.8  6.6 1 1 
       4444 1 . . . . . 5.84 1.8 6.42 1 1 
       4445 1 . . . . . 4.54 1.8 4.99 1 1 
       4446 1 . . . . . 5.38 1.8 5.92 1 1 
       4447 1 . . . . . 4.53 1.8 4.98 1 1 
       4448 1 . . . . . 5.16 1.8 5.68 1 1 
       4449 1 . . . . . 3.27 1.8  3.6 1 1 
       4450 1 . . . . . 4.41 1.8 4.85 1 1 
       4451 1 . . . . .  5.1 1.8 5.61 1 1 
       4452 1 . . . . .  6.0 1.8  6.6 1 1 
       4453 1 . . . . . 5.14 1.8 5.65 1 1 
       4454 1 . . . . . 4.34 1.8 4.77 1 1 
       4455 1 . . . . . 4.48 1.8 4.93 1 1 
       4456 1 . . . . . 5.78 1.8 6.36 1 1 
       4457 1 . . . . . 3.89 1.8 4.28 1 1 
       4458 1 . . . . . 5.13 1.8 5.64 1 1 
       4459 1 . . . . . 4.26 1.8 4.69 1 1 
       4460 1 . . . . .  4.1 1.8 4.51 1 1 
       4461 1 . . . . . 3.01 1.8 3.31 1 1 
       4462 1 . . . . . 3.05 1.8 3.36 1 1 
       4463 1 . . . . . 3.45 1.8 3.79 1 1 
       4464 1 . . . . . 3.86 1.8 4.25 1 1 
       4465 1 . . . . . 2.42 1.8 2.66 1 1 
       4466 1 . . . . . 2.62 1.8 2.88 1 1 
       4467 1 . . . . .  4.1 1.8 4.51 1 1 
       4468 1 . . . . . 3.41 1.8 3.75 1 1 
       4469 1 . . . . . 4.53 1.8 4.98 1 1 
       4470 1 . . . . . 3.11 1.8 3.42 1 1 
       4471 1 . . . . .  4.7 1.8 5.17 1 1 
       4472 1 . . . . . 3.67 1.8 4.04 1 1 
       4473 1 . . . . .  5.4 1.8 5.94 1 1 
       4474 1 . . . . . 4.43 1.8 4.87 1 1 
       4475 1 . . . . . 5.91 1.8  6.5 1 1 
       4476 1 . . . . . 4.23 1.8 4.65 1 1 
       4477 1 . . . . . 4.43 1.8 4.87 1 1 
       4478 1 . . . . .  3.0 1.8  3.3 1 1 
       4479 1 . . . . . 4.79 1.8 5.27 1 1 
       4480 1 . . . . . 4.92 1.8 5.41 1 1 
       4481 1 . . . . . 4.57 1.8 5.03 1 1 
       4482 1 . . . . . 4.92 1.8 5.41 1 1 
       4483 1 . . . . .  5.7 1.8 6.27 1 1 
       4484 1 . . . . . 2.58 1.8 2.84 1 1 
       4485 1 . . . . .  3.6 1.8 3.96 1 1 
       4486 1 . . . . . 5.14 1.8 5.65 1 1 
       4487 1 . . . . . 3.62 1.8 3.98 1 1 
       4488 1 . . . . . 4.16 1.8 4.58 1 1 
       4489 1 . . . . . 5.37 1.8 5.91 1 1 
       4490 1 . . . . . 4.59 1.8 5.05 1 1 
       4491 1 . . . . . 2.97 1.8 3.27 1 1 
       4492 1 . . . . . 3.01 1.8 3.31 1 1 
       4493 1 . . . . . 3.54 1.8 3.89 1 1 
       4494 1 . . . . . 2.34 1.8 2.57 1 1 
       4495 1 . . . . . 3.18 1.8  3.5 1 1 
       4496 1 . . . . . 5.05 1.8 5.56 1 1 
       4497 1 . . . . . 5.38 1.8 5.92 1 1 
       4498 1 . . . . . 4.15 1.8 4.57 1 1 
       4499 1 . . . . . 5.46 1.8 6.01 1 1 
       4500 1 . . . . .  3.5 1.8 3.85 1 1 
       4501 1 . . . . .  4.2 1.8 4.62 1 1 
       4502 1 . . . . . 4.68 1.8 5.15 1 1 
       4503 1 . . . . . 5.09 1.8  5.6 1 1 
       4504 1 . . . . . 4.45 1.8 4.89 1 1 
       4505 1 . . . . . 4.39 1.8 4.83 1 1 
       4506 1 . . . . . 3.93 1.8 4.32 1 1 
       4507 1 . . . . . 5.08 1.8 5.59 1 1 
       4508 1 . . . . . 2.76 1.8 3.04 1 1 
       4509 1 . . . . . 4.48 1.8 4.93 1 1 
       4510 1 . . . . .  6.0 1.8  6.6 1 1 
       4511 1 . . . . .  6.0 1.8  6.6 1 1 
       4512 1 . . . . . 3.15 1.8 3.47 1 1 
       4513 1 . . . . . 3.09 1.8  3.4 1 1 
       4514 1 . . . . .  2.5 1.8 2.75 1 1 
       4515 1 . . . . .  3.2 1.8 3.52 1 1 
       4516 1 . . . . . 3.17 1.8 3.49 1 1 
       4517 1 . . . . . 2.31 1.8 2.54 1 1 
       4518 1 . . . . . 4.96 1.8 5.46 1 1 
       4519 1 . . . . . 3.82 1.8  4.2 1 1 
       4520 1 . . . . . 4.39 1.8 4.83 1 1 
       4521 1 . . . . . 3.26 1.8 3.59 1 1 
       4522 1 . . . . . 3.29 1.8 3.62 1 1 
       4523 1 . . . . . 5.08 1.8 5.59 1 1 
       4524 1 . . . . . 5.99 1.8 6.59 1 1 
       4525 1 . . . . . 4.29 1.8 4.72 1 1 
       4526 1 . . . . . 4.48 1.8 4.93 1 1 
       4527 1 . . . . . 4.31 1.8 4.74 1 1 
       4528 1 . . . . . 3.26 1.8 3.59 1 1 
       4529 1 . . . . . 4.83 1.8 5.31 1 1 
       4530 1 . . . . . 3.36 1.8  3.7 1 1 
       4531 1 . . . . . 4.56 1.8 5.02 1 1 
       4532 1 . . . . . 3.69 1.8 4.06 1 1 
       4533 1 . . . . .  5.0 1.8  5.5 1 1 
       4534 1 . . . . . 5.51 1.8 6.06 1 1 
       4535 1 . . . . . 4.23 1.8 4.65 1 1 
       4536 1 . . . . . 5.16 1.8 5.68 1 1 
       4537 1 . . . . . 5.33 1.8 5.86 1 1 
       4538 1 . . . . . 5.05 1.8 5.56 1 1 
       4539 1 . . . . .  6.0 1.8  6.6 1 1 
       4540 1 . . . . . 3.08 1.8 3.39 1 1 
       4541 1 . . . . . 3.96 1.8 4.36 1 1 
       4542 1 . . . . .  6.0 1.8  6.6 1 1 
       4543 1 . . . . . 3.24 1.8 3.56 1 1 
       4544 1 . . . . . 2.34 1.8 2.57 1 1 
       4545 1 . . . . . 3.29 1.8 3.62 1 1 
       4546 1 . . . . .  5.1 1.8 5.61 1 1 
       4547 1 . . . . . 3.88 1.8 4.27 1 1 
       4548 1 . . . . . 5.12 1.8 5.63 1 1 
       4549 1 . . . . . 3.36 1.8  3.7 1 1 
       4550 1 . . . . .  5.1 1.8 5.61 1 1 
       4551 1 . . . . . 3.91 1.8  4.3 1 1 
       4552 1 . . . . . 4.46 1.8 4.91 1 1 
       4553 1 . . . . . 3.72 1.8 4.09 1 1 
       4554 1 . . . . .  3.4 1.8 3.74 1 1 
       4555 1 . . . . . 5.06 1.8 5.57 1 1 
       4556 1 . . . . . 4.81 1.8 5.29 1 1 
       4557 1 . . . . . 5.65 1.8 6.21 1 1 
       4558 1 . . . . . 3.87 1.8 4.26 1 1 
       4559 1 . . . . . 3.26 1.8 3.59 1 1 
       4560 1 . . . . . 3.62 1.8 3.98 1 1 
       4561 1 . . . . . 3.11 1.8 3.42 1 1 
       4562 1 . . . . . 4.35 1.8 4.79 1 1 
       4563 1 . . . . . 4.58 1.8 5.04 1 1 
       4564 1 . . . . . 3.75 1.8 4.13 1 1 
       4565 1 . . . . . 3.32 1.8 3.65 1 1 
       4566 1 . . . . . 3.26 1.8 3.59 1 1 
       4567 1 . . . . . 4.75 1.8 5.22 1 1 
       4568 1 . . . . . 3.41 1.8 3.75 1 1 
       4569 1 . . . . . 4.95 1.8 5.44 1 1 
       4570 1 . . . . . 5.38 1.8 5.92 1 1 
       4571 1 . . . . . 3.03 1.8 3.33 1 1 
       4572 1 . . . . . 5.18 1.8  5.7 1 1 
       4573 1 . . . . . 5.86 1.8 6.45 1 1 
       4574 1 . . . . . 5.85 1.8 6.43 1 1 
       4575 1 . . . . . 4.35 1.8 4.79 1 1 
       4576 1 . . . . . 3.94 1.8 4.33 1 1 
       4577 1 . . . . . 4.23 1.8 4.65 1 1 
       4578 1 . . . . . 5.06 1.8 5.57 1 1 
       4579 1 . . . . . 5.34 1.8 5.87 1 1 
       4580 1 . . . . . 3.45 1.8 3.79 1 1 
       4581 1 . . . . . 3.68 1.8 4.05 1 1 
       4582 1 . . . . . 5.12 1.8 5.63 1 1 
       4583 1 . . . . .  4.9 1.8 5.39 1 1 
       4584 1 . . . . . 3.69 1.8 4.06 1 1 
       4585 1 . . . . . 4.84 1.8 5.32 1 1 
       4586 1 . . . . . 3.66 1.8 4.03 1 1 
       4587 1 . . . . . 3.32 1.8 3.65 1 1 
       4588 1 . . . . .  5.1 1.8 5.61 1 1 
       4589 1 . . . . . 5.36 1.8  5.9 1 1 
       4590 1 . . . . . 5.75 1.8 6.32 1 1 
       4591 1 . . . . .  3.3 1.8 3.63 1 1 
       4592 1 . . . . . 4.04 1.8 4.44 1 1 
       4593 1 . . . . . 4.56 1.8 5.02 1 1 
       4594 1 . . . . . 4.18 1.8  4.6 1 1 
       4595 1 . . . . . 4.06 1.8 4.47 1 1 
       4596 1 . . . . . 3.28 1.8 3.61 1 1 
       4597 1 . . . . . 4.27 1.8  4.7 1 1 
       4598 1 . . . . . 4.42 1.8 4.86 1 1 
       4599 1 . . . . . 2.36 1.8  2.6 1 1 
       4600 1 . . . . . 5.74 1.8 6.31 1 1 
       4601 1 . . . . . 4.56 1.8 5.02 1 1 
       4602 1 . . . . .  3.1 1.8 3.41 1 1 
       4603 1 . . . . . 3.26 1.8 3.59 1 1 
       4604 1 . . . . . 2.96 1.8 3.26 1 1 
       4605 1 . . . . . 3.96 1.8 4.36 1 1 
       4606 1 . . . . . 4.39 1.8 4.83 1 1 
       4607 1 . . . . .  6.0 1.8  6.6 1 1 
       4608 1 . . . . . 3.62 1.8 3.98 1 1 
       4609 1 . . . . . 5.02 1.8 5.52 1 1 
       4610 1 . . . . . 4.94 1.8 5.43 1 1 
       4611 1 . . . . . 5.08 1.8 5.59 1 1 
       4612 1 . . . . . 2.93 1.8 3.22 1 1 
       4613 1 . . . . . 4.16 1.8 4.58 1 1 
       4614 1 . . . . . 4.68 1.8 5.15 1 1 
       4615 1 . . . . . 4.67 1.8 5.14 1 1 
       4616 1 . . . . . 3.62 1.8 3.98 1 1 
       4617 1 . . . . . 4.22 1.8 4.64 1 1 
       4618 1 . . . . . 3.04 1.8 3.34 1 1 
       4619 1 . . . . . 3.52 1.8 3.87 1 1 
       4620 1 . . . . .  3.2 1.8 3.52 1 1 
       4621 1 . . . . . 5.46 1.8 6.01 1 1 
       4622 1 . . . . . 4.28 1.8 4.71 1 1 
       4623 1 . . . . . 4.08 1.8 4.49 1 1 
       4624 1 . . . . . 4.73 1.8  5.2 1 1 
       4625 1 . . . . . 2.35 1.8 2.58 1 1 
       4626 1 . . . . . 3.32 1.8 3.65 1 1 
       4627 1 . . . . . 4.13 1.8 4.54 1 1 
       4628 1 . . . . . 4.78 1.8 5.26 1 1 
       4629 1 . . . . . 4.31 1.8 4.74 1 1 
       4630 1 . . . . . 5.37 1.8 5.91 1 1 
       4631 1 . . . . . 3.93 1.8 4.32 1 1 
       4632 1 . . . . . 2.98 1.8 3.28 1 1 
       4633 1 . . . . . 3.48 1.8 3.83 1 1 
       4634 1 . . . . .  6.0 1.8  6.6 1 1 
       4635 1 . . . . .  6.0 1.8  6.6 1 1 
       4636 1 . . . . .  6.1 1.8 6.71 1 1 
       4637 1 . . . . . 3.38 1.8 3.72 1 1 
       4638 1 . . . . . 3.45 1.8 3.79 1 1 
       4639 1 . . . . . 3.54 1.8 3.89 1 1 
       4640 1 . . . . . 4.41 1.8 4.85 1 1 
       4641 1 . . . . . 5.07 1.8 5.58 1 1 
       4642 1 . . . . . 5.43 1.8 5.97 1 1 
       4643 1 . . . . . 4.26 1.8 4.69 1 1 
       4644 1 . . . . . 2.92 1.8 3.21 1 1 
       4645 1 . . . . . 3.31 1.8 3.64 1 1 
       4646 1 . . . . . 3.26 1.8 3.59 1 1 
       4647 1 . . . . . 2.43 1.8 2.67 1 1 
       4648 1 . . . . . 4.22 1.8 4.64 1 1 
       4649 1 . . . . . 4.93 1.8 5.42 1 1 
       4650 1 . . . . . 5.99 1.8 6.59 1 1 
       4651 1 . . . . . 3.54 1.8 3.89 1 1 
       4652 1 . . . . . 4.88 1.8 5.37 1 1 
       4653 1 . . . . . 5.99 1.8 6.59 1 1 
       4654 1 . . . . . 3.31 1.8 3.64 1 1 
       4655 1 . . . . .  3.9 1.8 4.29 1 1 
       4656 1 . . . . .  5.2 1.8 5.72 1 1 
       4657 1 . . . . . 5.61 1.8 6.17 1 1 
       4658 1 . . . . . 3.07 1.8 3.38 1 1 
       4659 1 . . . . . 3.25 1.8 3.58 1 1 
       4660 1 . . . . . 4.35 1.8 4.79 1 1 
       4661 1 . . . . . 2.29 1.8 2.52 1 1 
       4662 1 . . . . .  5.4 1.8 5.94 1 1 
       4663 1 . . . . . 4.71 1.8 5.18 1 1 
       4664 1 . . . . . 3.43 1.8 3.77 1 1 
       4665 1 . . . . .  3.1 1.8 3.41 1 1 
       4666 1 . . . . .  6.0 1.8  6.6 1 1 
       4667 1 . . . . . 2.63 1.8 2.89 1 1 
       4668 1 . . . . . 3.08 1.8 3.39 1 1 
       4669 1 . . . . . 3.51 1.8 3.86 1 1 
       4670 1 . . . . . 4.85 1.8 5.33 1 1 
       4671 1 . . . . . 5.99 1.8 6.59 1 1 
       4672 1 . . . . . 5.34 1.8 5.87 1 1 
       4673 1 . . . . . 4.43 1.8 4.87 1 1 
       4674 1 . . . . . 3.74 1.8 4.11 1 1 
       4675 1 . . . . . 4.54 1.8 4.99 1 1 
       4676 1 . . . . . 4.48 1.8 4.93 1 1 
       4677 1 . . . . .  3.4 1.8 3.74 1 1 
       4678 1 . . . . . 4.81 1.8 5.29 1 1 
       4679 1 . . . . . 3.82 1.8  4.2 1 1 
       4680 1 . . . . . 4.23 1.8 4.65 1 1 
       4681 1 . . . . . 4.55 1.8 5.01 1 1 
       4682 1 . . . . . 3.22 1.8 3.54 1 1 
       4683 1 . . . . . 3.26 1.8 3.59 1 1 
       4684 1 . . . . . 4.27 1.8  4.7 1 1 
       4685 1 . . . . . 6.11 1.8 6.72 1 1 
       4686 1 . . . . . 5.99 1.8 6.59 1 1 
       4687 1 . . . . . 3.92 1.8 4.31 1 1 
       4688 1 . . . . . 3.66 1.8 4.03 1 1 
       4689 1 . . . . . 3.11 1.8 3.42 1 1 
       4690 1 . . . . . 5.15 1.8 5.67 1 1 
       4691 1 . . . . . 4.32 1.8 4.75 1 1 
       4692 1 . . . . . 5.47 1.8 6.02 1 1 
       4693 1 . . . . . 4.71 1.8 5.18 1 1 
       4694 1 . . . . . 5.61 1.8 6.17 1 1 
       4695 1 . . . . . 5.19 1.8 5.71 1 1 
       4696 1 . . . . . 4.07 1.8 4.48 1 1 
       4697 1 . . . . . 5.33 1.8 5.86 1 1 
       4698 1 . . . . . 4.41 1.8 4.85 1 1 
       4699 1 . . . . . 3.36 1.8  3.7 1 1 
       4700 1 . . . . . 4.28 1.8 4.71 1 1 
       4701 1 . . . . . 4.58 1.8 5.04 1 1 
       4702 1 . . . . . 3.73 1.8  4.1 1 1 
       4703 1 . . . . . 4.85 1.8 5.33 1 1 
       4704 1 . . . . . 5.99 1.8 6.59 1 1 
       4705 1 . . . . . 6.11 1.8 6.72 1 1 
       4706 1 . . . . . 4.21 1.8 4.63 1 1 
       4707 1 . . . . .  4.0 1.8  4.4 1 1 
       4708 1 . . . . . 4.63 1.8 5.09 1 1 
       4709 1 . . . . . 3.77 1.8 4.15 1 1 
       4710 1 . . . . . 4.32 1.8 4.75 1 1 
       4711 1 . . . . . 4.55 1.8 5.01 1 1 
       4712 1 . . . . . 4.21 1.8 4.63 1 1 
       4713 1 . . . . . 4.11 1.8 4.52 1 1 
       4714 1 . . . . . 5.06 1.8 5.57 1 1 
       4715 1 . . . . . 4.15 1.8 4.57 1 1 
       4716 1 . . . . . 3.54 1.8 3.89 1 1 
       4717 1 . . . . . 5.88 1.8 6.47 1 1 
       4718 1 . . . . . 4.35 1.8 4.79 1 1 
       4719 1 . . . . . 4.91 1.8  5.4 1 1 
       4720 1 . . . . . 4.44 1.8 4.88 1 1 
       4721 1 . . . . . 4.87 1.8 5.36 1 1 
       4722 1 . . . . . 5.74 1.8 6.31 1 1 
       4723 1 . . . . . 4.51 1.8 4.96 1 1 
       4724 1 . . . . . 5.06 1.8 5.57 1 1 
       4725 1 . . . . . 4.93 1.8 5.42 1 1 
       4726 1 . . . . . 4.64 1.8  5.1 1 1 
       4727 1 . . . . . 5.39 1.8 5.93 1 1 
       4728 1 . . . . . 3.47 1.8 3.82 1 1 
       4729 1 . . . . . 3.96 1.8 4.36 1 1 
       4730 1 . . . . . 5.17 1.8 5.69 1 1 
       4731 1 . . . . . 2.92 1.8 3.21 1 1 
       4732 1 . . . . . 3.58 1.8 3.94 1 1 
       4733 1 . . . . . 5.98 1.8 6.58 1 1 
       4734 1 . . . . . 2.36 1.8  2.6 1 1 
       4735 1 . . . . . 3.08 1.8 3.39 1 1 
       4736 1 . . . . . 4.64 1.8  5.1 1 1 
       4737 1 . . . . . 5.11 1.8 5.62 1 1 
       4738 1 . . . . . 5.76 1.8 6.34 1 1 
       4739 1 . . . . . 3.15 1.8 3.47 1 1 
       4740 1 . . . . . 4.44 1.8 4.88 1 1 
       4741 1 . . . . . 4.23 1.8 4.65 1 1 
       4742 1 . . . . .  4.0 1.8  4.4 1 1 
       4743 1 . . . . .  3.4 1.8 3.74 1 1 
       4744 1 . . . . . 5.38 1.8 5.92 1 1 
       4745 1 . . . . . 4.35 1.8 4.79 1 1 
       4746 1 . . . . . 3.58 1.8 3.94 1 1 
       4747 1 . . . . . 4.52 1.8 4.97 1 1 
       4748 1 . . . . . 4.72 1.8 5.19 1 1 
       4749 1 . . . . . 3.38 1.8 3.72 1 1 
       4750 1 . . . . .  6.0 1.8  6.6 1 1 
       4751 1 . . . . . 3.29 1.8 3.62 1 1 
       4752 1 . . . . . 4.98 1.8 5.48 1 1 
       4753 1 . . . . . 3.73 1.8  4.1 1 1 
       4754 1 . . . . . 4.27 1.8  4.7 1 1 
       4755 1 . . . . . 5.28 1.8 5.81 1 1 
       4756 1 . . . . .  5.2 1.8 5.72 1 1 
       4757 1 . . . . . 2.96 1.8 3.26 1 1 
       4758 1 . . . . . 4.99 1.8 5.49 1 1 
       4759 1 . . . . .  5.6 1.8 6.16 1 1 
       4760 1 . . . . .  6.0 1.8  6.6 1 1 
       4761 1 . . . . . 3.53 1.8 3.88 1 1 
       4762 1 . . . . . 4.95 1.8 5.44 1 1 
       4763 1 . . . . . 4.75 1.8 5.22 1 1 
       4764 1 . . . . . 5.16 1.8 5.68 1 1 
       4765 1 . . . . . 3.11 1.8 3.42 1 1 
       4766 1 . . . . . 4.69 1.8 5.16 1 1 
       4767 1 . . . . .  6.0 1.8  6.6 1 1 
       4768 1 . . . . .  3.6 1.8 3.96 1 1 
       4769 1 . . . . . 4.82 1.8  5.3 1 1 
       4770 1 . . . . . 3.16 1.8 3.48 1 1 
       4771 1 . . . . . 2.52 1.8 2.77 1 1 
       4772 1 . . . . . 3.71 1.8 4.08 1 1 
       4773 1 . . . . . 4.62 1.8 5.08 1 1 
       4774 1 . . . . . 4.69 1.8 5.16 1 1 
       4775 1 . . . . . 3.16 1.8 3.48 1 1 
       4776 1 . . . . . 4.02 1.8 4.42 1 1 
       4777 1 . . . . . 5.05 1.8 5.56 1 1 
       4778 1 . . . . . 4.29 1.8 4.72 1 1 
       4779 1 . . . . .  3.3 1.8 3.63 1 1 
       4780 1 . . . . . 4.01 1.8 4.41 1 1 
       4781 1 . . . . . 4.07 1.8 4.48 1 1 
       4782 1 . . . . .  6.0 1.8  6.6 1 1 
       4783 1 . . . . . 4.44 1.8 4.88 1 1 
       4784 1 . . . . . 3.99 1.8 4.39 1 1 
       4785 1 . . . . . 4.82 1.8  5.3 1 1 
       4786 1 . . . . . 2.57 1.8 2.83 1 1 
       4787 1 . . . . . 4.99 1.8 5.49 1 1 
       4788 1 . . . . . 3.86 1.8 4.25 1 1 
       4789 1 . . . . . 5.34 1.8 5.87 1 1 
       4790 1 . . . . . 2.94 1.8 3.23 1 1 
       4791 1 . . . . . 3.17 1.8 3.49 1 1 
       4792 1 . . . . . 3.25 1.8 3.58 1 1 
       4793 1 . . . . .  4.2 1.8 4.62 1 1 
       4794 1 . . . . . 3.53 1.8 3.88 1 1 
       4795 1 . . . . . 3.68 1.8 4.05 1 1 
       4796 1 . . . . . 2.54 1.8 2.79 1 1 
       4797 1 . . . . .  3.5 1.8 3.85 1 1 
       4798 1 . . . . . 5.67 1.8 6.24 1 1 
       4799 1 . . . . . 5.99 1.8 6.59 1 1 
       4800 1 . . . . . 4.28 1.8 4.71 1 1 
       4801 1 . . . . . 4.87 1.8 5.36 1 1 
       4802 1 . . . . .  6.0 1.8  6.6 1 1 
       4803 1 . . . . . 3.53 1.8 3.88 1 1 
       4804 1 . . . . . 3.55 1.8  3.9 1 1 
       4805 1 . . . . . 4.92 1.8 5.41 1 1 
       4806 1 . . . . . 3.89 1.8 4.28 1 1 
       4807 1 . . . . . 2.62 1.8 2.88 1 1 
       4808 1 . . . . . 4.27 1.8  4.7 1 1 
       4809 1 . . . . . 4.33 1.8 4.76 1 1 
       4810 1 . . . . . 5.22 1.8 5.74 1 1 
       4811 1 . . . . . 3.91 1.8  4.3 1 1 
       4812 1 . . . . . 5.99 1.8 6.59 1 1 
       4813 1 . . . . . 4.32 1.8 4.75 1 1 
       4814 1 . . . . . 4.97 1.8 5.47 1 1 
       4815 1 . . . . . 5.34 1.8 5.87 1 1 
       4816 1 . . . . . 4.79 1.8 5.27 1 1 
       4817 1 . . . . . 4.15 1.8 4.57 1 1 
       4818 1 . . . . . 3.33 1.8 3.66 1 1 
       4819 1 . . . . . 4.62 1.8 5.08 1 1 
       4820 1 . . . . . 3.38 1.8 3.72 1 1 
       4821 1 . . . . . 3.17 1.8 3.49 1 1 
       4822 1 . . . . . 3.99 1.8 4.39 1 1 
       4823 1 . . . . . 3.19 1.8 3.51 1 1 
       4824 1 . . . . . 4.02 1.8 4.42 1 1 
       4825 1 . . . . . 5.41 1.8 5.95 1 1 
       4826 1 . . . . . 3.51 1.8 3.86 1 1 
       4827 1 . . . . . 4.15 1.8 4.57 1 1 
       4828 1 . . . . .  4.2 1.8 4.62 1 1 
       4829 1 . . . . . 5.27 1.8  5.8 1 1 
       4830 1 . . . . . 4.74 1.8 5.21 1 1 
       4831 1 . . . . . 5.74 1.8 6.31 1 1 
       4832 1 . . . . . 5.62 1.8 6.18 1 1 
       4833 1 . . . . . 4.55 1.8 5.01 1 1 
       4834 1 . . . . . 4.66 1.8 5.13 1 1 
       4835 1 . . . . . 5.92 1.8 6.51 1 1 
       4836 1 . . . . . 4.67 1.8 5.14 1 1 
       4837 1 . . . . . 5.34 1.8 5.87 1 1 
       4838 1 . . . . . 3.63 1.8 3.99 1 1 
       4839 1 . . . . . 4.65 1.8 5.12 1 1 
       4840 1 . . . . . 3.93 1.8 4.32 1 1 
       4841 1 . . . . . 4.88 1.8 5.37 1 1 
       4842 1 . . . . . 4.25 1.8 4.68 1 1 
       4843 1 . . . . . 5.27 1.8  5.8 1 1 
       4844 1 . . . . . 4.87 1.8 5.36 1 1 
       4845 1 . . . . .  4.4 1.8 4.84 1 1 
       4846 1 . . . . . 3.76 1.8 4.14 1 1 
       4847 1 . . . . . 2.32 1.8 2.55 1 1 
       4848 1 . . . . . 3.29 1.8 3.62 1 1 
       4849 1 . . . . . 3.73 1.8  4.1 1 1 
       4850 1 . . . . . 5.74 1.8 6.31 1 1 
       4851 1 . . . . . 3.45 1.8 3.79 1 1 
       4852 1 . . . . .  4.2 1.8 4.62 1 1 
       4853 1 . . . . .  4.2 1.8 4.62 1 1 
       4854 1 . . . . . 5.21 1.8 5.73 1 1 
       4855 1 . . . . . 5.26 1.8 5.79 1 1 
       4856 1 . . . . . 3.43 1.8 3.77 1 1 
       4857 1 . . . . . 4.03 1.8 4.43 1 1 
       4858 1 . . . . . 5.74 1.8 6.31 1 1 
       4859 1 . . . . . 3.72 1.8 4.09 1 1 
       4860 1 . . . . . 5.18 1.8  5.7 1 1 
       4861 1 . . . . . 4.27 1.8  4.7 1 1 
       4862 1 . . . . . 3.59 1.8 3.95 1 1 
       4863 1 . . . . . 3.49 1.8 3.84 1 1 
       4864 1 . . . . . 4.76 1.8 5.24 1 1 
       4865 1 . . . . . 6.11 1.8 6.72 1 1 
       4866 1 . . . . . 5.99 1.8 6.59 1 1 
       4867 1 . . . . . 3.02 1.8 3.32 1 1 
       4868 1 . . . . . 2.75 1.8 3.03 1 1 
       4869 1 . . . . . 5.05 1.8 5.56 1 1 
       4870 1 . . . . . 3.12 1.8 3.43 1 1 
       4871 1 . . . . . 4.96 1.8 5.46 1 1 
       4872 1 . . . . . 5.14 1.8 5.65 1 1 
       4873 1 . . . . . 5.25 1.8 5.78 1 1 
       4874 1 . . . . . 5.01 1.8 5.51 1 1 
       4875 1 . . . . . 3.05 1.8 3.36 1 1 
       4876 1 . . . . .  3.3 1.8 3.63 1 1 
       4877 1 . . . . . 5.41 1.8 5.95 1 1 
       4878 1 . . . . . 3.54 1.8 3.89 1 1 
       4879 1 . . . . . 3.99 1.8 4.39 1 1 
       4880 1 . . . . . 4.69 1.8 5.16 1 1 
       4881 1 . . . . . 5.99 1.8 6.59 1 1 
       4882 1 . . . . . 3.33 1.8 3.66 1 1 
       4883 1 . . . . . 5.99 1.8 6.59 1 1 
       4884 1 . . . . .  6.0 1.8  6.6 1 1 
       4885 1 . . . . . 5.76 1.8 6.34 1 1 
       4886 1 . . . . . 4.27 1.8  4.7 1 1 
       4887 1 . . . . .  5.8 1.8 6.38 1 1 
       4888 1 . . . . . 4.53 1.8 4.98 1 1 
       4889 1 . . . . . 4.59 1.8 5.05 1 1 
       4890 1 . . . . . 4.25 1.8 4.68 1 1 
       4891 1 . . . . . 4.65 1.8 5.12 1 1 
       4892 1 . . . . . 3.58 1.8 3.94 1 1 
       4893 1 . . . . . 4.57 1.8 5.03 1 1 
       4894 1 . . . . . 3.04 1.8 3.34 1 1 
       4895 1 . . . . . 3.33 1.8 3.66 1 1 
       4896 1 . . . . . 3.61 1.8 3.97 1 1 
       4897 1 . . . . . 3.14 1.8 3.45 1 1 
       4898 1 . . . . . 3.54 1.8 3.89 1 1 
       4899 1 . . . . . 4.51 1.8 4.96 1 1 
       4900 1 . . . . . 3.61 1.8 3.97 1 1 
       4901 1 . . . . . 4.48 1.8 4.93 1 1 
       4902 1 . . . . . 2.54 1.8 2.79 1 1 
       4903 1 . . . . . 3.42 1.8 3.76 1 1 
       4904 1 . . . . . 2.31 1.8 2.54 1 1 
       4905 1 . . . . . 3.32 1.8 3.65 1 1 
       4906 1 . . . . . 5.82 1.8  6.4 1 1 
       4907 1 . . . . . 5.92 1.8 6.51 1 1 
       4908 1 . . . . . 5.98 1.8 6.58 1 1 
       4909 1 . . . . . 5.09 1.8  5.6 1 1 
       4910 1 . . . . . 5.81 1.8 6.39 1 1 
       4911 1 . . . . . 3.59 1.8 3.95 1 1 
       4912 1 . . . . . 3.08 1.8 3.39 1 1 
       4913 1 . . . . . 3.19 1.8 3.51 1 1 
       4914 1 . . . . . 3.62 1.8 3.98 1 1 
       4915 1 . . . . .  2.3 1.8 2.53 1 1 
       4916 1 . . . . . 3.52 1.8 3.87 1 1 
       4917 1 . . . . . 4.57 1.8 5.03 1 1 
       4918 1 . . . . . 3.98 1.8 4.38 1 1 
       4919 1 . . . . . 5.65 1.8 6.21 1 1 
       4920 1 . . . . . 5.31 1.8 5.84 1 1 
       4921 1 . . . . . 5.05 1.8 5.56 1 1 
       4922 1 . . . . . 4.14 1.8 4.55 1 1 
       4923 1 . . . . . 3.99 1.8 4.39 1 1 
       4924 1 . . . . . 5.58 1.8 6.14 1 1 
       4925 1 . . . . . 5.89 1.8 6.48 1 1 
       4926 1 . . . . . 4.22 1.8 4.64 1 1 
       4927 1 . . . . . 4.34 1.8 4.77 1 1 
       4928 1 . . . . . 5.34 1.8 5.87 1 1 
       4929 1 . . . . . 4.72 1.8 5.19 1 1 
       4930 1 . . . . . 4.01 1.8 4.41 1 1 
       4931 1 . . . . . 5.01 1.8 5.51 1 1 
       4932 1 . . . . . 5.34 1.8 5.87 1 1 
       4933 1 . . . . . 3.87 1.8 4.26 1 1 
       4934 1 . . . . . 3.49 1.8 3.84 1 1 
       4935 1 . . . . . 3.89 1.8 4.28 1 1 
       4936 1 . . . . . 4.23 1.8 4.65 1 1 
       4937 1 . . . . . 3.51 1.8 3.86 1 1 
       4938 1 . . . . . 5.59 1.8 6.15 1 1 
       4939 1 . . . . .  6.0 1.8  6.6 1 1 
       4940 1 . . . . .  5.0 1.8  5.5 1 1 
       4941 1 . . . . .  5.4 1.8 5.94 1 1 
       4942 1 . . . . . 4.78 1.8 5.26 1 1 
       4943 1 . . . . .  5.0 1.8  5.5 1 1 
       4944 1 . . . . . 4.95 1.8 5.44 1 1 
       4945 1 . . . . .  3.0 1.8  3.3 1 1 
       4946 1 . . . . . 4.67 1.8 5.14 1 1 
       4947 1 . . . . . 3.15 1.8 3.47 1 1 
       4948 1 . . . . . 4.79 1.8 5.27 1 1 
       4949 1 . . . . . 3.45 1.8 3.79 1 1 
       4950 1 . . . . . 2.57 1.8 2.83 1 1 
       4951 1 . . . . . 2.94 1.8 3.23 1 1 
       4952 1 . . . . . 3.43 1.8 3.77 1 1 
       4953 1 . . . . . 4.74 1.8 5.21 1 1 
       4954 1 . . . . . 5.71 1.8 6.28 1 1 
       4955 1 . . . . . 3.36 1.8  3.7 1 1 
       4956 1 . . . . . 4.69 1.8 5.16 1 1 
       4957 1 . . . . . 2.88 1.8 3.17 1 1 
       4958 1 . . . . . 4.19 1.8 4.61 1 1 
       4959 1 . . . . . 3.81 1.8 4.19 1 1 
       4960 1 . . . . . 5.93 1.8 6.52 1 1 
       4961 1 . . . . . 4.67 1.8 5.14 1 1 
       4962 1 . . . . .  5.0 1.8  5.5 1 1 
       4963 1 . . . . . 3.23 1.8 3.55 1 1 
       4964 1 . . . . . 4.21 1.8 4.63 1 1 
       4965 1 . . . . . 4.21 1.8 4.63 1 1 
       4966 1 . . . . . 4.68 1.8 5.15 1 1 
       4967 1 . . . . .  6.0 1.8  6.6 1 1 
       4968 1 . . . . . 4.62 1.8 5.08 1 1 
       4969 1 . . . . .  5.2 1.8 5.72 1 1 
       4970 1 . . . . . 3.71 1.8 4.08 1 1 
       4971 1 . . . . . 4.87 1.8 5.36 1 1 
       4972 1 . . . . . 3.26 1.8 3.59 1 1 
       4973 1 . . . . .  4.0 1.8  4.4 1 1 
       4974 1 . . . . . 2.62 1.8 2.88 1 1 
       4975 1 . . . . . 3.51 1.8 3.86 1 1 
       4976 1 . . . . . 5.99 1.8 6.59 1 1 
       4977 1 . . . . . 2.86 1.8 3.15 1 1 
       4978 1 . . . . . 3.36 1.8  3.7 1 1 
       4979 1 . . . . . 3.99 1.8 4.39 1 1 
       4980 1 . . . . . 4.77 1.8 5.25 1 1 
       4981 1 . . . . . 3.31 1.8 3.64 1 1 
    stop_

save_


save_CNS/XPLOR_distance_constraints_4_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  2
    _Distance_constraint_list.Constraint_type     "hydrogen bond"
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

        1 1 . . . 1 2 
        2 1 . . . 1 2 
        3 1 . . . 1 2 
        4 1 . . . 1 2 
        5 1 . . . 1 2 
        6 1 . . . 1 2 
        7 1 . . . 1 2 
        8 1 . . . 1 2 
        9 1 . . . 1 2 
       10 1 . . . 1 2 
       11 1 . . . 1 2 
       12 1 . . . 1 2 
       13 1 . . . 1 2 
       14 1 . . . 1 2 
       15 1 . . . 1 2 
       16 1 . . . 1 2 
       17 1 . . . 1 2 
       18 1 . . . 1 2 
       19 1 . . . 1 2 
       20 1 . . . 1 2 
       21 1 . . . 1 2 
       22 1 . . . 1 2 
       23 1 . . . 1 2 
       24 1 . . . 1 2 
       25 1 . . . 1 2 
       26 1 . . . 1 2 
       27 1 . . . 1 2 
       28 1 . . . 1 2 
       29 1 . . . 1 2 
       30 1 . . . 1 2 
       31 1 . . . 1 2 
       32 1 . . . 1 2 
       33 1 . . . 1 2 
       34 1 . . . 1 2 
       35 1 . . . 1 2 
       36 1 . . . 1 2 
       37 1 . . . 1 2 
       38 1 . . . 1 2 
       39 1 . . . 1 2 
       40 1 . . . 1 2 
       41 1 . . . 1 2 
       42 1 . . . 1 2 
       43 1 . . . 1 2 
       44 1 . . . 1 2 
       45 1 . . . 1 2 
       46 1 . . . 1 2 
       47 1 . . . 1 2 
       48 1 . . . 1 2 
       49 1 . . . 1 2 
       50 1 . . . 1 2 
       51 1 . . . 1 2 
       52 1 . . . 1 2 
       53 1 . . . 1 2 
       54 1 . . . 1 2 
       55 1 . . . 1 2 
       56 1 . . . 1 2 
       57 1 . . . 1 2 
       58 1 . . . 1 2 
       59 1 . . . 1 2 
       60 1 . . . 1 2 
       61 1 . . . 1 2 
       62 1 . . . 1 2 
       63 1 . . . 1 2 
       64 1 . . . 1 2 
       65 1 . . . 1 2 
       66 1 . . . 1 2 
       67 1 . . . 1 2 
       68 1 . . . 1 2 
       69 1 . . . 1 2 
       70 1 . . . 1 2 
       71 1 . . . 1 2 
       72 1 . . . 1 2 
       73 1 . . . 1 2 
       74 1 . . . 1 2 
       75 1 . . . 1 2 
       76 1 . . . 1 2 
       77 1 . . . 1 2 
       78 1 . . . 1 2 
       79 1 . . . 1 2 
       80 1 . . . 1 2 
       81 1 . . . 1 2 
       82 1 . . . 1 2 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

        1 1 1 1 1   6 VAL H .   6 . HN 1 2 
        1 1 2 1 1 107 PHE O . 107 . O  1 2 
        2 1 1 1 1   6 VAL N .   6 . N  1 2 
        2 1 2 1 1 107 PHE O . 107 . O  1 2 
        3 1 1 1 1   7 VAL H .   7 . HN 1 2 
        3 1 2 1 1  82 VAL O .  82 . O  1 2 
        4 1 1 1 1   7 VAL N .   7 . N  1 2 
        4 1 2 1 1  82 VAL O .  82 . O  1 2 
        5 1 1 1 1   9 SER H .   9 . HN 1 2 
        5 1 2 1 1  84 VAL O .  84 . O  1 2 
        6 1 1 1 1   9 SER N .   9 . N  1 2 
        6 1 2 1 1  84 VAL O .  84 . O  1 2 
        7 1 1 1 1  15 LEU O .  15 . O  1 2 
        7 1 2 1 1  19 VAL H .  19 . HN 1 2 
        8 1 1 1 1  15 LEU O .  15 . O  1 2 
        8 1 2 1 1  19 VAL N .  19 . N  1 2 
        9 1 1 1 1  18 ILE O .  18 . O  1 2 
        9 1 2 1 1  22 ILE H .  22 . HN 1 2 
       10 1 1 1 1  18 ILE O .  18 . O  1 2 
       10 1 2 1 1  22 ILE N .  22 . N  1 2 
       11 1 1 1 1  19 VAL O .  19 . O  1 2 
       11 1 2 1 1  23 LYS H .  23 . HN 1 2 
       12 1 1 1 1  19 VAL O .  19 . O  1 2 
       12 1 2 1 1  23 LYS N .  23 . N  1 2 
       13 1 1 1 1  21 GLU O .  21 . O  1 2 
       13 1 2 1 1  25 GLN H .  25 . HN 1 2 
       14 1 1 1 1  21 GLU O .  21 . O  1 2 
       14 1 2 1 1  25 GLN N .  25 . N  1 2 
       15 1 1 1 1  30 VAL H .  30 . HN 1 2 
       15 1 2 1 1  81 VAL O .  81 . O  1 2 
       16 1 1 1 1  30 VAL N .  30 . N  1 2 
       16 1 2 1 1  81 VAL O .  81 . O  1 2 
       17 1 1 1 1  32 LEU H .  32 . HN 1 2 
       17 1 2 1 1  83 ILE O .  83 . O  1 2 
       18 1 1 1 1  32 LEU N .  32 . N  1 2 
       18 1 2 1 1  83 ILE O .  83 . O  1 2 
       19 1 1 1 1  38 GLU O .  38 . O  1 2 
       19 1 2 1 1  42 ARG H .  42 . HN 1 2 
       20 1 1 1 1  38 GLU O .  38 . O  1 2 
       20 1 2 1 1  42 ARG N .  42 . N  1 2 
       21 1 1 1 1  41 ARG O .  41 . O  1 2 
       21 1 2 1 1  45 LEU H .  45 . HN 1 2 
       22 1 1 1 1  41 ARG O .  41 . O  1 2 
       22 1 2 1 1  45 LEU N .  45 . N  1 2 
       23 1 1 1 1  45 LEU O .  45 . O  1 2 
       23 1 2 1 1  49 GLU H .  49 . HN 1 2 
       24 1 1 1 1  45 LEU O .  45 . O  1 2 
       24 1 2 1 1  49 GLU N .  49 . N  1 2 
       25 1 1 1 1  46 GLU O .  46 . O  1 2 
       25 1 2 1 1  50 LYS H .  50 . HN 1 2 
       26 1 1 1 1  46 GLU O .  46 . O  1 2 
       26 1 2 1 1  50 LYS N .  50 . N  1 2 
       27 1 1 1 1  49 GLU O .  49 . O  1 2 
       27 1 2 1 1  52 GLY H .  52 . HN 1 2 
       28 1 1 1 1  49 GLU O .  49 . O  1 2 
       28 1 2 1 1  52 GLY N .  52 . N  1 2 
       29 1 1 1 1  31 LEU O .  31 . O  1 2 
       29 1 2 1 1  56 ARG H .  56 . HN 1 2 
       30 1 1 1 1  31 LEU O .  31 . O  1 2 
       30 1 2 1 1  56 ARG N .  56 . N  1 2 
       31 1 1 1 1  33 TYR O .  33 . O  1 2 
       31 1 2 1 1  58 VAL H .  58 . HN 1 2 
       32 1 1 1 1  33 TYR O .  33 . O  1 2 
       32 1 2 1 1  58 VAL N .  58 . N  1 2 
       33 1 1 1 1  61 LYS O .  61 . O  1 2 
       33 1 2 1 1  65 ARG H .  65 . HN 1 2 
       34 1 1 1 1  61 LYS O .  61 . O  1 2 
       34 1 2 1 1  65 ARG N .  65 . N  1 2 
       35 1 1 1 1  70 GLU O .  70 . O  1 2 
       35 1 2 1 1  74 ARG H .  74 . HN 1 2 
       36 1 1 1 1  70 GLU O .  70 . O  1 2 
       36 1 2 1 1  74 ARG N .  74 . N  1 2 
       37 1 1 1 1   5 PHE O .   5 . O  1 2 
       37 1 2 1 1  82 VAL H .  82 . HN 1 2 
       38 1 1 1 1   5 PHE O .   5 . O  1 2 
       38 1 2 1 1  82 VAL N .  82 . N  1 2 
       39 1 1 1 1  30 VAL O .  30 . O  1 2 
       39 1 2 1 1  83 ILE H .  83 . HN 1 2 
       40 1 1 1 1  30 VAL O .  30 . O  1 2 
       40 1 2 1 1  83 ILE N .  83 . N  1 2 
       41 1 1 1 1   7 VAL O .   7 . O  1 2 
       41 1 2 1 1  84 VAL H .  84 . HN 1 2 
       42 1 1 1 1   7 VAL O .   7 . O  1 2 
       42 1 2 1 1  84 VAL N .  84 . N  1 2 
       43 1 1 1 1  88 ASP O .  88 . O  1 2 
       43 1 2 1 1  92 ILE H .  92 . HN 1 2 
       44 1 1 1 1  88 ASP O .  88 . O  1 2 
       44 1 2 1 1  92 ILE N .  92 . N  1 2 
       45 1 1 1 1  89 LYS O .  89 . O  1 2 
       45 1 2 1 1  93 LYS H .  93 . HN 1 2 
       46 1 1 1 1  89 LYS O .  89 . O  1 2 
       46 1 2 1 1  93 LYS N .  93 . N  1 2 
       47 1 1 1 1  90 GLU O .  90 . O  1 2 
       47 1 2 1 1  94 ASP H .  94 . HN 1 2 
       48 1 1 1 1  90 GLU O .  90 . O  1 2 
       48 1 2 1 1  94 ASP N .  94 . N  1 2 
       49 1 1 1 1  93 LYS O .  93 . O  1 2 
       49 1 2 1 1  97 GLU H .  97 . HN 1 2 
       50 1 1 1 1  93 LYS O .  93 . O  1 2 
       50 1 2 1 1  97 GLU N .  97 . N  1 2 
       51 1 1 1 1  96 ILE O .  96 . O  1 2 
       51 1 2 1 1 100 LYS H . 100 . HN 1 2 
       52 1 1 1 1  96 ILE O .  96 . O  1 2 
       52 1 2 1 1 100 LYS N . 100 . N  1 2 
       53 1 1 1 1  97 GLU O .  97 . O  1 2 
       53 1 2 1 1 101 GLU H . 101 . HN 1 2 
       54 1 1 1 1  97 GLU O .  97 . O  1 2 
       54 1 2 1 1 101 GLU N . 101 . N  1 2 
       55 1 1 1 1  99 ALA O .  99 . O  1 2 
       55 1 2 1 1 104 VAL H . 104 . HN 1 2 
       56 1 1 1 1  99 ALA O .  99 . O  1 2 
       56 1 2 1 1 104 VAL N . 104 . N  1 2 
       57 1 1 1 1   2 SER O .   2 . O  1 2 
       57 1 2 1 1 105 GLU H . 105 . HN 1 2 
       58 1 1 1 1   2 SER O .   2 . O  1 2 
       58 1 2 1 1 105 GLU N . 105 . N  1 2 
       59 1 1 1 1 108 VAL H . 108 . HN 1 2 
       59 1 2 1 1 131 ASP O . 131 . O  1 2 
       60 1 1 1 1 108 VAL N . 108 . N  1 2 
       60 1 2 1 1 131 ASP O . 131 . O  1 2 
       61 1 1 1 1   6 VAL O .   6 . O  1 2 
       61 1 2 1 1 109 VAL H . 109 . HN 1 2 
       62 1 1 1 1   6 VAL O .   6 . O  1 2 
       62 1 2 1 1 109 VAL N . 109 . N  1 2 
       63 1 1 1 1 112 ASN H . 112 . HN 1 2 
       63 1 2 1 1 135 VAL O . 135 . O  1 2 
       64 1 1 1 1 112 ASN N . 112 . N  1 2 
       64 1 2 1 1 135 VAL O . 135 . O  1 2 
       65 1 1 1 1 115 ASP O . 115 . O  1 2 
       65 1 2 1 1 119 LYS H . 119 . HN 1 2 
       66 1 1 1 1 115 ASP O . 115 . O  1 2 
       66 1 2 1 1 119 LYS N . 119 . N  1 2 
       67 1 1 1 1 118 ARG O . 118 . O  1 2 
       67 1 2 1 1 122 GLN H . 122 . HN 1 2 
       68 1 1 1 1 118 ARG O . 118 . O  1 2 
       68 1 2 1 1 122 GLN N . 122 . N  1 2 
       69 1 1 1 1 106 VAL O . 106 . O  1 2 
       69 1 2 1 1 131 ASP H . 131 . HN 1 2 
       70 1 1 1 1 106 VAL O . 106 . O  1 2 
       70 1 2 1 1 131 ASP N . 131 . N  1 2 
       71 1 1 1 1 108 VAL O . 108 . O  1 2 
       71 1 2 1 1 133 ARG H . 133 . HN 1 2 
       72 1 1 1 1 108 VAL O . 108 . O  1 2 
       72 1 2 1 1 133 ARG N . 133 . N  1 2 
       73 1 1 1 1 138 LYS O . 138 . O  1 2 
       73 1 2 1 1 141 LEU H . 141 . HN 1 2 
       74 1 1 1 1 138 LYS O . 138 . O  1 2 
       74 1 2 1 1 141 LEU N . 141 . N  1 2 
       75 1 1 1 1 142 ILE O . 142 . O  1 2 
       75 1 2 1 1 146 ARG H . 146 . HN 1 2 
       76 1 1 1 1 142 ILE O . 142 . O  1 2 
       76 1 2 1 1 146 ARG N . 146 . N  1 2 
       77 1 1 1 1 143 GLU O . 143 . O  1 2 
       77 1 2 1 1 147 ARG H . 147 . HN 1 2 
       78 1 1 1 1 143 GLU O . 143 . O  1 2 
       78 1 2 1 1 147 ARG N . 147 . N  1 2 
       79 1 1 1 1 144 GLN O . 144 . O  1 2 
       79 1 2 1 1 148 PHE H . 148 . HN 1 2 
       80 1 1 1 1 144 GLN O . 144 . O  1 2 
       80 1 2 1 1 148 PHE N . 148 . N  1 2 
       81 1 1 1 1 147 ARG O . 147 . O  1 2 
       81 1 2 1 1 151 LYS H . 151 . HN 1 2 
       82 1 1 1 1 147 ARG O . 147 . O  1 2 
       82 1 2 1 1 151 LYS N . 151 . N  1 2 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

        1 1 . . . . . 2.0 1.8 2.2 1 2 
        2 1 . . . . . 3.0 1.8 3.3 1 2 
        3 1 . . . . . 2.0 1.8 2.2 1 2 
        4 1 . . . . . 3.0 1.8 3.3 1 2 
        5 1 . . . . . 2.0 1.8 2.2 1 2 
        6 1 . . . . . 3.0 1.8 3.3 1 2 
        7 1 . . . . . 2.0 1.8 2.2 1 2 
        8 1 . . . . . 3.0 1.8 3.3 1 2 
        9 1 . . . . . 2.0 1.8 2.2 1 2 
       10 1 . . . . . 3.0 1.8 3.3 1 2 
       11 1 . . . . . 2.0 1.8 2.2 1 2 
       12 1 . . . . . 3.0 1.8 3.3 1 2 
       13 1 . . . . . 2.0 1.8 2.2 1 2 
       14 1 . . . . . 3.0 1.8 3.3 1 2 
       15 1 . . . . . 2.0 1.8 2.2 1 2 
       16 1 . . . . . 3.0 1.8 3.3 1 2 
       17 1 . . . . . 2.0 1.8 2.2 1 2 
       18 1 . . . . . 3.0 1.8 3.3 1 2 
       19 1 . . . . . 2.0 1.8 2.2 1 2 
       20 1 . . . . . 3.0 1.8 3.3 1 2 
       21 1 . . . . . 2.0 1.8 2.2 1 2 
       22 1 . . . . . 3.0 1.8 3.3 1 2 
       23 1 . . . . . 2.0 1.8 2.2 1 2 
       24 1 . . . . . 3.0 1.8 3.3 1 2 
       25 1 . . . . . 2.0 1.8 2.2 1 2 
       26 1 . . . . . 3.0 1.8 3.3 1 2 
       27 1 . . . . . 2.0 1.8 2.2 1 2 
       28 1 . . . . . 3.0 1.8 3.3 1 2 
       29 1 . . . . . 2.0 1.8 2.2 1 2 
       30 1 . . . . . 3.0 1.8 3.3 1 2 
       31 1 . . . . . 2.0 1.8 2.2 1 2 
       32 1 . . . . . 3.0 1.8 3.3 1 2 
       33 1 . . . . . 2.0 1.8 2.2 1 2 
       34 1 . . . . . 3.0 1.8 3.3 1 2 
       35 1 . . . . . 2.0 1.8 2.2 1 2 
       36 1 . . . . . 3.0 1.8 3.3 1 2 
       37 1 . . . . . 2.0 1.8 2.2 1 2 
       38 1 . . . . . 3.0 1.8 3.3 1 2 
       39 1 . . . . . 2.0 1.8 2.2 1 2 
       40 1 . . . . . 3.0 1.8 3.3 1 2 
       41 1 . . . . . 2.0 1.8 2.2 1 2 
       42 1 . . . . . 3.0 1.8 3.3 1 2 
       43 1 . . . . . 2.0 1.8 2.2 1 2 
       44 1 . . . . . 3.0 1.8 3.3 1 2 
       45 1 . . . . . 2.0 1.8 2.2 1 2 
       46 1 . . . . . 3.0 1.8 3.3 1 2 
       47 1 . . . . . 2.0 1.8 2.2 1 2 
       48 1 . . . . . 3.0 1.8 3.3 1 2 
       49 1 . . . . . 2.0 1.8 2.2 1 2 
       50 1 . . . . . 3.0 1.8 3.3 1 2 
       51 1 . . . . . 2.0 1.8 2.2 1 2 
       52 1 . . . . . 3.0 1.8 3.3 1 2 
       53 1 . . . . . 2.0 1.8 2.2 1 2 
       54 1 . . . . . 3.0 1.8 3.3 1 2 
       55 1 . . . . . 2.0 1.8 2.2 1 2 
       56 1 . . . . . 3.0 1.8 3.3 1 2 
       57 1 . . . . . 2.0 1.8 2.2 1 2 
       58 1 . . . . . 3.0 1.8 3.3 1 2 
       59 1 . . . . . 2.0 1.8 2.2 1 2 
       60 1 . . . . . 3.0 1.8 3.3 1 2 
       61 1 . . . . . 2.0 1.8 2.2 1 2 
       62 1 . . . . . 3.0 1.8 3.3 1 2 
       63 1 . . . . . 2.0 1.8 2.2 1 2 
       64 1 . . . . . 3.0 1.8 3.3 1 2 
       65 1 . . . . . 2.0 1.8 2.2 1 2 
       66 1 . . . . . 3.0 1.8 3.3 1 2 
       67 1 . . . . . 2.0 1.8 2.2 1 2 
       68 1 . . . . . 3.0 1.8 3.3 1 2 
       69 1 . . . . . 2.0 1.8 2.2 1 2 
       70 1 . . . . . 3.0 1.8 3.3 1 2 
       71 1 . . . . . 2.0 1.8 2.2 1 2 
       72 1 . . . . . 3.0 1.8 3.3 1 2 
       73 1 . . . . . 2.0 1.8 2.2 1 2 
       74 1 . . . . . 3.0 1.8 3.3 1 2 
       75 1 . . . . . 2.0 1.8 2.2 1 2 
       76 1 . . . . . 3.0 1.8 3.3 1 2 
       77 1 . . . . . 2.0 1.8 2.2 1 2 
       78 1 . . . . . 3.0 1.8 3.3 1 2 
       79 1 . . . . . 2.0 1.8 2.2 1 2 
       80 1 . . . . . 3.0 1.8 3.3 1 2 
       81 1 . . . . . 2.0 1.8 2.2 1 2 
       82 1 . . . . . 3.0 1.8 3.3 1 2 
    stop_

save_


save_CNS/XPLOR_dihedral_2
    _Torsion_angle_constraint_list.Sf_category         torsion_angle_constraints
    _Torsion_angle_constraint_list.Entry_ID            1
    _Torsion_angle_constraint_list.ID                  1
    _Torsion_angle_constraint_list.Constraint_file_ID  .
    _Torsion_angle_constraint_list.Block_ID            .

    loop_
       _Torsion_angle_constraint.ID
       _Torsion_angle_constraint.Torsion_angle_name
       _Torsion_angle_constraint.Entity_assembly_ID_1
       _Torsion_angle_constraint.Entity_ID_1
       _Torsion_angle_constraint.Comp_index_ID_1
       _Torsion_angle_constraint.Comp_ID_1
       _Torsion_angle_constraint.Atom_ID_1
       _Torsion_angle_constraint.Entity_assembly_ID_2
       _Torsion_angle_constraint.Entity_ID_2
       _Torsion_angle_constraint.Comp_index_ID_2
       _Torsion_angle_constraint.Comp_ID_2
       _Torsion_angle_constraint.Atom_ID_2
       _Torsion_angle_constraint.Entity_assembly_ID_3
       _Torsion_angle_constraint.Entity_ID_3
       _Torsion_angle_constraint.Comp_index_ID_3
       _Torsion_angle_constraint.Comp_ID_3
       _Torsion_angle_constraint.Atom_ID_3
       _Torsion_angle_constraint.Entity_assembly_ID_4
       _Torsion_angle_constraint.Entity_ID_4
       _Torsion_angle_constraint.Comp_index_ID_4
       _Torsion_angle_constraint.Comp_ID_4
       _Torsion_angle_constraint.Atom_ID_4
       _Torsion_angle_constraint.Angle_lower_bound_val
       _Torsion_angle_constraint.Angle_upper_bound_val
       _Torsion_angle_constraint.Auth_asym_ID_1
       _Torsion_angle_constraint.Auth_seq_ID_1
       _Torsion_angle_constraint.Auth_comp_ID_1
       _Torsion_angle_constraint.Auth_atom_ID_1
       _Torsion_angle_constraint.Auth_asym_ID_2
       _Torsion_angle_constraint.Auth_seq_ID_2
       _Torsion_angle_constraint.Auth_comp_ID_2
       _Torsion_angle_constraint.Auth_atom_ID_2
       _Torsion_angle_constraint.Auth_asym_ID_3
       _Torsion_angle_constraint.Auth_seq_ID_3
       _Torsion_angle_constraint.Auth_comp_ID_3
       _Torsion_angle_constraint.Auth_atom_ID_3
       _Torsion_angle_constraint.Auth_asym_ID_4
       _Torsion_angle_constraint.Auth_seq_ID_4
       _Torsion_angle_constraint.Auth_comp_ID_4
       _Torsion_angle_constraint.Auth_atom_ID_4
       _Torsion_angle_constraint.Entry_ID
       _Torsion_angle_constraint.Torsion_angle_constraint_list_ID

         1 . 1 1   2 SER C 1 1   3 GLN N  1 1   3 GLN CA 1 1   3 GLN C      -138.0      -88.9 .   2 . C .   3 . N  .   3 . CA .   3 . C 1 1 
         2 . 1 1   3 GLN N 1 1   3 GLN CA 1 1   3 GLN C  1 1   4 ILE N   118.59999  170.59999 .   3 . N .   3 . CA .   3 . C  .   4 . N 1 1 
         3 . 1 1   3 GLN C 1 1   4 ILE N  1 1   4 ILE CA 1 1   4 ILE C      -153.5     -113.5 .   3 . C .   4 . N  .   4 . CA .   4 . C 1 1 
         4 . 1 1   4 ILE N 1 1   4 ILE CA 1 1   4 ILE C  1 1   5 PHE N       110.3      150.3 .   4 . N .   4 . CA .   4 . C  .   5 . N 1 1 
         5 . 1 1   4 ILE C 1 1   5 PHE N  1 1   5 PHE CA 1 1   5 PHE C      -132.8      -92.8 .   4 . C .   5 . N  .   5 . CA .   5 . C 1 1 
         6 . 1 1   5 PHE N 1 1   5 PHE CA 1 1   5 PHE C  1 1   6 VAL N       106.3      146.3 .   5 . N .   5 . CA .   5 . C  .   6 . N 1 1 
         7 . 1 1   5 PHE C 1 1   6 VAL N  1 1   6 VAL CA 1 1   6 VAL C      -145.0     -104.1 .   5 . C .   6 . N  .   6 . CA .   6 . C 1 1 
         8 . 1 1   6 VAL N 1 1   6 VAL CA 1 1   6 VAL C  1 1   7 VAL N       110.2      164.0 .   6 . N .   6 . CA .   6 . C  .   7 . N 1 1 
         9 . 1 1   6 VAL C 1 1   7 VAL N  1 1   7 VAL CA 1 1   7 VAL C      -156.6      -78.5 .   6 . C .   7 . N  .   7 . CA .   7 . C 1 1 
        10 . 1 1   7 VAL N 1 1   7 VAL CA 1 1   7 VAL C  1 1   8 PHE N       103.7      171.8 .   7 . N .   7 . CA .   7 . C  .   8 . N 1 1 
        11 . 1 1   7 VAL C 1 1   8 PHE N  1 1   8 PHE CA 1 1   8 PHE C      -156.6      -67.2 .   7 . C .   8 . N  .   8 . CA .   8 . C 1 1 
        12 . 1 1   8 PHE N 1 1   8 PHE CA 1 1   8 PHE C  1 1   9 SER N   124.50001      170.7 .   8 . N .   8 . CA .   8 . C  .   9 . N 1 1 
        13 . 1 1   8 PHE C 1 1   9 SER N  1 1   9 SER CA 1 1   9 SER C  -140.29999      -49.7 .   8 . C .   9 . N  .   9 . CA .   9 . C 1 1 
        14 . 1 1   9 SER N 1 1   9 SER CA 1 1   9 SER C  1 1  10 SER N        85.5      168.3 .   9 . N .   9 . CA .   9 . C  .  10 . N 1 1 
        15 . 1 1  12 PRO C 1 1  13 GLU N  1 1  13 GLU CA 1 1  13 GLU C       -96.5      -44.2 .  12 . C .  13 . N  .  13 . CA .  13 . C 1 1 
        16 . 1 1  13 GLU N 1 1  13 GLU CA 1 1  13 GLU C  1 1  14 ILE N       -69.4  7.1999993 .  13 . N .  13 . CA .  13 . C  .  14 . N 1 1 
        17 . 1 1  13 GLU C 1 1  14 ILE N  1 1  14 ILE CA 1 1  14 ILE C      -120.9 -41.699997 .  13 . C .  14 . N  .  14 . CA .  14 . C 1 1 
        18 . 1 1  14 ILE N 1 1  14 ILE CA 1 1  14 ILE C  1 1  15 LEU N       -58.0       14.0 .  14 . N .  14 . CA .  14 . C  .  15 . N 1 1 
        19 . 1 1  14 ILE C 1 1  15 LEU N  1 1  15 LEU CA 1 1  15 LEU C       -81.2      -41.2 .  14 . C .  15 . N  .  15 . CA .  15 . C 1 1 
        20 . 1 1  15 LEU N 1 1  15 LEU CA 1 1  15 LEU C  1 1  16 LYS N  -60.099995      -20.1 .  15 . N .  15 . CA .  15 . C  .  16 . N 1 1 
        21 . 1 1  15 LEU C 1 1  16 LYS N  1 1  16 LYS CA 1 1  16 LYS C       -82.0      -42.0 .  15 . C .  16 . N  .  16 . CA .  16 . C 1 1 
        22 . 1 1  16 LYS N 1 1  16 LYS CA 1 1  16 LYS C  1 1  17 GLU N  -61.399998 -21.399998 .  16 . N .  16 . CA .  16 . C  .  17 . N 1 1 
        23 . 1 1  16 LYS C 1 1  17 GLU N  1 1  17 GLU CA 1 1  17 GLU C       -84.6      -44.6 .  16 . C .  17 . N  .  17 . CA .  17 . C 1 1 
        24 . 1 1  17 GLU N 1 1  17 GLU CA 1 1  17 GLU C  1 1  18 ILE N       -64.6      -24.6 .  17 . N .  17 . CA .  17 . C  .  18 . N 1 1 
        25 . 1 1  17 GLU C 1 1  18 ILE N  1 1  18 ILE CA 1 1  18 ILE C       -84.5      -44.5 .  17 . C .  18 . N  .  18 . CA .  18 . C 1 1 
        26 . 1 1  18 ILE N 1 1  18 ILE CA 1 1  18 ILE C  1 1  19 VAL N       -64.6      -24.6 .  18 . N .  18 . CA .  18 . C  .  19 . N 1 1 
        27 . 1 1  18 ILE C 1 1  19 VAL N  1 1  19 VAL CA 1 1  19 VAL C       -85.2      -45.2 .  18 . C .  19 . N  .  19 . CA .  19 . C 1 1 
        28 . 1 1  19 VAL N 1 1  19 VAL CA 1 1  19 VAL C  1 1  20 ARG N  -61.999996      -22.0 .  19 . N .  19 . CA .  19 . C  .  20 . N 1 1 
        29 . 1 1  19 VAL C 1 1  20 ARG N  1 1  20 ARG CA 1 1  20 ARG C       -83.0      -43.0 .  19 . C .  20 . N  .  20 . CA .  20 . C 1 1 
        30 . 1 1  20 ARG N 1 1  20 ARG CA 1 1  20 ARG C  1 1  21 GLU N       -61.7      -21.7 .  20 . N .  20 . CA .  20 . C  .  21 . N 1 1 
        31 . 1 1  20 ARG C 1 1  21 GLU N  1 1  21 GLU CA 1 1  21 GLU C       -86.7      -46.7 .  20 . C .  21 . N  .  21 . CA .  21 . C 1 1 
        32 . 1 1  21 GLU N 1 1  21 GLU CA 1 1  21 GLU C  1 1  22 ILE N       -59.0      -19.0 .  21 . N .  21 . CA .  21 . C  .  22 . N 1 1 
        33 . 1 1  21 GLU C 1 1  22 ILE N  1 1  22 ILE CA 1 1  22 ILE C       -82.6      -42.6 .  21 . C .  22 . N  .  22 . CA .  22 . C 1 1 
        34 . 1 1  22 ILE N 1 1  22 ILE CA 1 1  22 ILE C  1 1  23 LYS N  -57.599995      -17.6 .  22 . N .  22 . CA .  22 . C  .  23 . N 1 1 
        35 . 1 1  22 ILE C 1 1  23 LYS N  1 1  23 LYS CA 1 1  23 LYS C       -82.3      -42.3 .  22 . C .  23 . N  .  23 . CA .  23 . C 1 1 
        36 . 1 1  23 LYS N 1 1  23 LYS CA 1 1  23 LYS C  1 1  24 ARG N       -59.2      -19.2 .  23 . N .  23 . CA .  23 . C  .  24 . N 1 1 
        37 . 1 1  23 LYS C 1 1  24 ARG N  1 1  24 ARG CA 1 1  24 ARG C       -87.6      -47.6 .  23 . C .  24 . N  .  24 . CA .  24 . C 1 1 
        38 . 1 1  24 ARG N 1 1  24 ARG CA 1 1  24 ARG C  1 1  25 GLN N  -47.999996       -2.5 .  24 . N .  24 . CA .  24 . C  .  25 . N 1 1 
        39 . 1 1  24 ARG C 1 1  25 GLN N  1 1  25 GLN CA 1 1  25 GLN C      -113.2      -67.3 .  24 . C .  25 . N  .  25 . CA .  25 . C 1 1 
        40 . 1 1  25 GLN N 1 1  25 GLN CA 1 1  25 GLN C  1 1  26 GLY N  -26.999998       27.3 .  25 . N .  25 . CA .  25 . C  .  26 . N 1 1 
        41 . 1 1  26 GLY C 1 1  27 VAL N  1 1  27 VAL CA 1 1  27 VAL C      -150.1      -58.4 .  26 . C .  27 . N  .  27 . CA .  27 . C 1 1 
        42 . 1 1  27 VAL N 1 1  27 VAL CA 1 1  27 VAL C  1 1  28 ARG N        97.0      168.2 .  27 . N .  27 . CA .  27 . C  .  28 . N 1 1 
        43 . 1 1  27 VAL C 1 1  28 ARG N  1 1  28 ARG CA 1 1  28 ARG C  -115.19999      -58.9 .  27 . C .  28 . N  .  28 . CA .  28 . C 1 1 
        44 . 1 1  28 ARG N 1 1  28 ARG CA 1 1  28 ARG C  1 1  29 VAL N        87.3      178.6 .  28 . N .  28 . CA .  28 . C  .  29 . N 1 1 
        45 . 1 1  28 ARG C 1 1  29 VAL N  1 1  29 VAL CA 1 1  29 VAL C  -155.39998      -92.1 .  28 . C .  29 . N  .  29 . CA .  29 . C 1 1 
        46 . 1 1  29 VAL N 1 1  29 VAL CA 1 1  29 VAL C  1 1  30 VAL N       119.6      159.6 .  29 . N .  29 . CA .  29 . C  .  30 . N 1 1 
        47 . 1 1  29 VAL C 1 1  30 VAL N  1 1  30 VAL CA 1 1  30 VAL C      -136.2      -87.7 .  29 . C .  30 . N  .  30 . CA .  30 . C 1 1 
        48 . 1 1  30 VAL N 1 1  30 VAL CA 1 1  30 VAL C  1 1  31 LEU N        98.4      151.6 .  30 . N .  30 . CA .  30 . C  .  31 . N 1 1 
        49 . 1 1  30 VAL C 1 1  31 LEU N  1 1  31 LEU CA 1 1  31 LEU C      -130.0  -89.99999 .  30 . C .  31 . N  .  31 . CA .  31 . C 1 1 
        50 . 1 1  31 LEU N 1 1  31 LEU CA 1 1  31 LEU C  1 1  32 LEU N       100.3  140.29999 .  31 . N .  31 . CA .  31 . C  .  32 . N 1 1 
        51 . 1 1  31 LEU C 1 1  32 LEU N  1 1  32 LEU CA 1 1  32 LEU C      -117.6      -77.6 .  31 . C .  32 . N  .  32 . CA .  32 . C 1 1 
        52 . 1 1  32 LEU N 1 1  32 LEU CA 1 1  32 LEU C  1 1  33 TYR N        94.8      134.8 .  32 . N .  32 . CA .  32 . C  .  33 . N 1 1 
        53 . 1 1  32 LEU C 1 1  33 TYR N  1 1  33 TYR CA 1 1  33 TYR C      -127.9      -81.8 .  32 . C .  33 . N  .  33 . CA .  33 . C 1 1 
        54 . 1 1  33 TYR N 1 1  33 TYR CA 1 1  33 TYR C  1 1  34 SER N   100.69999      140.7 .  33 . N .  33 . CA .  33 . C  .  34 . N 1 1 
        55 . 1 1  33 TYR C 1 1  34 SER N  1 1  34 SER CA 1 1  34 SER C      -133.6      -74.4 .  33 . C .  34 . N  .  34 . CA .  34 . C 1 1 
        56 . 1 1  34 SER N 1 1  34 SER CA 1 1  34 SER C  1 1  35 ASP N       101.8      142.3 .  34 . N .  34 . CA .  34 . C  .  35 . N 1 1 
        57 . 1 1  34 SER C 1 1  35 ASP N  1 1  35 ASP CA 1 1  35 ASP C      -133.5      -53.6 .  34 . C .  35 . N  .  35 . CA .  35 . C 1 1 
        58 . 1 1  35 ASP N 1 1  35 ASP CA 1 1  35 ASP C  1 1  36 GLN N        88.9      174.5 .  35 . N .  35 . CA .  35 . C  .  36 . N 1 1 
        59 . 1 1  37 ASP C 1 1  38 GLU N  1 1  38 GLU CA 1 1  38 GLU C      -104.8      -20.2 .  37 . C .  38 . N  .  38 . CA .  38 . C 1 1 
        60 . 1 1  38 GLU N 1 1  38 GLU CA 1 1  38 GLU C  1 1  39 LYS N  -58.300003        6.8 .  38 . N .  38 . CA .  38 . C  .  39 . N 1 1 
        61 . 1 1  38 GLU C 1 1  39 LYS N  1 1  39 LYS CA 1 1  39 LYS C  -85.299995      -45.3 .  38 . C .  39 . N  .  39 . CA .  39 . C 1 1 
        62 . 1 1  39 LYS N 1 1  39 LYS CA 1 1  39 LYS C  1 1  40 ARG N       -67.2       -8.0 .  39 . N .  39 . CA .  39 . C  .  40 . N 1 1 
        63 . 1 1  39 LYS C 1 1  40 ARG N  1 1  40 ARG CA 1 1  40 ARG C       -84.0      -44.0 .  39 . C .  40 . N  .  40 . CA .  40 . C 1 1 
        64 . 1 1  40 ARG N 1 1  40 ARG CA 1 1  40 ARG C  1 1  41 ARG N  -60.299995      -20.3 .  40 . N .  40 . CA .  40 . C  .  41 . N 1 1 
        65 . 1 1  40 ARG C 1 1  41 ARG N  1 1  41 ARG CA 1 1  41 ARG C      -100.0      -32.1 .  40 . C .  41 . N  .  41 . CA .  41 . C 1 1 
        66 . 1 1  41 ARG N 1 1  41 ARG CA 1 1  41 ARG C  1 1  42 ARG N       -72.8       -2.5 .  41 . N .  41 . CA .  41 . C  .  42 . N 1 1 
        67 . 1 1  41 ARG C 1 1  42 ARG N  1 1  42 ARG CA 1 1  42 ARG C       -81.9      -41.9 .  41 . C .  42 . N  .  42 . CA .  42 . C 1 1 
        68 . 1 1  42 ARG N 1 1  42 ARG CA 1 1  42 ARG C  1 1  43 GLU N  -60.399998      -16.0 .  42 . N .  42 . CA .  42 . C  .  43 . N 1 1 
        69 . 1 1  42 ARG C 1 1  43 GLU N  1 1  43 GLU CA 1 1  43 GLU C       -84.5      -44.5 .  42 . C .  43 . N  .  43 . CA .  43 . C 1 1 
        70 . 1 1  43 GLU N 1 1  43 GLU CA 1 1  43 GLU C  1 1  44 ARG N       -62.5 -22.499998 .  43 . N .  43 . CA .  43 . C  .  44 . N 1 1 
        71 . 1 1  43 GLU C 1 1  44 ARG N  1 1  44 ARG CA 1 1  44 ARG C       -86.0      -46.0 .  43 . C .  44 . N  .  44 . CA .  44 . C 1 1 
        72 . 1 1  44 ARG N 1 1  44 ARG CA 1 1  44 ARG C  1 1  45 LEU N       -61.5      -21.5 .  44 . N .  44 . CA .  44 . C  .  45 . N 1 1 
        73 . 1 1  44 ARG C 1 1  45 LEU N  1 1  45 LEU CA 1 1  45 LEU C       -78.4      -38.4 .  44 . C .  45 . N  .  45 . CA .  45 . C 1 1 
        74 . 1 1  45 LEU N 1 1  45 LEU CA 1 1  45 LEU C  1 1  46 GLU N       -65.0      -25.0 .  45 . N .  45 . CA .  45 . C  .  46 . N 1 1 
        75 . 1 1  45 LEU C 1 1  46 GLU N  1 1  46 GLU CA 1 1  46 GLU C       -81.4      -41.4 .  45 . C .  46 . N  .  46 . CA .  46 . C 1 1 
        76 . 1 1  46 GLU N 1 1  46 GLU CA 1 1  46 GLU C  1 1  47 GLU N  -62.199997 -15.699999 .  46 . N .  46 . CA .  46 . C  .  47 . N 1 1 
        77 . 1 1  46 GLU C 1 1  47 GLU N  1 1  47 GLU CA 1 1  47 GLU C       -84.4      -44.4 .  46 . C .  47 . N  .  47 . CA .  47 . C 1 1 
        78 . 1 1  47 GLU N 1 1  47 GLU CA 1 1  47 GLU C  1 1  48 PHE N  -60.099995      -20.1 .  47 . N .  47 . CA .  47 . C  .  48 . N 1 1 
        79 . 1 1  47 GLU C 1 1  48 PHE N  1 1  48 PHE CA 1 1  48 PHE C       -85.5      -45.5 .  47 . C .  48 . N  .  48 . CA .  48 . C 1 1 
        80 . 1 1  48 PHE N 1 1  48 PHE CA 1 1  48 PHE C  1 1  49 GLU N  -59.400005      -19.4 .  48 . N .  48 . CA .  48 . C  .  49 . N 1 1 
        81 . 1 1  48 PHE C 1 1  49 GLU N  1 1  49 GLU CA 1 1  49 GLU C       -82.1      -42.1 .  48 . C .  49 . N  .  49 . CA .  49 . C 1 1 
        82 . 1 1  49 GLU N 1 1  49 GLU CA 1 1  49 GLU C  1 1  50 LYS N       -64.4      -24.4 .  49 . N .  49 . CA .  49 . C  .  50 . N 1 1 
        83 . 1 1  49 GLU C 1 1  50 LYS N  1 1  50 LYS CA 1 1  50 LYS C       -87.3      -47.3 .  49 . C .  50 . N  .  50 . CA .  50 . C 1 1 
        84 . 1 1  50 LYS N 1 1  50 LYS CA 1 1  50 LYS C  1 1  51 GLN N       -55.0      -15.0 .  50 . N .  50 . CA .  50 . C  .  51 . N 1 1 
        85 . 1 1  50 LYS C 1 1  51 GLN N  1 1  51 GLN CA 1 1  51 GLN C      -113.3      -68.6 .  50 . C .  51 . N  .  51 . CA .  51 . C 1 1 
        86 . 1 1  51 GLN N 1 1  51 GLN CA 1 1  51 GLN C  1 1  52 GLY N       -33.4       21.5 .  51 . N .  51 . CA .  51 . C  .  52 . N 1 1 
        87 . 1 1  53 VAL C 1 1  54 ASP N  1 1  54 ASP CA 1 1  54 ASP C      -140.7      -50.0 .  53 . C .  54 . N  .  54 . CA .  54 . C 1 1 
        88 . 1 1  54 ASP N 1 1  54 ASP CA 1 1  54 ASP C  1 1  55 VAL N        68.3      165.4 .  54 . N .  54 . CA .  54 . C  .  55 . N 1 1 
        89 . 1 1  54 ASP C 1 1  55 VAL N  1 1  55 VAL CA 1 1  55 VAL C      -141.9      -80.9 .  54 . C .  55 . N  .  55 . CA .  55 . C 1 1 
        90 . 1 1  55 VAL N 1 1  55 VAL CA 1 1  55 VAL C  1 1  56 ARG N   106.69999      146.7 .  55 . N .  55 . CA .  55 . C  .  56 . N 1 1 
        91 . 1 1  55 VAL C 1 1  56 ARG N  1 1  56 ARG CA 1 1  56 ARG C      -161.9      -77.2 .  55 . C .  56 . N  .  56 . CA .  56 . C 1 1 
        92 . 1 1  56 ARG N 1 1  56 ARG CA 1 1  56 ARG C  1 1  57 THR N       101.3      180.5 .  56 . N .  56 . CA .  56 . C  .  57 . N 1 1 
        93 . 1 1  56 ARG C 1 1  57 THR N  1 1  57 THR CA 1 1  57 THR C      -133.9 -63.899998 .  56 . C .  57 . N  .  57 . CA .  57 . C 1 1 
        94 . 1 1  57 THR N 1 1  57 THR CA 1 1  57 THR C  1 1  58 VAL N       104.3      164.3 .  57 . N .  57 . CA .  57 . C  .  58 . N 1 1 
        95 . 1 1  57 THR C 1 1  58 VAL N  1 1  58 VAL CA 1 1  58 VAL C      -156.8      -62.4 .  57 . C .  58 . N  .  58 . CA .  58 . C 1 1 
        96 . 1 1  58 VAL N 1 1  58 VAL CA 1 1  58 VAL C  1 1  59 GLU N   124.50001      173.3 .  58 . N .  58 . CA .  58 . C  .  59 . N 1 1 
        97 . 1 1  60 ASP C 1 1  61 LYS N  1 1  61 LYS CA 1 1  61 LYS C       -80.3      -40.3 .  60 . C .  61 . N  .  61 . CA .  61 . C 1 1 
        98 . 1 1  61 LYS N 1 1  61 LYS CA 1 1  61 LYS C  1 1  62 GLU N  -57.500004      -17.5 .  61 . N .  61 . CA .  61 . C  .  62 . N 1 1 
        99 . 1 1  61 LYS C 1 1  62 GLU N  1 1  62 GLU CA 1 1  62 GLU C       -86.7      -46.7 .  61 . C .  62 . N  .  62 . CA .  62 . C 1 1 
       100 . 1 1  62 GLU N 1 1  62 GLU CA 1 1  62 GLU C  1 1  63 ASP N       -61.7      -21.7 .  62 . N .  62 . CA .  62 . C  .  63 . N 1 1 
       101 . 1 1  62 GLU C 1 1  63 ASP N  1 1  63 ASP CA 1 1  63 ASP C       -84.6      -44.6 .  62 . C .  63 . N  .  63 . CA .  63 . C 1 1 
       102 . 1 1  63 ASP N 1 1  63 ASP CA 1 1  63 ASP C  1 1  64 PHE N  -60.399998      -20.4 .  63 . N .  63 . CA .  63 . C  .  64 . N 1 1 
       103 . 1 1  63 ASP C 1 1  64 PHE N  1 1  64 PHE CA 1 1  64 PHE C       -83.9      -43.9 .  63 . C .  64 . N  .  64 . CA .  64 . C 1 1 
       104 . 1 1  64 PHE N 1 1  64 PHE CA 1 1  64 PHE C  1 1  65 ARG N       -62.5 -22.499998 .  64 . N .  64 . CA .  64 . C  .  65 . N 1 1 
       105 . 1 1  64 PHE C 1 1  65 ARG N  1 1  65 ARG CA 1 1  65 ARG C  -79.299995      -39.3 .  64 . C .  65 . N  .  65 . CA .  65 . C 1 1 
       106 . 1 1  65 ARG N 1 1  65 ARG CA 1 1  65 ARG C  1 1  66 GLU N       -63.3      -18.9 .  65 . N .  65 . CA .  65 . C  .  66 . N 1 1 
       107 . 1 1  65 ARG C 1 1  66 GLU N  1 1  66 GLU CA 1 1  66 GLU C       -84.0      -44.0 .  65 . C .  66 . N  .  66 . CA .  66 . C 1 1 
       108 . 1 1  66 GLU N 1 1  66 GLU CA 1 1  66 GLU C  1 1  67 ASN N  -60.399998      -20.4 .  66 . N .  66 . CA .  66 . C  .  67 . N 1 1 
       109 . 1 1  66 GLU C 1 1  67 ASN N  1 1  67 ASN CA 1 1  67 ASN C       -85.4      -45.4 .  66 . C .  67 . N  .  67 . CA .  67 . C 1 1 
       110 . 1 1  67 ASN N 1 1  67 ASN CA 1 1  67 ASN C  1 1  68 ILE N       -61.5      -21.5 .  67 . N .  67 . CA .  67 . C  .  68 . N 1 1 
       111 . 1 1  67 ASN C 1 1  68 ILE N  1 1  68 ILE CA 1 1  68 ILE C       -82.1      -42.1 .  67 . C .  68 . N  .  68 . CA .  68 . C 1 1 
       112 . 1 1  68 ILE N 1 1  68 ILE CA 1 1  68 ILE C  1 1  69 ARG N       -67.8      -27.8 .  68 . N .  68 . CA .  68 . C  .  69 . N 1 1 
       113 . 1 1  68 ILE C 1 1  69 ARG N  1 1  69 ARG CA 1 1  69 ARG C       -82.5      -42.5 .  68 . C .  69 . N  .  69 . CA .  69 . C 1 1 
       114 . 1 1  69 ARG N 1 1  69 ARG CA 1 1  69 ARG C  1 1  70 GLU N       -57.3      -17.3 .  69 . N .  69 . CA .  69 . C  .  70 . N 1 1 
       115 . 1 1  69 ARG C 1 1  70 GLU N  1 1  70 GLU CA 1 1  70 GLU C       -89.9 -49.899998 .  69 . C .  70 . N  .  70 . CA .  70 . C 1 1 
       116 . 1 1  70 GLU N 1 1  70 GLU CA 1 1  70 GLU C  1 1  71 ILE N  -59.499996      -19.5 .  70 . N .  70 . CA .  70 . C  .  71 . N 1 1 
       117 . 1 1  70 GLU C 1 1  71 ILE N  1 1  71 ILE CA 1 1  71 ILE C       -83.0      -43.0 .  70 . C .  71 . N  .  71 . CA .  71 . C 1 1 
       118 . 1 1  71 ILE N 1 1  71 ILE CA 1 1  71 ILE C  1 1  72 TRP N       -59.2      -19.2 .  71 . N .  71 . CA .  71 . C  .  72 . N 1 1 
       119 . 1 1  71 ILE C 1 1  72 TRP N  1 1  72 TRP CA 1 1  72 TRP C       -99.4      -48.5 .  71 . C .  72 . N  .  72 . CA .  72 . C 1 1 
       120 . 1 1  72 TRP N 1 1  72 TRP CA 1 1  72 TRP C  1 1  73 GLU N       -40.7        5.6 .  72 . N .  72 . CA .  72 . C  .  73 . N 1 1 
       121 . 1 1  72 TRP C 1 1  73 GLU N  1 1  73 GLU CA 1 1  73 GLU C      -155.9      -36.9 .  72 . C .  73 . N  .  73 . CA .  73 . C 1 1 
       122 . 1 1  73 GLU N 1 1  73 GLU CA 1 1  73 GLU C  1 1  74 ARG N       -67.6       26.0 .  73 . N .  73 . CA .  73 . C  .  74 . N 1 1 
       123 . 1 1  73 GLU C 1 1  74 ARG N  1 1  74 ARG CA 1 1  74 ARG C       -97.0      -57.0 .  73 . C .  74 . N  .  74 . CA .  74 . C 1 1 
       124 . 1 1  74 ARG N 1 1  74 ARG CA 1 1  74 ARG C  1 1  75 TYR N       -70.5       10.5 .  74 . N .  74 . CA .  74 . C  .  75 . N 1 1 
       125 . 1 1  79 ASP C 1 1  80 VAL N  1 1  80 VAL CA 1 1  80 VAL C      -168.8 -91.899994 .  79 . C .  80 . N  .  80 . CA .  80 . C 1 1 
       126 . 1 1  80 VAL N 1 1  80 VAL CA 1 1  80 VAL C  1 1  81 VAL N        97.4      203.5 .  80 . N .  80 . CA .  80 . C  .  81 . N 1 1 
       127 . 1 1  80 VAL C 1 1  81 VAL N  1 1  81 VAL CA 1 1  81 VAL C      -141.5 -61.999996 .  80 . C .  81 . N  .  81 . CA .  81 . C 1 1 
       128 . 1 1  81 VAL N 1 1  81 VAL CA 1 1  81 VAL C  1 1  82 VAL N       107.5      151.3 .  81 . N .  81 . CA .  81 . C  .  82 . N 1 1 
       129 . 1 1  81 VAL C 1 1  82 VAL N  1 1  82 VAL CA 1 1  82 VAL C  -129.59999      -89.6 .  81 . C .  82 . N  .  82 . CA .  82 . C 1 1 
       130 . 1 1  82 VAL N 1 1  82 VAL CA 1 1  82 VAL C  1 1  83 ILE N       106.5      146.5 .  82 . N .  82 . CA .  82 . C  .  83 . N 1 1 
       131 . 1 1  82 VAL C 1 1  83 ILE N  1 1  83 ILE CA 1 1  83 ILE C  -126.09999      -86.1 .  82 . C .  83 . N  .  83 . CA .  83 . C 1 1 
       132 . 1 1  83 ILE N 1 1  83 ILE CA 1 1  83 ILE C  1 1  84 VAL N        98.6      138.6 .  83 . N .  83 . CA .  83 . C  .  84 . N 1 1 
       133 . 1 1  83 ILE C 1 1  84 VAL N  1 1  84 VAL CA 1 1  84 VAL C      -139.5      -90.8 .  83 . C .  84 . N  .  84 . CA .  84 . C 1 1 
       134 . 1 1  84 VAL N 1 1  84 VAL CA 1 1  84 VAL C  1 1  85 THR N       100.5      162.9 .  84 . N .  84 . CA .  84 . C  .  85 . N 1 1 
       135 . 1 1  88 ASP C 1 1  89 LYS N  1 1  89 LYS CA 1 1  89 LYS C       -77.1      -37.1 .  88 . C .  89 . N  .  89 . CA .  89 . C 1 1 
       136 . 1 1  89 LYS N 1 1  89 LYS CA 1 1  89 LYS C  1 1  90 GLU N  -57.899998      -17.9 .  89 . N .  89 . CA .  89 . C  .  90 . N 1 1 
       137 . 1 1  89 LYS C 1 1  90 GLU N  1 1  90 GLU CA 1 1  90 GLU C       -81.7 -41.699997 .  89 . C .  90 . N  .  90 . CA .  90 . C 1 1 
       138 . 1 1  90 GLU N 1 1  90 GLU CA 1 1  90 GLU C  1 1  91 TRP N       -58.0      -18.0 .  90 . N .  90 . CA .  90 . C  .  91 . N 1 1 
       139 . 1 1  90 GLU C 1 1  91 TRP N  1 1  91 TRP CA 1 1  91 TRP C   -83.69999      -43.7 .  90 . C .  91 . N  .  91 . CA .  91 . C 1 1 
       140 . 1 1  91 TRP N 1 1  91 TRP CA 1 1  91 TRP C  1 1  92 ILE N  -63.699997      -23.7 .  91 . N .  91 . CA .  91 . C  .  92 . N 1 1 
       141 . 1 1  91 TRP C 1 1  92 ILE N  1 1  92 ILE CA 1 1  92 ILE C       -82.7      -42.6 .  91 . C .  92 . N  .  92 . CA .  92 . C 1 1 
       142 . 1 1  92 ILE N 1 1  92 ILE CA 1 1  92 ILE C  1 1  93 LYS N       -65.0      -25.0 .  92 . N .  92 . CA .  92 . C  .  93 . N 1 1 
       143 . 1 1  92 ILE C 1 1  93 LYS N  1 1  93 LYS CA 1 1  93 LYS C       -79.7      -39.7 .  92 . C .  93 . N  .  93 . CA .  93 . C 1 1 
       144 . 1 1  93 LYS N 1 1  93 LYS CA 1 1  93 LYS C  1 1  94 ASP N       -61.1      -21.1 .  93 . N .  93 . CA .  93 . C  .  94 . N 1 1 
       145 . 1 1  93 LYS C 1 1  94 ASP N  1 1  94 ASP CA 1 1  94 ASP C   -83.69999      -43.7 .  93 . C .  94 . N  .  94 . CA .  94 . C 1 1 
       146 . 1 1  94 ASP N 1 1  94 ASP CA 1 1  94 ASP C  1 1  95 PHE N  -61.600002      -21.6 .  94 . N .  94 . CA .  94 . C  .  95 . N 1 1 
       147 . 1 1  94 ASP C 1 1  95 PHE N  1 1  95 PHE CA 1 1  95 PHE C       -85.5      -45.5 .  94 . C .  95 . N  .  95 . CA .  95 . C 1 1 
       148 . 1 1  95 PHE N 1 1  95 PHE CA 1 1  95 PHE C  1 1  96 ILE N       -64.2      -24.2 .  95 . N .  95 . CA .  95 . C  .  96 . N 1 1 
       149 . 1 1  95 PHE C 1 1  96 ILE N  1 1  96 ILE CA 1 1  96 ILE C       -83.5      -43.5 .  95 . C .  96 . N  .  96 . CA .  96 . C 1 1 
       150 . 1 1  96 ILE N 1 1  96 ILE CA 1 1  96 ILE C  1 1  97 GLU N       -61.9      -21.9 .  96 . N .  96 . CA .  96 . C  .  97 . N 1 1 
       151 . 1 1  96 ILE C 1 1  97 GLU N  1 1  97 GLU CA 1 1  97 GLU C       -82.6      -42.6 .  96 . C .  97 . N  .  97 . CA .  97 . C 1 1 
       152 . 1 1  97 GLU N 1 1  97 GLU CA 1 1  97 GLU C  1 1  98 GLU N       -59.9 -19.899998 .  97 . N .  97 . CA .  97 . C  .  98 . N 1 1 
       153 . 1 1  97 GLU C 1 1  98 GLU N  1 1  98 GLU CA 1 1  98 GLU C       -94.2      -43.5 .  97 . C .  98 . N  .  98 . CA .  98 . C 1 1 
       154 . 1 1  98 GLU N 1 1  98 GLU CA 1 1  98 GLU C  1 1  99 ALA N  -59.299995      -19.3 .  98 . N .  98 . CA .  98 . C  .  99 . N 1 1 
       155 . 1 1  98 GLU C 1 1  99 ALA N  1 1  99 ALA CA 1 1  99 ALA C       -82.1      -42.1 .  98 . C .  99 . N  .  99 . CA .  99 . C 1 1 
       156 . 1 1  99 ALA N 1 1  99 ALA CA 1 1  99 ALA C  1 1 100 LYS N  -62.199997      -22.2 .  99 . N .  99 . CA .  99 . C  . 100 . N 1 1 
       157 . 1 1  99 ALA C 1 1 100 LYS N  1 1 100 LYS CA 1 1 100 LYS C       -84.4      -44.4 .  99 . C . 100 . N  . 100 . CA . 100 . C 1 1 
       158 . 1 1 100 LYS N 1 1 100 LYS CA 1 1 100 LYS C  1 1 101 GLU N       -63.4      -23.4 . 100 . N . 100 . CA . 100 . C  . 101 . N 1 1 
       159 . 1 1 100 LYS C 1 1 101 GLU N  1 1 101 GLU CA 1 1 101 GLU C       -85.9      -45.9 . 100 . C . 101 . N  . 101 . CA . 101 . C 1 1 
       160 . 1 1 101 GLU N 1 1 101 GLU CA 1 1 101 GLU C  1 1 102 ARG N       -52.7      -12.2 . 101 . N . 101 . CA . 101 . C  . 102 . N 1 1 
       161 . 1 1 101 GLU C 1 1 102 ARG N  1 1 102 ARG CA 1 1 102 ARG C      -119.7      -58.6 . 101 . C . 102 . N  . 102 . CA . 102 . C 1 1 
       162 . 1 1 102 ARG N 1 1 102 ARG CA 1 1 102 ARG C  1 1 103 GLY N       -18.0       25.4 . 102 . N . 102 . CA . 102 . C  . 103 . N 1 1 
       163 . 1 1 104 VAL C 1 1 105 GLU N  1 1 105 GLU CA 1 1 105 GLU C      -145.0 -60.800003 . 104 . C . 105 . N  . 105 . CA . 105 . C 1 1 
       164 . 1 1 105 GLU N 1 1 105 GLU CA 1 1 105 GLU C  1 1 106 VAL N        74.8      204.7 . 105 . N . 105 . CA . 105 . C  . 106 . N 1 1 
       165 . 1 1 105 GLU C 1 1 106 VAL N  1 1 106 VAL CA 1 1 106 VAL C      -147.1     -101.2 . 105 . C . 106 . N  . 106 . CA . 106 . C 1 1 
       166 . 1 1 106 VAL N 1 1 106 VAL CA 1 1 106 VAL C  1 1 107 PHE N       111.0  150.99998 . 106 . N . 106 . CA . 106 . C  . 107 . N 1 1 
       167 . 1 1 106 VAL C 1 1 107 PHE N  1 1 107 PHE CA 1 1 107 PHE C      -152.1      -70.8 . 106 . C . 107 . N  . 107 . CA . 107 . C 1 1 
       168 . 1 1 107 PHE N 1 1 107 PHE CA 1 1 107 PHE C  1 1 108 VAL N       103.8      149.9 . 107 . N . 107 . CA . 107 . C  . 108 . N 1 1 
       169 . 1 1 107 PHE C 1 1 108 VAL N  1 1 108 VAL CA 1 1 108 VAL C      -139.5      -92.3 . 107 . C . 108 . N  . 108 . CA . 108 . C 1 1 
       170 . 1 1 108 VAL N 1 1 108 VAL CA 1 1 108 VAL C  1 1 109 VAL N       106.6      146.6 . 108 . N . 108 . CA . 108 . C  . 109 . N 1 1 
       171 . 1 1 108 VAL C 1 1 109 VAL N  1 1 109 VAL CA 1 1 109 VAL C  -125.59999  -85.59999 . 108 . C . 109 . N  . 109 . CA . 109 . C 1 1 
       172 . 1 1 109 VAL N 1 1 109 VAL CA 1 1 109 VAL C  1 1 110 TYR N       100.8      140.8 . 109 . N . 109 . CA . 109 . C  . 110 . N 1 1 
       173 . 1 1 109 VAL C 1 1 110 TYR N  1 1 110 TYR CA 1 1 110 TYR C      -135.2      -95.2 . 109 . C . 110 . N  . 110 . CA . 110 . C 1 1 
       174 . 1 1 110 TYR N 1 1 110 TYR CA 1 1 110 TYR C  1 1 111 ASN N       105.2      148.4 . 110 . N . 110 . CA . 110 . C  . 111 . N 1 1 
       175 . 1 1 110 TYR C 1 1 111 ASN N  1 1 111 ASN CA 1 1 111 ASN C      -142.6      -92.1 . 110 . C . 111 . N  . 111 . CA . 111 . C 1 1 
       176 . 1 1 111 ASN N 1 1 111 ASN CA 1 1 111 ASN C  1 1 112 ASN N       109.2      153.5 . 111 . N . 111 . CA . 111 . C  . 112 . N 1 1 
       177 . 1 1 111 ASN C 1 1 112 ASN N  1 1 112 ASN CA 1 1 112 ASN C      -162.4      -67.9 . 111 . C . 112 . N  . 112 . CA . 112 . C 1 1 
       178 . 1 1 112 ASN N 1 1 112 ASN CA 1 1 112 ASN C  1 1 113 LYS N        89.7      165.1 . 112 . N . 112 . CA . 112 . C  . 113 . N 1 1 
       179 . 1 1 115 ASP C 1 1 116 ASP N  1 1 116 ASP CA 1 1 116 ASP C  -85.299995      -45.3 . 115 . C . 116 . N  . 116 . CA . 116 . C 1 1 
       180 . 1 1 116 ASP N 1 1 116 ASP CA 1 1 116 ASP C  1 1 117 ARG N       -60.7      -10.4 . 116 . N . 116 . CA . 116 . C  . 117 . N 1 1 
       181 . 1 1 116 ASP C 1 1 117 ARG N  1 1 117 ARG CA 1 1 117 ARG C  -85.299995      -45.3 . 116 . C . 117 . N  . 117 . CA . 117 . C 1 1 
       182 . 1 1 117 ARG N 1 1 117 ARG CA 1 1 117 ARG C  1 1 118 ARG N       -63.0      -23.0 . 117 . N . 117 . CA . 117 . C  . 118 . N 1 1 
       183 . 1 1 117 ARG C 1 1 118 ARG N  1 1 118 ARG CA 1 1 118 ARG C       -82.4      -42.4 . 117 . C . 118 . N  . 118 . CA . 118 . C 1 1 
       184 . 1 1 118 ARG N 1 1 118 ARG CA 1 1 118 ARG C  1 1 119 LYS N  -61.799995      -21.8 . 118 . N . 118 . CA . 118 . C  . 119 . N 1 1 
       185 . 1 1 118 ARG C 1 1 119 LYS N  1 1 119 LYS CA 1 1 119 LYS C       -82.8 -42.799995 . 118 . C . 119 . N  . 119 . CA . 119 . C 1 1 
       186 . 1 1 119 LYS N 1 1 119 LYS CA 1 1 119 LYS C  1 1 120 GLU N  -62.899998      -22.9 . 119 . N . 119 . CA . 119 . C  . 120 . N 1 1 
       187 . 1 1 119 LYS C 1 1 120 GLU N  1 1 120 GLU CA 1 1 120 GLU C       -83.0      -43.0 . 119 . C . 120 . N  . 120 . CA . 120 . C 1 1 
       188 . 1 1 120 GLU N 1 1 120 GLU CA 1 1 120 GLU C  1 1 121 ALA N       -62.5      -19.5 . 120 . N . 120 . CA . 120 . C  . 121 . N 1 1 
       189 . 1 1 120 GLU C 1 1 121 ALA N  1 1 121 ALA CA 1 1 121 ALA C      -101.2      -38.3 . 120 . C . 121 . N  . 121 . CA . 121 . C 1 1 
       190 . 1 1 121 ALA N 1 1 121 ALA CA 1 1 121 ALA C  1 1 122 GLN N  -61.600002        6.8 . 121 . N . 121 . CA . 121 . C  . 122 . N 1 1 
       191 . 1 1 121 ALA C 1 1 122 GLN N  1 1 122 GLN CA 1 1 122 GLN C       -87.9      -47.9 . 121 . C . 122 . N  . 122 . CA . 122 . C 1 1 
       192 . 1 1 122 GLN N 1 1 122 GLN CA 1 1 122 GLN C  1 1 123 GLN N       -55.0      -12.1 . 122 . N . 122 . CA . 122 . C  . 123 . N 1 1 
       193 . 1 1 122 GLN C 1 1 123 GLN N  1 1 123 GLN CA 1 1 123 GLN C       -88.5      -48.5 . 122 . C . 123 . N  . 123 . CA . 123 . C 1 1 
       194 . 1 1 123 GLN N 1 1 123 GLN CA 1 1 123 GLN C  1 1 124 GLU N       -53.5 -5.9999995 . 123 . N . 123 . CA . 123 . C  . 124 . N 1 1 
       195 . 1 1 123 GLN C 1 1 124 GLU N  1 1 124 GLU CA 1 1 124 GLU C       -94.9 -42.799995 . 123 . C . 124 . N  . 124 . CA . 124 . C 1 1 
       196 . 1 1 124 GLU N 1 1 124 GLU CA 1 1 124 GLU C  1 1 125 PHE N       -52.3       -6.6 . 124 . N . 124 . CA . 124 . C  . 125 . N 1 1 
       197 . 1 1 124 GLU C 1 1 125 PHE N  1 1 125 PHE CA 1 1 125 PHE C -125.700005      -83.2 . 124 . C . 125 . N  . 125 . CA . 125 . C 1 1 
       198 . 1 1 125 PHE N 1 1 125 PHE CA 1 1 125 PHE C  1 1 126 ARG N       -30.0       38.6 . 125 . N . 125 . CA . 125 . C  . 126 . N 1 1 
       199 . 1 1 129 GLY C 1 1 130 VAL N  1 1 130 VAL CA 1 1 130 VAL C      -171.0 -30.999998 . 129 . C . 130 . N  . 130 . CA . 130 . C 1 1 
       200 . 1 1 130 VAL N 1 1 130 VAL CA 1 1 130 VAL C  1 1 131 ASP N       112.3      166.3 . 130 . N . 130 . CA . 130 . C  . 131 . N 1 1 
       201 . 1 1 130 VAL C 1 1 131 ASP N  1 1 131 ASP CA 1 1 131 ASP C      -134.6      -82.7 . 130 . C . 131 . N  . 131 . CA . 131 . C 1 1 
       202 . 1 1 131 ASP N 1 1 131 ASP CA 1 1 131 ASP C  1 1 132 VAL N       102.3      149.9 . 131 . N . 131 . CA . 131 . C  . 132 . N 1 1 
       203 . 1 1 131 ASP C 1 1 132 VAL N  1 1 132 VAL CA 1 1 132 VAL C      -135.5      -95.5 . 131 . C . 132 . N  . 132 . CA . 132 . C 1 1 
       204 . 1 1 132 VAL N 1 1 132 VAL CA 1 1 132 VAL C  1 1 133 ARG N       107.4      147.4 . 132 . N . 132 . CA . 132 . C  . 133 . N 1 1 
       205 . 1 1 132 VAL C 1 1 133 ARG N  1 1 133 ARG CA 1 1 133 ARG C      -130.6      -88.6 . 132 . C . 133 . N  . 133 . CA . 133 . C 1 1 
       206 . 1 1 133 ARG N 1 1 133 ARG CA 1 1 133 ARG C  1 1 134 THR N       102.4      157.7 . 133 . N . 133 . CA . 133 . C  . 134 . N 1 1 
       207 . 1 1 133 ARG C 1 1 134 THR N  1 1 134 THR CA 1 1 134 THR C      -161.6      -73.5 . 133 . C . 134 . N  . 134 . CA . 134 . C 1 1 
       208 . 1 1 134 THR N 1 1 134 THR CA 1 1 134 THR C  1 1 135 VAL N  116.600006      188.5 . 134 . N . 134 . CA . 134 . C  . 135 . N 1 1 
       209 . 1 1 134 THR C 1 1 135 VAL N  1 1 135 VAL CA 1 1 135 VAL C      -158.4     -110.9 . 134 . C . 135 . N  . 135 . CA . 135 . C 1 1 
       210 . 1 1 135 VAL N 1 1 135 VAL CA 1 1 135 VAL C  1 1 136 SER N       139.4      179.4 . 135 . N . 135 . CA . 135 . C  . 136 . N 1 1 
       211 . 1 1 137 ASP C 1 1 138 LYS N  1 1 138 LYS CA 1 1 138 LYS C       -80.1      -40.1 . 137 . C . 138 . N  . 138 . CA . 138 . C 1 1 
       212 . 1 1 138 LYS N 1 1 138 LYS CA 1 1 138 LYS C  1 1 139 GLU N       -57.2      -17.2 . 138 . N . 138 . CA . 138 . C  . 139 . N 1 1 
       213 . 1 1 138 LYS C 1 1 139 GLU N  1 1 139 GLU CA 1 1 139 GLU C       -85.9      -45.9 . 138 . C . 139 . N  . 139 . CA . 139 . C 1 1 
       214 . 1 1 139 GLU N 1 1 139 GLU CA 1 1 139 GLU C  1 1 140 GLU N       -60.7      -20.7 . 139 . N . 139 . CA . 139 . C  . 140 . N 1 1 
       215 . 1 1 139 GLU C 1 1 140 GLU N  1 1 140 GLU CA 1 1 140 GLU C       -87.0      -47.0 . 139 . C . 140 . N  . 140 . CA . 140 . C 1 1 
       216 . 1 1 140 GLU N 1 1 140 GLU CA 1 1 140 GLU C  1 1 141 LEU N       -61.3      -21.3 . 140 . N . 140 . CA . 140 . C  . 141 . N 1 1 
       217 . 1 1 140 GLU C 1 1 141 LEU N  1 1 141 LEU CA 1 1 141 LEU C       -80.2      -40.2 . 140 . C . 141 . N  . 141 . CA . 141 . C 1 1 
       218 . 1 1 141 LEU N 1 1 141 LEU CA 1 1 141 LEU C  1 1 142 ILE N  -63.899998      -23.9 . 141 . N . 141 . CA . 141 . C  . 142 . N 1 1 
       219 . 1 1 141 LEU C 1 1 142 ILE N  1 1 142 ILE CA 1 1 142 ILE C       -86.3      -46.3 . 141 . C . 142 . N  . 142 . CA . 142 . C 1 1 
       220 . 1 1 142 ILE N 1 1 142 ILE CA 1 1 142 ILE C  1 1 143 GLU N       -60.7      -20.7 . 142 . N . 142 . CA . 142 . C  . 143 . N 1 1 
       221 . 1 1 142 ILE C 1 1 143 GLU N  1 1 143 GLU CA 1 1 143 GLU C       -86.7      -46.7 . 142 . C . 143 . N  . 143 . CA . 143 . C 1 1 
       222 . 1 1 143 GLU N 1 1 143 GLU CA 1 1 143 GLU C  1 1 144 GLN N       -58.2      -18.2 . 143 . N . 143 . CA . 143 . C  . 144 . N 1 1 
       223 . 1 1 143 GLU C 1 1 144 GLN N  1 1 144 GLN CA 1 1 144 GLN C       -86.0      -46.0 . 143 . C . 144 . N  . 144 . CA . 144 . C 1 1 
       224 . 1 1 144 GLN N 1 1 144 GLN CA 1 1 144 GLN C  1 1 145 VAL N  -59.299995      -19.3 . 144 . N . 144 . CA . 144 . C  . 145 . N 1 1 
       225 . 1 1 144 GLN C 1 1 145 VAL N  1 1 145 VAL CA 1 1 145 VAL C       -85.1      -45.1 . 144 . C . 145 . N  . 145 . CA . 145 . C 1 1 
       226 . 1 1 145 VAL N 1 1 145 VAL CA 1 1 145 VAL C  1 1 146 ARG N       -65.7      -25.7 . 145 . N . 145 . CA . 145 . C  . 146 . N 1 1 
       227 . 1 1 145 VAL C 1 1 146 ARG N  1 1 146 ARG CA 1 1 146 ARG C  -77.399994      -37.4 . 145 . C . 146 . N  . 146 . CA . 146 . C 1 1 
       228 . 1 1 146 ARG N 1 1 146 ARG CA 1 1 146 ARG C  1 1 147 ARG N       -65.4      -25.4 . 146 . N . 146 . CA . 146 . C  . 147 . N 1 1 
       229 . 1 1 146 ARG C 1 1 147 ARG N  1 1 147 ARG CA 1 1 147 ARG C       -82.7      -42.7 . 146 . C . 147 . N  . 147 . CA . 147 . C 1 1 
       230 . 1 1 147 ARG N 1 1 147 ARG CA 1 1 147 ARG C  1 1 148 PHE N  -60.399998      -20.4 . 147 . N . 147 . CA . 147 . C  . 148 . N 1 1 
       231 . 1 1 147 ARG C 1 1 148 PHE N  1 1 148 PHE CA 1 1 148 PHE C       -85.1      -45.1 . 147 . C . 148 . N  . 148 . CA . 148 . C 1 1 
       232 . 1 1 148 PHE N 1 1 148 PHE CA 1 1 148 PHE C  1 1 149 VAL N       -58.4 -18.399998 . 148 . N . 148 . CA . 148 . C  . 149 . N 1 1 
       233 . 1 1 148 PHE C 1 1 149 VAL N  1 1 149 VAL CA 1 1 149 VAL C       -83.1 -43.099995 . 148 . C . 149 . N  . 149 . CA . 149 . C 1 1 
       234 . 1 1 149 VAL N 1 1 149 VAL CA 1 1 149 VAL C  1 1 150 ARG N       -54.7      -14.7 . 149 . N . 149 . CA . 149 . C  . 150 . N 1 1 
       235 . 1 1 149 VAL C 1 1 150 ARG N  1 1 150 ARG CA 1 1 150 ARG C   -83.69999      -43.7 . 149 . C . 150 . N  . 150 . CA . 150 . C 1 1 
       236 . 1 1 150 ARG N 1 1 150 ARG CA 1 1 150 ARG C  1 1 151 LYS N  -58.300003       -3.9 . 150 . N . 150 . CA . 150 . C  . 151 . N 1 1 
       237 . 1 1 150 ARG C 1 1 151 LYS N  1 1 151 LYS CA 1 1 151 LYS C       -86.9      -43.4 . 150 . C . 151 . N  . 151 . CA . 151 . C 1 1 
       238 . 1 1 151 LYS N 1 1 151 LYS CA 1 1 151 LYS C  1 1 152 VAL N  -57.899998      -11.9 . 151 . N . 151 . CA . 151 . C  . 152 . N 1 1 
       239 . 1 1 151 LYS C 1 1 152 VAL N  1 1 152 VAL CA 1 1 152 VAL C  -118.19999      -39.1 . 151 . C . 152 . N  . 152 . CA . 152 . C 1 1 
       240 . 1 1 152 VAL N 1 1 152 VAL CA 1 1 152 VAL C  1 1 153 GLY N       -64.2      -14.0 . 152 . N . 152 . CA . 152 . C  . 153 . N 1 1 
    stop_

save_


save_conformer_family_coord_set_1
    _Conformer_family_coord_set.Sf_category  conformer_family_coord_set
    _Conformer_family_coord_set.Entry_ID     1
    _Conformer_family_coord_set.ID           1

    loop_
       _Atom_site.Model_ID
       _Atom_site.ID
       _Atom_site.Label_entity_assembly_ID
       _Atom_site.Label_entity_ID
       _Atom_site.Label_comp_index_ID
       _Atom_site.Label_comp_ID
       _Atom_site.Label_atom_ID
       _Atom_site.Type_symbol
       _Atom_site.Cartn_x
       _Atom_site.Cartn_y
       _Atom_site.Cartn_z
       _Atom_site.Occupancy
       _Atom_site.Uncertainty
       _Atom_site.PDBX_label_asym_ID
       _Atom_site.PDB_strand_ID
       _Atom_site.PDB_ins_code
       _Atom_site.PDB_residue_no
       _Atom_site.PDB_residue_name
       _Atom_site.PDB_atom_name
       _Atom_site.Entry_ID
       _Atom_site.Conformer_family_coord_set_ID

        1     1 1 1   1 MET C    C  -1.306  -4.358  17.678 1.00 . A A .   1 MET C    1 1 
        1     2 1 1   1 MET CA   C  -1.233  -3.993  19.173 1.00 . A A .   1 MET CA   1 1 
        1     3 1 1   1 MET CB   C  -2.021  -5.014  20.007 1.00 . A A .   1 MET CB   1 1 
        1     4 1 1   1 MET CE   C   0.210  -8.520  19.561 1.00 . A A .   1 MET CE   1 1 
        1     5 1 1   1 MET CG   C  -1.636  -6.465  19.737 1.00 . A A .   1 MET CG   1 1 
        1     6 1 1   1 MET H1   H  -1.663  -2.387  20.441 1.00 . A A .   1 MET H1   1 1 
        1     7 1 1   1 MET H2   H  -2.753  -2.556  19.159 1.00 . A A .   1 MET H2   1 1 
        1     8 1 1   1 MET H3   H  -1.213  -1.922  18.878 1.00 . A A .   1 MET H3   1 1 
        1     9 1 1   1 MET HA   H  -0.197  -4.017  19.480 1.00 . A A .   1 MET HA   1 1 
        1    10 1 1   1 MET HB2  H  -1.853  -4.810  21.055 1.00 . A A .   1 MET HB2  1 1 
        1    11 1 1   1 MET HB3  H  -3.074  -4.898  19.793 1.00 . A A .   1 MET HB3  1 1 
        1    12 1 1   1 MET HE1  H  -0.113  -8.649  18.537 1.00 . A A .   1 MET HE1  1 1 
        1    13 1 1   1 MET HE2  H  -0.430  -9.094  20.217 1.00 . A A .   1 MET HE2  1 1 
        1    14 1 1   1 MET HE3  H   1.226  -8.866  19.662 1.00 . A A .   1 MET HE3  1 1 
        1    15 1 1   1 MET HG2  H  -2.205  -7.105  20.395 1.00 . A A .   1 MET HG2  1 1 
        1    16 1 1   1 MET HG3  H  -1.879  -6.704  18.711 1.00 . A A .   1 MET HG3  1 1 
        1    17 1 1   1 MET N    N  -1.752  -2.622  19.430 1.00 . A A .   1 MET N    1 1 
        1    18 1 1   1 MET O    O  -0.279  -4.577  17.035 1.00 . A A .   1 MET O    1 1 
        1    19 1 1   1 MET SD   S   0.120  -6.783  20.004 1.00 . A A .   1 MET SD   1 1 
        1    20 1 1   2 SER C    C  -2.358  -3.716  14.735 1.00 . A A .   2 SER C    1 1 
        1    21 1 1   2 SER CA   C  -2.725  -4.829  15.730 1.00 . A A .   2 SER CA   1 1 
        1    22 1 1   2 SER CB   C  -4.186  -5.246  15.512 1.00 . A A .   2 SER CB   1 1 
        1    23 1 1   2 SER H    H  -3.301  -4.167  17.672 1.00 . A A .   2 SER H    1 1 
        1    24 1 1   2 SER HA   H  -2.090  -5.685  15.543 1.00 . A A .   2 SER HA   1 1 
        1    25 1 1   2 SER HB2  H  -4.835  -4.415  15.746 1.00 . A A .   2 SER HB2  1 1 
        1    26 1 1   2 SER HB3  H  -4.329  -5.532  14.479 1.00 . A A .   2 SER HB3  1 1 
        1    27 1 1   2 SER HG   H  -4.747  -7.109  15.788 1.00 . A A .   2 SER HG   1 1 
        1    28 1 1   2 SER N    N  -2.519  -4.414  17.130 1.00 . A A .   2 SER N    1 1 
        1    29 1 1   2 SER O    O  -3.068  -2.718  14.620 1.00 . A A .   2 SER O    1 1 
        1    30 1 1   2 SER OG   O  -4.541  -6.345  16.340 1.00 . A A .   2 SER OG   1 1 
        1    31 1 1   3 GLN C    C  -0.771  -3.535  11.593 1.00 . A A .   3 GLN C    1 1 
        1    32 1 1   3 GLN CA   C  -0.800  -2.924  13.006 1.00 . A A .   3 GLN CA   1 1 
        1    33 1 1   3 GLN CB   C   0.608  -2.414  13.357 1.00 . A A .   3 GLN CB   1 1 
        1    34 1 1   3 GLN CD   C   2.617  -1.092  12.503 1.00 . A A .   3 GLN CD   1 1 
        1    35 1 1   3 GLN CG   C   1.106  -1.287  12.444 1.00 . A A .   3 GLN CG   1 1 
        1    36 1 1   3 GLN H    H  -0.733  -4.723  14.138 1.00 . A A .   3 GLN H    1 1 
        1    37 1 1   3 GLN HA   H  -1.489  -2.091  13.015 1.00 . A A .   3 GLN HA   1 1 
        1    38 1 1   3 GLN HB2  H   0.604  -2.048  14.375 1.00 . A A .   3 GLN HB2  1 1 
        1    39 1 1   3 GLN HB3  H   1.303  -3.239  13.287 1.00 . A A .   3 GLN HB3  1 1 
        1    40 1 1   3 GLN HE21 H   2.863  -2.337  10.987 1.00 . A A .   3 GLN HE21 1 1 
        1    41 1 1   3 GLN HE22 H   4.302  -1.652  11.643 1.00 . A A .   3 GLN HE22 1 1 
        1    42 1 1   3 GLN HG2  H   0.830  -1.518  11.425 1.00 . A A .   3 GLN HG2  1 1 
        1    43 1 1   3 GLN HG3  H   0.627  -0.364  12.740 1.00 . A A .   3 GLN HG3  1 1 
        1    44 1 1   3 GLN N    N  -1.255  -3.905  14.006 1.00 . A A .   3 GLN N    1 1 
        1    45 1 1   3 GLN NE2  N   3.333  -1.761  11.622 1.00 . A A .   3 GLN NE2  1 1 
        1    46 1 1   3 GLN O    O  -0.404  -4.695  11.419 1.00 . A A .   3 GLN O    1 1 
        1    47 1 1   3 GLN OE1  O   3.140  -0.340  13.318 1.00 . A A .   3 GLN OE1  1 1 
        1    48 1 1   4 ILE C    C  -0.188  -2.133   8.399 1.00 . A A .   4 ILE C    1 1 
        1    49 1 1   4 ILE CA   C  -1.038  -3.150   9.183 1.00 . A A .   4 ILE CA   1 1 
        1    50 1 1   4 ILE CB   C  -2.433  -3.313   8.515 1.00 . A A .   4 ILE CB   1 1 
        1    51 1 1   4 ILE CD1  C  -3.601  -4.099   6.368 1.00 . A A .   4 ILE CD1  1 1 
        1    52 1 1   4 ILE CG1  C  -2.293  -3.696   7.026 1.00 . A A .   4 ILE CG1  1 1 
        1    53 1 1   4 ILE CG2  C  -3.257  -2.035   8.672 1.00 . A A .   4 ILE CG2  1 1 
        1    54 1 1   4 ILE H    H  -1.532  -1.864  10.801 1.00 . A A .   4 ILE H    1 1 
        1    55 1 1   4 ILE HA   H  -0.536  -4.111   9.155 1.00 . A A .   4 ILE HA   1 1 
        1    56 1 1   4 ILE HB   H  -2.955  -4.107   9.032 1.00 . A A .   4 ILE HB   1 1 
        1    57 1 1   4 ILE HD11 H  -4.293  -3.271   6.401 1.00 . A A .   4 ILE HD11 1 1 
        1    58 1 1   4 ILE HD12 H  -4.024  -4.944   6.893 1.00 . A A .   4 ILE HD12 1 1 
        1    59 1 1   4 ILE HD13 H  -3.417  -4.374   5.339 1.00 . A A .   4 ILE HD13 1 1 
        1    60 1 1   4 ILE HG12 H  -1.900  -2.851   6.478 1.00 . A A .   4 ILE HG12 1 1 
        1    61 1 1   4 ILE HG13 H  -1.606  -4.524   6.933 1.00 . A A .   4 ILE HG13 1 1 
        1    62 1 1   4 ILE HG21 H  -2.734  -1.207   8.219 1.00 . A A .   4 ILE HG21 1 1 
        1    63 1 1   4 ILE HG22 H  -3.411  -1.831   9.723 1.00 . A A .   4 ILE HG22 1 1 
        1    64 1 1   4 ILE HG23 H  -4.215  -2.161   8.189 1.00 . A A .   4 ILE HG23 1 1 
        1    65 1 1   4 ILE N    N  -1.154  -2.745  10.591 1.00 . A A .   4 ILE N    1 1 
        1    66 1 1   4 ILE O    O  -0.245  -0.927   8.657 1.00 . A A .   4 ILE O    1 1 
        1    67 1 1   5 PHE C    C   0.944  -1.484   5.294 1.00 . A A .   5 PHE C    1 1 
        1    68 1 1   5 PHE CA   C   1.523  -1.771   6.686 1.00 . A A .   5 PHE CA   1 1 
        1    69 1 1   5 PHE CB   C   2.886  -2.464   6.558 1.00 . A A .   5 PHE CB   1 1 
        1    70 1 1   5 PHE CD1  C   4.234  -1.254   4.802 1.00 . A A .   5 PHE CD1  1 1 
        1    71 1 1   5 PHE CD2  C   4.874  -1.014   7.087 1.00 . A A .   5 PHE CD2  1 1 
        1    72 1 1   5 PHE CE1  C   5.279  -0.436   4.425 1.00 . A A .   5 PHE CE1  1 1 
        1    73 1 1   5 PHE CE2  C   5.918  -0.193   6.711 1.00 . A A .   5 PHE CE2  1 1 
        1    74 1 1   5 PHE CG   C   4.017  -1.555   6.138 1.00 . A A .   5 PHE CG   1 1 
        1    75 1 1   5 PHE CZ   C   6.120   0.095   5.378 1.00 . A A .   5 PHE CZ   1 1 
        1    76 1 1   5 PHE H    H   0.596  -3.589   7.276 1.00 . A A .   5 PHE H    1 1 
        1    77 1 1   5 PHE HA   H   1.649  -0.836   7.218 1.00 . A A .   5 PHE HA   1 1 
        1    78 1 1   5 PHE HB2  H   3.148  -2.895   7.513 1.00 . A A .   5 PHE HB2  1 1 
        1    79 1 1   5 PHE HB3  H   2.810  -3.259   5.827 1.00 . A A .   5 PHE HB3  1 1 
        1    80 1 1   5 PHE HD1  H   3.575  -1.664   4.052 1.00 . A A .   5 PHE HD1  1 1 
        1    81 1 1   5 PHE HD2  H   4.720  -1.238   8.135 1.00 . A A .   5 PHE HD2  1 1 
        1    82 1 1   5 PHE HE1  H   5.438  -0.211   3.382 1.00 . A A .   5 PHE HE1  1 1 
        1    83 1 1   5 PHE HE2  H   6.577   0.222   7.461 1.00 . A A .   5 PHE HE2  1 1 
        1    84 1 1   5 PHE HZ   H   6.938   0.735   5.080 1.00 . A A .   5 PHE HZ   1 1 
        1    85 1 1   5 PHE N    N   0.616  -2.626   7.462 1.00 . A A .   5 PHE N    1 1 
        1    86 1 1   5 PHE O    O   0.462  -2.392   4.614 1.00 . A A .   5 PHE O    1 1 
        1    87 1 1   6 VAL C    C   1.408   1.147   2.824 1.00 . A A .   6 VAL C    1 1 
        1    88 1 1   6 VAL CA   C   0.476   0.154   3.547 1.00 . A A .   6 VAL CA   1 1 
        1    89 1 1   6 VAL CB   C  -0.954   0.746   3.655 1.00 . A A .   6 VAL CB   1 1 
        1    90 1 1   6 VAL CG1  C  -0.952   2.070   4.415 1.00 . A A .   6 VAL CG1  1 1 
        1    91 1 1   6 VAL CG2  C  -1.582   0.904   2.273 1.00 . A A .   6 VAL CG2  1 1 
        1    92 1 1   6 VAL H    H   1.380   0.468   5.449 1.00 . A A .   6 VAL H    1 1 
        1    93 1 1   6 VAL HA   H   0.416  -0.749   2.950 1.00 . A A .   6 VAL HA   1 1 
        1    94 1 1   6 VAL HB   H  -1.561   0.046   4.215 1.00 . A A .   6 VAL HB   1 1 
        1    95 1 1   6 VAL HG11 H  -1.962   2.448   4.487 1.00 . A A .   6 VAL HG11 1 1 
        1    96 1 1   6 VAL HG12 H  -0.337   2.788   3.891 1.00 . A A .   6 VAL HG12 1 1 
        1    97 1 1   6 VAL HG13 H  -0.555   1.917   5.409 1.00 . A A .   6 VAL HG13 1 1 
        1    98 1 1   6 VAL HG21 H  -2.569   1.332   2.371 1.00 . A A .   6 VAL HG21 1 1 
        1    99 1 1   6 VAL HG22 H  -1.657  -0.065   1.799 1.00 . A A .   6 VAL HG22 1 1 
        1   100 1 1   6 VAL HG23 H  -0.966   1.554   1.668 1.00 . A A .   6 VAL HG23 1 1 
        1   101 1 1   6 VAL N    N   0.994  -0.224   4.866 1.00 . A A .   6 VAL N    1 1 
        1   102 1 1   6 VAL O    O   1.960   2.065   3.433 1.00 . A A .   6 VAL O    1 1 
        1   103 1 1   7 VAL C    C   1.727   2.428  -0.462 1.00 . A A .   7 VAL C    1 1 
        1   104 1 1   7 VAL CA   C   2.475   1.767   0.702 1.00 . A A .   7 VAL CA   1 1 
        1   105 1 1   7 VAL CB   C   3.628   0.916   0.108 1.00 . A A .   7 VAL CB   1 1 
        1   106 1 1   7 VAL CG1  C   4.552   1.774  -0.756 1.00 . A A .   7 VAL CG1  1 1 
        1   107 1 1   7 VAL CG2  C   4.415   0.212   1.210 1.00 . A A .   7 VAL CG2  1 1 
        1   108 1 1   7 VAL H    H   1.087   0.220   1.089 1.00 . A A .   7 VAL H    1 1 
        1   109 1 1   7 VAL HA   H   2.904   2.536   1.331 1.00 . A A .   7 VAL HA   1 1 
        1   110 1 1   7 VAL HB   H   3.191   0.157  -0.527 1.00 . A A .   7 VAL HB   1 1 
        1   111 1 1   7 VAL HG11 H   4.971   2.573  -0.160 1.00 . A A .   7 VAL HG11 1 1 
        1   112 1 1   7 VAL HG12 H   3.991   2.196  -1.578 1.00 . A A .   7 VAL HG12 1 1 
        1   113 1 1   7 VAL HG13 H   5.351   1.161  -1.147 1.00 . A A .   7 VAL HG13 1 1 
        1   114 1 1   7 VAL HG21 H   5.196  -0.389   0.767 1.00 . A A .   7 VAL HG21 1 1 
        1   115 1 1   7 VAL HG22 H   3.751  -0.424   1.778 1.00 . A A .   7 VAL HG22 1 1 
        1   116 1 1   7 VAL HG23 H   4.858   0.947   1.867 1.00 . A A .   7 VAL HG23 1 1 
        1   117 1 1   7 VAL N    N   1.579   0.945   1.519 1.00 . A A .   7 VAL N    1 1 
        1   118 1 1   7 VAL O    O   0.918   1.790  -1.137 1.00 . A A .   7 VAL O    1 1 
        1   119 1 1   8 PHE C    C   2.655   4.888  -2.766 1.00 . A A .   8 PHE C    1 1 
        1   120 1 1   8 PHE CA   C   1.492   4.400  -1.886 1.00 . A A .   8 PHE CA   1 1 
        1   121 1 1   8 PHE CB   C   0.599   5.582  -1.474 1.00 . A A .   8 PHE CB   1 1 
        1   122 1 1   8 PHE CD1  C  -0.634   4.909   0.617 1.00 . A A .   8 PHE CD1  1 1 
        1   123 1 1   8 PHE CD2  C  -1.857   5.026  -1.429 1.00 . A A .   8 PHE CD2  1 1 
        1   124 1 1   8 PHE CE1  C  -1.781   4.523   1.284 1.00 . A A .   8 PHE CE1  1 1 
        1   125 1 1   8 PHE CE2  C  -3.007   4.641  -0.766 1.00 . A A .   8 PHE CE2  1 1 
        1   126 1 1   8 PHE CG   C  -0.656   5.165  -0.747 1.00 . A A .   8 PHE CG   1 1 
        1   127 1 1   8 PHE CZ   C  -2.970   4.389   0.591 1.00 . A A .   8 PHE CZ   1 1 
        1   128 1 1   8 PHE H    H   2.577   4.194  -0.066 1.00 . A A .   8 PHE H    1 1 
        1   129 1 1   8 PHE HA   H   0.899   3.695  -2.456 1.00 . A A .   8 PHE HA   1 1 
        1   130 1 1   8 PHE HB2  H   1.158   6.240  -0.824 1.00 . A A .   8 PHE HB2  1 1 
        1   131 1 1   8 PHE HB3  H   0.306   6.128  -2.360 1.00 . A A .   8 PHE HB3  1 1 
        1   132 1 1   8 PHE HD1  H   0.293   5.014   1.162 1.00 . A A .   8 PHE HD1  1 1 
        1   133 1 1   8 PHE HD2  H  -1.889   5.223  -2.492 1.00 . A A .   8 PHE HD2  1 1 
        1   134 1 1   8 PHE HE1  H  -1.749   4.326   2.346 1.00 . A A .   8 PHE HE1  1 1 
        1   135 1 1   8 PHE HE2  H  -3.936   4.537  -1.310 1.00 . A A .   8 PHE HE2  1 1 
        1   136 1 1   8 PHE HZ   H  -3.867   4.087   1.111 1.00 . A A .   8 PHE HZ   1 1 
        1   137 1 1   8 PHE N    N   2.008   3.705  -0.700 1.00 . A A .   8 PHE N    1 1 
        1   138 1 1   8 PHE O    O   3.521   5.642  -2.314 1.00 . A A .   8 PHE O    1 1 
        1   139 1 1   9 SER C    C   3.208   5.017  -6.375 1.00 . A A .   9 SER C    1 1 
        1   140 1 1   9 SER CA   C   3.749   4.806  -4.959 1.00 . A A .   9 SER CA   1 1 
        1   141 1 1   9 SER CB   C   4.837   3.721  -4.987 1.00 . A A .   9 SER CB   1 1 
        1   142 1 1   9 SER H    H   1.945   3.863  -4.331 1.00 . A A .   9 SER H    1 1 
        1   143 1 1   9 SER HA   H   4.190   5.733  -4.618 1.00 . A A .   9 SER HA   1 1 
        1   144 1 1   9 SER HB2  H   5.287   3.639  -4.009 1.00 . A A .   9 SER HB2  1 1 
        1   145 1 1   9 SER HB3  H   4.390   2.774  -5.255 1.00 . A A .   9 SER HB3  1 1 
        1   146 1 1   9 SER HG   H   6.429   3.267  -6.042 1.00 . A A .   9 SER HG   1 1 
        1   147 1 1   9 SER N    N   2.676   4.443  -4.021 1.00 . A A .   9 SER N    1 1 
        1   148 1 1   9 SER O    O   2.346   4.269  -6.839 1.00 . A A .   9 SER O    1 1 
        1   149 1 1   9 SER OG   O   5.855   4.031  -5.929 1.00 . A A .   9 SER OG   1 1 
        1   150 1 1  10 SER C    C   4.225   5.488  -9.427 1.00 . A A .  10 SER C    1 1 
        1   151 1 1  10 SER CA   C   3.345   6.292  -8.459 1.00 . A A .  10 SER CA   1 1 
        1   152 1 1  10 SER CB   C   3.459   7.790  -8.778 1.00 . A A .  10 SER CB   1 1 
        1   153 1 1  10 SER H    H   4.364   6.629  -6.624 1.00 . A A .  10 SER H    1 1 
        1   154 1 1  10 SER HA   H   2.316   5.984  -8.590 1.00 . A A .  10 SER HA   1 1 
        1   155 1 1  10 SER HB2  H   3.208   7.958  -9.814 1.00 . A A .  10 SER HB2  1 1 
        1   156 1 1  10 SER HB3  H   2.772   8.342  -8.151 1.00 . A A .  10 SER HB3  1 1 
        1   157 1 1  10 SER HG   H   5.373   7.929  -9.222 1.00 . A A .  10 SER HG   1 1 
        1   158 1 1  10 SER N    N   3.721   6.033  -7.062 1.00 . A A .  10 SER N    1 1 
        1   159 1 1  10 SER O    O   3.808   5.167 -10.541 1.00 . A A .  10 SER O    1 1 
        1   160 1 1  10 SER OG   O   4.777   8.273  -8.544 1.00 . A A .  10 SER OG   1 1 
        1   161 1 1  11 ASP C    C   6.223   2.902  -9.699 1.00 . A A .  11 ASP C    1 1 
        1   162 1 1  11 ASP CA   C   6.401   4.428  -9.822 1.00 . A A .  11 ASP CA   1 1 
        1   163 1 1  11 ASP CB   C   7.830   4.809  -9.427 1.00 . A A .  11 ASP CB   1 1 
        1   164 1 1  11 ASP CG   C   8.131   6.275  -9.671 1.00 . A A .  11 ASP CG   1 1 
        1   165 1 1  11 ASP H    H   5.702   5.414  -8.080 1.00 . A A .  11 ASP H    1 1 
        1   166 1 1  11 ASP HA   H   6.236   4.718 -10.850 1.00 . A A .  11 ASP HA   1 1 
        1   167 1 1  11 ASP HB2  H   7.972   4.602  -8.376 1.00 . A A .  11 ASP HB2  1 1 
        1   168 1 1  11 ASP HB3  H   8.528   4.215 -10.001 1.00 . A A .  11 ASP HB3  1 1 
        1   169 1 1  11 ASP N    N   5.442   5.160  -8.990 1.00 . A A .  11 ASP N    1 1 
        1   170 1 1  11 ASP O    O   6.471   2.318  -8.639 1.00 . A A .  11 ASP O    1 1 
        1   171 1 1  11 ASP OD1  O   7.830   7.104  -8.790 1.00 . A A .  11 ASP OD1  1 1 
        1   172 1 1  11 ASP OD2  O   8.680   6.599 -10.744 1.00 . A A .  11 ASP OD2  1 1 
        1   173 1 1  12 PRO C    C   6.963   0.011 -10.608 1.00 . A A .  12 PRO C    1 1 
        1   174 1 1  12 PRO CA   C   5.636   0.765 -10.796 1.00 . A A .  12 PRO CA   1 1 
        1   175 1 1  12 PRO CB   C   5.031   0.482 -12.179 1.00 . A A .  12 PRO CB   1 1 
        1   176 1 1  12 PRO CD   C   5.510   2.827 -12.106 1.00 . A A .  12 PRO CD   1 1 
        1   177 1 1  12 PRO CG   C   5.457   1.635 -13.024 1.00 . A A .  12 PRO CG   1 1 
        1   178 1 1  12 PRO HA   H   4.942   0.457 -10.026 1.00 . A A .  12 PRO HA   1 1 
        1   179 1 1  12 PRO HB2  H   5.412  -0.455 -12.562 1.00 . A A .  12 PRO HB2  1 1 
        1   180 1 1  12 PRO HB3  H   3.955   0.430 -12.099 1.00 . A A .  12 PRO HB3  1 1 
        1   181 1 1  12 PRO HD2  H   6.291   3.508 -12.412 1.00 . A A .  12 PRO HD2  1 1 
        1   182 1 1  12 PRO HD3  H   4.555   3.333 -12.082 1.00 . A A .  12 PRO HD3  1 1 
        1   183 1 1  12 PRO HG2  H   6.435   1.441 -13.445 1.00 . A A .  12 PRO HG2  1 1 
        1   184 1 1  12 PRO HG3  H   4.737   1.800 -13.813 1.00 . A A .  12 PRO HG3  1 1 
        1   185 1 1  12 PRO N    N   5.818   2.227 -10.793 1.00 . A A .  12 PRO N    1 1 
        1   186 1 1  12 PRO O    O   6.995  -1.084 -10.043 1.00 . A A .  12 PRO O    1 1 
        1   187 1 1  13 GLU C    C   9.837   0.040  -9.439 1.00 . A A .  13 GLU C    1 1 
        1   188 1 1  13 GLU CA   C   9.396   0.031 -10.915 1.00 . A A .  13 GLU CA   1 1 
        1   189 1 1  13 GLU CB   C  10.404   0.788 -11.790 1.00 . A A .  13 GLU CB   1 1 
        1   190 1 1  13 GLU CD   C  11.057   1.506 -14.143 1.00 . A A .  13 GLU CD   1 1 
        1   191 1 1  13 GLU CG   C  10.106   0.685 -13.286 1.00 . A A .  13 GLU CG   1 1 
        1   192 1 1  13 GLU H    H   7.963   1.468 -11.545 1.00 . A A .  13 GLU H    1 1 
        1   193 1 1  13 GLU HA   H   9.348  -0.996 -11.250 1.00 . A A .  13 GLU HA   1 1 
        1   194 1 1  13 GLU HB2  H  10.392   1.833 -11.512 1.00 . A A .  13 GLU HB2  1 1 
        1   195 1 1  13 GLU HB3  H  11.393   0.388 -11.613 1.00 . A A .  13 GLU HB3  1 1 
        1   196 1 1  13 GLU HG2  H  10.183  -0.352 -13.583 1.00 . A A .  13 GLU HG2  1 1 
        1   197 1 1  13 GLU HG3  H   9.096   1.030 -13.461 1.00 . A A .  13 GLU HG3  1 1 
        1   198 1 1  13 GLU N    N   8.057   0.613 -11.075 1.00 . A A .  13 GLU N    1 1 
        1   199 1 1  13 GLU O    O  10.629  -0.797  -9.013 1.00 . A A .  13 GLU O    1 1 
        1   200 1 1  13 GLU OE1  O  12.143   1.002 -14.497 1.00 . A A .  13 GLU OE1  1 1 
        1   201 1 1  13 GLU OE2  O  10.719   2.662 -14.471 1.00 . A A .  13 GLU OE2  1 1 
        1   202 1 1  14 ILE C    C   8.622   0.011  -6.519 1.00 . A A .  14 ILE C    1 1 
        1   203 1 1  14 ILE CA   C   9.543   1.018  -7.214 1.00 . A A .  14 ILE CA   1 1 
        1   204 1 1  14 ILE CB   C   9.303   2.437  -6.628 1.00 . A A .  14 ILE CB   1 1 
        1   205 1 1  14 ILE CD1  C  10.215   4.834  -6.619 1.00 . A A .  14 ILE CD1  1 1 
        1   206 1 1  14 ILE CG1  C  10.357   3.424  -7.162 1.00 . A A .  14 ILE CG1  1 1 
        1   207 1 1  14 ILE CG2  C   9.313   2.409  -5.097 1.00 . A A .  14 ILE CG2  1 1 
        1   208 1 1  14 ILE H    H   8.718   1.654  -9.064 1.00 . A A .  14 ILE H    1 1 
        1   209 1 1  14 ILE HA   H  10.573   0.738  -7.034 1.00 . A A .  14 ILE HA   1 1 
        1   210 1 1  14 ILE HB   H   8.324   2.768  -6.945 1.00 . A A .  14 ILE HB   1 1 
        1   211 1 1  14 ILE HD11 H  10.300   4.817  -5.541 1.00 . A A .  14 ILE HD11 1 1 
        1   212 1 1  14 ILE HD12 H   9.252   5.234  -6.898 1.00 . A A .  14 ILE HD12 1 1 
        1   213 1 1  14 ILE HD13 H  10.995   5.457  -7.030 1.00 . A A .  14 ILE HD13 1 1 
        1   214 1 1  14 ILE HG12 H  11.341   3.069  -6.895 1.00 . A A .  14 ILE HG12 1 1 
        1   215 1 1  14 ILE HG13 H  10.279   3.475  -8.240 1.00 . A A .  14 ILE HG13 1 1 
        1   216 1 1  14 ILE HG21 H   9.145   3.406  -4.715 1.00 . A A .  14 ILE HG21 1 1 
        1   217 1 1  14 ILE HG22 H  10.268   2.048  -4.748 1.00 . A A .  14 ILE HG22 1 1 
        1   218 1 1  14 ILE HG23 H   8.530   1.753  -4.740 1.00 . A A .  14 ILE HG23 1 1 
        1   219 1 1  14 ILE N    N   9.303   0.982  -8.662 1.00 . A A .  14 ILE N    1 1 
        1   220 1 1  14 ILE O    O   9.047  -0.759  -5.657 1.00 . A A .  14 ILE O    1 1 
        1   221 1 1  15 LEU C    C   6.854  -2.383  -6.546 1.00 . A A .  15 LEU C    1 1 
        1   222 1 1  15 LEU CA   C   6.352  -0.926  -6.456 1.00 . A A .  15 LEU CA   1 1 
        1   223 1 1  15 LEU CB   C   5.055  -0.718  -7.274 1.00 . A A .  15 LEU CB   1 1 
        1   224 1 1  15 LEU CD1  C   3.660  -2.660  -6.437 1.00 . A A .  15 LEU CD1  1 1 
        1   225 1 1  15 LEU CD2  C   3.201  -1.661  -8.696 1.00 . A A .  15 LEU CD2  1 1 
        1   226 1 1  15 LEU CG   C   4.276  -1.985  -7.661 1.00 . A A .  15 LEU CG   1 1 
        1   227 1 1  15 LEU H    H   7.089   0.688  -7.598 1.00 . A A .  15 LEU H    1 1 
        1   228 1 1  15 LEU HA   H   6.151  -0.693  -5.419 1.00 . A A .  15 LEU HA   1 1 
        1   229 1 1  15 LEU HB2  H   4.396  -0.081  -6.702 1.00 . A A .  15 LEU HB2  1 1 
        1   230 1 1  15 LEU HB3  H   5.316  -0.197  -8.186 1.00 . A A .  15 LEU HB3  1 1 
        1   231 1 1  15 LEU HD11 H   4.440  -2.914  -5.735 1.00 . A A .  15 LEU HD11 1 1 
        1   232 1 1  15 LEU HD12 H   3.147  -3.561  -6.741 1.00 . A A .  15 LEU HD12 1 1 
        1   233 1 1  15 LEU HD13 H   2.957  -1.987  -5.966 1.00 . A A .  15 LEU HD13 1 1 
        1   234 1 1  15 LEU HD21 H   2.500  -0.951  -8.281 1.00 . A A .  15 LEU HD21 1 1 
        1   235 1 1  15 LEU HD22 H   2.677  -2.567  -8.969 1.00 . A A .  15 LEU HD22 1 1 
        1   236 1 1  15 LEU HD23 H   3.664  -1.236  -9.575 1.00 . A A .  15 LEU HD23 1 1 
        1   237 1 1  15 LEU HG   H   4.968  -2.680  -8.113 1.00 . A A .  15 LEU HG   1 1 
        1   238 1 1  15 LEU N    N   7.358   0.020  -6.935 1.00 . A A .  15 LEU N    1 1 
        1   239 1 1  15 LEU O    O   6.777  -3.134  -5.572 1.00 . A A .  15 LEU O    1 1 
        1   240 1 1  16 LYS C    C   8.974  -4.515  -6.927 1.00 . A A .  16 LYS C    1 1 
        1   241 1 1  16 LYS CA   C   7.864  -4.139  -7.926 1.00 . A A .  16 LYS CA   1 1 
        1   242 1 1  16 LYS CB   C   8.383  -4.304  -9.361 1.00 . A A .  16 LYS CB   1 1 
        1   243 1 1  16 LYS CD   C   9.392  -5.862 -11.091 1.00 . A A .  16 LYS CD   1 1 
        1   244 1 1  16 LYS CE   C  10.733  -5.137 -11.182 1.00 . A A .  16 LYS CE   1 1 
        1   245 1 1  16 LYS CG   C   8.758  -5.743  -9.707 1.00 . A A .  16 LYS CG   1 1 
        1   246 1 1  16 LYS H    H   7.432  -2.123  -8.446 1.00 . A A .  16 LYS H    1 1 
        1   247 1 1  16 LYS HA   H   7.029  -4.809  -7.780 1.00 . A A .  16 LYS HA   1 1 
        1   248 1 1  16 LYS HB2  H   7.615  -3.976 -10.050 1.00 . A A .  16 LYS HB2  1 1 
        1   249 1 1  16 LYS HB3  H   9.258  -3.683  -9.491 1.00 . A A .  16 LYS HB3  1 1 
        1   250 1 1  16 LYS HD2  H   9.548  -6.909 -11.312 1.00 . A A .  16 LYS HD2  1 1 
        1   251 1 1  16 LYS HD3  H   8.714  -5.441 -11.821 1.00 . A A .  16 LYS HD3  1 1 
        1   252 1 1  16 LYS HE2  H  11.117  -5.246 -12.185 1.00 . A A .  16 LYS HE2  1 1 
        1   253 1 1  16 LYS HE3  H  10.578  -4.087 -10.973 1.00 . A A .  16 LYS HE3  1 1 
        1   254 1 1  16 LYS HG2  H   9.456  -6.108  -8.970 1.00 . A A .  16 LYS HG2  1 1 
        1   255 1 1  16 LYS HG3  H   7.863  -6.349  -9.680 1.00 . A A .  16 LYS HG3  1 1 
        1   256 1 1  16 LYS HZ1  H  11.520  -5.367  -9.258 1.00 . A A .  16 LYS HZ1  1 1 
        1   257 1 1  16 LYS HZ2  H  12.689  -5.326 -10.474 1.00 . A A .  16 LYS HZ2  1 1 
        1   258 1 1  16 LYS HZ3  H  11.749  -6.715 -10.251 1.00 . A A .  16 LYS HZ3  1 1 
        1   259 1 1  16 LYS N    N   7.377  -2.770  -7.711 1.00 . A A .  16 LYS N    1 1 
        1   260 1 1  16 LYS NZ   N  11.739  -5.676 -10.226 1.00 . A A .  16 LYS NZ   1 1 
        1   261 1 1  16 LYS O    O   8.998  -5.628  -6.394 1.00 . A A .  16 LYS O    1 1 
        1   262 1 1  17 GLU C    C  10.493  -3.981  -4.308 1.00 . A A .  17 GLU C    1 1 
        1   263 1 1  17 GLU CA   C  10.995  -3.807  -5.747 1.00 . A A .  17 GLU CA   1 1 
        1   264 1 1  17 GLU CB   C  12.000  -2.652  -5.831 1.00 . A A .  17 GLU CB   1 1 
        1   265 1 1  17 GLU CD   C  13.543  -3.771  -7.495 1.00 . A A .  17 GLU CD   1 1 
        1   266 1 1  17 GLU CG   C  12.696  -2.550  -7.186 1.00 . A A .  17 GLU CG   1 1 
        1   267 1 1  17 GLU H    H   9.811  -2.710  -7.126 1.00 . A A .  17 GLU H    1 1 
        1   268 1 1  17 GLU HA   H  11.490  -4.721  -6.048 1.00 . A A .  17 GLU HA   1 1 
        1   269 1 1  17 GLU HB2  H  11.481  -1.723  -5.645 1.00 . A A .  17 GLU HB2  1 1 
        1   270 1 1  17 GLU HB3  H  12.757  -2.788  -5.071 1.00 . A A .  17 GLU HB3  1 1 
        1   271 1 1  17 GLU HG2  H  11.944  -2.444  -7.957 1.00 . A A .  17 GLU HG2  1 1 
        1   272 1 1  17 GLU HG3  H  13.332  -1.676  -7.187 1.00 . A A .  17 GLU HG3  1 1 
        1   273 1 1  17 GLU N    N   9.886  -3.579  -6.678 1.00 . A A .  17 GLU N    1 1 
        1   274 1 1  17 GLU O    O  11.026  -4.790  -3.548 1.00 . A A .  17 GLU O    1 1 
        1   275 1 1  17 GLU OE1  O  14.725  -3.798  -7.088 1.00 . A A .  17 GLU OE1  1 1 
        1   276 1 1  17 GLU OE2  O  13.026  -4.727  -8.111 1.00 . A A .  17 GLU OE2  1 1 
        1   277 1 1  18 ILE C    C   8.224  -4.792  -2.503 1.00 . A A .  18 ILE C    1 1 
        1   278 1 1  18 ILE CA   C   8.824  -3.384  -2.636 1.00 . A A .  18 ILE CA   1 1 
        1   279 1 1  18 ILE CB   C   7.707  -2.331  -2.425 1.00 . A A .  18 ILE CB   1 1 
        1   280 1 1  18 ILE CD1  C   7.194   0.166  -2.645 1.00 . A A .  18 ILE CD1  1 1 
        1   281 1 1  18 ILE CG1  C   8.257  -0.912  -2.649 1.00 . A A .  18 ILE CG1  1 1 
        1   282 1 1  18 ILE CG2  C   7.103  -2.459  -1.024 1.00 . A A .  18 ILE CG2  1 1 
        1   283 1 1  18 ILE H    H   9.126  -2.543  -4.562 1.00 . A A .  18 ILE H    1 1 
        1   284 1 1  18 ILE HA   H   9.577  -3.245  -1.872 1.00 . A A .  18 ILE HA   1 1 
        1   285 1 1  18 ILE HB   H   6.924  -2.523  -3.146 1.00 . A A .  18 ILE HB   1 1 
        1   286 1 1  18 ILE HD11 H   7.652   1.125  -2.837 1.00 . A A .  18 ILE HD11 1 1 
        1   287 1 1  18 ILE HD12 H   6.708   0.189  -1.681 1.00 . A A .  18 ILE HD12 1 1 
        1   288 1 1  18 ILE HD13 H   6.462  -0.044  -3.412 1.00 . A A .  18 ILE HD13 1 1 
        1   289 1 1  18 ILE HG12 H   8.965  -0.677  -1.868 1.00 . A A .  18 ILE HG12 1 1 
        1   290 1 1  18 ILE HG13 H   8.761  -0.875  -3.604 1.00 . A A .  18 ILE HG13 1 1 
        1   291 1 1  18 ILE HG21 H   6.319  -1.726  -0.899 1.00 . A A .  18 ILE HG21 1 1 
        1   292 1 1  18 ILE HG22 H   7.870  -2.293  -0.282 1.00 . A A .  18 ILE HG22 1 1 
        1   293 1 1  18 ILE HG23 H   6.690  -3.450  -0.897 1.00 . A A .  18 ILE HG23 1 1 
        1   294 1 1  18 ILE N    N   9.463  -3.225  -3.942 1.00 . A A .  18 ILE N    1 1 
        1   295 1 1  18 ILE O    O   8.464  -5.495  -1.520 1.00 . A A .  18 ILE O    1 1 
        1   296 1 1  19 VAL C    C   7.818  -7.668  -3.350 1.00 . A A .  19 VAL C    1 1 
        1   297 1 1  19 VAL CA   C   6.815  -6.518  -3.542 1.00 . A A .  19 VAL CA   1 1 
        1   298 1 1  19 VAL CB   C   6.038  -6.743  -4.864 1.00 . A A .  19 VAL CB   1 1 
        1   299 1 1  19 VAL CG1  C   5.436  -8.147  -4.916 1.00 . A A .  19 VAL CG1  1 1 
        1   300 1 1  19 VAL CG2  C   4.951  -5.685  -5.038 1.00 . A A .  19 VAL CG2  1 1 
        1   301 1 1  19 VAL H    H   7.330  -4.594  -4.282 1.00 . A A .  19 VAL H    1 1 
        1   302 1 1  19 VAL HA   H   6.103  -6.543  -2.727 1.00 . A A .  19 VAL HA   1 1 
        1   303 1 1  19 VAL HB   H   6.736  -6.646  -5.686 1.00 . A A .  19 VAL HB   1 1 
        1   304 1 1  19 VAL HG11 H   4.740  -8.274  -4.099 1.00 . A A .  19 VAL HG11 1 1 
        1   305 1 1  19 VAL HG12 H   6.224  -8.882  -4.833 1.00 . A A .  19 VAL HG12 1 1 
        1   306 1 1  19 VAL HG13 H   4.918  -8.283  -5.854 1.00 . A A .  19 VAL HG13 1 1 
        1   307 1 1  19 VAL HG21 H   5.401  -4.702  -5.044 1.00 . A A .  19 VAL HG21 1 1 
        1   308 1 1  19 VAL HG22 H   4.247  -5.751  -4.221 1.00 . A A .  19 VAL HG22 1 1 
        1   309 1 1  19 VAL HG23 H   4.434  -5.847  -5.972 1.00 . A A .  19 VAL HG23 1 1 
        1   310 1 1  19 VAL N    N   7.464  -5.201  -3.521 1.00 . A A .  19 VAL N    1 1 
        1   311 1 1  19 VAL O    O   7.625  -8.528  -2.486 1.00 . A A .  19 VAL O    1 1 
        1   312 1 1  20 ARG C    C  10.482  -8.845  -2.648 1.00 . A A .  20 ARG C    1 1 
        1   313 1 1  20 ARG CA   C   9.876  -8.772  -4.058 1.00 . A A .  20 ARG CA   1 1 
        1   314 1 1  20 ARG CB   C  10.991  -8.620  -5.107 1.00 . A A .  20 ARG CB   1 1 
        1   315 1 1  20 ARG CD   C  13.128  -7.449  -5.772 1.00 . A A .  20 ARG CD   1 1 
        1   316 1 1  20 ARG CG   C  11.856  -7.376  -4.934 1.00 . A A .  20 ARG CG   1 1 
        1   317 1 1  20 ARG CZ   C  14.649  -5.931  -4.590 1.00 . A A .  20 ARG CZ   1 1 
        1   318 1 1  20 ARG H    H   9.007  -6.978  -4.816 1.00 . A A .  20 ARG H    1 1 
        1   319 1 1  20 ARG HA   H   9.352  -9.701  -4.248 1.00 . A A .  20 ARG HA   1 1 
        1   320 1 1  20 ARG HB2  H  11.633  -9.488  -5.057 1.00 . A A .  20 ARG HB2  1 1 
        1   321 1 1  20 ARG HB3  H  10.538  -8.582  -6.089 1.00 . A A .  20 ARG HB3  1 1 
        1   322 1 1  20 ARG HD2  H  13.709  -8.303  -5.453 1.00 . A A .  20 ARG HD2  1 1 
        1   323 1 1  20 ARG HD3  H  12.852  -7.573  -6.809 1.00 . A A .  20 ARG HD3  1 1 
        1   324 1 1  20 ARG HE   H  13.967  -5.637  -6.408 1.00 . A A .  20 ARG HE   1 1 
        1   325 1 1  20 ARG HG2  H  11.287  -6.509  -5.237 1.00 . A A .  20 ARG HG2  1 1 
        1   326 1 1  20 ARG HG3  H  12.128  -7.280  -3.892 1.00 . A A .  20 ARG HG3  1 1 
        1   327 1 1  20 ARG HH11 H  14.159  -7.551  -3.552 1.00 . A A .  20 ARG HH11 1 1 
        1   328 1 1  20 ARG HH12 H  15.209  -6.446  -2.746 1.00 . A A .  20 ARG HH12 1 1 
        1   329 1 1  20 ARG HH21 H  15.327  -4.239  -5.388 1.00 . A A .  20 ARG HH21 1 1 
        1   330 1 1  20 ARG HH22 H  15.871  -4.589  -3.780 1.00 . A A .  20 ARG HH22 1 1 
        1   331 1 1  20 ARG N    N   8.885  -7.692  -4.154 1.00 . A A .  20 ARG N    1 1 
        1   332 1 1  20 ARG NE   N  13.947  -6.247  -5.645 1.00 . A A .  20 ARG NE   1 1 
        1   333 1 1  20 ARG NH1  N  14.675  -6.706  -3.552 1.00 . A A .  20 ARG NH1  1 1 
        1   334 1 1  20 ARG NH2  N  15.336  -4.837  -4.585 1.00 . A A .  20 ARG NH2  1 1 
        1   335 1 1  20 ARG O    O  10.664  -9.933  -2.104 1.00 . A A .  20 ARG O    1 1 
        1   336 1 1  21 GLU C    C  10.308  -8.284   0.303 1.00 . A A .  21 GLU C    1 1 
        1   337 1 1  21 GLU CA   C  11.286  -7.624  -0.675 1.00 . A A .  21 GLU CA   1 1 
        1   338 1 1  21 GLU CB   C  11.549  -6.172  -0.251 1.00 . A A .  21 GLU CB   1 1 
        1   339 1 1  21 GLU CD   C  14.097  -6.285  -0.206 1.00 . A A .  21 GLU CD   1 1 
        1   340 1 1  21 GLU CG   C  12.861  -5.595  -0.779 1.00 . A A .  21 GLU CG   1 1 
        1   341 1 1  21 GLU H    H  10.648  -6.844  -2.551 1.00 . A A .  21 GLU H    1 1 
        1   342 1 1  21 GLU HA   H  12.219  -8.170  -0.648 1.00 . A A .  21 GLU HA   1 1 
        1   343 1 1  21 GLU HB2  H  10.740  -5.553  -0.612 1.00 . A A .  21 GLU HB2  1 1 
        1   344 1 1  21 GLU HB3  H  11.569  -6.121   0.829 1.00 . A A .  21 GLU HB3  1 1 
        1   345 1 1  21 GLU HG2  H  12.876  -5.699  -1.855 1.00 . A A .  21 GLU HG2  1 1 
        1   346 1 1  21 GLU HG3  H  12.904  -4.545  -0.524 1.00 . A A .  21 GLU HG3  1 1 
        1   347 1 1  21 GLU N    N  10.779  -7.683  -2.054 1.00 . A A .  21 GLU N    1 1 
        1   348 1 1  21 GLU O    O  10.702  -9.118   1.120 1.00 . A A .  21 GLU O    1 1 
        1   349 1 1  21 GLU OE1  O  14.049  -6.748   0.958 1.00 . A A .  21 GLU OE1  1 1 
        1   350 1 1  21 GLU OE2  O  15.124  -6.363  -0.914 1.00 . A A .  21 GLU OE2  1 1 
        1   351 1 1  22 ILE C    C   8.024 -10.056   0.926 1.00 . A A .  22 ILE C    1 1 
        1   352 1 1  22 ILE CA   C   7.981  -8.522   1.024 1.00 . A A .  22 ILE CA   1 1 
        1   353 1 1  22 ILE CB   C   6.586  -8.017   0.581 1.00 . A A .  22 ILE CB   1 1 
        1   354 1 1  22 ILE CD1  C   5.270  -5.893   0.047 1.00 . A A .  22 ILE CD1  1 1 
        1   355 1 1  22 ILE CG1  C   6.522  -6.483   0.658 1.00 . A A .  22 ILE CG1  1 1 
        1   356 1 1  22 ILE CG2  C   5.485  -8.643   1.434 1.00 . A A .  22 ILE CG2  1 1 
        1   357 1 1  22 ILE H    H   8.791  -7.214  -0.441 1.00 . A A .  22 ILE H    1 1 
        1   358 1 1  22 ILE HA   H   8.143  -8.227   2.053 1.00 . A A .  22 ILE HA   1 1 
        1   359 1 1  22 ILE HB   H   6.429  -8.324  -0.445 1.00 . A A .  22 ILE HB   1 1 
        1   360 1 1  22 ILE HD11 H   5.212  -6.167  -0.997 1.00 . A A .  22 ILE HD11 1 1 
        1   361 1 1  22 ILE HD12 H   5.300  -4.818   0.134 1.00 . A A .  22 ILE HD12 1 1 
        1   362 1 1  22 ILE HD13 H   4.402  -6.272   0.567 1.00 . A A .  22 ILE HD13 1 1 
        1   363 1 1  22 ILE HG12 H   6.559  -6.177   1.693 1.00 . A A .  22 ILE HG12 1 1 
        1   364 1 1  22 ILE HG13 H   7.372  -6.065   0.136 1.00 . A A .  22 ILE HG13 1 1 
        1   365 1 1  22 ILE HG21 H   5.497  -9.715   1.306 1.00 . A A .  22 ILE HG21 1 1 
        1   366 1 1  22 ILE HG22 H   4.524  -8.255   1.127 1.00 . A A .  22 ILE HG22 1 1 
        1   367 1 1  22 ILE HG23 H   5.654  -8.404   2.475 1.00 . A A .  22 ILE HG23 1 1 
        1   368 1 1  22 ILE N    N   9.034  -7.915   0.203 1.00 . A A .  22 ILE N    1 1 
        1   369 1 1  22 ILE O    O   7.935 -10.766   1.932 1.00 . A A .  22 ILE O    1 1 
        1   370 1 1  23 LYS C    C   9.613 -12.556   0.060 1.00 . A A .  23 LYS C    1 1 
        1   371 1 1  23 LYS CA   C   8.305 -11.998  -0.533 1.00 . A A .  23 LYS CA   1 1 
        1   372 1 1  23 LYS CB   C   8.239 -12.294  -2.036 1.00 . A A .  23 LYS CB   1 1 
        1   373 1 1  23 LYS CD   C   5.698 -12.325  -2.140 1.00 . A A .  23 LYS CD   1 1 
        1   374 1 1  23 LYS CE   C   5.617 -13.841  -2.315 1.00 . A A .  23 LYS CE   1 1 
        1   375 1 1  23 LYS CG   C   6.988 -11.745  -2.723 1.00 . A A .  23 LYS CG   1 1 
        1   376 1 1  23 LYS H    H   8.209  -9.942  -1.063 1.00 . A A .  23 LYS H    1 1 
        1   377 1 1  23 LYS HA   H   7.470 -12.482  -0.045 1.00 . A A .  23 LYS HA   1 1 
        1   378 1 1  23 LYS HB2  H   9.105 -11.856  -2.514 1.00 . A A .  23 LYS HB2  1 1 
        1   379 1 1  23 LYS HB3  H   8.264 -13.365  -2.183 1.00 . A A .  23 LYS HB3  1 1 
        1   380 1 1  23 LYS HD2  H   5.657 -12.093  -1.085 1.00 . A A .  23 LYS HD2  1 1 
        1   381 1 1  23 LYS HD3  H   4.854 -11.869  -2.639 1.00 . A A .  23 LYS HD3  1 1 
        1   382 1 1  23 LYS HE2  H   6.455 -14.295  -1.809 1.00 . A A .  23 LYS HE2  1 1 
        1   383 1 1  23 LYS HE3  H   4.697 -14.192  -1.869 1.00 . A A .  23 LYS HE3  1 1 
        1   384 1 1  23 LYS HG2  H   6.968 -10.671  -2.602 1.00 . A A .  23 LYS HG2  1 1 
        1   385 1 1  23 LYS HG3  H   7.037 -11.984  -3.775 1.00 . A A .  23 LYS HG3  1 1 
        1   386 1 1  23 LYS HZ1  H   6.510 -13.902  -4.204 1.00 . A A .  23 LYS HZ1  1 1 
        1   387 1 1  23 LYS HZ2  H   4.820 -13.854  -4.248 1.00 . A A .  23 LYS HZ2  1 1 
        1   388 1 1  23 LYS HZ3  H   5.617 -15.281  -3.825 1.00 . A A .  23 LYS HZ3  1 1 
        1   389 1 1  23 LYS N    N   8.183 -10.557  -0.297 1.00 . A A .  23 LYS N    1 1 
        1   390 1 1  23 LYS NZ   N   5.644 -14.246  -3.746 1.00 . A A .  23 LYS NZ   1 1 
        1   391 1 1  23 LYS O    O   9.646 -13.685   0.549 1.00 . A A .  23 LYS O    1 1 
        1   392 1 1  24 ARG C    C  11.826 -12.353   2.138 1.00 . A A .  24 ARG C    1 1 
        1   393 1 1  24 ARG CA   C  11.971 -12.159   0.622 1.00 . A A .  24 ARG CA   1 1 
        1   394 1 1  24 ARG CB   C  13.063 -11.104   0.365 1.00 . A A .  24 ARG CB   1 1 
        1   395 1 1  24 ARG CD   C  13.847 -12.049  -1.862 1.00 . A A .  24 ARG CD   1 1 
        1   396 1 1  24 ARG CG   C  13.368 -10.814  -1.104 1.00 . A A .  24 ARG CG   1 1 
        1   397 1 1  24 ARG CZ   C  12.836 -14.222  -2.376 1.00 . A A .  24 ARG CZ   1 1 
        1   398 1 1  24 ARG H    H  10.613 -10.883  -0.417 1.00 . A A .  24 ARG H    1 1 
        1   399 1 1  24 ARG HA   H  12.272 -13.097   0.174 1.00 . A A .  24 ARG HA   1 1 
        1   400 1 1  24 ARG HB2  H  12.758 -10.177   0.827 1.00 . A A .  24 ARG HB2  1 1 
        1   401 1 1  24 ARG HB3  H  13.979 -11.437   0.837 1.00 . A A .  24 ARG HB3  1 1 
        1   402 1 1  24 ARG HD2  H  14.375 -11.726  -2.746 1.00 . A A .  24 ARG HD2  1 1 
        1   403 1 1  24 ARG HD3  H  14.522 -12.605  -1.227 1.00 . A A .  24 ARG HD3  1 1 
        1   404 1 1  24 ARG HE   H  11.889 -12.501  -2.484 1.00 . A A .  24 ARG HE   1 1 
        1   405 1 1  24 ARG HG2  H  12.473 -10.443  -1.577 1.00 . A A .  24 ARG HG2  1 1 
        1   406 1 1  24 ARG HG3  H  14.138 -10.055  -1.151 1.00 . A A .  24 ARG HG3  1 1 
        1   407 1 1  24 ARG HH11 H  14.742 -14.308  -1.805 1.00 . A A .  24 ARG HH11 1 1 
        1   408 1 1  24 ARG HH12 H  14.006 -15.822  -2.193 1.00 . A A .  24 ARG HH12 1 1 
        1   409 1 1  24 ARG HH21 H  10.958 -14.438  -2.992 1.00 . A A .  24 ARG HH21 1 1 
        1   410 1 1  24 ARG HH22 H  11.871 -15.901  -2.847 1.00 . A A .  24 ARG HH22 1 1 
        1   411 1 1  24 ARG N    N  10.687 -11.759   0.019 1.00 . A A .  24 ARG N    1 1 
        1   412 1 1  24 ARG NE   N  12.744 -12.923  -2.266 1.00 . A A .  24 ARG NE   1 1 
        1   413 1 1  24 ARG NH1  N  13.946 -14.831  -2.102 1.00 . A A .  24 ARG NH1  1 1 
        1   414 1 1  24 ARG NH2  N  11.810 -14.906  -2.769 1.00 . A A .  24 ARG NH2  1 1 
        1   415 1 1  24 ARG O    O  12.451 -13.233   2.728 1.00 . A A .  24 ARG O    1 1 
        1   416 1 1  25 GLN C    C   9.757 -12.627   4.611 1.00 . A A .  25 GLN C    1 1 
        1   417 1 1  25 GLN CA   C  10.783 -11.547   4.209 1.00 . A A .  25 GLN CA   1 1 
        1   418 1 1  25 GLN CB   C  10.295 -10.171   4.695 1.00 . A A .  25 GLN CB   1 1 
        1   419 1 1  25 GLN CD   C  12.562  -8.994   4.580 1.00 . A A .  25 GLN CD   1 1 
        1   420 1 1  25 GLN CG   C  11.099  -8.988   4.157 1.00 . A A .  25 GLN CG   1 1 
        1   421 1 1  25 GLN H    H  10.520 -10.842   2.223 1.00 . A A .  25 GLN H    1 1 
        1   422 1 1  25 GLN HA   H  11.729 -11.770   4.683 1.00 . A A .  25 GLN HA   1 1 
        1   423 1 1  25 GLN HB2  H   9.265 -10.042   4.392 1.00 . A A .  25 GLN HB2  1 1 
        1   424 1 1  25 GLN HB3  H  10.344 -10.148   5.775 1.00 . A A .  25 GLN HB3  1 1 
        1   425 1 1  25 GLN HE21 H  13.087  -8.089   2.894 1.00 . A A .  25 GLN HE21 1 1 
        1   426 1 1  25 GLN HE22 H  14.370  -8.456   3.991 1.00 . A A .  25 GLN HE22 1 1 
        1   427 1 1  25 GLN HG2  H  11.058  -9.009   3.079 1.00 . A A .  25 GLN HG2  1 1 
        1   428 1 1  25 GLN HG3  H  10.643  -8.073   4.510 1.00 . A A .  25 GLN HG3  1 1 
        1   429 1 1  25 GLN N    N  10.997 -11.512   2.757 1.00 . A A .  25 GLN N    1 1 
        1   430 1 1  25 GLN NE2  N  13.426  -8.458   3.738 1.00 . A A .  25 GLN NE2  1 1 
        1   431 1 1  25 GLN O    O   9.450 -12.794   5.793 1.00 . A A .  25 GLN O    1 1 
        1   432 1 1  25 GLN OE1  O  12.915  -9.472   5.652 1.00 . A A .  25 GLN OE1  1 1 
        1   433 1 1  26 GLY C    C   6.862 -13.801   4.294 1.00 . A A .  26 GLY C    1 1 
        1   434 1 1  26 GLY CA   C   8.216 -14.379   3.886 1.00 . A A .  26 GLY CA   1 1 
        1   435 1 1  26 GLY H    H   9.524 -13.192   2.702 1.00 . A A .  26 GLY H    1 1 
        1   436 1 1  26 GLY HA2  H   8.082 -14.970   2.991 1.00 . A A .  26 GLY HA2  1 1 
        1   437 1 1  26 GLY HA3  H   8.573 -15.025   4.677 1.00 . A A .  26 GLY HA3  1 1 
        1   438 1 1  26 GLY N    N   9.225 -13.351   3.621 1.00 . A A .  26 GLY N    1 1 
        1   439 1 1  26 GLY O    O   6.112 -14.416   5.057 1.00 . A A .  26 GLY O    1 1 
        1   440 1 1  27 VAL C    C   4.360 -11.817   2.908 1.00 . A A .  27 VAL C    1 1 
        1   441 1 1  27 VAL CA   C   5.305 -11.916   4.120 1.00 . A A .  27 VAL CA   1 1 
        1   442 1 1  27 VAL CB   C   5.626 -10.494   4.660 1.00 . A A .  27 VAL CB   1 1 
        1   443 1 1  27 VAL CG1  C   4.356  -9.723   5.016 1.00 . A A .  27 VAL CG1  1 1 
        1   444 1 1  27 VAL CG2  C   6.556 -10.584   5.869 1.00 . A A .  27 VAL CG2  1 1 
        1   445 1 1  27 VAL H    H   7.169 -12.198   3.142 1.00 . A A .  27 VAL H    1 1 
        1   446 1 1  27 VAL HA   H   4.809 -12.473   4.904 1.00 . A A .  27 VAL HA   1 1 
        1   447 1 1  27 VAL HB   H   6.142  -9.947   3.882 1.00 . A A .  27 VAL HB   1 1 
        1   448 1 1  27 VAL HG11 H   4.621  -8.746   5.394 1.00 . A A .  27 VAL HG11 1 1 
        1   449 1 1  27 VAL HG12 H   3.803 -10.262   5.771 1.00 . A A .  27 VAL HG12 1 1 
        1   450 1 1  27 VAL HG13 H   3.742  -9.611   4.133 1.00 . A A .  27 VAL HG13 1 1 
        1   451 1 1  27 VAL HG21 H   6.083 -11.164   6.648 1.00 . A A .  27 VAL HG21 1 1 
        1   452 1 1  27 VAL HG22 H   6.766  -9.591   6.238 1.00 . A A .  27 VAL HG22 1 1 
        1   453 1 1  27 VAL HG23 H   7.481 -11.061   5.578 1.00 . A A .  27 VAL HG23 1 1 
        1   454 1 1  27 VAL N    N   6.548 -12.618   3.777 1.00 . A A .  27 VAL N    1 1 
        1   455 1 1  27 VAL O    O   4.803 -11.828   1.756 1.00 . A A .  27 VAL O    1 1 
        1   456 1 1  28 ARG C    C   1.934 -10.138   1.634 1.00 . A A .  28 ARG C    1 1 
        1   457 1 1  28 ARG CA   C   2.055 -11.595   2.107 1.00 . A A .  28 ARG CA   1 1 
        1   458 1 1  28 ARG CB   C   0.692 -12.116   2.586 1.00 . A A .  28 ARG CB   1 1 
        1   459 1 1  28 ARG CD   C  -1.748 -12.495   2.039 1.00 . A A .  28 ARG CD   1 1 
        1   460 1 1  28 ARG CG   C  -0.476 -11.739   1.678 1.00 . A A .  28 ARG CG   1 1 
        1   461 1 1  28 ARG CZ   C  -1.788 -14.930   2.299 1.00 . A A .  28 ARG CZ   1 1 
        1   462 1 1  28 ARG H    H   2.755 -11.770   4.106 1.00 . A A .  28 ARG H    1 1 
        1   463 1 1  28 ARG HA   H   2.381 -12.200   1.270 1.00 . A A .  28 ARG HA   1 1 
        1   464 1 1  28 ARG HB2  H   0.737 -13.195   2.650 1.00 . A A .  28 ARG HB2  1 1 
        1   465 1 1  28 ARG HB3  H   0.495 -11.717   3.572 1.00 . A A .  28 ARG HB3  1 1 
        1   466 1 1  28 ARG HD2  H  -1.860 -12.503   3.115 1.00 . A A .  28 ARG HD2  1 1 
        1   467 1 1  28 ARG HD3  H  -2.592 -11.985   1.596 1.00 . A A .  28 ARG HD3  1 1 
        1   468 1 1  28 ARG HE   H  -1.664 -13.994   0.578 1.00 . A A .  28 ARG HE   1 1 
        1   469 1 1  28 ARG HG2  H  -0.664 -10.678   1.772 1.00 . A A .  28 ARG HG2  1 1 
        1   470 1 1  28 ARG HG3  H  -0.212 -11.967   0.654 1.00 . A A .  28 ARG HG3  1 1 
        1   471 1 1  28 ARG HH11 H  -1.758 -13.931   4.024 1.00 . A A .  28 ARG HH11 1 1 
        1   472 1 1  28 ARG HH12 H  -1.859 -15.651   4.158 1.00 . A A .  28 ARG HH12 1 1 
        1   473 1 1  28 ARG HH21 H  -1.775 -16.172   0.748 1.00 . A A .  28 ARG HH21 1 1 
        1   474 1 1  28 ARG HH22 H  -1.863 -16.918   2.310 1.00 . A A .  28 ARG HH22 1 1 
        1   475 1 1  28 ARG N    N   3.055 -11.737   3.172 1.00 . A A .  28 ARG N    1 1 
        1   476 1 1  28 ARG NE   N  -1.719 -13.868   1.548 1.00 . A A .  28 ARG NE   1 1 
        1   477 1 1  28 ARG NH1  N  -1.804 -14.829   3.593 1.00 . A A .  28 ARG NH1  1 1 
        1   478 1 1  28 ARG NH2  N  -1.812 -16.098   1.746 1.00 . A A .  28 ARG NH2  1 1 
        1   479 1 1  28 ARG O    O   2.100  -9.199   2.413 1.00 . A A .  28 ARG O    1 1 
        1   480 1 1  29 VAL C    C   0.178  -8.453  -0.990 1.00 . A A .  29 VAL C    1 1 
        1   481 1 1  29 VAL CA   C   1.517  -8.635  -0.256 1.00 . A A .  29 VAL CA   1 1 
        1   482 1 1  29 VAL CB   C   2.695  -8.381  -1.233 1.00 . A A .  29 VAL CB   1 1 
        1   483 1 1  29 VAL CG1  C   2.886  -9.563  -2.182 1.00 . A A .  29 VAL CG1  1 1 
        1   484 1 1  29 VAL CG2  C   2.495  -7.076  -2.010 1.00 . A A .  29 VAL CG2  1 1 
        1   485 1 1  29 VAL H    H   1.462 -10.752  -0.205 1.00 . A A .  29 VAL H    1 1 
        1   486 1 1  29 VAL HA   H   1.576  -7.901   0.537 1.00 . A A .  29 VAL HA   1 1 
        1   487 1 1  29 VAL HB   H   3.594  -8.286  -0.646 1.00 . A A .  29 VAL HB   1 1 
        1   488 1 1  29 VAL HG11 H   1.983  -9.716  -2.756 1.00 . A A .  29 VAL HG11 1 1 
        1   489 1 1  29 VAL HG12 H   3.104 -10.454  -1.610 1.00 . A A .  29 VAL HG12 1 1 
        1   490 1 1  29 VAL HG13 H   3.707  -9.359  -2.854 1.00 . A A .  29 VAL HG13 1 1 
        1   491 1 1  29 VAL HG21 H   3.340  -6.911  -2.664 1.00 . A A .  29 VAL HG21 1 1 
        1   492 1 1  29 VAL HG22 H   2.414  -6.252  -1.316 1.00 . A A .  29 VAL HG22 1 1 
        1   493 1 1  29 VAL HG23 H   1.592  -7.139  -2.599 1.00 . A A .  29 VAL HG23 1 1 
        1   494 1 1  29 VAL N    N   1.626  -9.963   0.351 1.00 . A A .  29 VAL N    1 1 
        1   495 1 1  29 VAL O    O  -0.135  -9.183  -1.931 1.00 . A A .  29 VAL O    1 1 
        1   496 1 1  30 VAL C    C  -1.756  -5.939  -2.101 1.00 . A A .  30 VAL C    1 1 
        1   497 1 1  30 VAL CA   C  -1.896  -7.155  -1.171 1.00 . A A .  30 VAL CA   1 1 
        1   498 1 1  30 VAL CB   C  -2.988  -6.869  -0.106 1.00 . A A .  30 VAL CB   1 1 
        1   499 1 1  30 VAL CG1  C  -4.343  -6.619  -0.772 1.00 . A A .  30 VAL CG1  1 1 
        1   500 1 1  30 VAL CG2  C  -3.074  -8.020   0.899 1.00 . A A .  30 VAL CG2  1 1 
        1   501 1 1  30 VAL H    H  -0.307  -6.939   0.220 1.00 . A A .  30 VAL H    1 1 
        1   502 1 1  30 VAL HA   H  -2.215  -8.012  -1.758 1.00 . A A .  30 VAL HA   1 1 
        1   503 1 1  30 VAL HB   H  -2.709  -5.971   0.433 1.00 . A A .  30 VAL HB   1 1 
        1   504 1 1  30 VAL HG11 H  -4.632  -7.490  -1.344 1.00 . A A .  30 VAL HG11 1 1 
        1   505 1 1  30 VAL HG12 H  -4.271  -5.766  -1.431 1.00 . A A .  30 VAL HG12 1 1 
        1   506 1 1  30 VAL HG13 H  -5.088  -6.424  -0.015 1.00 . A A .  30 VAL HG13 1 1 
        1   507 1 1  30 VAL HG21 H  -2.110  -8.164   1.368 1.00 . A A .  30 VAL HG21 1 1 
        1   508 1 1  30 VAL HG22 H  -3.362  -8.928   0.387 1.00 . A A .  30 VAL HG22 1 1 
        1   509 1 1  30 VAL HG23 H  -3.809  -7.787   1.657 1.00 . A A .  30 VAL HG23 1 1 
        1   510 1 1  30 VAL N    N  -0.608  -7.474  -0.545 1.00 . A A .  30 VAL N    1 1 
        1   511 1 1  30 VAL O    O  -1.758  -4.792  -1.651 1.00 . A A .  30 VAL O    1 1 
        1   512 1 1  31 LEU C    C  -2.783  -4.648  -4.933 1.00 . A A .  31 LEU C    1 1 
        1   513 1 1  31 LEU CA   C  -1.434  -5.122  -4.378 1.00 . A A .  31 LEU CA   1 1 
        1   514 1 1  31 LEU CB   C  -0.529  -5.586  -5.530 1.00 . A A .  31 LEU CB   1 1 
        1   515 1 1  31 LEU CD1  C   0.236  -3.255  -6.143 1.00 . A A .  31 LEU CD1  1 1 
        1   516 1 1  31 LEU CD2  C   0.554  -5.145  -7.768 1.00 . A A .  31 LEU CD2  1 1 
        1   517 1 1  31 LEU CG   C  -0.338  -4.567  -6.671 1.00 . A A .  31 LEU CG   1 1 
        1   518 1 1  31 LEU H    H  -1.622  -7.126  -3.701 1.00 . A A .  31 LEU H    1 1 
        1   519 1 1  31 LEU HA   H  -0.955  -4.291  -3.876 1.00 . A A .  31 LEU HA   1 1 
        1   520 1 1  31 LEU HB2  H   0.444  -5.826  -5.121 1.00 . A A .  31 LEU HB2  1 1 
        1   521 1 1  31 LEU HB3  H  -0.953  -6.487  -5.952 1.00 . A A .  31 LEU HB3  1 1 
        1   522 1 1  31 LEU HD11 H   0.356  -2.558  -6.960 1.00 . A A .  31 LEU HD11 1 1 
        1   523 1 1  31 LEU HD12 H   1.196  -3.438  -5.682 1.00 . A A .  31 LEU HD12 1 1 
        1   524 1 1  31 LEU HD13 H  -0.439  -2.835  -5.412 1.00 . A A .  31 LEU HD13 1 1 
        1   525 1 1  31 LEU HD21 H   1.530  -5.372  -7.362 1.00 . A A .  31 LEU HD21 1 1 
        1   526 1 1  31 LEU HD22 H   0.657  -4.425  -8.566 1.00 . A A .  31 LEU HD22 1 1 
        1   527 1 1  31 LEU HD23 H   0.109  -6.049  -8.158 1.00 . A A .  31 LEU HD23 1 1 
        1   528 1 1  31 LEU HG   H  -1.302  -4.349  -7.110 1.00 . A A .  31 LEU HG   1 1 
        1   529 1 1  31 LEU N    N  -1.608  -6.195  -3.396 1.00 . A A .  31 LEU N    1 1 
        1   530 1 1  31 LEU O    O  -3.506  -5.408  -5.572 1.00 . A A .  31 LEU O    1 1 
        1   531 1 1  32 LEU C    C  -3.946  -1.986  -6.499 1.00 . A A .  32 LEU C    1 1 
        1   532 1 1  32 LEU CA   C  -4.317  -2.770  -5.233 1.00 . A A .  32 LEU CA   1 1 
        1   533 1 1  32 LEU CB   C  -4.973  -1.854  -4.186 1.00 . A A .  32 LEU CB   1 1 
        1   534 1 1  32 LEU CD1  C  -5.956  -1.555  -1.877 1.00 . A A .  32 LEU CD1  1 1 
        1   535 1 1  32 LEU CD2  C  -6.288  -3.718  -3.101 1.00 . A A .  32 LEU CD2  1 1 
        1   536 1 1  32 LEU CG   C  -5.341  -2.545  -2.859 1.00 . A A .  32 LEU CG   1 1 
        1   537 1 1  32 LEU H    H  -2.521  -2.849  -4.117 1.00 . A A .  32 LEU H    1 1 
        1   538 1 1  32 LEU HA   H  -5.009  -3.559  -5.499 1.00 . A A .  32 LEU HA   1 1 
        1   539 1 1  32 LEU HB2  H  -4.289  -1.043  -3.970 1.00 . A A .  32 LEU HB2  1 1 
        1   540 1 1  32 LEU HB3  H  -5.874  -1.437  -4.614 1.00 . A A .  32 LEU HB3  1 1 
        1   541 1 1  32 LEU HD11 H  -5.253  -0.760  -1.679 1.00 . A A .  32 LEU HD11 1 1 
        1   542 1 1  32 LEU HD12 H  -6.191  -2.064  -0.952 1.00 . A A .  32 LEU HD12 1 1 
        1   543 1 1  32 LEU HD13 H  -6.861  -1.139  -2.297 1.00 . A A .  32 LEU HD13 1 1 
        1   544 1 1  32 LEU HD21 H  -6.537  -4.183  -2.157 1.00 . A A .  32 LEU HD21 1 1 
        1   545 1 1  32 LEU HD22 H  -5.807  -4.442  -3.742 1.00 . A A .  32 LEU HD22 1 1 
        1   546 1 1  32 LEU HD23 H  -7.192  -3.363  -3.575 1.00 . A A .  32 LEU HD23 1 1 
        1   547 1 1  32 LEU HG   H  -4.440  -2.936  -2.408 1.00 . A A .  32 LEU HG   1 1 
        1   548 1 1  32 LEU N    N  -3.112  -3.387  -4.680 1.00 . A A .  32 LEU N    1 1 
        1   549 1 1  32 LEU O    O  -3.527  -0.827  -6.433 1.00 . A A .  32 LEU O    1 1 
        1   550 1 1  33 TYR C    C  -4.593  -1.245  -9.653 1.00 . A A .  33 TYR C    1 1 
        1   551 1 1  33 TYR CA   C  -3.558  -2.105  -8.909 1.00 . A A .  33 TYR CA   1 1 
        1   552 1 1  33 TYR CB   C  -3.085  -3.257  -9.811 1.00 . A A .  33 TYR CB   1 1 
        1   553 1 1  33 TYR CD1  C  -0.719  -2.838 -10.580 1.00 . A A .  33 TYR CD1  1 1 
        1   554 1 1  33 TYR CD2  C  -2.489  -2.349 -12.103 1.00 . A A .  33 TYR CD2  1 1 
        1   555 1 1  33 TYR CE1  C   0.209  -2.406 -11.508 1.00 . A A .  33 TYR CE1  1 1 
        1   556 1 1  33 TYR CE2  C  -1.566  -1.920 -13.041 1.00 . A A .  33 TYR CE2  1 1 
        1   557 1 1  33 TYR CG   C  -2.080  -2.814 -10.857 1.00 . A A .  33 TYR CG   1 1 
        1   558 1 1  33 TYR CZ   C  -0.218  -1.949 -12.738 1.00 . A A .  33 TYR CZ   1 1 
        1   559 1 1  33 TYR H    H  -4.550  -3.502  -7.654 1.00 . A A .  33 TYR H    1 1 
        1   560 1 1  33 TYR HA   H  -2.704  -1.485  -8.668 1.00 . A A .  33 TYR HA   1 1 
        1   561 1 1  33 TYR HB2  H  -2.619  -4.019  -9.201 1.00 . A A .  33 TYR HB2  1 1 
        1   562 1 1  33 TYR HB3  H  -3.937  -3.684 -10.321 1.00 . A A .  33 TYR HB3  1 1 
        1   563 1 1  33 TYR HD1  H  -0.387  -3.201  -9.616 1.00 . A A .  33 TYR HD1  1 1 
        1   564 1 1  33 TYR HD2  H  -3.546  -2.330 -12.337 1.00 . A A .  33 TYR HD2  1 1 
        1   565 1 1  33 TYR HE1  H   1.262  -2.435 -11.268 1.00 . A A .  33 TYR HE1  1 1 
        1   566 1 1  33 TYR HE2  H  -1.902  -1.563 -14.003 1.00 . A A .  33 TYR HE2  1 1 
        1   567 1 1  33 TYR HH   H   0.427  -0.642 -13.997 1.00 . A A .  33 TYR HH   1 1 
        1   568 1 1  33 TYR N    N  -4.084  -2.639  -7.650 1.00 . A A .  33 TYR N    1 1 
        1   569 1 1  33 TYR O    O  -5.680  -1.713  -9.999 1.00 . A A .  33 TYR O    1 1 
        1   570 1 1  33 TYR OH   O   0.704  -1.505 -13.665 1.00 . A A .  33 TYR OH   1 1 
        1   571 1 1  34 SER C    C  -4.395   1.388 -11.956 1.00 . A A .  34 SER C    1 1 
        1   572 1 1  34 SER CA   C  -5.086   0.944 -10.656 1.00 . A A .  34 SER CA   1 1 
        1   573 1 1  34 SER CB   C  -5.433   2.176  -9.802 1.00 . A A .  34 SER CB   1 1 
        1   574 1 1  34 SER H    H  -3.371   0.334  -9.563 1.00 . A A .  34 SER H    1 1 
        1   575 1 1  34 SER HA   H  -6.003   0.427 -10.912 1.00 . A A .  34 SER HA   1 1 
        1   576 1 1  34 SER HB2  H  -6.065   2.843 -10.371 1.00 . A A .  34 SER HB2  1 1 
        1   577 1 1  34 SER HB3  H  -5.961   1.857  -8.914 1.00 . A A .  34 SER HB3  1 1 
        1   578 1 1  34 SER HG   H  -4.137   2.786  -8.461 1.00 . A A .  34 SER HG   1 1 
        1   579 1 1  34 SER N    N  -4.236   0.014  -9.901 1.00 . A A .  34 SER N    1 1 
        1   580 1 1  34 SER O    O  -3.298   1.949 -11.936 1.00 . A A .  34 SER O    1 1 
        1   581 1 1  34 SER OG   O  -4.269   2.885  -9.408 1.00 . A A .  34 SER OG   1 1 
        1   582 1 1  35 ASP C    C  -5.631   2.135 -15.255 1.00 . A A .  35 ASP C    1 1 
        1   583 1 1  35 ASP CA   C  -4.510   1.506 -14.402 1.00 . A A .  35 ASP CA   1 1 
        1   584 1 1  35 ASP CB   C  -3.896   0.284 -15.106 1.00 . A A .  35 ASP CB   1 1 
        1   585 1 1  35 ASP CG   C  -3.056   0.661 -16.317 1.00 . A A .  35 ASP CG   1 1 
        1   586 1 1  35 ASP H    H  -5.894   0.642 -13.038 1.00 . A A .  35 ASP H    1 1 
        1   587 1 1  35 ASP HA   H  -3.739   2.249 -14.246 1.00 . A A .  35 ASP HA   1 1 
        1   588 1 1  35 ASP HB2  H  -3.266  -0.244 -14.404 1.00 . A A .  35 ASP HB2  1 1 
        1   589 1 1  35 ASP HB3  H  -4.691  -0.376 -15.430 1.00 . A A .  35 ASP HB3  1 1 
        1   590 1 1  35 ASP N    N  -5.037   1.113 -13.087 1.00 . A A .  35 ASP N    1 1 
        1   591 1 1  35 ASP O    O  -6.807   2.009 -14.923 1.00 . A A .  35 ASP O    1 1 
        1   592 1 1  35 ASP OD1  O  -3.635   0.913 -17.391 1.00 . A A .  35 ASP OD1  1 1 
        1   593 1 1  35 ASP OD2  O  -1.814   0.729 -16.194 1.00 . A A .  35 ASP OD2  1 1 
        1   594 1 1  36 GLN C    C  -6.865   2.602 -18.284 1.00 . A A .  36 GLN C    1 1 
        1   595 1 1  36 GLN CA   C  -6.259   3.502 -17.191 1.00 . A A .  36 GLN CA   1 1 
        1   596 1 1  36 GLN CB   C  -5.624   4.746 -17.831 1.00 . A A .  36 GLN CB   1 1 
        1   597 1 1  36 GLN CD   C  -6.464   6.335 -16.040 1.00 . A A .  36 GLN CD   1 1 
        1   598 1 1  36 GLN CG   C  -5.261   5.841 -16.833 1.00 . A A .  36 GLN CG   1 1 
        1   599 1 1  36 GLN H    H  -4.328   2.806 -16.619 1.00 . A A .  36 GLN H    1 1 
        1   600 1 1  36 GLN HA   H  -7.062   3.827 -16.543 1.00 . A A .  36 GLN HA   1 1 
        1   601 1 1  36 GLN HB2  H  -4.723   4.450 -18.350 1.00 . A A .  36 GLN HB2  1 1 
        1   602 1 1  36 GLN HB3  H  -6.318   5.162 -18.549 1.00 . A A .  36 GLN HB3  1 1 
        1   603 1 1  36 GLN HE21 H  -6.105   5.031 -14.594 1.00 . A A .  36 GLN HE21 1 1 
        1   604 1 1  36 GLN HE22 H  -7.468   6.064 -14.355 1.00 . A A .  36 GLN HE22 1 1 
        1   605 1 1  36 GLN HG2  H  -4.527   5.453 -16.141 1.00 . A A .  36 GLN HG2  1 1 
        1   606 1 1  36 GLN HG3  H  -4.837   6.676 -17.373 1.00 . A A .  36 GLN HG3  1 1 
        1   607 1 1  36 GLN N    N  -5.272   2.799 -16.353 1.00 . A A .  36 GLN N    1 1 
        1   608 1 1  36 GLN NE2  N  -6.703   5.748 -14.882 1.00 . A A .  36 GLN NE2  1 1 
        1   609 1 1  36 GLN O    O  -7.843   2.980 -18.927 1.00 . A A .  36 GLN O    1 1 
        1   610 1 1  36 GLN OE1  O  -7.173   7.240 -16.466 1.00 . A A .  36 GLN OE1  1 1 
        1   611 1 1  37 ASP C    C  -6.957  -0.928 -18.894 1.00 . A A .  37 ASP C    1 1 
        1   612 1 1  37 ASP CA   C  -6.795   0.476 -19.496 1.00 . A A .  37 ASP CA   1 1 
        1   613 1 1  37 ASP CB   C  -5.841   0.428 -20.696 1.00 . A A .  37 ASP CB   1 1 
        1   614 1 1  37 ASP CG   C  -6.373  -0.429 -21.831 1.00 . A A .  37 ASP CG   1 1 
        1   615 1 1  37 ASP H    H  -5.495   1.179 -17.966 1.00 . A A .  37 ASP H    1 1 
        1   616 1 1  37 ASP HA   H  -7.763   0.827 -19.829 1.00 . A A .  37 ASP HA   1 1 
        1   617 1 1  37 ASP HB2  H  -5.691   1.432 -21.068 1.00 . A A .  37 ASP HB2  1 1 
        1   618 1 1  37 ASP HB3  H  -4.891   0.025 -20.375 1.00 . A A .  37 ASP HB3  1 1 
        1   619 1 1  37 ASP N    N  -6.287   1.423 -18.493 1.00 . A A .  37 ASP N    1 1 
        1   620 1 1  37 ASP O    O  -6.091  -1.389 -18.154 1.00 . A A .  37 ASP O    1 1 
        1   621 1 1  37 ASP OD1  O  -7.250   0.048 -22.578 1.00 . A A .  37 ASP OD1  1 1 
        1   622 1 1  37 ASP OD2  O  -5.934  -1.588 -21.975 1.00 . A A .  37 ASP OD2  1 1 
        1   623 1 1  38 GLU C    C  -7.273  -3.960 -19.164 1.00 . A A .  38 GLU C    1 1 
        1   624 1 1  38 GLU CA   C  -8.334  -2.951 -18.695 1.00 . A A .  38 GLU CA   1 1 
        1   625 1 1  38 GLU CB   C  -9.726  -3.430 -19.140 1.00 . A A .  38 GLU CB   1 1 
        1   626 1 1  38 GLU CD   C -10.988  -2.476 -17.146 1.00 . A A .  38 GLU CD   1 1 
        1   627 1 1  38 GLU CG   C -10.878  -2.549 -18.663 1.00 . A A .  38 GLU CG   1 1 
        1   628 1 1  38 GLU H    H  -8.716  -1.184 -19.817 1.00 . A A .  38 GLU H    1 1 
        1   629 1 1  38 GLU HA   H  -8.311  -2.898 -17.616 1.00 . A A .  38 GLU HA   1 1 
        1   630 1 1  38 GLU HB2  H  -9.753  -3.461 -20.221 1.00 . A A .  38 GLU HB2  1 1 
        1   631 1 1  38 GLU HB3  H  -9.887  -4.430 -18.760 1.00 . A A .  38 GLU HB3  1 1 
        1   632 1 1  38 GLU HG2  H -10.732  -1.550 -19.049 1.00 . A A .  38 GLU HG2  1 1 
        1   633 1 1  38 GLU HG3  H -11.803  -2.949 -19.058 1.00 . A A .  38 GLU HG3  1 1 
        1   634 1 1  38 GLU N    N  -8.064  -1.601 -19.216 1.00 . A A .  38 GLU N    1 1 
        1   635 1 1  38 GLU O    O  -6.710  -4.712 -18.363 1.00 . A A .  38 GLU O    1 1 
        1   636 1 1  38 GLU OE1  O -11.398  -3.481 -16.524 1.00 . A A .  38 GLU OE1  1 1 
        1   637 1 1  38 GLU OE2  O -10.686  -1.415 -16.570 1.00 . A A .  38 GLU OE2  1 1 
        1   638 1 1  39 LYS C    C  -4.627  -4.659 -20.496 1.00 . A A .  39 LYS C    1 1 
        1   639 1 1  39 LYS CA   C  -6.036  -4.886 -21.066 1.00 . A A .  39 LYS CA   1 1 
        1   640 1 1  39 LYS CB   C  -6.044  -4.720 -22.591 1.00 . A A .  39 LYS CB   1 1 
        1   641 1 1  39 LYS CD   C  -7.445  -4.726 -24.718 1.00 . A A .  39 LYS CD   1 1 
        1   642 1 1  39 LYS CE   C  -7.692  -3.236 -24.976 1.00 . A A .  39 LYS CE   1 1 
        1   643 1 1  39 LYS CG   C  -7.389  -5.068 -23.227 1.00 . A A .  39 LYS CG   1 1 
        1   644 1 1  39 LYS H    H  -7.468  -3.317 -21.045 1.00 . A A .  39 LYS H    1 1 
        1   645 1 1  39 LYS HA   H  -6.348  -5.893 -20.823 1.00 . A A .  39 LYS HA   1 1 
        1   646 1 1  39 LYS HB2  H  -5.807  -3.692 -22.831 1.00 . A A .  39 LYS HB2  1 1 
        1   647 1 1  39 LYS HB3  H  -5.289  -5.364 -23.019 1.00 . A A .  39 LYS HB3  1 1 
        1   648 1 1  39 LYS HD2  H  -6.506  -5.003 -25.174 1.00 . A A .  39 LYS HD2  1 1 
        1   649 1 1  39 LYS HD3  H  -8.244  -5.295 -25.172 1.00 . A A .  39 LYS HD3  1 1 
        1   650 1 1  39 LYS HE2  H  -7.832  -3.090 -26.036 1.00 . A A .  39 LYS HE2  1 1 
        1   651 1 1  39 LYS HE3  H  -8.593  -2.940 -24.456 1.00 . A A .  39 LYS HE3  1 1 
        1   652 1 1  39 LYS HG2  H  -7.563  -6.128 -23.109 1.00 . A A .  39 LYS HG2  1 1 
        1   653 1 1  39 LYS HG3  H  -8.169  -4.521 -22.712 1.00 . A A .  39 LYS HG3  1 1 
        1   654 1 1  39 LYS HZ1  H  -6.774  -1.375 -24.744 1.00 . A A .  39 LYS HZ1  1 1 
        1   655 1 1  39 LYS HZ2  H  -5.686  -2.644 -25.001 1.00 . A A .  39 LYS HZ2  1 1 
        1   656 1 1  39 LYS HZ3  H  -6.434  -2.457 -23.494 1.00 . A A .  39 LYS HZ3  1 1 
        1   657 1 1  39 LYS N    N  -7.007  -3.963 -20.468 1.00 . A A .  39 LYS N    1 1 
        1   658 1 1  39 LYS NZ   N  -6.569  -2.370 -24.522 1.00 . A A .  39 LYS NZ   1 1 
        1   659 1 1  39 LYS O    O  -3.981  -5.595 -20.019 1.00 . A A .  39 LYS O    1 1 
        1   660 1 1  40 ARG C    C  -2.843  -3.455 -18.443 1.00 . A A .  40 ARG C    1 1 
        1   661 1 1  40 ARG CA   C  -2.888  -3.031 -19.918 1.00 . A A .  40 ARG CA   1 1 
        1   662 1 1  40 ARG CB   C  -2.675  -1.513 -20.028 1.00 . A A .  40 ARG CB   1 1 
        1   663 1 1  40 ARG CD   C  -0.954  -1.455 -21.871 1.00 . A A .  40 ARG CD   1 1 
        1   664 1 1  40 ARG CG   C  -2.352  -1.028 -21.439 1.00 . A A .  40 ARG CG   1 1 
        1   665 1 1  40 ARG CZ   C   1.334  -1.183 -21.047 1.00 . A A .  40 ARG CZ   1 1 
        1   666 1 1  40 ARG H    H  -4.697  -2.721 -20.988 1.00 . A A .  40 ARG H    1 1 
        1   667 1 1  40 ARG HA   H  -2.097  -3.539 -20.453 1.00 . A A .  40 ARG HA   1 1 
        1   668 1 1  40 ARG HB2  H  -3.574  -1.013 -19.698 1.00 . A A .  40 ARG HB2  1 1 
        1   669 1 1  40 ARG HB3  H  -1.860  -1.226 -19.377 1.00 . A A .  40 ARG HB3  1 1 
        1   670 1 1  40 ARG HD2  H  -0.885  -2.532 -21.820 1.00 . A A .  40 ARG HD2  1 1 
        1   671 1 1  40 ARG HD3  H  -0.787  -1.131 -22.888 1.00 . A A .  40 ARG HD3  1 1 
        1   672 1 1  40 ARG HE   H  -0.213  -0.184 -20.374 1.00 . A A .  40 ARG HE   1 1 
        1   673 1 1  40 ARG HG2  H  -3.073  -1.442 -22.130 1.00 . A A .  40 ARG HG2  1 1 
        1   674 1 1  40 ARG HG3  H  -2.411   0.052 -21.462 1.00 . A A .  40 ARG HG3  1 1 
        1   675 1 1  40 ARG HH11 H   1.134  -2.586 -22.448 1.00 . A A .  40 ARG HH11 1 1 
        1   676 1 1  40 ARG HH12 H   2.744  -2.323 -21.875 1.00 . A A .  40 ARG HH12 1 1 
        1   677 1 1  40 ARG HH21 H   1.807   0.119 -19.627 1.00 . A A .  40 ARG HH21 1 1 
        1   678 1 1  40 ARG HH22 H   3.124  -0.799 -20.274 1.00 . A A .  40 ARG HH22 1 1 
        1   679 1 1  40 ARG N    N  -4.165  -3.408 -20.533 1.00 . A A .  40 ARG N    1 1 
        1   680 1 1  40 ARG NE   N   0.072  -0.871 -21.013 1.00 . A A .  40 ARG NE   1 1 
        1   681 1 1  40 ARG NH1  N   1.772  -2.102 -21.849 1.00 . A A .  40 ARG NH1  1 1 
        1   682 1 1  40 ARG NH2  N   2.153  -0.576 -20.256 1.00 . A A .  40 ARG NH2  1 1 
        1   683 1 1  40 ARG O    O  -1.902  -4.113 -18.002 1.00 . A A .  40 ARG O    1 1 
        1   684 1 1  41 ARG C    C  -3.669  -4.872 -15.986 1.00 . A A .  41 ARG C    1 1 
        1   685 1 1  41 ARG CA   C  -3.990  -3.398 -16.272 1.00 . A A .  41 ARG CA   1 1 
        1   686 1 1  41 ARG CB   C  -5.403  -3.057 -15.774 1.00 . A A .  41 ARG CB   1 1 
        1   687 1 1  41 ARG CD   C  -7.004  -2.761 -13.848 1.00 . A A .  41 ARG CD   1 1 
        1   688 1 1  41 ARG CG   C  -5.593  -3.169 -14.264 1.00 . A A .  41 ARG CG   1 1 
        1   689 1 1  41 ARG CZ   C  -8.552  -0.901 -14.250 1.00 . A A .  41 ARG CZ   1 1 
        1   690 1 1  41 ARG H    H  -4.614  -2.588 -18.128 1.00 . A A .  41 ARG H    1 1 
        1   691 1 1  41 ARG HA   H  -3.276  -2.780 -15.750 1.00 . A A .  41 ARG HA   1 1 
        1   692 1 1  41 ARG HB2  H  -5.634  -2.042 -16.064 1.00 . A A .  41 ARG HB2  1 1 
        1   693 1 1  41 ARG HB3  H  -6.109  -3.723 -16.253 1.00 . A A .  41 ARG HB3  1 1 
        1   694 1 1  41 ARG HD2  H  -7.708  -3.467 -14.266 1.00 . A A .  41 ARG HD2  1 1 
        1   695 1 1  41 ARG HD3  H  -7.068  -2.789 -12.769 1.00 . A A .  41 ARG HD3  1 1 
        1   696 1 1  41 ARG HE   H  -6.635  -0.873 -14.695 1.00 . A A .  41 ARG HE   1 1 
        1   697 1 1  41 ARG HG2  H  -5.421  -4.192 -13.963 1.00 . A A .  41 ARG HG2  1 1 
        1   698 1 1  41 ARG HG3  H  -4.879  -2.522 -13.772 1.00 . A A .  41 ARG HG3  1 1 
        1   699 1 1  41 ARG HH11 H  -9.406  -2.517 -13.464 1.00 . A A .  41 ARG HH11 1 1 
        1   700 1 1  41 ARG HH12 H -10.456  -1.177 -13.753 1.00 . A A .  41 ARG HH12 1 1 
        1   701 1 1  41 ARG HH21 H  -8.021   0.835 -15.058 1.00 . A A .  41 ARG HH21 1 1 
        1   702 1 1  41 ARG HH22 H  -9.692   0.676 -14.644 1.00 . A A .  41 ARG HH22 1 1 
        1   703 1 1  41 ARG N    N  -3.886  -3.088 -17.701 1.00 . A A .  41 ARG N    1 1 
        1   704 1 1  41 ARG NE   N  -7.348  -1.415 -14.310 1.00 . A A .  41 ARG NE   1 1 
        1   705 1 1  41 ARG NH1  N  -9.544  -1.585 -13.781 1.00 . A A .  41 ARG NH1  1 1 
        1   706 1 1  41 ARG NH2  N  -8.767   0.297 -14.679 1.00 . A A .  41 ARG NH2  1 1 
        1   707 1 1  41 ARG O    O  -2.820  -5.176 -15.145 1.00 . A A .  41 ARG O    1 1 
        1   708 1 1  42 ARG C    C  -2.672  -7.622 -16.864 1.00 . A A .  42 ARG C    1 1 
        1   709 1 1  42 ARG CA   C  -4.113  -7.218 -16.507 1.00 . A A .  42 ARG CA   1 1 
        1   710 1 1  42 ARG CB   C  -5.102  -8.047 -17.340 1.00 . A A .  42 ARG CB   1 1 
        1   711 1 1  42 ARG CD   C  -5.394  -9.920 -15.665 1.00 . A A .  42 ARG CD   1 1 
        1   712 1 1  42 ARG CG   C  -4.982  -9.550 -17.090 1.00 . A A .  42 ARG CG   1 1 
        1   713 1 1  42 ARG CZ   C  -5.354 -12.373 -15.643 1.00 . A A .  42 ARG CZ   1 1 
        1   714 1 1  42 ARG H    H  -4.990  -5.481 -17.370 1.00 . A A .  42 ARG H    1 1 
        1   715 1 1  42 ARG HA   H  -4.279  -7.433 -15.461 1.00 . A A .  42 ARG HA   1 1 
        1   716 1 1  42 ARG HB2  H  -6.110  -7.738 -17.098 1.00 . A A .  42 ARG HB2  1 1 
        1   717 1 1  42 ARG HB3  H  -4.920  -7.861 -18.390 1.00 . A A .  42 ARG HB3  1 1 
        1   718 1 1  42 ARG HD2  H  -5.014  -9.169 -14.986 1.00 . A A .  42 ARG HD2  1 1 
        1   719 1 1  42 ARG HD3  H  -6.474  -9.937 -15.608 1.00 . A A .  42 ARG HD3  1 1 
        1   720 1 1  42 ARG HE   H  -4.122 -11.232 -14.623 1.00 . A A .  42 ARG HE   1 1 
        1   721 1 1  42 ARG HG2  H  -5.624 -10.072 -17.784 1.00 . A A .  42 ARG HG2  1 1 
        1   722 1 1  42 ARG HG3  H  -3.956  -9.851 -17.249 1.00 . A A .  42 ARG HG3  1 1 
        1   723 1 1  42 ARG HH11 H  -6.765 -11.600 -16.811 1.00 . A A .  42 ARG HH11 1 1 
        1   724 1 1  42 ARG HH12 H  -6.700 -13.325 -16.758 1.00 . A A .  42 ARG HH12 1 1 
        1   725 1 1  42 ARG HH21 H  -4.077 -13.412 -14.540 1.00 . A A .  42 ARG HH21 1 1 
        1   726 1 1  42 ARG HH22 H  -5.181 -14.345 -15.491 1.00 . A A .  42 ARG HH22 1 1 
        1   727 1 1  42 ARG N    N  -4.336  -5.782 -16.699 1.00 . A A .  42 ARG N    1 1 
        1   728 1 1  42 ARG NE   N  -4.877 -11.224 -15.251 1.00 . A A .  42 ARG NE   1 1 
        1   729 1 1  42 ARG NH1  N  -6.349 -12.436 -16.468 1.00 . A A .  42 ARG NH1  1 1 
        1   730 1 1  42 ARG NH2  N  -4.836 -13.460 -15.189 1.00 . A A .  42 ARG NH2  1 1 
        1   731 1 1  42 ARG O    O  -2.005  -8.308 -16.090 1.00 . A A .  42 ARG O    1 1 
        1   732 1 1  43 GLU C    C   0.243  -7.037 -17.537 1.00 . A A .  43 GLU C    1 1 
        1   733 1 1  43 GLU CA   C  -0.845  -7.531 -18.504 1.00 . A A .  43 GLU CA   1 1 
        1   734 1 1  43 GLU CB   C  -0.603  -6.944 -19.904 1.00 . A A .  43 GLU CB   1 1 
        1   735 1 1  43 GLU CD   C  -1.282  -6.916 -22.352 1.00 . A A .  43 GLU CD   1 1 
        1   736 1 1  43 GLU CG   C  -1.552  -7.486 -20.968 1.00 . A A .  43 GLU CG   1 1 
        1   737 1 1  43 GLU H    H  -2.762  -6.601 -18.588 1.00 . A A .  43 GLU H    1 1 
        1   738 1 1  43 GLU HA   H  -0.789  -8.609 -18.564 1.00 . A A .  43 GLU HA   1 1 
        1   739 1 1  43 GLU HB2  H  -0.725  -5.870 -19.857 1.00 . A A .  43 GLU HB2  1 1 
        1   740 1 1  43 GLU HB3  H   0.411  -7.169 -20.206 1.00 . A A .  43 GLU HB3  1 1 
        1   741 1 1  43 GLU HG2  H  -1.447  -8.561 -21.012 1.00 . A A .  43 GLU HG2  1 1 
        1   742 1 1  43 GLU HG3  H  -2.567  -7.240 -20.684 1.00 . A A .  43 GLU HG3  1 1 
        1   743 1 1  43 GLU N    N  -2.196  -7.181 -18.030 1.00 . A A .  43 GLU N    1 1 
        1   744 1 1  43 GLU O    O   1.334  -7.608 -17.460 1.00 . A A .  43 GLU O    1 1 
        1   745 1 1  43 GLU OE1  O  -0.446  -7.484 -23.085 1.00 . A A .  43 GLU OE1  1 1 
        1   746 1 1  43 GLU OE2  O  -1.905  -5.894 -22.716 1.00 . A A .  43 GLU OE2  1 1 
        1   747 1 1  44 ARG C    C   0.855  -6.227 -14.516 1.00 . A A .  44 ARG C    1 1 
        1   748 1 1  44 ARG CA   C   0.854  -5.407 -15.818 1.00 . A A .  44 ARG CA   1 1 
        1   749 1 1  44 ARG CB   C   0.450  -3.959 -15.524 1.00 . A A .  44 ARG CB   1 1 
        1   750 1 1  44 ARG CD   C   1.967  -2.676 -17.085 1.00 . A A .  44 ARG CD   1 1 
        1   751 1 1  44 ARG CG   C   0.531  -3.039 -16.738 1.00 . A A .  44 ARG CG   1 1 
        1   752 1 1  44 ARG CZ   C   3.677  -1.130 -16.275 1.00 . A A .  44 ARG CZ   1 1 
        1   753 1 1  44 ARG H    H  -0.935  -5.540 -16.949 1.00 . A A .  44 ARG H    1 1 
        1   754 1 1  44 ARG HA   H   1.849  -5.415 -16.241 1.00 . A A .  44 ARG HA   1 1 
        1   755 1 1  44 ARG HB2  H  -0.569  -3.950 -15.161 1.00 . A A .  44 ARG HB2  1 1 
        1   756 1 1  44 ARG HB3  H   1.099  -3.564 -14.754 1.00 . A A .  44 ARG HB3  1 1 
        1   757 1 1  44 ARG HD2  H   2.565  -3.578 -17.092 1.00 . A A .  44 ARG HD2  1 1 
        1   758 1 1  44 ARG HD3  H   1.986  -2.226 -18.069 1.00 . A A .  44 ARG HD3  1 1 
        1   759 1 1  44 ARG HE   H   1.993  -1.521 -15.332 1.00 . A A .  44 ARG HE   1 1 
        1   760 1 1  44 ARG HG2  H   0.084  -3.539 -17.585 1.00 . A A .  44 ARG HG2  1 1 
        1   761 1 1  44 ARG HG3  H  -0.018  -2.132 -16.527 1.00 . A A .  44 ARG HG3  1 1 
        1   762 1 1  44 ARG HH11 H   4.192  -2.163 -17.895 1.00 . A A .  44 ARG HH11 1 1 
        1   763 1 1  44 ARG HH12 H   5.330  -0.973 -17.371 1.00 . A A .  44 ARG HH12 1 1 
        1   764 1 1  44 ARG HH21 H   3.459   0.011 -14.664 1.00 . A A .  44 ARG HH21 1 1 
        1   765 1 1  44 ARG HH22 H   4.923   0.247 -15.555 1.00 . A A .  44 ARG HH22 1 1 
        1   766 1 1  44 ARG N    N  -0.063  -5.971 -16.809 1.00 . A A .  44 ARG N    1 1 
        1   767 1 1  44 ARG NE   N   2.532  -1.735 -16.120 1.00 . A A .  44 ARG NE   1 1 
        1   768 1 1  44 ARG NH1  N   4.461  -1.447 -17.254 1.00 . A A .  44 ARG NH1  1 1 
        1   769 1 1  44 ARG NH2  N   4.048  -0.223 -15.430 1.00 . A A .  44 ARG NH2  1 1 
        1   770 1 1  44 ARG O    O   1.898  -6.705 -14.070 1.00 . A A .  44 ARG O    1 1 
        1   771 1 1  45 LEU C    C  -0.188  -8.601 -12.749 1.00 . A A .  45 LEU C    1 1 
        1   772 1 1  45 LEU CA   C  -0.451  -7.090 -12.631 1.00 . A A .  45 LEU CA   1 1 
        1   773 1 1  45 LEU CB   C  -1.831  -6.808 -12.012 1.00 . A A .  45 LEU CB   1 1 
        1   774 1 1  45 LEU CD1  C  -3.387  -8.719 -12.651 1.00 . A A .  45 LEU CD1  1 1 
        1   775 1 1  45 LEU CD2  C  -4.270  -6.378 -12.488 1.00 . A A .  45 LEU CD2  1 1 
        1   776 1 1  45 LEU CG   C  -3.062  -7.238 -12.841 1.00 . A A .  45 LEU CG   1 1 
        1   777 1 1  45 LEU H    H  -1.131  -6.040 -14.353 1.00 . A A .  45 LEU H    1 1 
        1   778 1 1  45 LEU HA   H   0.300  -6.679 -11.972 1.00 . A A .  45 LEU HA   1 1 
        1   779 1 1  45 LEU HB2  H  -1.875  -7.308 -11.057 1.00 . A A .  45 LEU HB2  1 1 
        1   780 1 1  45 LEU HB3  H  -1.902  -5.743 -11.835 1.00 . A A .  45 LEU HB3  1 1 
        1   781 1 1  45 LEU HD11 H  -3.590  -8.915 -11.608 1.00 . A A .  45 LEU HD11 1 1 
        1   782 1 1  45 LEU HD12 H  -2.546  -9.318 -12.971 1.00 . A A .  45 LEU HD12 1 1 
        1   783 1 1  45 LEU HD13 H  -4.254  -8.978 -13.241 1.00 . A A .  45 LEU HD13 1 1 
        1   784 1 1  45 LEU HD21 H  -4.500  -6.489 -11.438 1.00 . A A .  45 LEU HD21 1 1 
        1   785 1 1  45 LEU HD22 H  -5.120  -6.689 -13.079 1.00 . A A .  45 LEU HD22 1 1 
        1   786 1 1  45 LEU HD23 H  -4.048  -5.341 -12.699 1.00 . A A .  45 LEU HD23 1 1 
        1   787 1 1  45 LEU HG   H  -2.846  -7.086 -13.890 1.00 . A A .  45 LEU HG   1 1 
        1   788 1 1  45 LEU N    N  -0.324  -6.394 -13.919 1.00 . A A .  45 LEU N    1 1 
        1   789 1 1  45 LEU O    O   0.188  -9.247 -11.768 1.00 . A A .  45 LEU O    1 1 
        1   790 1 1  46 GLU C    C   1.322 -10.964 -13.806 1.00 . A A .  46 GLU C    1 1 
        1   791 1 1  46 GLU CA   C  -0.125 -10.597 -14.164 1.00 . A A .  46 GLU CA   1 1 
        1   792 1 1  46 GLU CB   C  -0.429 -11.010 -15.611 1.00 . A A .  46 GLU CB   1 1 
        1   793 1 1  46 GLU CD   C  -0.713 -12.977 -17.200 1.00 . A A .  46 GLU CD   1 1 
        1   794 1 1  46 GLU CG   C  -0.127 -12.481 -15.891 1.00 . A A .  46 GLU CG   1 1 
        1   795 1 1  46 GLU H    H  -0.706  -8.615 -14.688 1.00 . A A .  46 GLU H    1 1 
        1   796 1 1  46 GLU HA   H  -0.785 -11.144 -13.504 1.00 . A A .  46 GLU HA   1 1 
        1   797 1 1  46 GLU HB2  H  -1.477 -10.830 -15.813 1.00 . A A .  46 GLU HB2  1 1 
        1   798 1 1  46 GLU HB3  H   0.167 -10.406 -16.281 1.00 . A A .  46 GLU HB3  1 1 
        1   799 1 1  46 GLU HG2  H   0.946 -12.613 -15.923 1.00 . A A .  46 GLU HG2  1 1 
        1   800 1 1  46 GLU HG3  H  -0.531 -13.077 -15.082 1.00 . A A .  46 GLU HG3  1 1 
        1   801 1 1  46 GLU N    N  -0.381  -9.166 -13.945 1.00 . A A .  46 GLU N    1 1 
        1   802 1 1  46 GLU O    O   1.588 -12.055 -13.294 1.00 . A A .  46 GLU O    1 1 
        1   803 1 1  46 GLU OE1  O  -0.075 -12.785 -18.257 1.00 . A A .  46 GLU OE1  1 1 
        1   804 1 1  46 GLU OE2  O  -1.810 -13.576 -17.175 1.00 . A A .  46 GLU OE2  1 1 
        1   805 1 1  47 GLU C    C   3.792 -10.483 -12.169 1.00 . A A .  47 GLU C    1 1 
        1   806 1 1  47 GLU CA   C   3.654 -10.243 -13.679 1.00 . A A .  47 GLU CA   1 1 
        1   807 1 1  47 GLU CB   C   4.514  -9.047 -14.115 1.00 . A A .  47 GLU CB   1 1 
        1   808 1 1  47 GLU CD   C   5.206 -10.067 -16.344 1.00 . A A .  47 GLU CD   1 1 
        1   809 1 1  47 GLU CG   C   4.594  -8.865 -15.630 1.00 . A A .  47 GLU CG   1 1 
        1   810 1 1  47 GLU H    H   1.990  -9.208 -14.501 1.00 . A A .  47 GLU H    1 1 
        1   811 1 1  47 GLU HA   H   4.001 -11.126 -14.197 1.00 . A A .  47 GLU HA   1 1 
        1   812 1 1  47 GLU HB2  H   4.098  -8.146 -13.687 1.00 . A A .  47 GLU HB2  1 1 
        1   813 1 1  47 GLU HB3  H   5.519  -9.182 -13.736 1.00 . A A .  47 GLU HB3  1 1 
        1   814 1 1  47 GLU HG2  H   3.596  -8.705 -16.011 1.00 . A A .  47 GLU HG2  1 1 
        1   815 1 1  47 GLU HG3  H   5.197  -7.991 -15.841 1.00 . A A .  47 GLU HG3  1 1 
        1   816 1 1  47 GLU N    N   2.252 -10.041 -14.054 1.00 . A A .  47 GLU N    1 1 
        1   817 1 1  47 GLU O    O   4.714 -11.159 -11.719 1.00 . A A .  47 GLU O    1 1 
        1   818 1 1  47 GLU OE1  O   6.454 -10.167 -16.389 1.00 . A A .  47 GLU OE1  1 1 
        1   819 1 1  47 GLU OE2  O   4.448 -10.912 -16.864 1.00 . A A .  47 GLU OE2  1 1 
        1   820 1 1  48 PHE C    C   2.065 -11.445  -9.592 1.00 . A A .  48 PHE C    1 1 
        1   821 1 1  48 PHE CA   C   2.829 -10.158  -9.945 1.00 . A A .  48 PHE CA   1 1 
        1   822 1 1  48 PHE CB   C   2.210  -8.947  -9.235 1.00 . A A .  48 PHE CB   1 1 
        1   823 1 1  48 PHE CD1  C   4.170  -7.533  -8.543 1.00 . A A .  48 PHE CD1  1 1 
        1   824 1 1  48 PHE CD2  C   2.749  -6.713 -10.277 1.00 . A A .  48 PHE CD2  1 1 
        1   825 1 1  48 PHE CE1  C   4.960  -6.406  -8.650 1.00 . A A .  48 PHE CE1  1 1 
        1   826 1 1  48 PHE CE2  C   3.536  -5.580 -10.387 1.00 . A A .  48 PHE CE2  1 1 
        1   827 1 1  48 PHE CG   C   3.056  -7.703  -9.353 1.00 . A A .  48 PHE CG   1 1 
        1   828 1 1  48 PHE CZ   C   4.644  -5.428  -9.572 1.00 . A A .  48 PHE CZ   1 1 
        1   829 1 1  48 PHE H    H   2.178  -9.364 -11.801 1.00 . A A .  48 PHE H    1 1 
        1   830 1 1  48 PHE HA   H   3.852 -10.268  -9.609 1.00 . A A .  48 PHE HA   1 1 
        1   831 1 1  48 PHE HB2  H   1.241  -8.740  -9.668 1.00 . A A .  48 PHE HB2  1 1 
        1   832 1 1  48 PHE HB3  H   2.089  -9.172  -8.184 1.00 . A A .  48 PHE HB3  1 1 
        1   833 1 1  48 PHE HD1  H   4.420  -8.296  -7.819 1.00 . A A .  48 PHE HD1  1 1 
        1   834 1 1  48 PHE HD2  H   1.882  -6.832 -10.912 1.00 . A A .  48 PHE HD2  1 1 
        1   835 1 1  48 PHE HE1  H   5.824  -6.289  -8.012 1.00 . A A .  48 PHE HE1  1 1 
        1   836 1 1  48 PHE HE2  H   3.287  -4.815 -11.109 1.00 . A A .  48 PHE HE2  1 1 
        1   837 1 1  48 PHE HZ   H   5.264  -4.546  -9.657 1.00 . A A .  48 PHE HZ   1 1 
        1   838 1 1  48 PHE N    N   2.862  -9.934 -11.392 1.00 . A A .  48 PHE N    1 1 
        1   839 1 1  48 PHE O    O   2.464 -12.179  -8.686 1.00 . A A .  48 PHE O    1 1 
        1   840 1 1  49 GLU C    C   1.127 -14.196 -10.203 1.00 . A A .  49 GLU C    1 1 
        1   841 1 1  49 GLU CA   C   0.206 -12.966 -10.109 1.00 . A A .  49 GLU CA   1 1 
        1   842 1 1  49 GLU CB   C  -0.924 -13.103 -11.149 1.00 . A A .  49 GLU CB   1 1 
        1   843 1 1  49 GLU CD   C  -3.083 -12.183 -12.116 1.00 . A A .  49 GLU CD   1 1 
        1   844 1 1  49 GLU CG   C  -1.865 -11.903 -11.238 1.00 . A A .  49 GLU CG   1 1 
        1   845 1 1  49 GLU H    H   0.675 -11.082 -10.995 1.00 . A A .  49 GLU H    1 1 
        1   846 1 1  49 GLU HA   H  -0.227 -12.927  -9.119 1.00 . A A .  49 GLU HA   1 1 
        1   847 1 1  49 GLU HB2  H  -0.482 -13.252 -12.124 1.00 . A A .  49 GLU HB2  1 1 
        1   848 1 1  49 GLU HB3  H  -1.515 -13.975 -10.901 1.00 . A A .  49 GLU HB3  1 1 
        1   849 1 1  49 GLU HG2  H  -2.199 -11.643 -10.244 1.00 . A A .  49 GLU HG2  1 1 
        1   850 1 1  49 GLU HG3  H  -1.322 -11.068 -11.658 1.00 . A A .  49 GLU HG3  1 1 
        1   851 1 1  49 GLU N    N   0.974 -11.724 -10.315 1.00 . A A .  49 GLU N    1 1 
        1   852 1 1  49 GLU O    O   1.114 -15.076  -9.338 1.00 . A A .  49 GLU O    1 1 
        1   853 1 1  49 GLU OE1  O  -2.933 -12.244 -13.357 1.00 . A A .  49 GLU OE1  1 1 
        1   854 1 1  49 GLU OE2  O  -4.193 -12.366 -11.571 1.00 . A A .  49 GLU OE2  1 1 
        1   855 1 1  50 LYS C    C   4.047 -15.336 -10.484 1.00 . A A .  50 LYS C    1 1 
        1   856 1 1  50 LYS CA   C   2.887 -15.323 -11.505 1.00 . A A .  50 LYS CA   1 1 
        1   857 1 1  50 LYS CB   C   3.434 -15.216 -12.938 1.00 . A A .  50 LYS CB   1 1 
        1   858 1 1  50 LYS CD   C   4.268 -13.589 -14.701 1.00 . A A .  50 LYS CD   1 1 
        1   859 1 1  50 LYS CE   C   5.046 -14.624 -15.498 1.00 . A A .  50 LYS CE   1 1 
        1   860 1 1  50 LYS CG   C   4.195 -13.921 -13.210 1.00 . A A .  50 LYS CG   1 1 
        1   861 1 1  50 LYS H    H   1.895 -13.485 -11.903 1.00 . A A .  50 LYS H    1 1 
        1   862 1 1  50 LYS HA   H   2.340 -16.252 -11.413 1.00 . A A .  50 LYS HA   1 1 
        1   863 1 1  50 LYS HB2  H   4.101 -16.048 -13.121 1.00 . A A .  50 LYS HB2  1 1 
        1   864 1 1  50 LYS HB3  H   2.605 -15.276 -13.630 1.00 . A A .  50 LYS HB3  1 1 
        1   865 1 1  50 LYS HD2  H   3.264 -13.534 -15.094 1.00 . A A .  50 LYS HD2  1 1 
        1   866 1 1  50 LYS HD3  H   4.749 -12.627 -14.818 1.00 . A A .  50 LYS HD3  1 1 
        1   867 1 1  50 LYS HE2  H   6.060 -14.665 -15.127 1.00 . A A .  50 LYS HE2  1 1 
        1   868 1 1  50 LYS HE3  H   4.576 -15.590 -15.373 1.00 . A A .  50 LYS HE3  1 1 
        1   869 1 1  50 LYS HG2  H   3.695 -13.109 -12.700 1.00 . A A .  50 LYS HG2  1 1 
        1   870 1 1  50 LYS HG3  H   5.200 -14.019 -12.822 1.00 . A A .  50 LYS HG3  1 1 
        1   871 1 1  50 LYS HZ1  H   4.123 -14.366 -17.350 1.00 . A A .  50 LYS HZ1  1 1 
        1   872 1 1  50 LYS HZ2  H   5.711 -14.933 -17.454 1.00 . A A .  50 LYS HZ2  1 1 
        1   873 1 1  50 LYS HZ3  H   5.411 -13.310 -17.082 1.00 . A A .  50 LYS HZ3  1 1 
        1   874 1 1  50 LYS N    N   1.940 -14.225 -11.258 1.00 . A A .  50 LYS N    1 1 
        1   875 1 1  50 LYS NZ   N   5.076 -14.285 -16.946 1.00 . A A .  50 LYS NZ   1 1 
        1   876 1 1  50 LYS O    O   4.784 -16.318 -10.384 1.00 . A A .  50 LYS O    1 1 
        1   877 1 1  51 GLN C    C   4.634 -14.444  -7.290 1.00 . A A .  51 GLN C    1 1 
        1   878 1 1  51 GLN CA   C   5.232 -14.158  -8.678 1.00 . A A .  51 GLN CA   1 1 
        1   879 1 1  51 GLN CB   C   5.900 -12.772  -8.676 1.00 . A A .  51 GLN CB   1 1 
        1   880 1 1  51 GLN CD   C   7.555 -11.187  -9.771 1.00 . A A .  51 GLN CD   1 1 
        1   881 1 1  51 GLN CG   C   6.859 -12.539  -9.840 1.00 . A A .  51 GLN CG   1 1 
        1   882 1 1  51 GLN H    H   3.634 -13.466  -9.904 1.00 . A A .  51 GLN H    1 1 
        1   883 1 1  51 GLN HA   H   5.986 -14.905  -8.885 1.00 . A A .  51 GLN HA   1 1 
        1   884 1 1  51 GLN HB2  H   5.128 -12.016  -8.718 1.00 . A A .  51 GLN HB2  1 1 
        1   885 1 1  51 GLN HB3  H   6.452 -12.654  -7.754 1.00 . A A .  51 GLN HB3  1 1 
        1   886 1 1  51 GLN HE21 H   6.106 -10.348 -10.822 1.00 . A A .  51 GLN HE21 1 1 
        1   887 1 1  51 GLN HE22 H   7.390  -9.303 -10.342 1.00 . A A .  51 GLN HE22 1 1 
        1   888 1 1  51 GLN HG2  H   7.613 -13.313  -9.831 1.00 . A A .  51 GLN HG2  1 1 
        1   889 1 1  51 GLN HG3  H   6.302 -12.593 -10.766 1.00 . A A .  51 GLN HG3  1 1 
        1   890 1 1  51 GLN N    N   4.211 -14.241  -9.739 1.00 . A A .  51 GLN N    1 1 
        1   891 1 1  51 GLN NE2  N   6.957 -10.177 -10.370 1.00 . A A .  51 GLN NE2  1 1 
        1   892 1 1  51 GLN O    O   5.281 -14.210  -6.264 1.00 . A A .  51 GLN O    1 1 
        1   893 1 1  51 GLN OE1  O   8.623 -11.049  -9.181 1.00 . A A .  51 GLN OE1  1 1 
        1   894 1 1  52 GLY C    C   2.430 -14.001  -5.179 1.00 . A A .  52 GLY C    1 1 
        1   895 1 1  52 GLY CA   C   2.746 -15.254  -5.992 1.00 . A A .  52 GLY CA   1 1 
        1   896 1 1  52 GLY H    H   2.940 -15.132  -8.103 1.00 . A A .  52 GLY H    1 1 
        1   897 1 1  52 GLY HA2  H   1.823 -15.777  -6.197 1.00 . A A .  52 GLY HA2  1 1 
        1   898 1 1  52 GLY HA3  H   3.387 -15.900  -5.406 1.00 . A A .  52 GLY HA3  1 1 
        1   899 1 1  52 GLY N    N   3.406 -14.956  -7.259 1.00 . A A .  52 GLY N    1 1 
        1   900 1 1  52 GLY O    O   2.985 -13.794  -4.097 1.00 . A A .  52 GLY O    1 1 
        1   901 1 1  53 VAL C    C  -0.387 -11.809  -4.975 1.00 . A A .  53 VAL C    1 1 
        1   902 1 1  53 VAL CA   C   1.147 -11.903  -5.065 1.00 . A A .  53 VAL CA   1 1 
        1   903 1 1  53 VAL CB   C   1.700 -10.671  -5.835 1.00 . A A .  53 VAL CB   1 1 
        1   904 1 1  53 VAL CG1  C   1.197  -9.358  -5.234 1.00 . A A .  53 VAL CG1  1 1 
        1   905 1 1  53 VAL CG2  C   3.229 -10.704  -5.864 1.00 . A A .  53 VAL CG2  1 1 
        1   906 1 1  53 VAL H    H   1.200 -13.358  -6.609 1.00 . A A .  53 VAL H    1 1 
        1   907 1 1  53 VAL HA   H   1.558 -11.893  -4.064 1.00 . A A .  53 VAL HA   1 1 
        1   908 1 1  53 VAL HB   H   1.347 -10.726  -6.856 1.00 . A A .  53 VAL HB   1 1 
        1   909 1 1  53 VAL HG11 H   0.120  -9.317  -5.308 1.00 . A A .  53 VAL HG11 1 1 
        1   910 1 1  53 VAL HG12 H   1.626  -8.524  -5.772 1.00 . A A .  53 VAL HG12 1 1 
        1   911 1 1  53 VAL HG13 H   1.487  -9.302  -4.196 1.00 . A A .  53 VAL HG13 1 1 
        1   912 1 1  53 VAL HG21 H   3.562 -11.613  -6.345 1.00 . A A .  53 VAL HG21 1 1 
        1   913 1 1  53 VAL HG22 H   3.610 -10.673  -4.853 1.00 . A A .  53 VAL HG22 1 1 
        1   914 1 1  53 VAL HG23 H   3.599  -9.851  -6.415 1.00 . A A .  53 VAL HG23 1 1 
        1   915 1 1  53 VAL N    N   1.564 -13.151  -5.725 1.00 . A A .  53 VAL N    1 1 
        1   916 1 1  53 VAL O    O  -1.098 -12.325  -5.840 1.00 . A A .  53 VAL O    1 1 
        1   917 1 1  54 ASP C    C  -2.806  -9.657  -4.403 1.00 . A A .  54 ASP C    1 1 
        1   918 1 1  54 ASP CA   C  -2.345 -10.979  -3.757 1.00 . A A .  54 ASP CA   1 1 
        1   919 1 1  54 ASP CB   C  -2.712 -11.000  -2.266 1.00 . A A .  54 ASP CB   1 1 
        1   920 1 1  54 ASP CG   C  -2.348 -12.314  -1.593 1.00 . A A .  54 ASP CG   1 1 
        1   921 1 1  54 ASP H    H  -0.288 -10.812  -3.234 1.00 . A A .  54 ASP H    1 1 
        1   922 1 1  54 ASP HA   H  -2.847 -11.800  -4.253 1.00 . A A .  54 ASP HA   1 1 
        1   923 1 1  54 ASP HB2  H  -2.185 -10.202  -1.761 1.00 . A A .  54 ASP HB2  1 1 
        1   924 1 1  54 ASP HB3  H  -3.778 -10.841  -2.160 1.00 . A A .  54 ASP HB3  1 1 
        1   925 1 1  54 ASP N    N  -0.897 -11.166  -3.923 1.00 . A A .  54 ASP N    1 1 
        1   926 1 1  54 ASP O    O  -2.868  -8.619  -3.744 1.00 . A A .  54 ASP O    1 1 
        1   927 1 1  54 ASP OD1  O  -1.145 -12.584  -1.405 1.00 . A A .  54 ASP OD1  1 1 
        1   928 1 1  54 ASP OD2  O  -3.268 -13.088  -1.252 1.00 . A A .  54 ASP OD2  1 1 
        1   929 1 1  55 VAL C    C  -5.000  -8.299  -6.597 1.00 . A A .  55 VAL C    1 1 
        1   930 1 1  55 VAL CA   C  -3.479  -8.472  -6.434 1.00 . A A .  55 VAL CA   1 1 
        1   931 1 1  55 VAL CB   C  -2.830  -8.437  -7.843 1.00 . A A .  55 VAL CB   1 1 
        1   932 1 1  55 VAL CG1  C  -3.174  -7.131  -8.561 1.00 . A A .  55 VAL CG1  1 1 
        1   933 1 1  55 VAL CG2  C  -1.316  -8.630  -7.753 1.00 . A A .  55 VAL CG2  1 1 
        1   934 1 1  55 VAL H    H  -3.112 -10.553  -6.172 1.00 . A A .  55 VAL H    1 1 
        1   935 1 1  55 VAL HA   H  -3.095  -7.627  -5.875 1.00 . A A .  55 VAL HA   1 1 
        1   936 1 1  55 VAL HB   H  -3.239  -9.256  -8.423 1.00 . A A .  55 VAL HB   1 1 
        1   937 1 1  55 VAL HG11 H  -2.790  -6.294  -7.995 1.00 . A A .  55 VAL HG11 1 1 
        1   938 1 1  55 VAL HG12 H  -4.248  -7.039  -8.651 1.00 . A A .  55 VAL HG12 1 1 
        1   939 1 1  55 VAL HG13 H  -2.734  -7.132  -9.545 1.00 . A A .  55 VAL HG13 1 1 
        1   940 1 1  55 VAL HG21 H  -1.100  -9.584  -7.293 1.00 . A A .  55 VAL HG21 1 1 
        1   941 1 1  55 VAL HG22 H  -0.885  -7.838  -7.158 1.00 . A A .  55 VAL HG22 1 1 
        1   942 1 1  55 VAL HG23 H  -0.888  -8.605  -8.746 1.00 . A A .  55 VAL HG23 1 1 
        1   943 1 1  55 VAL N    N  -3.122  -9.692  -5.698 1.00 . A A .  55 VAL N    1 1 
        1   944 1 1  55 VAL O    O  -5.692  -9.174  -7.118 1.00 . A A .  55 VAL O    1 1 
        1   945 1 1  56 ARG C    C  -6.885  -5.515  -7.357 1.00 . A A .  56 ARG C    1 1 
        1   946 1 1  56 ARG CA   C  -6.889  -6.734  -6.411 1.00 . A A .  56 ARG CA   1 1 
        1   947 1 1  56 ARG CB   C  -7.622  -6.372  -5.105 1.00 . A A .  56 ARG CB   1 1 
        1   948 1 1  56 ARG CD   C  -7.123  -8.481  -3.740 1.00 . A A .  56 ARG CD   1 1 
        1   949 1 1  56 ARG CG   C  -8.195  -7.559  -4.322 1.00 . A A .  56 ARG CG   1 1 
        1   950 1 1  56 ARG CZ   C  -7.289 -10.671  -2.621 1.00 . A A .  56 ARG CZ   1 1 
        1   951 1 1  56 ARG H    H  -4.935  -6.575  -5.597 1.00 . A A .  56 ARG H    1 1 
        1   952 1 1  56 ARG HA   H  -7.406  -7.552  -6.896 1.00 . A A .  56 ARG HA   1 1 
        1   953 1 1  56 ARG HB2  H  -6.933  -5.849  -4.456 1.00 . A A .  56 ARG HB2  1 1 
        1   954 1 1  56 ARG HB3  H  -8.441  -5.705  -5.343 1.00 . A A .  56 ARG HB3  1 1 
        1   955 1 1  56 ARG HD2  H  -6.642  -9.015  -4.548 1.00 . A A .  56 ARG HD2  1 1 
        1   956 1 1  56 ARG HD3  H  -6.392  -7.883  -3.215 1.00 . A A .  56 ARG HD3  1 1 
        1   957 1 1  56 ARG HE   H  -8.485  -9.153  -2.294 1.00 . A A .  56 ARG HE   1 1 
        1   958 1 1  56 ARG HG2  H  -8.794  -7.176  -3.508 1.00 . A A .  56 ARG HG2  1 1 
        1   959 1 1  56 ARG HG3  H  -8.828  -8.135  -4.983 1.00 . A A .  56 ARG HG3  1 1 
        1   960 1 1  56 ARG HH11 H  -5.745 -10.545  -3.873 1.00 . A A .  56 ARG HH11 1 1 
        1   961 1 1  56 ARG HH12 H  -5.946 -12.066  -3.081 1.00 . A A .  56 ARG HH12 1 1 
        1   962 1 1  56 ARG HH21 H  -8.744 -11.100  -1.330 1.00 . A A .  56 ARG HH21 1 1 
        1   963 1 1  56 ARG HH22 H  -7.616 -12.377  -1.651 1.00 . A A .  56 ARG HH22 1 1 
        1   964 1 1  56 ARG N    N  -5.509  -7.160  -6.137 1.00 . A A .  56 ARG N    1 1 
        1   965 1 1  56 ARG NE   N  -7.709  -9.446  -2.806 1.00 . A A .  56 ARG NE   1 1 
        1   966 1 1  56 ARG NH1  N  -6.244 -11.127  -3.240 1.00 . A A .  56 ARG NH1  1 1 
        1   967 1 1  56 ARG NH2  N  -7.930 -11.442  -1.805 1.00 . A A .  56 ARG NH2  1 1 
        1   968 1 1  56 ARG O    O  -6.030  -4.638  -7.242 1.00 . A A .  56 ARG O    1 1 
        1   969 1 1  57 THR C    C  -8.841  -3.235  -8.756 1.00 . A A .  57 THR C    1 1 
        1   970 1 1  57 THR CA   C  -7.906  -4.341  -9.247 1.00 . A A .  57 THR CA   1 1 
        1   971 1 1  57 THR CB   C  -8.396  -4.805 -10.640 1.00 . A A .  57 THR CB   1 1 
        1   972 1 1  57 THR CG2  C  -7.371  -5.714 -11.303 1.00 . A A .  57 THR CG2  1 1 
        1   973 1 1  57 THR H    H  -8.492  -6.182  -8.350 1.00 . A A .  57 THR H    1 1 
        1   974 1 1  57 THR HA   H  -6.910  -3.931  -9.360 1.00 . A A .  57 THR HA   1 1 
        1   975 1 1  57 THR HB   H  -8.535  -3.931 -11.265 1.00 . A A .  57 THR HB   1 1 
        1   976 1 1  57 THR HG1  H -10.329  -4.884 -10.203 1.00 . A A .  57 THR HG1  1 1 
        1   977 1 1  57 THR HG21 H  -7.171  -6.561 -10.663 1.00 . A A .  57 THR HG21 1 1 
        1   978 1 1  57 THR HG22 H  -6.452  -5.164 -11.469 1.00 . A A .  57 THR HG22 1 1 
        1   979 1 1  57 THR HG23 H  -7.756  -6.062 -12.250 1.00 . A A .  57 THR HG23 1 1 
        1   980 1 1  57 THR N    N  -7.829  -5.462  -8.295 1.00 . A A .  57 THR N    1 1 
        1   981 1 1  57 THR O    O  -9.959  -3.506  -8.318 1.00 . A A .  57 THR O    1 1 
        1   982 1 1  57 THR OG1  O  -9.653  -5.495 -10.524 1.00 . A A .  57 THR OG1  1 1 
        1   983 1 1  58 VAL C    C  -9.309   0.206  -9.606 1.00 . A A .  58 VAL C    1 1 
        1   984 1 1  58 VAL CA   C  -9.197  -0.821  -8.471 1.00 . A A .  58 VAL CA   1 1 
        1   985 1 1  58 VAL CB   C  -8.644  -0.120  -7.204 1.00 . A A .  58 VAL CB   1 1 
        1   986 1 1  58 VAL CG1  C  -9.144  -0.817  -5.943 1.00 . A A .  58 VAL CG1  1 1 
        1   987 1 1  58 VAL CG2  C  -7.116  -0.072  -7.231 1.00 . A A .  58 VAL CG2  1 1 
        1   988 1 1  58 VAL H    H  -7.474  -1.840  -9.186 1.00 . A A .  58 VAL H    1 1 
        1   989 1 1  58 VAL HA   H -10.192  -1.180  -8.244 1.00 . A A .  58 VAL HA   1 1 
        1   990 1 1  58 VAL HB   H  -9.013   0.898  -7.191 1.00 . A A .  58 VAL HB   1 1 
        1   991 1 1  58 VAL HG11 H  -8.918  -1.873  -5.996 1.00 . A A .  58 VAL HG11 1 1 
        1   992 1 1  58 VAL HG12 H -10.216  -0.680  -5.857 1.00 . A A .  58 VAL HG12 1 1 
        1   993 1 1  58 VAL HG13 H  -8.660  -0.388  -5.077 1.00 . A A .  58 VAL HG13 1 1 
        1   994 1 1  58 VAL HG21 H  -6.722  -1.077  -7.246 1.00 . A A .  58 VAL HG21 1 1 
        1   995 1 1  58 VAL HG22 H  -6.754   0.443  -6.352 1.00 . A A .  58 VAL HG22 1 1 
        1   996 1 1  58 VAL HG23 H  -6.788   0.455  -8.115 1.00 . A A .  58 VAL HG23 1 1 
        1   997 1 1  58 VAL N    N  -8.384  -1.986  -8.853 1.00 . A A .  58 VAL N    1 1 
        1   998 1 1  58 VAL O    O  -8.351   0.456 -10.340 1.00 . A A .  58 VAL O    1 1 
        1   999 1 1  59 GLU C    C -11.062   3.191 -10.154 1.00 . A A .  59 GLU C    1 1 
        1  1000 1 1  59 GLU CA   C -10.761   1.811 -10.764 1.00 . A A .  59 GLU CA   1 1 
        1  1001 1 1  59 GLU CB   C -11.942   1.375 -11.640 1.00 . A A .  59 GLU CB   1 1 
        1  1002 1 1  59 GLU CD   C -14.361   0.617 -11.752 1.00 . A A .  59 GLU CD   1 1 
        1  1003 1 1  59 GLU CG   C -13.210   1.043 -10.856 1.00 . A A .  59 GLU CG   1 1 
        1  1004 1 1  59 GLU H    H -11.225   0.515  -9.140 1.00 . A A .  59 GLU H    1 1 
        1  1005 1 1  59 GLU HA   H  -9.880   1.895 -11.386 1.00 . A A .  59 GLU HA   1 1 
        1  1006 1 1  59 GLU HB2  H -12.174   2.173 -12.331 1.00 . A A .  59 GLU HB2  1 1 
        1  1007 1 1  59 GLU HB3  H -11.653   0.500 -12.202 1.00 . A A .  59 GLU HB3  1 1 
        1  1008 1 1  59 GLU HG2  H -12.992   0.236 -10.171 1.00 . A A .  59 GLU HG2  1 1 
        1  1009 1 1  59 GLU HG3  H -13.510   1.918 -10.294 1.00 . A A .  59 GLU HG3  1 1 
        1  1010 1 1  59 GLU N    N -10.497   0.792  -9.738 1.00 . A A .  59 GLU N    1 1 
        1  1011 1 1  59 GLU O    O -10.707   4.224 -10.725 1.00 . A A .  59 GLU O    1 1 
        1  1012 1 1  59 GLU OE1  O -14.272  -0.468 -12.365 1.00 . A A .  59 GLU OE1  1 1 
        1  1013 1 1  59 GLU OE2  O -15.358   1.363 -11.851 1.00 . A A .  59 GLU OE2  1 1 
        1  1014 1 1  60 ASP C    C -11.831   4.509  -6.884 1.00 . A A .  60 ASP C    1 1 
        1  1015 1 1  60 ASP CA   C -12.197   4.443  -8.380 1.00 . A A .  60 ASP CA   1 1 
        1  1016 1 1  60 ASP CB   C -13.722   4.533  -8.572 1.00 . A A .  60 ASP CB   1 1 
        1  1017 1 1  60 ASP CG   C -14.300   5.874  -8.153 1.00 . A A .  60 ASP CG   1 1 
        1  1018 1 1  60 ASP H    H -11.875   2.352  -8.535 1.00 . A A .  60 ASP H    1 1 
        1  1019 1 1  60 ASP HA   H -11.729   5.275  -8.888 1.00 . A A .  60 ASP HA   1 1 
        1  1020 1 1  60 ASP HB2  H -13.952   4.376  -9.616 1.00 . A A .  60 ASP HB2  1 1 
        1  1021 1 1  60 ASP HB3  H -14.197   3.757  -7.988 1.00 . A A .  60 ASP HB3  1 1 
        1  1022 1 1  60 ASP N    N -11.715   3.200  -8.994 1.00 . A A .  60 ASP N    1 1 
        1  1023 1 1  60 ASP O    O -11.353   3.531  -6.306 1.00 . A A .  60 ASP O    1 1 
        1  1024 1 1  60 ASP OD1  O -14.363   6.790  -8.997 1.00 . A A .  60 ASP OD1  1 1 
        1  1025 1 1  60 ASP OD2  O -14.677   6.022  -6.974 1.00 . A A .  60 ASP OD2  1 1 
        1  1026 1 1  61 LYS C    C -12.697   4.981  -3.976 1.00 . A A .  61 LYS C    1 1 
        1  1027 1 1  61 LYS CA   C -11.789   5.874  -4.840 1.00 . A A .  61 LYS CA   1 1 
        1  1028 1 1  61 LYS CB   C -11.994   7.354  -4.451 1.00 . A A .  61 LYS CB   1 1 
        1  1029 1 1  61 LYS CD   C -11.385   8.443  -6.674 1.00 . A A .  61 LYS CD   1 1 
        1  1030 1 1  61 LYS CE   C -10.632   9.576  -7.362 1.00 . A A .  61 LYS CE   1 1 
        1  1031 1 1  61 LYS CG   C -11.083   8.357  -5.176 1.00 . A A .  61 LYS CG   1 1 
        1  1032 1 1  61 LYS H    H -12.504   6.383  -6.770 1.00 . A A .  61 LYS H    1 1 
        1  1033 1 1  61 LYS HA   H -10.757   5.600  -4.666 1.00 . A A .  61 LYS HA   1 1 
        1  1034 1 1  61 LYS HB2  H -13.020   7.627  -4.657 1.00 . A A .  61 LYS HB2  1 1 
        1  1035 1 1  61 LYS HB3  H -11.820   7.454  -3.388 1.00 . A A .  61 LYS HB3  1 1 
        1  1036 1 1  61 LYS HD2  H -11.100   7.511  -7.139 1.00 . A A .  61 LYS HD2  1 1 
        1  1037 1 1  61 LYS HD3  H -12.447   8.599  -6.808 1.00 . A A .  61 LYS HD3  1 1 
        1  1038 1 1  61 LYS HE2  H  -9.588   9.512  -7.096 1.00 . A A .  61 LYS HE2  1 1 
        1  1039 1 1  61 LYS HE3  H -10.734   9.461  -8.432 1.00 . A A .  61 LYS HE3  1 1 
        1  1040 1 1  61 LYS HG2  H -11.223   9.336  -4.737 1.00 . A A .  61 LYS HG2  1 1 
        1  1041 1 1  61 LYS HG3  H -10.055   8.050  -5.043 1.00 . A A .  61 LYS HG3  1 1 
        1  1042 1 1  61 LYS HZ1  H -12.185  10.902  -6.912 1.00 . A A .  61 LYS HZ1  1 1 
        1  1043 1 1  61 LYS HZ2  H -10.858  11.627  -7.673 1.00 . A A .  61 LYS HZ2  1 1 
        1  1044 1 1  61 LYS HZ3  H -10.762  11.194  -6.043 1.00 . A A .  61 LYS HZ3  1 1 
        1  1045 1 1  61 LYS N    N -12.081   5.662  -6.264 1.00 . A A .  61 LYS N    1 1 
        1  1046 1 1  61 LYS NZ   N -11.146  10.917  -6.970 1.00 . A A .  61 LYS NZ   1 1 
        1  1047 1 1  61 LYS O    O -12.246   4.339  -3.026 1.00 . A A .  61 LYS O    1 1 
        1  1048 1 1  62 GLU C    C -14.682   2.596  -3.936 1.00 . A A .  62 GLU C    1 1 
        1  1049 1 1  62 GLU CA   C -14.956   4.083  -3.651 1.00 . A A .  62 GLU CA   1 1 
        1  1050 1 1  62 GLU CB   C -16.378   4.459  -4.092 1.00 . A A .  62 GLU CB   1 1 
        1  1051 1 1  62 GLU CD   C -17.076   6.085  -2.252 1.00 . A A .  62 GLU CD   1 1 
        1  1052 1 1  62 GLU CG   C -16.778   5.892  -3.736 1.00 . A A .  62 GLU CG   1 1 
        1  1053 1 1  62 GLU H    H -14.283   5.502  -5.079 1.00 . A A .  62 GLU H    1 1 
        1  1054 1 1  62 GLU HA   H -14.861   4.256  -2.586 1.00 . A A .  62 GLU HA   1 1 
        1  1055 1 1  62 GLU HB2  H -16.452   4.345  -5.165 1.00 . A A .  62 GLU HB2  1 1 
        1  1056 1 1  62 GLU HB3  H -17.080   3.785  -3.621 1.00 . A A .  62 GLU HB3  1 1 
        1  1057 1 1  62 GLU HG2  H -15.970   6.556  -4.013 1.00 . A A .  62 GLU HG2  1 1 
        1  1058 1 1  62 GLU HG3  H -17.661   6.154  -4.304 1.00 . A A .  62 GLU HG3  1 1 
        1  1059 1 1  62 GLU N    N -13.980   4.937  -4.334 1.00 . A A .  62 GLU N    1 1 
        1  1060 1 1  62 GLU O    O -14.942   1.732  -3.096 1.00 . A A .  62 GLU O    1 1 
        1  1061 1 1  62 GLU OE1  O -16.132   6.296  -1.461 1.00 . A A .  62 GLU OE1  1 1 
        1  1062 1 1  62 GLU OE2  O -18.266   6.029  -1.872 1.00 . A A .  62 GLU OE2  1 1 
        1  1063 1 1  63 ASP C    C -12.503   0.527  -4.724 1.00 . A A .  63 ASP C    1 1 
        1  1064 1 1  63 ASP CA   C -13.773   0.940  -5.483 1.00 . A A .  63 ASP CA   1 1 
        1  1065 1 1  63 ASP CB   C -13.572   0.865  -7.003 1.00 . A A .  63 ASP CB   1 1 
        1  1066 1 1  63 ASP CG   C -13.420  -0.553  -7.524 1.00 . A A .  63 ASP CG   1 1 
        1  1067 1 1  63 ASP H    H -13.952   3.022  -5.756 1.00 . A A .  63 ASP H    1 1 
        1  1068 1 1  63 ASP HA   H -14.586   0.286  -5.195 1.00 . A A .  63 ASP HA   1 1 
        1  1069 1 1  63 ASP HB2  H -14.425   1.313  -7.492 1.00 . A A .  63 ASP HB2  1 1 
        1  1070 1 1  63 ASP HB3  H -12.685   1.425  -7.265 1.00 . A A .  63 ASP HB3  1 1 
        1  1071 1 1  63 ASP N    N -14.134   2.304  -5.118 1.00 . A A .  63 ASP N    1 1 
        1  1072 1 1  63 ASP O    O -12.283  -0.644  -4.432 1.00 . A A .  63 ASP O    1 1 
        1  1073 1 1  63 ASP OD1  O -14.399  -1.329  -7.457 1.00 . A A .  63 ASP OD1  1 1 
        1  1074 1 1  63 ASP OD2  O -12.336  -0.886  -8.031 1.00 . A A .  63 ASP OD2  1 1 
        1  1075 1 1  64 PHE C    C -10.857   0.866  -2.140 1.00 . A A .  64 PHE C    1 1 
        1  1076 1 1  64 PHE CA   C -10.495   1.317  -3.565 1.00 . A A .  64 PHE CA   1 1 
        1  1077 1 1  64 PHE CB   C  -9.679   2.617  -3.526 1.00 . A A .  64 PHE CB   1 1 
        1  1078 1 1  64 PHE CD1  C  -7.425   1.805  -2.760 1.00 . A A .  64 PHE CD1  1 1 
        1  1079 1 1  64 PHE CD2  C  -8.574   3.394  -1.402 1.00 . A A .  64 PHE CD2  1 1 
        1  1080 1 1  64 PHE CE1  C  -6.379   1.794  -1.859 1.00 . A A .  64 PHE CE1  1 1 
        1  1081 1 1  64 PHE CE2  C  -7.530   3.385  -0.502 1.00 . A A .  64 PHE CE2  1 1 
        1  1082 1 1  64 PHE CG   C  -8.535   2.605  -2.544 1.00 . A A .  64 PHE CG   1 1 
        1  1083 1 1  64 PHE CZ   C  -6.431   2.584  -0.729 1.00 . A A .  64 PHE CZ   1 1 
        1  1084 1 1  64 PHE H    H -11.890   2.423  -4.706 1.00 . A A .  64 PHE H    1 1 
        1  1085 1 1  64 PHE HA   H  -9.901   0.548  -4.030 1.00 . A A .  64 PHE HA   1 1 
        1  1086 1 1  64 PHE HB2  H  -9.267   2.801  -4.509 1.00 . A A .  64 PHE HB2  1 1 
        1  1087 1 1  64 PHE HB3  H -10.336   3.435  -3.265 1.00 . A A .  64 PHE HB3  1 1 
        1  1088 1 1  64 PHE HD1  H  -7.380   1.186  -3.645 1.00 . A A .  64 PHE HD1  1 1 
        1  1089 1 1  64 PHE HD2  H  -9.434   4.023  -1.220 1.00 . A A .  64 PHE HD2  1 1 
        1  1090 1 1  64 PHE HE1  H  -5.519   1.166  -2.038 1.00 . A A .  64 PHE HE1  1 1 
        1  1091 1 1  64 PHE HE2  H  -7.574   4.005   0.382 1.00 . A A .  64 PHE HE2  1 1 
        1  1092 1 1  64 PHE HZ   H  -5.613   2.576  -0.023 1.00 . A A .  64 PHE HZ   1 1 
        1  1093 1 1  64 PHE N    N -11.688   1.520  -4.385 1.00 . A A .  64 PHE N    1 1 
        1  1094 1 1  64 PHE O    O -10.426  -0.197  -1.687 1.00 . A A .  64 PHE O    1 1 
        1  1095 1 1  65 ARG C    C -12.674   0.020   0.147 1.00 . A A .  65 ARG C    1 1 
        1  1096 1 1  65 ARG CA   C -12.014   1.402  -0.049 1.00 . A A .  65 ARG CA   1 1 
        1  1097 1 1  65 ARG CB   C -12.921   2.516   0.492 1.00 . A A .  65 ARG CB   1 1 
        1  1098 1 1  65 ARG CD   C -15.089   3.796   0.294 1.00 . A A .  65 ARG CD   1 1 
        1  1099 1 1  65 ARG CG   C -14.290   2.589  -0.179 1.00 . A A .  65 ARG CG   1 1 
        1  1100 1 1  65 ARG CZ   C -15.634   4.885   2.406 1.00 . A A .  65 ARG CZ   1 1 
        1  1101 1 1  65 ARG H    H -12.030   2.470  -1.889 1.00 . A A .  65 ARG H    1 1 
        1  1102 1 1  65 ARG HA   H -11.092   1.413   0.514 1.00 . A A .  65 ARG HA   1 1 
        1  1103 1 1  65 ARG HB2  H -13.073   2.356   1.550 1.00 . A A .  65 ARG HB2  1 1 
        1  1104 1 1  65 ARG HB3  H -12.423   3.465   0.351 1.00 . A A .  65 ARG HB3  1 1 
        1  1105 1 1  65 ARG HD2  H -14.613   4.696  -0.071 1.00 . A A .  65 ARG HD2  1 1 
        1  1106 1 1  65 ARG HD3  H -16.089   3.731  -0.114 1.00 . A A .  65 ARG HD3  1 1 
        1  1107 1 1  65 ARG HE   H -14.852   3.093   2.259 1.00 . A A .  65 ARG HE   1 1 
        1  1108 1 1  65 ARG HG2  H -14.154   2.661  -1.249 1.00 . A A .  65 ARG HG2  1 1 
        1  1109 1 1  65 ARG HG3  H -14.843   1.690   0.053 1.00 . A A .  65 ARG HG3  1 1 
        1  1110 1 1  65 ARG HH11 H -16.120   5.918   0.776 1.00 . A A .  65 ARG HH11 1 1 
        1  1111 1 1  65 ARG HH12 H -16.455   6.695   2.284 1.00 . A A .  65 ARG HH12 1 1 
        1  1112 1 1  65 ARG HH21 H -15.275   4.065   4.180 1.00 . A A .  65 ARG HH21 1 1 
        1  1113 1 1  65 ARG HH22 H -15.966   5.653   4.210 1.00 . A A .  65 ARG HH22 1 1 
        1  1114 1 1  65 ARG N    N -11.665   1.669  -1.450 1.00 . A A .  65 ARG N    1 1 
        1  1115 1 1  65 ARG NE   N -15.176   3.860   1.749 1.00 . A A .  65 ARG NE   1 1 
        1  1116 1 1  65 ARG NH1  N -16.108   5.912   1.774 1.00 . A A .  65 ARG NH1  1 1 
        1  1117 1 1  65 ARG NH2  N -15.631   4.866   3.698 1.00 . A A .  65 ARG NH2  1 1 
        1  1118 1 1  65 ARG O    O -12.447  -0.641   1.162 1.00 . A A .  65 ARG O    1 1 
        1  1119 1 1  66 GLU C    C -13.146  -2.904  -0.814 1.00 . A A .  66 GLU C    1 1 
        1  1120 1 1  66 GLU CA   C -14.145  -1.731  -0.715 1.00 . A A .  66 GLU CA   1 1 
        1  1121 1 1  66 GLU CB   C -15.242  -1.881  -1.776 1.00 . A A .  66 GLU CB   1 1 
        1  1122 1 1  66 GLU CD   C -15.826  -2.316  -4.194 1.00 . A A .  66 GLU CD   1 1 
        1  1123 1 1  66 GLU CG   C -14.730  -1.959  -3.208 1.00 . A A .  66 GLU CG   1 1 
        1  1124 1 1  66 GLU H    H -13.623   0.128  -1.620 1.00 . A A .  66 GLU H    1 1 
        1  1125 1 1  66 GLU HA   H -14.609  -1.768   0.262 1.00 . A A .  66 GLU HA   1 1 
        1  1126 1 1  66 GLU HB2  H -15.803  -2.781  -1.569 1.00 . A A .  66 GLU HB2  1 1 
        1  1127 1 1  66 GLU HB3  H -15.909  -1.032  -1.704 1.00 . A A .  66 GLU HB3  1 1 
        1  1128 1 1  66 GLU HG2  H -14.315  -0.998  -3.483 1.00 . A A .  66 GLU HG2  1 1 
        1  1129 1 1  66 GLU HG3  H -13.953  -2.711  -3.262 1.00 . A A .  66 GLU HG3  1 1 
        1  1130 1 1  66 GLU N    N -13.473  -0.428  -0.825 1.00 . A A .  66 GLU N    1 1 
        1  1131 1 1  66 GLU O    O -13.299  -3.917  -0.129 1.00 . A A .  66 GLU O    1 1 
        1  1132 1 1  66 GLU OE1  O -16.590  -1.418  -4.599 1.00 . A A .  66 GLU OE1  1 1 
        1  1133 1 1  66 GLU OE2  O -15.940  -3.508  -4.559 1.00 . A A .  66 GLU OE2  1 1 
        1  1134 1 1  67 ASN C    C -10.229  -3.875  -0.483 1.00 . A A .  67 ASN C    1 1 
        1  1135 1 1  67 ASN CA   C -11.073  -3.797  -1.767 1.00 . A A .  67 ASN CA   1 1 
        1  1136 1 1  67 ASN CB   C -10.175  -3.556  -2.991 1.00 . A A .  67 ASN CB   1 1 
        1  1137 1 1  67 ASN CG   C -10.817  -4.044  -4.280 1.00 . A A .  67 ASN CG   1 1 
        1  1138 1 1  67 ASN H    H -12.068  -1.965  -2.225 1.00 . A A .  67 ASN H    1 1 
        1  1139 1 1  67 ASN HA   H -11.573  -4.749  -1.891 1.00 . A A .  67 ASN HA   1 1 
        1  1140 1 1  67 ASN HB2  H  -9.979  -2.497  -3.086 1.00 . A A .  67 ASN HB2  1 1 
        1  1141 1 1  67 ASN HB3  H  -9.238  -4.079  -2.856 1.00 . A A .  67 ASN HB3  1 1 
        1  1142 1 1  67 ASN HD21 H -11.567  -2.257  -4.635 1.00 . A A .  67 ASN HD21 1 1 
        1  1143 1 1  67 ASN HD22 H -11.929  -3.468  -5.805 1.00 . A A .  67 ASN HD22 1 1 
        1  1144 1 1  67 ASN N    N -12.121  -2.768  -1.661 1.00 . A A .  67 ASN N    1 1 
        1  1145 1 1  67 ASN ND2  N -11.505  -3.168  -4.974 1.00 . A A .  67 ASN ND2  1 1 
        1  1146 1 1  67 ASN O    O  -9.574  -4.882  -0.220 1.00 . A A .  67 ASN O    1 1 
        1  1147 1 1  67 ASN OD1  O -10.688  -5.204  -4.651 1.00 . A A .  67 ASN OD1  1 1 
        1  1148 1 1  68 ILE C    C -10.396  -3.696   2.603 1.00 . A A .  68 ILE C    1 1 
        1  1149 1 1  68 ILE CA   C  -9.602  -2.815   1.627 1.00 . A A .  68 ILE CA   1 1 
        1  1150 1 1  68 ILE CB   C  -9.499  -1.385   2.204 1.00 . A A .  68 ILE CB   1 1 
        1  1151 1 1  68 ILE CD1  C  -8.780   0.989   1.633 1.00 . A A .  68 ILE CD1  1 1 
        1  1152 1 1  68 ILE CG1  C  -8.830  -0.451   1.185 1.00 . A A .  68 ILE CG1  1 1 
        1  1153 1 1  68 ILE CG2  C  -8.729  -1.386   3.526 1.00 . A A .  68 ILE CG2  1 1 
        1  1154 1 1  68 ILE H    H -10.690  -1.989  -0.004 1.00 . A A .  68 ILE H    1 1 
        1  1155 1 1  68 ILE HA   H  -8.602  -3.217   1.517 1.00 . A A .  68 ILE HA   1 1 
        1  1156 1 1  68 ILE HB   H -10.500  -1.028   2.402 1.00 . A A .  68 ILE HB   1 1 
        1  1157 1 1  68 ILE HD11 H  -8.282   1.581   0.881 1.00 . A A .  68 ILE HD11 1 1 
        1  1158 1 1  68 ILE HD12 H  -8.233   1.056   2.561 1.00 . A A .  68 ILE HD12 1 1 
        1  1159 1 1  68 ILE HD13 H  -9.785   1.359   1.777 1.00 . A A .  68 ILE HD13 1 1 
        1  1160 1 1  68 ILE HG12 H  -7.816  -0.779   1.011 1.00 . A A .  68 ILE HG12 1 1 
        1  1161 1 1  68 ILE HG13 H  -9.380  -0.489   0.255 1.00 . A A .  68 ILE HG13 1 1 
        1  1162 1 1  68 ILE HG21 H  -7.727  -1.756   3.362 1.00 . A A .  68 ILE HG21 1 1 
        1  1163 1 1  68 ILE HG22 H  -9.235  -2.024   4.238 1.00 . A A .  68 ILE HG22 1 1 
        1  1164 1 1  68 ILE HG23 H  -8.681  -0.381   3.919 1.00 . A A .  68 ILE HG23 1 1 
        1  1165 1 1  68 ILE N    N -10.244  -2.807   0.308 1.00 . A A .  68 ILE N    1 1 
        1  1166 1 1  68 ILE O    O  -9.827  -4.421   3.420 1.00 . A A .  68 ILE O    1 1 
        1  1167 1 1  69 ARG C    C -12.366  -5.950   3.045 1.00 . A A .  69 ARG C    1 1 
        1  1168 1 1  69 ARG CA   C -12.620  -4.462   3.306 1.00 . A A .  69 ARG CA   1 1 
        1  1169 1 1  69 ARG CB   C -14.075  -4.096   3.003 1.00 . A A .  69 ARG CB   1 1 
        1  1170 1 1  69 ARG CD   C -15.754  -2.209   2.805 1.00 . A A .  69 ARG CD   1 1 
        1  1171 1 1  69 ARG CG   C -14.359  -2.623   3.248 1.00 . A A .  69 ARG CG   1 1 
        1  1172 1 1  69 ARG CZ   C -17.142  -0.214   3.031 1.00 . A A .  69 ARG CZ   1 1 
        1  1173 1 1  69 ARG H    H -12.112  -2.985   1.867 1.00 . A A .  69 ARG H    1 1 
        1  1174 1 1  69 ARG HA   H -12.417  -4.255   4.347 1.00 . A A .  69 ARG HA   1 1 
        1  1175 1 1  69 ARG HB2  H -14.290  -4.324   1.967 1.00 . A A .  69 ARG HB2  1 1 
        1  1176 1 1  69 ARG HB3  H -14.727  -4.681   3.638 1.00 . A A .  69 ARG HB3  1 1 
        1  1177 1 1  69 ARG HD2  H -15.844  -2.360   1.738 1.00 . A A .  69 ARG HD2  1 1 
        1  1178 1 1  69 ARG HD3  H -16.484  -2.815   3.322 1.00 . A A .  69 ARG HD3  1 1 
        1  1179 1 1  69 ARG HE   H -15.233  -0.287   3.442 1.00 . A A .  69 ARG HE   1 1 
        1  1180 1 1  69 ARG HG2  H -14.260  -2.420   4.305 1.00 . A A .  69 ARG HG2  1 1 
        1  1181 1 1  69 ARG HG3  H -13.632  -2.034   2.704 1.00 . A A .  69 ARG HG3  1 1 
        1  1182 1 1  69 ARG HH11 H -18.084  -1.759   2.196 1.00 . A A .  69 ARG HH11 1 1 
        1  1183 1 1  69 ARG HH12 H -19.051  -0.357   2.495 1.00 . A A .  69 ARG HH12 1 1 
        1  1184 1 1  69 ARG HH21 H -16.441   1.487   3.784 1.00 . A A .  69 ARG HH21 1 1 
        1  1185 1 1  69 ARG HH22 H -18.127   1.479   3.385 1.00 . A A .  69 ARG HH22 1 1 
        1  1186 1 1  69 ARG N    N -11.723  -3.625   2.500 1.00 . A A .  69 ARG N    1 1 
        1  1187 1 1  69 ARG NE   N -15.992  -0.807   3.113 1.00 . A A .  69 ARG NE   1 1 
        1  1188 1 1  69 ARG NH1  N -18.171  -0.823   2.532 1.00 . A A .  69 ARG NH1  1 1 
        1  1189 1 1  69 ARG NH2  N -17.246   1.011   3.425 1.00 . A A .  69 ARG NH2  1 1 
        1  1190 1 1  69 ARG O    O -12.490  -6.782   3.947 1.00 . A A .  69 ARG O    1 1 
        1  1191 1 1  70 GLU C    C -10.416  -8.052   2.411 1.00 . A A .  70 GLU C    1 1 
        1  1192 1 1  70 GLU CA   C -11.520  -7.600   1.440 1.00 . A A .  70 GLU CA   1 1 
        1  1193 1 1  70 GLU CB   C -10.983  -7.565  -0.004 1.00 . A A .  70 GLU CB   1 1 
        1  1194 1 1  70 GLU CD   C -11.515  -9.915  -0.773 1.00 . A A .  70 GLU CD   1 1 
        1  1195 1 1  70 GLU CG   C -11.757  -8.431  -0.987 1.00 . A A .  70 GLU CG   1 1 
        1  1196 1 1  70 GLU H    H -12.079  -5.590   1.097 1.00 . A A .  70 GLU H    1 1 
        1  1197 1 1  70 GLU HA   H -12.350  -8.290   1.500 1.00 . A A .  70 GLU HA   1 1 
        1  1198 1 1  70 GLU HB2  H -11.017  -6.545  -0.361 1.00 . A A .  70 GLU HB2  1 1 
        1  1199 1 1  70 GLU HB3  H  -9.952  -7.894  -0.005 1.00 . A A .  70 GLU HB3  1 1 
        1  1200 1 1  70 GLU HG2  H -12.812  -8.229  -0.871 1.00 . A A .  70 GLU HG2  1 1 
        1  1201 1 1  70 GLU HG3  H -11.453  -8.169  -1.988 1.00 . A A .  70 GLU HG3  1 1 
        1  1202 1 1  70 GLU N    N -12.005  -6.268   1.801 1.00 . A A .  70 GLU N    1 1 
        1  1203 1 1  70 GLU O    O -10.497  -9.122   3.009 1.00 . A A .  70 GLU O    1 1 
        1  1204 1 1  70 GLU OE1  O -10.391 -10.384  -1.057 1.00 . A A .  70 GLU OE1  1 1 
        1  1205 1 1  70 GLU OE2  O -12.439 -10.619  -0.312 1.00 . A A .  70 GLU OE2  1 1 
        1  1206 1 1  71 ILE C    C  -8.754  -7.795   4.912 1.00 . A A .  71 ILE C    1 1 
        1  1207 1 1  71 ILE CA   C  -8.281  -7.495   3.479 1.00 . A A .  71 ILE CA   1 1 
        1  1208 1 1  71 ILE CB   C  -7.282  -6.314   3.514 1.00 . A A .  71 ILE CB   1 1 
        1  1209 1 1  71 ILE CD1  C  -5.962  -4.717   2.017 1.00 . A A .  71 ILE CD1  1 1 
        1  1210 1 1  71 ILE CG1  C  -6.845  -5.943   2.087 1.00 . A A .  71 ILE CG1  1 1 
        1  1211 1 1  71 ILE CG2  C  -6.071  -6.652   4.386 1.00 . A A .  71 ILE CG2  1 1 
        1  1212 1 1  71 ILE H    H  -9.418  -6.351   2.098 1.00 . A A .  71 ILE H    1 1 
        1  1213 1 1  71 ILE HA   H  -7.766  -8.364   3.090 1.00 . A A .  71 ILE HA   1 1 
        1  1214 1 1  71 ILE HB   H  -7.784  -5.465   3.959 1.00 . A A .  71 ILE HB   1 1 
        1  1215 1 1  71 ILE HD11 H  -6.484  -3.869   2.435 1.00 . A A .  71 ILE HD11 1 1 
        1  1216 1 1  71 ILE HD12 H  -5.710  -4.514   0.986 1.00 . A A .  71 ILE HD12 1 1 
        1  1217 1 1  71 ILE HD13 H  -5.055  -4.894   2.578 1.00 . A A .  71 ILE HD13 1 1 
        1  1218 1 1  71 ILE HG12 H  -6.297  -6.768   1.657 1.00 . A A .  71 ILE HG12 1 1 
        1  1219 1 1  71 ILE HG13 H  -7.724  -5.752   1.487 1.00 . A A .  71 ILE HG13 1 1 
        1  1220 1 1  71 ILE HG21 H  -5.389  -5.813   4.398 1.00 . A A .  71 ILE HG21 1 1 
        1  1221 1 1  71 ILE HG22 H  -5.565  -7.519   3.985 1.00 . A A .  71 ILE HG22 1 1 
        1  1222 1 1  71 ILE HG23 H  -6.398  -6.862   5.394 1.00 . A A .  71 ILE HG23 1 1 
        1  1223 1 1  71 ILE N    N  -9.407  -7.202   2.584 1.00 . A A .  71 ILE N    1 1 
        1  1224 1 1  71 ILE O    O  -8.398  -8.826   5.487 1.00 . A A .  71 ILE O    1 1 
        1  1225 1 1  72 TRP C    C -10.867  -8.388   6.986 1.00 . A A .  72 TRP C    1 1 
        1  1226 1 1  72 TRP CA   C -10.097  -7.066   6.841 1.00 . A A .  72 TRP CA   1 1 
        1  1227 1 1  72 TRP CB   C -11.032  -5.903   7.212 1.00 . A A .  72 TRP CB   1 1 
        1  1228 1 1  72 TRP CD1  C -11.053  -3.483   6.356 1.00 . A A .  72 TRP CD1  1 1 
        1  1229 1 1  72 TRP CD2  C  -9.152  -4.062   7.392 1.00 . A A .  72 TRP CD2  1 1 
        1  1230 1 1  72 TRP CE2  C  -9.047  -2.723   6.967 1.00 . A A .  72 TRP CE2  1 1 
        1  1231 1 1  72 TRP CE3  C  -8.070  -4.638   8.067 1.00 . A A .  72 TRP CE3  1 1 
        1  1232 1 1  72 TRP CG   C -10.448  -4.533   6.989 1.00 . A A .  72 TRP CG   1 1 
        1  1233 1 1  72 TRP CH2  C  -6.871  -2.543   7.857 1.00 . A A .  72 TRP CH2  1 1 
        1  1234 1 1  72 TRP CZ2  C  -7.910  -1.954   7.198 1.00 . A A .  72 TRP CZ2  1 1 
        1  1235 1 1  72 TRP CZ3  C  -6.942  -3.872   8.293 1.00 . A A .  72 TRP CZ3  1 1 
        1  1236 1 1  72 TRP H    H  -9.814  -6.093   4.966 1.00 . A A .  72 TRP H    1 1 
        1  1237 1 1  72 TRP HA   H  -9.258  -7.073   7.524 1.00 . A A .  72 TRP HA   1 1 
        1  1238 1 1  72 TRP HB2  H -11.934  -5.976   6.621 1.00 . A A .  72 TRP HB2  1 1 
        1  1239 1 1  72 TRP HB3  H -11.294  -5.984   8.259 1.00 . A A .  72 TRP HB3  1 1 
        1  1240 1 1  72 TRP HD1  H -12.047  -3.518   5.934 1.00 . A A .  72 TRP HD1  1 1 
        1  1241 1 1  72 TRP HE1  H -10.429  -1.523   5.942 1.00 . A A .  72 TRP HE1  1 1 
        1  1242 1 1  72 TRP HE3  H  -8.106  -5.662   8.410 1.00 . A A .  72 TRP HE3  1 1 
        1  1243 1 1  72 TRP HH2  H  -5.972  -1.981   8.055 1.00 . A A .  72 TRP HH2  1 1 
        1  1244 1 1  72 TRP HZ2  H  -7.838  -0.927   6.872 1.00 . A A .  72 TRP HZ2  1 1 
        1  1245 1 1  72 TRP HZ3  H  -6.096  -4.299   8.811 1.00 . A A .  72 TRP HZ3  1 1 
        1  1246 1 1  72 TRP N    N  -9.568  -6.895   5.476 1.00 . A A .  72 TRP N    1 1 
        1  1247 1 1  72 TRP NE1  N -10.219  -2.394   6.340 1.00 . A A .  72 TRP NE1  1 1 
        1  1248 1 1  72 TRP O    O -10.866  -9.012   8.050 1.00 . A A .  72 TRP O    1 1 
        1  1249 1 1  73 GLU C    C -11.497 -11.275   5.590 1.00 . A A .  73 GLU C    1 1 
        1  1250 1 1  73 GLU CA   C -12.341 -10.022   5.904 1.00 . A A .  73 GLU CA   1 1 
        1  1251 1 1  73 GLU CB   C -13.482  -9.862   4.884 1.00 . A A .  73 GLU CB   1 1 
        1  1252 1 1  73 GLU CD   C -15.697 -10.717   4.002 1.00 . A A .  73 GLU CD   1 1 
        1  1253 1 1  73 GLU CG   C -14.471 -11.022   4.851 1.00 . A A .  73 GLU CG   1 1 
        1  1254 1 1  73 GLU H    H -11.482  -8.257   5.090 1.00 . A A .  73 GLU H    1 1 
        1  1255 1 1  73 GLU HA   H -12.771 -10.135   6.889 1.00 . A A .  73 GLU HA   1 1 
        1  1256 1 1  73 GLU HB2  H -14.030  -8.961   5.122 1.00 . A A .  73 GLU HB2  1 1 
        1  1257 1 1  73 GLU HB3  H -13.052  -9.755   3.897 1.00 . A A .  73 GLU HB3  1 1 
        1  1258 1 1  73 GLU HG2  H -13.973 -11.892   4.444 1.00 . A A .  73 GLU HG2  1 1 
        1  1259 1 1  73 GLU HG3  H -14.790 -11.236   5.862 1.00 . A A .  73 GLU HG3  1 1 
        1  1260 1 1  73 GLU N    N -11.529  -8.799   5.909 1.00 . A A .  73 GLU N    1 1 
        1  1261 1 1  73 GLU O    O -11.877 -12.395   5.939 1.00 . A A .  73 GLU O    1 1 
        1  1262 1 1  73 GLU OE1  O -15.675 -10.998   2.787 1.00 . A A .  73 GLU OE1  1 1 
        1  1263 1 1  73 GLU OE2  O -16.690 -10.190   4.547 1.00 . A A .  73 GLU OE2  1 1 
        1  1264 1 1  74 ARG C    C  -8.416 -12.522   5.643 1.00 . A A .  74 ARG C    1 1 
        1  1265 1 1  74 ARG CA   C  -9.462 -12.193   4.559 1.00 . A A .  74 ARG CA   1 1 
        1  1266 1 1  74 ARG CB   C  -8.726 -11.862   3.249 1.00 . A A .  74 ARG CB   1 1 
        1  1267 1 1  74 ARG CD   C -10.104 -13.122   1.528 1.00 . A A .  74 ARG CD   1 1 
        1  1268 1 1  74 ARG CG   C  -9.622 -11.760   2.018 1.00 . A A .  74 ARG CG   1 1 
        1  1269 1 1  74 ARG CZ   C -11.134 -13.931  -0.546 1.00 . A A .  74 ARG CZ   1 1 
        1  1270 1 1  74 ARG H    H -10.092 -10.162   4.702 1.00 . A A .  74 ARG H    1 1 
        1  1271 1 1  74 ARG HA   H -10.079 -13.066   4.399 1.00 . A A .  74 ARG HA   1 1 
        1  1272 1 1  74 ARG HB2  H  -8.218 -10.916   3.370 1.00 . A A .  74 ARG HB2  1 1 
        1  1273 1 1  74 ARG HB3  H  -7.986 -12.630   3.064 1.00 . A A .  74 ARG HB3  1 1 
        1  1274 1 1  74 ARG HD2  H  -9.243 -13.734   1.295 1.00 . A A .  74 ARG HD2  1 1 
        1  1275 1 1  74 ARG HD3  H -10.681 -13.594   2.310 1.00 . A A .  74 ARG HD3  1 1 
        1  1276 1 1  74 ARG HE   H -11.368 -12.126   0.187 1.00 . A A .  74 ARG HE   1 1 
        1  1277 1 1  74 ARG HG2  H -10.482 -11.156   2.263 1.00 . A A .  74 ARG HG2  1 1 
        1  1278 1 1  74 ARG HG3  H  -9.065 -11.281   1.224 1.00 . A A .  74 ARG HG3  1 1 
        1  1279 1 1  74 ARG HH11 H  -9.983 -15.278   0.361 1.00 . A A .  74 ARG HH11 1 1 
        1  1280 1 1  74 ARG HH12 H -10.737 -15.802  -1.100 1.00 . A A .  74 ARG HH12 1 1 
        1  1281 1 1  74 ARG HH21 H -12.328 -12.806  -1.668 1.00 . A A .  74 ARG HH21 1 1 
        1  1282 1 1  74 ARG HH22 H -12.054 -14.413  -2.241 1.00 . A A .  74 ARG HH22 1 1 
        1  1283 1 1  74 ARG N    N -10.348 -11.078   4.942 1.00 . A A .  74 ARG N    1 1 
        1  1284 1 1  74 ARG NE   N -10.933 -12.989   0.334 1.00 . A A .  74 ARG NE   1 1 
        1  1285 1 1  74 ARG NH1  N -10.575 -15.093  -0.419 1.00 . A A .  74 ARG NH1  1 1 
        1  1286 1 1  74 ARG NH2  N -11.896 -13.699  -1.563 1.00 . A A .  74 ARG NH2  1 1 
        1  1287 1 1  74 ARG O    O  -8.284 -13.676   6.062 1.00 . A A .  74 ARG O    1 1 
        1  1288 1 1  75 TYR C    C  -6.543 -10.981   8.271 1.00 . A A .  75 TYR C    1 1 
        1  1289 1 1  75 TYR CA   C  -6.478 -11.756   6.941 1.00 . A A .  75 TYR CA   1 1 
        1  1290 1 1  75 TYR CB   C  -5.190 -11.371   6.190 1.00 . A A .  75 TYR CB   1 1 
        1  1291 1 1  75 TYR CD1  C  -5.275 -13.152   4.395 1.00 . A A .  75 TYR CD1  1 1 
        1  1292 1 1  75 TYR CD2  C  -5.093 -10.871   3.706 1.00 . A A .  75 TYR CD2  1 1 
        1  1293 1 1  75 TYR CE1  C  -5.289 -13.555   3.074 1.00 . A A .  75 TYR CE1  1 1 
        1  1294 1 1  75 TYR CE2  C  -5.101 -11.270   2.380 1.00 . A A .  75 TYR CE2  1 1 
        1  1295 1 1  75 TYR CG   C  -5.178 -11.807   4.736 1.00 . A A .  75 TYR CG   1 1 
        1  1296 1 1  75 TYR CZ   C  -5.205 -12.613   2.071 1.00 . A A .  75 TYR CZ   1 1 
        1  1297 1 1  75 TYR H    H  -7.883 -10.595   5.833 1.00 . A A .  75 TYR H    1 1 
        1  1298 1 1  75 TYR HA   H  -6.441 -12.814   7.163 1.00 . A A .  75 TYR HA   1 1 
        1  1299 1 1  75 TYR HB2  H  -5.073 -10.296   6.215 1.00 . A A .  75 TYR HB2  1 1 
        1  1300 1 1  75 TYR HB3  H  -4.342 -11.829   6.681 1.00 . A A .  75 TYR HB3  1 1 
        1  1301 1 1  75 TYR HD1  H  -5.343 -13.890   5.182 1.00 . A A .  75 TYR HD1  1 1 
        1  1302 1 1  75 TYR HD2  H  -5.004  -9.817   3.955 1.00 . A A .  75 TYR HD2  1 1 
        1  1303 1 1  75 TYR HE1  H  -5.367 -14.605   2.832 1.00 . A A .  75 TYR HE1  1 1 
        1  1304 1 1  75 TYR HE2  H  -5.034 -10.532   1.595 1.00 . A A .  75 TYR HE2  1 1 
        1  1305 1 1  75 TYR HH   H  -4.449 -12.666   0.296 1.00 . A A .  75 TYR HH   1 1 
        1  1306 1 1  75 TYR N    N  -7.652 -11.515   6.082 1.00 . A A .  75 TYR N    1 1 
        1  1307 1 1  75 TYR O    O  -6.118  -9.828   8.343 1.00 . A A .  75 TYR O    1 1 
        1  1308 1 1  75 TYR OH   O  -5.223 -13.018   0.755 1.00 . A A .  75 TYR OH   1 1 
        1  1309 1 1  76 PRO C    C  -5.641 -11.004  11.315 1.00 . A A .  76 PRO C    1 1 
        1  1310 1 1  76 PRO CA   C  -7.052 -11.005  10.695 1.00 . A A .  76 PRO CA   1 1 
        1  1311 1 1  76 PRO CB   C  -8.003 -11.907  11.495 1.00 . A A .  76 PRO CB   1 1 
        1  1312 1 1  76 PRO CD   C  -7.764 -12.909   9.331 1.00 . A A .  76 PRO CD   1 1 
        1  1313 1 1  76 PRO CG   C  -7.952 -13.224  10.794 1.00 . A A .  76 PRO CG   1 1 
        1  1314 1 1  76 PRO HA   H  -7.435  -9.993  10.682 1.00 . A A .  76 PRO HA   1 1 
        1  1315 1 1  76 PRO HB2  H  -7.662 -11.987  12.519 1.00 . A A .  76 PRO HB2  1 1 
        1  1316 1 1  76 PRO HB3  H  -9.000 -11.491  11.477 1.00 . A A .  76 PRO HB3  1 1 
        1  1317 1 1  76 PRO HD2  H  -7.152 -13.663   8.857 1.00 . A A .  76 PRO HD2  1 1 
        1  1318 1 1  76 PRO HD3  H  -8.721 -12.834   8.835 1.00 . A A .  76 PRO HD3  1 1 
        1  1319 1 1  76 PRO HG2  H  -7.119 -13.807  11.164 1.00 . A A .  76 PRO HG2  1 1 
        1  1320 1 1  76 PRO HG3  H  -8.879 -13.759  10.946 1.00 . A A .  76 PRO HG3  1 1 
        1  1321 1 1  76 PRO N    N  -7.075 -11.602   9.345 1.00 . A A .  76 PRO N    1 1 
        1  1322 1 1  76 PRO O    O  -5.368 -10.267  12.263 1.00 . A A .  76 PRO O    1 1 
        1  1323 1 1  77 GLN C    C  -2.616 -10.567  10.966 1.00 . A A .  77 GLN C    1 1 
        1  1324 1 1  77 GLN CA   C  -3.348 -11.902  11.212 1.00 . A A .  77 GLN CA   1 1 
        1  1325 1 1  77 GLN CB   C  -2.612 -13.049  10.488 1.00 . A A .  77 GLN CB   1 1 
        1  1326 1 1  77 GLN CD   C  -1.879 -14.076   8.275 1.00 . A A .  77 GLN CD   1 1 
        1  1327 1 1  77 GLN CG   C  -2.605 -12.926   8.963 1.00 . A A .  77 GLN CG   1 1 
        1  1328 1 1  77 GLN H    H  -5.050 -12.452  10.063 1.00 . A A .  77 GLN H    1 1 
        1  1329 1 1  77 GLN HA   H  -3.349 -12.105  12.274 1.00 . A A .  77 GLN HA   1 1 
        1  1330 1 1  77 GLN HB2  H  -1.586 -13.073  10.829 1.00 . A A .  77 GLN HB2  1 1 
        1  1331 1 1  77 GLN HB3  H  -3.088 -13.984  10.749 1.00 . A A .  77 GLN HB3  1 1 
        1  1332 1 1  77 GLN HE21 H  -3.550 -15.131   8.190 1.00 . A A .  77 GLN HE21 1 1 
        1  1333 1 1  77 GLN HE22 H  -2.148 -15.881   7.513 1.00 . A A .  77 GLN HE22 1 1 
        1  1334 1 1  77 GLN HG2  H  -3.627 -12.906   8.612 1.00 . A A .  77 GLN HG2  1 1 
        1  1335 1 1  77 GLN HG3  H  -2.118 -11.999   8.692 1.00 . A A .  77 GLN HG3  1 1 
        1  1336 1 1  77 GLN N    N  -4.751 -11.843  10.769 1.00 . A A .  77 GLN N    1 1 
        1  1337 1 1  77 GLN NE2  N  -2.597 -15.134   7.963 1.00 . A A .  77 GLN NE2  1 1 
        1  1338 1 1  77 GLN O    O  -1.712 -10.196  11.715 1.00 . A A .  77 GLN O    1 1 
        1  1339 1 1  77 GLN OE1  O  -0.679 -14.013   8.023 1.00 . A A .  77 GLN OE1  1 1 
        1  1340 1 1  78 LEU C    C  -0.957  -8.654   9.111 1.00 . A A .  78 LEU C    1 1 
        1  1341 1 1  78 LEU CA   C  -2.441  -8.566   9.523 1.00 . A A .  78 LEU CA   1 1 
        1  1342 1 1  78 LEU CB   C  -2.627  -7.523  10.639 1.00 . A A .  78 LEU CB   1 1 
        1  1343 1 1  78 LEU CD1  C  -4.144  -6.011  11.969 1.00 . A A .  78 LEU CD1  1 1 
        1  1344 1 1  78 LEU CD2  C  -4.832  -6.762   9.668 1.00 . A A .  78 LEU CD2  1 1 
        1  1345 1 1  78 LEU CG   C  -4.087  -7.145  10.948 1.00 . A A .  78 LEU CG   1 1 
        1  1346 1 1  78 LEU H    H  -3.750 -10.224   9.362 1.00 . A A .  78 LEU H    1 1 
        1  1347 1 1  78 LEU HA   H  -2.995  -8.229   8.658 1.00 . A A .  78 LEU HA   1 1 
        1  1348 1 1  78 LEU HB2  H  -2.177  -7.911  11.544 1.00 . A A .  78 LEU HB2  1 1 
        1  1349 1 1  78 LEU HB3  H  -2.100  -6.624  10.354 1.00 . A A .  78 LEU HB3  1 1 
        1  1350 1 1  78 LEU HD11 H  -5.174  -5.768  12.183 1.00 . A A .  78 LEU HD11 1 1 
        1  1351 1 1  78 LEU HD12 H  -3.643  -5.139  11.572 1.00 . A A .  78 LEU HD12 1 1 
        1  1352 1 1  78 LEU HD13 H  -3.653  -6.323  12.880 1.00 . A A .  78 LEU HD13 1 1 
        1  1353 1 1  78 LEU HD21 H  -5.851  -6.497   9.910 1.00 . A A .  78 LEU HD21 1 1 
        1  1354 1 1  78 LEU HD22 H  -4.832  -7.601   8.986 1.00 . A A .  78 LEU HD22 1 1 
        1  1355 1 1  78 LEU HD23 H  -4.343  -5.919   9.200 1.00 . A A .  78 LEU HD23 1 1 
        1  1356 1 1  78 LEU HG   H  -4.587  -8.001  11.380 1.00 . A A .  78 LEU HG   1 1 
        1  1357 1 1  78 LEU N    N  -3.021  -9.865   9.905 1.00 . A A .  78 LEU N    1 1 
        1  1358 1 1  78 LEU O    O  -0.300  -7.628   8.941 1.00 . A A .  78 LEU O    1 1 
        1  1359 1 1  79 ASP C    C   0.934  -9.782   6.837 1.00 . A A .  79 ASP C    1 1 
        1  1360 1 1  79 ASP CA   C   0.915 -10.050   8.357 1.00 . A A .  79 ASP CA   1 1 
        1  1361 1 1  79 ASP CB   C   1.419 -11.472   8.626 1.00 . A A .  79 ASP CB   1 1 
        1  1362 1 1  79 ASP CG   C   1.569 -11.784  10.102 1.00 . A A .  79 ASP CG   1 1 
        1  1363 1 1  79 ASP H    H  -0.960 -10.656   9.160 1.00 . A A .  79 ASP H    1 1 
        1  1364 1 1  79 ASP HA   H   1.573  -9.343   8.843 1.00 . A A .  79 ASP HA   1 1 
        1  1365 1 1  79 ASP HB2  H   0.724 -12.180   8.197 1.00 . A A .  79 ASP HB2  1 1 
        1  1366 1 1  79 ASP HB3  H   2.383 -11.596   8.152 1.00 . A A .  79 ASP HB3  1 1 
        1  1367 1 1  79 ASP N    N  -0.439  -9.868   8.911 1.00 . A A .  79 ASP N    1 1 
        1  1368 1 1  79 ASP O    O   1.610 -10.482   6.079 1.00 . A A .  79 ASP O    1 1 
        1  1369 1 1  79 ASP OD1  O   0.560 -12.134  10.746 1.00 . A A .  79 ASP OD1  1 1 
        1  1370 1 1  79 ASP OD2  O   2.707 -11.719  10.617 1.00 . A A .  79 ASP OD2  1 1 
        1  1371 1 1  80 VAL C    C   0.550  -6.975   4.724 1.00 . A A .  80 VAL C    1 1 
        1  1372 1 1  80 VAL CA   C   0.108  -8.424   4.979 1.00 . A A .  80 VAL CA   1 1 
        1  1373 1 1  80 VAL CB   C  -1.332  -8.624   4.434 1.00 . A A .  80 VAL CB   1 1 
        1  1374 1 1  80 VAL CG1  C  -1.792 -10.063   4.648 1.00 . A A .  80 VAL CG1  1 1 
        1  1375 1 1  80 VAL CG2  C  -2.312  -7.646   5.083 1.00 . A A .  80 VAL CG2  1 1 
        1  1376 1 1  80 VAL H    H  -0.318  -8.235   7.039 1.00 . A A .  80 VAL H    1 1 
        1  1377 1 1  80 VAL HA   H   0.767  -9.088   4.434 1.00 . A A .  80 VAL HA   1 1 
        1  1378 1 1  80 VAL HB   H  -1.320  -8.433   3.369 1.00 . A A .  80 VAL HB   1 1 
        1  1379 1 1  80 VAL HG11 H  -2.775 -10.194   4.221 1.00 . A A .  80 VAL HG11 1 1 
        1  1380 1 1  80 VAL HG12 H  -1.829 -10.278   5.707 1.00 . A A .  80 VAL HG12 1 1 
        1  1381 1 1  80 VAL HG13 H  -1.099 -10.739   4.169 1.00 . A A .  80 VAL HG13 1 1 
        1  1382 1 1  80 VAL HG21 H  -2.012  -6.632   4.857 1.00 . A A .  80 VAL HG21 1 1 
        1  1383 1 1  80 VAL HG22 H  -2.313  -7.791   6.154 1.00 . A A .  80 VAL HG22 1 1 
        1  1384 1 1  80 VAL HG23 H  -3.306  -7.820   4.695 1.00 . A A .  80 VAL HG23 1 1 
        1  1385 1 1  80 VAL N    N   0.188  -8.769   6.395 1.00 . A A .  80 VAL N    1 1 
        1  1386 1 1  80 VAL O    O   0.189  -6.058   5.464 1.00 . A A .  80 VAL O    1 1 
        1  1387 1 1  81 VAL C    C   0.930  -5.005   2.034 1.00 . A A .  81 VAL C    1 1 
        1  1388 1 1  81 VAL CA   C   1.748  -5.439   3.256 1.00 . A A .  81 VAL CA   1 1 
        1  1389 1 1  81 VAL CB   C   3.256  -5.374   2.916 1.00 . A A .  81 VAL CB   1 1 
        1  1390 1 1  81 VAL CG1  C   3.653  -3.962   2.486 1.00 . A A .  81 VAL CG1  1 1 
        1  1391 1 1  81 VAL CG2  C   4.099  -5.838   4.102 1.00 . A A .  81 VAL CG2  1 1 
        1  1392 1 1  81 VAL H    H   1.690  -7.557   3.193 1.00 . A A .  81 VAL H    1 1 
        1  1393 1 1  81 VAL HA   H   1.553  -4.752   4.072 1.00 . A A .  81 VAL HA   1 1 
        1  1394 1 1  81 VAL HB   H   3.444  -6.044   2.086 1.00 . A A .  81 VAL HB   1 1 
        1  1395 1 1  81 VAL HG11 H   4.712  -3.931   2.271 1.00 . A A .  81 VAL HG11 1 1 
        1  1396 1 1  81 VAL HG12 H   3.427  -3.267   3.280 1.00 . A A .  81 VAL HG12 1 1 
        1  1397 1 1  81 VAL HG13 H   3.099  -3.685   1.599 1.00 . A A .  81 VAL HG13 1 1 
        1  1398 1 1  81 VAL HG21 H   5.145  -5.814   3.833 1.00 . A A .  81 VAL HG21 1 1 
        1  1399 1 1  81 VAL HG22 H   3.821  -6.847   4.371 1.00 . A A .  81 VAL HG22 1 1 
        1  1400 1 1  81 VAL HG23 H   3.931  -5.182   4.945 1.00 . A A .  81 VAL HG23 1 1 
        1  1401 1 1  81 VAL N    N   1.351  -6.779   3.684 1.00 . A A .  81 VAL N    1 1 
        1  1402 1 1  81 VAL O    O   1.022  -5.607   0.961 1.00 . A A .  81 VAL O    1 1 
        1  1403 1 1  82 VAL C    C  -0.034  -2.398   0.307 1.00 . A A .  82 VAL C    1 1 
        1  1404 1 1  82 VAL CA   C  -0.747  -3.476   1.135 1.00 . A A .  82 VAL CA   1 1 
        1  1405 1 1  82 VAL CB   C  -2.059  -2.888   1.712 1.00 . A A .  82 VAL CB   1 1 
        1  1406 1 1  82 VAL CG1  C  -3.043  -2.529   0.598 1.00 . A A .  82 VAL CG1  1 1 
        1  1407 1 1  82 VAL CG2  C  -2.686  -3.861   2.708 1.00 . A A .  82 VAL CG2  1 1 
        1  1408 1 1  82 VAL H    H   0.095  -3.526   3.082 1.00 . A A .  82 VAL H    1 1 
        1  1409 1 1  82 VAL HA   H  -1.000  -4.308   0.491 1.00 . A A .  82 VAL HA   1 1 
        1  1410 1 1  82 VAL HB   H  -1.813  -1.978   2.245 1.00 . A A .  82 VAL HB   1 1 
        1  1411 1 1  82 VAL HG11 H  -2.595  -1.796  -0.057 1.00 . A A .  82 VAL HG11 1 1 
        1  1412 1 1  82 VAL HG12 H  -3.945  -2.120   1.031 1.00 . A A .  82 VAL HG12 1 1 
        1  1413 1 1  82 VAL HG13 H  -3.288  -3.417   0.032 1.00 . A A .  82 VAL HG13 1 1 
        1  1414 1 1  82 VAL HG21 H  -3.600  -3.438   3.098 1.00 . A A .  82 VAL HG21 1 1 
        1  1415 1 1  82 VAL HG22 H  -1.999  -4.040   3.522 1.00 . A A .  82 VAL HG22 1 1 
        1  1416 1 1  82 VAL HG23 H  -2.907  -4.796   2.212 1.00 . A A .  82 VAL HG23 1 1 
        1  1417 1 1  82 VAL N    N   0.116  -3.972   2.207 1.00 . A A .  82 VAL N    1 1 
        1  1418 1 1  82 VAL O    O   0.548  -1.472   0.859 1.00 . A A .  82 VAL O    1 1 
        1  1419 1 1  83 ILE C    C  -0.446  -0.996  -2.930 1.00 . A A .  83 ILE C    1 1 
        1  1420 1 1  83 ILE CA   C   0.557  -1.536  -1.903 1.00 . A A .  83 ILE CA   1 1 
        1  1421 1 1  83 ILE CB   C   1.775  -2.138  -2.653 1.00 . A A .  83 ILE CB   1 1 
        1  1422 1 1  83 ILE CD1  C   3.950  -3.442  -2.321 1.00 . A A .  83 ILE CD1  1 1 
        1  1423 1 1  83 ILE CG1  C   2.760  -2.779  -1.660 1.00 . A A .  83 ILE CG1  1 1 
        1  1424 1 1  83 ILE CG2  C   2.478  -1.060  -3.481 1.00 . A A .  83 ILE CG2  1 1 
        1  1425 1 1  83 ILE H    H  -0.541  -3.292  -1.406 1.00 . A A .  83 ILE H    1 1 
        1  1426 1 1  83 ILE HA   H   0.908  -0.712  -1.295 1.00 . A A .  83 ILE HA   1 1 
        1  1427 1 1  83 ILE HB   H   1.412  -2.899  -3.331 1.00 . A A .  83 ILE HB   1 1 
        1  1428 1 1  83 ILE HD11 H   3.608  -4.240  -2.965 1.00 . A A .  83 ILE HD11 1 1 
        1  1429 1 1  83 ILE HD12 H   4.601  -3.849  -1.563 1.00 . A A .  83 ILE HD12 1 1 
        1  1430 1 1  83 ILE HD13 H   4.492  -2.713  -2.907 1.00 . A A .  83 ILE HD13 1 1 
        1  1431 1 1  83 ILE HG12 H   3.138  -2.019  -0.992 1.00 . A A .  83 ILE HG12 1 1 
        1  1432 1 1  83 ILE HG13 H   2.242  -3.532  -1.082 1.00 . A A .  83 ILE HG13 1 1 
        1  1433 1 1  83 ILE HG21 H   3.315  -1.496  -4.007 1.00 . A A .  83 ILE HG21 1 1 
        1  1434 1 1  83 ILE HG22 H   2.834  -0.276  -2.828 1.00 . A A .  83 ILE HG22 1 1 
        1  1435 1 1  83 ILE HG23 H   1.782  -0.643  -4.195 1.00 . A A .  83 ILE HG23 1 1 
        1  1436 1 1  83 ILE N    N  -0.075  -2.523  -1.015 1.00 . A A .  83 ILE N    1 1 
        1  1437 1 1  83 ILE O    O  -1.157  -1.762  -3.576 1.00 . A A .  83 ILE O    1 1 
        1  1438 1 1  84 VAL C    C  -0.690   1.794  -5.069 1.00 . A A .  84 VAL C    1 1 
        1  1439 1 1  84 VAL CA   C  -1.435   0.969  -4.007 1.00 . A A .  84 VAL CA   1 1 
        1  1440 1 1  84 VAL CB   C  -2.425   1.890  -3.253 1.00 . A A .  84 VAL CB   1 1 
        1  1441 1 1  84 VAL CG1  C  -3.556   2.347  -4.175 1.00 . A A .  84 VAL CG1  1 1 
        1  1442 1 1  84 VAL CG2  C  -2.975   1.187  -2.013 1.00 . A A .  84 VAL CG2  1 1 
        1  1443 1 1  84 VAL H    H   0.109   0.886  -2.552 1.00 . A A .  84 VAL H    1 1 
        1  1444 1 1  84 VAL HA   H  -2.006   0.191  -4.503 1.00 . A A .  84 VAL HA   1 1 
        1  1445 1 1  84 VAL HB   H  -1.885   2.770  -2.927 1.00 . A A .  84 VAL HB   1 1 
        1  1446 1 1  84 VAL HG11 H  -4.119   1.487  -4.510 1.00 . A A .  84 VAL HG11 1 1 
        1  1447 1 1  84 VAL HG12 H  -3.140   2.858  -5.031 1.00 . A A .  84 VAL HG12 1 1 
        1  1448 1 1  84 VAL HG13 H  -4.212   3.019  -3.639 1.00 . A A .  84 VAL HG13 1 1 
        1  1449 1 1  84 VAL HG21 H  -2.158   0.927  -1.354 1.00 . A A .  84 VAL HG21 1 1 
        1  1450 1 1  84 VAL HG22 H  -3.498   0.289  -2.309 1.00 . A A .  84 VAL HG22 1 1 
        1  1451 1 1  84 VAL HG23 H  -3.656   1.847  -1.495 1.00 . A A .  84 VAL HG23 1 1 
        1  1452 1 1  84 VAL N    N  -0.497   0.326  -3.079 1.00 . A A .  84 VAL N    1 1 
        1  1453 1 1  84 VAL O    O   0.216   2.570  -4.750 1.00 . A A .  84 VAL O    1 1 
        1  1454 1 1  85 THR C    C  -0.924   3.773  -7.608 1.00 . A A .  85 THR C    1 1 
        1  1455 1 1  85 THR CA   C  -0.420   2.328  -7.445 1.00 . A A .  85 THR CA   1 1 
        1  1456 1 1  85 THR CB   C  -0.616   1.566  -8.779 1.00 . A A .  85 THR CB   1 1 
        1  1457 1 1  85 THR CG2  C  -0.049   0.152  -8.683 1.00 . A A .  85 THR CG2  1 1 
        1  1458 1 1  85 THR H    H  -1.827   1.023  -6.524 1.00 . A A .  85 THR H    1 1 
        1  1459 1 1  85 THR HA   H   0.641   2.357  -7.233 1.00 . A A .  85 THR HA   1 1 
        1  1460 1 1  85 THR HB   H  -0.092   2.095  -9.564 1.00 . A A .  85 THR HB   1 1 
        1  1461 1 1  85 THR HG1  H  -2.292   2.335  -9.508 1.00 . A A .  85 THR HG1  1 1 
        1  1462 1 1  85 THR HG21 H  -0.187  -0.357  -9.626 1.00 . A A .  85 THR HG21 1 1 
        1  1463 1 1  85 THR HG22 H  -0.565  -0.393  -7.903 1.00 . A A .  85 THR HG22 1 1 
        1  1464 1 1  85 THR HG23 H   1.005   0.198  -8.452 1.00 . A A .  85 THR HG23 1 1 
        1  1465 1 1  85 THR N    N  -1.080   1.630  -6.331 1.00 . A A .  85 THR N    1 1 
        1  1466 1 1  85 THR O    O  -1.710   4.074  -8.507 1.00 . A A .  85 THR O    1 1 
        1  1467 1 1  85 THR OG1  O  -2.011   1.495  -9.113 1.00 . A A .  85 THR OG1  1 1 
        1  1468 1 1  86 THR C    C  -0.174   6.875  -5.629 1.00 . A A .  86 THR C    1 1 
        1  1469 1 1  86 THR CA   C  -0.841   6.087  -6.765 1.00 . A A .  86 THR CA   1 1 
        1  1470 1 1  86 THR CB   C  -2.375   6.315  -6.674 1.00 . A A .  86 THR CB   1 1 
        1  1471 1 1  86 THR CG2  C  -2.952   5.691  -5.406 1.00 . A A .  86 THR CG2  1 1 
        1  1472 1 1  86 THR H    H   0.106   4.343  -5.991 1.00 . A A .  86 THR H    1 1 
        1  1473 1 1  86 THR HA   H  -0.496   6.482  -7.712 1.00 . A A .  86 THR HA   1 1 
        1  1474 1 1  86 THR HB   H  -2.845   5.848  -7.532 1.00 . A A .  86 THR HB   1 1 
        1  1475 1 1  86 THR HG1  H  -2.819   8.012  -7.599 1.00 . A A .  86 THR HG1  1 1 
        1  1476 1 1  86 THR HG21 H  -2.744   4.631  -5.398 1.00 . A A .  86 THR HG21 1 1 
        1  1477 1 1  86 THR HG22 H  -4.021   5.847  -5.381 1.00 . A A .  86 THR HG22 1 1 
        1  1478 1 1  86 THR HG23 H  -2.501   6.152  -4.539 1.00 . A A .  86 THR HG23 1 1 
        1  1479 1 1  86 THR N    N  -0.481   4.657  -6.713 1.00 . A A .  86 THR N    1 1 
        1  1480 1 1  86 THR O    O   0.402   6.292  -4.711 1.00 . A A .  86 THR O    1 1 
        1  1481 1 1  86 THR OG1  O  -2.671   7.721  -6.689 1.00 . A A .  86 THR OG1  1 1 
        1  1482 1 1  87 ASP C    C  -0.854  10.042  -4.150 1.00 . A A .  87 ASP C    1 1 
        1  1483 1 1  87 ASP CA   C   0.248   9.082  -4.63