NMR Restraints Grid

Result table
 (Save to zip file containing files for each block)

image mrblock_id pdb_id bmrb_id cing stage program type subtype item_count
545771 2lvb 18561 cing 4-filtered-FRED STAR entry full 3192


data_FRED_restraints_with_modified_coordinates_PDB_code_2lvb

# This FRED archive file contains, for PDB entry <2lvb>:
# 
# - Coordinates and sequence information from the PDB mmCIF file
# - NMR restraints from the PDB MR file
# 
# In this file, the coordinates and NMR restraints share the same atom names,
# and in this way can differ from the data deposited at the wwPDB. To achieve
# this aim, the NMR restraints were parsed from their original format files, and
# the coordinates and NMR restraints information were subsequently harmonized.
# 
# Due to the complexity of this harmonization process and the filtering process
# used in creating these files, the NMR restraints information in these files
# may differ significantly from that in the originally deposited file. Other 
# modifications could have occurred to the NMR restraints information, or data 
# could have been lost because of parsing or conversion errors. The PDB file 
# remains the authoritative reference for the atomic coordinates and the 
# originally deposited restraints files remain the primary reference for these 
# data.
# 
# This file is generated at the BioMagResBank (BMRB) in collaboration with the 
# PDBe (formerly MSD) group at the European Bioinformatics Institute (EBI) and 
# the CMBI/IMM group at the Radboud University of Nijmegen.
# 
# Several software packages were used to produce this file:
# 
# - Wattos (BMRB and CMBI/IMM).
# - FormatConverter and NMRStarExport (PDBe).
# - CCPN framework (http://www.ccpn.ac.uk/).
# 
# More information about this process can be found in the references below.
# Please cite the original reference for this PDB entry.
# 
# JF Doreleijers, A Nederveen, W Vranken, J Lin, AM Bonvin, R Kaptein, JL
# Markley, and EL Ulrich (2005). BioMagResBank databases DOCR and FRED
# containing converted and filtered sets of experimental NMR restraints and
# coordinates from over 500 protein PDB structures. J. Biomol. NMR 32, 1-12.
# 
# WF Vranken, W Boucher, TJ Stevens, RH Fogh, A Pajon, M Llinas, EL Ulrich, JL
# Markley, J Ionides, ED Laue (2005). The CCPN data model for NMR spectroscopy:
# development of a software pipeline. Proteins 59, 687-696. 
# 
# JF Doreleijers, WF Vranken, C Schulte, J Lin, JR Wedell, CJ Penkett, GW Vuister, 
# G Vriend, JL Markley, and EL Ulrich (2009). The NMR Restraints Grid at BMRB for 
# 5,266 Protein and Nucleic Acid PDB Entries. J Biomol. NMR 45, 389?396.




save_Conversion_project_for_entry_Name_1
    _Study_list.Sf_category  study_list
    _Study_list.Entry_ID     1
    _Study_list.ID           1

    loop_
       _Study.ID
       _Study.Name
       _Study.Type
       _Study.Details
       _Study.Entry_ID
       _Study.Study_list_ID

       1 "Conversion project for entry 1" NMR . 1 1 
    stop_

save_


save_originalConstraints_1
    _Entry.PDB_coordinate_file_version  .
    _Entry.Sf_category                  entry_information
    _Entry.ID                           1
    _Entry.Title                        "Data for entry 1"
    _Entry.NMR_STAR_version             3.1.0.8
    _Entry.Experimental_method          NMR
    _Entry.Details                      .

save_


save_assembly_2lvb
    _Assembly.Sf_category           assembly
    _Assembly.Entry_ID              1
    _Assembly.ID                    1
    _Assembly.Name                  2lvb
    _Assembly.Number_of_components  1
    _Assembly.Organic_ligands       .
    _Assembly.Metal_ions            .
    _Assembly.Paramagnetic          .
    _Assembly.Thiol_state           "not present"
    _Assembly.Molecular_mass        12655.03

    loop_
       _Entity_assembly.ID
       _Entity_assembly.Entity_assembly_name
       _Entity_assembly.Entity_ID
       _Entity_assembly.Entity_label
       _Entity_assembly.Asym_ID
       _Entity_assembly.Details
       _Entity_assembly.Entry_ID
       _Entity_assembly.Assembly_ID

       1 . 1 $DE_NOVO_DESIGNED_PFK_fold_PROTEIN A . 1 1 
    stop_

save_


save_DE_NOVO_DESIGNED_PFK_fold_PROTEIN
    _Entity.Sf_category                  entity
    _Entity.Entry_ID                     1
    _Entity.ID                           1
    _Entity.Name                         "DE NOVO DESIGNED PFK fold PROTEIN"
    _Entity.Type                         polymer
    _Entity.Polymer_type                 polypeptide(L)
    _Entity.Polymer_seq_one_letter_code  MGKVLLVISTDTNIISSVQERAKHNYPGREIRTATSSQDIRDIIKSMKDNGKPLVVFVNGASQNDVNEFQNEAKKEGVSYDVLKSTDPEELTQRVREFLKTAGSLEHHHHHH
    _Entity.Number_of_monomers           112

    loop_
       _Entity_comp_index.ID
       _Entity_comp_index.Comp_ID
       _Entity_comp_index.Comp_label
       _Entity_comp_index.Entry_ID
       _Entity_comp_index.Entity_ID

         1 MET . 1 1 
         2 GLY . 1 1 
         3 LYS . 1 1 
         4 VAL . 1 1 
         5 LEU . 1 1 
         6 LEU . 1 1 
         7 VAL . 1 1 
         8 ILE . 1 1 
         9 SER . 1 1 
        10 THR . 1 1 
        11 ASP . 1 1 
        12 THR . 1 1 
        13 ASN . 1 1 
        14 ILE . 1 1 
        15 ILE . 1 1 
        16 SER . 1 1 
        17 SER . 1 1 
        18 VAL . 1 1 
        19 GLN . 1 1 
        20 GLU . 1 1 
        21 ARG . 1 1 
        22 ALA . 1 1 
        23 LYS . 1 1 
        24 HIS . 1 1 
        25 ASN . 1 1 
        26 TYR . 1 1 
        27 PRO . 1 1 
        28 GLY . 1 1 
        29 ARG . 1 1 
        30 GLU . 1 1 
        31 ILE . 1 1 
        32 ARG . 1 1 
        33 THR . 1 1 
        34 ALA . 1 1 
        35 THR . 1 1 
        36 SER . 1 1 
        37 SER . 1 1 
        38 GLN . 1 1 
        39 ASP . 1 1 
        40 ILE . 1 1 
        41 ARG . 1 1 
        42 ASP . 1 1 
        43 ILE . 1 1 
        44 ILE . 1 1 
        45 LYS . 1 1 
        46 SER . 1 1 
        47 MET . 1 1 
        48 LYS . 1 1 
        49 ASP . 1 1 
        50 ASN . 1 1 
        51 GLY . 1 1 
        52 LYS . 1 1 
        53 PRO . 1 1 
        54 LEU . 1 1 
        55 VAL . 1 1 
        56 VAL . 1 1 
        57 PHE . 1 1 
        58 VAL . 1 1 
        59 ASN . 1 1 
        60 GLY . 1 1 
        61 ALA . 1 1 
        62 SER . 1 1 
        63 GLN . 1 1 
        64 ASN . 1 1 
        65 ASP . 1 1 
        66 VAL . 1 1 
        67 ASN . 1 1 
        68 GLU . 1 1 
        69 PHE . 1 1 
        70 GLN . 1 1 
        71 ASN . 1 1 
        72 GLU . 1 1 
        73 ALA . 1 1 
        74 LYS . 1 1 
        75 LYS . 1 1 
        76 GLU . 1 1 
        77 GLY . 1 1 
        78 VAL . 1 1 
        79 SER . 1 1 
        80 TYR . 1 1 
        81 ASP . 1 1 
        82 VAL . 1 1 
        83 LEU . 1 1 
        84 LYS . 1 1 
        85 SER . 1 1 
        86 THR . 1 1 
        87 ASP . 1 1 
        88 PRO . 1 1 
        89 GLU . 1 1 
        90 GLU . 1 1 
        91 LEU . 1 1 
        92 THR . 1 1 
        93 GLN . 1 1 
        94 ARG . 1 1 
        95 VAL . 1 1 
        96 ARG . 1 1 
        97 GLU . 1 1 
        98 PHE . 1 1 
        99 LEU . 1 1 
       100 LYS . 1 1 
       101 THR . 1 1 
       102 ALA . 1 1 
       103 GLY . 1 1 
       104 SER . 1 1 
       105 LEU . 1 1 
       106 GLU . 1 1 
       107 HIS . 1 1 
       108 HIS . 1 1 
       109 HIS . 1 1 
       110 HIS . 1 1 
       111 HIS . 1 1 
       112 HIS . 1 1 
    stop_

    loop_
       _Entity_poly_seq.Mon_ID
       _Entity_poly_seq.Num
       _Entity_poly_seq.Comp_index_ID
       _Entity_poly_seq.Entry_ID
       _Entity_poly_seq.Entity_ID

       MET   1   1 1 1 
       GLY   2   2 1 1 
       LYS   3   3 1 1 
       VAL   4   4 1 1 
       LEU   5   5 1 1 
       LEU   6   6 1 1 
       VAL   7   7 1 1 
       ILE   8   8 1 1 
       SER   9   9 1 1 
       THR  10  10 1 1 
       ASP  11  11 1 1 
       THR  12  12 1 1 
       ASN  13  13 1 1 
       ILE  14  14 1 1 
       ILE  15  15 1 1 
       SER  16  16 1 1 
       SER  17  17 1 1 
       VAL  18  18 1 1 
       GLN  19  19 1 1 
       GLU  20  20 1 1 
       ARG  21  21 1 1 
       ALA  22  22 1 1 
       LYS  23  23 1 1 
       HIS  24  24 1 1 
       ASN  25  25 1 1 
       TYR  26  26 1 1 
       PRO  27  27 1 1 
       GLY  28  28 1 1 
       ARG  29  29 1 1 
       GLU  30  30 1 1 
       ILE  31  31 1 1 
       ARG  32  32 1 1 
       THR  33  33 1 1 
       ALA  34  34 1 1 
       THR  35  35 1 1 
       SER  36  36 1 1 
       SER  37  37 1 1 
       GLN  38  38 1 1 
       ASP  39  39 1 1 
       ILE  40  40 1 1 
       ARG  41  41 1 1 
       ASP  42  42 1 1 
       ILE  43  43 1 1 
       ILE  44  44 1 1 
       LYS  45  45 1 1 
       SER  46  46 1 1 
       MET  47  47 1 1 
       LYS  48  48 1 1 
       ASP  49  49 1 1 
       ASN  50  50 1 1 
       GLY  51  51 1 1 
       LYS  52  52 1 1 
       PRO  53  53 1 1 
       LEU  54  54 1 1 
       VAL  55  55 1 1 
       VAL  56  56 1 1 
       PHE  57  57 1 1 
       VAL  58  58 1 1 
       ASN  59  59 1 1 
       GLY  60  60 1 1 
       ALA  61  61 1 1 
       SER  62  62 1 1 
       GLN  63  63 1 1 
       ASN  64  64 1 1 
       ASP  65  65 1 1 
       VAL  66  66 1 1 
       ASN  67  67 1 1 
       GLU  68  68 1 1 
       PHE  69  69 1 1 
       GLN  70  70 1 1 
       ASN  71  71 1 1 
       GLU  72  72 1 1 
       ALA  73  73 1 1 
       LYS  74  74 1 1 
       LYS  75  75 1 1 
       GLU  76  76 1 1 
       GLY  77  77 1 1 
       VAL  78  78 1 1 
       SER  79  79 1 1 
       TYR  80  80 1 1 
       ASP  81  81 1 1 
       VAL  82  82 1 1 
       LEU  83  83 1 1 
       LYS  84  84 1 1 
       SER  85  85 1 1 
       THR  86  86 1 1 
       ASP  87  87 1 1 
       PRO  88  88 1 1 
       GLU  89  89 1 1 
       GLU  90  90 1 1 
       LEU  91  91 1 1 
       THR  92  92 1 1 
       GLN  93  93 1 1 
       ARG  94  94 1 1 
       VAL  95  95 1 1 
       ARG  96  96 1 1 
       GLU  97  97 1 1 
       PHE  98  98 1 1 
       LEU  99  99 1 1 
       LYS 100 100 1 1 
       THR 101 101 1 1 
       ALA 102 102 1 1 
       GLY 103 103 1 1 
       SER 104 104 1 1 
       LEU 105 105 1 1 
       GLU 106 106 1 1 
       HIS 107 107 1 1 
       HIS 108 108 1 1 
       HIS 109 109 1 1 
       HIS 110 110 1 1 
       HIS 111 111 1 1 
       HIS 112 112 1 1 
    stop_

save_


save_CNS/XPLOR_distance_constraints_4_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  1
    _Distance_constraint_list.Constraint_type     NOE
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

          1 1 . . . 1 1 
          2 1 . . . 1 1 
          3 1 . . . 1 1 
          4 1 . . . 1 1 
          5 1 . . . 1 1 
          6 1 . . . 1 1 
          7 1 . . . 1 1 
          8 1 . . . 1 1 
          9 1 . . . 1 1 
         10 1 . . . 1 1 
         11 1 . . . 1 1 
         12 1 . . . 1 1 
         13 1 . . . 1 1 
         14 1 . . . 1 1 
         15 1 . . . 1 1 
         16 1 . . . 1 1 
         17 1 . . . 1 1 
         18 1 . . . 1 1 
         19 1 . . . 1 1 
         20 1 . . . 1 1 
         21 1 . . . 1 1 
         22 1 . . . 1 1 
         23 1 . . . 1 1 
         24 1 . . . 1 1 
         25 1 . . . 1 1 
         26 1 . . . 1 1 
         27 1 . . . 1 1 
         28 1 . . . 1 1 
         29 1 . . . 1 1 
         30 1 . . . 1 1 
         31 1 . . . 1 1 
         32 1 . . . 1 1 
         33 1 . . . 1 1 
         34 1 . . . 1 1 
         35 1 . . . 1 1 
         36 1 . . . 1 1 
         37 1 . . . 1 1 
         38 1 . . . 1 1 
         39 1 . . . 1 1 
         40 1 . . . 1 1 
         41 1 . . . 1 1 
         42 1 . . . 1 1 
         43 1 . . . 1 1 
         44 1 . . . 1 1 
         45 1 . . . 1 1 
         46 1 . . . 1 1 
         47 1 . . . 1 1 
         48 1 . . . 1 1 
         49 1 . . . 1 1 
         50 1 . . . 1 1 
         51 1 . . . 1 1 
         52 1 . . . 1 1 
         53 1 . . . 1 1 
         54 1 . . . 1 1 
         55 1 . . . 1 1 
         56 1 . . . 1 1 
         57 1 . . . 1 1 
         58 1 . . . 1 1 
         59 1 . . . 1 1 
         60 1 . . . 1 1 
         61 1 . . . 1 1 
         62 1 . . . 1 1 
         63 1 . . . 1 1 
         64 1 . . . 1 1 
         65 1 . . . 1 1 
         66 1 . . . 1 1 
         67 1 . . . 1 1 
         68 1 . . . 1 1 
         69 1 . . . 1 1 
         70 1 . . . 1 1 
         71 1 . . . 1 1 
         72 1 . . . 1 1 
         73 1 . . . 1 1 
         74 1 . . . 1 1 
         75 1 . . . 1 1 
         76 1 . . . 1 1 
         77 1 . . . 1 1 
         78 1 . . . 1 1 
         79 1 . . . 1 1 
         80 1 . . . 1 1 
         81 1 . . . 1 1 
         82 1 . . . 1 1 
         83 1 . . . 1 1 
         84 1 . . . 1 1 
         85 1 . . . 1 1 
         86 1 . . . 1 1 
         87 1 . . . 1 1 
         88 1 . . . 1 1 
         89 1 . . . 1 1 
         90 1 . . . 1 1 
         91 1 . . . 1 1 
         92 1 . . . 1 1 
         93 1 . . . 1 1 
         94 1 . . . 1 1 
         95 1 . . . 1 1 
         96 1 . . . 1 1 
         97 1 . . . 1 1 
         98 1 . . . 1 1 
         99 1 . . . 1 1 
        100 1 . . . 1 1 
        101 1 . . . 1 1 
        102 1 . . . 1 1 
        103 1 . . . 1 1 
        104 1 . . . 1 1 
        105 1 . . . 1 1 
        106 1 . . . 1 1 
        107 1 . . . 1 1 
        108 1 . . . 1 1 
        109 1 . . . 1 1 
        110 1 . . . 1 1 
        111 1 . . . 1 1 
        112 1 . . . 1 1 
        113 1 . . . 1 1 
        114 1 . . . 1 1 
        115 1 . . . 1 1 
        116 1 . . . 1 1 
        117 1 . . . 1 1 
        118 1 . . . 1 1 
        119 1 . . . 1 1 
        120 1 . . . 1 1 
        121 1 . . . 1 1 
        122 1 . . . 1 1 
        123 1 . . . 1 1 
        124 1 . . . 1 1 
        125 1 . . . 1 1 
        126 1 . . . 1 1 
        127 1 . . . 1 1 
        128 1 . . . 1 1 
        129 1 . . . 1 1 
        130 1 . . . 1 1 
        131 1 . . . 1 1 
        132 1 . . . 1 1 
        133 1 . . . 1 1 
        134 1 . . . 1 1 
        135 1 . . . 1 1 
        136 1 . . . 1 1 
        137 1 . . . 1 1 
        138 1 . . . 1 1 
        139 1 . . . 1 1 
        140 1 . . . 1 1 
        141 1 . . . 1 1 
        142 1 . . . 1 1 
        143 1 . . . 1 1 
        144 1 . . . 1 1 
        145 1 . . . 1 1 
        146 1 . . . 1 1 
        147 1 . . . 1 1 
        148 1 . . . 1 1 
        149 1 . . . 1 1 
        150 1 . . . 1 1 
        151 1 . . . 1 1 
        152 1 . . . 1 1 
        153 1 . . . 1 1 
        154 1 . . . 1 1 
        155 1 . . . 1 1 
        156 1 . . . 1 1 
        157 1 . . . 1 1 
        158 1 . . . 1 1 
        159 1 . . . 1 1 
        160 1 . . . 1 1 
        161 1 . . . 1 1 
        162 1 . . . 1 1 
        163 1 . . . 1 1 
        164 1 . . . 1 1 
        165 1 . . . 1 1 
        166 1 . . . 1 1 
        167 1 . . . 1 1 
        168 1 . . . 1 1 
        169 1 . . . 1 1 
        170 1 . . . 1 1 
        171 1 . . . 1 1 
        172 1 . . . 1 1 
        173 1 . . . 1 1 
        174 1 . . . 1 1 
        175 1 . . . 1 1 
        176 1 . . . 1 1 
        177 1 . . . 1 1 
        178 1 . . . 1 1 
        179 1 . . . 1 1 
        180 1 . . . 1 1 
        181 1 . . . 1 1 
        182 1 . . . 1 1 
        183 1 . . . 1 1 
        184 1 . . . 1 1 
        185 1 . . . 1 1 
        186 1 . . . 1 1 
        187 1 . . . 1 1 
        188 1 . . . 1 1 
        189 1 . . . 1 1 
        190 1 . . . 1 1 
        191 1 . . . 1 1 
        192 1 . . . 1 1 
        193 1 . . . 1 1 
        194 1 . . . 1 1 
        195 1 . . . 1 1 
        196 1 . . . 1 1 
        197 1 . . . 1 1 
        198 1 . . . 1 1 
        199 1 . . . 1 1 
        200 1 . . . 1 1 
        201 1 . . . 1 1 
        202 1 . . . 1 1 
        203 1 . . . 1 1 
        204 1 . . . 1 1 
        205 1 . . . 1 1 
        206 1 . . . 1 1 
        207 1 . . . 1 1 
        208 1 . . . 1 1 
        209 1 . . . 1 1 
        210 1 . . . 1 1 
        211 1 . . . 1 1 
        212 1 . . . 1 1 
        213 1 . . . 1 1 
        214 1 . . . 1 1 
        215 1 . . . 1 1 
        216 1 . . . 1 1 
        217 1 . . . 1 1 
        218 1 . . . 1 1 
        219 1 . . . 1 1 
        220 1 . . . 1 1 
        221 1 . . . 1 1 
        222 1 . . . 1 1 
        223 1 . . . 1 1 
        224 1 . . . 1 1 
        225 1 . . . 1 1 
        226 1 . . . 1 1 
        227 1 . . . 1 1 
        228 1 . . . 1 1 
        229 1 . . . 1 1 
        230 1 . . . 1 1 
        231 1 . . . 1 1 
        232 1 . . . 1 1 
        233 1 . . . 1 1 
        234 1 . . . 1 1 
        235 1 . . . 1 1 
        236 1 . . . 1 1 
        237 1 . . . 1 1 
        238 1 . . . 1 1 
        239 1 . . . 1 1 
        240 1 . . . 1 1 
        241 1 . . . 1 1 
        242 1 . . . 1 1 
        243 1 . . . 1 1 
        244 1 . . . 1 1 
        245 1 . . . 1 1 
        246 1 . . . 1 1 
        247 1 . . . 1 1 
        248 1 . . . 1 1 
        249 1 . . . 1 1 
        250 1 . . . 1 1 
        251 1 . . . 1 1 
        252 1 . . . 1 1 
        253 1 . . . 1 1 
        254 1 . . . 1 1 
        255 1 . . . 1 1 
        256 1 . . . 1 1 
        257 1 . . . 1 1 
        258 1 . . . 1 1 
        259 1 . . . 1 1 
        260 1 . . . 1 1 
        261 1 . . . 1 1 
        262 1 . . . 1 1 
        263 1 . . . 1 1 
        264 1 . . . 1 1 
        265 1 . . . 1 1 
        266 1 . . . 1 1 
        267 1 . . . 1 1 
        268 1 . . . 1 1 
        269 1 . . . 1 1 
        270 1 . . . 1 1 
        271 1 . . . 1 1 
        272 1 . . . 1 1 
        273 1 . . . 1 1 
        274 1 . . . 1 1 
        275 1 . . . 1 1 
        276 1 . . . 1 1 
        277 1 . . . 1 1 
        278 1 . . . 1 1 
        279 1 . . . 1 1 
        280 1 . . . 1 1 
        281 1 . . . 1 1 
        282 1 . . . 1 1 
        283 1 . . . 1 1 
        284 1 . . . 1 1 
        285 1 . . . 1 1 
        286 1 . . . 1 1 
        287 1 . . . 1 1 
        288 1 . . . 1 1 
        289 1 . . . 1 1 
        290 1 . . . 1 1 
        291 1 . . . 1 1 
        292 1 . . . 1 1 
        293 1 . . . 1 1 
        294 1 . . . 1 1 
        295 1 . . . 1 1 
        296 1 . . . 1 1 
        297 1 . . . 1 1 
        298 1 . . . 1 1 
        299 1 . . . 1 1 
        300 1 . . . 1 1 
        301 1 . . . 1 1 
        302 1 . . . 1 1 
        303 1 . . . 1 1 
        304 1 . . . 1 1 
        305 1 . . . 1 1 
        306 1 . . . 1 1 
        307 1 . . . 1 1 
        308 1 . . . 1 1 
        309 1 . . . 1 1 
        310 1 . . . 1 1 
        311 1 . . . 1 1 
        312 1 . . . 1 1 
        313 1 . . . 1 1 
        314 1 . . . 1 1 
        315 1 . . . 1 1 
        316 1 . . . 1 1 
        317 1 . . . 1 1 
        318 1 . . . 1 1 
        319 1 . . . 1 1 
        320 1 . . . 1 1 
        321 1 . . . 1 1 
        322 1 . . . 1 1 
        323 1 . . . 1 1 
        324 1 . . . 1 1 
        325 1 . . . 1 1 
        326 1 . . . 1 1 
        327 1 . . . 1 1 
        328 1 . . . 1 1 
        329 1 . . . 1 1 
        330 1 . . . 1 1 
        331 1 . . . 1 1 
        332 1 . . . 1 1 
        333 1 . . . 1 1 
        334 1 . . . 1 1 
        335 1 . . . 1 1 
        336 1 . . . 1 1 
        337 1 . . . 1 1 
        338 1 . . . 1 1 
        339 1 . . . 1 1 
        340 1 . . . 1 1 
        341 1 . . . 1 1 
        342 1 . . . 1 1 
        343 1 . . . 1 1 
        344 1 . . . 1 1 
        345 1 . . . 1 1 
        346 1 . . . 1 1 
        347 1 . . . 1 1 
        348 1 . . . 1 1 
        349 1 . . . 1 1 
        350 1 . . . 1 1 
        351 1 . . . 1 1 
        352 1 . . . 1 1 
        353 1 . . . 1 1 
        354 1 . . . 1 1 
        355 1 . . . 1 1 
        356 1 . . . 1 1 
        357 1 . . . 1 1 
        358 1 . . . 1 1 
        359 1 . . . 1 1 
        360 1 . . . 1 1 
        361 1 . . . 1 1 
        362 1 . . . 1 1 
        363 1 . . . 1 1 
        364 1 . . . 1 1 
        365 1 . . . 1 1 
        366 1 . . . 1 1 
        367 1 . . . 1 1 
        368 1 . . . 1 1 
        369 1 . . . 1 1 
        370 1 . . . 1 1 
        371 1 . . . 1 1 
        372 1 . . . 1 1 
        373 1 . . . 1 1 
        374 1 . . . 1 1 
        375 1 . . . 1 1 
        376 1 . . . 1 1 
        377 1 . . . 1 1 
        378 1 . . . 1 1 
        379 1 . . . 1 1 
        380 1 . . . 1 1 
        381 1 . . . 1 1 
        382 1 . . . 1 1 
        383 1 . . . 1 1 
        384 1 . . . 1 1 
        385 1 . . . 1 1 
        386 1 . . . 1 1 
        387 1 . . . 1 1 
        388 1 . . . 1 1 
        389 1 . . . 1 1 
        390 1 . . . 1 1 
        391 1 . . . 1 1 
        392 1 . . . 1 1 
        393 1 . . . 1 1 
        394 1 . . . 1 1 
        395 1 . . . 1 1 
        396 1 . . . 1 1 
        397 1 . . . 1 1 
        398 1 . . . 1 1 
        399 1 . . . 1 1 
        400 1 . . . 1 1 
        401 1 . . . 1 1 
        402 1 . . . 1 1 
        403 1 . . . 1 1 
        404 1 . . . 1 1 
        405 1 . . . 1 1 
        406 1 . . . 1 1 
        407 1 . . . 1 1 
        408 1 . . . 1 1 
        409 1 . . . 1 1 
        410 1 . . . 1 1 
        411 1 . . . 1 1 
        412 1 . . . 1 1 
        413 1 . . . 1 1 
        414 1 . . . 1 1 
        415 1 . . . 1 1 
        416 1 . . . 1 1 
        417 1 . . . 1 1 
        418 1 . . . 1 1 
        419 1 . . . 1 1 
        420 1 . . . 1 1 
        421 1 . . . 1 1 
        422 1 . . . 1 1 
        423 1 . . . 1 1 
        424 1 . . . 1 1 
        425 1 . . . 1 1 
        426 1 . . . 1 1 
        427 1 . . . 1 1 
        428 1 . . . 1 1 
        429 1 . . . 1 1 
        430 1 . . . 1 1 
        431 1 . . . 1 1 
        432 1 . . . 1 1 
        433 1 . . . 1 1 
        434 1 . . . 1 1 
        435 1 . . . 1 1 
        436 1 . . . 1 1 
        437 1 . . . 1 1 
        438 1 . . . 1 1 
        439 1 . . . 1 1 
        440 1 . . . 1 1 
        441 1 . . . 1 1 
        442 1 . . . 1 1 
        443 1 . . . 1 1 
        444 1 . . . 1 1 
        445 1 . . . 1 1 
        446 1 . . . 1 1 
        447 1 . . . 1 1 
        448 1 . . . 1 1 
        449 1 . . . 1 1 
        450 1 . . . 1 1 
        451 1 . . . 1 1 
        452 1 . . . 1 1 
        453 1 . . . 1 1 
        454 1 . . . 1 1 
        455 1 . . . 1 1 
        456 1 . . . 1 1 
        457 1 . . . 1 1 
        458 1 . . . 1 1 
        459 1 . . . 1 1 
        460 1 . . . 1 1 
        461 1 . . . 1 1 
        462 1 . . . 1 1 
        463 1 . . . 1 1 
        464 1 . . . 1 1 
        465 1 . . . 1 1 
        466 1 . . . 1 1 
        467 1 . . . 1 1 
        468 1 . . . 1 1 
        469 1 . . . 1 1 
        470 1 . . . 1 1 
        471 1 . . . 1 1 
        472 1 . . . 1 1 
        473 1 . . . 1 1 
        474 1 . . . 1 1 
        475 1 . . . 1 1 
        476 1 . . . 1 1 
        477 1 . . . 1 1 
        478 1 . . . 1 1 
        479 1 . . . 1 1 
        480 1 . . . 1 1 
        481 1 . . . 1 1 
        482 1 . . . 1 1 
        483 1 . . . 1 1 
        484 1 . . . 1 1 
        485 1 . . . 1 1 
        486 1 . . . 1 1 
        487 1 . . . 1 1 
        488 1 . . . 1 1 
        489 1 . . . 1 1 
        490 1 . . . 1 1 
        491 1 . . . 1 1 
        492 1 . . . 1 1 
        493 1 . . . 1 1 
        494 1 . . . 1 1 
        495 1 . . . 1 1 
        496 1 . . . 1 1 
        497 1 . . . 1 1 
        498 1 . . . 1 1 
        499 1 . . . 1 1 
        500 1 . . . 1 1 
        501 1 . . . 1 1 
        502 1 . . . 1 1 
        503 1 . . . 1 1 
        504 1 . . . 1 1 
        505 1 . . . 1 1 
        506 1 . . . 1 1 
        507 1 . . . 1 1 
        508 1 . . . 1 1 
        509 1 . . . 1 1 
        510 1 . . . 1 1 
        511 1 . . . 1 1 
        512 1 . . . 1 1 
        513 1 . . . 1 1 
        514 1 . . . 1 1 
        515 1 . . . 1 1 
        516 1 . . . 1 1 
        517 1 . . . 1 1 
        518 1 . . . 1 1 
        519 1 . . . 1 1 
        520 1 . . . 1 1 
        521 1 . . . 1 1 
        522 1 . . . 1 1 
        523 1 . . . 1 1 
        524 1 . . . 1 1 
        525 1 . . . 1 1 
        526 1 . . . 1 1 
        527 1 . . . 1 1 
        528 1 . . . 1 1 
        529 1 . . . 1 1 
        530 1 . . . 1 1 
        531 1 . . . 1 1 
        532 1 . . . 1 1 
        533 1 . . . 1 1 
        534 1 . . . 1 1 
        535 1 . . . 1 1 
        536 1 . . . 1 1 
        537 1 . . . 1 1 
        538 1 . . . 1 1 
        539 1 . . . 1 1 
        540 1 . . . 1 1 
        541 1 . . . 1 1 
        542 1 . . . 1 1 
        543 1 . . . 1 1 
        544 1 . . . 1 1 
        545 1 . . . 1 1 
        546 1 . . . 1 1 
        547 1 . . . 1 1 
        548 1 . . . 1 1 
        549 1 . . . 1 1 
        550 1 . . . 1 1 
        551 1 . . . 1 1 
        552 1 . . . 1 1 
        553 1 . . . 1 1 
        554 1 . . . 1 1 
        555 1 . . . 1 1 
        556 1 . . . 1 1 
        557 1 . . . 1 1 
        558 1 . . . 1 1 
        559 1 . . . 1 1 
        560 1 . . . 1 1 
        561 1 . . . 1 1 
        562 1 . . . 1 1 
        563 1 . . . 1 1 
        564 1 . . . 1 1 
        565 1 . . . 1 1 
        566 1 . . . 1 1 
        567 1 . . . 1 1 
        568 1 . . . 1 1 
        569 1 . . . 1 1 
        570 1 . . . 1 1 
        571 1 . . . 1 1 
        572 1 . . . 1 1 
        573 1 . . . 1 1 
        574 1 . . . 1 1 
        575 1 . . . 1 1 
        576 1 . . . 1 1 
        577 1 . . . 1 1 
        578 1 . . . 1 1 
        579 1 . . . 1 1 
        580 1 . . . 1 1 
        581 1 . . . 1 1 
        582 1 . . . 1 1 
        583 1 . . . 1 1 
        584 1 . . . 1 1 
        585 1 . . . 1 1 
        586 1 . . . 1 1 
        587 1 . . . 1 1 
        588 1 . . . 1 1 
        589 1 . . . 1 1 
        590 1 . . . 1 1 
        591 1 . . . 1 1 
        592 1 . . . 1 1 
        593 1 . . . 1 1 
        594 1 . . . 1 1 
        595 1 . . . 1 1 
        596 1 . . . 1 1 
        597 1 . . . 1 1 
        598 1 . . . 1 1 
        599 1 . . . 1 1 
        600 1 . . . 1 1 
        601 1 . . . 1 1 
        602 1 . . . 1 1 
        603 1 . . . 1 1 
        604 1 . . . 1 1 
        605 1 . . . 1 1 
        606 1 . . . 1 1 
        607 1 . . . 1 1 
        608 1 . . . 1 1 
        609 1 . . . 1 1 
        610 1 . . . 1 1 
        611 1 . . . 1 1 
        612 1 . . . 1 1 
        613 1 . . . 1 1 
        614 1 . . . 1 1 
        615 1 . . . 1 1 
        616 1 . . . 1 1 
        617 1 . . . 1 1 
        618 1 . . . 1 1 
        619 1 . . . 1 1 
        620 1 . . . 1 1 
        621 1 . . . 1 1 
        622 1 . . . 1 1 
        623 1 . . . 1 1 
        624 1 . . . 1 1 
        625 1 . . . 1 1 
        626 1 . . . 1 1 
        627 1 . . . 1 1 
        628 1 . . . 1 1 
        629 1 . . . 1 1 
        630 1 . . . 1 1 
        631 1 . . . 1 1 
        632 1 . . . 1 1 
        633 1 . . . 1 1 
        634 1 . . . 1 1 
        635 1 . . . 1 1 
        636 1 . . . 1 1 
        637 1 . . . 1 1 
        638 1 . . . 1 1 
        639 1 . . . 1 1 
        640 1 . . . 1 1 
        641 1 . . . 1 1 
        642 1 . . . 1 1 
        643 1 . . . 1 1 
        644 1 . . . 1 1 
        645 1 . . . 1 1 
        646 1 . . . 1 1 
        647 1 . . . 1 1 
        648 1 . . . 1 1 
        649 1 . . . 1 1 
        650 1 . . . 1 1 
        651 1 . . . 1 1 
        652 1 . . . 1 1 
        653 1 . . . 1 1 
        654 1 . . . 1 1 
        655 1 . . . 1 1 
        656 1 . . . 1 1 
        657 1 . . . 1 1 
        658 1 . . . 1 1 
        659 1 . . . 1 1 
        660 1 . . . 1 1 
        661 1 . . . 1 1 
        662 1 . . . 1 1 
        663 1 . . . 1 1 
        664 1 . . . 1 1 
        665 1 . . . 1 1 
        666 1 . . . 1 1 
        667 1 . . . 1 1 
        668 1 . . . 1 1 
        669 1 . . . 1 1 
        670 1 . . . 1 1 
        671 1 . . . 1 1 
        672 1 . . . 1 1 
        673 1 . . . 1 1 
        674 1 . . . 1 1 
        675 1 . . . 1 1 
        676 1 . . . 1 1 
        677 1 . . . 1 1 
        678 1 . . . 1 1 
        679 1 . . . 1 1 
        680 1 . . . 1 1 
        681 1 . . . 1 1 
        682 1 . . . 1 1 
        683 1 . . . 1 1 
        684 1 . . . 1 1 
        685 1 . . . 1 1 
        686 1 . . . 1 1 
        687 1 . . . 1 1 
        688 1 . . . 1 1 
        689 1 . . . 1 1 
        690 1 . . . 1 1 
        691 1 . . . 1 1 
        692 1 . . . 1 1 
        693 1 . . . 1 1 
        694 1 . . . 1 1 
        695 1 . . . 1 1 
        696 1 . . . 1 1 
        697 1 . . . 1 1 
        698 1 . . . 1 1 
        699 1 . . . 1 1 
        700 1 . . . 1 1 
        701 1 . . . 1 1 
        702 1 . . . 1 1 
        703 1 . . . 1 1 
        704 1 . . . 1 1 
        705 1 . . . 1 1 
        706 1 . . . 1 1 
        707 1 . . . 1 1 
        708 1 . . . 1 1 
        709 1 . . . 1 1 
        710 1 . . . 1 1 
        711 1 . . . 1 1 
        712 1 . . . 1 1 
        713 1 . . . 1 1 
        714 1 . . . 1 1 
        715 1 . . . 1 1 
        716 1 . . . 1 1 
        717 1 . . . 1 1 
        718 1 . . . 1 1 
        719 1 . . . 1 1 
        720 1 . . . 1 1 
        721 1 . . . 1 1 
        722 1 . . . 1 1 
        723 1 . . . 1 1 
        724 1 . . . 1 1 
        725 1 . . . 1 1 
        726 1 . . . 1 1 
        727 1 . . . 1 1 
        728 1 . . . 1 1 
        729 1 . . . 1 1 
        730 1 . . . 1 1 
        731 1 . . . 1 1 
        732 1 . . . 1 1 
        733 1 . . . 1 1 
        734 1 . . . 1 1 
        735 1 . . . 1 1 
        736 1 . . . 1 1 
        737 1 . . . 1 1 
        738 1 . . . 1 1 
        739 1 . . . 1 1 
        740 1 . . . 1 1 
        741 1 . . . 1 1 
        742 1 . . . 1 1 
        743 1 . . . 1 1 
        744 1 . . . 1 1 
        745 1 . . . 1 1 
        746 1 . . . 1 1 
        747 1 . . . 1 1 
        748 1 . . . 1 1 
        749 1 . . . 1 1 
        750 1 . . . 1 1 
        751 1 . . . 1 1 
        752 1 . . . 1 1 
        753 1 . . . 1 1 
        754 1 . . . 1 1 
        755 1 . . . 1 1 
        756 1 . . . 1 1 
        757 1 . . . 1 1 
        758 1 . . . 1 1 
        759 1 . . . 1 1 
        760 1 . . . 1 1 
        761 1 . . . 1 1 
        762 1 . . . 1 1 
        763 1 . . . 1 1 
        764 1 . . . 1 1 
        765 1 . . . 1 1 
        766 1 . . . 1 1 
        767 1 . . . 1 1 
        768 1 . . . 1 1 
        769 1 . . . 1 1 
        770 1 . . . 1 1 
        771 1 . . . 1 1 
        772 1 . . . 1 1 
        773 1 . . . 1 1 
        774 1 . . . 1 1 
        775 1 . . . 1 1 
        776 1 . . . 1 1 
        777 1 . . . 1 1 
        778 1 . . . 1 1 
        779 1 . . . 1 1 
        780 1 . . . 1 1 
        781 1 . . . 1 1 
        782 1 . . . 1 1 
        783 1 . . . 1 1 
        784 1 . . . 1 1 
        785 1 . . . 1 1 
        786 1 . . . 1 1 
        787 1 . . . 1 1 
        788 1 . . . 1 1 
        789 1 . . . 1 1 
        790 1 . . . 1 1 
        791 1 . . . 1 1 
        792 1 . . . 1 1 
        793 1 . . . 1 1 
        794 1 . . . 1 1 
        795 1 . . . 1 1 
        796 1 . . . 1 1 
        797 1 . . . 1 1 
        798 1 . . . 1 1 
        799 1 . . . 1 1 
        800 1 . . . 1 1 
        801 1 . . . 1 1 
        802 1 . . . 1 1 
        803 1 . . . 1 1 
        804 1 . . . 1 1 
        805 1 . . . 1 1 
        806 1 . . . 1 1 
        807 1 . . . 1 1 
        808 1 . . . 1 1 
        809 1 . . . 1 1 
        810 1 . . . 1 1 
        811 1 . . . 1 1 
        812 1 . . . 1 1 
        813 1 . . . 1 1 
        814 1 . . . 1 1 
        815 1 . . . 1 1 
        816 1 . . . 1 1 
        817 1 . . . 1 1 
        818 1 . . . 1 1 
        819 1 . . . 1 1 
        820 1 . . . 1 1 
        821 1 . . . 1 1 
        822 1 . . . 1 1 
        823 1 . . . 1 1 
        824 1 . . . 1 1 
        825 1 . . . 1 1 
        826 1 . . . 1 1 
        827 1 . . . 1 1 
        828 1 . . . 1 1 
        829 1 . . . 1 1 
        830 1 . . . 1 1 
        831 1 . . . 1 1 
        832 1 . . . 1 1 
        833 1 . . . 1 1 
        834 1 . . . 1 1 
        835 1 . . . 1 1 
        836 1 . . . 1 1 
        837 1 . . . 1 1 
        838 1 . . . 1 1 
        839 1 . . . 1 1 
        840 1 . . . 1 1 
        841 1 . . . 1 1 
        842 1 . . . 1 1 
        843 1 . . . 1 1 
        844 1 . . . 1 1 
        845 1 . . . 1 1 
        846 1 . . . 1 1 
        847 1 . . . 1 1 
        848 1 . . . 1 1 
        849 1 . . . 1 1 
        850 1 . . . 1 1 
        851 1 . . . 1 1 
        852 1 . . . 1 1 
        853 1 . . . 1 1 
        854 1 . . . 1 1 
        855 1 . . . 1 1 
        856 1 . . . 1 1 
        857 1 . . . 1 1 
        858 1 . . . 1 1 
        859 1 . . . 1 1 
        860 1 . . . 1 1 
        861 1 . . . 1 1 
        862 1 . . . 1 1 
        863 1 . . . 1 1 
        864 1 . . . 1 1 
        865 1 . . . 1 1 
        866 1 . . . 1 1 
        867 1 . . . 1 1 
        868 1 . . . 1 1 
        869 1 . . . 1 1 
        870 1 . . . 1 1 
        871 1 . . . 1 1 
        872 1 . . . 1 1 
        873 1 . . . 1 1 
        874 1 . . . 1 1 
        875 1 . . . 1 1 
        876 1 . . . 1 1 
        877 1 . . . 1 1 
        878 1 . . . 1 1 
        879 1 . . . 1 1 
        880 1 . . . 1 1 
        881 1 . . . 1 1 
        882 1 . . . 1 1 
        883 1 . . . 1 1 
        884 1 . . . 1 1 
        885 1 . . . 1 1 
        886 1 . . . 1 1 
        887 1 . . . 1 1 
        888 1 . . . 1 1 
        889 1 . . . 1 1 
        890 1 . . . 1 1 
        891 1 . . . 1 1 
        892 1 . . . 1 1 
        893 1 . . . 1 1 
        894 1 . . . 1 1 
        895 1 . . . 1 1 
        896 1 . . . 1 1 
        897 1 . . . 1 1 
        898 1 . . . 1 1 
        899 1 . . . 1 1 
        900 1 . . . 1 1 
        901 1 . . . 1 1 
        902 1 . . . 1 1 
        903 1 . . . 1 1 
        904 1 . . . 1 1 
        905 1 . . . 1 1 
        906 1 . . . 1 1 
        907 1 . . . 1 1 
        908 1 . . . 1 1 
        909 1 . . . 1 1 
        910 1 . . . 1 1 
        911 1 . . . 1 1 
        912 1 . . . 1 1 
        913 1 . . . 1 1 
        914 1 . . . 1 1 
        915 1 . . . 1 1 
        916 1 . . . 1 1 
        917 1 . . . 1 1 
        918 1 . . . 1 1 
        919 1 . . . 1 1 
        920 1 . . . 1 1 
        921 1 . . . 1 1 
        922 1 . . . 1 1 
        923 1 . . . 1 1 
        924 1 . . . 1 1 
        925 1 . . . 1 1 
        926 1 . . . 1 1 
        927 1 . . . 1 1 
        928 1 . . . 1 1 
        929 1 . . . 1 1 
        930 1 . . . 1 1 
        931 1 . . . 1 1 
        932 1 . . . 1 1 
        933 1 . . . 1 1 
        934 1 . . . 1 1 
        935 1 . . . 1 1 
        936 1 . . . 1 1 
        937 1 . . . 1 1 
        938 1 . . . 1 1 
        939 1 . . . 1 1 
        940 1 . . . 1 1 
        941 1 . . . 1 1 
        942 1 . . . 1 1 
        943 1 . . . 1 1 
        944 1 . . . 1 1 
        945 1 . . . 1 1 
        946 1 . . . 1 1 
        947 1 . . . 1 1 
        948 1 . . . 1 1 
        949 1 . . . 1 1 
        950 1 . . . 1 1 
        951 1 . . . 1 1 
        952 1 . . . 1 1 
        953 1 . . . 1 1 
        954 1 . . . 1 1 
        955 1 . . . 1 1 
        956 1 . . . 1 1 
        957 1 . . . 1 1 
        958 1 . . . 1 1 
        959 1 . . . 1 1 
        960 1 . . . 1 1 
        961 1 . . . 1 1 
        962 1 . . . 1 1 
        963 1 . . . 1 1 
        964 1 . . . 1 1 
        965 1 . . . 1 1 
        966 1 . . . 1 1 
        967 1 . . . 1 1 
        968 1 . . . 1 1 
        969 1 . . . 1 1 
        970 1 . . . 1 1 
        971 1 . . . 1 1 
        972 1 . . . 1 1 
        973 1 . . . 1 1 
        974 1 . . . 1 1 
        975 1 . . . 1 1 
        976 1 . . . 1 1 
        977 1 . . . 1 1 
        978 1 . . . 1 1 
        979 1 . . . 1 1 
        980 1 . . . 1 1 
        981 1 . . . 1 1 
        982 1 . . . 1 1 
        983 1 . . . 1 1 
        984 1 . . . 1 1 
        985 1 . . . 1 1 
        986 1 . . . 1 1 
        987 1 . . . 1 1 
        988 1 . . . 1 1 
        989 1 . . . 1 1 
        990 1 . . . 1 1 
        991 1 . . . 1 1 
        992 1 . . . 1 1 
        993 1 . . . 1 1 
        994 1 . . . 1 1 
        995 1 . . . 1 1 
        996 1 . . . 1 1 
        997 1 . . . 1 1 
        998 1 . . . 1 1 
        999 1 . . . 1 1 
       1000 1 . . . 1 1 
       1001 1 . . . 1 1 
       1002 1 . . . 1 1 
       1003 1 . . . 1 1 
       1004 1 . . . 1 1 
       1005 1 . . . 1 1 
       1006 1 . . . 1 1 
       1007 1 . . . 1 1 
       1008 1 . . . 1 1 
       1009 1 . . . 1 1 
       1010 1 . . . 1 1 
       1011 1 . . . 1 1 
       1012 1 . . . 1 1 
       1013 1 . . . 1 1 
       1014 1 . . . 1 1 
       1015 1 . . . 1 1 
       1016 1 . . . 1 1 
       1017 1 . . . 1 1 
       1018 1 . . . 1 1 
       1019 1 . . . 1 1 
       1020 1 . . . 1 1 
       1021 1 . . . 1 1 
       1022 1 . . . 1 1 
       1023 1 . . . 1 1 
       1024 1 . . . 1 1 
       1025 1 . . . 1 1 
       1026 1 . . . 1 1 
       1027 1 . . . 1 1 
       1028 1 . . . 1 1 
       1029 1 . . . 1 1 
       1030 1 . . . 1 1 
       1031 1 . . . 1 1 
       1032 1 . . . 1 1 
       1033 1 . . . 1 1 
       1034 1 . . . 1 1 
       1035 1 . . . 1 1 
       1036 1 . . . 1 1 
       1037 1 . . . 1 1 
       1038 1 . . . 1 1 
       1039 1 . . . 1 1 
       1040 1 . . . 1 1 
       1041 1 . . . 1 1 
       1042 1 . . . 1 1 
       1043 1 . . . 1 1 
       1044 1 . . . 1 1 
       1045 1 . . . 1 1 
       1046 1 . . . 1 1 
       1047 1 . . . 1 1 
       1048 1 . . . 1 1 
       1049 1 . . . 1 1 
       1050 1 . . . 1 1 
       1051 1 . . . 1 1 
       1052 1 . . . 1 1 
       1053 1 . . . 1 1 
       1054 1 . . . 1 1 
       1055 1 . . . 1 1 
       1056 1 . . . 1 1 
       1057 1 . . . 1 1 
       1058 1 . . . 1 1 
       1059 1 . . . 1 1 
       1060 1 . . . 1 1 
       1061 1 . . . 1 1 
       1062 1 . . . 1 1 
       1063 1 . . . 1 1 
       1064 1 . . . 1 1 
       1065 1 . . . 1 1 
       1066 1 . . . 1 1 
       1067 1 . . . 1 1 
       1068 1 . . . 1 1 
       1069 1 . . . 1 1 
       1070 1 . . . 1 1 
       1071 1 . . . 1 1 
       1072 1 . . . 1 1 
       1073 1 . . . 1 1 
       1074 1 . . . 1 1 
       1075 1 . . . 1 1 
       1076 1 . . . 1 1 
       1077 1 . . . 1 1 
       1078 1 . . . 1 1 
       1079 1 . . . 1 1 
       1080 1 . . . 1 1 
       1081 1 . . . 1 1 
       1082 1 . . . 1 1 
       1083 1 . . . 1 1 
       1084 1 . . . 1 1 
       1085 1 . . . 1 1 
       1086 1 . . . 1 1 
       1087 1 . . . 1 1 
       1088 1 . . . 1 1 
       1089 1 . . . 1 1 
       1090 1 . . . 1 1 
       1091 1 . . . 1 1 
       1092 1 . . . 1 1 
       1093 1 . . . 1 1 
       1094 1 . . . 1 1 
       1095 1 . . . 1 1 
       1096 1 . . . 1 1 
       1097 1 . . . 1 1 
       1098 1 . . . 1 1 
       1099 1 . . . 1 1 
       1100 1 . . . 1 1 
       1101 1 . . . 1 1 
       1102 1 . . . 1 1 
       1103 1 . . . 1 1 
       1104 1 . . . 1 1 
       1105 1 . . . 1 1 
       1106 1 . . . 1 1 
       1107 1 . . . 1 1 
       1108 1 . . . 1 1 
       1109 1 . . . 1 1 
       1110 1 . . . 1 1 
       1111 1 . . . 1 1 
       1112 1 . . . 1 1 
       1113 1 . . . 1 1 
       1114 1 . . . 1 1 
       1115 1 . . . 1 1 
       1116 1 . . . 1 1 
       1117 1 . . . 1 1 
       1118 1 . . . 1 1 
       1119 1 . . . 1 1 
       1120 1 . . . 1 1 
       1121 1 . . . 1 1 
       1122 1 . . . 1 1 
       1123 1 . . . 1 1 
       1124 1 . . . 1 1 
       1125 1 . . . 1 1 
       1126 1 . . . 1 1 
       1127 1 . . . 1 1 
       1128 1 . . . 1 1 
       1129 1 . . . 1 1 
       1130 1 . . . 1 1 
       1131 1 . . . 1 1 
       1132 1 . . . 1 1 
       1133 1 . . . 1 1 
       1134 1 . . . 1 1 
       1135 1 . . . 1 1 
       1136 1 . . . 1 1 
       1137 1 . . . 1 1 
       1138 1 . . . 1 1 
       1139 1 . . . 1 1 
       1140 1 . . . 1 1 
       1141 1 . . . 1 1 
       1142 1 . . . 1 1 
       1143 1 . . . 1 1 
       1144 1 . . . 1 1 
       1145 1 . . . 1 1 
       1146 1 . . . 1 1 
       1147 1 . . . 1 1 
       1148 1 . . . 1 1 
       1149 1 . . . 1 1 
       1150 1 . . . 1 1 
       1151 1 . . . 1 1 
       1152 1 . . . 1 1 
       1153 1 . . . 1 1 
       1154 1 . . . 1 1 
       1155 1 . . . 1 1 
       1156 1 . . . 1 1 
       1157 1 . . . 1 1 
       1158 1 . . . 1 1 
       1159 1 . . . 1 1 
       1160 1 . . . 1 1 
       1161 1 . . . 1 1 
       1162 1 . . . 1 1 
       1163 1 . . . 1 1 
       1164 1 . . . 1 1 
       1165 1 . . . 1 1 
       1166 1 . . . 1 1 
       1167 1 . . . 1 1 
       1168 1 . . . 1 1 
       1169 1 . . . 1 1 
       1170 1 . . . 1 1 
       1171 1 . . . 1 1 
       1172 1 . . . 1 1 
       1173 1 . . . 1 1 
       1174 1 . . . 1 1 
       1175 1 . . . 1 1 
       1176 1 . . . 1 1 
       1177 1 . . . 1 1 
       1178 1 . . . 1 1 
       1179 1 . . . 1 1 
       1180 1 . . . 1 1 
       1181 1 . . . 1 1 
       1182 1 . . . 1 1 
       1183 1 . . . 1 1 
       1184 1 . . . 1 1 
       1185 1 . . . 1 1 
       1186 1 . . . 1 1 
       1187 1 . . . 1 1 
       1188 1 . . . 1 1 
       1189 1 . . . 1 1 
       1190 1 . . . 1 1 
       1191 1 . . . 1 1 
       1192 1 . . . 1 1 
       1193 1 . . . 1 1 
       1194 1 . . . 1 1 
       1195 1 . . . 1 1 
       1196 1 . . . 1 1 
       1197 1 . . . 1 1 
       1198 1 . . . 1 1 
       1199 1 . . . 1 1 
       1200 1 . . . 1 1 
       1201 1 . . . 1 1 
       1202 1 . . . 1 1 
       1203 1 . . . 1 1 
       1204 1 . . . 1 1 
       1205 1 . . . 1 1 
       1206 1 . . . 1 1 
       1207 1 . . . 1 1 
       1208 1 . . . 1 1 
       1209 1 . . . 1 1 
       1210 1 . . . 1 1 
       1211 1 . . . 1 1 
       1212 1 . . . 1 1 
       1213 1 . . . 1 1 
       1214 1 . . . 1 1 
       1215 1 . . . 1 1 
       1216 1 . . . 1 1 
       1217 1 . . . 1 1 
       1218 1 . . . 1 1 
       1219 1 . . . 1 1 
       1220 1 . . . 1 1 
       1221 1 . . . 1 1 
       1222 1 . . . 1 1 
       1223 1 . . . 1 1 
       1224 1 . . . 1 1 
       1225 1 . . . 1 1 
       1226 1 . . . 1 1 
       1227 1 . . . 1 1 
       1228 1 . . . 1 1 
       1229 1 . . . 1 1 
       1230 1 . . . 1 1 
       1231 1 . . . 1 1 
       1232 1 . . . 1 1 
       1233 1 . . . 1 1 
       1234 1 . . . 1 1 
       1235 1 . . . 1 1 
       1236 1 . . . 1 1 
       1237 1 . . . 1 1 
       1238 1 . . . 1 1 
       1239 1 . . . 1 1 
       1240 1 . . . 1 1 
       1241 1 . . . 1 1 
       1242 1 . . . 1 1 
       1243 1 . . . 1 1 
       1244 1 . . . 1 1 
       1245 1 . . . 1 1 
       1246 1 . . . 1 1 
       1247 1 . . . 1 1 
       1248 1 . . . 1 1 
       1249 1 . . . 1 1 
       1250 1 . . . 1 1 
       1251 1 . . . 1 1 
       1252 1 . . . 1 1 
       1253 1 . . . 1 1 
       1254 1 . . . 1 1 
       1255 1 . . . 1 1 
       1256 1 . . . 1 1 
       1257 1 . . . 1 1 
       1258 1 . . . 1 1 
       1259 1 . . . 1 1 
       1260 1 . . . 1 1 
       1261 1 . . . 1 1 
       1262 1 . . . 1 1 
       1263 1 . . . 1 1 
       1264 1 . . . 1 1 
       1265 1 . . . 1 1 
       1266 1 . . . 1 1 
       1267 1 . . . 1 1 
       1268 1 . . . 1 1 
       1269 1 . . . 1 1 
       1270 1 . . . 1 1 
       1271 1 . . . 1 1 
       1272 1 . . . 1 1 
       1273 1 . . . 1 1 
       1274 1 . . . 1 1 
       1275 1 . . . 1 1 
       1276 1 . . . 1 1 
       1277 1 . . . 1 1 
       1278 1 . . . 1 1 
       1279 1 . . . 1 1 
       1280 1 . . . 1 1 
       1281 1 . . . 1 1 
       1282 1 . . . 1 1 
       1283 1 . . . 1 1 
       1284 1 . . . 1 1 
       1285 1 . . . 1 1 
       1286 1 . . . 1 1 
       1287 1 . . . 1 1 
       1288 1 . . . 1 1 
       1289 1 . . . 1 1 
       1290 1 . . . 1 1 
       1291 1 . . . 1 1 
       1292 1 . . . 1 1 
       1293 1 . . . 1 1 
       1294 1 . . . 1 1 
       1295 1 . . . 1 1 
       1296 1 . . . 1 1 
       1297 1 . . . 1 1 
       1298 1 . . . 1 1 
       1299 1 . . . 1 1 
       1300 1 . . . 1 1 
       1301 1 . . . 1 1 
       1302 1 . . . 1 1 
       1303 1 . . . 1 1 
       1304 1 . . . 1 1 
       1305 1 . . . 1 1 
       1306 1 . . . 1 1 
       1307 1 . . . 1 1 
       1308 1 . . . 1 1 
       1309 1 . . . 1 1 
       1310 1 . . . 1 1 
       1311 1 . . . 1 1 
       1312 1 . . . 1 1 
       1313 1 . . . 1 1 
       1314 1 . . . 1 1 
       1315 1 . . . 1 1 
       1316 1 . . . 1 1 
       1317 1 . . . 1 1 
       1318 1 . . . 1 1 
       1319 1 . . . 1 1 
       1320 1 . . . 1 1 
       1321 1 . . . 1 1 
       1322 1 . . . 1 1 
       1323 1 . . . 1 1 
       1324 1 . . . 1 1 
       1325 1 . . . 1 1 
       1326 1 . . . 1 1 
       1327 1 . . . 1 1 
       1328 1 . . . 1 1 
       1329 1 . . . 1 1 
       1330 1 . . . 1 1 
       1331 1 . . . 1 1 
       1332 1 . . . 1 1 
       1333 1 . . . 1 1 
       1334 1 . . . 1 1 
       1335 1 . . . 1 1 
       1336 1 . . . 1 1 
       1337 1 . . . 1 1 
       1338 1 . . . 1 1 
       1339 1 . . . 1 1 
       1340 1 . . . 1 1 
       1341 1 . . . 1 1 
       1342 1 . . . 1 1 
       1343 1 . . . 1 1 
       1344 1 . . . 1 1 
       1345 1 . . . 1 1 
       1346 1 . . . 1 1 
       1347 1 . . . 1 1 
       1348 1 . . . 1 1 
       1349 1 . . . 1 1 
       1350 1 . . . 1 1 
       1351 1 . . . 1 1 
       1352 1 . . . 1 1 
       1353 1 . . . 1 1 
       1354 1 . . . 1 1 
       1355 1 . . . 1 1 
       1356 1 . . . 1 1 
       1357 1 . . . 1 1 
       1358 1 . . . 1 1 
       1359 1 . . . 1 1 
       1360 1 . . . 1 1 
       1361 1 . . . 1 1 
       1362 1 . . . 1 1 
       1363 1 . . . 1 1 
       1364 1 . . . 1 1 
       1365 1 . . . 1 1 
       1366 1 . . . 1 1 
       1367 1 . . . 1 1 
       1368 1 . . . 1 1 
       1369 1 . . . 1 1 
       1370 1 . . . 1 1 
       1371 1 . . . 1 1 
       1372 1 . . . 1 1 
       1373 1 . . . 1 1 
       1374 1 . . . 1 1 
       1375 1 . . . 1 1 
       1376 1 . . . 1 1 
       1377 1 . . . 1 1 
       1378 1 . . . 1 1 
       1379 1 . . . 1 1 
       1380 1 . . . 1 1 
       1381 1 . . . 1 1 
       1382 1 . . . 1 1 
       1383 1 . . . 1 1 
       1384 1 . . . 1 1 
       1385 1 . . . 1 1 
       1386 1 . . . 1 1 
       1387 1 . . . 1 1 
       1388 1 . . . 1 1 
       1389 1 . . . 1 1 
       1390 1 . . . 1 1 
       1391 1 . . . 1 1 
       1392 1 . . . 1 1 
       1393 1 . . . 1 1 
       1394 1 . . . 1 1 
       1395 1 . . . 1 1 
       1396 1 . . . 1 1 
       1397 1 . . . 1 1 
       1398 1 . . . 1 1 
       1399 1 . . . 1 1 
       1400 1 . . . 1 1 
       1401 1 . . . 1 1 
       1402 1 . . . 1 1 
       1403 1 . . . 1 1 
       1404 1 . . . 1 1 
       1405 1 . . . 1 1 
       1406 1 . . . 1 1 
       1407 1 . . . 1 1 
       1408 1 . . . 1 1 
       1409 1 . . . 1 1 
       1410 1 . . . 1 1 
       1411 1 . . . 1 1 
       1412 1 . . . 1 1 
       1413 1 . . . 1 1 
       1414 1 . . . 1 1 
       1415 1 . . . 1 1 
       1416 1 . . . 1 1 
       1417 1 . . . 1 1 
       1418 1 . . . 1 1 
       1419 1 . . . 1 1 
       1420 1 . . . 1 1 
       1421 1 . . . 1 1 
       1422 1 . . . 1 1 
       1423 1 . . . 1 1 
       1424 1 . . . 1 1 
       1425 1 . . . 1 1 
       1426 1 . . . 1 1 
       1427 1 . . . 1 1 
       1428 1 . . . 1 1 
       1429 1 . . . 1 1 
       1430 1 . . . 1 1 
       1431 1 . . . 1 1 
       1432 1 . . . 1 1 
       1433 1 . . . 1 1 
       1434 1 . . . 1 1 
       1435 1 . . . 1 1 
       1436 1 . . . 1 1 
       1437 1 . . . 1 1 
       1438 1 . . . 1 1 
       1439 1 . . . 1 1 
       1440 1 . . . 1 1 
       1441 1 . . . 1 1 
       1442 1 . . . 1 1 
       1443 1 . . . 1 1 
       1444 1 . . . 1 1 
       1445 1 . . . 1 1 
       1446 1 . . . 1 1 
       1447 1 . . . 1 1 
       1448 1 . . . 1 1 
       1449 1 . . . 1 1 
       1450 1 . . . 1 1 
       1451 1 . . . 1 1 
       1452 1 . . . 1 1 
       1453 1 . . . 1 1 
       1454 1 . . . 1 1 
       1455 1 . . . 1 1 
       1456 1 . . . 1 1 
       1457 1 . . . 1 1 
       1458 1 . . . 1 1 
       1459 1 . . . 1 1 
       1460 1 . . . 1 1 
       1461 1 . . . 1 1 
       1462 1 . . . 1 1 
       1463 1 . . . 1 1 
       1464 1 . . . 1 1 
       1465 1 . . . 1 1 
       1466 1 . . . 1 1 
       1467 1 . . . 1 1 
       1468 1 . . . 1 1 
       1469 1 . . . 1 1 
       1470 1 . . . 1 1 
       1471 1 . . . 1 1 
       1472 1 . . . 1 1 
       1473 1 . . . 1 1 
       1474 1 . . . 1 1 
       1475 1 . . . 1 1 
       1476 1 . . . 1 1 
       1477 1 . . . 1 1 
       1478 1 . . . 1 1 
       1479 1 . . . 1 1 
       1480 1 . . . 1 1 
       1481 1 . . . 1 1 
       1482 1 . . . 1 1 
       1483 1 . . . 1 1 
       1484 1 . . . 1 1 
       1485 1 . . . 1 1 
       1486 1 . . . 1 1 
       1487 1 . . . 1 1 
       1488 1 . . . 1 1 
       1489 1 . . . 1 1 
       1490 1 . . . 1 1 
       1491 1 . . . 1 1 
       1492 1 . . . 1 1 
       1493 1 . . . 1 1 
       1494 1 . . . 1 1 
       1495 1 . . . 1 1 
       1496 1 . . . 1 1 
       1497 1 . . . 1 1 
       1498 1 . . . 1 1 
       1499 1 . . . 1 1 
       1500 1 . . . 1 1 
       1501 1 . . . 1 1 
       1502 1 . . . 1 1 
       1503 1 . . . 1 1 
       1504 1 . . . 1 1 
       1505 1 . . . 1 1 
       1506 1 . . . 1 1 
       1507 1 . . . 1 1 
       1508 1 . . . 1 1 
       1509 1 . . . 1 1 
       1510 1 . . . 1 1 
       1511 1 . . . 1 1 
       1512 1 . . . 1 1 
       1513 1 . . . 1 1 
       1514 1 . . . 1 1 
       1515 1 . . . 1 1 
       1516 1 . . . 1 1 
       1517 1 . . . 1 1 
       1518 1 . . . 1 1 
       1519 1 . . . 1 1 
       1520 1 . . . 1 1 
       1521 1 . . . 1 1 
       1522 1 . . . 1 1 
       1523 1 . . . 1 1 
       1524 1 . . . 1 1 
       1525 1 . . . 1 1 
       1526 1 . . . 1 1 
       1527 1 . . . 1 1 
       1528 1 . . . 1 1 
       1529 1 . . . 1 1 
       1530 1 . . . 1 1 
       1531 1 . . . 1 1 
       1532 1 . . . 1 1 
       1533 1 . . . 1 1 
       1534 1 . . . 1 1 
       1535 1 . . . 1 1 
       1536 1 . . . 1 1 
       1537 1 . . . 1 1 
       1538 1 . . . 1 1 
       1539 1 . . . 1 1 
       1540 1 . . . 1 1 
       1541 1 . . . 1 1 
       1542 1 . . . 1 1 
       1543 1 . . . 1 1 
       1544 1 . . . 1 1 
       1545 1 . . . 1 1 
       1546 1 . . . 1 1 
       1547 1 . . . 1 1 
       1548 1 . . . 1 1 
       1549 1 . . . 1 1 
       1550 1 . . . 1 1 
       1551 1 . . . 1 1 
       1552 1 . . . 1 1 
       1553 1 . . . 1 1 
       1554 1 . . . 1 1 
       1555 1 . . . 1 1 
       1556 1 . . . 1 1 
       1557 1 . . . 1 1 
       1558 1 . . . 1 1 
       1559 1 . . . 1 1 
       1560 1 . . . 1 1 
       1561 1 . . . 1 1 
       1562 1 . . . 1 1 
       1563 1 . . . 1 1 
       1564 1 . . . 1 1 
       1565 1 . . . 1 1 
       1566 1 . . . 1 1 
       1567 1 . . . 1 1 
       1568 1 . . . 1 1 
       1569 1 . . . 1 1 
       1570 1 . . . 1 1 
       1571 1 . . . 1 1 
       1572 1 . . . 1 1 
       1573 1 . . . 1 1 
       1574 1 . . . 1 1 
       1575 1 . . . 1 1 
       1576 1 . . . 1 1 
       1577 1 . . . 1 1 
       1578 1 . . . 1 1 
       1579 1 . . . 1 1 
       1580 1 . . . 1 1 
       1581 1 . . . 1 1 
       1582 1 . . . 1 1 
       1583 1 . . . 1 1 
       1584 1 . . . 1 1 
       1585 1 . . . 1 1 
       1586 1 . . . 1 1 
       1587 1 . . . 1 1 
       1588 1 . . . 1 1 
       1589 1 . . . 1 1 
       1590 1 . . . 1 1 
       1591 1 . . . 1 1 
       1592 1 . . . 1 1 
       1593 1 . . . 1 1 
       1594 1 . . . 1 1 
       1595 1 . . . 1 1 
       1596 1 . . . 1 1 
       1597 1 . . . 1 1 
       1598 1 . . . 1 1 
       1599 1 . . . 1 1 
       1600 1 . . . 1 1 
       1601 1 . . . 1 1 
       1602 1 . . . 1 1 
       1603 1 . . . 1 1 
       1604 1 . . . 1 1 
       1605 1 . . . 1 1 
       1606 1 . . . 1 1 
       1607 1 . . . 1 1 
       1608 1 . . . 1 1 
       1609 1 . . . 1 1 
       1610 1 . . . 1 1 
       1611 1 . . . 1 1 
       1612 1 . . . 1 1 
       1613 1 . . . 1 1 
       1614 1 . . . 1 1 
       1615 1 . . . 1 1 
       1616 1 . . . 1 1 
       1617 1 . . . 1 1 
       1618 1 . . . 1 1 
       1619 1 . . . 1 1 
       1620 1 . . . 1 1 
       1621 1 . . . 1 1 
       1622 1 . . . 1 1 
       1623 1 . . . 1 1 
       1624 1 . . . 1 1 
       1625 1 . . . 1 1 
       1626 1 . . . 1 1 
       1627 1 . . . 1 1 
       1628 1 . . . 1 1 
       1629 1 . . . 1 1 
       1630 1 . . . 1 1 
       1631 1 . . . 1 1 
       1632 1 . . . 1 1 
       1633 1 . . . 1 1 
       1634 1 . . . 1 1 
       1635 1 . . . 1 1 
       1636 1 . . . 1 1 
       1637 1 . . . 1 1 
       1638 1 . . . 1 1 
       1639 1 . . . 1 1 
       1640 1 . . . 1 1 
       1641 1 . . . 1 1 
       1642 1 . . . 1 1 
       1643 1 . . . 1 1 
       1644 1 . . . 1 1 
       1645 1 . . . 1 1 
       1646 1 . . . 1 1 
       1647 1 . . . 1 1 
       1648 1 . . . 1 1 
       1649 1 . . . 1 1 
       1650 1 . . . 1 1 
       1651 1 . . . 1 1 
       1652 1 . . . 1 1 
       1653 1 . . . 1 1 
       1654 1 . . . 1 1 
       1655 1 . . . 1 1 
       1656 1 . . . 1 1 
       1657 1 . . . 1 1 
       1658 1 . . . 1 1 
       1659 1 . . . 1 1 
       1660 1 . . . 1 1 
       1661 1 . . . 1 1 
       1662 1 . . . 1 1 
       1663 1 . . . 1 1 
       1664 1 . . . 1 1 
       1665 1 . . . 1 1 
       1666 1 . . . 1 1 
       1667 1 . . . 1 1 
       1668 1 . . . 1 1 
       1669 1 . . . 1 1 
       1670 1 . . . 1 1 
       1671 1 . . . 1 1 
       1672 1 . . . 1 1 
       1673 1 . . . 1 1 
       1674 1 . . . 1 1 
       1675 1 . . . 1 1 
       1676 1 . . . 1 1 
       1677 1 . . . 1 1 
       1678 1 . . . 1 1 
       1679 1 . . . 1 1 
       1680 1 . . . 1 1 
       1681 1 . . . 1 1 
       1682 1 . . . 1 1 
       1683 1 . . . 1 1 
       1684 1 . . . 1 1 
       1685 1 . . . 1 1 
       1686 1 . . . 1 1 
       1687 1 . . . 1 1 
       1688 1 . . . 1 1 
       1689 1 . . . 1 1 
       1690 1 . . . 1 1 
       1691 1 . . . 1 1 
       1692 1 . . . 1 1 
       1693 1 . . . 1 1 
       1694 1 . . . 1 1 
       1695 1 . . . 1 1 
       1696 1 . . . 1 1 
       1697 1 . . . 1 1 
       1698 1 . . . 1 1 
       1699 1 . . . 1 1 
       1700 1 . . . 1 1 
       1701 1 . . . 1 1 
       1702 1 . . . 1 1 
       1703 1 . . . 1 1 
       1704 1 . . . 1 1 
       1705 1 . . . 1 1 
       1706 1 . . . 1 1 
       1707 1 . . . 1 1 
       1708 1 . . . 1 1 
       1709 1 . . . 1 1 
       1710 1 . . . 1 1 
       1711 1 . . . 1 1 
       1712 1 . . . 1 1 
       1713 1 . . . 1 1 
       1714 1 . . . 1 1 
       1715 1 . . . 1 1 
       1716 1 . . . 1 1 
       1717 1 . . . 1 1 
       1718 1 . . . 1 1 
       1719 1 . . . 1 1 
       1720 1 . . . 1 1 
       1721 1 . . . 1 1 
       1722 1 . . . 1 1 
       1723 1 . . . 1 1 
       1724 1 . . . 1 1 
       1725 1 . . . 1 1 
       1726 1 . . . 1 1 
       1727 1 . . . 1 1 
       1728 1 . . . 1 1 
       1729 1 . . . 1 1 
       1730 1 . . . 1 1 
       1731 1 . . . 1 1 
       1732 1 . . . 1 1 
       1733 1 . . . 1 1 
       1734 1 . . . 1 1 
       1735 1 . . . 1 1 
       1736 1 . . . 1 1 
       1737 1 . . . 1 1 
       1738 1 . . . 1 1 
       1739 1 . . . 1 1 
       1740 1 . . . 1 1 
       1741 1 . . . 1 1 
       1742 1 . . . 1 1 
       1743 1 . . . 1 1 
       1744 1 . . . 1 1 
       1745 1 . . . 1 1 
       1746 1 . . . 1 1 
       1747 1 . . . 1 1 
       1748 1 . . . 1 1 
       1749 1 . . . 1 1 
       1750 1 . . . 1 1 
       1751 1 . . . 1 1 
       1752 1 . . . 1 1 
       1753 1 . . . 1 1 
       1754 1 . . . 1 1 
       1755 1 . . . 1 1 
       1756 1 . . . 1 1 
       1757 1 . . . 1 1 
       1758 1 . . . 1 1 
       1759 1 . . . 1 1 
       1760 1 . . . 1 1 
       1761 1 . . . 1 1 
       1762 1 . . . 1 1 
       1763 1 . . . 1 1 
       1764 1 . . . 1 1 
       1765 1 . . . 1 1 
       1766 1 . . . 1 1 
       1767 1 . . . 1 1 
       1768 1 . . . 1 1 
       1769 1 . . . 1 1 
       1770 1 . . . 1 1 
       1771 1 . . . 1 1 
       1772 1 . . . 1 1 
       1773 1 . . . 1 1 
       1774 1 . . . 1 1 
       1775 1 . . . 1 1 
       1776 1 . . . 1 1 
       1777 1 . . . 1 1 
       1778 1 . . . 1 1 
       1779 1 . . . 1 1 
       1780 1 . . . 1 1 
       1781 1 . . . 1 1 
       1782 1 . . . 1 1 
       1783 1 . . . 1 1 
       1784 1 . . . 1 1 
       1785 1 . . . 1 1 
       1786 1 . . . 1 1 
       1787 1 . . . 1 1 
       1788 1 . . . 1 1 
       1789 1 . . . 1 1 
       1790 1 . . . 1 1 
       1791 1 . . . 1 1 
       1792 1 . . . 1 1 
       1793 1 . . . 1 1 
       1794 1 . . . 1 1 
       1795 1 . . . 1 1 
       1796 1 . . . 1 1 
       1797 1 . . . 1 1 
       1798 1 . . . 1 1 
       1799 1 . . . 1 1 
       1800 1 . . . 1 1 
       1801 1 . . . 1 1 
       1802 1 . . . 1 1 
       1803 1 . . . 1 1 
       1804 1 . . . 1 1 
       1805 1 . . . 1 1 
       1806 1 . . . 1 1 
       1807 1 . . . 1 1 
       1808 1 . . . 1 1 
       1809 1 . . . 1 1 
       1810 1 . . . 1 1 
       1811 1 . . . 1 1 
       1812 1 . . . 1 1 
       1813 1 . . . 1 1 
       1814 1 . . . 1 1 
       1815 1 . . . 1 1 
       1816 1 . . . 1 1 
       1817 1 . . . 1 1 
       1818 1 . . . 1 1 
       1819 1 . . . 1 1 
       1820 1 . . . 1 1 
       1821 1 . . . 1 1 
       1822 1 . . . 1 1 
       1823 1 . . . 1 1 
       1824 1 . . . 1 1 
       1825 1 . . . 1 1 
       1826 1 . . . 1 1 
       1827 1 . . . 1 1 
       1828 1 . . . 1 1 
       1829 1 . . . 1 1 
       1830 1 . . . 1 1 
       1831 1 . . . 1 1 
       1832 1 . . . 1 1 
       1833 1 . . . 1 1 
       1834 1 . . . 1 1 
       1835 1 . . . 1 1 
       1836 1 . . . 1 1 
       1837 1 . . . 1 1 
       1838 1 . . . 1 1 
       1839 1 . . . 1 1 
       1840 1 . . . 1 1 
       1841 1 . . . 1 1 
       1842 1 . . . 1 1 
       1843 1 . . . 1 1 
       1844 1 . . . 1 1 
       1845 1 . . . 1 1 
       1846 1 . . . 1 1 
       1847 1 . . . 1 1 
       1848 1 . . . 1 1 
       1849 1 . . . 1 1 
       1850 1 . . . 1 1 
       1851 1 . . . 1 1 
       1852 1 . . . 1 1 
       1853 1 . . . 1 1 
       1854 1 . . . 1 1 
       1855 1 . . . 1 1 
       1856 1 . . . 1 1 
       1857 1 . . . 1 1 
       1858 1 . . . 1 1 
       1859 1 . . . 1 1 
       1860 1 . . . 1 1 
       1861 1 . . . 1 1 
       1862 1 . . . 1 1 
       1863 1 . . . 1 1 
       1864 1 . . . 1 1 
       1865 1 . . . 1 1 
       1866 1 . . . 1 1 
       1867 1 . . . 1 1 
       1868 1 . . . 1 1 
       1869 1 . . . 1 1 
       1870 1 . . . 1 1 
       1871 1 . . . 1 1 
       1872 1 . . . 1 1 
       1873 1 . . . 1 1 
       1874 1 . . . 1 1 
       1875 1 . . . 1 1 
       1876 1 . . . 1 1 
       1877 1 . . . 1 1 
       1878 1 . . . 1 1 
       1879 1 . . . 1 1 
       1880 1 . . . 1 1 
       1881 1 . . . 1 1 
       1882 1 . . . 1 1 
       1883 1 . . . 1 1 
       1884 1 . . . 1 1 
       1885 1 . . . 1 1 
       1886 1 . . . 1 1 
       1887 1 . . . 1 1 
       1888 1 . . . 1 1 
       1889 1 . . . 1 1 
       1890 1 . . . 1 1 
       1891 1 . . . 1 1 
       1892 1 . . . 1 1 
       1893 1 . . . 1 1 
       1894 1 . . . 1 1 
       1895 1 . . . 1 1 
       1896 1 . . . 1 1 
       1897 1 . . . 1 1 
       1898 1 . . . 1 1 
       1899 1 . . . 1 1 
       1900 1 . . . 1 1 
       1901 1 . . . 1 1 
       1902 1 . . . 1 1 
       1903 1 . . . 1 1 
       1904 1 . . . 1 1 
       1905 1 . . . 1 1 
       1906 1 . . . 1 1 
       1907 1 . . . 1 1 
       1908 1 . . . 1 1 
       1909 1 . . . 1 1 
       1910 1 . . . 1 1 
       1911 1 . . . 1 1 
       1912 1 . . . 1 1 
       1913 1 . . . 1 1 
       1914 1 . . . 1 1 
       1915 1 . . . 1 1 
       1916 1 . . . 1 1 
       1917 1 . . . 1 1 
       1918 1 . . . 1 1 
       1919 1 . . . 1 1 
       1920 1 . . . 1 1 
       1921 1 . . . 1 1 
       1922 1 . . . 1 1 
       1923 1 . . . 1 1 
       1924 1 . . . 1 1 
       1925 1 . . . 1 1 
       1926 1 . . . 1 1 
       1927 1 . . . 1 1 
       1928 1 . . . 1 1 
       1929 1 . . . 1 1 
       1930 1 . . . 1 1 
       1931 1 . . . 1 1 
       1932 1 . . . 1 1 
       1933 1 . . . 1 1 
       1934 1 . . . 1 1 
       1935 1 . . . 1 1 
       1936 1 . . . 1 1 
       1937 1 . . . 1 1 
       1938 1 . . . 1 1 
       1939 1 . . . 1 1 
       1940 1 . . . 1 1 
       1941 1 . . . 1 1 
       1942 1 . . . 1 1 
       1943 1 . . . 1 1 
       1944 1 . . . 1 1 
       1945 1 . . . 1 1 
       1946 1 . . . 1 1 
       1947 1 . . . 1 1 
       1948 1 . . . 1 1 
       1949 1 . . . 1 1 
       1950 1 . . . 1 1 
       1951 1 . . . 1 1 
       1952 1 . . . 1 1 
       1953 1 . . . 1 1 
       1954 1 . . . 1 1 
       1955 1 . . . 1 1 
       1956 1 . . . 1 1 
       1957 1 . . . 1 1 
       1958 1 . . . 1 1 
       1959 1 . . . 1 1 
       1960 1 . . . 1 1 
       1961 1 . . . 1 1 
       1962 1 . . . 1 1 
       1963 1 . . . 1 1 
       1964 1 . . . 1 1 
       1965 1 . . . 1 1 
       1966 1 . . . 1 1 
       1967 1 . . . 1 1 
       1968 1 . . . 1 1 
       1969 1 . . . 1 1 
       1970 1 . . . 1 1 
       1971 1 . . . 1 1 
       1972 1 . . . 1 1 
       1973 1 . . . 1 1 
       1974 1 . . . 1 1 
       1975 1 . . . 1 1 
       1976 1 . . . 1 1 
       1977 1 . . . 1 1 
       1978 1 . . . 1 1 
       1979 1 . . . 1 1 
       1980 1 . . . 1 1 
       1981 1 . . . 1 1 
       1982 1 . . . 1 1 
       1983 1 . . . 1 1 
       1984 1 . . . 1 1 
       1985 1 . . . 1 1 
       1986 1 . . . 1 1 
       1987 1 . . . 1 1 
       1988 1 . . . 1 1 
       1989 1 . . . 1 1 
       1990 1 . . . 1 1 
       1991 1 . . . 1 1 
       1992 1 . . . 1 1 
       1993 1 . . . 1 1 
       1994 1 . . . 1 1 
       1995 1 . . . 1 1 
       1996 1 . . . 1 1 
       1997 1 . . . 1 1 
       1998 1 . . . 1 1 
       1999 1 . . . 1 1 
       2000 1 . . . 1 1 
       2001 1 . . . 1 1 
       2002 1 . . . 1 1 
       2003 1 . . . 1 1 
       2004 1 . . . 1 1 
       2005 1 . . . 1 1 
       2006 1 . . . 1 1 
       2007 1 . . . 1 1 
       2008 1 . . . 1 1 
       2009 1 . . . 1 1 
       2010 1 . . . 1 1 
       2011 1 . . . 1 1 
       2012 1 . . . 1 1 
       2013 1 . . . 1 1 
       2014 1 . . . 1 1 
       2015 1 . . . 1 1 
       2016 1 . . . 1 1 
       2017 1 . . . 1 1 
       2018 1 . . . 1 1 
       2019 1 . . . 1 1 
       2020 1 . . . 1 1 
       2021 1 . . . 1 1 
       2022 1 . . . 1 1 
       2023 1 . . . 1 1 
       2024 1 . . . 1 1 
       2025 1 . . . 1 1 
       2026 1 . . . 1 1 
       2027 1 . . . 1 1 
       2028 1 . . . 1 1 
       2029 1 . . . 1 1 
       2030 1 . . . 1 1 
       2031 1 . . . 1 1 
       2032 1 . . . 1 1 
       2033 1 . . . 1 1 
       2034 1 . . . 1 1 
       2035 1 . . . 1 1 
       2036 1 . . . 1 1 
       2037 1 . . . 1 1 
       2038 1 . . . 1 1 
       2039 1 . . . 1 1 
       2040 1 . . . 1 1 
       2041 1 . . . 1 1 
       2042 1 . . . 1 1 
       2043 1 . . . 1 1 
       2044 1 . . . 1 1 
       2045 1 . . . 1 1 
       2046 1 . . . 1 1 
       2047 1 . . . 1 1 
       2048 1 . . . 1 1 
       2049 1 . . . 1 1 
       2050 1 . . . 1 1 
       2051 1 . . . 1 1 
       2052 1 . . . 1 1 
       2053 1 . . . 1 1 
       2054 1 . . . 1 1 
       2055 1 . . . 1 1 
       2056 1 . . . 1 1 
       2057 1 . . . 1 1 
       2058 1 . . . 1 1 
       2059 1 . . . 1 1 
       2060 1 . . . 1 1 
       2061 1 . . . 1 1 
       2062 1 . . . 1 1 
       2063 1 . . . 1 1 
       2064 1 . . . 1 1 
       2065 1 . . . 1 1 
       2066 1 . . . 1 1 
       2067 1 . . . 1 1 
       2068 1 . . . 1 1 
       2069 1 . . . 1 1 
       2070 1 . . . 1 1 
       2071 1 . . . 1 1 
       2072 1 . . . 1 1 
       2073 1 . . . 1 1 
       2074 1 . . . 1 1 
       2075 1 . . . 1 1 
       2076 1 . . . 1 1 
       2077 1 . . . 1 1 
       2078 1 . . . 1 1 
       2079 1 . . . 1 1 
       2080 1 . . . 1 1 
       2081 1 . . . 1 1 
       2082 1 . . . 1 1 
       2083 1 . . . 1 1 
       2084 1 . . . 1 1 
       2085 1 . . . 1 1 
       2086 1 . . . 1 1 
       2087 1 . . . 1 1 
       2088 1 . . . 1 1 
       2089 1 . . . 1 1 
       2090 1 . . . 1 1 
       2091 1 . . . 1 1 
       2092 1 . . . 1 1 
       2093 1 . . . 1 1 
       2094 1 . . . 1 1 
       2095 1 . . . 1 1 
       2096 1 . . . 1 1 
       2097 1 . . . 1 1 
       2098 1 . . . 1 1 
       2099 1 . . . 1 1 
       2100 1 . . . 1 1 
       2101 1 . . . 1 1 
       2102 1 . . . 1 1 
       2103 1 . . . 1 1 
       2104 1 . . . 1 1 
       2105 1 . . . 1 1 
       2106 1 . . . 1 1 
       2107 1 . . . 1 1 
       2108 1 . . . 1 1 
       2109 1 . . . 1 1 
       2110 1 . . . 1 1 
       2111 1 . . . 1 1 
       2112 1 . . . 1 1 
       2113 1 . . . 1 1 
       2114 1 . . . 1 1 
       2115 1 . . . 1 1 
       2116 1 . . . 1 1 
       2117 1 . . . 1 1 
       2118 1 . . . 1 1 
       2119 1 . . . 1 1 
       2120 1 . . . 1 1 
       2121 1 . . . 1 1 
       2122 1 . . . 1 1 
       2123 1 . . . 1 1 
       2124 1 . . . 1 1 
       2125 1 . . . 1 1 
       2126 1 . . . 1 1 
       2127 1 . . . 1 1 
       2128 1 . . . 1 1 
       2129 1 . . . 1 1 
       2130 1 . . . 1 1 
       2131 1 . . . 1 1 
       2132 1 . . . 1 1 
       2133 1 . . . 1 1 
       2134 1 . . . 1 1 
       2135 1 . . . 1 1 
       2136 1 . . . 1 1 
       2137 1 . . . 1 1 
       2138 1 . . . 1 1 
       2139 1 . . . 1 1 
       2140 1 . . . 1 1 
       2141 1 . . . 1 1 
       2142 1 . . . 1 1 
       2143 1 . . . 1 1 
       2144 1 . . . 1 1 
       2145 1 . . . 1 1 
       2146 1 . . . 1 1 
       2147 1 . . . 1 1 
       2148 1 . . . 1 1 
       2149 1 . . . 1 1 
       2150 1 . . . 1 1 
       2151 1 . . . 1 1 
       2152 1 . . . 1 1 
       2153 1 . . . 1 1 
       2154 1 . . . 1 1 
       2155 1 . . . 1 1 
       2156 1 . . . 1 1 
       2157 1 . . . 1 1 
       2158 1 . . . 1 1 
       2159 1 . . . 1 1 
       2160 1 . . . 1 1 
       2161 1 . . . 1 1 
       2162 1 . . . 1 1 
       2163 1 . . . 1 1 
       2164 1 . . . 1 1 
       2165 1 . . . 1 1 
       2166 1 . . . 1 1 
       2167 1 . . . 1 1 
       2168 1 . . . 1 1 
       2169 1 . . . 1 1 
       2170 1 . . . 1 1 
       2171 1 . . . 1 1 
       2172 1 . . . 1 1 
       2173 1 . . . 1 1 
       2174 1 . . . 1 1 
       2175 1 . . . 1 1 
       2176 1 . . . 1 1 
       2177 1 . . . 1 1 
       2178 1 . . . 1 1 
       2179 1 . . . 1 1 
       2180 1 . . . 1 1 
       2181 1 . . . 1 1 
       2182 1 . . . 1 1 
       2183 1 . . . 1 1 
       2184 1 . . . 1 1 
       2185 1 . . . 1 1 
       2186 1 . . . 1 1 
       2187 1 . . . 1 1 
       2188 1 . . . 1 1 
       2189 1 . . . 1 1 
       2190 1 . . . 1 1 
       2191 1 . . . 1 1 
       2192 1 . . . 1 1 
       2193 1 . . . 1 1 
       2194 1 . . . 1 1 
       2195 1 . . . 1 1 
       2196 1 . . . 1 1 
       2197 1 . . . 1 1 
       2198 1 . . . 1 1 
       2199 1 . . . 1 1 
       2200 1 . . . 1 1 
       2201 1 . . . 1 1 
       2202 1 . . . 1 1 
       2203 1 . . . 1 1 
       2204 1 . . . 1 1 
       2205 1 . . . 1 1 
       2206 1 . . . 1 1 
       2207 1 . . . 1 1 
       2208 1 . . . 1 1 
       2209 1 . . . 1 1 
       2210 1 . . . 1 1 
       2211 1 . . . 1 1 
       2212 1 . . . 1 1 
       2213 1 . . . 1 1 
       2214 1 . . . 1 1 
       2215 1 . . . 1 1 
       2216 1 . . . 1 1 
       2217 1 . . . 1 1 
       2218 1 . . . 1 1 
       2219 1 . . . 1 1 
       2220 1 . . . 1 1 
       2221 1 . . . 1 1 
       2222 1 . . . 1 1 
       2223 1 . . . 1 1 
       2224 1 . . . 1 1 
       2225 1 . . . 1 1 
       2226 1 . . . 1 1 
       2227 1 . . . 1 1 
       2228 1 . . . 1 1 
       2229 1 . . . 1 1 
       2230 1 . . . 1 1 
       2231 1 . . . 1 1 
       2232 1 . . . 1 1 
       2233 1 . . . 1 1 
       2234 1 . . . 1 1 
       2235 1 . . . 1 1 
       2236 1 . . . 1 1 
       2237 1 . . . 1 1 
       2238 1 . . . 1 1 
       2239 1 . . . 1 1 
       2240 1 . . . 1 1 
       2241 1 . . . 1 1 
       2242 1 . . . 1 1 
       2243 1 . . . 1 1 
       2244 1 . . . 1 1 
       2245 1 . . . 1 1 
       2246 1 . . . 1 1 
       2247 1 . . . 1 1 
       2248 1 . . . 1 1 
       2249 1 . . . 1 1 
       2250 1 . . . 1 1 
       2251 1 . . . 1 1 
       2252 1 . . . 1 1 
       2253 1 . . . 1 1 
       2254 1 . . . 1 1 
       2255 1 . . . 1 1 
       2256 1 . . . 1 1 
       2257 1 . . . 1 1 
       2258 1 . . . 1 1 
       2259 1 . . . 1 1 
       2260 1 . . . 1 1 
       2261 1 . . . 1 1 
       2262 1 . . . 1 1 
       2263 1 . . . 1 1 
       2264 1 . . . 1 1 
       2265 1 . . . 1 1 
       2266 1 . . . 1 1 
       2267 1 . . . 1 1 
       2268 1 . . . 1 1 
       2269 1 . . . 1 1 
       2270 1 . . . 1 1 
       2271 1 . . . 1 1 
       2272 1 . . . 1 1 
       2273 1 . . . 1 1 
       2274 1 . . . 1 1 
       2275 1 . . . 1 1 
       2276 1 . . . 1 1 
       2277 1 . . . 1 1 
       2278 1 . . . 1 1 
       2279 1 . . . 1 1 
       2280 1 . . . 1 1 
       2281 1 . . . 1 1 
       2282 1 . . . 1 1 
       2283 1 . . . 1 1 
       2284 1 . . . 1 1 
       2285 1 . . . 1 1 
       2286 1 . . . 1 1 
       2287 1 . . . 1 1 
       2288 1 . . . 1 1 
       2289 1 . . . 1 1 
       2290 1 . . . 1 1 
       2291 1 . . . 1 1 
       2292 1 . . . 1 1 
       2293 1 . . . 1 1 
       2294 1 . . . 1 1 
       2295 1 . . . 1 1 
       2296 1 . . . 1 1 
       2297 1 . . . 1 1 
       2298 1 . . . 1 1 
       2299 1 . . . 1 1 
       2300 1 . . . 1 1 
       2301 1 . . . 1 1 
       2302 1 . . . 1 1 
       2303 1 . . . 1 1 
       2304 1 . . . 1 1 
       2305 1 . . . 1 1 
       2306 1 . . . 1 1 
       2307 1 . . . 1 1 
       2308 1 . . . 1 1 
       2309 1 . . . 1 1 
       2310 1 . . . 1 1 
       2311 1 . . . 1 1 
       2312 1 . . . 1 1 
       2313 1 . . . 1 1 
       2314 1 . . . 1 1 
       2315 1 . . . 1 1 
       2316 1 . . . 1 1 
       2317 1 . . . 1 1 
       2318 1 . . . 1 1 
       2319 1 . . . 1 1 
       2320 1 . . . 1 1 
       2321 1 . . . 1 1 
       2322 1 . . . 1 1 
       2323 1 . . . 1 1 
       2324 1 . . . 1 1 
       2325 1 . . . 1 1 
       2326 1 . . . 1 1 
       2327 1 . . . 1 1 
       2328 1 . . . 1 1 
       2329 1 . . . 1 1 
       2330 1 . . . 1 1 
       2331 1 . . . 1 1 
       2332 1 . . . 1 1 
       2333 1 . . . 1 1 
       2334 1 . . . 1 1 
       2335 1 . . . 1 1 
       2336 1 . . . 1 1 
       2337 1 . . . 1 1 
       2338 1 . . . 1 1 
       2339 1 . . . 1 1 
       2340 1 . . . 1 1 
       2341 1 . . . 1 1 
       2342 1 . . . 1 1 
       2343 1 . . . 1 1 
       2344 1 . . . 1 1 
       2345 1 . . . 1 1 
       2346 1 . . . 1 1 
       2347 1 . . . 1 1 
       2348 1 . . . 1 1 
       2349 1 . . . 1 1 
       2350 1 . . . 1 1 
       2351 1 . . . 1 1 
       2352 1 . . . 1 1 
       2353 1 . . . 1 1 
       2354 1 . . . 1 1 
       2355 1 . . . 1 1 
       2356 1 . . . 1 1 
       2357 1 . . . 1 1 
       2358 1 . . . 1 1 
       2359 1 . . . 1 1 
       2360 1 . . . 1 1 
       2361 1 . . . 1 1 
       2362 1 . . . 1 1 
       2363 1 . . . 1 1 
       2364 1 . . . 1 1 
       2365 1 . . . 1 1 
       2366 1 . . . 1 1 
       2367 1 . . . 1 1 
       2368 1 . . . 1 1 
       2369 1 . . . 1 1 
       2370 1 . . . 1 1 
       2371 1 . . . 1 1 
       2372 1 . . . 1 1 
       2373 1 . . . 1 1 
       2374 1 . . . 1 1 
       2375 1 . . . 1 1 
       2376 1 . . . 1 1 
       2377 1 . . . 1 1 
       2378 1 . . . 1 1 
       2379 1 . . . 1 1 
       2380 1 . . . 1 1 
       2381 1 . . . 1 1 
       2382 1 . . . 1 1 
       2383 1 . . . 1 1 
       2384 1 . . . 1 1 
       2385 1 . . . 1 1 
       2386 1 . . . 1 1 
       2387 1 . . . 1 1 
       2388 1 . . . 1 1 
       2389 1 . . . 1 1 
       2390 1 . . . 1 1 
       2391 1 . . . 1 1 
       2392 1 . . . 1 1 
       2393 1 . . . 1 1 
       2394 1 . . . 1 1 
       2395 1 . . . 1 1 
       2396 1 . . . 1 1 
       2397 1 . . . 1 1 
       2398 1 . . . 1 1 
       2399 1 . . . 1 1 
       2400 1 . . . 1 1 
       2401 1 . . . 1 1 
       2402 1 . . . 1 1 
       2403 1 . . . 1 1 
       2404 1 . . . 1 1 
       2405 1 . . . 1 1 
       2406 1 . . . 1 1 
       2407 1 . . . 1 1 
       2408 1 . . . 1 1 
       2409 1 . . . 1 1 
       2410 1 . . . 1 1 
       2411 1 . . . 1 1 
       2412 1 . . . 1 1 
       2413 1 . . . 1 1 
       2414 1 . . . 1 1 
       2415 1 . . . 1 1 
       2416 1 . . . 1 1 
       2417 1 . . . 1 1 
       2418 1 . . . 1 1 
       2419 1 . . . 1 1 
       2420 1 . . . 1 1 
       2421 1 . . . 1 1 
       2422 1 . . . 1 1 
       2423 1 . . . 1 1 
       2424 1 . . . 1 1 
       2425 1 . . . 1 1 
       2426 1 . . . 1 1 
       2427 1 . . . 1 1 
       2428 1 . . . 1 1 
       2429 1 . . . 1 1 
       2430 1 . . . 1 1 
       2431 1 . . . 1 1 
       2432 1 . . . 1 1 
       2433 1 . . . 1 1 
       2434 1 . . . 1 1 
       2435 1 . . . 1 1 
       2436 1 . . . 1 1 
       2437 1 . . . 1 1 
       2438 1 . . . 1 1 
       2439 1 . . . 1 1 
       2440 1 . . . 1 1 
       2441 1 . . . 1 1 
       2442 1 . . . 1 1 
       2443 1 . . . 1 1 
       2444 1 . . . 1 1 
       2445 1 . . . 1 1 
       2446 1 . . . 1 1 
       2447 1 . . . 1 1 
       2448 1 . . . 1 1 
       2449 1 . . . 1 1 
       2450 1 . . . 1 1 
       2451 1 . . . 1 1 
       2452 1 . . . 1 1 
       2453 1 . . . 1 1 
       2454 1 . . . 1 1 
       2455 1 . . . 1 1 
       2456 1 . . . 1 1 
       2457 1 . . . 1 1 
       2458 1 . . . 1 1 
       2459 1 . . . 1 1 
       2460 1 . . . 1 1 
       2461 1 . . . 1 1 
       2462 1 . . . 1 1 
       2463 1 . . . 1 1 
       2464 1 . . . 1 1 
       2465 1 . . . 1 1 
       2466 1 . . . 1 1 
       2467 1 . . . 1 1 
       2468 1 . . . 1 1 
       2469 1 . . . 1 1 
       2470 1 . . . 1 1 
       2471 1 . . . 1 1 
       2472 1 . . . 1 1 
       2473 1 . . . 1 1 
       2474 1 . . . 1 1 
       2475 1 . . . 1 1 
       2476 1 . . . 1 1 
       2477 1 . . . 1 1 
       2478 1 . . . 1 1 
       2479 1 . . . 1 1 
       2480 1 . . . 1 1 
       2481 1 . . . 1 1 
       2482 1 . . . 1 1 
       2483 1 . . . 1 1 
       2484 1 . . . 1 1 
       2485 1 . . . 1 1 
       2486 1 . . . 1 1 
       2487 1 . . . 1 1 
       2488 1 . . . 1 1 
       2489 1 . . . 1 1 
       2490 1 . . . 1 1 
       2491 1 . . . 1 1 
       2492 1 . . . 1 1 
       2493 1 . . . 1 1 
       2494 1 . . . 1 1 
       2495 1 . . . 1 1 
       2496 1 . . . 1 1 
       2497 1 . . . 1 1 
       2498 1 . . . 1 1 
       2499 1 . . . 1 1 
       2500 1 . . . 1 1 
       2501 1 . . . 1 1 
       2502 1 . . . 1 1 
       2503 1 . . . 1 1 
       2504 1 . . . 1 1 
       2505 1 . . . 1 1 
       2506 1 . . . 1 1 
       2507 1 . . . 1 1 
       2508 1 . . . 1 1 
       2509 1 . . . 1 1 
       2510 1 . . . 1 1 
       2511 1 . . . 1 1 
       2512 1 . . . 1 1 
       2513 1 . . . 1 1 
       2514 1 . . . 1 1 
       2515 1 . . . 1 1 
       2516 1 . . . 1 1 
       2517 1 . . . 1 1 
       2518 1 . . . 1 1 
       2519 1 . . . 1 1 
       2520 1 . . . 1 1 
       2521 1 . . . 1 1 
       2522 1 . . . 1 1 
       2523 1 . . . 1 1 
       2524 1 . . . 1 1 
       2525 1 . . . 1 1 
       2526 1 . . . 1 1 
       2527 1 . . . 1 1 
       2528 1 . . . 1 1 
       2529 1 . . . 1 1 
       2530 1 . . . 1 1 
       2531 1 . . . 1 1 
       2532 1 . . . 1 1 
       2533 1 . . . 1 1 
       2534 1 . . . 1 1 
       2535 1 . . . 1 1 
       2536 1 . . . 1 1 
       2537 1 . . . 1 1 
       2538 1 . . . 1 1 
       2539 1 . . . 1 1 
       2540 1 . . . 1 1 
       2541 1 . . . 1 1 
       2542 1 . . . 1 1 
       2543 1 . . . 1 1 
       2544 1 . . . 1 1 
       2545 1 . . . 1 1 
       2546 1 . . . 1 1 
       2547 1 . . . 1 1 
       2548 1 . . . 1 1 
       2549 1 . . . 1 1 
       2550 1 . . . 1 1 
       2551 1 . . . 1 1 
       2552 1 . . . 1 1 
       2553 1 . . . 1 1 
       2554 1 . . . 1 1 
       2555 1 . . . 1 1 
       2556 1 . . . 1 1 
       2557 1 . . . 1 1 
       2558 1 . . . 1 1 
       2559 1 . . . 1 1 
       2560 1 . . . 1 1 
       2561 1 . . . 1 1 
       2562 1 . . . 1 1 
       2563 1 . . . 1 1 
       2564 1 . . . 1 1 
       2565 1 . . . 1 1 
       2566 1 . . . 1 1 
       2567 1 . . . 1 1 
       2568 1 . . . 1 1 
       2569 1 . . . 1 1 
       2570 1 . . . 1 1 
       2571 1 . . . 1 1 
       2572 1 . . . 1 1 
       2573 1 . . . 1 1 
       2574 1 . . . 1 1 
       2575 1 . . . 1 1 
       2576 1 . . . 1 1 
       2577 1 . . . 1 1 
       2578 1 . . . 1 1 
       2579 1 . . . 1 1 
       2580 1 . . . 1 1 
       2581 1 . . . 1 1 
       2582 1 . . . 1 1 
       2583 1 . . . 1 1 
       2584 1 . . . 1 1 
       2585 1 . . . 1 1 
       2586 1 . . . 1 1 
       2587 1 . . . 1 1 
       2588 1 . . . 1 1 
       2589 1 . . . 1 1 
       2590 1 . . . 1 1 
       2591 1 . . . 1 1 
       2592 1 . . . 1 1 
       2593 1 . . . 1 1 
       2594 1 . . . 1 1 
       2595 1 . . . 1 1 
       2596 1 . . . 1 1 
       2597 1 . . . 1 1 
       2598 1 . . . 1 1 
       2599 1 . . . 1 1 
       2600 1 . . . 1 1 
       2601 1 . . . 1 1 
       2602 1 . . . 1 1 
       2603 1 . . . 1 1 
       2604 1 . . . 1 1 
       2605 1 . . . 1 1 
       2606 1 . . . 1 1 
       2607 1 . . . 1 1 
       2608 1 . . . 1 1 
       2609 1 . . . 1 1 
       2610 1 . . . 1 1 
       2611 1 . . . 1 1 
       2612 1 . . . 1 1 
       2613 1 . . . 1 1 
       2614 1 . . . 1 1 
       2615 1 . . . 1 1 
       2616 1 . . . 1 1 
       2617 1 . . . 1 1 
       2618 1 . . . 1 1 
       2619 1 . . . 1 1 
       2620 1 . . . 1 1 
       2621 1 . . . 1 1 
       2622 1 . . . 1 1 
       2623 1 . . . 1 1 
       2624 1 . . . 1 1 
       2625 1 . . . 1 1 
       2626 1 . . . 1 1 
       2627 1 . . . 1 1 
       2628 1 . . . 1 1 
       2629 1 . . . 1 1 
       2630 1 . . . 1 1 
       2631 1 . . . 1 1 
       2632 1 . . . 1 1 
       2633 1 . . . 1 1 
       2634 1 . . . 1 1 
       2635 1 . . . 1 1 
       2636 1 . . . 1 1 
       2637 1 . . . 1 1 
       2638 1 . . . 1 1 
       2639 1 . . . 1 1 
       2640 1 . . . 1 1 
       2641 1 . . . 1 1 
       2642 1 . . . 1 1 
       2643 1 . . . 1 1 
       2644 1 . . . 1 1 
       2645 1 . . . 1 1 
       2646 1 . . . 1 1 
       2647 1 . . . 1 1 
       2648 1 . . . 1 1 
       2649 1 . . . 1 1 
       2650 1 . . . 1 1 
       2651 1 . . . 1 1 
       2652 1 . . . 1 1 
       2653 1 . . . 1 1 
       2654 1 . . . 1 1 
       2655 1 . . . 1 1 
       2656 1 . . . 1 1 
       2657 1 . . . 1 1 
       2658 1 . . . 1 1 
       2659 1 . . . 1 1 
       2660 1 . . . 1 1 
       2661 1 . . . 1 1 
       2662 1 . . . 1 1 
       2663 1 . . . 1 1 
       2664 1 . . . 1 1 
       2665 1 . . . 1 1 
       2666 1 . . . 1 1 
       2667 1 . . . 1 1 
       2668 1 . . . 1 1 
       2669 1 . . . 1 1 
       2670 1 . . . 1 1 
       2671 1 . . . 1 1 
       2672 1 . . . 1 1 
       2673 1 . . . 1 1 
       2674 1 . . . 1 1 
       2675 1 . . . 1 1 
       2676 1 . . . 1 1 
       2677 1 . . . 1 1 
       2678 1 . . . 1 1 
       2679 1 . . . 1 1 
       2680 1 . . . 1 1 
       2681 1 . . . 1 1 
       2682 1 . . . 1 1 
       2683 1 . . . 1 1 
       2684 1 . . . 1 1 
       2685 1 . . . 1 1 
       2686 1 . . . 1 1 
       2687 1 . . . 1 1 
       2688 1 . . . 1 1 
       2689 1 . . . 1 1 
       2690 1 . . . 1 1 
       2691 1 . . . 1 1 
       2692 1 . . . 1 1 
       2693 1 . . . 1 1 
       2694 1 . . . 1 1 
       2695 1 . . . 1 1 
       2696 1 . . . 1 1 
       2697 1 . . . 1 1 
       2698 1 . . . 1 1 
       2699 1 . . . 1 1 
       2700 1 . . . 1 1 
       2701 1 . . . 1 1 
       2702 1 . . . 1 1 
       2703 1 . . . 1 1 
       2704 1 . . . 1 1 
       2705 1 . . . 1 1 
       2706 1 . . . 1 1 
       2707 1 . . . 1 1 
       2708 1 . . . 1 1 
       2709 1 . . . 1 1 
       2710 1 . . . 1 1 
       2711 1 . . . 1 1 
       2712 1 . . . 1 1 
       2713 1 . . . 1 1 
       2714 1 . . . 1 1 
       2715 1 . . . 1 1 
       2716 1 . . . 1 1 
       2717 1 . . . 1 1 
       2718 1 . . . 1 1 
       2719 1 . . . 1 1 
       2720 1 . . . 1 1 
       2721 1 . . . 1 1 
       2722 1 . . . 1 1 
       2723 1 . . . 1 1 
       2724 1 . . . 1 1 
       2725 1 . . . 1 1 
       2726 1 . . . 1 1 
       2727 1 . . . 1 1 
       2728 1 . . . 1 1 
       2729 1 . . . 1 1 
       2730 1 . . . 1 1 
       2731 1 . . . 1 1 
       2732 1 . . . 1 1 
       2733 1 . . . 1 1 
       2734 1 . . . 1 1 
       2735 1 . . . 1 1 
       2736 1 . . . 1 1 
       2737 1 . . . 1 1 
       2738 1 . . . 1 1 
       2739 1 . . . 1 1 
       2740 1 . . . 1 1 
       2741 1 . . . 1 1 
       2742 1 . . . 1 1 
       2743 1 . . . 1 1 
       2744 1 . . . 1 1 
       2745 1 . . . 1 1 
       2746 1 . . . 1 1 
       2747 1 . . . 1 1 
       2748 1 . . . 1 1 
       2749 1 . . . 1 1 
       2750 1 . . . 1 1 
       2751 1 . . . 1 1 
       2752 1 . . . 1 1 
       2753 1 . . . 1 1 
       2754 1 . . . 1 1 
       2755 1 . . . 1 1 
       2756 1 . . . 1 1 
       2757 1 . . . 1 1 
       2758 1 . . . 1 1 
       2759 1 . . . 1 1 
       2760 1 . . . 1 1 
       2761 1 . . . 1 1 
       2762 1 . . . 1 1 
       2763 1 . . . 1 1 
       2764 1 . . . 1 1 
       2765 1 . . . 1 1 
       2766 1 . . . 1 1 
       2767 1 . . . 1 1 
       2768 1 . . . 1 1 
       2769 1 . . . 1 1 
       2770 1 . . . 1 1 
       2771 1 . . . 1 1 
       2772 1 . . . 1 1 
       2773 1 . . . 1 1 
       2774 1 . . . 1 1 
       2775 1 . . . 1 1 
       2776 1 . . . 1 1 
       2777 1 . . . 1 1 
       2778 1 . . . 1 1 
       2779 1 . . . 1 1 
       2780 1 . . . 1 1 
       2781 1 . . . 1 1 
       2782 1 . . . 1 1 
       2783 1 . . . 1 1 
       2784 1 . . . 1 1 
       2785 1 . . . 1 1 
       2786 1 . . . 1 1 
       2787 1 . . . 1 1 
       2788 1 . . . 1 1 
       2789 1 . . . 1 1 
       2790 1 . . . 1 1 
       2791 1 . . . 1 1 
       2792 1 . . . 1 1 
       2793 1 . . . 1 1 
       2794 1 . . . 1 1 
       2795 1 . . . 1 1 
       2796 1 . . . 1 1 
       2797 1 . . . 1 1 
       2798 1 . . . 1 1 
       2799 1 . . . 1 1 
       2800 1 . . . 1 1 
       2801 1 . . . 1 1 
       2802 1 . . . 1 1 
       2803 1 . . . 1 1 
       2804 1 . . . 1 1 
       2805 1 . . . 1 1 
       2806 1 . . . 1 1 
       2807 1 . . . 1 1 
       2808 1 . . . 1 1 
       2809 1 . . . 1 1 
       2810 1 . . . 1 1 
       2811 1 . . . 1 1 
       2812 1 . . . 1 1 
       2813 1 . . . 1 1 
       2814 1 . . . 1 1 
       2815 1 . . . 1 1 
       2816 1 . . . 1 1 
       2817 1 . . . 1 1 
       2818 1 . . . 1 1 
       2819 1 . . . 1 1 
       2820 1 . . . 1 1 
       2821 1 . . . 1 1 
       2822 1 . . . 1 1 
       2823 1 . . . 1 1 
       2824 1 . . . 1 1 
       2825 1 . . . 1 1 
       2826 1 . . . 1 1 
       2827 1 . . . 1 1 
       2828 1 . . . 1 1 
       2829 1 . . . 1 1 
       2830 1 . . . 1 1 
       2831 1 . . . 1 1 
       2832 1 . . . 1 1 
       2833 1 . . . 1 1 
       2834 1 . . . 1 1 
       2835 1 . . . 1 1 
       2836 1 . . . 1 1 
       2837 1 . . . 1 1 
       2838 1 . . . 1 1 
       2839 1 . . . 1 1 
       2840 1 . . . 1 1 
       2841 1 . . . 1 1 
       2842 1 . . . 1 1 
       2843 1 . . . 1 1 
       2844 1 . . . 1 1 
       2845 1 . . . 1 1 
       2846 1 . . . 1 1 
       2847 1 . . . 1 1 
       2848 1 . . . 1 1 
       2849 1 . . . 1 1 
       2850 1 . . . 1 1 
       2851 1 . . . 1 1 
       2852 1 . . . 1 1 
       2853 1 . . . 1 1 
       2854 1 . . . 1 1 
       2855 1 . . . 1 1 
       2856 1 . . . 1 1 
       2857 1 . . . 1 1 
       2858 1 . . . 1 1 
       2859 1 . . . 1 1 
       2860 1 . . . 1 1 
       2861 1 . . . 1 1 
       2862 1 . . . 1 1 
       2863 1 . . . 1 1 
       2864 1 . . . 1 1 
       2865 1 . . . 1 1 
       2866 1 . . . 1 1 
       2867 1 . . . 1 1 
       2868 1 . . . 1 1 
       2869 1 . . . 1 1 
       2870 1 . . . 1 1 
       2871 1 . . . 1 1 
       2872 1 . . . 1 1 
       2873 1 . . . 1 1 
       2874 1 . . . 1 1 
       2875 1 . . . 1 1 
       2876 1 . . . 1 1 
       2877 1 . . . 1 1 
       2878 1 . . . 1 1 
       2879 1 . . . 1 1 
       2880 1 . . . 1 1 
       2881 1 . . . 1 1 
       2882 1 . . . 1 1 
       2883 1 . . . 1 1 
       2884 1 . . . 1 1 
       2885 1 . . . 1 1 
       2886 1 . . . 1 1 
       2887 1 . . . 1 1 
       2888 1 . . . 1 1 
       2889 1 . . . 1 1 
       2890 1 . . . 1 1 
       2891 1 . . . 1 1 
       2892 1 . . . 1 1 
       2893 1 . . . 1 1 
       2894 1 . . . 1 1 
       2895 1 . . . 1 1 
       2896 1 . . . 1 1 
       2897 1 . . . 1 1 
       2898 1 . . . 1 1 
       2899 1 . . . 1 1 
       2900 1 . . . 1 1 
       2901 1 . . . 1 1 
       2902 1 . . . 1 1 
       2903 1 . . . 1 1 
       2904 1 . . . 1 1 
       2905 1 . . . 1 1 
       2906 1 . . . 1 1 
       2907 1 . . . 1 1 
       2908 1 . . . 1 1 
       2909 1 . . . 1 1 
       2910 1 . . . 1 1 
       2911 1 . . . 1 1 
       2912 1 . . . 1 1 
       2913 1 . . . 1 1 
       2914 1 . . . 1 1 
       2915 1 . . . 1 1 
       2916 1 . . . 1 1 
       2917 1 . . . 1 1 
       2918 1 . . . 1 1 
       2919 1 . . . 1 1 
       2920 1 . . . 1 1 
       2921 1 . . . 1 1 
       2922 1 . . . 1 1 
       2923 1 . . . 1 1 
       2924 1 . . . 1 1 
       2925 1 . . . 1 1 
       2926 1 . . . 1 1 
       2927 1 . . . 1 1 
       2928 1 . . . 1 1 
       2929 1 . . . 1 1 
       2930 1 . . . 1 1 
       2931 1 . . . 1 1 
       2932 1 . . . 1 1 
       2933 1 . . . 1 1 
       2934 1 . . . 1 1 
       2935 1 . . . 1 1 
       2936 1 . . . 1 1 
       2937 1 . . . 1 1 
       2938 1 . . . 1 1 
       2939 1 . . . 1 1 
       2940 1 . . . 1 1 
       2941 1 . . . 1 1 
       2942 1 . . . 1 1 
       2943 1 . . . 1 1 
       2944 1 . . . 1 1 
       2945 1 . . . 1 1 
       2946 1 . . . 1 1 
       2947 1 . . . 1 1 
       2948 1 . . . 1 1 
       2949 1 . . . 1 1 
       2950 1 . . . 1 1 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

          1 1 1 1 1   3 LYS HA   .   3 . HA   1 1 
          1 1 2 1 1   4 VAL H    .   4 . HN   1 1 
          2 1 1 1 1   3 LYS HB2  .   3 . HB2  1 1 
          2 1 2 1 1   4 VAL H    .   4 . HN   1 1 
          3 1 1 1 1   3 LYS HB3  .   3 . HB1  1 1 
          3 1 2 1 1   4 VAL H    .   4 . HN   1 1 
          4 1 1 1 1   4 VAL H    .   4 . HN   1 1 
          4 1 2 1 1  47 MET ME   .  47 . HE*  1 1 
          5 1 1 1 1   3 LYS HG2  .   3 . HG2  1 1 
          5 1 2 1 1   4 VAL H    .   4 . HN   1 1 
          6 1 1 1 1   3 LYS HG3  .   3 . HG1  1 1 
          6 1 2 1 1   4 VAL H    .   4 . HN   1 1 
          7 1 1 1 1   4 VAL H    .   4 . HN   1 1 
          7 1 2 1 1   5 LEU H    .   5 . HN   1 1 
          8 1 1 1 1   4 VAL HA   .   4 . HA   1 1 
          8 1 2 1 1   5 LEU H    .   5 . HN   1 1 
          9 1 1 1 1   4 VAL HB   .   4 . HB   1 1 
          9 1 2 1 1   5 LEU H    .   5 . HN   1 1 
         10 1 1 1 1   4 VAL MG2  .   4 . HG2* 1 1 
         10 1 2 1 1   5 LEU H    .   5 . HN   1 1 
         11 1 1 1 1   4 VAL MG1  .   4 . HG1* 1 1 
         11 1 2 1 1   5 LEU H    .   5 . HN   1 1 
         12 1 1 1 1   5 LEU HA   .   5 . HA   1 1 
         12 1 2 1 1   6 LEU H    .   6 . HN   1 1 
         13 1 1 1 1   5 LEU HB2  .   5 . HB2  1 1 
         13 1 2 1 1   6 LEU H    .   6 . HN   1 1 
         14 1 1 1 1   5 LEU HB3  .   5 . HB1  1 1 
         14 1 2 1 1   6 LEU H    .   6 . HN   1 1 
         15 1 1 1 1   5 LEU HG   .   5 . HG   1 1 
         15 1 2 1 1   6 LEU H    .   6 . HN   1 1 
         16 1 1 1 1   5 LEU MD2  .   5 . HD2* 1 1 
         16 1 2 1 1   6 LEU H    .   6 . HN   1 1 
         17 1 1 1 1   6 LEU HA   .   6 . HA   1 1 
         17 1 2 1 1   7 VAL H    .   7 . HN   1 1 
         18 1 1 1 1   7 VAL H    .   7 . HN   1 1 
         18 1 2 1 1  56 VAL HB   .  56 . HB   1 1 
         19 1 1 1 1   6 LEU HB3  .   6 . HB1  1 1 
         19 1 2 1 1   7 VAL H    .   7 . HN   1 1 
         20 1 1 1 1   6 LEU HG   .   6 . HG   1 1 
         20 1 2 1 1   7 VAL H    .   7 . HN   1 1 
         21 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
         21 1 2 1 1   7 VAL H    .   7 . HN   1 1 
         22 1 1 1 1   7 VAL HB   .   7 . HB   1 1 
         22 1 2 1 1   8 ILE H    .   8 . HN   1 1 
         23 1 1 1 1   7 VAL MG1  .   7 . HG1* 1 1 
         23 1 2 1 1   8 ILE H    .   8 . HN   1 1 
         24 1 1 1 1   8 ILE H    .   8 . HN   1 1 
         24 1 2 1 1   9 SER H    .   9 . HN   1 1 
         25 1 1 1 1   8 ILE HA   .   8 . HA   1 1 
         25 1 2 1 1   9 SER H    .   9 . HN   1 1 
         26 1 1 1 1   8 ILE HB   .   8 . HB   1 1 
         26 1 2 1 1   9 SER H    .   9 . HN   1 1 
         27 1 1 1 1   8 ILE MG   .   8 . HG2* 1 1 
         27 1 2 1 1   9 SER H    .   9 . HN   1 1 
         28 1 1 1 1   8 ILE HG12 .   8 . HG12 1 1 
         28 1 2 1 1   9 SER H    .   9 . HN   1 1 
         29 1 1 1 1   8 ILE HG13 .   8 . HG11 1 1 
         29 1 2 1 1   9 SER H    .   9 . HN   1 1 
         30 1 1 1 1   9 SER H    .   9 . HN   1 1 
         30 1 2 1 1  15 ILE MG   .  15 . HG2* 1 1 
         31 1 1 1 1   7 VAL MG1  .   7 . HG1* 1 1 
         31 1 2 1 1   9 SER H    .   9 . HN   1 1 
         32 1 1 1 1  11 ASP H    .  11 . HN   1 1 
         32 1 2 1 1  86 THR HA   .  86 . HA   1 1 
         33 1 1 1 1  10 THR MG   .  10 . HG2* 1 1 
         33 1 2 1 1  11 ASP H    .  11 . HN   1 1 
         34 1 1 1 1  12 THR HB   .  12 . HB   1 1 
         34 1 2 1 1  13 ASN H    .  13 . HN   1 1 
         35 1 1 1 1  13 ASN HB2  .  13 . HB2  1 1 
         35 1 2 1 1  14 ILE H    .  14 . HN   1 1 
         36 1 1 1 1  13 ASN HB3  .  13 . HB1  1 1 
         36 1 2 1 1  14 ILE H    .  14 . HN   1 1 
         37 1 1 1 1  14 ILE H    .  14 . HN   1 1 
         37 1 2 1 1  15 ILE H    .  15 . HN   1 1 
         38 1 1 1 1  14 ILE HB   .  14 . HB   1 1 
         38 1 2 1 1  15 ILE H    .  15 . HN   1 1 
         39 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
         39 1 2 1 1  15 ILE H    .  15 . HN   1 1 
         40 1 1 1 1  14 ILE MD   .  14 . HD1* 1 1 
         40 1 2 1 1  15 ILE H    .  15 . HN   1 1 
         41 1 1 1 1  15 ILE H    .  15 . HN   1 1 
         41 1 2 1 1  16 SER H    .  16 . HN   1 1 
         42 1 1 1 1  15 ILE HB   .  15 . HB   1 1 
         42 1 2 1 1  16 SER H    .  16 . HN   1 1 
         43 1 1 1 1  15 ILE MG   .  15 . HG2* 1 1 
         43 1 2 1 1  16 SER H    .  16 . HN   1 1 
         44 1 1 1 1  10 THR H    .  10 . HN   1 1 
         44 1 2 1 1  15 ILE MD   .  15 . HD1* 1 1 
         45 1 1 1 1  15 ILE MD   .  15 . HD1* 1 1 
         45 1 2 1 1  16 SER H    .  16 . HN   1 1 
         46 1 1 1 1  16 SER H    .  16 . HN   1 1 
         46 1 2 1 1  17 SER H    .  17 . HN   1 1 
         47 1 1 1 1  14 ILE HA   .  14 . HA   1 1 
         47 1 2 1 1  17 SER H    .  17 . HN   1 1 
         48 1 1 1 1  18 VAL H    .  18 . HN   1 1 
         48 1 2 1 1  19 GLN H    .  19 . HN   1 1 
         49 1 1 1 1  18 VAL HB   .  18 . HB   1 1 
         49 1 2 1 1  19 GLN H    .  19 . HN   1 1 
         50 1 1 1 1  18 VAL MG1  .  18 . HG1* 1 1 
         50 1 2 1 1  19 GLN H    .  19 . HN   1 1 
         51 1 1 1 1  18 VAL MG2  .  18 . HG2* 1 1 
         51 1 2 1 1  19 GLN H    .  19 . HN   1 1 
         52 1 1 1 1  19 GLN H    .  19 . HN   1 1 
         52 1 2 1 1  20 GLU H    .  20 . HN   1 1 
         53 1 1 1 1  20 GLU H    .  20 . HN   1 1 
         53 1 2 1 1  21 ARG H    .  21 . HN   1 1 
         54 1 1 1 1  20 GLU HB2  .  20 . HB2  1 1 
         54 1 2 1 1  21 ARG H    .  21 . HN   1 1 
         55 1 1 1 1  20 GLU HB3  .  20 . HB1  1 1 
         55 1 2 1 1  21 ARG H    .  21 . HN   1 1 
         56 1 1 1 1  21 ARG HG2  .  21 . HG2  1 1 
         56 1 2 1 1  22 ALA H    .  22 . HN   1 1 
         57 1 1 1 1  21 ARG HG3  .  21 . HG1  1 1 
         57 1 2 1 1  22 ALA H    .  22 . HN   1 1 
         58 1 1 1 1  23 LYS H    .  23 . HN   1 1 
         58 1 2 1 1  24 HIS H    .  24 . HN   1 1 
         59 1 1 1 1  22 ALA MB   .  22 . HB*  1 1 
         59 1 2 1 1  24 HIS H    .  24 . HN   1 1 
         60 1 1 1 1  23 LYS HG3  .  23 . HG1  1 1 
         60 1 2 1 1  24 HIS H    .  24 . HN   1 1 
         61 1 1 1 1  31 ILE H    .  31 . HN   1 1 
         61 1 2 1 1  32 ARG H    .  32 . HN   1 1 
         62 1 1 1 1  31 ILE HA   .  31 . HA   1 1 
         62 1 2 1 1  32 ARG H    .  32 . HN   1 1 
         63 1 1 1 1  31 ILE HB   .  31 . HB   1 1 
         63 1 2 1 1  32 ARG H    .  32 . HN   1 1 
         64 1 1 1 1  31 ILE MG   .  31 . HG2* 1 1 
         64 1 2 1 1  32 ARG H    .  32 . HN   1 1 
         65 1 1 1 1  32 ARG H    .  32 . HN   1 1 
         65 1 2 1 1  32 ARG HG2  .  32 . HG2  1 1 
         66 1 1 1 1  31 ILE HG13 .  31 . HG11 1 1 
         66 1 2 1 1  32 ARG H    .  32 . HN   1 1 
         67 1 1 1 1  31 ILE MD   .  31 . HD1* 1 1 
         67 1 2 1 1  32 ARG H    .  32 . HN   1 1 
         68 1 1 1 1  32 ARG H    .  32 . HN   1 1 
         68 1 2 1 1  33 THR H    .  33 . HN   1 1 
         69 1 1 1 1  32 ARG HA   .  32 . HA   1 1 
         69 1 2 1 1  33 THR H    .  33 . HN   1 1 
         70 1 1 1 1  32 ARG HB3  .  32 . HB1  1 1 
         70 1 2 1 1  33 THR H    .  33 . HN   1 1 
         71 1 1 1 1  32 ARG HG2  .  32 . HG2  1 1 
         71 1 2 1 1  33 THR H    .  33 . HN   1 1 
         72 1 1 1 1  32 ARG HG3  .  32 . HG1  1 1 
         72 1 2 1 1  33 THR H    .  33 . HN   1 1 
         73 1 1 1 1  32 ARG HD2  .  32 . HD2  1 1 
         73 1 2 1 1  33 THR H    .  33 . HN   1 1 
         74 1 1 1 1  32 ARG HD3  .  32 . HD1  1 1 
         74 1 2 1 1  33 THR H    .  33 . HN   1 1 
         75 1 1 1 1  33 THR H    .  33 . HN   1 1 
         75 1 2 1 1  34 ALA H    .  34 . HN   1 1 
         76 1 1 1 1  33 THR HA   .  33 . HA   1 1 
         76 1 2 1 1  34 ALA H    .  34 . HN   1 1 
         77 1 1 1 1  33 THR MG   .  33 . HG2* 1 1 
         77 1 2 1 1  34 ALA H    .  34 . HN   1 1 
         78 1 1 1 1  34 ALA HA   .  34 . HA   1 1 
         78 1 2 1 1  35 THR H    .  35 . HN   1 1 
         79 1 1 1 1  34 ALA MB   .  34 . HB*  1 1 
         79 1 2 1 1  35 THR H    .  35 . HN   1 1 
         80 1 1 1 1  35 THR HB   .  35 . HB   1 1 
         80 1 2 1 1  36 SER H    .  36 . HN   1 1 
         81 1 1 1 1  35 THR MG   .  35 . HG2* 1 1 
         81 1 2 1 1  36 SER H    .  36 . HN   1 1 
         82 1 1 1 1  38 GLN HB2  .  38 . HB2  1 1 
         82 1 2 1 1  39 ASP H    .  39 . HN   1 1 
         83 1 1 1 1  38 GLN HB3  .  38 . HB1  1 1 
         83 1 2 1 1  39 ASP H    .  39 . HN   1 1 
         84 1 1 1 1  39 ASP HB2  .  39 . HB2  1 1 
         84 1 2 1 1  40 ILE H    .  40 . HN   1 1 
         85 1 1 1 1  39 ASP HB3  .  39 . HB1  1 1 
         85 1 2 1 1  40 ILE H    .  40 . HN   1 1 
         86 1 1 1 1  40 ILE H    .  40 . HN   1 1 
         86 1 2 1 1  41 ARG H    .  41 . HN   1 1 
         87 1 1 1 1  40 ILE HB   .  40 . HB   1 1 
         87 1 2 1 1  41 ARG H    .  41 . HN   1 1 
         88 1 1 1 1  40 ILE MG   .  40 . HG2* 1 1 
         88 1 2 1 1  41 ARG H    .  41 . HN   1 1 
         89 1 1 1 1  44 ILE MG   .  44 . HG2* 1 1 
         89 1 2 1 1  45 LYS H    .  45 . HN   1 1 
         90 1 1 1 1  40 ILE MD   .  40 . HD1* 1 1 
         90 1 2 1 1  41 ARG H    .  41 . HN   1 1 
         91 1 1 1 1  41 ARG HG2  .  41 . HG2  1 1 
         91 1 2 1 1  42 ASP H    .  42 . HN   1 1 
         92 1 1 1 1  41 ARG HG3  .  41 . HG1  1 1 
         92 1 2 1 1  42 ASP H    .  42 . HN   1 1 
         93 1 1 1 1  42 ASP HB3  .  42 . HB1  1 1 
         93 1 2 1 1  43 ILE H    .  43 . HN   1 1 
         94 1 1 1 1  43 ILE H    .  43 . HN   1 1 
         94 1 2 1 1  44 ILE H    .  44 . HN   1 1 
         95 1 1 1 1  43 ILE MG   .  43 . HG2* 1 1 
         95 1 2 1 1  44 ILE H    .  44 . HN   1 1 
         96 1 1 1 1  45 LYS HA   .  45 . HA   1 1 
         96 1 2 1 1  46 SER H    .  46 . HN   1 1 
         97 1 1 1 1  45 LYS HG2  .  45 . HG2  1 1 
         97 1 2 1 1  46 SER H    .  46 . HN   1 1 
         98 1 1 1 1  45 LYS HG3  .  45 . HG1  1 1 
         98 1 2 1 1  46 SER H    .  46 . HN   1 1 
         99 1 1 1 1  47 MET H    .  47 . HN   1 1 
         99 1 2 1 1  48 LYS H    .  48 . HN   1 1 
        100 1 1 1 1  47 MET HG2  .  47 . HG2  1 1 
        100 1 2 1 1  48 LYS H    .  48 . HN   1 1 
        101 1 1 1 1  48 LYS HB2  .  48 . HB2  1 1 
        101 1 2 1 1  49 ASP H    .  49 . HN   1 1 
        102 1 1 1 1  48 LYS HB3  .  48 . HB1  1 1 
        102 1 2 1 1  49 ASP H    .  49 . HN   1 1 
        103 1 1 1 1  48 LYS HG2  .  48 . HG2  1 1 
        103 1 2 1 1  49 ASP H    .  49 . HN   1 1 
        104 1 1 1 1  49 ASP HB2  .  49 . HB2  1 1 
        104 1 2 1 1  50 ASN H    .  50 . HN   1 1 
        105 1 1 1 1  49 ASP HB3  .  49 . HB1  1 1 
        105 1 2 1 1  50 ASN H    .  50 . HN   1 1 
        106 1 1 1 1  53 PRO HA   .  53 . HA   1 1 
        106 1 2 1 1  54 LEU H    .  54 . HN   1 1 
        107 1 1 1 1  53 PRO HB2  .  53 . HB2  1 1 
        107 1 2 1 1  54 LEU H    .  54 . HN   1 1 
        108 1 1 1 1  53 PRO HB3  .  53 . HB1  1 1 
        108 1 2 1 1  54 LEU H    .  54 . HN   1 1 
        109 1 1 1 1  47 MET ME   .  47 . HE*  1 1 
        109 1 2 1 1  54 LEU H    .  54 . HN   1 1 
        110 1 1 1 1  54 LEU MD2  .  54 . HD2* 1 1 
        110 1 2 1 1  55 VAL H    .  55 . HN   1 1 
        111 1 1 1 1  55 VAL HA   .  55 . HA   1 1 
        111 1 2 1 1  56 VAL H    .  56 . HN   1 1 
        112 1 1 1 1  55 VAL HB   .  55 . HB   1 1 
        112 1 2 1 1  56 VAL H    .  56 . HN   1 1 
        113 1 1 1 1  55 VAL MG2  .  55 . HG2* 1 1 
        113 1 2 1 1  56 VAL H    .  56 . HN   1 1 
        114 1 1 1 1  55 VAL MG1  .  55 . HG1* 1 1 
        114 1 2 1 1  56 VAL H    .  56 . HN   1 1 
        115 1 1 1 1  56 VAL HA   .  56 . HA   1 1 
        115 1 2 1 1  57 PHE H    .  57 . HN   1 1 
        116 1 1 1 1  56 VAL HB   .  56 . HB   1 1 
        116 1 2 1 1  57 PHE H    .  57 . HN   1 1 
        117 1 1 1 1  56 VAL MG1  .  56 . HG1* 1 1 
        117 1 2 1 1  57 PHE H    .  57 . HN   1 1 
        118 1 1 1 1  57 PHE HA   .  57 . HA   1 1 
        118 1 2 1 1  58 VAL H    .  58 . HN   1 1 
        119 1 1 1 1  58 VAL H    .  58 . HN   1 1 
        119 1 2 1 1  59 ASN H    .  59 . HN   1 1 
        120 1 1 1 1  58 VAL HA   .  58 . HA   1 1 
        120 1 2 1 1  59 ASN H    .  59 . HN   1 1 
        121 1 1 1 1  58 VAL HB   .  58 . HB   1 1 
        121 1 2 1 1  59 ASN H    .  59 . HN   1 1 
        122 1 1 1 1  58 VAL MG2  .  58 . HG2* 1 1 
        122 1 2 1 1  59 ASN H    .  59 . HN   1 1 
        123 1 1 1 1  64 ASN HB2  .  64 . HB2  1 1 
        123 1 2 1 1  65 ASP H    .  65 . HN   1 1 
        124 1 1 1 1  64 ASN HB3  .  64 . HB1  1 1 
        124 1 2 1 1  65 ASP H    .  65 . HN   1 1 
        125 1 1 1 1  65 ASP HB2  .  65 . HB2  1 1 
        125 1 2 1 1  66 VAL H    .  66 . HN   1 1 
        126 1 1 1 1  65 ASP HB3  .  65 . HB1  1 1 
        126 1 2 1 1  66 VAL H    .  66 . HN   1 1 
        127 1 1 1 1  66 VAL H    .  66 . HN   1 1 
        127 1 2 1 1  67 ASN H    .  67 . HN   1 1 
        128 1 1 1 1  66 VAL HB   .  66 . HB   1 1 
        128 1 2 1 1  67 ASN H    .  67 . HN   1 1 
        129 1 1 1 1  66 VAL MG1  .  66 . HG1* 1 1 
        129 1 2 1 1  67 ASN H    .  67 . HN   1 1 
        130 1 1 1 1  66 VAL MG2  .  66 . HG2* 1 1 
        130 1 2 1 1  67 ASN H    .  67 . HN   1 1 
        131 1 1 1 1  68 GLU H    .  68 . HN   1 1 
        131 1 2 1 1  69 PHE H    .  69 . HN   1 1 
        132 1 1 1 1  68 GLU HB3  .  68 . HB1  1 1 
        132 1 2 1 1  69 PHE H    .  69 . HN   1 1 
        133 1 1 1 1  68 GLU HG2  .  68 . HG2  1 1 
        133 1 2 1 1  69 PHE H    .  69 . HN   1 1 
        134 1 1 1 1  69 PHE HB2  .  69 . HB2  1 1 
        134 1 2 1 1  70 GLN H    .  70 . HN   1 1 
        135 1 1 1 1  69 PHE HB3  .  69 . HB1  1 1 
        135 1 2 1 1  70 GLN H    .  70 . HN   1 1 
        136 1 1 1 1  69 PHE QD   .  69 . HD*  1 1 
        136 1 2 1 1  70 GLN H    .  70 . HN   1 1 
        137 1 1 1 1  70 GLN HB2  .  70 . HB2  1 1 
        137 1 2 1 1  71 ASN H    .  71 . HN   1 1 
        138 1 1 1 1  70 GLN HB3  .  70 . HB1  1 1 
        138 1 2 1 1  71 ASN H    .  71 . HN   1 1 
        139 1 1 1 1  71 ASN HB2  .  71 . HB2  1 1 
        139 1 2 1 1  72 GLU H    .  72 . HN   1 1 
        140 1 1 1 1  71 ASN HB3  .  71 . HB1  1 1 
        140 1 2 1 1  72 GLU H    .  72 . HN   1 1 
        141 1 1 1 1  72 GLU H    .  72 . HN   1 1 
        141 1 2 1 1  73 ALA H    .  73 . HN   1 1 
        142 1 1 1 1  73 ALA H    .  73 . HN   1 1 
        142 1 2 1 1  74 LYS H    .  74 . HN   1 1 
        143 1 1 1 1  73 ALA MB   .  73 . HB*  1 1 
        143 1 2 1 1  74 LYS H    .  74 . HN   1 1 
        144 1 1 1 1  74 LYS HG2  .  74 . HG2  1 1 
        144 1 2 1 1  75 LYS H    .  75 . HN   1 1 
        145 1 1 1 1  74 LYS HG3  .  74 . HG1  1 1 
        145 1 2 1 1  75 LYS H    .  75 . HN   1 1 
        146 1 1 1 1  74 LYS HE2  .  74 . HE2  1 1 
        146 1 2 1 1  75 LYS H    .  75 . HN   1 1 
        147 1 1 1 1  74 LYS HE3  .  74 . HE1  1 1 
        147 1 2 1 1  75 LYS H    .  75 . HN   1 1 
        148 1 1 1 1  75 LYS HB2  .  75 . HB2  1 1 
        148 1 2 1 1  76 GLU H    .  76 . HN   1 1 
        149 1 1 1 1  75 LYS HB3  .  75 . HB1  1 1 
        149 1 2 1 1  76 GLU H    .  76 . HN   1 1 
        150 1 1 1 1  76 GLU HB2  .  76 . HB2  1 1 
        150 1 2 1 1  77 GLY H    .  77 . HN   1 1 
        151 1 1 1 1  76 GLU HB3  .  76 . HB1  1 1 
        151 1 2 1 1  77 GLY H    .  77 . HN   1 1 
        152 1 1 1 1  78 VAL H    .  78 . HN   1 1 
        152 1 2 1 1  79 SER H    .  79 . HN   1 1 
        153 1 1 1 1  78 VAL HA   .  78 . HA   1 1 
        153 1 2 1 1  79 SER H    .  79 . HN   1 1 
        154 1 1 1 1  47 MET ME   .  47 . HE*  1 1 
        154 1 2 1 1  79 SER H    .  79 . HN   1 1 
        155 1 1 1 1  78 VAL MG2  .  78 . HG2* 1 1 
        155 1 2 1 1  79 SER H    .  79 . HN   1 1 
        156 1 1 1 1  78 VAL MG1  .  78 . HG1* 1 1 
        156 1 2 1 1  79 SER H    .  79 . HN   1 1 
        157 1 1 1 1  79 SER H    .  79 . HN   1 1 
        157 1 2 1 1  80 TYR H    .  80 . HN   1 1 
        158 1 1 1 1  79 SER HA   .  79 . HA   1 1 
        158 1 2 1 1  80 TYR H    .  80 . HN   1 1 
        159 1 1 1 1  80 TYR HA   .  80 . HA   1 1 
        159 1 2 1 1  81 ASP H    .  81 . HN   1 1 
        160 1 1 1 1  81 ASP HA   .  81 . HA   1 1 
        160 1 2 1 1  82 VAL H    .  82 . HN   1 1 
        161 1 1 1 1  81 ASP HB2  .  81 . HB2  1 1 
        161 1 2 1 1  82 VAL H    .  82 . HN   1 1 
        162 1 1 1 1  82 VAL H    .  82 . HN   1 1 
        162 1 2 1 1  83 LEU H    .  83 . HN   1 1 
        163 1 1 1 1  82 VAL HA   .  82 . HA   1 1 
        163 1 2 1 1  83 LEU H    .  83 . HN   1 1 
        164 1 1 1 1  82 VAL HB   .  82 . HB   1 1 
        164 1 2 1 1  83 LEU H    .  83 . HN   1 1 
        165 1 1 1 1  82 VAL MG1  .  82 . HG1* 1 1 
        165 1 2 1 1  83 LEU H    .  83 . HN   1 1 
        166 1 1 1 1  83 LEU H    .  83 . HN   1 1 
        166 1 2 1 1  84 LYS H    .  84 . HN   1 1 
        167 1 1 1 1  83 LEU HA   .  83 . HA   1 1 
        167 1 2 1 1  84 LYS H    .  84 . HN   1 1 
        168 1 1 1 1  83 LEU HG   .  83 . HG   1 1 
        168 1 2 1 1  84 LYS H    .  84 . HN   1 1 
        169 1 1 1 1  83 LEU MD1  .  83 . HD1* 1 1 
        169 1 2 1 1  84 LYS H    .  84 . HN   1 1 
        170 1 1 1 1  84 LYS H    .  84 . HN   1 1 
        170 1 2 1 1  85 SER H    .  85 . HN   1 1 
        171 1 1 1 1  84 LYS HA   .  84 . HA   1 1 
        171 1 2 1 1  85 SER H    .  85 . HN   1 1 
        172 1 1 1 1  84 LYS HB2  .  84 . HB2  1 1 
        172 1 2 1 1  85 SER H    .  85 . HN   1 1 
        173 1 1 1 1  84 LYS HB3  .  84 . HB1  1 1 
        173 1 2 1 1  85 SER H    .  85 . HN   1 1 
        174 1 1 1 1  86 THR HB   .  86 . HB   1 1 
        174 1 2 1 1  87 ASP H    .  87 . HN   1 1 
        175 1 1 1 1  86 THR MG   .  86 . HG2* 1 1 
        175 1 2 1 1  87 ASP H    .  87 . HN   1 1 
        176 1 1 1 1  89 GLU HG3  .  89 . HG1  1 1 
        176 1 2 1 1  90 GLU H    .  90 . HN   1 1 
        177 1 1 1 1  90 GLU HB2  .  90 . HB2  1 1 
        177 1 2 1 1  91 LEU H    .  91 . HN   1 1 
        178 1 1 1 1  91 LEU H    .  91 . HN   1 1 
        178 1 2 1 1  92 THR H    .  92 . HN   1 1 
        179 1 1 1 1  91 LEU HB2  .  91 . HB2  1 1 
        179 1 2 1 1  92 THR H    .  92 . HN   1 1 
        180 1 1 1 1  91 LEU HB3  .  91 . HB1  1 1 
        180 1 2 1 1  92 THR H    .  92 . HN   1 1 
        181 1 1 1 1  91 LEU HG   .  91 . HG   1 1 
        181 1 2 1 1  92 THR H    .  92 . HN   1 1 
        182 1 1 1 1  91 LEU MD1  .  91 . HD1* 1 1 
        182 1 2 1 1  92 THR H    .  92 . HN   1 1 
        183 1 1 1 1  92 THR HB   .  92 . HB   1 1 
        183 1 2 1 1  93 GLN H    .  93 . HN   1 1 
        184 1 1 1 1  92 THR MG   .  92 . HG2* 1 1 
        184 1 2 1 1  93 GLN H    .  93 . HN   1 1 
        185 1 1 1 1  93 GLN HG2  .  93 . HG2  1 1 
        185 1 2 1 1  94 ARG H    .  94 . HN   1 1 
        186 1 1 1 1  93 GLN HG3  .  93 . HG1  1 1 
        186 1 2 1 1  94 ARG H    .  94 . HN   1 1 
        187 1 1 1 1  94 ARG HB3  .  94 . HB1  1 1 
        187 1 2 1 1  95 VAL H    .  95 . HN   1 1 
        188 1 1 1 1 106 GLU H    . 106 . HN   1 1 
        188 1 2 1 1 106 GLU HB3  . 106 . HB1  1 1 
        189 1 1 1 1  94 ARG HB2  .  94 . HB2  1 1 
        189 1 2 1 1  95 VAL H    .  95 . HN   1 1 
        190 1 1 1 1  95 VAL H    .  95 . HN   1 1 
        190 1 2 1 1  96 ARG H    .  96 . HN   1 1 
        191 1 1 1 1  95 VAL HB   .  95 . HB   1 1 
        191 1 2 1 1  96 ARG H    .  96 . HN   1 1 
        192 1 1 1 1  95 VAL MG1  .  95 . HG1* 1 1 
        192 1 2 1 1  96 ARG H    .  96 . HN   1 1 
        193 1 1 1 1  96 ARG HG2  .  96 . HG2  1 1 
        193 1 2 1 1  97 GLU H    .  97 . HN   1 1 
        194 1 1 1 1  96 ARG HG3  .  96 . HG1  1 1 
        194 1 2 1 1  97 GLU H    .  97 . HN   1 1 
        195 1 1 1 1  96 ARG HD2  .  96 . HD2  1 1 
        195 1 2 1 1  97 GLU H    .  97 . HN   1 1 
        196 1 1 1 1  96 ARG HD3  .  96 . HD1  1 1 
        196 1 2 1 1  97 GLU H    .  97 . HN   1 1 
        197 1 1 1 1  97 GLU H    .  97 . HN   1 1 
        197 1 2 1 1  98 PHE H    .  98 . HN   1 1 
        198 1 1 1 1  97 GLU HB2  .  97 . HB2  1 1 
        198 1 2 1 1  98 PHE H    .  98 . HN   1 1 
        199 1 1 1 1  97 GLU HB3  .  97 . HB1  1 1 
        199 1 2 1 1  98 PHE H    .  98 . HN   1 1 
        200 1 1 1 1  97 GLU HG2  .  97 . HG2  1 1 
        200 1 2 1 1  98 PHE H    .  98 . HN   1 1 
        201 1 1 1 1  98 PHE H    .  98 . HN   1 1 
        201 1 2 1 1  99 LEU H    .  99 . HN   1 1 
        202 1 1 1 1  98 PHE HB2  .  98 . HB2  1 1 
        202 1 2 1 1  99 LEU H    .  99 . HN   1 1 
        203 1 1 1 1  98 PHE HB3  .  98 . HB1  1 1 
        203 1 2 1 1  99 LEU H    .  99 . HN   1 1 
        204 1 1 1 1  98 PHE QD   .  98 . HD*  1 1 
        204 1 2 1 1  99 LEU H    .  99 . HN   1 1 
        205 1 1 1 1  99 LEU H    .  99 . HN   1 1 
        205 1 2 1 1 100 LYS H    . 100 . HN   1 1 
        206 1 1 1 1  99 LEU HB3  .  99 . HB1  1 1 
        206 1 2 1 1 100 LYS H    . 100 . HN   1 1 
        207 1 1 1 1  99 LEU HG   .  99 . HG   1 1 
        207 1 2 1 1 100 LYS H    . 100 . HN   1 1 
        208 1 1 1 1  99 LEU MD2  .  99 . HD2* 1 1 
        208 1 2 1 1 100 LYS H    . 100 . HN   1 1 
        209 1 1 1 1  99 LEU MD1  .  99 . HD1* 1 1 
        209 1 2 1 1 100 LYS H    . 100 . HN   1 1 
        210 1 1 1 1 100 LYS H    . 100 . HN   1 1 
        210 1 2 1 1 101 THR H    . 101 . HN   1 1 
        211 1 1 1 1 101 THR HB   . 101 . HB   1 1 
        211 1 2 1 1 102 ALA H    . 102 . HN   1 1 
        212 1 1 1 1 104 SER HB2  . 104 . HB2  1 1 
        212 1 2 1 1 105 LEU H    . 105 . HN   1 1 
        213 1 1 1 1 104 SER HB3  . 104 . HB1  1 1 
        213 1 2 1 1 105 LEU H    . 105 . HN   1 1 
        214 1 1 1 1 105 LEU HA   . 105 . HA   1 1 
        214 1 2 1 1 106 GLU H    . 106 . HN   1 1 
        215 1 1 1 1 105 LEU HB3  . 105 . HB1  1 1 
        215 1 2 1 1 106 GLU H    . 106 . HN   1 1 
        216 1 1 1 1 105 LEU HB2  . 105 . HB2  1 1 
        216 1 2 1 1 106 GLU H    . 106 . HN   1 1 
        217 1 1 1 1  83 LEU MD2  .  83 . HD2* 1 1 
        217 1 2 1 1  95 VAL H    .  95 . HN   1 1 
        218 1 1 1 1  50 ASN HA   .  50 . HA   1 1 
        218 1 2 1 1  50 ASN HD21 .  50 . HD21 1 1 
        219 1 1 1 1  50 ASN HA   .  50 . HA   1 1 
        219 1 2 1 1  50 ASN HD22 .  50 . HD22 1 1 
        220 1 1 1 1  59 ASN HA   .  59 . HA   1 1 
        220 1 2 1 1  59 ASN HD21 .  59 . HD21 1 1 
        221 1 1 1 1  67 ASN HA   .  67 . HA   1 1 
        221 1 2 1 1  67 ASN HD22 .  67 . HD22 1 1 
        222 1 1 1 1  67 ASN HB2  .  67 . HB2  1 1 
        222 1 2 1 1  67 ASN HD22 .  67 . HD22 1 1 
        223 1 1 1 1  67 ASN HB3  .  67 . HB1  1 1 
        223 1 2 1 1  67 ASN HD22 .  67 . HD22 1 1 
        224 1 1 1 1  67 ASN HA   .  67 . HA   1 1 
        224 1 2 1 1  71 ASN HD21 .  71 . HD21 1 1 
        225 1 1 1 1  67 ASN HA   .  67 . HA   1 1 
        225 1 2 1 1  71 ASN HD22 .  71 . HD22 1 1 
        226 1 1 1 1  93 GLN HE22 .  93 . HE22 1 1 
        226 1 2 1 1  97 GLU HG3  .  97 . HG1  1 1 
        227 1 1 1 1   4 VAL H    .   4 . HN   1 1 
        227 1 2 1 1   4 VAL HB   .   4 . HB   1 1 
        228 1 1 1 1   5 LEU H    .   5 . HN   1 1 
        228 1 2 1 1  55 VAL HA   .  55 . HA   1 1 
        229 1 1 1 1   5 LEU H    .   5 . HN   1 1 
        229 1 2 1 1   5 LEU HB2  .   5 . HB2  1 1 
        230 1 1 1 1   5 LEU H    .   5 . HN   1 1 
        230 1 2 1 1   5 LEU HB3  .   5 . HB1  1 1 
        231 1 1 1 1   5 LEU H    .   5 . HN   1 1 
        231 1 2 1 1   5 LEU MD1  .   5 . HD1* 1 1 
        232 1 1 1 1   5 LEU H    .   5 . HN   1 1 
        232 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
        233 1 1 1 1   6 LEU H    .   6 . HN   1 1 
        233 1 2 1 1   6 LEU HB2  .   6 . HB2  1 1 
        234 1 1 1 1   6 LEU H    .   6 . HN   1 1 
        234 1 2 1 1   6 LEU HB3  .   6 . HB1  1 1 
        235 1 1 1 1   6 LEU H    .   6 . HN   1 1 
        235 1 2 1 1   6 LEU HG   .   6 . HG   1 1 
        236 1 1 1 1   6 LEU H    .   6 . HN   1 1 
        236 1 2 1 1   6 LEU MD1  .   6 . HD1* 1 1 
        237 1 1 1 1   6 LEU H    .   6 . HN   1 1 
        237 1 2 1 1   7 VAL MG2  .   7 . HG2* 1 1 
        238 1 1 1 1   7 VAL H    .   7 . HN   1 1 
        238 1 2 1 1   7 VAL HB   .   7 . HB   1 1 
        239 1 1 1 1   7 VAL H    .   7 . HN   1 1 
        239 1 2 1 1   7 VAL MG2  .   7 . HG2* 1 1 
        240 1 1 1 1   8 ILE H    .   8 . HN   1 1 
        240 1 2 1 1   8 ILE HB   .   8 . HB   1 1 
        241 1 1 1 1   8 ILE H    .   8 . HN   1 1 
        241 1 2 1 1  91 LEU MD2  .  91 . HD2* 1 1 
        242 1 1 1 1   8 ILE H    .   8 . HN   1 1 
        242 1 2 1 1   8 ILE HG12 .   8 . HG12 1 1 
        243 1 1 1 1   8 ILE H    .   8 . HN   1 1 
        243 1 2 1 1   8 ILE HG13 .   8 . HG11 1 1 
        244 1 1 1 1   9 SER H    .   9 . HN   1 1 
        244 1 2 1 1   9 SER HB3  .   9 . HB1  1 1 
        245 1 1 1 1  11 ASP H    .  11 . HN   1 1 
        245 1 2 1 1  11 ASP HB2  .  11 . HB2  1 1 
        246 1 1 1 1  11 ASP H    .  11 . HN   1 1 
        246 1 2 1 1  11 ASP HB3  .  11 . HB1  1 1 
        247 1 1 1 1  13 ASN H    .  13 . HN   1 1 
        247 1 2 1 1  13 ASN HB2  .  13 . HB2  1 1 
        248 1 1 1 1  13 ASN H    .  13 . HN   1 1 
        248 1 2 1 1  13 ASN HB3  .  13 . HB1  1 1 
        249 1 1 1 1  14 ILE H    .  14 . HN   1 1 
        249 1 2 1 1  14 ILE HB   .  14 . HB   1 1 
        250 1 1 1 1  14 ILE H    .  14 . HN   1 1 
        250 1 2 1 1  14 ILE MG   .  14 . HG2* 1 1 
        251 1 1 1 1  14 ILE H    .  14 . HN   1 1 
        251 1 2 1 1  14 ILE HG12 .  14 . HG12 1 1 
        252 1 1 1 1  14 ILE H    .  14 . HN   1 1 
        252 1 2 1 1  14 ILE MD   .  14 . HD1* 1 1 
        253 1 1 1 1  15 ILE H    .  15 . HN   1 1 
        253 1 2 1 1  15 ILE HB   .  15 . HB   1 1 
        254 1 1 1 1  15 ILE H    .  15 . HN   1 1 
        254 1 2 1 1  15 ILE MG   .  15 . HG2* 1 1 
        255 1 1 1 1  15 ILE H    .  15 . HN   1 1 
        255 1 2 1 1  15 ILE HG12 .  15 . HG12 1 1 
        256 1 1 1 1  15 ILE H    .  15 . HN   1 1 
        256 1 2 1 1  15 ILE HG13 .  15 . HG11 1 1 
        257 1 1 1 1  15 ILE H    .  15 . HN   1 1 
        257 1 2 1 1  15 ILE MD   .  15 . HD1* 1 1 
        258 1 1 1 1  16 SER H    .  16 . HN   1 1 
        258 1 2 1 1  16 SER HB2  .  16 . HB2  1 1 
        259 1 1 1 1  18 VAL H    .  18 . HN   1 1 
        259 1 2 1 1  18 VAL HB   .  18 . HB   1 1 
        260 1 1 1 1  18 VAL H    .  18 . HN   1 1 
        260 1 2 1 1  18 VAL MG1  .  18 . HG1* 1 1 
        261 1 1 1 1  18 VAL H    .  18 . HN   1 1 
        261 1 2 1 1  18 VAL MG2  .  18 . HG2* 1 1 
        262 1 1 1 1  19 GLN H    .  19 . HN   1 1 
        262 1 2 1 1  19 GLN HB2  .  19 . HB2  1 1 
        263 1 1 1 1  19 GLN H    .  19 . HN   1 1 
        263 1 2 1 1  19 GLN HB3  .  19 . HB1  1 1 
        264 1 1 1 1  21 ARG H    .  21 . HN   1 1 
        264 1 2 1 1  21 ARG HG2  .  21 . HG2  1 1 
        265 1 1 1 1  21 ARG H    .  21 . HN   1 1 
        265 1 2 1 1  21 ARG HG3  .  21 . HG1  1 1 
        266 1 1 1 1  22 ALA H    .  22 . HN   1 1 
        266 1 2 1 1  22 ALA MB   .  22 . HB*  1 1 
        267 1 1 1 1  22 ALA MB   .  22 . HB*  1 1 
        267 1 2 1 1  23 LYS H    .  23 . HN   1 1 
        268 1 1 1 1  23 LYS H    .  23 . HN   1 1 
        268 1 2 1 1  23 LYS HG3  .  23 . HG1  1 1 
        269 1 1 1 1  24 HIS H    .  24 . HN   1 1 
        269 1 2 1 1  24 HIS HB2  .  24 . HB2  1 1 
        270 1 1 1 1  24 HIS H    .  24 . HN   1 1 
        270 1 2 1 1  24 HIS HB3  .  24 . HB1  1 1 
        271 1 1 1 1  24 HIS H    .  24 . HN   1 1 
        271 1 2 1 1  24 HIS HD2  .  24 . HD2  1 1 
        272 1 1 1 1  32 ARG H    .  32 . HN   1 1 
        272 1 2 1 1  32 ARG HB2  .  32 . HB2  1 1 
        273 1 1 1 1  32 ARG H    .  32 . HN   1 1 
        273 1 2 1 1  32 ARG HB3  .  32 . HB1  1 1 
        274 1 1 1 1  32 ARG H    .  32 . HN   1 1 
        274 1 2 1 1  32 ARG HG3  .  32 . HG1  1 1 
        275 1 1 1 1  33 THR H    .  33 . HN   1 1 
        275 1 2 1 1  33 THR HB   .  33 . HB   1 1 
        276 1 1 1 1  33 THR H    .  33 . HN   1 1 
        276 1 2 1 1  33 THR MG   .  33 . HG2* 1 1 
        277 1 1 1 1  34 ALA H    .  34 . HN   1 1 
        277 1 2 1 1  34 ALA MB   .  34 . HB*  1 1 
        278 1 1 1 1  35 THR H    .  35 . HN   1 1 
        278 1 2 1 1  35 THR MG   .  35 . HG2* 1 1 
        279 1 1 1 1  38 GLN H    .  38 . HN   1 1 
        279 1 2 1 1  38 GLN HB2  .  38 . HB2  1 1 
        280 1 1 1 1  38 GLN H    .  38 . HN   1 1 
        280 1 2 1 1  38 GLN HB3  .  38 . HB1  1 1 
        281 1 1 1 1  38 GLN H    .  38 . HN   1 1 
        281 1 2 1 1  38 GLN HG2  .  38 . HG2  1 1 
        282 1 1 1 1  39 ASP H    .  39 . HN   1 1 
        282 1 2 1 1  39 ASP HB2  .  39 . HB2  1 1 
        283 1 1 1 1  39 ASP H    .  39 . HN   1 1 
        283 1 2 1 1  39 ASP HB3  .  39 . HB1  1 1 
        284 1 1 1 1  40 ILE H    .  40 . HN   1 1 
        284 1 2 1 1  40 ILE HB   .  40 . HB   1 1 
        285 1 1 1 1  40 ILE H    .  40 . HN   1 1 
        285 1 2 1 1  40 ILE MG   .  40 . HG2* 1 1 
        286 1 1 1 1  40 ILE H    .  40 . HN   1 1 
        286 1 2 1 1  40 ILE HG12 .  40 . HG12 1 1 
        287 1 1 1 1  40 ILE H    .  40 . HN   1 1 
        287 1 2 1 1  40 ILE HG13 .  40 . HG11 1 1 
        288 1 1 1 1  40 ILE H    .  40 . HN   1 1 
        288 1 2 1 1  40 ILE MD   .  40 . HD1* 1 1 
        289 1 1 1 1  41 ARG H    .  41 . HN   1 1 
        289 1 2 1 1  41 ARG HG2  .  41 . HG2  1 1 
        290 1 1 1 1  41 ARG H    .  41 . HN   1 1 
        290 1 2 1 1  41 ARG HG3  .  41 . HG1  1 1 
        291 1 1 1 1  42 ASP H    .  42 . HN   1 1 
        291 1 2 1 1  42 ASP HB2  .  42 . HB2  1 1 
        292 1 1 1 1  43 ILE H    .  43 . HN   1 1 
        292 1 2 1 1  43 ILE MG   .  43 . HG2* 1 1 
        293 1 1 1 1  43 ILE H    .  43 . HN   1 1 
        293 1 2 1 1  43 ILE MD   .  43 . HD1* 1 1 
        294 1 1 1 1  43 ILE HB   .  43 . HB   1 1 
        294 1 2 1 1  44 ILE H    .  44 . HN   1 1 
        295 1 1 1 1  44 ILE H    .  44 . HN   1 1 
        295 1 2 1 1  44 ILE HB   .  44 . HB   1 1 
        296 1 1 1 1   4 VAL H    .   4 . HN   1 1 
        296 1 2 1 1   4 VAL MG1  .   4 . HG1* 1 1 
        297 1 1 1 1  44 ILE H    .  44 . HN   1 1 
        297 1 2 1 1  44 ILE HG12 .  44 . HG12 1 1 
        298 1 1 1 1  44 ILE H    .  44 . HN   1 1 
        298 1 2 1 1  44 ILE HG13 .  44 . HG11 1 1 
        299 1 1 1 1  44 ILE H    .  44 . HN   1 1 
        299 1 2 1 1  44 ILE MD   .  44 . HD1* 1 1 
        300 1 1 1 1  47 MET H    .  47 . HN   1 1 
        300 1 2 1 1  47 MET HG2  .  47 . HG2  1 1 
        301 1 1 1 1  47 MET H    .  47 . HN   1 1 
        301 1 2 1 1  47 MET HG3  .  47 . HG1  1 1 
        302 1 1 1 1  47 MET H    .  47 . HN   1 1 
        302 1 2 1 1  47 MET ME   .  47 . HE*  1 1 
        303 1 1 1 1  48 LYS H    .  48 . HN   1 1 
        303 1 2 1 1  48 LYS HB2  .  48 . HB2  1 1 
        304 1 1 1 1  48 LYS H    .  48 . HN   1 1 
        304 1 2 1 1  48 LYS HB3  .  48 . HB1  1 1 
        305 1 1 1 1  48 LYS H    .  48 . HN   1 1 
        305 1 2 1 1  48 LYS HG2  .  48 . HG2  1 1 
        306 1 1 1 1  48 LYS H    .  48 . HN   1 1 
        306 1 2 1 1  48 LYS HG3  .  48 . HG1  1 1 
        307 1 1 1 1  54 LEU H    .  54 . HN   1 1 
        307 1 2 1 1  54 LEU HG   .  54 . HG   1 1 
        308 1 1 1 1  54 LEU H    .  54 . HN   1 1 
        308 1 2 1 1  54 LEU MD1  .  54 . HD1* 1 1 
        309 1 1 1 1  54 LEU H    .  54 . HN   1 1 
        309 1 2 1 1  54 LEU MD2  .  54 . HD2* 1 1 
        310 1 1 1 1  56 VAL H    .  56 . HN   1 1 
        310 1 2 1 1  56 VAL HB   .  56 . HB   1 1 
        311 1 1 1 1  56 VAL H    .  56 . HN   1 1 
        311 1 2 1 1  56 VAL MG2  .  56 . HG2* 1 1 
        312 1 1 1 1  56 VAL H    .  56 . HN   1 1 
        312 1 2 1 1  56 VAL MG1  .  56 . HG1* 1 1 
        313 1 1 1 1  57 PHE H    .  57 . HN   1 1 
        313 1 2 1 1  57 PHE HB2  .  57 . HB2  1 1 
        314 1 1 1 1  57 PHE H    .  57 . HN   1 1 
        314 1 2 1 1  57 PHE HB3  .  57 . HB1  1 1 
        315 1 1 1 1  57 PHE H    .  57 . HN   1 1 
        315 1 2 1 1  57 PHE QE   .  57 . HE*  1 1 
        316 1 1 1 1  58 VAL H    .  58 . HN   1 1 
        316 1 2 1 1  58 VAL HB   .  58 . HB   1 1 
        317 1 1 1 1  58 VAL H    .  58 . HN   1 1 
        317 1 2 1 1  58 VAL MG1  .  58 . HG1* 1 1 
        318 1 1 1 1  58 VAL H    .  58 . HN   1 1 
        318 1 2 1 1  58 VAL MG2  .  58 . HG2* 1 1 
        319 1 1 1 1  59 ASN H    .  59 . HN   1 1 
        319 1 2 1 1  59 ASN HB2  .  59 . HB2  1 1 
        320 1 1 1 1  59 ASN H    .  59 . HN   1 1 
        320 1 2 1 1  59 ASN HB3  .  59 . HB1  1 1 
        321 1 1 1 1  65 ASP H    .  65 . HN   1 1 
        321 1 2 1 1  65 ASP HB2  .  65 . HB2  1 1 
        322 1 1 1 1  65 ASP H    .  65 . HN   1 1 
        322 1 2 1 1  65 ASP HB3  .  65 . HB1  1 1 
        323 1 1 1 1  66 VAL H    .  66 . HN   1 1 
        323 1 2 1 1  66 VAL HB   .  66 . HB   1 1 
        324 1 1 1 1  66 VAL H    .  66 . HN   1 1 
        324 1 2 1 1  66 VAL MG1  .  66 . HG1* 1 1 
        325 1 1 1 1  66 VAL H    .  66 . HN   1 1 
        325 1 2 1 1  66 VAL MG2  .  66 . HG2* 1 1 
        326 1 1 1 1  67 ASN H    .  67 . HN   1 1 
        326 1 2 1 1  67 ASN HB2  .  67 . HB2  1 1 
        327 1 1 1 1  69 PHE H    .  69 . HN   1 1 
        327 1 2 1 1  69 PHE HB2  .  69 . HB2  1 1 
        328 1 1 1 1  69 PHE H    .  69 . HN   1 1 
        328 1 2 1 1  69 PHE HB3  .  69 . HB1  1 1 
        329 1 1 1 1  69 PHE H    .  69 . HN   1 1 
        329 1 2 1 1  69 PHE QD   .  69 . HD*  1 1 
        330 1 1 1 1  70 GLN H    .  70 . HN   1 1 
        330 1 2 1 1  70 GLN HB3  .  70 . HB1  1 1 
        331 1 1 1 1  70 GLN H    .  70 . HN   1 1 
        331 1 2 1 1  70 GLN HG2  .  70 . HG2  1 1 
        332 1 1 1 1  70 GLN H    .  70 . HN   1 1 
        332 1 2 1 1  70 GLN HG3  .  70 . HG1  1 1 
        333 1 1 1 1  71 ASN H    .  71 . HN   1 1 
        333 1 2 1 1  71 ASN HB2  .  71 . HB2  1 1 
        334 1 1 1 1  71 ASN H    .  71 . HN   1 1 
        334 1 2 1 1  71 ASN HB3  .  71 . HB1  1 1 
        335 1 1 1 1  72 GLU H    .  72 . HN   1 1 
        335 1 2 1 1  72 GLU HG2  .  72 . HG2  1 1 
        336 1 1 1 1  72 GLU H    .  72 . HN   1 1 
        336 1 2 1 1  72 GLU HG3  .  72 . HG1  1 1 
        337 1 1 1 1  73 ALA H    .  73 . HN   1 1 
        337 1 2 1 1  73 ALA MB   .  73 . HB*  1 1 
        338 1 1 1 1  74 LYS H    .  74 . HN   1 1 
        338 1 2 1 1  74 LYS HG2  .  74 . HG2  1 1 
        339 1 1 1 1  74 LYS H    .  74 . HN   1 1 
        339 1 2 1 1  74 LYS HG3  .  74 . HG1  1 1 
        340 1 1 1 1  75 LYS H    .  75 . HN   1 1 
        340 1 2 1 1  75 LYS HG2  .  75 . HG2  1 1 
        341 1 1 1 1  75 LYS H    .  75 . HN   1 1 
        341 1 2 1 1  75 LYS HG3  .  75 . HG1  1 1 
        342 1 1 1 1  76 GLU H    .  76 . HN   1 1 
        342 1 2 1 1  76 GLU HB2  .  76 . HB2  1 1 
        343 1 1 1 1  76 GLU H    .  76 . HN   1 1 
        343 1 2 1 1  76 GLU HB3  .  76 . HB1  1 1 
        344 1 1 1 1  76 GLU H    .  76 . HN   1 1 
        344 1 2 1 1  76 GLU HG2  .  76 . HG2  1 1 
        345 1 1 1 1  78 VAL H    .  78 . HN   1 1 
        345 1 2 1 1  78 VAL HB   .  78 . HB   1 1 
        346 1 1 1 1  78 VAL H    .  78 . HN   1 1 
        346 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
        347 1 1 1 1  80 TYR H    .  80 . HN   1 1 
        347 1 2 1 1  80 TYR QD   .  80 . HD*  1 1 
        348 1 1 1 1  81 ASP H    .  81 . HN   1 1 
        348 1 2 1 1  81 ASP HB3  .  81 . HB1  1 1 
        349 1 1 1 1  82 VAL H    .  82 . HN   1 1 
        349 1 2 1 1  82 VAL HB   .  82 . HB   1 1 
        350 1 1 1 1  82 VAL H    .  82 . HN   1 1 
        350 1 2 1 1  82 VAL MG2  .  82 . HG2* 1 1 
        351 1 1 1 1  82 VAL H    .  82 . HN   1 1 
        351 1 2 1 1  82 VAL MG1  .  82 . HG1* 1 1 
        352 1 1 1 1  83 LEU H    .  83 . HN   1 1 
        352 1 2 1 1  83 LEU HB2  .  83 . HB2  1 1 
        353 1 1 1 1  83 LEU H    .  83 . HN   1 1 
        353 1 2 1 1  83 LEU HB3  .  83 . HB1  1 1 
        354 1 1 1 1  83 LEU H    .  83 . HN   1 1 
        354 1 2 1 1  83 LEU HG   .  83 . HG   1 1 
        355 1 1 1 1  84 LYS H    .  84 . HN   1 1 
        355 1 2 1 1  84 LYS HB2  .  84 . HB2  1 1 
        356 1 1 1 1  84 LYS H    .  84 . HN   1 1 
        356 1 2 1 1  84 LYS HB3  .  84 . HB1  1 1 
        357 1 1 1 1  85 SER H    .  85 . HN   1 1 
        357 1 2 1 1  85 SER HB2  .  85 . HB2  1 1 
        358 1 1 1 1  85 SER H    .  85 . HN   1 1 
        358 1 2 1 1  85 SER HB3  .  85 . HB1  1 1 
        359 1 1 1 1  87 ASP H    .  87 . HN   1 1 
        359 1 2 1 1  87 ASP HB2  .  87 . HB2  1 1 
        360 1 1 1 1  87 ASP H    .  87 . HN   1 1 
        360 1 2 1 1  87 ASP HB3  .  87 . HB1  1 1 
        361 1 1 1 1  89 GLU H    .  89 . HN   1 1 
        361 1 2 1 1  89 GLU HG2  .  89 . HG2  1 1 
        362 1 1 1 1  89 GLU H    .  89 . HN   1 1 
        362 1 2 1 1  89 GLU HG3  .  89 . HG1  1 1 
        363 1 1 1 1  90 GLU H    .  90 . HN   1 1 
        363 1 2 1 1  90 GLU HB2  .  90 . HB2  1 1 
        364 1 1 1 1  90 GLU H    .  90 . HN   1 1 
        364 1 2 1 1  90 GLU HB3  .  90 . HB1  1 1 
        365 1 1 1 1  89 GLU HG2  .  89 . HG2  1 1 
        365 1 2 1 1  90 GLU H    .  90 . HN   1 1 
        366 1 1 1 1  91 LEU H    .  91 . HN   1 1 
        366 1 2 1 1  91 LEU HB2  .  91 . HB2  1 1 
        367 1 1 1 1  91 LEU H    .  91 . HN   1 1 
        367 1 2 1 1  91 LEU HB3  .  91 . HB1  1 1 
        368 1 1 1 1  91 LEU H    .  91 . HN   1 1 
        368 1 2 1 1  91 LEU HG   .  91 . HG   1 1 
        369 1 1 1 1  91 LEU H    .  91 . HN   1 1 
        369 1 2 1 1  91 LEU MD2  .  91 . HD2* 1 1 
        370 1 1 1 1  91 LEU H    .  91 . HN   1 1 
        370 1 2 1 1  91 LEU MD1  .  91 . HD1* 1 1 
        371 1 1 1 1  92 THR H    .  92 . HN   1 1 
        371 1 2 1 1  92 THR HB   .  92 . HB   1 1 
        372 1 1 1 1  93 GLN H    .  93 . HN   1 1 
        372 1 2 1 1  93 GLN HG2  .  93 . HG2  1 1 
        373 1 1 1 1  93 GLN H    .  93 . HN   1 1 
        373 1 2 1 1  93 GLN HG3  .  93 . HG1  1 1 
        374 1 1 1 1  94 ARG H    .  94 . HN   1 1 
        374 1 2 1 1  94 ARG HB3  .  94 . HB1  1 1 
        375 1 1 1 1  94 ARG H    .  94 . HN   1 1 
        375 1 2 1 1  94 ARG HB2  .  94 . HB2  1 1 
        376 1 1 1 1  94 ARG H    .  94 . HN   1 1 
        376 1 2 1 1  94 ARG HD2  .  94 . HD2  1 1 
        377 1 1 1 1  94 ARG H    .  94 . HN   1 1 
        377 1 2 1 1  94 ARG HD3  .  94 . HD1  1 1 
        378 1 1 1 1  95 VAL H    .  95 . HN   1 1 
        378 1 2 1 1  95 VAL HB   .  95 . HB   1 1 
        379 1 1 1 1  95 VAL H    .  95 . HN   1 1 
        379 1 2 1 1  95 VAL MG2  .  95 . HG2* 1 1 
        380 1 1 1 1  96 ARG H    .  96 . HN   1 1 
        380 1 2 1 1  96 ARG HG2  .  96 . HG2  1 1 
        381 1 1 1 1  96 ARG H    .  96 . HN   1 1 
        381 1 2 1 1  96 ARG HG3  .  96 . HG1  1 1 
        382 1 1 1 1  96 ARG H    .  96 . HN   1 1 
        382 1 2 1 1  96 ARG HD2  .  96 . HD2  1 1 
        383 1 1 1 1  96 ARG H    .  96 . HN   1 1 
        383 1 2 1 1  96 ARG HD3  .  96 . HD1  1 1 
        384 1 1 1 1  97 GLU H    .  97 . HN   1 1 
        384 1 2 1 1  97 GLU HB3  .  97 . HB1  1 1 
        385 1 1 1 1  97 GLU H    .  97 . HN   1 1 
        385 1 2 1 1  97 GLU HG3  .  97 . HG1  1 1 
        386 1 1 1 1  98 PHE H    .  98 . HN   1 1 
        386 1 2 1 1  98 PHE HB2  .  98 . HB2  1 1 
        387 1 1 1 1  98 PHE H    .  98 . HN   1 1 
        387 1 2 1 1  98 PHE HB3  .  98 . HB1  1 1 
        388 1 1 1 1  98 PHE H    .  98 . HN   1 1 
        388 1 2 1 1  98 PHE QD   .  98 . HD*  1 1 
        389 1 1 1 1  99 LEU H    .  99 . HN   1 1 
        389 1 2 1 1  99 LEU HB2  .  99 . HB2  1 1 
        390 1 1 1 1  99 LEU H    .  99 . HN   1 1 
        390 1 2 1 1  99 LEU HB3  .  99 . HB1  1 1 
        391 1 1 1 1  99 LEU H    .  99 . HN   1 1 
        391 1 2 1 1  99 LEU HG   .  99 . HG   1 1 
        392 1 1 1 1  99 LEU H    .  99 . HN   1 1 
        392 1 2 1 1  99 LEU MD2  .  99 . HD2* 1 1 
        393 1 1 1 1  99 LEU H    .  99 . HN   1 1 
        393 1 2 1 1  99 LEU MD1  .  99 . HD1* 1 1 
        394 1 1 1 1 100 LYS H    . 100 . HN   1 1 
        394 1 2 1 1 100 LYS HB2  . 100 . HB2  1 1 
        395 1 1 1 1 100 LYS H    . 100 . HN   1 1 
        395 1 2 1 1 100 LYS HB3  . 100 . HB1  1 1 
        396 1 1 1 1  99 LEU HB2  .  99 . HB2  1 1 
        396 1 2 1 1 100 LYS H    . 100 . HN   1 1 
        397 1 1 1 1 101 THR H    . 101 . HN   1 1 
        397 1 2 1 1 101 THR MG   . 101 . HG2* 1 1 
        398 1 1 1 1 105 LEU H    . 105 . HN   1 1 
        398 1 2 1 1 105 LEU MD2  . 105 . HD2* 1 1 
        399 1 1 1 1 106 GLU H    . 106 . HN   1 1 
        399 1 2 1 1 106 GLU HB2  . 106 . HB2  1 1 
        400 1 1 1 1  68 GLU H    .  68 . HN   1 1 
        400 1 2 1 1  68 GLU HB3  .  68 . HB1  1 1 
        401 1 1 1 1 106 GLU H    . 106 . HN   1 1 
        401 1 2 1 1 106 GLU HG3  . 106 . HG1  1 1 
        402 1 1 1 1   5 LEU H    .   5 . HN   1 1 
        402 1 2 1 1   6 LEU H    .   6 . HN   1 1 
        403 1 1 1 1   9 SER H    .   9 . HN   1 1 
        403 1 2 1 1  10 THR H    .  10 . HN   1 1 
        404 1 1 1 1  13 ASN H    .  13 . HN   1 1 
        404 1 2 1 1  14 ILE H    .  14 . HN   1 1 
        405 1 1 1 1  17 SER H    .  17 . HN   1 1 
        405 1 2 1 1  18 VAL H    .  18 . HN   1 1 
        406 1 1 1 1  21 ARG H    .  21 . HN   1 1 
        406 1 2 1 1  22 ALA H    .  22 . HN   1 1 
        407 1 1 1 1  22 ALA H    .  22 . HN   1 1 
        407 1 2 1 1  23 LYS H    .  23 . HN   1 1 
        408 1 1 1 1  34 ALA H    .  34 . HN   1 1 
        408 1 2 1 1  35 THR H    .  35 . HN   1 1 
        409 1 1 1 1  38 GLN H    .  38 . HN   1 1 
        409 1 2 1 1  39 ASP H    .  39 . HN   1 1 
        410 1 1 1 1  39 ASP H    .  39 . HN   1 1 
        410 1 2 1 1  40 ILE H    .  40 . HN   1 1 
        411 1 1 1 1  41 ARG H    .  41 . HN   1 1 
        411 1 2 1 1  42 ASP H    .  42 . HN   1 1 
        412 1 1 1 1  42 ASP H    .  42 . HN   1 1 
        412 1 2 1 1  43 ILE H    .  43 . HN   1 1 
        413 1 1 1 1  45 LYS H    .  45 . HN   1 1 
        413 1 2 1 1  46 SER H    .  46 . HN   1 1 
        414 1 1 1 1  46 SER H    .  46 . HN   1 1 
        414 1 2 1 1  47 MET H    .  47 . HN   1 1 
        415 1 1 1 1  48 LYS H    .  48 . HN   1 1 
        415 1 2 1 1  49 ASP H    .  49 . HN   1 1 
        416 1 1 1 1  49 ASP H    .  49 . HN   1 1 
        416 1 2 1 1  50 ASN H    .  50 . HN   1 1 
        417 1 1 1 1  59 ASN H    .  59 . HN   1 1 
        417 1 2 1 1  60 GLY H    .  60 . HN   1 1 
        418 1 1 1 1  67 ASN H    .  67 . HN   1 1 
        418 1 2 1 1  68 GLU H    .  68 . HN   1 1 
        419 1 1 1 1  70 GLN H    .  70 . HN   1 1 
        419 1 2 1 1  71 ASN H    .  71 . HN   1 1 
        420 1 1 1 1  74 LYS H    .  74 . HN   1 1 
        420 1 2 1 1  75 LYS H    .  75 . HN   1 1 
        421 1 1 1 1  75 LYS H    .  75 . HN   1 1 
        421 1 2 1 1  76 GLU H    .  76 . HN   1 1 
        422 1 1 1 1  77 GLY H    .  77 . HN   1 1 
        422 1 2 1 1  78 VAL H    .  78 . HN   1 1 
        423 1 1 1 1  80 TYR H    .  80 . HN   1 1 
        423 1 2 1 1  81 ASP H    .  81 . HN   1 1 
        424 1 1 1 1  89 GLU H    .  89 . HN   1 1 
        424 1 2 1 1  90 GLU H    .  90 . HN   1 1 
        425 1 1 1 1  90 GLU H    .  90 . HN   1 1 
        425 1 2 1 1  91 LEU H    .  91 . HN   1 1 
        426 1 1 1 1  92 THR H    .  92 . HN   1 1 
        426 1 2 1 1  93 GLN H    .  93 . HN   1 1 
        427 1 1 1 1  93 GLN H    .  93 . HN   1 1 
        427 1 2 1 1  94 ARG H    .  94 . HN   1 1 
        428 1 1 1 1  94 ARG H    .  94 . HN   1 1 
        428 1 2 1 1  95 VAL H    .  95 . HN   1 1 
        429 1 1 1 1  96 ARG H    .  96 . HN   1 1 
        429 1 2 1 1  97 GLU H    .  97 . HN   1 1 
        430 1 1 1 1 101 THR H    . 101 . HN   1 1 
        430 1 2 1 1 102 ALA H    . 102 . HN   1 1 
        431 1 1 1 1  12 THR HA   .  12 . HA   1 1 
        431 1 2 1 1  14 ILE H    .  14 . HN   1 1 
        432 1 1 1 1  14 ILE H    .  14 . HN   1 1 
        432 1 2 1 1  16 SER H    .  16 . HN   1 1 
        433 1 1 1 1  13 ASN HA   .  13 . HA   1 1 
        433 1 2 1 1  15 ILE H    .  15 . HN   1 1 
        434 1 1 1 1  12 THR HA   .  12 . HA   1 1 
        434 1 2 1 1  15 ILE H    .  15 . HN   1 1 
        435 1 1 1 1  13 ASN HA   .  13 . HA   1 1 
        435 1 2 1 1  16 SER H    .  16 . HN   1 1 
        436 1 1 1 1  16 SER H    .  16 . HN   1 1 
        436 1 2 1 1  16 SER HB3  .  16 . HB1  1 1 
        437 1 1 1 1  16 SER H    .  16 . HN   1 1 
        437 1 2 1 1  18 VAL H    .  18 . HN   1 1 
        438 1 1 1 1  16 SER HA   .  16 . HA   1 1 
        438 1 2 1 1  18 VAL H    .  18 . HN   1 1 
        439 1 1 1 1  15 ILE HA   .  15 . HA   1 1 
        439 1 2 1 1  18 VAL H    .  18 . HN   1 1 
        440 1 1 1 1  17 SER HA   .  17 . HA   1 1 
        440 1 2 1 1  19 GLN H    .  19 . HN   1 1 
        441 1 1 1 1  16 SER HA   .  16 . HA   1 1 
        441 1 2 1 1  19 GLN H    .  19 . HN   1 1 
        442 1 1 1 1  15 ILE HA   .  15 . HA   1 1 
        442 1 2 1 1  19 GLN H    .  19 . HN   1 1 
        443 1 1 1 1  17 SER H    .  17 . HN   1 1 
        443 1 2 1 1  19 GLN H    .  19 . HN   1 1 
        444 1 1 1 1  19 GLN H    .  19 . HN   1 1 
        444 1 2 1 1  21 ARG H    .  21 . HN   1 1 
        445 1 1 1 1  18 VAL HA   .  18 . HA   1 1 
        445 1 2 1 1  20 GLU H    .  20 . HN   1 1 
        446 1 1 1 1  17 SER HA   .  17 . HA   1 1 
        446 1 2 1 1  20 GLU H    .  20 . HN   1 1 
        447 1 1 1 1  18 VAL HA   .  18 . HA   1 1 
        447 1 2 1 1  21 ARG H    .  21 . HN   1 1 
        448 1 1 1 1  17 SER HA   .  17 . HA   1 1 
        448 1 2 1 1  21 ARG H    .  21 . HN   1 1 
        449 1 1 1 1  21 ARG H    .  21 . HN   1 1 
        449 1 2 1 1  23 LYS H    .  23 . HN   1 1 
        450 1 1 1 1  20 GLU H    .  20 . HN   1 1 
        450 1 2 1 1  22 ALA H    .  22 . HN   1 1 
        451 1 1 1 1  19 GLN HA   .  19 . HA   1 1 
        451 1 2 1 1  22 ALA H    .  22 . HN   1 1 
        452 1 1 1 1  18 VAL HA   .  18 . HA   1 1 
        452 1 2 1 1  22 ALA H    .  22 . HN   1 1 
        453 1 1 1 1  20 GLU HA   .  20 . HA   1 1 
        453 1 2 1 1  23 LYS H    .  23 . HN   1 1 
        454 1 1 1 1  22 ALA H    .  22 . HN   1 1 
        454 1 2 1 1  24 HIS H    .  24 . HN   1 1 
        455 1 1 1 1  21 ARG HA   .  21 . HA   1 1 
        455 1 2 1 1  24 HIS H    .  24 . HN   1 1 
        456 1 1 1 1  37 SER H    .  37 . HN   1 1 
        456 1 2 1 1  39 ASP H    .  39 . HN   1 1 
        457 1 1 1 1  38 GLN HA   .  38 . HA   1 1 
        457 1 2 1 1  40 ILE H    .  40 . HN   1 1 
        458 1 1 1 1  37 SER HA   .  37 . HA   1 1 
        458 1 2 1 1  40 ILE H    .  40 . HN   1 1 
        459 1 1 1 1  37 SER HA   .  37 . HA   1 1 
        459 1 2 1 1  41 ARG H    .  41 . HN   1 1 
        460 1 1 1 1  41 ARG H    .  41 . HN   1 1 
        460 1 2 1 1  43 ILE H    .  43 . HN   1 1 
        461 1 1 1 1  43 ILE H    .  43 . HN   1 1 
        461 1 2 1 1  45 LYS H    .  45 . HN   1 1 
        462 1 1 1 1  40 ILE HA   .  40 . HA   1 1 
        462 1 2 1 1  42 ASP H    .  42 . HN   1 1 
        463 1 1 1 1  40 ILE H    .  40 . HN   1 1 
        463 1 2 1 1  42 ASP H    .  42 . HN   1 1 
        464 1 1 1 1  39 ASP HA   .  39 . HA   1 1 
        464 1 2 1 1  42 ASP H    .  42 . HN   1 1 
        465 1 1 1 1  42 ASP H    .  42 . HN   1 1 
        465 1 2 1 1  44 ILE H    .  44 . HN   1 1 
        466 1 1 1 1   3 LYS H    .   3 . HN   1 1 
        466 1 2 1 1   4 VAL H    .   4 . HN   1 1 
        467 1 1 1 1  41 ARG HA   .  41 . HA   1 1 
        467 1 2 1 1  44 ILE H    .  44 . HN   1 1 
        468 1 1 1 1  44 ILE H    .  44 . HN   1 1 
        468 1 2 1 1  46 SER H    .  46 . HN   1 1 
        469 1 1 1 1  42 ASP HA   .  42 . HA   1 1 
        469 1 2 1 1  45 LYS H    .  45 . HN   1 1 
        470 1 1 1 1  43 ILE HA   .  43 . HA   1 1 
        470 1 2 1 1  46 SER H    .  46 . HN   1 1 
        471 1 1 1 1  45 LYS HA   .  45 . HA   1 1 
        471 1 2 1 1  47 MET H    .  47 . HN   1 1 
        472 1 1 1 1  44 ILE HA   .  44 . HA   1 1 
        472 1 2 1 1  47 MET H    .  47 . HN   1 1 
        473 1 1 1 1  63 GLN HA   .  63 . HA   1 1 
        473 1 2 1 1  65 ASP H    .  65 . HN   1 1 
        474 1 1 1 1  65 ASP H    .  65 . HN   1 1 
        474 1 2 1 1  67 ASN H    .  67 . HN   1 1 
        475 1 1 1 1  64 ASN HA   .  64 . HA   1 1 
        475 1 2 1 1  66 VAL H    .  66 . HN   1 1 
        476 1 1 1 1  64 ASN HA   .  64 . HA   1 1 
        476 1 2 1 1  67 ASN H    .  67 . HN   1 1 
        477 1 1 1 1  67 ASN H    .  67 . HN   1 1 
        477 1 2 1 1  69 PHE H    .  69 . HN   1 1 
        478 1 1 1 1  64 ASN HA   .  64 . HA   1 1 
        478 1 2 1 1  68 GLU H    .  68 . HN   1 1 
        479 1 1 1 1  67 ASN HA   .  67 . HA   1 1 
        479 1 2 1 1  69 PHE H    .  69 . HN   1 1 
        480 1 1 1 1  66 VAL HA   .  66 . HA   1 1 
        480 1 2 1 1  69 PHE H    .  69 . HN   1 1 
        481 1 1 1 1  65 ASP HA   .  65 . HA   1 1 
        481 1 2 1 1  69 PHE H    .  69 . HN   1 1 
        482 1 1 1 1  68 GLU HA   .  68 . HA   1 1 
        482 1 2 1 1  70 GLN H    .  70 . HN   1 1 
        483 1 1 1 1  68 GLU H    .  68 . HN   1 1 
        483 1 2 1 1  70 GLN H    .  70 . HN   1 1 
        484 1 1 1 1  67 ASN HA   .  67 . HA   1 1 
        484 1 2 1 1  70 GLN H    .  70 . HN   1 1 
        485 1 1 1 1  66 VAL HA   .  66 . HA   1 1 
        485 1 2 1 1  70 GLN H    .  70 . HN   1 1 
        486 1 1 1 1  68 GLU HA   .  68 . HA   1 1 
        486 1 2 1 1  71 ASN H    .  71 . HN   1 1 
        487 1 1 1 1  69 PHE H    .  69 . HN   1 1 
        487 1 2 1 1  72 GLU H    .  72 . HN   1 1 
        488 1 1 1 1  70 GLN H    .  70 . HN   1 1 
        488 1 2 1 1  72 GLU H    .  72 . HN   1 1 
        489 1 1 1 1  69 PHE HA   .  69 . HA   1 1 
        489 1 2 1 1  72 GLU H    .  72 . HN   1 1 
        490 1 1 1 1  70 GLN HA   .  70 . HA   1 1 
        490 1 2 1 1  73 ALA H    .  73 . HN   1 1 
        491 1 1 1 1  69 PHE HA   .  69 . HA   1 1 
        491 1 2 1 1  73 ALA H    .  73 . HN   1 1 
        492 1 1 1 1  72 GLU HA   .  72 . HA   1 1 
        492 1 2 1 1  74 LYS H    .  74 . HN   1 1 
        493 1 1 1 1  74 LYS H    .  74 . HN   1 1 
        493 1 2 1 1  75 LYS HA   .  75 . HA   1 1 
        494 1 1 1 1  71 ASN HA   .  71 . HA   1 1 
        494 1 2 1 1  74 LYS H    .  74 . HN   1 1 
        495 1 1 1 1  70 GLN HA   .  70 . HA   1 1 
        495 1 2 1 1  74 LYS H    .  74 . HN   1 1 
        496 1 1 1 1  73 ALA HA   .  73 . HA   1 1 
        496 1 2 1 1  75 LYS H    .  75 . HN   1 1 
        497 1 1 1 1  73 ALA H    .  73 . HN   1 1 
        497 1 2 1 1  75 LYS H    .  75 . HN   1 1 
        498 1 1 1 1  71 ASN HA   .  71 . HA   1 1 
        498 1 2 1 1  75 LYS H    .  75 . HN   1 1 
        499 1 1 1 1  89 GLU H    .  89 . HN   1 1 
        499 1 2 1 1  91 LEU H    .  91 . HN   1 1 
        500 1 1 1 1  88 PRO HA   .  88 . HA   1 1 
        500 1 2 1 1  90 GLU H    .  90 . HN   1 1 
        501 1 1 1 1  89 GLU HA   .  89 . HA   1 1 
        501 1 2 1 1  91 LEU H    .  91 . HN   1 1 
        502 1 1 1 1  88 PRO HA   .  88 . HA   1 1 
        502 1 2 1 1  91 LEU H    .  91 . HN   1 1 
        503 1 1 1 1  91 LEU H    .  91 . HN   1 1 
        503 1 2 1 1  93 GLN H    .  93 . HN   1 1 
        504 1 1 1 1  90 GLU H    .  90 . HN   1 1 
        504 1 2 1 1  92 THR H    .  92 . HN   1 1 
        505 1 1 1 1  89 GLU HA   .  89 . HA   1 1 
        505 1 2 1 1  92 THR H    .  92 . HN   1 1 
        506 1 1 1 1  88 PRO HA   .  88 . HA   1 1 
        506 1 2 1 1  92 THR H    .  92 . HN   1 1 
        507 1 1 1 1  91 LEU HA   .  91 . HA   1 1 
        507 1 2 1 1  93 GLN H    .  93 . HN   1 1 
        508 1 1 1 1  89 GLU HA   .  89 . HA   1 1 
        508 1 2 1 1  93 GLN H    .  93 . HN   1 1 
        509 1 1 1 1  93 GLN H    .  93 . HN   1 1 
        509 1 2 1 1  95 VAL H    .  95 . HN   1 1 
        510 1 1 1 1  92 THR H    .  92 . HN   1 1 
        510 1 2 1 1  94 ARG H    .  94 . HN   1 1 
        511 1 1 1 1  91 LEU HA   .  91 . HA   1 1 
        511 1 2 1 1  94 ARG H    .  94 . HN   1 1 
        512 1 1 1 1  90 GLU HA   .  90 . HA   1 1 
        512 1 2 1 1  94 ARG H    .  94 . HN   1 1 
        513 1 1 1 1  94 ARG H    .  94 . HN   1 1 
        513 1 2 1 1  96 ARG H    .  96 . HN   1 1 
        514 1 1 1 1  91 LEU HA   .  91 . HA   1 1 
        514 1 2 1 1  95 VAL H    .  95 . HN   1 1 
        515 1 1 1 1  93 GLN HA   .  93 . HA   1 1 
        515 1 2 1 1  96 ARG H    .  96 . HN   1 1 
        516 1 1 1 1  92 THR HA   .  92 . HA   1 1 
        516 1 2 1 1  96 ARG H    .  96 . HN   1 1 
        517 1 1 1 1  96 ARG H    .  96 . HN   1 1 
        517 1 2 1 1  98 PHE H    .  98 . HN   1 1 
        518 1 1 1 1  95 VAL HA   .  95 . HA   1 1 
        518 1 2 1 1  97 GLU H    .  97 . HN   1 1 
        519 1 1 1 1  94 ARG HA   .  94 . HA   1 1 
        519 1 2 1 1  97 GLU H    .  97 . HN   1 1 
        520 1 1 1 1  95 VAL HA   .  95 . HA   1 1 
        520 1 2 1 1  98 PHE H    .  98 . HN   1 1 
        521 1 1 1 1  97 GLU H    .  97 . HN   1 1 
        521 1 2 1 1  99 LEU H    .  99 . HN   1 1 
        522 1 1 1 1  98 PHE H    .  98 . HN   1 1 
        522 1 2 1 1 100 LYS H    . 100 . HN   1 1 
        523 1 1 1 1  97 GLU HA   .  97 . HA   1 1 
        523 1 2 1 1 100 LYS H    . 100 . HN   1 1 
        524 1 1 1 1  96 ARG HA   .  96 . HA   1 1 
        524 1 2 1 1 100 LYS H    . 100 . HN   1 1 
        525 1 1 1 1  98 PHE HA   .  98 . HA   1 1 
        525 1 2 1 1 101 THR H    . 101 . HN   1 1 
        526 1 1 1 1   4 VAL H    .   4 . HN   1 1 
        526 1 2 1 1  80 TYR HA   .  80 . HA   1 1 
        527 1 1 1 1   4 VAL H    .   4 . HN   1 1 
        527 1 2 1 1  80 TYR HB2  .  80 . HB2  1 1 
        528 1 1 1 1   4 VAL H    .   4 . HN   1 1 
        528 1 2 1 1  80 TYR HB3  .  80 . HB1  1 1 
        529 1 1 1 1   4 VAL H    .   4 . HN   1 1 
        529 1 2 1 1  98 PHE QE   .  98 . HE*  1 1 
        530 1 1 1 1   4 VAL H    .   4 . HN   1 1 
        530 1 2 1 1  81 ASP H    .  81 . HN   1 1 
        531 1 1 1 1   5 LEU H    .   5 . HN   1 1 
        531 1 2 1 1  56 VAL HB   .  56 . HB   1 1 
        532 1 1 1 1   6 LEU H    .   6 . HN   1 1 
        532 1 2 1 1  83 LEU H    .  83 . HN   1 1 
        533 1 1 1 1   6 LEU H    .   6 . HN   1 1 
        533 1 2 1 1  80 TYR QD   .  80 . HD*  1 1 
        534 1 1 1 1   7 VAL H    .   7 . HN   1 1 
        534 1 2 1 1  58 VAL MG1  .  58 . HG1* 1 1 
        535 1 1 1 1   7 VAL H    .   7 . HN   1 1 
        535 1 2 1 1  83 LEU MD2  .  83 . HD2* 1 1 
        536 1 1 1 1   7 VAL H    .   7 . HN   1 1 
        536 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
        537 1 1 1 1   8 ILE H    .   8 . HN   1 1 
        537 1 2 1 1  83 LEU H    .  83 . HN   1 1 
        538 1 1 1 1   9 SER H    .   9 . HN   1 1 
        538 1 2 1 1  61 ALA MB   .  61 . HB*  1 1 
        539 1 1 1 1  11 ASP H    .  11 . HN   1 1 
        539 1 2 1 1  86 THR MG   .  86 . HG2* 1 1 
        540 1 1 1 1  11 ASP H    .  11 . HN   1 1 
        540 1 2 1 1  14 ILE HB   .  14 . HB   1 1 
        541 1 1 1 1   9 SER HB3  .   9 . HB1  1 1 
        541 1 2 1 1  11 ASP H    .  11 . HN   1 1 
        542 1 1 1 1   9 SER HB2  .   9 . HB2  1 1 
        542 1 2 1 1  11 ASP H    .  11 . HN   1 1 
        543 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
        543 1 2 1 1  18 VAL H    .  18 . HN   1 1 
        544 1 1 1 1  15 ILE MG   .  15 . HG2* 1 1 
        544 1 2 1 1  18 VAL H    .  18 . HN   1 1 
        545 1 1 1 1  18 VAL H    .  18 . HN   1 1 
        545 1 2 1 1  91 LEU MD1  .  91 . HD1* 1 1 
        546 1 1 1 1  32 ARG H    .  32 . HN   1 1 
        546 1 2 1 1  54 LEU MD2  .  54 . HD2* 1 1 
        547 1 1 1 1  32 ARG H    .  32 . HN   1 1 
        547 1 2 1 1  56 VAL MG2  .  56 . HG2* 1 1 
        548 1 1 1 1  32 ARG H    .  32 . HN   1 1 
        548 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
        549 1 1 1 1  32 ARG H    .  32 . HN   1 1 
        549 1 2 1 1  56 VAL HA   .  56 . HA   1 1 
        550 1 1 1 1  33 THR H    .  33 . HN   1 1 
        550 1 2 1 1  43 ILE MD   .  43 . HD1* 1 1 
        551 1 1 1 1  34 ALA H    .  34 . HN   1 1 
        551 1 2 1 1  58 VAL MG1  .  58 . HG1* 1 1 
        552 1 1 1 1  34 ALA H    .  34 . HN   1 1 
        552 1 2 1 1  43 ILE MD   .  43 . HD1* 1 1 
        553 1 1 1 1  34 ALA H    .  34 . HN   1 1 
        553 1 2 1 1  56 VAL MG1  .  56 . HG1* 1 1 
        554 1 1 1 1  34 ALA H    .  34 . HN   1 1 
        554 1 2 1 1  58 VAL HA   .  58 . HA   1 1 
        555 1 1 1 1  34 ALA H    .  34 . HN   1 1 
        555 1 2 1 1  59 ASN H    .  59 . HN   1 1 
        556 1 1 1 1  35 THR H    .  35 . HN   1 1 
        556 1 2 1 1  39 ASP HB2  .  39 . HB2  1 1 
        557 1 1 1 1  35 THR H    .  35 . HN   1 1 
        557 1 2 1 1  39 ASP HB3  .  39 . HB1  1 1 
        558 1 1 1 1  54 LEU H    .  54 . HN   1 1 
        558 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
        559 1 1 1 1   4 VAL MG2  .   4 . HG2* 1 1 
        559 1 2 1 1  54 LEU H    .  54 . HN   1 1 
        560 1 1 1 1   5 LEU H    .   5 . HN   1 1 
        560 1 2 1 1  56 VAL H    .  56 . HN   1 1 
        561 1 1 1 1   6 LEU HA   .   6 . HA   1 1 
        561 1 2 1 1  56 VAL H    .  56 . HN   1 1 
        562 1 1 1 1   4 VAL MG1  .   4 . HG1* 1 1 
        562 1 2 1 1  56 VAL H    .  56 . HN   1 1 
        563 1 1 1 1   6 LEU MD1  .   6 . HD1* 1 1 
        563 1 2 1 1  56 VAL H    .  56 . HN   1 1 
        564 1 1 1 1   6 LEU MD1  .   6 . HD1* 1 1 
        564 1 2 1 1  57 PHE H    .  57 . HN   1 1 
        565 1 1 1 1   7 VAL MG2  .   7 . HG2* 1 1 
        565 1 2 1 1  57 PHE H    .  57 . HN   1 1 
        566 1 1 1 1  57 PHE H    .  57 . HN   1 1 
        566 1 2 1 1  58 VAL MG1  .  58 . HG1* 1 1 
        567 1 1 1 1  31 ILE MG   .  31 . HG2* 1 1 
        567 1 2 1 1  57 PHE H    .  57 . HN   1 1 
        568 1 1 1 1  33 THR MG   .  33 . HG2* 1 1 
        568 1 2 1 1  57 PHE H    .  57 . HN   1 1 
        569 1 1 1 1  32 ARG H    .  32 . HN   1 1 
        569 1 2 1 1  57 PHE H    .  57 . HN   1 1 
        570 1 1 1 1  34 ALA H    .  34 . HN   1 1 
        570 1 2 1 1  57 PHE H    .  57 . HN   1 1 
        571 1 1 1 1   8 ILE HA   .   8 . HA   1 1 
        571 1 2 1 1  58 VAL H    .  58 . HN   1 1 
        572 1 1 1 1   7 VAL HB   .   7 . HB   1 1 
        572 1 2 1 1  58 VAL H    .  58 . HN   1 1 
        573 1 1 1 1  55 VAL MG1  .  55 . HG1* 1 1 
        573 1 2 1 1  58 VAL H    .  58 . HN   1 1 
        574 1 1 1 1   6 LEU MD1  .   6 . HD1* 1 1 
        574 1 2 1 1  58 VAL H    .  58 . HN   1 1 
        575 1 1 1 1  34 ALA MB   .  34 . HB*  1 1 
        575 1 2 1 1  59 ASN H    .  59 . HN   1 1 
        576 1 1 1 1  59 ASN H    .  59 . HN   1 1 
        576 1 2 1 1  61 ALA MB   .  61 . HB*  1 1 
        577 1 1 1 1  12 THR MG   .  12 . HG2* 1 1 
        577 1 2 1 1  59 ASN HD22 .  59 . HD22 1 1 
        578 1 1 1 1  15 ILE MD   .  15 . HD1* 1 1 
        578 1 2 1 1  60 GLY H    .  60 . HN   1 1 
        579 1 1 1 1  15 ILE MG   .  15 . HG2* 1 1 
        579 1 2 1 1  59 ASN HD21 .  59 . HD21 1 1 
        580 1 1 1 1  73 ALA HA   .  73 . HA   1 1 
        580 1 2 1 1  78 VAL H    .  78 . HN   1 1 
        581 1 1 1 1  76 GLU HB3  .  76 . HB1  1 1 
        581 1 2 1 1  78 VAL H    .  78 . HN   1 1 
        582 1 1 1 1  76 GLU HB2  .  76 . HB2  1 1 
        582 1 2 1 1  78 VAL H    .  78 . HN   1 1 
        583 1 1 1 1  73 ALA MB   .  73 . HB*  1 1 
        583 1 2 1 1  78 VAL H    .  78 . HN   1 1 
        584 1 1 1 1  44 ILE MG   .  44 . HG2* 1 1 
        584 1 2 1 1  78 VAL H    .  78 . HN   1 1 
        585 1 1 1 1  73 ALA MB   .  73 . HB*  1 1 
        585 1 2 1 1  79 SER H    .  79 . HN   1 1 
        586 1 1 1 1   4 VAL H    .   4 . HN   1 1 
        586 1 2 1 1  80 TYR H    .  80 . HN   1 1 
        587 1 1 1 1  73 ALA MB   .  73 . HB*  1 1 
        587 1 2 1 1  80 TYR H    .  80 . HN   1 1 
        588 1 1 1 1   4 VAL MG1  .   4 . HG1* 1 1 
        588 1 2 1 1  80 TYR H    .  80 . HN   1 1 
        589 1 1 1 1  81 ASP H    .  81 . HN   1 1 
        589 1 2 1 1  82 VAL MG2  .  82 . HG2* 1 1 
        590 1 1 1 1   4 VAL MG1  .   4 . HG1* 1 1 
        590 1 2 1 1  81 ASP H    .  81 . HN   1 1 
        591 1 1 1 1   5 LEU MD1  .   5 . HD1* 1 1 
        591 1 2 1 1  81 ASP H    .  81 . HN   1 1 
        592 1 1 1 1   5 LEU HA   .   5 . HA   1 1 
        592 1 2 1 1  81 ASP H    .  81 . HN   1 1 
        593 1 1 1 1   3 LYS HA   .   3 . HA   1 1 
        593 1 2 1 1  81 ASP H    .  81 . HN   1 1 
        594 1 1 1 1  81 ASP H    .  81 . HN   1 1 
        594 1 2 1 1  98 PHE QE   .  98 . HE*  1 1 
        595 1 1 1 1   6 LEU H    .   6 . HN   1 1 
        595 1 2 1 1  81 ASP H    .  81 . HN   1 1 
        596 1 1 1 1  80 TYR QD   .  80 . HD*  1 1 
        596 1 2 1 1  82 VAL H    .  82 . HN   1 1 
        597 1 1 1 1   5 LEU MD1  .   5 . HD1* 1 1 
        597 1 2 1 1  82 VAL H    .  82 . HN   1 1 
        598 1 1 1 1   5 LEU MD1  .   5 . HD1* 1 1 
        598 1 2 1 1  83 LEU H    .  83 . HN   1 1 
        599 1 1 1 1   5 LEU MD2  .   5 . HD2* 1 1 
        599 1 2 1 1  83 LEU H    .  83 . HN   1 1 
        600 1 1 1 1   7 VAL MG2  .   7 . HG2* 1 1 
        600 1 2 1 1  83 LEU H    .  83 . HN   1 1 
        601 1 1 1 1   8 ILE MD   .   8 . HD1* 1 1 
        601 1 2 1 1  83 LEU H    .  83 . HN   1 1 
        602 1 1 1 1   7 VAL HA   .   7 . HA   1 1 
        602 1 2 1 1  83 LEU H    .  83 . HN   1 1 
        603 1 1 1 1  83 LEU HG   .  83 . HG   1 1 
        603 1 2 1 1  85 SER H    .  85 . HN   1 1 
        604 1 1 1 1  83 LEU MD1  .  83 . HD1* 1 1 
        604 1 2 1 1  85 SER H    .  85 . HN   1 1 
        605 1 1 1 1  85 SER H    .  85 . HN   1 1 
        605 1 2 1 1  91 LEU MD1  .  91 . HD1* 1 1 
        606 1 1 1 1   8 ILE H    .   8 . HN   1 1 
        606 1 2 1 1  85 SER H    .  85 . HN   1 1 
        607 1 1 1 1  16 SER HA   .  16 . HA   1 1 
        607 1 2 1 1  19 GLN HE21 .  19 . HE21 1 1 
        608 1 1 1 1  16 SER HA   .  16 . HA   1 1 
        608 1 2 1 1  19 GLN HE22 .  19 . HE22 1 1 
        609 1 1 1 1  85 SER HB2  .  85 . HB2  1 1 
        609 1 2 1 1  87 ASP H    .  87 . HN   1 1 
        610 1 1 1 1  87 ASP H    .  87 . HN   1 1 
        610 1 2 1 1  88 PRO HD2  .  88 . HD2  1 1 
        611 1 1 1 1  87 ASP H    .  87 . HN   1 1 
        611 1 2 1 1  88 PRO HD3  .  88 . HD1  1 1 
        612 1 1 1 1  87 ASP H    .  87 . HN   1 1 
        612 1 2 1 1  90 GLU HB2  .  90 . HB2  1 1 
        613 1 1 1 1  87 ASP H    .  87 . HN   1 1 
        613 1 2 1 1  90 GLU HB3  .  90 . HB1  1 1 
        614 1 1 1 1  87 ASP H    .  87 . HN   1 1 
        614 1 2 1 1  91 LEU HG   .  91 . HG   1 1 
        615 1 1 1 1  14 ILE MD   .  14 . HD1* 1 1 
        615 1 2 1 1  87 ASP H    .  87 . HN   1 1 
        616 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
        616 1 2 1 1  87 ASP H    .  87 . HN   1 1 
        617 1 1 1 1  87 ASP H    .  87 . HN   1 1 
        617 1 2 1 1  91 LEU MD1  .  91 . HD1* 1 1 
        618 1 1 1 1  14 ILE MD   .  14 . HD1* 1 1 
        618 1 2 1 1  89 GLU H    .  89 . HN   1 1 
        619 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
        619 1 2 1 1  89 GLU H    .  89 . HN   1 1 
        620 1 1 1 1  90 GLU H    .  90 . HN   1 1 
        620 1 2 1 1  91 LEU HG   .  91 . HG   1 1 
        621 1 1 1 1  90 GLU H    .  90 . HN   1 1 
        621 1 2 1 1  92 THR MG   .  92 . HG2* 1 1 
        622 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
        622 1 2 1 1  90 GLU H    .  90 . HN   1 1 
        623 1 1 1 1  87 ASP HB3  .  87 . HB1  1 1 
        623 1 2 1 1  90 GLU H    .  90 . HN   1 1 
        624 1 1 1 1  87 ASP HB2  .  87 . HB2  1 1 
        624 1 2 1 1  90 GLU H    .  90 . HN   1 1 
        625 1 1 1 1  92 THR H    .  92 . HN   1 1 
        625 1 2 1 1  95 VAL MG2  .  95 . HG2* 1 1 
        626 1 1 1 1  18 VAL MG1  .  18 . HG1* 1 1 
        626 1 2 1 1  92 THR H    .  92 . HN   1 1 
        627 1 1 1 1  92 THR MG   .  92 . HG2* 1 1 
        627 1 2 1 1  94 ARG H    .  94 . HN   1 1 
        628 1 1 1 1  94 ARG H    .  94 . HN   1 1 
        628 1 2 1 1  95 VAL MG2  .  95 . HG2* 1 1 
        629 1 1 1 1  83 LEU MD2  .  83 . HD2* 1 1 
        629 1 2 1 1  94 ARG H    .  94 . HN   1 1 
        630 1 1 1 1  92 THR HB   .  92 . HB   1 1 
        630 1 2 1 1  94 ARG H    .  94 . HN   1 1 
        631 1 1 1 1 105 LEU MD2  . 105 . HD2* 1 1 
        631 1 2 1 1 106 GLU H    . 106 . HN   1 1 
        632 1 1 1 1   5 LEU MD2  .   5 . HD2* 1 1 
        632 1 2 1 1  95 VAL H    .  95 . HN   1 1 
        633 1 1 1 1  92 THR MG   .  92 . HG2* 1 1 
        633 1 2 1 1  95 VAL H    .  95 . HN   1 1 
        634 1 1 1 1  45 LYS H    .  45 . HN   1 1 
        634 1 2 1 1  45 LYS HG2  .  45 . HG2  1 1 
        635 1 1 1 1  95 VAL MG1  .  95 . HG1* 1 1 
        635 1 2 1 1  97 GLU H    .  97 . HN   1 1 
        636 1 1 1 1  98 PHE H    .  98 . HN   1 1 
        636 1 2 1 1  99 LEU HG   .  99 . HG   1 1 
        637 1 1 1 1  95 VAL MG1  .  95 . HG1* 1 1 
        637 1 2 1 1  98 PHE H    .  98 . HN   1 1 
        638 1 1 1 1   5 LEU MD2  .   5 . HD2* 1 1 
        638 1 2 1 1  98 PHE H    .  98 . HN   1 1 
        639 1 1 1 1   5 LEU MD2  .   5 . HD2* 1 1 
        639 1 2 1 1  99 LEU H    .  99 . HN   1 1 
        640 1 1 1 1 100 LYS H    . 100 . HN   1 1 
        640 1 2 1 1 101 THR MG   . 101 . HG2* 1 1 
        641 1 1 1 1  47 MET H    .  47 . HN   1 1 
        641 1 2 1 1  49 ASP H    .  49 . HN   1 1 
        642 1 1 1 1  18 VAL MG1  .  18 . HG1* 1 1 
        642 1 2 1 1  22 ALA H    .  22 . HN   1 1 
        643 1 1 1 1  22 ALA H    .  22 . HN   1 1 
        643 1 2 1 1  95 VAL MG1  .  95 . HG1* 1 1 
        644 1 1 1 1  22 ALA H    .  22 . HN   1 1 
        644 1 2 1 1  95 VAL MG2  .  95 . HG2* 1 1 
        645 1 1 1 1  20 GLU HB2  .  20 . HB2  1 1 
        645 1 2 1 1  22 ALA H    .  22 . HN   1 1 
        646 1 1 1 1  20 GLU HB3  .  20 . HB1  1 1 
        646 1 2 1 1  22 ALA H    .  22 . HN   1 1 
        647 1 1 1 1  23 LYS H    .  23 . HN   1 1 
        647 1 2 1 1  31 ILE MD   .  31 . HD1* 1 1 
        648 1 1 1 1  34 ALA MB   .  34 . HB*  1 1 
        648 1 2 1 1  36 SER H    .  36 . HN   1 1 
        649 1 1 1 1  36 SER H    .  36 . HN   1 1 
        649 1 2 1 1  39 ASP HB3  .  39 . HB1  1 1 
        650 1 1 1 1  36 SER H    .  36 . HN   1 1 
        650 1 2 1 1  39 ASP HB2  .  39 . HB2  1 1 
        651 1 1 1 1  36 SER H    .  36 . HN   1 1 
        651 1 2 1 1  40 ILE H    .  40 . HN   1 1 
        652 1 1 1 1  36 SER H    .  36 . HN   1 1 
        652 1 2 1 1  39 ASP H    .  39 . HN   1 1 
        653 1 1 1 1  40 ILE MG   .  40 . HG2* 1 1 
        653 1 2 1 1  42 ASP H    .  42 . HN   1 1 
        654 1 1 1 1  44 ILE MG   .  44 . HG2* 1 1 
        654 1 2 1 1  46 SER H    .  46 . HN   1 1 
        655 1 1 1 1  47 MET H    .  47 . HN   1 1 
        655 1 2 1 1  54 LEU MD1  .  54 . HD1* 1 1 
        656 1 1 1 1  48 LYS H    .  48 . HN   1 1 
        656 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
        657 1 1 1 1  54 LEU H    .  54 . HN   1 1 
        657 1 2 1 1  98 PHE QE   .  98 . HE*  1 1 
        658 1 1 1 1   8 ILE MG   .   8 . HG2* 1 1 
        658 1 2 1 1  61 ALA H    .  61 . HN   1 1 
        659 1 1 1 1  58 VAL MG1  .  58 . HG1* 1 1 
        659 1 2 1 1  61 ALA H    .  61 . HN   1 1 
        660 1 1 1 1  61 ALA MB   .  61 . HB*  1 1 
        660 1 2 1 1  65 ASP H    .  65 . HN   1 1 
        661 1 1 1 1  65 ASP H    .  65 . HN   1 1 
        661 1 2 1 1  66 VAL MG2  .  66 . HG2* 1 1 
        662 1 1 1 1  62 SER HB2  .  62 . HB2  1 1 
        662 1 2 1 1  65 ASP H    .  65 . HN   1 1 
        663 1 1 1 1  62 SER H    .  62 . HN   1 1 
        663 1 2 1 1  65 ASP H    .  65 . HN   1 1 
        664 1 1 1 1  63 GLN HG2  .  63 . HG2  1 1 
        664 1 2 1 1  67 ASN HD22 .  67 . HD22 1 1 
        665 1 1 1 1  63 GLN HG3  .  63 . HG1  1 1 
        665 1 2 1 1  67 ASN HD22 .  67 . HD22 1 1 
        666 1 1 1 1  63 GLN HG3  .  63 . HG1  1 1 
        666 1 2 1 1  67 ASN HD21 .  67 . HD21 1 1 
        667 1 1 1 1  40 ILE MG   .  40 . HG2* 1 1 
        667 1 2 1 1  69 PHE H    .  69 . HN   1 1 
        668 1 1 1 1  40 ILE MD   .  40 . HD1* 1 1 
        668 1 2 1 1  69 PHE H    .  69 . HN   1 1 
        669 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
        669 1 2 1 1  69 PHE H    .  69 . HN   1 1 
        670 1 1 1 1  70 GLN H    .  70 . HN   1 1 
        670 1 2 1 1  73 ALA MB   .  73 . HB*  1 1 
        671 1 1 1 1  66 VAL MG1  .  66 . HG1* 1 1 
        671 1 2 1 1  70 GLN H    .  70 . HN   1 1 
        672 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
        672 1 2 1 1  70 GLN H    .  70 . HN   1 1 
        673 1 1 1 1  72 GLU H    .  72 . HN   1 1 
        673 1 2 1 1  73 ALA MB   .  73 . HB*  1 1 
        674 1 1 1 1  44 ILE MD   .  44 . HD1* 1 1 
        674 1 2 1 1  72 GLU H    .  72 . HN   1 1 
        675 1 1 1 1  69 PHE QD   .  69 . HD*  1 1 
        675 1 2 1 1  73 ALA H    .  73 . HN   1 1 
        676 1 1 1 1  74 LYS H    .  74 . HN   1 1 
        676 1 2 1 1  80 TYR QD   .  80 . HD*  1 1 
        677 1 1 1 1  74 LYS H    .  74 . HN   1 1 
        677 1 2 1 1  80 TYR QE   .  80 . HE*  1 1 
        678 1 1 1 1  73 ALA H    .  73 . HN   1 1 
        678 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
        679 1 1 1 1  44 ILE MG   .  44 . HG2* 1 1 
        679 1 2 1 1  73 ALA H    .  73 . HN   1 1 
        680 1 1 1 1  44 ILE MD   .  44 . HD1* 1 1 
        680 1 2 1 1  73 ALA H    .  73 . HN   1 1 
        681 1 1 1 1  76 GLU H    .  76 . HN   1 1 
        681 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
        682 1 1 1 1  44 ILE MG   .  44 . HG2* 1 1 
        682 1 2 1 1  76 GLU H    .  76 . HN   1 1 
        683 1 1 1 1  75 LYS HB2  .  75 . HB2  1 1 
        683 1 2 1 1  77 GLY H    .  77 . HN   1 1 
        684 1 1 1 1  75 LYS HB3  .  75 . HB1  1 1 
        684 1 2 1 1  77 GLY H    .  77 . HN   1 1 
        685 1 1 1 1  73 ALA MB   .  73 . HB*  1 1 
        685 1 2 1 1  77 GLY H    .  77 . HN   1 1 
        686 1 1 1 1  77 GLY H    .  77 . HN   1 1 
        686 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
        687 1 1 1 1  52 LYS H    .  52 . HN   1 1 
        687 1 2 1 1  52 LYS HE2  .  52 . HE2  1 1 
        688 1 1 1 1  52 LYS H    .  52 . HN   1 1 
        688 1 2 1 1  52 LYS HE3  .  52 . HE1  1 1 
        689 1 1 1 1  52 LYS H    .  52 . HN   1 1 
        689 1 2 1 1  52 LYS HB2  .  52 . HB2  1 1 
        690 1 1 1 1  52 LYS H    .  52 . HN   1 1 
        690 1 2 1 1  52 LYS HB3  .  52 . HB1  1 1 
        691 1 1 1 1   5 LEU H    .   5 . HN   1 1 
        691 1 2 1 1  98 PHE QE   .  98 . HE*  1 1 
        692 1 1 1 1  11 ASP H    .  11 . HN   1 1 
        692 1 2 1 1  15 ILE MD   .  15 . HD1* 1 1 
        693 1 1 1 1  26 TYR H    .  26 . HN   1 1 
        693 1 2 1 1  26 TYR QD   .  26 . HD*  1 1 
        694 1 1 1 1  22 ALA H    .  22 . HN   1 1 
        694 1 2 1 1  26 TYR H    .  26 . HN   1 1 
        695 1 1 1 1  22 ALA HA   .  22 . HA   1 1 
        695 1 2 1 1  26 TYR H    .  26 . HN   1 1 
        696 1 1 1 1  23 LYS HA   .  23 . HA   1 1 
        696 1 2 1 1  26 TYR H    .  26 . HN   1 1 
        697 1 1 1 1  25 ASN HB3  .  25 . HB1  1 1 
        697 1 2 1 1  26 TYR H    .  26 . HN   1 1 
        698 1 1 1 1  25 ASN HB2  .  25 . HB2  1 1 
        698 1 2 1 1  26 TYR H    .  26 . HN   1 1 
        699 1 1 1 1  26 TYR H    .  26 . HN   1 1 
        699 1 2 1 1  27 PRO HG2  .  27 . HG2  1 1 
        700 1 1 1 1  26 TYR H    .  26 . HN   1 1 
        700 1 2 1 1  27 PRO HG3  .  27 . HG1  1 1 
        701 1 1 1 1  22 ALA MB   .  22 . HB*  1 1 
        701 1 2 1 1  26 TYR H    .  26 . HN   1 1 
        702 1 1 1 1  26 TYR H    .  26 . HN   1 1 
        702 1 2 1 1  95 VAL MG1  .  95 . HG1* 1 1 
        703 1 1 1 1  26 TYR H    .  26 . HN   1 1 
        703 1 2 1 1  99 LEU MD1  .  99 . HD1* 1 1 
        704 1 1 1 1  33 THR HA   .  33 . HA   1 1 
        704 1 2 1 1  57 PHE H    .  57 . HN   1 1 
        705 1 1 1 1  18 VAL H    .  18 . HN   1 1 
        705 1 2 1 1  20 GLU H    .  20 . HN   1 1 
        706 1 1 1 1   6 LEU H    .   6 . HN   1 1 
        706 1 2 1 1  82 VAL HA   .  82 . HA   1 1 
        707 1 1 1 1   9 SER HA   .   9 . HA   1 1 
        707 1 2 1 1  85 SER H    .  85 . HN   1 1 
        708 1 1 1 1   7 VAL H    .   7 . HN   1 1 
        708 1 2 1 1  57 PHE HA   .  57 . HA   1 1 
        709 1 1 1 1   3 LYS HA   .   3 . HA   1 1 
        709 1 2 1 1  79 SER H    .  79 . HN   1 1 
        710 1 1 1 1  38 GLN HA   .  38 . HA   1 1 
        710 1 2 1 1  38 GLN HE21 .  38 . HE21 1 1 
        711 1 1 1 1  38 GLN HA   .  38 . HA   1 1 
        711 1 2 1 1  38 GLN HE22 .  38 . HE22 1 1 
        712 1 1 1 1  74 LYS HA   .  74 . HA   1 1 
        712 1 2 1 1  77 GLY H    .  77 . HN   1 1 
        713 1 1 1 1  64 ASN HA   .  64 . HA   1 1 
        713 1 2 1 1  67 ASN HD22 .  67 . HD22 1 1 
        714 1 1 1 1  64 ASN HA   .  64 . HA   1 1 
        714 1 2 1 1  67 ASN HD21 .  67 . HD21 1 1 
        715 1 1 1 1  71 ASN H    .  71 . HN   1 1 
        715 1 2 1 1  80 TYR QE   .  80 . HE*  1 1 
        716 1 1 1 1  36 SER HB3  .  36 . HB1  1 1 
        716 1 2 1 1  39 ASP H    .  39 . HN   1 1 
        717 1 1 1 1  44 ILE H    .  44 . HN   1 1 
        717 1 2 1 1  45 LYS H    .  45 . HN   1 1 
        718 1 1 1 1  45 LYS H    .  45 . HN   1 1 
        718 1 2 1 1  45 LYS HG3  .  45 . HG1  1 1 
        719 1 1 1 1  44 ILE HB   .  44 . HB   1 1 
        719 1 2 1 1  45 LYS H    .  45 . HN   1 1 
        720 1 1 1 1  16 SER HA   .  16 . HA   1 1 
        720 1 2 1 1  20 GLU H    .  20 . HN   1 1 
        721 1 1 1 1  17 SER H    .  17 . HN   1 1 
        721 1 2 1 1  18 VAL HB   .  18 . HB   1 1 
        722 1 1 1 1  17 SER H    .  17 . HN   1 1 
        722 1 2 1 1  18 VAL MG2  .  18 . HG2* 1 1 
        723 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
        723 1 2 1 1  17 SER H    .  17 . HN   1 1 
        724 1 1 1 1  18 VAL H    .  18 . HN   1 1 
        724 1 2 1 1  57 PHE QE   .  57 . HE*  1 1 
        725 1 1 1 1  19 GLN H    .  19 . HN   1 1 
        725 1 2 1 1  57 PHE HZ   .  57 . HZ   1 1 
        726 1 1 1 1  21 ARG H    .  21 . HN   1 1 
        726 1 2 1 1  22 ALA MB   .  22 . HB*  1 1 
        727 1 1 1 1  24 HIS H    .  24 . HN   1 1 
        727 1 2 1 1  25 ASN H    .  25 . HN   1 1 
        728 1 1 1 1  22 ALA HA   .  22 . HA   1 1 
        728 1 2 1 1  25 ASN H    .  25 . HN   1 1 
        729 1 1 1 1  26 TYR H    .  26 . HN   1 1 
        729 1 2 1 1  27 PRO HD3  .  27 . HD1  1 1 
        730 1 1 1 1  26 TYR H    .  26 . HN   1 1 
        730 1 2 1 1  27 PRO HD2  .  27 . HD2  1 1 
        731 1 1 1 1  32 ARG H    .  32 . HN   1 1 
        731 1 2 1 1  55 VAL H    .  55 . HN   1 1 
        732 1 1 1 1  34 ALA H    .  34 . HN   1 1 
        732 1 2 1 1  58 VAL H    .  58 . HN   1 1 
        733 1 1 1 1  30 GLU H    .  30 . HN   1 1 
        733 1 2 1 1  31 ILE H    .  31 . HN   1 1 
        734 1 1 1 1  30 GLU H    .  30 . HN   1 1 
        734 1 2 1 1  30 GLU HG2  .  30 . HG2  1 1 
        735 1 1 1 1  30 GLU H    .  30 . HN   1 1 
        735 1 2 1 1  30 GLU HG3  .  30 . HG1  1 1 
        736 1 1 1 1  35 THR H    .  35 . HN   1 1 
        736 1 2 1 1  36 SER H    .  36 . HN   1 1 
        737 1 1 1 1  31 ILE HA   .  31 . HA   1 1 
        737 1 2 1 1  55 VAL H    .  55 . HN   1 1 
        738 1 1 1 1  55 VAL H    .  55 . HN   1 1 
        738 1 2 1 1  56 VAL H    .  56 . HN   1 1 
        739 1 1 1 1  57 PHE H    .  57 . HN   1 1 
        739 1 2 1 1  58 VAL H    .  58 . HN   1 1 
        740 1 1 1 1   4 VAL MG2  .   4 . HG2* 1 1 
        740 1 2 1 1  56 VAL H    .  56 . HN   1 1 
        741 1 1 1 1   7 VAL HB   .   7 . HB   1 1 
        741 1 2 1 1  56 VAL H    .  56 . HN   1 1 
        742 1 1 1 1   9 SER H    .   9 . HN   1 1 
        742 1 2 1 1  58 VAL H    .  58 . HN   1 1 
        743 1 1 1 1  35 THR HA   .  35 . HA   1 1 
        743 1 2 1 1  59 ASN H    .  59 . HN   1 1 
        744 1 1 1 1  15 ILE MG   .  15 . HG2* 1 1 
        744 1 2 1 1  59 ASN HD22 .  59 . HD22 1 1 
        745 1 1 1 1  12 THR MG   .  12 . HG2* 1 1 
        745 1 2 1 1  59 ASN HD21 .  59 . HD21 1 1 
        746 1 1 1 1  59 ASN HA   .  59 . HA   1 1 
        746 1 2 1 1  61 ALA H    .  61 . HN   1 1 
        747 1 1 1 1  65 ASP H    .  65 . HN   1 1 
        747 1 2 1 1  66 VAL HA   .  66 . HA   1 1 
        748 1 1 1 1  62 SER HB3  .  62 . HB1  1 1 
        748 1 2 1 1  65 ASP H    .  65 . HN   1 1 
        749 1 1 1 1  67 ASN HA   .  67 . HA   1 1 
        749 1 2 1 1  70 GLN HE21 .  70 . HE21 1 1 
        750 1 1 1 1  67 ASN HA   .  67 . HA   1 1 
        750 1 2 1 1  70 GLN HE22 .  70 . HE22 1 1 
        751 1 1 1 1  70 GLN H    .  70 . HN   1 1 
        751 1 2 1 1  73 ALA H    .  73 . HN   1 1 
        752 1 1 1 1  73 ALA MB   .  73 . HB*  1 1 
        752 1 2 1 1  75 LYS H    .  75 . HN   1 1 
        753 1 1 1 1  73 ALA HA   .  73 . HA   1 1 
        753 1 2 1 1  77 GLY H    .  77 . HN   1 1 
        754 1 1 1 1  85 SER HB3  .  85 . HB1  1 1 
        754 1 2 1 1  87 ASP H    .  87 . HN   1 1 
        755 1 1 1 1  92 THR MG   .  92 . HG2* 1 1 
        755 1 2 1 1  96 ARG H    .  96 . HN   1 1 
        756 1 1 1 1  98 PHE H    .  98 . HN   1 1 
        756 1 2 1 1  99 LEU MD1  .  99 . HD1* 1 1 
        757 1 1 1 1  98 PHE QD   .  98 . HD*  1 1 
        757 1 2 1 1 100 LYS H    . 100 . HN   1 1 
        758 1 1 1 1   4 VAL H    .   4 . HN   1 1 
        758 1 2 1 1  78 VAL MG1  .  78 . HG1* 1 1 
        759 1 1 1 1  36 SER HA   .  36 . HA   1 1 
        759 1 2 1 1  39 ASP H    .  39 . HN   1 1 
        760 1 1 1 1  44 ILE HA   .  44 . HA   1 1 
        760 1 2 1 1  48 LYS H    .  48 . HN   1 1 
        761 1 1 1 1  45 LYS HA   .  45 . HA   1 1 
        761 1 2 1 1  48 LYS H    .  48 . HN   1 1 
        762 1 1 1 1  46 SER HA   .  46 . HA   1 1 
        762 1 2 1 1  48 LYS H    .  48 . HN   1 1 
        763 1 1 1 1   3 LYS HB2  .   3 . HB2  1 1 
        763 1 2 1 1   3 LYS HE2  .   3 . HE2  1 1 
        764 1 1 1 1   3 LYS HB3  .   3 . HB1  1 1 
        764 1 2 1 1   3 LYS HE2  .   3 . HE2  1 1 
        765 1 1 1 1   3 LYS HB2  .   3 . HB2  1 1 
        765 1 2 1 1   3 LYS HE3  .   3 . HE1  1 1 
        766 1 1 1 1   3 LYS HB3  .   3 . HB1  1 1 
        766 1 2 1 1   3 LYS HE3  .   3 . HE1  1 1 
        767 1 1 1 1   4 VAL H    .   4 . HN   1 1 
        767 1 2 1 1   4 VAL MG2  .   4 . HG2* 1 1 
        768 1 1 1 1   4 VAL HA   .   4 . HA   1 1 
        768 1 2 1 1   4 VAL MG2  .   4 . HG2* 1 1 
        769 1 1 1 1   4 VAL HA   .   4 . HA   1 1 
        769 1 2 1 1   4 VAL MG1  .   4 . HG1* 1 1 
        770 1 1 1 1   5 LEU HA   .   5 . HA   1 1 
        770 1 2 1 1   5 LEU HG   .   5 . HG   1 1 
        771 1 1 1 1   5 LEU H    .   5 . HN   1 1 
        771 1 2 1 1   5 LEU HG   .   5 . HG   1 1 
        772 1 1 1 1   5 LEU HA   .   5 . HA   1 1 
        772 1 2 1 1   5 LEU MD1  .   5 . HD1* 1 1 
        773 1 1 1 1  55 VAL HA   .  55 . HA   1 1 
        773 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
        774 1 1 1 1   5 LEU H    .   5 . HN   1 1 
        774 1 2 1 1   5 LEU MD2  .   5 . HD2* 1 1 
        775 1 1 1 1   5 LEU HA   .   5 . HA   1 1 
        775 1 2 1 1   5 LEU MD2  .   5 . HD2* 1 1 
        776 1 1 1 1   5 LEU MD2  .   5 . HD2* 1 1 
        776 1 2 1 1  83 LEU MD2  .  83 . HD2* 1 1 
        777 1 1 1 1   6 LEU HA   .   6 . HA   1 1 
        777 1 2 1 1   6 LEU MD1  .   6 . HD1* 1 1 
        778 1 1 1 1   6 LEU H    .   6 . HN   1 1 
        778 1 2 1 1   6 LEU MD2  .   6 . HD2* 1 1 
        779 1 1 1 1   6 LEU HA   .   6 . HA   1 1 
        779 1 2 1 1   6 LEU MD2  .   6 . HD2* 1 1 
        780 1 1 1 1   7 VAL H    .   7 . HN   1 1 
        780 1 2 1 1   7 VAL MG1  .   7 . HG1* 1 1 
        781 1 1 1 1   7 VAL HA   .   7 . HA   1 1 
        781 1 2 1 1   7 VAL MG1  .   7 . HG1* 1 1 
        782 1 1 1 1   7 VAL HA   .   7 . HA   1 1 
        782 1 2 1 1   7 VAL MG2  .   7 . HG2* 1 1 
        783 1 1 1 1   8 ILE HA   .   8 . HA   1 1 
        783 1 2 1 1   8 ILE MG   .   8 . HG2* 1 1 
        784 1 1 1 1   8 ILE HB   .   8 . HB   1 1 
        784 1 2 1 1   8 ILE MD   .   8 . HD1* 1 1 
        785 1 1 1 1   8 ILE H    .   8 . HN   1 1 
        785 1 2 1 1   8 ILE MG   .   8 . HG2* 1 1 
        786 1 1 1 1   8 ILE H    .   8 . HN   1 1 
        786 1 2 1 1   8 ILE MD   .   8 . HD1* 1 1 
        787 1 1 1 1   8 ILE HA   .   8 . HA   1 1 
        787 1 2 1 1   8 ILE MD   .   8 . HD1* 1 1 
        788 1 1 1 1   8 ILE MD   .   8 . HD1* 1 1 
        788 1 2 1 1   8 ILE MG   .   8 . HG2* 1 1 
        789 1 1 1 1   9 SER H    .   9 . HN   1 1 
        789 1 2 1 1   9 SER HB2  .   9 . HB2  1 1 
        790 1 1 1 1  10 THR H    .  10 . HN   1 1 
        790 1 2 1 1  10 THR MG   .  10 . HG2* 1 1 
        791 1 1 1 1  10 THR HA   .  10 . HA   1 1 
        791 1 2 1 1  10 THR MG   .  10 . HG2* 1 1 
        792 1 1 1 1  12 THR HA   .  12 . HA   1 1 
        792 1 2 1 1  12 THR MG   .  12 . HG2* 1 1 
        793 1 1 1 1  14 ILE HB   .  14 . HB   1 1 
        793 1 2 1 1  14 ILE MD   .  14 . HD1* 1 1 
        794 1 1 1 1  14 ILE HA   .  14 . HA   1 1 
        794 1 2 1 1  14 ILE MG   .  14 . HG2* 1 1 
        795 1 1 1 1  14 ILE MD   .  14 . HD1* 1 1 
        795 1 2 1 1  14 ILE MG   .  14 . HG2* 1 1 
        796 1 1 1 1  14 ILE HA   .  14 . HA   1 1 
        796 1 2 1 1  14 ILE HG12 .  14 . HG12 1 1 
        797 1 1 1 1  14 ILE HG12 .  14 . HG12 1 1 
        797 1 2 1 1  14 ILE MG   .  14 . HG2* 1 1 
        798 1 1 1 1  14 ILE H    .  14 . HN   1 1 
        798 1 2 1 1  14 ILE HG13 .  14 . HG11 1 1 
        799 1 1 1 1  14 ILE HA   .  14 . HA   1 1 
        799 1 2 1 1  14 ILE HG13 .  14 . HG11 1 1 
        800 1 1 1 1  14 ILE HG13 .  14 . HG11 1 1 
        800 1 2 1 1  14 ILE MG   .  14 . HG2* 1 1 
        801 1 1 1 1  14 ILE HA   .  14 . HA   1 1 
        801 1 2 1 1  14 ILE MD   .  14 . HD1* 1 1 
        802 1 1 1 1  15 ILE HA   .  15 . HA   1 1 
        802 1 2 1 1  15 ILE MD   .  15 . HD1* 1 1 
        803 1 1 1 1  15 ILE HA   .  15 . HA   1 1 
        803 1 2 1 1  15 ILE MG   .  15 . HG2* 1 1 
        804 1 1 1 1  15 ILE MD   .  15 . HD1* 1 1 
        804 1 2 1 1  15 ILE MG   .  15 . HG2* 1 1 
        805 1 1 1 1  18 VAL HA   .  18 . HA   1 1 
        805 1 2 1 1  18 VAL MG1  .  18 . HG1* 1 1 
        806 1 1 1 1  18 VAL HA   .  18 . HA   1 1 
        806 1 2 1 1  18 VAL MG2  .  18 . HG2* 1 1 
        807 1 1 1 1  19 GLN H    .  19 . HN   1 1 
        807 1 2 1 1  19 GLN HG2  .  19 . HG2  1 1 
        808 1 1 1 1  19 GLN H    .  19 . HN   1 1 
        808 1 2 1 1  19 GLN HG3  .  19 . HG1  1 1 
        809 1 1 1 1  21 ARG HA   .  21 . HA   1 1 
        809 1 2 1 1  21 ARG HG2  .  21 . HG2  1 1 
        810 1 1 1 1  21 ARG H    .  21 . HN   1 1 
        810 1 2 1 1  21 ARG HD2  .  21 . HD2  1 1 
        811 1 1 1 1  21 ARG H    .  21 . HN   1 1 
        811 1 2 1 1  21 ARG HD3  .  21 . HD1  1 1 
        812 1 1 1 1  23 LYS HA   .  23 . HA   1 1 
        812 1 2 1 1  23 LYS HG2  .  23 . HG2  1 1 
        813 1 1 1 1  23 LYS HA   .  23 . HA   1 1 
        813 1 2 1 1  23 LYS HG3  .  23 . HG1  1 1 
        814 1 1 1 1  23 LYS H    .  23 . HN   1 1 
        814 1 2 1 1  23 LYS HG2  .  23 . HG2  1 1 
        815 1 1 1 1  29 ARG HA   .  29 . HA   1 1 
        815 1 2 1 1  29 ARG HD2  .  29 . HD2  1 1 
        816 1 1 1 1  29 ARG HA   .  29 . HA   1 1 
        816 1 2 1 1  29 ARG HD3  .  29 . HD1  1 1 
        817 1 1 1 1  31 ILE HA   .  31 . HA   1 1 
        817 1 2 1 1  31 ILE HG13 .  31 . HG11 1 1 
        818 1 1 1 1  31 ILE HA   .  31 . HA   1 1 
        818 1 2 1 1  31 ILE HG12 .  31 . HG12 1 1 
        819 1 1 1 1  31 ILE H    .  31 . HN   1 1 
        819 1 2 1 1  31 ILE MD   .  31 . HD1* 1 1 
        820 1 1 1 1  31 ILE HA   .  31 . HA   1 1 
        820 1 2 1 1  31 ILE MD   .  31 . HD1* 1 1 
        821 1 1 1 1  31 ILE HB   .  31 . HB   1 1 
        821 1 2 1 1  31 ILE MD   .  31 . HD1* 1 1 
        822 1 1 1 1  31 ILE MD   .  31 . HD1* 1 1 
        822 1 2 1 1  31 ILE MG   .  31 . HG2* 1 1 
        823 1 1 1 1  32 ARG HA   .  32 . HA   1 1 
        823 1 2 1 1  32 ARG HD2  .  32 . HD2  1 1 
        824 1 1 1 1  32 ARG HA   .  32 . HA   1 1 
        824 1 2 1 1  32 ARG HG2  .  32 . HG2  1 1 
        825 1 1 1 1  32 ARG HA   .  32 . HA   1 1 
        825 1 2 1 1  32 ARG HG3  .  32 . HG1  1 1 
        826 1 1 1 1  32 ARG HB2  .  32 . HB2  1 1 
        826 1 2 1 1  32 ARG HD2  .  32 . HD2  1 1 
        827 1 1 1 1  32 ARG HB3  .  32 . HB1  1 1 
        827 1 2 1 1  32 ARG HD2  .  32 . HD2  1 1 
        828 1 1 1 1  32 ARG HA   .  32 . HA   1 1 
        828 1 2 1 1  32 ARG HD3  .  32 . HD1  1 1 
        829 1 1 1 1  32 ARG HB2  .  32 . HB2  1 1 
        829 1 2 1 1  32 ARG HD3  .  32 . HD1  1 1 
        830 1 1 1 1  32 ARG HB3  .  32 . HB1  1 1 
        830 1 2 1 1  32 ARG HD3  .  32 . HD1  1 1 
        831 1 1 1 1  33 THR HA   .  33 . HA   1 1 
        831 1 2 1 1  33 THR MG   .  33 . HG2* 1 1 
        832 1 1 1 1  35 THR HA   .  35 . HA   1 1 
        832 1 2 1 1  35 THR MG   .  35 . HG2* 1 1 
        833 1 1 1 1  38 GLN HA   .  38 . HA   1 1 
        833 1 2 1 1  38 GLN HG2  .  38 . HG2  1 1 
        834 1 1 1 1  38 GLN H    .  38 . HN   1 1 
        834 1 2 1 1  38 GLN HG3  .  38 . HG1  1 1 
        835 1 1 1 1  38 GLN HA   .  38 . HA   1 1 
        835 1 2 1 1  38 GLN HG3  .  38 . HG1  1 1 
        836 1 1 1 1  40 ILE HA   .  40 . HA   1 1 
        836 1 2 1 1  40 ILE MD   .  40 . HD1* 1 1 
        837 1 1 1 1  40 ILE HA   .  40 . HA   1 1 
        837 1 2 1 1  40 ILE MG   .  40 . HG2* 1 1 
        838 1 1 1 1  40 ILE HG12 .  40 . HG12 1 1 
        838 1 2 1 1  40 ILE MG   .  40 . HG2* 1 1 
        839 1 1 1 1  40 ILE HG13 .  40 . HG11 1 1 
        839 1 2 1 1  40 ILE MG   .  40 . HG2* 1 1 
        840 1 1 1 1  40 ILE MD   .  40 . HD1* 1 1 
        840 1 2 1 1  40 ILE MG   .  40 . HG2* 1 1 
        841 1 1 1 1  40 ILE MD   .  40 . HD1* 1 1 
        841 1 2 1 1  58 VAL MG1  .  58 . HG1* 1 1 
        842 1 1 1 1  41 ARG HA   .  41 . HA   1 1 
        842 1 2 1 1  41 ARG HG2  .  41 . HG2  1 1 
        843 1 1 1 1  41 ARG H    .  41 . HN   1 1 
        843 1 2 1 1  41 ARG HD2  .  41 . HD2  1 1 
        844 1 1 1 1  41 ARG HA   .  41 . HA   1 1 
        844 1 2 1 1  41 ARG HD2  .  41 . HD2  1 1 
        845 1 1 1 1  41 ARG H    .  41 . HN   1 1 
        845 1 2 1 1  41 ARG HD3  .  41 . HD1  1 1 
        846 1 1 1 1  41 ARG HA   .  41 . HA   1 1 
        846 1 2 1 1  41 ARG HD3  .  41 . HD1  1 1 
        847 1 1 1 1  42 ASP H    .  42 . HN   1 1 
        847 1 2 1 1  42 ASP HB3  .  42 . HB1  1 1 
        848 1 1 1 1  43 ILE HA   .  43 . HA   1 1 
        848 1 2 1 1  43 ILE MG   .  43 . HG2* 1 1 
        849 1 1 1 1  43 ILE HA   .  43 . HA   1 1 
        849 1 2 1 1  43 ILE HG12 .  43 . HG12 1 1 
        850 1 1 1 1  43 ILE HA   .  43 . HA   1 1 
        850 1 2 1 1  43 ILE MD   .  43 . HD1* 1 1 
        851 1 1 1 1  43 ILE H    .  43 . HN   1 1 
        851 1 2 1 1  43 ILE HB   .  43 . HB   1 1 
        852 1 1 1 1  43 ILE HA   .  43 . HA   1 1 
        852 1 2 1 1  43 ILE HG13 .  43 . HG11 1 1 
        853 1 1 1 1  40 ILE HA   .  40 . HA   1 1 
        853 1 2 1 1  43 ILE MD   .  43 . HD1* 1 1 
        854 1 1 1 1  43 ILE MD   .  43 . HD1* 1 1 
        854 1 2 1 1  43 ILE MG   .  43 . HG2* 1 1 
        855 1 1 1 1  43 ILE HB   .  43 . HB   1 1 
        855 1 2 1 1  43 ILE MD   .  43 . HD1* 1 1 
        856 1 1 1 1  44 ILE HA   .  44 . HA   1 1 
        856 1 2 1 1  44 ILE HG12 .  44 . HG12 1 1 
        857 1 1 1 1  44 ILE HA   .  44 . HA   1 1 
        857 1 2 1 1  44 ILE HG13 .  44 . HG11 1 1 
        858 1 1 1 1  44 ILE H    .  44 . HN   1 1 
        858 1 2 1 1  44 ILE MG   .  44 . HG2* 1 1 
        859 1 1 1 1  44 ILE HA   .  44 . HA   1 1 
        859 1 2 1 1  44 ILE MG   .  44 . HG2* 1 1 
        860 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
        860 1 2 1 1  18 VAL MG2  .  18 . HG2* 1 1 
        861 1 1 1 1  44 ILE MD   .  44 . HD1* 1 1 
        861 1 2 1 1  44 ILE MG   .  44 . HG2* 1 1 
        862 1 1 1 1  44 ILE HA   .  44 . HA   1 1 
        862 1 2 1 1  44 ILE MD   .  44 . HD1* 1 1 
        863 1 1 1 1  45 LYS HA   .  45 . HA   1 1 
        863 1 2 1 1  48 LYS HG3  .  48 . HG1  1 1 
        864 1 1 1 1  45 LYS HA   .  45 . HA   1 1 
        864 1 2 1 1  45 LYS HG3  .  45 . HG1  1 1 
        865 1 1 1 1  45 LYS HA   .  45 . HA   1 1 
        865 1 2 1 1  45 LYS HG2  .  45 . HG2  1 1 
        866 1 1 1 1  47 MET HA   .  47 . HA   1 1 
        866 1 2 1 1  47 MET ME   .  47 . HE*  1 1 
        867 1 1 1 1  47 MET ME   .  47 . HE*  1 1 
        867 1 2 1 1  47 MET HG2  .  47 . HG2  1 1 
        868 1 1 1 1  47 MET ME   .  47 . HE*  1 1 
        868 1 2 1 1  47 MET HG3  .  47 . HG1  1 1 
        869 1 1 1 1  21 ARG HA   .  21 . HA   1 1 
        869 1 2 1 1  21 ARG HG3  .  21 . HG1  1 1 
        870 1 1 1 1  48 LYS HA   .  48 . HA   1 1 
        870 1 2 1 1  48 LYS HG2  .  48 . HG2  1 1 
        871 1 1 1 1  48 LYS HA   .  48 . HA   1 1 
        871 1 2 1 1  48 LYS HE2  .  48 . HE2  1 1 
        872 1 1 1 1  48 LYS HA   .  48 . HA   1 1 
        872 1 2 1 1  48 LYS HE3  .  48 . HE1  1 1 
        873 1 1 1 1  48 LYS HB2  .  48 . HB2  1 1 
        873 1 2 1 1  48 LYS HE2  .  48 . HE2  1 1 
        874 1 1 1 1  48 LYS HB2  .  48 . HB2  1 1 
        874 1 2 1 1  48 LYS HE3  .  48 . HE1  1 1 
        875 1 1 1 1  48 LYS HB3  .  48 . HB1  1 1 
        875 1 2 1 1  48 LYS HE2  .  48 . HE2  1 1 
        876 1 1 1 1  48 LYS HB3  .  48 . HB1  1 1 
        876 1 2 1 1  48 LYS HE3  .  48 . HE1  1 1 
        877 1 1 1 1  54 LEU HA   .  54 . HA   1 1 
        877 1 2 1 1  54 LEU HG   .  54 . HG   1 1 
        878 1 1 1 1  54 LEU HA   .  54 . HA   1 1 
        878 1 2 1 1  54 LEU MD2  .  54 . HD2* 1 1 
        879 1 1 1 1  54 LEU MD1  .  54 . HD1* 1 1 
        879 1 2 1 1  55 VAL H    .  55 . HN   1 1 
        880 1 1 1 1  54 LEU HA   .  54 . HA   1 1 
        880 1 2 1 1  54 LEU MD1  .  54 . HD1* 1 1 
        881 1 1 1 1  32 ARG HG2  .  32 . HG2  1 1 
        881 1 2 1 1  54 LEU MD1  .  54 . HD1* 1 1 
        882 1 1 1 1  55 VAL H    .  55 . HN   1 1 
        882 1 2 1 1  55 VAL HB   .  55 . HB   1 1 
        883 1 1 1 1  55 VAL H    .  55 . HN   1 1 
        883 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
        884 1 1 1 1  55 VAL HA   .  55 . HA   1 1 
        884 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
        885 1 1 1 1  55 VAL H    .  55 . HN   1 1 
        885 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
        886 1 1 1 1  56 VAL HA   .  56 . HA   1 1 
        886 1 2 1 1  56 VAL MG2  .  56 . HG2* 1 1 
        887 1 1 1 1  58 VAL HA   .  58 . HA   1 1 
        887 1 2 1 1  58 VAL MG1  .  58 . HG1* 1 1 
        888 1 1 1 1   8 ILE MG   .   8 . HG2* 1 1 
        888 1 2 1 1  58 VAL MG2  .  58 . HG2* 1 1 
        889 1 1 1 1  59 ASN HA   .  59 . HA   1 1 
        889 1 2 1 1  59 ASN HD22 .  59 . HD22 1 1 
        890 1 1 1 1  66 VAL HA   .  66 . HA   1 1 
        890 1 2 1 1  66 VAL MG1  .  66 . HG1* 1 1 
        891 1 1 1 1  66 VAL HA   .  66 . HA   1 1 
        891 1 2 1 1  66 VAL MG2  .  66 . HG2* 1 1 
        892 1 1 1 1  67 ASN H    .  67 . HN   1 1 
        892 1 2 1 1  67 ASN HB3  .  67 . HB1  1 1 
        893 1 1 1 1  68 GLU HA   .  68 . HA   1 1 
        893 1 2 1 1  68 GLU HG3  .  68 . HG1  1 1 
        894 1 1 1 1  68 GLU H    .  68 . HN   1 1 
        894 1 2 1 1  68 GLU HB2  .  68 . HB2  1 1 
        895 1 1 1 1  68 GLU H    .  68 . HN   1 1 
        895 1 2 1 1  68 GLU HG2  .  68 . HG2  1 1 
        896 1 1 1 1  94 ARG HA   .  94 . HA   1 1 
        896 1 2 1 1  97 GLU HG2  .  97 . HG2  1 1 
        897 1 1 1 1  68 GLU H    .  68 . HN   1 1 
        897 1 2 1 1  68 GLU HG3  .  68 . HG1  1 1 
        898 1 1 1 1  69 PHE HA   .  69 . HA   1 1 
        898 1 2 1 1  69 PHE QD   .  69 . HD*  1 1 
        899 1 1 1 1  70 GLN HA   .  70 . HA   1 1 
        899 1 2 1 1  70 GLN HG2  .  70 . HG2  1 1 
        900 1 1 1 1  70 GLN HA   .  70 . HA   1 1 
        900 1 2 1 1  70 GLN HG3  .  70 . HG1  1 1 
        901 1 1 1 1  70 GLN H    .  70 . HN   1 1 
        901 1 2 1 1  70 GLN HB2  .  70 . HB2  1 1 
        902 1 1 1 1  72 GLU HA   .  72 . HA   1 1 
        902 1 2 1 1  72 GLU HG2  .  72 . HG2  1 1 
        903 1 1 1 1  72 GLU HA   .  72 . HA   1 1 
        903 1 2 1 1  72 GLU HG3  .  72 . HG1  1 1 
        904 1 1 1 1  74 LYS HA   .  74 . HA   1 1 
        904 1 2 1 1  74 LYS HG2  .  74 . HG2  1 1 
        905 1 1 1 1  74 LYS HA   .  74 . HA   1 1 
        905 1 2 1 1  74 LYS HG3  .  74 . HG1  1 1 
        906 1 1 1 1  74 LYS H    .  74 . HN   1 1 
        906 1 2 1 1  74 LYS HD2  .  74 . HD2  1 1 
        907 1 1 1 1  74 LYS H    .  74 . HN   1 1 
        907 1 2 1 1  74 LYS HD3  .  74 . HD1  1 1 
        908 1 1 1 1  74 LYS H    .  74 . HN   1 1 
        908 1 2 1 1  74 LYS HE2  .  74 . HE2  1 1 
        909 1 1 1 1  74 LYS H    .  74 . HN   1 1 
        909 1 2 1 1  74 LYS HE3  .  74 . HE1  1 1 
        910 1 1 1 1  74 LYS HA   .  74 . HA   1 1 
        910 1 2 1 1  74 LYS HE2  .  74 . HE2  1 1 
        911 1 1 1 1  74 LYS HA   .  74 . HA   1 1 
        911 1 2 1 1  74 LYS HE3  .  74 . HE1  1 1 
        912 1 1 1 1  87 ASP HB2  .  87 . HB2  1 1 
        912 1 2 1 1  90 GLU HB3  .  90 . HB1  1 1 
        913 1 1 1 1  75 LYS HA   .  75 . HA   1 1 
        913 1 2 1 1  75 LYS HG2  .  75 . HG2  1 1 
        914 1 1 1 1  75 LYS HA   .  75 . HA   1 1 
        914 1 2 1 1  75 LYS HG3  .  75 . HG1  1 1 
        915 1 1 1 1  72 GLU HA   .  72 . HA   1 1 
        915 1 2 1 1  75 LYS HG2  .  75 . HG2  1 1 
        916 1 1 1 1  72 GLU HA   .  72 . HA   1 1 
        916 1 2 1 1  75 LYS HG3  .  75 . HG1  1 1 
        917 1 1 1 1  76 GLU HA   .  76 . HA   1 1 
        917 1 2 1 1  76 GLU HG2  .  76 . HG2  1 1 
        918 1 1 1 1  76 GLU HA   .  76 . HA   1 1 
        918 1 2 1 1  76 GLU HG3  .  76 . HG1  1 1 
        919 1 1 1 1  78 VAL HA   .  78 . HA   1 1 
        919 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
        920 1 1 1 1  78 VAL HA   .  78 . HA   1 1 
        920 1 2 1 1  78 VAL MG1  .  78 . HG1* 1 1 
        921 1 1 1 1  78 VAL H    .  78 . HN   1 1 
        921 1 2 1 1  78 VAL MG1  .  78 . HG1* 1 1 
        922 1 1 1 1  47 MET ME   .  47 . HE*  1 1 
        922 1 2 1 1  78 VAL MG1  .  78 . HG1* 1 1 
        923 1 1 1 1  81 ASP H    .  81 . HN   1 1 
        923 1 2 1 1  81 ASP HB2  .  81 . HB2  1 1 
        924 1 1 1 1  82 VAL HA   .  82 . HA   1 1 
        924 1 2 1 1  82 VAL MG2  .  82 . HG2* 1 1 
        925 1 1 1 1  82 VAL HA   .  82 . HA   1 1 
        925 1 2 1 1  82 VAL MG1  .  82 . HG1* 1 1 
        926 1 1 1 1   6 LEU HA   .   6 . HA   1 1 
        926 1 2 1 1  56 VAL HB   .  56 . HB   1 1 
        927 1 1 1 1  83 LEU HA   .  83 . HA   1 1 
        927 1 2 1 1  83 LEU HG   .  83 . HG   1 1 
        928 1 1 1 1  83 LEU HA   .  83 . HA   1 1 
        928 1 2 1 1  83 LEU MD2  .  83 . HD2* 1 1 
        929 1 1 1 1  83 LEU HA   .  83 . HA   1 1 
        929 1 2 1 1  83 LEU MD1  .  83 . HD1* 1 1 
        930 1 1 1 1  83 LEU HB3  .  83 . HB1  1 1 
        930 1 2 1 1  83 LEU MD2  .  83 . HD2* 1 1 
        931 1 1 1 1  83 LEU HG   .  83 . HG   1 1 
        931 1 2 1 1  91 LEU MD2  .  91 . HD2* 1 1 
        932 1 1 1 1  83 LEU H    .  83 . HN   1 1 
        932 1 2 1 1  83 LEU MD2  .  83 . HD2* 1 1 
        933 1 1 1 1  83 LEU HB2  .  83 . HB2  1 1 
        933 1 2 1 1  83 LEU MD2  .  83 . HD2* 1 1 
        934 1 1 1 1  83 LEU H    .  83 . HN   1 1 
        934 1 2 1 1  83 LEU MD1  .  83 . HD1* 1 1 
        935 1 1 1 1  83 LEU HB2  .  83 . HB2  1 1 
        935 1 2 1 1  83 LEU MD1  .  83 . HD1* 1 1 
        936 1 1 1 1  83 LEU HB3  .  83 . HB1  1 1 
        936 1 2 1 1  83 LEU MD1  .  83 . HD1* 1 1 
        937 1 1 1 1  84 LYS H    .  84 . HN   1 1 
        937 1 2 1 1  84 LYS HG2  .  84 . HG2  1 1 
        938 1 1 1 1  84 LYS H    .  84 . HN   1 1 
        938 1 2 1 1  84 LYS HG3  .  84 . HG1  1 1 
        939 1 1 1 1  84 LYS HA   .  84 . HA   1 1 
        939 1 2 1 1  84 LYS HE2  .  84 . HE2  1 1 
        940 1 1 1 1  84 LYS HA   .  84 . HA   1 1 
        940 1 2 1 1  84 LYS HE3  .  84 . HE1  1 1 
        941 1 1 1 1  86 THR HA   .  86 . HA   1 1 
        941 1 2 1 1  86 THR MG   .  86 . HG2* 1 1 
        942 1 1 1 1  89 GLU HA   .  89 . HA   1 1 
        942 1 2 1 1  89 GLU HG2  .  89 . HG2  1 1 
        943 1 1 1 1  89 GLU HA   .  89 . HA   1 1 
        943 1 2 1 1  89 GLU HG3  .  89 . HG1  1 1 
        944 1 1 1 1  90 GLU HA   .  90 . HA   1 1 
        944 1 2 1 1  90 GLU HG2  .  90 . HG2  1 1 
        945 1 1 1 1  90 GLU HA   .  90 . HA   1 1 
        945 1 2 1 1  90 GLU HG3  .  90 . HG1  1 1 
        946 1 1 1 1  83 LEU MD2  .  83 . HD2* 1 1 
        946 1 2 1 1  91 LEU HA   .  91 . HA   1 1 
        947 1 1 1 1  91 LEU HA   .  91 . HA   1 1 
        947 1 2 1 1  91 LEU HG   .  91 . HG   1 1 
        948 1 1 1 1  91 LEU HA   .  91 . HA   1 1 
        948 1 2 1 1  91 LEU MD2  .  91 . HD2* 1 1 
        949 1 1 1 1  91 LEU HA   .  91 . HA   1 1 
        949 1 2 1 1  91 LEU MD1  .  91 . HD1* 1 1 
        950 1 1 1 1  91 LEU HB2  .  91 . HB2  1 1 
        950 1 2 1 1  91 LEU MD1  .  91 . HD1* 1 1 
        951 1 1 1 1  91 LEU HB3  .  91 . HB1  1 1 
        951 1 2 1 1  91 LEU MD1  .  91 . HD1* 1 1 
        952 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
        952 1 2 1 1  91 LEU MD1  .  91 . HD1* 1 1 
        953 1 1 1 1  92 THR H    .  92 . HN   1 1 
        953 1 2 1 1  92 THR MG   .  92 . HG2* 1 1 
        954 1 1 1 1  92 THR HA   .  92 . HA   1 1 
        954 1 2 1 1  92 THR MG   .  92 . HG2* 1 1 
        955 1 1 1 1  97 GLU HA   .  97 . HA   1 1 
        955 1 2 1 1  97 GLU HG3  .  97 . HG1  1 1 
        956 1 1 1 1  94 ARG HA   .  94 . HA   1 1 
        956 1 2 1 1  94 ARG HG2  .  94 . HG2  1 1 
        957 1 1 1 1  94 ARG HA   .  94 . HA   1 1 
        957 1 2 1 1  94 ARG HG3  .  94 . HG1  1 1 
        958 1 1 1 1  94 ARG HA   .  94 . HA   1 1 
        958 1 2 1 1  94 ARG HD2  .  94 . HD2  1 1 
        959 1 1 1 1  94 ARG HA   .  94 . HA   1 1 
        959 1 2 1 1  94 ARG HD3  .  94 . HD1  1 1 
        960 1 1 1 1  95 VAL HA   .  95 . HA   1 1 
        960 1 2 1 1  95 VAL MG1  .  95 . HG1* 1 1 
        961 1 1 1 1  95 VAL HA   .  95 . HA   1 1 
        961 1 2 1 1  95 VAL MG2  .  95 . HG2* 1 1 
        962 1 1 1 1  96 ARG HA   .  96 . HA   1 1 
        962 1 2 1 1  96 ARG HG2  .  96 . HG2  1 1 
        963 1 1 1 1  96 ARG HA   .  96 . HA   1 1 
        963 1 2 1 1  96 ARG HG3  .  96 . HG1  1 1 
        964 1 1 1 1  97 GLU H    .  97 . HN   1 1 
        964 1 2 1 1  97 GLU HB2  .  97 . HB2  1 1 
        965 1 1 1 1  97 GLU H    .  97 . HN   1 1 
        965 1 2 1 1  97 GLU HG2  .  97 . HG2  1 1 
        966 1 1 1 1  98 PHE HA   .  98 . HA   1 1 
        966 1 2 1 1  98 PHE QD   .  98 . HD*  1 1 
        967 1 1 1 1  99 LEU HA   .  99 . HA   1 1 
        967 1 2 1 1  99 LEU HG   .  99 . HG   1 1 
        968 1 1 1 1  99 LEU HA   .  99 . HA   1 1 
        968 1 2 1 1  99 LEU MD2  .  99 . HD2* 1 1 
        969 1 1 1 1  99 LEU HA   .  99 . HA   1 1 
        969 1 2 1 1  99 LEU MD1  .  99 . HD1* 1 1 
        970 1 1 1 1  95 VAL MG1  .  95 . HG1* 1 1 
        970 1 2 1 1  99 LEU HG   .  99 . HG   1 1 
        971 1 1 1 1  21 ARG HA   .  21 . HA   1 1 
        971 1 2 1 1  25 ASN H    .  25 . HN   1 1 
        972 1 1 1 1  48 LYS HA   .  48 . HA   1 1 
        972 1 2 1 1  48 LYS HG3  .  48 . HG1  1 1 
        973 1 1 1 1 100 LYS HA   . 100 . HA   1 1 
        973 1 2 1 1 100 LYS HG2  . 100 . HG2  1 1 
        974 1 1 1 1 100 LYS HA   . 100 . HA   1 1 
        974 1 2 1 1 100 LYS HG3  . 100 . HG1  1 1 
        975 1 1 1 1 100 LYS HA   . 100 . HA   1 1 
        975 1 2 1 1 100 LYS HE2  . 100 . HE2  1 1 
        976 1 1 1 1 100 LYS HA   . 100 . HA   1 1 
        976 1 2 1 1 100 LYS HE3  . 100 . HE1  1 1 
        977 1 1 1 1 101 THR HA   . 101 . HA   1 1 
        977 1 2 1 1 101 THR MG   . 101 . HG2* 1 1 
        978 1 1 1 1  22 ALA HA   .  22 . HA   1 1 
        978 1 2 1 1  95 VAL MG1  .  95 . HG1* 1 1 
        979 1 1 1 1 105 LEU HA   . 105 . HA   1 1 
        979 1 2 1 1 105 LEU MD2  . 105 . HD2* 1 1 
        980 1 1 1 1 105 LEU HB2  . 105 . HB2  1 1 
        980 1 2 1 1 105 LEU MD1  . 105 . HD1* 1 1 
        981 1 1 1 1 105 LEU HB2  . 105 . HB2  1 1 
        981 1 2 1 1 105 LEU MD2  . 105 . HD2* 1 1 
        982 1 1 1 1 105 LEU H    . 105 . HN   1 1 
        982 1 2 1 1 105 LEU HG   . 105 . HG   1 1 
        983 1 1 1 1 105 LEU HA   . 105 . HA   1 1 
        983 1 2 1 1 105 LEU HG   . 105 . HG   1 1 
        984 1 1 1 1 105 LEU HA   . 105 . HA   1 1 
        984 1 2 1 1 105 LEU MD1  . 105 . HD1* 1 1 
        985 1 1 1 1 105 LEU HB3  . 105 . HB1  1 1 
        985 1 2 1 1 105 LEU MD1  . 105 . HD1* 1 1 
        986 1 1 1 1 105 LEU HB3  . 105 . HB1  1 1 
        986 1 2 1 1 105 LEU MD2  . 105 . HD2* 1 1 
        987 1 1 1 1 106 GLU HA   . 106 . HA   1 1 
        987 1 2 1 1 106 GLU HG2  . 106 . HG2  1 1 
        988 1 1 1 1 106 GLU HA   . 106 . HA   1 1 
        988 1 2 1 1 106 GLU HG3  . 106 . HG1  1 1 
        989 1 1 1 1 106 GLU H    . 106 . HN   1 1 
        989 1 2 1 1 106 GLU HG2  . 106 . HG2  1 1 
        990 1 1 1 1   3 LYS H    .   3 . HN   1 1 
        990 1 2 1 1   4 VAL HB   .   4 . HB   1 1 
        991 1 1 1 1   5 LEU MD1  .   5 . HD1* 1 1 
        991 1 2 1 1   6 LEU H    .   6 . HN   1 1 
        992 1 1 1 1   6 LEU HB2  .   6 . HB2  1 1 
        992 1 2 1 1   7 VAL H    .   7 . HN   1 1 
        993 1 1 1 1   6 LEU MD1  .   6 . HD1* 1 1 
        993 1 2 1 1   7 VAL H    .   7 . HN   1 1 
        994 1 1 1 1   7 VAL HA   .   7 . HA   1 1 
        994 1 2 1 1   8 ILE H    .   8 . HN   1 1 
        995 1 1 1 1   7 VAL MG2  .   7 . HG2* 1 1 
        995 1 2 1 1   8 ILE H    .   8 . HN   1 1 
        996 1 1 1 1   7 VAL MG2  .   7 . HG2* 1 1 
        996 1 2 1 1  56 VAL H    .  56 . HN   1 1 
        997 1 1 1 1   8 ILE MD   .   8 . HD1* 1 1 
        997 1 2 1 1   9 SER H    .   9 . HN   1 1 
        998 1 1 1 1  10 THR HB   .  10 . HB   1 1 
        998 1 2 1 1  11 ASP H    .  11 . HN   1 1 
        999 1 1 1 1  12 THR MG   .  12 . HG2* 1 1 
        999 1 2 1 1  13 ASN H    .  13 . HN   1 1 
       1000 1 1 1 1  18 VAL MG2  .  18 . HG2* 1 1 
       1000 1 2 1 1  91 LEU H    .  91 . HN   1 1 
       1001 1 1 1 1  21 ARG HD2  .  21 . HD2  1 1 
       1001 1 2 1 1  22 ALA H    .  22 . HN   1 1 
       1002 1 1 1 1  21 ARG HD3  .  21 . HD1  1 1 
       1002 1 2 1 1  22 ALA H    .  22 . HN   1 1 
       1003 1 1 1 1  30 GLU HB2  .  30 . HB2  1 1 
       1003 1 2 1 1  31 ILE H    .  31 . HN   1 1 
       1004 1 1 1 1  30 GLU HB3  .  30 . HB1  1 1 
       1004 1 2 1 1  31 ILE H    .  31 . HN   1 1 
       1005 1 1 1 1  31 ILE HG12 .  31 . HG12 1 1 
       1005 1 2 1 1  32 ARG H    .  32 . HN   1 1 
       1006 1 1 1 1  32 ARG HB2  .  32 . HB2  1 1 
       1006 1 2 1 1  33 THR H    .  33 . HN   1 1 
       1007 1 1 1 1  33 THR HB   .  33 . HB   1 1 
       1007 1 2 1 1  34 ALA H    .  34 . HN   1 1 
       1008 1 1 1 1  42 ASP HB2  .  42 . HB2  1 1 
       1008 1 2 1 1  43 ILE H    .  43 . HN   1 1 
       1009 1 1 1 1  43 ILE MD   .  43 . HD1* 1 1 
       1009 1 2 1 1  44 ILE H    .  44 . HN   1 1 
       1010 1 1 1 1  10 THR H    .  10 . HN   1 1 
       1010 1 2 1 1  86 THR HA   .  86 . HA   1 1 
       1011 1 1 1 1  47 MET HG3  .  47 . HG1  1 1 
       1011 1 2 1 1  48 LYS H    .  48 . HN   1 1 
       1012 1 1 1 1  47 MET ME   .  47 . HE*  1 1 
       1012 1 2 1 1  48 LYS H    .  48 . HN   1 1 
       1013 1 1 1 1  48 LYS HG3  .  48 . HG1  1 1 
       1013 1 2 1 1  49 ASP H    .  49 . HN   1 1 
       1014 1 1 1 1  56 VAL MG2  .  56 . HG2* 1 1 
       1014 1 2 1 1  57 PHE H    .  57 . HN   1 1 
       1015 1 1 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       1015 1 2 1 1  59 ASN H    .  59 . HN   1 1 
       1016 1 1 1 1  59 ASN HA   .  59 . HA   1 1 
       1016 1 2 1 1  60 GLY H    .  60 . HN   1 1 
       1017 1 1 1 1  59 ASN HB2  .  59 . HB2  1 1 
       1017 1 2 1 1  60 GLY H    .  60 . HN   1 1 
       1018 1 1 1 1  59 ASN HB3  .  59 . HB1  1 1 
       1018 1 2 1 1  60 GLY H    .  60 . HN   1 1 
       1019 1 1 1 1  61 ALA MB   .  61 . HB*  1 1 
       1019 1 2 1 1  62 SER H    .  62 . HN   1 1 
       1020 1 1 1 1  67 ASN HB2  .  67 . HB2  1 1 
       1020 1 2 1 1  68 GLU H    .  68 . HN   1 1 
       1021 1 1 1 1  67 ASN HB3  .  67 . HB1  1 1 
       1021 1 2 1 1  68 GLU H    .  68 . HN   1 1 
       1022 1 1 1 1  68 GLU HB2  .  68 . HB2  1 1 
       1022 1 2 1 1  69 PHE H    .  69 . HN   1 1 
       1023 1 1 1 1  68 GLU HG3  .  68 . HG1  1 1 
       1023 1 2 1 1  69 PHE H    .  69 . HN   1 1 
       1024 1 1 1 1  73 ALA HA   .  73 . HA   1 1 
       1024 1 2 1 1  76 GLU H    .  76 . HN   1 1 
       1025 1 1 1 1  75 LYS HA   .  75 . HA   1 1 
       1025 1 2 1 1  77 GLY H    .  77 . HN   1 1 
       1026 1 1 1 1  75 LYS HG2  .  75 . HG2  1 1 
       1026 1 2 1 1  76 GLU H    .  76 . HN   1 1 
       1027 1 1 1 1  75 LYS HG3  .  75 . HG1  1 1 
       1027 1 2 1 1  76 GLU H    .  76 . HN   1 1 
       1028 1 1 1 1  76 GLU H    .  76 . HN   1 1 
       1028 1 2 1 1  76 GLU HG3  .  76 . HG1  1 1 
       1029 1 1 1 1  78 VAL HB   .  78 . HB   1 1 
       1029 1 2 1 1  79 SER H    .  79 . HN   1 1 
       1030 1 1 1 1  81 ASP HB3  .  81 . HB1  1 1 
       1030 1 2 1 1  82 VAL H    .  82 . HN   1 1 
       1031 1 1 1 1  82 VAL MG2  .  82 . HG2* 1 1 
       1031 1 2 1 1  83 LEU H    .  83 . HN   1 1 
       1032 1 1 1 1  90 GLU HB3  .  90 . HB1  1 1 
       1032 1 2 1 1  91 LEU H    .  91 . HN   1 1 
       1033 1 1 1 1  91 LEU MD2  .  91 . HD2* 1 1 
       1033 1 2 1 1  92 THR H    .  92 . HN   1 1 
       1034 1 1 1 1  93 GLN HB2  .  93 . HB2  1 1 
       1034 1 2 1 1  94 ARG H    .  94 . HN   1 1 
       1035 1 1 1 1  93 GLN HB3  .  93 . HB1  1 1 
       1035 1 2 1 1  94 ARG H    .  94 . HN   1 1 
       1036 1 1 1 1  94 ARG HG2  .  94 . HG2  1 1 
       1036 1 2 1 1  95 VAL H    .  95 . HN   1 1 
       1037 1 1 1 1  94 ARG HG3  .  94 . HG1  1 1 
       1037 1 2 1 1  95 VAL H    .  95 . HN   1 1 
       1038 1 1 1 1  95 VAL MG2  .  95 . HG2* 1 1 
       1038 1 2 1 1  96 ARG H    .  96 . HN   1 1 
       1039 1 1 1 1  97 GLU HG3  .  97 . HG1  1 1 
       1039 1 2 1 1  98 PHE H    .  98 . HN   1 1 
       1040 1 1 1 1  98 PHE HA   .  98 . HA   1 1 
       1040 1 2 1 1 102 ALA H    . 102 . HN   1 1 
       1041 1 1 1 1 101 THR MG   . 101 . HG2* 1 1 
       1041 1 2 1 1 102 ALA H    . 102 . HN   1 1 
       1042 1 1 1 1 105 LEU H    . 105 . HN   1 1 
       1042 1 2 1 1 105 LEU MD1  . 105 . HD1* 1 1 
       1043 1 1 1 1 105 LEU MD1  . 105 . HD1* 1 1 
       1043 1 2 1 1 106 GLU H    . 106 . HN   1 1 
       1044 1 1 1 1  12 THR HA   .  12 . HA   1 1 
       1044 1 2 1 1  15 ILE HB   .  15 . HB   1 1 
       1045 1 1 1 1  12 THR HA   .  12 . HA   1 1 
       1045 1 2 1 1  16 SER H    .  16 . HN   1 1 
       1046 1 1 1 1  13 ASN HA   .  13 . HA   1 1 
       1046 1 2 1 1  16 SER HB2  .  16 . HB2  1 1 
       1047 1 1 1 1  13 ASN HA   .  13 . HA   1 1 
       1047 1 2 1 1  16 SER HB3  .  16 . HB1  1 1 
       1048 1 1 1 1  14 ILE HA   .  14 . HA   1 1 
       1048 1 2 1 1  16 SER H    .  16 . HN   1 1 
       1049 1 1 1 1  14 ILE HA   .  14 . HA   1 1 
       1049 1 2 1 1  18 VAL H    .  18 . HN   1 1 
       1050 1 1 1 1  15 ILE HA   .  15 . HA   1 1 
       1050 1 2 1 1  18 VAL HB   .  18 . HB   1 1 
       1051 1 1 1 1  16 SER HA   .  16 . HA   1 1 
       1051 1 2 1 1  19 GLN HB2  .  19 . HB2  1 1 
       1052 1 1 1 1  16 SER HA   .  16 . HA   1 1 
       1052 1 2 1 1  19 GLN HB3  .  19 . HB1  1 1 
       1053 1 1 1 1  19 GLN HA   .  19 . HA   1 1 
       1053 1 2 1 1  22 ALA MB   .  22 . HB*  1 1 
       1054 1 1 1 1  19 GLN HA   .  19 . HA   1 1 
       1054 1 2 1 1  23 LYS H    .  23 . HN   1 1 
       1055 1 1 1 1  20 GLU HA   .  20 . HA   1 1 
       1055 1 2 1 1  22 ALA H    .  22 . HN   1 1 
       1056 1 1 1 1  21 ARG HA   .  21 . HA   1 1 
       1056 1 2 1 1  23 LYS H    .  23 . HN   1 1 
       1057 1 1 1 1  37 SER HA   .  37 . HA   1 1 
       1057 1 2 1 1  40 ILE HB   .  40 . HB   1 1 
       1058 1 1 1 1  38 GLN HA   .  38 . HA   1 1 
       1058 1 2 1 1  41 ARG H    .  41 . HN   1 1 
       1059 1 1 1 1  39 ASP HA   .  39 . HA   1 1 
       1059 1 2 1 1  42 ASP HB2  .  42 . HB2  1 1 
       1060 1 1 1 1  39 ASP HA   .  39 . HA   1 1 
       1060 1 2 1 1  42 ASP HB3  .  42 . HB1  1 1 
       1061 1 1 1 1  39 ASP HA   .  39 . HA   1 1 
       1061 1 2 1 1  43 ILE H    .  43 . HN   1 1 
       1062 1 1 1 1  40 ILE HA   .  40 . HA   1 1 
       1062 1 2 1 1  43 ILE H    .  43 . HN   1 1 
       1063 1 1 1 1  40 ILE HA   .  40 . HA   1 1 
       1063 1 2 1 1  43 ILE HB   .  43 . HB   1 1 
       1064 1 1 1 1  40 ILE HA   .  40 . HA   1 1 
       1064 1 2 1 1  44 ILE H    .  44 . HN   1 1 
       1065 1 1 1 1  41 ARG HA   .  41 . HA   1 1 
       1065 1 2 1 1  43 ILE H    .  43 . HN   1 1 
       1066 1 1 1 1  41 ARG HA   .  41 . HA   1 1 
       1066 1 2 1 1  44 ILE HB   .  44 . HB   1 1 
       1067 1 1 1 1  42 ASP HA   .  42 . HA   1 1 
       1067 1 2 1 1  44 ILE H    .  44 . HN   1 1 
       1068 1 1 1 1  42 ASP HA   .  42 . HA   1 1 
       1068 1 2 1 1  45 LYS HB2  .  45 . HB2  1 1 
       1069 1 1 1 1  42 ASP HA   .  42 . HA   1 1 
       1069 1 2 1 1  45 LYS HB3  .  45 . HB1  1 1 
       1070 1 1 1 1  42 ASP HA   .  42 . HA   1 1 
       1070 1 2 1 1  46 SER H    .  46 . HN   1 1 
       1071 1 1 1 1  43 ILE HA   .  43 . HA   1 1 
       1071 1 2 1 1  46 SER HB2  .  46 . HB2  1 1 
       1072 1 1 1 1  43 ILE HA   .  43 . HA   1 1 
       1072 1 2 1 1  46 SER HB3  .  46 . HB1  1 1 
       1073 1 1 1 1  43 ILE HA   .  43 . HA   1 1 
       1073 1 2 1 1  45 LYS H    .  45 . HN   1 1 
       1074 1 1 1 1  63 GLN HA   .  63 . HA   1 1 
       1074 1 2 1 1  66 VAL H    .  66 . HN   1 1 
       1075 1 1 1 1  63 GLN HA   .  63 . HA   1 1 
       1075 1 2 1 1  66 VAL HB   .  66 . HB   1 1 
       1076 1 1 1 1  63 GLN HA   .  63 . HA   1 1 
       1076 1 2 1 1  67 ASN H    .  67 . HN   1 1 
       1077 1 1 1 1  65 ASP HA   .  65 . HA   1 1 
       1077 1 2 1 1  67 ASN H    .  67 . HN   1 1 
       1078 1 1 1 1  65 ASP HA   .  65 . HA   1 1 
       1078 1 2 1 1  68 GLU H    .  68 . HN   1 1 
       1079 1 1 1 1  65 ASP HA   .  65 . HA   1 1 
       1079 1 2 1 1  68 GLU HB2  .  68 . HB2  1 1 
       1080 1 1 1 1  65 ASP HA   .  65 . HA   1 1 
       1080 1 2 1 1  68 GLU HB3  .  68 . HB1  1 1 
       1081 1 1 1 1  66 VAL HA   .  66 . HA   1 1 
       1081 1 2 1 1  69 PHE HB2  .  69 . HB2  1 1 
       1082 1 1 1 1  66 VAL HA   .  66 . HA   1 1 
       1082 1 2 1 1  69 PHE HB3  .  69 . HB1  1 1 
       1083 1 1 1 1  66 VAL HB   .  66 . HB   1 1 
       1083 1 2 1 1  67 ASN HA   .  67 . HA   1 1 
       1084 1 1 1 1  68 GLU HA   .  68 . HA   1 1 
       1084 1 2 1 1  72 GLU H    .  72 . HN   1 1 
       1085 1 1 1 1  70 GLN HA   .  70 . HA   1 1 
       1085 1 2 1 1  73 ALA MB   .  73 . HB*  1 1 
       1086 1 1 1 1  71 ASN HA   .  71 . HA   1 1 
       1086 1 2 1 1  73 ALA H    .  73 . HN   1 1 
       1087 1 1 1 1  72 GLU HA   .  72 . HA   1 1 
       1087 1 2 1 1  76 GLU H    .  76 . HN   1 1 
       1088 1 1 1 1  72 GLU HA   .  72 . HA   1 1 
       1088 1 2 1 1  75 LYS H    .  75 . HN   1 1 
       1089 1 1 1 1  88 PRO HA   .  88 . HA   1 1 
       1089 1 2 1 1  91 LEU HB2  .  91 . HB2  1 1 
       1090 1 1 1 1  88 PRO HA   .  88 . HA   1 1 
       1090 1 2 1 1  91 LEU HB3  .  91 . HB1  1 1 
       1091 1 1 1 1  89 GLU HA   .  89 . HA   1 1 
       1091 1 2 1 1  92 THR HB   .  92 . HB   1 1 
       1092 1 1 1 1  90 GLU HA   .  90 . HA   1 1 
       1092 1 2 1 1  92 THR H    .  92 . HN   1 1 
       1093 1 1 1 1  90 GLU HA   .  90 . HA   1 1 
       1093 1 2 1 1  93 GLN H    .  93 . HN   1 1 
       1094 1 1 1 1  91 LEU HA   .  91 . HA   1 1 
       1094 1 2 1 1  94 ARG HB2  .  94 . HB2  1 1 
       1095 1 1 1 1  91 LEU HA   .  91 . HA   1 1 
       1095 1 2 1 1  94 ARG HB3  .  94 . HB1  1 1 
       1096 1 1 1 1  92 THR HA   .  92 . HA   1 1 
       1096 1 2 1 1  94 ARG H    .  94 . HN   1 1 
       1097 1 1 1 1  92 THR HA   .  92 . HA   1 1 
       1097 1 2 1 1  95 VAL H    .  95 . HN   1 1 
       1098 1 1 1 1  92 THR HA   .  92 . HA   1 1 
       1098 1 2 1 1  95 VAL HB   .  95 . HB   1 1 
       1099 1 1 1 1  93 GLN HA   .  93 . HA   1 1 
       1099 1 2 1 1  95 VAL H    .  95 . HN   1 1 
       1100 1 1 1 1  94 ARG HA   .  94 . HA   1 1 
       1100 1 2 1 1  96 ARG H    .  96 . HN   1 1 
       1101 1 1 1 1  94 ARG HA   .  94 . HA   1 1 
       1101 1 2 1 1  97 GLU HB2  .  97 . HB2  1 1 
       1102 1 1 1 1  94 ARG HA   .  94 . HA   1 1 
       1102 1 2 1 1  97 GLU HB3  .  97 . HB1  1 1 
       1103 1 1 1 1  94 ARG HA   .  94 . HA   1 1 
       1103 1 2 1 1  98 PHE H    .  98 . HN   1 1 
       1104 1 1 1 1  95 VAL HA   .  95 . HA   1 1 
       1104 1 2 1 1  98 PHE HB2  .  98 . HB2  1 1 
       1105 1 1 1 1  95 VAL HA   .  95 . HA   1 1 
       1105 1 2 1 1  98 PHE HB3  .  98 . HB1  1 1 
       1106 1 1 1 1  95 VAL HA   .  95 . HA   1 1 
       1106 1 2 1 1  99 LEU H    .  99 . HN   1 1 
       1107 1 1 1 1  96 ARG HA   .  96 . HA   1 1 
       1107 1 2 1 1  98 PHE H    .  98 . HN   1 1 
       1108 1 1 1 1  96 ARG HA   .  96 . HA   1 1 
       1108 1 2 1 1  99 LEU H    .  99 . HN   1 1 
       1109 1 1 1 1  95 VAL MG1  .  95 . HG1* 1 1 
       1109 1 2 1 1  96 ARG HA   .  96 . HA   1 1 
       1110 1 1 1 1  97 GLU HA   .  97 . HA   1 1 
       1110 1 2 1 1  99 LEU H    .  99 . HN   1 1 
       1111 1 1 1 1  98 PHE HA   .  98 . HA   1 1 
       1111 1 2 1 1 100 LYS H    . 100 . HN   1 1 
       1112 1 1 1 1  98 PHE HA   .  98 . HA   1 1 
       1112 1 2 1 1 101 THR HB   . 101 . HB   1 1 
       1113 1 1 1 1   4 VAL HB   .   4 . HB   1 1 
       1113 1 2 1 1  80 TYR HA   .  80 . HA   1 1 
       1114 1 1 1 1   4 VAL MG2  .   4 . HG2* 1 1 
       1114 1 2 1 1  80 TYR HA   .  80 . HA   1 1 
       1115 1 1 1 1   4 VAL MG1  .   4 . HG1* 1 1 
       1115 1 2 1 1  80 TYR HA   .  80 . HA   1 1 
       1116 1 1 1 1   4 VAL MG1  .   4 . HG1* 1 1 
       1116 1 2 1 1   5 LEU HA   .   5 . HA   1 1 
       1117 1 1 1 1   4 VAL MG2  .   4 . HG2* 1 1 
       1117 1 2 1 1  54 LEU HB2  .  54 . HB2  1 1 
       1118 1 1 1 1   4 VAL MG2  .   4 . HG2* 1 1 
       1118 1 2 1 1  54 LEU HB3  .  54 . HB1  1 1 
       1119 1 1 1 1   4 VAL MG2  .   4 . HG2* 1 1 
       1119 1 2 1 1  56 VAL MG2  .  56 . HG2* 1 1 
       1120 1 1 1 1   4 VAL MG2  .   4 . HG2* 1 1 
       1120 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       1121 1 1 1 1   4 VAL HA   .   4 . HA   1 1 
       1121 1 2 1 1   5 LEU HB2  .   5 . HB2  1 1 
       1122 1 1 1 1   4 VAL HA   .   4 . HA   1 1 
       1122 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       1123 1 1 1 1   4 VAL HA   .   4 . HA   1 1 
       1123 1 2 1 1  56 VAL MG2  .  56 . HG2* 1 1 
       1124 1 1 1 1   4 VAL HA   .   4 . HA   1 1 
       1124 1 2 1 1   5 LEU HB3  .   5 . HB1  1 1 
       1125 1 1 1 1   4 VAL HB   .   4 . HB   1 1 
       1125 1 2 1 1  56 VAL MG2  .  56 . HG2* 1 1 
       1126 1 1 1 1   4 VAL HB   .   4 . HB   1 1 
       1126 1 2 1 1  78 VAL MG1  .  78 . HG1* 1 1 
       1127 1 1 1 1   4 VAL MG1  .   4 . HG1* 1 1 
       1127 1 2 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       1128 1 1 1 1   4 VAL MG1  .   4 . HG1* 1 1 
       1128 1 2 1 1   6 LEU MD1  .   6 . HD1* 1 1 
       1129 1 1 1 1   4 VAL MG2  .   4 . HG2* 1 1 
       1129 1 2 1 1  47 MET HG2  .  47 . HG2  1 1 
       1130 1 1 1 1   4 VAL MG2  .   4 . HG2* 1 1 
       1130 1 2 1 1  47 MET HG3  .  47 . HG1  1 1 
       1131 1 1 1 1   4 VAL HB   .   4 . HB   1 1 
       1131 1 2 1 1  80 TYR HB2  .  80 . HB2  1 1 
       1132 1 1 1 1   4 VAL HB   .   4 . HB   1 1 
       1132 1 2 1 1  80 TYR HB3  .  80 . HB1  1 1 
       1133 1 1 1 1   4 VAL HA   .   4 . HA   1 1 
       1133 1 2 1 1  98 PHE QD   .  98 . HD*  1 1 
       1134 1 1 1 1   4 VAL HB   .   4 . HB   1 1 
       1134 1 2 1 1  69 PHE QE   .  69 . HE*  1 1 
       1135 1 1 1 1   4 VAL HB   .   4 . HB   1 1 
       1135 1 2 1 1  81 ASP H    .  81 . HN   1 1 
       1136 1 1 1 1   4 VAL MG2  .   4 . HG2* 1 1 
       1136 1 2 1 1  69 PHE QE   .  69 . HE*  1 1 
       1137 1 1 1 1   4 VAL MG1  .   4 . HG1* 1 1 
       1137 1 2 1 1  98 PHE QD   .  98 . HD*  1 1 
       1138 1 1 1 1   5 LEU MD1  .   5 . HD1* 1 1 
       1138 1 2 1 1  95 VAL HA   .  95 . HA   1 1 
       1139 1 1 1 1   5 LEU MD1  .   5 . HD1* 1 1 
       1139 1 2 1 1  98 PHE HB2  .  98 . HB2  1 1 
       1140 1 1 1 1   5 LEU MD1  .   5 . HD1* 1 1 
       1140 1 2 1 1  81 ASP HB2  .  81 . HB2  1 1 
       1141 1 1 1 1   5 LEU MD2  .   5 . HD2* 1 1 
       1141 1 2 1 1  98 PHE HB2  .  98 . HB2  1 1 
       1142 1 1 1 1   5 LEU MD2  .   5 . HD2* 1 1 
       1142 1 2 1 1  98 PHE HB3  .  98 . HB1  1 1 
       1143 1 1 1 1   5 LEU MD1  .   5 . HD1* 1 1 
       1143 1 2 1 1  82 VAL HA   .  82 . HA   1 1 
       1144 1 1 1 1   5 LEU MD1  .   5 . HD1* 1 1 
       1144 1 2 1 1  83 LEU HB3  .  83 . HB1  1 1 
       1145 1 1 1 1   5 LEU MD2  .   5 . HD2* 1 1 
       1145 1 2 1 1  99 LEU HG   .  99 . HG   1 1 
       1146 1 1 1 1   5 LEU MD2  .   5 . HD2* 1 1 
       1146 1 2 1 1   7 VAL MG2  .   7 . HG2* 1 1 
       1147 1 1 1 1   6 LEU MD1  .   6 . HD1* 1 1 
       1147 1 2 1 1  58 VAL HB   .  58 . HB   1 1 
       1148 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       1148 1 2 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       1149 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       1149 1 2 1 1   8 ILE MD   .   8 . HD1* 1 1 
       1150 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       1150 1 2 1 1  66 VAL MG1  .  66 . HG1* 1 1 
       1151 1 1 1 1   6 LEU HG   .   6 . HG   1 1 
       1151 1 2 1 1   8 ILE HG13 .   8 . HG11 1 1 
       1152 1 1 1 1   6 LEU HG   .   6 . HG   1 1 
       1152 1 2 1 1  66 VAL MG1  .  66 . HG1* 1 1 
       1153 1 1 1 1   6 LEU HG   .   6 . HG   1 1 
       1153 1 2 1 1  82 VAL MG1  .  82 . HG1* 1 1 
       1154 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       1154 1 2 1 1  66 VAL HA   .  66 . HA   1 1 
       1155 1 1 1 1   6 LEU HG   .   6 . HG   1 1 
       1155 1 2 1 1  83 LEU H    .  83 . HN   1 1 
       1156 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       1156 1 2 1 1  83 LEU H    .  83 . HN   1 1 
       1157 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       1157 1 2 1 1  71 ASN H    .  71 . HN   1 1 
       1158 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       1158 1 2 1 1  69 PHE QD   .  69 . HD*  1 1 
       1159 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       1159 1 2 1 1  69 PHE QE   .  69 . HE*  1 1 
       1160 1 1 1 1   6 LEU MD1  .   6 . HD1* 1 1 
       1160 1 2 1 1  69 PHE QD   .  69 . HD*  1 1 
       1161 1 1 1 1   6 LEU MD1  .   6 . HD1* 1 1 
       1161 1 2 1 1  69 PHE QE   .  69 . HE*  1 1 
       1162 1 1 1 1   7 VAL MG1  .   7 . HG1* 1 1 
       1162 1 2 1 1  83 LEU H    .  83 . HN   1 1 
       1163 1 1 1 1   5 LEU H    .   5 . HN   1 1 
       1163 1 2 1 1   7 VAL MG2  .   7 . HG2* 1 1 
       1164 1 1 1 1   7 VAL MG1  .   7 . HG1* 1 1 
       1164 1 2 1 1  85 SER H    .  85 . HN   1 1 
       1165 1 1 1 1   7 VAL MG2  .   7 . HG2* 1 1 
       1165 1 2 1 1  95 VAL HA   .  95 . HA   1 1 
       1166 1 1 1 1   7 VAL MG1  .   7 . HG1* 1 1 
       1166 1 2 1 1   9 SER HB2  .   9 . HB2  1 1 
       1167 1 1 1 1   7 VAL MG1  .   7 . HG1* 1 1 
       1167 1 2 1 1  91 LEU HA   .  91 . HA   1 1 
       1168 1 1 1 1   7 VAL HA   .   7 . HA   1 1 
       1168 1 2 1 1  83 LEU MD2  .  83 . HD2* 1 1 
       1169 1 1 1 1   7 VAL HB   .   7 . HB   1 1 
       1169 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       1170 1 1 1 1   5 LEU HG   .   5 . HG   1 1 
       1170 1 2 1 1   7 VAL HB   .   7 . HB   1 1 
       1171 1 1 1 1   7 VAL HB   .   7 . HB   1 1 
       1171 1 2 1 1  83 LEU MD2  .  83 . HD2* 1 1 
       1172 1 1 1 1   7 VAL HA   .   7 . HA   1 1 
       1172 1 2 1 1  83 LEU HB2  .  83 . HB2  1 1 
       1173 1 1 1 1   7 VAL HA   .   7 . HA   1 1 
       1173 1 2 1 1  83 LEU HG   .  83 . HG   1 1 
       1174 1 1 1 1   7 VAL HA   .   7 . HA   1 1 
       1174 1 2 1 1  83 LEU HB3  .  83 . HB1  1 1 
       1175 1 1 1 1   5 LEU MD1  .   5 . HD1* 1 1 
       1175 1 2 1 1   7 VAL HA   .   7 . HA   1 1 
       1176 1 1 1 1   7 VAL MG1  .   7 . HG1* 1 1 
       1176 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       1177 1 1 1 1   5 LEU HG   .   5 . HG   1 1 
       1177 1 2 1 1   7 VAL MG2  .   7 . HG2* 1 1 
       1178 1 1 1 1   7 VAL MG2  .   7 . HG2* 1 1 
       1178 1 2 1 1  83 LEU MD2  .  83 . HD2* 1 1 
       1179 1 1 1 1   7 VAL MG2  .   7 . HG2* 1 1 
       1179 1 2 1 1  95 VAL MG2  .  95 . HG2* 1 1 
       1180 1 1 1 1   7 VAL MG2  .   7 . HG2* 1 1 
       1180 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       1181 1 1 1 1   6 LEU MD1  .   6 . HD1* 1 1 
       1181 1 2 1 1   8 ILE MD   .   8 . HD1* 1 1 
       1182 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       1182 1 2 1 1   8 ILE HG13 .   8 . HG11 1 1 
       1183 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       1183 1 2 1 1   8 ILE HG12 .   8 . HG12 1 1 
       1184 1 1 1 1   8 ILE MG   .   8 . HG2* 1 1 
       1184 1 2 1 1  84 LYS HE2  .  84 . HE2  1 1 
       1185 1 1 1 1   8 ILE MG   .   8 . HG2* 1 1 
       1185 1 2 1 1  84 LYS HE3  .  84 . HE1  1 1 
       1186 1 1 1 1   7 VAL HA   .   7 . HA   1 1 
       1186 1 2 1 1   8 ILE HB   .   8 . HB   1 1 
       1187 1 1 1 1   6 LEU HG   .   6 . HG   1 1 
       1187 1 2 1 1   8 ILE MD   .   8 . HD1* 1 1 
       1188 1 1 1 1   8 ILE MG   .   8 . HG2* 1 1 
       1188 1 2 1 1  61 ALA MB   .  61 . HB*  1 1 
       1189 1 1 1 1   8 ILE HB   .   8 . HB   1 1 
       1189 1 2 1 1  84 LYS HA   .  84 . HA   1 1 
       1190 1 1 1 1   8 ILE MG   .   8 . HG2* 1 1 
       1190 1 2 1 1  84 LYS HA   .  84 . HA   1 1 
       1191 1 1 1 1   8 ILE MD   .   8 . HD1* 1 1 
       1191 1 2 1 1  84 LYS HA   .  84 . HA   1 1 
       1192 1 1 1 1   8 ILE MD   .   8 . HD1* 1 1 
       1192 1 2 1 1   9 SER HA   .   9 . HA   1 1 
       1193 1 1 1 1   8 ILE HB   .   8 . HB   1 1 
       1193 1 2 1 1  85 SER H    .  85 . HN   1 1 
       1194 1 1 1 1   9 SER HB3  .   9 . HB1  1 1 
       1194 1 2 1 1  15 ILE HG13 .  15 . HG11 1 1 
       1195 1 1 1 1   9 SER HB3  .   9 . HB1  1 1 
       1195 1 2 1 1  86 THR MG   .  86 . HG2* 1 1 
       1196 1 1 1 1   9 SER HB2  .   9 . HB2  1 1 
       1196 1 2 1 1  15 ILE HG13 .  15 . HG11 1 1 
       1197 1 1 1 1   9 SER HB2  .   9 . HB2  1 1 
       1197 1 2 1 1  86 THR MG   .  86 . HG2* 1 1 
       1198 1 1 1 1   7 VAL MG1  .   7 . HG1* 1 1 
       1198 1 2 1 1   9 SER HB3  .   9 . HB1  1 1 
       1199 1 1 1 1  10 THR HA   .  10 . HA   1 1 
       1199 1 2 1 1  15 ILE MD   .  15 . HD1* 1 1 
       1200 1 1 1 1  33 THR MG   .  33 . HG2* 1 1 
       1200 1 2 1 1  57 PHE HB2  .  57 . HB2  1 1 
       1201 1 1 1 1  11 ASP HB3  .  11 . HB1  1 1 
       1201 1 2 1 1  14 ILE HG13 .  14 . HG11 1 1 
       1202 1 1 1 1  11 ASP HB3  .  11 . HB1  1 1 
       1202 1 2 1 1  14 ILE HG12 .  14 . HG12 1 1 
       1203 1 1 1 1  11 ASP HB3  .  11 . HB1  1 1 
       1203 1 2 1 1  14 ILE MD   .  14 . HD1* 1 1 
       1204 1 1 1 1  11 ASP HB2  .  11 . HB2  1 1 
       1204 1 2 1 1  14 ILE HG12 .  14 . HG12 1 1 
       1205 1 1 1 1  12 THR HA   .  12 . HA   1 1 
       1205 1 2 1 1  15 ILE HG13 .  15 . HG11 1 1 
       1206 1 1 1 1  12 THR HA   .  12 . HA   1 1 
       1206 1 2 1 1  15 ILE MD   .  15 . HD1* 1 1 
       1207 1 1 1 1  12 THR HB   .  12 . HB   1 1 
       1207 1 2 1 1  15 ILE MD   .  15 . HD1* 1 1 
       1208 1 1 1 1  12 THR MG   .  12 . HG2* 1 1 
       1208 1 2 1 1  15 ILE MD   .  15 . HD1* 1 1 
       1209 1 1 1 1  12 THR HA   .  12 . HA   1 1 
       1209 1 2 1 1  14 ILE HB   .  14 . HB   1 1 
       1210 1 1 1 1  11 ASP H    .  11 . HN   1 1 
       1210 1 2 1 1  12 THR MG   .  12 . HG2* 1 1 
       1211 1 1 1 1  12 THR MG   .  12 . HG2* 1 1 
       1211 1 2 1 1  14 ILE H    .  14 . HN   1 1 
       1212 1 1 1 1  14 ILE MD   .  14 . HD1* 1 1 
       1212 1 2 1 1  18 VAL H    .  18 . HN   1 1 
       1213 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
       1213 1 2 1 1  57 PHE QE   .  57 . HE*  1 1 
       1214 1 1 1 1  11 ASP HB3  .  11 . HB1  1 1 
       1214 1 2 1 1  14 ILE HB   .  14 . HB   1 1 
       1215 1 1 1 1  11 ASP HB2  .  11 . HB2  1 1 
       1215 1 2 1 1  14 ILE HB   .  14 . HB   1 1 
       1216 1 1 1 1  11 ASP HB2  .  11 . HB2  1 1 
       1216 1 2 1 1  14 ILE HG13 .  14 . HG11 1 1 
       1217 1 1 1 1  14 ILE MD   .  14 . HD1* 1 1 
       1217 1 2 1 1  88 PRO HB2  .  88 . HB2  1 1 
       1218 1 1 1 1  11 ASP HB2  .  11 . HB2  1 1 
       1218 1 2 1 1  14 ILE MD   .  14 . HD1* 1 1 
       1219 1 1 1 1  14 ILE HB   .  14 . HB   1 1 
       1219 1 2 1 1  18 VAL MG2  .  18 . HG2* 1 1 
       1220 1 1 1 1  12 THR HA   .  12 . HA   1 1 
       1220 1 2 1 1  15 ILE MG   .  15 . HG2* 1 1 
       1221 1 1 1 1  14 ILE H    .  14 . HN   1 1 
       1221 1 2 1 1  15 ILE HB   .  15 . HB   1 1 
       1222 1 1 1 1  15 ILE HB   .  15 . HB   1 1 
       1222 1 2 1 1  17 SER H    .  17 . HN   1 1 
       1223 1 1 1 1  15 ILE MG   .  15 . HG2* 1 1 
       1223 1 2 1 1  57 PHE QD   .  57 . HD*  1 1 
       1224 1 1 1 1  15 ILE MG   .  15 . HG2* 1 1 
       1224 1 2 1 1  57 PHE QE   .  57 . HE*  1 1 
       1225 1 1 1 1  15 ILE MD   .  15 . HD1* 1 1 
       1225 1 2 1 1  57 PHE QD   .  57 . HD*  1 1 
       1226 1 1 1 1  15 ILE MD   .  15 . HD1* 1 1 
       1226 1 2 1 1  57 PHE QE   .  57 . HE*  1 1 
       1227 1 1 1 1  18 VAL MG2  .  18 . HG2* 1 1 
       1227 1 2 1 1  57 PHE HZ   .  57 . HZ   1 1 
       1228 1 1 1 1  18 VAL MG2  .  18 . HG2* 1 1 
       1228 1 2 1 1  57 PHE QD   .  57 . HD*  1 1 
       1229 1 1 1 1  18 VAL MG1  .  18 . HG1* 1 1 
       1229 1 2 1 1  20 GLU H    .  20 . HN   1 1 
       1230 1 1 1 1  18 VAL MG1  .  18 . HG1* 1 1 
       1230 1 2 1 1  57 PHE QD   .  57 . HD*  1 1 
       1231 1 1 1 1  18 VAL MG1  .  18 . HG1* 1 1 
       1231 1 2 1 1  57 PHE QE   .  57 . HE*  1 1 
       1232 1 1 1 1  18 VAL HB   .  18 . HB   1 1 
       1232 1 2 1 1  57 PHE QE   .  57 . HE*  1 1 
       1233 1 1 1 1  18 VAL MG2  .  18 . HG2* 1 1 
       1233 1 2 1 1  88 PRO HA   .  88 . HA   1 1 
       1234 1 1 1 1  14 ILE HA   .  14 . HA   1 1 
       1234 1 2 1 1  18 VAL MG2  .  18 . HG2* 1 1 
       1235 1 1 1 1  18 VAL MG1  .  18 . HG1* 1 1 
       1235 1 2 1 1  95 VAL HB   .  95 . HB   1 1 
       1236 1 1 1 1  18 VAL MG2  .  18 . HG2* 1 1 
       1236 1 2 1 1  91 LEU HB2  .  91 . HB2  1 1 
       1237 1 1 1 1  18 VAL MG2  .  18 . HG2* 1 1 
       1237 1 2 1 1  91 LEU HG   .  91 . HG   1 1 
       1238 1 1 1 1  18 VAL HA   .  18 . HA   1 1 
       1238 1 2 1 1  21 ARG HG3  .  21 . HG1  1 1 
       1239 1 1 1 1  18 VAL HA   .  18 . HA   1 1 
       1239 1 2 1 1  21 ARG HG2  .  21 . HG2  1 1 
       1240 1 1 1 1  18 VAL HA   .  18 . HA   1 1 
       1240 1 2 1 1  22 ALA MB   .  22 . HB*  1 1 
       1241 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
       1241 1 2 1 1  18 VAL HA   .  18 . HA   1 1 
       1242 1 1 1 1  18 VAL HA   .  18 . HA   1 1 
       1242 1 2 1 1  92 THR MG   .  92 . HG2* 1 1 
       1243 1 1 1 1  18 VAL HB   .  18 . HB   1 1 
       1243 1 2 1 1  92 THR MG   .  92 . HG2* 1 1 
       1244 1 1 1 1  18 VAL MG1  .  18 . HG1* 1 1 
       1244 1 2 1 1  92 THR MG   .  92 . HG2* 1 1 
       1245 1 1 1 1  30 GLU HB2  .  30 . HB2  1 1 
       1245 1 2 1 1  54 LEU MD1  .  54 . HD1* 1 1 
       1246 1 1 1 1  30 GLU HB3  .  30 . HB1  1 1 
       1246 1 2 1 1  54 LEU HG   .  54 . HG   1 1 
       1247 1 1 1 1  22 ALA H    .  22 . HN   1 1 
       1247 1 2 1 1  31 ILE MD   .  31 . HD1* 1 1 
       1248 1 1 1 1  26 TYR H    .  26 . HN   1 1 
       1248 1 2 1 1  31 ILE MD   .  31 . HD1* 1 1 
       1249 1 1 1 1  31 ILE MD   .  31 . HD1* 1 1 
       1249 1 2 1 1  57 PHE QE   .  57 . HE*  1 1 
       1250 1 1 1 1  26 TYR QE   .  26 . HE*  1 1 
       1250 1 2 1 1  31 ILE MD   .  31 . HD1* 1 1 
       1251 1 1 1 1  31 ILE HG12 .  31 . HG12 1 1 
       1251 1 2 1 1  57 PHE QE   .  57 . HE*  1 1 
       1252 1 1 1 1  31 ILE HG13 .  31 . HG11 1 1 
       1252 1 2 1 1  57 PHE QE   .  57 . HE*  1 1 
       1253 1 1 1 1  31 ILE MG   .  31 . HG2* 1 1 
       1253 1 2 1 1  57 PHE HZ   .  57 . HZ   1 1 
       1254 1 1 1 1  23 LYS HA   .  23 . HA   1 1 
       1254 1 2 1 1  31 ILE MG   .  31 . HG2* 1 1 
       1255 1 1 1 1  22 ALA MB   .  22 . HB*  1 1 
       1255 1 2 1 1  31 ILE MD   .  31 . HD1* 1 1 
       1256 1 1 1 1  31 ILE MD   .  31 . HD1* 1 1 
       1256 1 2 1 1  55 VAL HB   .  55 . HB   1 1 
       1257 1 1 1 1  19 GLN HA   .  19 . HA   1 1 
       1257 1 2 1 1  31 ILE MD   .  31 . HD1* 1 1 
       1258 1 1 1 1  23 LYS HA   .  23 . HA   1 1 
       1258 1 2 1 1  31 ILE MD   .  31 . HD1* 1 1 
       1259 1 1 1 1  31 ILE MG   .  31 . HG2* 1 1 
       1259 1 2 1 1  55 VAL HB   .  55 . HB   1 1 
       1260 1 1 1 1  22 ALA MB   .  22 . HB*  1 1 
       1260 1 2 1 1  31 ILE MG   .  31 . HG2* 1 1 
       1261 1 1 1 1  23 LYS HE2  .  23 . HE2  1 1 
       1261 1 2 1 1  31 ILE HB   .  31 . HB   1 1 
       1262 1 1 1 1  23 LYS HE3  .  23 . HE1  1 1 
       1262 1 2 1 1  31 ILE HB   .  31 . HB   1 1 
       1263 1 1 1 1  23 LYS HE2  .  23 . HE2  1 1 
       1263 1 2 1 1  31 ILE MG   .  31 . HG2* 1 1 
       1264 1 1 1 1  23 LYS HE3  .  23 . HE1  1 1 
       1264 1 2 1 1  31 ILE MG   .  31 . HG2* 1 1 
       1265 1 1 1 1  19 GLN HA   .  19 . HA   1 1 
       1265 1 2 1 1  31 ILE MG   .  31 . HG2* 1 1 
       1266 1 1 1 1  31 ILE MG   .  31 . HG2* 1 1 
       1266 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       1267 1 1 1 1  31 ILE HG12 .  31 . HG12 1 1 
       1267 1 2 1 1  99 LEU MD1  .  99 . HD1* 1 1 
       1268 1 1 1 1  31 ILE HG13 .  31 . HG11 1 1 
       1268 1 2 1 1  99 LEU MD1  .  99 . HD1* 1 1 
       1269 1 1 1 1  31 ILE MD   .  31 . HD1* 1 1 
       1269 1 2 1 1  99 LEU MD1  .  99 . HD1* 1 1 
       1270 1 1 1 1  32 ARG HB3  .  32 . HB1  1 1 
       1270 1 2 1 1  56 VAL MG2  .  56 . HG2* 1 1 
       1271 1 1 1 1  32 ARG HB3  .  32 . HB1  1 1 
       1271 1 2 1 1  56 VAL MG1  .  56 . HG1* 1 1 
       1272 1 1 1 1  32 ARG HB2  .  32 . HB2  1 1 
       1272 1 2 1 1  56 VAL MG2  .  56 . HG2* 1 1 
       1273 1 1 1 1  32 ARG HB2  .  32 . HB2  1 1 
       1273 1 2 1 1  56 VAL MG1  .  56 . HG1* 1 1 
       1274 1 1 1 1  33 THR MG   .  33 . HG2* 1 1 
       1274 1 2 1 1  58 VAL H    .  58 . HN   1 1 
       1275 1 1 1 1  33 THR HA   .  33 . HA   1 1 
       1275 1 2 1 1  58 VAL HA   .  58 . HA   1 1 
       1276 1 1 1 1  32 ARG HA   .  32 . HA   1 1 
       1276 1 2 1 1  33 THR HB   .  33 . HB   1 1 
       1277 1 1 1 1  33 THR MG   .  33 . HG2* 1 1 
       1277 1 2 1 1  57 PHE HB3  .  57 . HB1  1 1 
       1278 1 1 1 1  33 THR HA   .  33 . HA   1 1 
       1278 1 2 1 1  56 VAL MG1  .  56 . HG1* 1 1 
       1279 1 1 1 1  33 THR HB   .  33 . HB   1 1 
       1279 1 2 1 1  43 ILE MD   .  43 . HD1* 1 1 
       1280 1 1 1 1  33 THR MG   .  33 . HG2* 1 1 
       1280 1 2 1 1  43 ILE MD   .  43 . HD1* 1 1 
       1281 1 1 1 1  33 THR MG   .  33 . HG2* 1 1 
       1281 1 2 1 1  56 VAL MG1  .  56 . HG1* 1 1 
       1282 1 1 1 1  34 ALA MB   .  34 . HB*  1 1 
       1282 1 2 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       1283 1 1 1 1  34 ALA MB   .  34 . HB*  1 1 
       1283 1 2 1 1  56 VAL MG1  .  56 . HG1* 1 1 
       1284 1 1 1 1  33 THR HA   .  33 . HA   1 1 
       1284 1 2 1 1  34 ALA MB   .  34 . HB*  1 1 
       1285 1 1 1 1  34 ALA MB   .  34 . HB*  1 1 
       1285 1 2 1 1  40 ILE HA   .  40 . HA   1 1 
       1286 1 1 1 1  34 ALA MB   .  34 . HB*  1 1 
       1286 1 2 1 1  39 ASP HB3  .  39 . HB1  1 1 
       1287 1 1 1 1  34 ALA MB   .  34 . HB*  1 1 
       1287 1 2 1 1  40 ILE HB   .  40 . HB   1 1 
       1288 1 1 1 1  34 ALA MB   .  34 . HB*  1 1 
       1288 1 2 1 1  43 ILE HB   .  43 . HB   1 1 
       1289 1 1 1 1  34 ALA MB   .  34 . HB*  1 1 
       1289 1 2 1 1  58 VAL H    .  58 . HN   1 1 
       1290 1 1 1 1  34 ALA MB   .  34 . HB*  1 1 
       1290 1 2 1 1  39 ASP HB2  .  39 . HB2  1 1 
       1291 1 1 1 1  34 ALA MB   .  34 . HB*  1 1 
       1291 1 2 1 1  35 THR HA   .  35 . HA   1 1 
       1292 1 1 1 1  52 LYS HA   .  52 . HA   1 1 
       1292 1 2 1 1  53 PRO HD2  .  53 . HD2  1 1 
       1293 1 1 1 1  53 PRO HD2  .  53 . HD2  1 1 
       1293 1 2 1 1 102 ALA MB   . 102 . HB*  1 1 
       1294 1 1 1 1  53 PRO HD3  .  53 . HD1  1 1 
       1294 1 2 1 1 102 ALA MB   . 102 . HB*  1 1 
       1295 1 1 1 1  53 PRO HB2  .  53 . HB2  1 1 
       1295 1 2 1 1 102 ALA MB   . 102 . HB*  1 1 
       1296 1 1 1 1  54 LEU HA   .  54 . HA   1 1 
       1296 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       1297 1 1 1 1  54 LEU HB2  .  54 . HB2  1 1 
       1297 1 2 1 1  56 VAL MG2  .  56 . HG2* 1 1 
       1298 1 1 1 1  54 LEU HB3  .  54 . HB1  1 1 
       1298 1 2 1 1  56 VAL MG2  .  56 . HG2* 1 1 
       1299 1 1 1 1   5 LEU MD1  .   5 . HD1* 1 1 
       1299 1 2 1 1  83 LEU HB2  .  83 . HB2  1 1 
       1300 1 1 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       1300 1 2 1 1  98 PHE HB3  .  98 . HB1  1 1 
       1301 1 1 1 1  31 ILE HA   .  31 . HA   1 1 
       1301 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       1302 1 1 1 1  54 LEU HA   .  54 . HA   1 1 
       1302 1 2 1 1  55 VAL HB   .  55 . HB   1 1 
       1303 1 1 1 1  54 LEU HA   .  54 . HA   1 1 
       1303 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       1304 1 1 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       1304 1 2 1 1  57 PHE HZ   .  57 . HZ   1 1 
       1305 1 1 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       1305 1 2 1 1  98 PHE QE   .  98 . HE*  1 1 
       1306 1 1 1 1  55 VAL HA   .  55 . HA   1 1 
       1306 1 2 1 1  98 PHE QD   .  98 . HD*  1 1 
       1307 1 1 1 1  55 VAL HB   .  55 . HB   1 1 
       1307 1 2 1 1  57 PHE QE   .  57 . HE*  1 1 
       1308 1 1 1 1  32 ARG H    .  32 . HN   1 1 
       1308 1 2 1 1  55 VAL HB   .  55 . HB   1 1 
       1309 1 1 1 1   5 LEU MD1  .   5 . HD1* 1 1 
       1309 1 2 1 1  98 PHE H    .  98 . HN   1 1 
       1310 1 1 1 1  56 VAL MG1  .  56 . HG1* 1 1 
       1310 1 2 1 1  59 ASN H    .  59 . HN   1 1 
       1311 1 1 1 1  56 VAL MG1  .  56 . HG1* 1 1 
       1311 1 2 1 1  69 PHE QD   .  69 . HD*  1 1 
       1312 1 1 1 1  44 ILE H    .  44 . HN   1 1 
       1312 1 2 1 1  56 VAL MG2  .  56 . HG2* 1 1 
       1313 1 1 1 1  56 VAL MG2  .  56 . HG2* 1 1 
       1313 1 2 1 1  69 PHE HZ   .  69 . HZ   1 1 
       1314 1 1 1 1  56 VAL MG2  .  56 . HG2* 1 1 
       1314 1 2 1 1  69 PHE QE   .  69 . HE*  1 1 
       1315 1 1 1 1   6 LEU HA   .   6 . HA   1 1 
       1315 1 2 1 1  56 VAL MG2  .  56 . HG2* 1 1 
       1316 1 1 1 1   6 LEU HA   .   6 . HA   1 1 
       1316 1 2 1 1  56 VAL MG1  .  56 . HG1* 1 1 
       1317 1 1 1 1  55 VAL HA   .  55 . HA   1 1 
       1317 1 2 1 1  56 VAL MG2  .  56 . HG2* 1 1 
       1318 1 1 1 1  55 VAL HA   .  55 . HA   1 1 
       1318 1 2 1 1  56 VAL HB   .  56 . HB   1 1 
       1319 1 1 1 1  40 ILE HA   .  40 . HA   1 1 
       1319 1 2 1 1  56 VAL MG1  .  56 . HG1* 1 1 
       1320 1 1 1 1  43 ILE HB   .  43 . HB   1 1 
       1320 1 2 1 1  56 VAL MG1  .  56 . HG1* 1 1 
       1321 1 1 1 1  43 ILE HB   .  43 . HB   1 1 
       1321 1 2 1 1  56 VAL MG2  .  56 . HG2* 1 1 
       1322 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       1322 1 2 1 1  56 VAL HB   .  56 . HB   1 1 
       1323 1 1 1 1   6 LEU MD1  .   6 . HD1* 1 1 
       1323 1 2 1 1  56 VAL HB   .  56 . HB   1 1 
       1324 1 1 1 1   6 LEU MD1  .   6 . HD1* 1 1 
       1324 1 2 1 1  56 VAL MG2  .  56 . HG2* 1 1 
       1325 1 1 1 1   4 VAL MG1  .   4 . HG1* 1 1 
       1325 1 2 1 1  56 VAL HB   .  56 . HB   1 1 
       1326 1 1 1 1   6 LEU MD1  .   6 . HD1* 1 1 
       1326 1 2 1 1  56 VAL MG1  .  56 . HG1* 1 1 
       1327 1 1 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       1327 1 2 1 1  57 PHE HA   .  57 . HA   1 1 
       1328 1 1 1 1  15 ILE MG   .  15 . HG2* 1 1 
       1328 1 2 1 1  57 PHE HZ   .  57 . HZ   1 1 
       1329 1 1 1 1  57 PHE HZ   .  57 . HZ   1 1 
       1329 1 2 1 1  91 LEU MD1  .  91 . HD1* 1 1 
       1330 1 1 1 1   8 ILE HA   .   8 . HA   1 1 
       1330 1 2 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       1331 1 1 1 1   8 ILE HA   .   8 . HA   1 1 
       1331 1 2 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       1332 1 1 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       1332 1 2 1 1  66 VAL HA   .  66 . HA   1 1 
       1333 1 1 1 1  34 ALA MB   .  34 . HB*  1 1 
       1333 1 2 1 1  58 VAL HA   .  58 . HA   1 1 
       1334 1 1 1 1   6 LEU HG   .   6 . HG   1 1 
       1334 1 2 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       1335 1 1 1 1   6 LEU MD1  .   6 . HD1* 1 1 
       1335 1 2 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       1336 1 1 1 1   6 LEU MD1  .   6 . HD1* 1 1 
       1336 1 2 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       1337 1 1 1 1  76 GLU H    .  76 . HN   1 1 
       1337 1 2 1 1  78 VAL HB   .  78 . HB   1 1 
       1338 1 1 1 1  77 GLY H    .  77 . HN   1 1 
       1338 1 2 1 1  78 VAL HB   .  78 . HB   1 1 
       1339 1 1 1 1  73 ALA HA   .  73 . HA   1 1 
       1339 1 2 1 1  78 VAL MG1  .  78 . HG1* 1 1 
       1340 1 1 1 1  47 MET HG3  .  47 . HG1  1 1 
       1340 1 2 1 1  78 VAL MG1  .  78 . HG1* 1 1 
       1341 1 1 1 1  47 MET HB2  .  47 . HB2  1 1 
       1341 1 2 1 1  78 VAL MG1  .  78 . HG1* 1 1 
       1342 1 1 1 1  47 MET HB3  .  47 . HB1  1 1 
       1342 1 2 1 1  78 VAL MG1  .  78 . HG1* 1 1 
       1343 1 1 1 1  48 LYS H    .  48 . HN   1 1 
       1343 1 2 1 1  78 VAL MG1  .  78 . HG1* 1 1 
       1344 1 1 1 1  78 VAL MG1  .  78 . HG1* 1 1 
       1344 1 2 1 1  80 TYR H    .  80 . HN   1 1 
       1345 1 1 1 1  78 VAL MG1  .  78 . HG1* 1 1 
       1345 1 2 1 1  80 TYR QD   .  80 . HD*  1 1 
       1346 1 1 1 1  69 PHE HZ   .  69 . HZ   1 1 
       1346 1 2 1 1  78 VAL MG1  .  78 . HG1* 1 1 
       1347 1 1 1 1  78 VAL MG1  .  78 . HG1* 1 1 
       1347 1 2 1 1  80 TYR QE   .  80 . HE*  1 1 
       1348 1 1 1 1  73 ALA MB   .  73 . HB*  1 1 
       1348 1 2 1 1  78 VAL HA   .  78 . HA   1 1 
       1349 1 1 1 1  44 ILE MD   .  44 . HD1* 1 1 
       1349 1 2 1 1  78 VAL HB   .  78 . HB   1 1 
       1350 1 1 1 1  22 ALA MB   .  22 . HB*  1 1 
       1350 1 2 1 1  95 VAL MG1  .  95 . HG1* 1 1 
       1351 1 1 1 1  95 VAL MG1  .  95 . HG1* 1 1 
       1351 1 2 1 1  99 LEU MD1  .  99 . HD1* 1 1 
       1352 1 1 1 1   7 VAL MG2  .   7 . HG2* 1 1 
       1352 1 2 1 1  95 VAL MG1  .  95 . HG1* 1 1 
       1353 1 1 1 1  44 ILE MD   .  44 . HD1* 1 1 
       1353 1 2 1 1  78 VAL MG1  .  78 . HG1* 1 1 
       1354 1 1 1 1  79 SER HB2  .  79 . HB2  1 1 
       1354 1 2 1 1  80 TYR QD   .  80 . HD*  1 1 
       1355 1 1 1 1  79 SER HB3  .  79 . HB1  1 1 
       1355 1 2 1 1  80 TYR QD   .  80 . HD*  1 1 
       1356 1 1 1 1  79 SER HA   .  79 . HA   1 1 
       1356 1 2 1 1  80 TYR HA   .  80 . HA   1 1 
       1357 1 1 1 1  73 ALA MB   .  73 . HB*  1 1 
       1357 1 2 1 1  80 TYR HA   .  80 . HA   1 1 
       1358 1 1 1 1  66 VAL MG1  .  66 . HG1* 1 1 
       1358 1 2 1 1  80 TYR QE   .  80 . HE*  1 1 
       1359 1 1 1 1  80 TYR QE   .  80 . HE*  1 1 
       1359 1 2 1 1  82 VAL MG1  .  82 . HG1* 1 1 
       1360 1 1 1 1   5 LEU MD1  .   5 . HD1* 1 1 
       1360 1 2 1 1  81 ASP HB3  .  81 . HB1  1 1 
       1361 1 1 1 1   5 LEU HA   .   5 . HA   1 1 
       1361 1 2 1 1  81 ASP HB2  .  81 . HB2  1 1 
       1362 1 1 1 1   5 LEU HA   .   5 . HA   1 1 
       1362 1 2 1 1  81 ASP HB3  .  81 . HB1  1 1 
       1363 1 1 1 1   6 LEU H    .   6 . HN   1 1 
       1363 1 2 1 1  81 ASP HB2  .  81 . HB2  1 1 
       1364 1 1 1 1   6 LEU H    .   6 . HN   1 1 
       1364 1 2 1 1  81 ASP HB3  .  81 . HB1  1 1 
       1365 1 1 1 1  80 TYR QD   .  80 . HD*  1 1 
       1365 1 2 1 1  82 VAL MG2  .  82 . HG2* 1 1 
       1366 1 1 1 1  80 TYR QE   .  80 . HE*  1 1 
       1366 1 2 1 1  82 VAL MG2  .  82 . HG2* 1 1 
       1367 1 1 1 1   6 LEU H    .   6 . HN   1 1 
       1367 1 2 1 1  82 VAL MG1  .  82 . HG1* 1 1 
       1368 1 1 1 1   6 LEU H    .   6 . HN   1 1 
       1368 1 2 1 1  82 VAL MG2  .  82 . HG2* 1 1 
       1369 1 1 1 1   6 LEU H    .   6 . HN   1 1 
       1369 1 2 1 1  82 VAL HB   .  82 . HB   1 1 
       1370 1 1 1 1  80 TYR QD   .  80 . HD*  1 1 
       1370 1 2 1 1  82 VAL HB   .  82 . HB   1 1 
       1371 1 1 1 1  80 TYR QE   .  80 . HE*  1 1 
       1371 1 2 1 1  82 VAL HB   .  82 . HB   1 1 
       1372 1 1 1 1  81 ASP HA   .  81 . HA   1 1 
       1372 1 2 1 1  82 VAL HB   .  82 . HB   1 1 
       1373 1 1 1 1  81 ASP HA   .  81 . HA   1 1 
       1373 1 2 1 1  82 VAL MG2  .  82 . HG2* 1 1 
       1374 1 1 1 1  66 VAL MG1  .  66 . HG1* 1 1 
       1374 1 2 1 1  70 GLN HG3  .  70 . HG1  1 1 
       1375 1 1 1 1   8 ILE MD   .   8 . HD1* 1 1 
       1375 1 2 1 1  82 VAL HB   .  82 . HB   1 1 
       1376 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       1376 1 2 1 1  82 VAL MG2  .  82 . HG2* 1 1 
       1377 1 1 1 1   5 LEU MD1  .   5 . HD1* 1 1 
       1377 1 2 1 1  83 LEU HG   .  83 . HG   1 1 
       1378 1 1 1 1   7 VAL MG2  .   7 . HG2* 1 1 
       1378 1 2 1 1  83 LEU HG   .  83 . HG   1 1 
       1379 1 1 1 1   5 LEU MD1  .   5 . HD1* 1 1 
       1379 1 2 1 1  83 LEU MD2  .  83 . HD2* 1 1 
       1380 1 1 1 1  83 LEU MD1  .  83 . HD1* 1 1 
       1380 1 2 1 1  94 ARG HG3  .  94 . HG1  1 1 
       1381 1 1 1 1  83 LEU MD1  .  83 . HD1* 1 1 
       1381 1 2 1 1  94 ARG HG2  .  94 . HG2  1 1 
       1382 1 1 1 1  83 LEU MD1  .  83 . HD1* 1 1 
       1382 1 2 1 1  94 ARG HB3  .  94 . HB1  1 1 
       1383 1 1 1 1  83 LEU MD2  .  83 . HD2* 1 1 
       1383 1 2 1 1  94 ARG HG3  .  94 . HG1  1 1 
       1384 1 1 1 1  83 LEU MD1  .  83 . HD1* 1 1 
       1384 1 2 1 1  91 LEU HA   .  91 . HA   1 1 
       1385 1 1 1 1  83 LEU MD1  .  83 . HD1* 1 1 
       1385 1 2 1 1  94 ARG HD3  .  94 . HD1  1 1 
       1386 1 1 1 1  83 LEU MD2  .  83 . HD2* 1 1 
       1386 1 2 1 1  91 LEU H    .  91 . HN   1 1 
       1387 1 1 1 1  83 LEU MD1  .  83 . HD1* 1 1 
       1387 1 2 1 1  94 ARG H    .  94 . HN   1 1 
       1388 1 1 1 1   8 ILE H    .   8 . HN   1 1 
       1388 1 2 1 1  84 LYS HA   .  84 . HA   1 1 
       1389 1 1 1 1   7 VAL HA   .   7 . HA   1 1 
       1389 1 2 1 1  84 LYS HA   .  84 . HA   1 1 
       1390 1 1 1 1  83 LEU HG   .  83 . HG   1 1 
       1390 1 2 1 1  84 LYS HA   .  84 . HA   1 1 
       1391 1 1 1 1  82 VAL MG1  .  82 . HG1* 1 1 
       1391 1 2 1 1  84 LYS HA   .  84 . HA   1 1 
       1392 1 1 1 1   7 VAL MG1  .   7 . HG1* 1 1 
       1392 1 2 1 1  84 LYS HA   .  84 . HA   1 1 
       1393 1 1 1 1  85 SER HB3  .  85 . HB1  1 1 
       1393 1 2 1 1  91 LEU HG   .  91 . HG   1 1 
       1394 1 1 1 1  85 SER HB2  .  85 . HB2  1 1 
       1394 1 2 1 1  91 LEU HG   .  91 . HG   1 1 
       1395 1 1 1 1  85 SER HB2  .  85 . HB2  1 1 
       1395 1 2 1 1  91 LEU MD2  .  91 . HD2* 1 1 
       1396 1 1 1 1  83 LEU MD1  .  83 . HD1* 1 1 
       1396 1 2 1 1  85 SER HB2  .  85 . HB2  1 1 
       1397 1 1 1 1  85 SER HB3  .  85 . HB1  1 1 
       1397 1 2 1 1  91 LEU MD2  .  91 . HD2* 1 1 
       1398 1 1 1 1  83 LEU MD1  .  83 . HD1* 1 1 
       1398 1 2 1 1  85 SER HB3  .  85 . HB1  1 1 
       1399 1 1 1 1  18 VAL HB   .  18 . HB   1 1 
       1399 1 2 1 1  19 GLN HA   .  19 . HA   1 1 
       1400 1 1 1 1  19 GLN HG2  .  19 . HG2  1 1 
       1400 1 2 1 1  23 LYS H    .  23 . HN   1 1 
       1401 1 1 1 1  19 GLN HG3  .  19 . HG1  1 1 
       1401 1 2 1 1  23 LYS H    .  23 . HN   1 1 
       1402 1 1 1 1  87 ASP HA   .  87 . HA   1 1 
       1402 1 2 1 1  89 GLU H    .  89 . HN   1 1 
       1403 1 1 1 1  87 ASP HB2  .  87 . HB2  1 1 
       1403 1 2 1 1  89 GLU H    .  89 . HN   1 1 
       1404 1 1 1 1  87 ASP HB3  .  87 . HB1  1 1 
       1404 1 2 1 1  89 GLU H    .  89 . HN   1 1 
       1405 1 1 1 1  87 ASP HA   .  87 . HA   1 1 
       1405 1 2 1 1  88 PRO HD2  .  88 . HD2  1 1 
       1406 1 1 1 1  87 ASP HA   .  87 . HA   1 1 
       1406 1 2 1 1  88 PRO HD3  .  88 . HD1  1 1 
       1407 1 1 1 1  87 ASP HB3  .  87 . HB1  1 1 
       1407 1 2 1 1  90 GLU HB3  .  90 . HB1  1 1 
       1408 1 1 1 1  87 ASP HB2  .  87 . HB2  1 1 
       1408 1 2 1 1  90 GLU HB2  .  90 . HB2  1 1 
       1409 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
       1409 1 2 1 1  86 THR HA   .  86 . HA   1 1 
       1410 1 1 1 1  86 THR HA   .  86 . HA   1 1 
       1410 1 2 1 1  91 LEU MD1  .  91 . HD1* 1 1 
       1411 1 1 1 1  14 ILE MD   .  14 . HD1* 1 1 
       1411 1 2 1 1  86 THR HB   .  86 . HB   1 1 
       1412 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
       1412 1 2 1 1  86 THR HB   .  86 . HB   1 1 
       1413 1 1 1 1  86 THR MG   .  86 . HG2* 1 1 
       1413 1 2 1 1  91 LEU MD1  .  91 . HD1* 1 1 
       1414 1 1 1 1  14 ILE HB   .  14 . HB   1 1 
       1414 1 2 1 1  86 THR MG   .  86 . HG2* 1 1 
       1415 1 1 1 1  84 LYS HA   .  84 . HA   1 1 
       1415 1 2 1 1  86 THR MG   .  86 . HG2* 1 1 
       1416 1 1 1 1  10 THR H    .  10 . HN   1 1 
       1416 1 2 1 1  86 THR MG   .  86 . HG2* 1 1 
       1417 1 1 1 1  14 ILE H    .  14 . HN   1 1 
       1417 1 2 1 1  86 THR HA   .  86 . HA   1 1 
       1418 1 1 1 1  87 ASP HA   .  87 . HA   1 1 
       1418 1 2 1 1  88 PRO HB2  .  88 . HB2  1 1 
       1419 1 1 1 1  87 ASP HA   .  87 . HA   1 1 
       1419 1 2 1 1  88 PRO HB3  .  88 . HB1  1 1 
       1420 1 1 1 1  87 ASP HA   .  87 . HA   1 1 
       1420 1 2 1 1  88 PRO HG2  .  88 . HG2  1 1 
       1421 1 1 1 1  87 ASP HA   .  87 . HA   1 1 
       1421 1 2 1 1  88 PRO HG3  .  88 . HG1  1 1 
       1422 1 1 1 1  88 PRO HA   .  88 . HA   1 1 
       1422 1 2 1 1  91 LEU HG   .  91 . HG   1 1 
       1423 1 1 1 1  18 VAL MG1  .  18 . HG1* 1 1 
       1423 1 2 1 1  88 PRO HA   .  88 . HA   1 1 
       1424 1 1 1 1  88 PRO HA   .  88 . HA   1 1 
       1424 1 2 1 1  91 LEU MD1  .  91 . HD1* 1 1 
       1425 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
       1425 1 2 1 1  88 PRO HB2  .  88 . HB2  1 1 
       1426 1 1 1 1  18 VAL MG2  .  18 . HG2* 1 1 
       1426 1 2 1 1  88 PRO HG2  .  88 . HG2  1 1 
       1427 1 1 1 1  14 ILE MD   .  14 . HD1* 1 1 
       1427 1 2 1 1  88 PRO HG2  .  88 . HG2  1 1 
       1428 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
       1428 1 2 1 1  88 PRO HG2  .  88 . HG2  1 1 
       1429 1 1 1 1  18 VAL MG2  .  18 . HG2* 1 1 
       1429 1 2 1 1  88 PRO HG3  .  88 . HG1  1 1 
       1430 1 1 1 1  14 ILE MD   .  14 . HD1* 1 1 
       1430 1 2 1 1  88 PRO HG3  .  88 . HG1  1 1 
       1431 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
       1431 1 2 1 1  88 PRO HG3  .  88 . HG1  1 1 
       1432 1 1 1 1  14 ILE MD   .  14 . HD1* 1 1 
       1432 1 2 1 1  88 PRO HB3  .  88 . HB1  1 1 
       1433 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
       1433 1 2 1 1  88 PRO HB3  .  88 . HB1  1 1 
       1434 1 1 1 1  87 ASP HB3  .  87 . HB1  1 1 
       1434 1 2 1 1  90 GLU HB2  .  90 . HB2  1 1 
       1435 1 1 1 1  18 VAL MG1  .  18 . HG1* 1 1 
       1435 1 2 1 1  91 LEU HB2  .  91 . HB2  1 1 
       1436 1 1 1 1  18 VAL MG1  .  18 . HG1* 1 1 
       1436 1 2 1 1  91 LEU HB3  .  91 . HB1  1 1 
       1437 1 1 1 1  18 VAL HB   .  18 . HB   1 1 
       1437 1 2 1 1  91 LEU MD1  .  91 . HD1* 1 1 
       1438 1 1 1 1  30 GLU HB3  .  30 . HB1  1 1 
       1438 1 2 1 1  54 LEU MD1  .  54 . HD1* 1 1 
       1439 1 1 1 1   7 VAL HA   .   7 . HA   1 1 
       1439 1 2 1 1  91 LEU MD2  .  91 . HD2* 1 1 
       1440 1 1 1 1  47 MET HA   .  47 . HA   1 1 
       1440 1 2 1 1  54 LEU MD1  .  54 . HD1* 1 1 
       1441 1 1 1 1  85 SER H    .  85 . HN   1 1 
       1441 1 2 1 1  91 LEU MD2  .  91 . HD2* 1 1 
       1442 1 1 1 1  15 ILE H    .  15 . HN   1 1 
       1442 1 2 1 1  91 LEU MD1  .  91 . HD1* 1 1 
       1443 1 1 1 1  57 PHE QE   .  57 . HE*  1 1 
       1443 1 2 1 1  91 LEU MD1  .  91 . HD1* 1 1 
       1444 1 1 1 1  57 PHE QD   .  57 . HD*  1 1 
       1444 1 2 1 1  91 LEU MD1  .  91 . HD1* 1 1 
       1445 1 1 1 1  57 PHE QE   .  57 . HE*  1 1 
       1445 1 2 1 1  91 LEU MD2  .  91 . HD2* 1 1 
       1446 1 1 1 1   9 SER H    .   9 . HN   1 1 
       1446 1 2 1 1  91 LEU MD2  .  91 . HD2* 1 1 
       1447 1 1 1 1  18 VAL HB   .  18 . HB   1 1 
       1447 1 2 1 1  92 THR HA   .  92 . HA   1 1 
       1448 1 1 1 1  92 THR HB   .  92 . HB   1 1 
       1448 1 2 1 1  93 GLN HG3  .  93 . HG1  1 1 
       1449 1 1 1 1  92 THR MG   .  92 . HG2* 1 1 
       1449 1 2 1 1  95 VAL HB   .  95 . HB   1 1 
       1450 1 1 1 1  18 VAL MG2  .  18 . HG2* 1 1 
       1450 1 2 1 1  92 THR HA   .  92 . HA   1 1 
       1451 1 1 1 1  18 VAL MG1  .  18 . HG1* 1 1 
       1451 1 2 1 1  92 THR HA   .  92 . HA   1 1 
       1452 1 1 1 1  92 THR HA   .  92 . HA   1 1 
       1452 1 2 1 1  95 VAL MG2  .  95 . HG2* 1 1 
       1453 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
       1453 1 2 1 1  92 THR HA   .  92 . HA   1 1 
       1454 1 1 1 1  91 LEU MD2  .  91 . HD2* 1 1 
       1454 1 2 1 1  92 THR HA   .  92 . HA   1 1 
       1455 1 1 1 1  92 THR HB   .  92 . HB   1 1 
       1455 1 2 1 1  93 GLN HG2  .  93 . HG2  1 1 
       1456 1 1 1 1  92 THR MG   .  92 . HG2* 1 1 
       1456 1 2 1 1  93 GLN HG2  .  93 . HG2  1 1 
       1457 1 1 1 1  83 LEU MD2  .  83 . HD2* 1 1 
       1457 1 2 1 1  94 ARG HA   .  94 . HA   1 1 
       1458 1 1 1 1  83 LEU MD1  .  83 . HD1* 1 1 
       1458 1 2 1 1  94 ARG HB2  .  94 . HB2  1 1 
       1459 1 1 1 1  83 LEU MD2  .  83 . HD2* 1 1 
       1459 1 2 1 1  94 ARG HG2  .  94 . HG2  1 1 
       1460 1 1 1 1   5 LEU MD2  .   5 . HD2* 1 1 
       1460 1 2 1 1  94 ARG HG2  .  94 . HG2  1 1 
       1461 1 1 1 1  83 LEU MD2  .  83 . HD2* 1 1 
       1461 1 2 1 1  94 ARG HD2  .  94 . HD2  1 1 
       1462 1 1 1 1  83 LEU MD2  .  83 . HD2* 1 1 
       1462 1 2 1 1  94 ARG HD3  .  94 . HD1  1 1 
       1463 1 1 1 1  83 LEU MD1  .  83 . HD1* 1 1 
       1463 1 2 1 1  94 ARG HD2  .  94 . HD2  1 1 
       1464 1 1 1 1   5 LEU MD2  .   5 . HD2* 1 1 
       1464 1 2 1 1  95 VAL HA   .  95 . HA   1 1 
       1465 1 1 1 1  92 THR MG   .  92 . HG2* 1 1 
       1465 1 2 1 1  95 VAL MG2  .  95 . HG2* 1 1 
       1466 1 1 1 1  22 ALA MB   .  22 . HB*  1 1 
       1466 1 2 1 1  95 VAL MG2  .  95 . HG2* 1 1 
       1467 1 1 1 1  94 ARG HB2  .  94 . HB2  1 1 
       1467 1 2 1 1  95 VAL MG2  .  95 . HG2* 1 1 
       1468 1 1 1 1  91 LEU HB2  .  91 . HB2  1 1 
       1468 1 2 1 1  95 VAL MG2  .  95 . HG2* 1 1 
       1469 1 1 1 1  94 ARG HB3  .  94 . HB1  1 1 
       1469 1 2 1 1  95 VAL MG2  .  95 . HG2* 1 1 
       1470 1 1 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       1470 1 2 1 1  95 VAL MG2  .  95 . HG2* 1 1 
       1471 1 1 1 1   5 LEU MD2  .   5 . HD2* 1 1 
       1471 1 2 1 1  95 VAL MG2  .  95 . HG2* 1 1 
       1472 1 1 1 1  22 ALA MB   .  22 . HB*  1 1 
       1472 1 2 1 1  95 VAL HB   .  95 . HB   1 1 
       1473 1 1 1 1  95 VAL HB   .  95 . HB   1 1 
       1473 1 2 1 1  99 LEU HG   .  99 . HG   1 1 
       1474 1 1 1 1  94 ARG HB2  .  94 . HB2  1 1 
       1474 1 2 1 1  95 VAL HA   .  95 . HA   1 1 
       1475 1 1 1 1  95 VAL HA   .  95 . HA   1 1 
       1475 1 2 1 1  99 LEU HG   .  99 . HG   1 1 
       1476 1 1 1 1  94 ARG HB3  .  94 . HB1  1 1 
       1476 1 2 1 1  95 VAL HA   .  95 . HA   1 1 
       1477 1 1 1 1  77 GLY HA2  .  77 . HA2  1 1 
       1477 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       1478 1 1 1 1  26 TYR QE   .  26 . HE*  1 1 
       1478 1 2 1 1  95 VAL HA   .  95 . HA   1 1 
       1479 1 1 1 1  66 VAL HA   .  66 . HA   1 1 
       1479 1 2 1 1  69 PHE QD   .  69 . HD*  1 1 
       1480 1 1 1 1  26 TYR QD   .  26 . HD*  1 1 
       1480 1 2 1 1  95 VAL MG2  .  95 . HG2* 1 1 
       1481 1 1 1 1  57 PHE HZ   .  57 . HZ   1 1 
       1481 1 2 1 1  95 VAL MG1  .  95 . HG1* 1 1 
       1482 1 1 1 1  57 PHE QE   .  57 . HE*  1 1 
       1482 1 2 1 1  95 VAL MG1  .  95 . HG1* 1 1 
       1483 1 1 1 1  95 VAL MG1  .  95 . HG1* 1 1 
       1483 1 2 1 1  98 PHE QD   .  98 . HD*  1 1 
       1484 1 1 1 1  94 ARG H    .  94 . HN   1 1 
       1484 1 2 1 1  95 VAL HB   .  95 . HB   1 1 
       1485 1 1 1 1  93 GLN HE21 .  93 . HE21 1 1 
       1485 1 2 1 1  97 GLU HG2  .  97 . HG2  1 1 
       1486 1 1 1 1  93 GLN HE21 .  93 . HE21 1 1 
       1486 1 2 1 1  97 GLU HG3  .  97 . HG1  1 1 
       1487 1 1 1 1  94 ARG HA   .  94 . HA   1 1 
       1487 1 2 1 1  97 GLU HG3  .  97 . HG1  1 1 
       1488 1 1 1 1  96 ARG HD2  .  96 . HD2  1 1 
       1488 1 2 1 1  97 GLU HG3  .  97 . HG1  1 1 
       1489 1 1 1 1  96 ARG HD3  .  96 . HD1  1 1 
       1489 1 2 1 1  97 GLU HG3  .  97 . HG1  1 1 
       1490 1 1 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       1490 1 2 1 1  98 PHE HB2  .  98 . HB2  1 1 
       1491 1 1 1 1   5 LEU MD2  .   5 . HD2* 1 1 
       1491 1 2 1 1  98 PHE HA   .  98 . HA   1 1 
       1492 1 1 1 1  98 PHE QD   .  98 . HD*  1 1 
       1492 1 2 1 1  99 LEU HA   .  99 . HA   1 1 
       1493 1 1 1 1  98 PHE QD   .  98 . HD*  1 1 
       1493 1 2 1 1  99 LEU MD1  .  99 . HD1* 1 1 
       1494 1 1 1 1  53 PRO HB3  .  53 . HB1  1 1 
       1494 1 2 1 1 102 ALA MB   . 102 . HB*  1 1 
       1495 1 1 1 1  99 LEU HA   .  99 . HA   1 1 
       1495 1 2 1 1 102 ALA MB   . 102 . HB*  1 1 
       1496 1 1 1 1  98 PHE QE   .  98 . HE*  1 1 
       1496 1 2 1 1 102 ALA HA   . 102 . HA   1 1 
       1497 1 1 1 1  98 PHE QD   .  98 . HD*  1 1 
       1497 1 2 1 1 102 ALA MB   . 102 . HB*  1 1 
       1498 1 1 1 1 102 ALA MB   . 102 . HB*  1 1 
       1498 1 2 1 1 103 GLY H    . 103 . HN   1 1 
       1499 1 1 1 1  18 VAL MG1  .  18 . HG1* 1 1 
       1499 1 2 1 1  22 ALA MB   .  22 . HB*  1 1 
       1500 1 1 1 1  22 ALA MB   .  22 . HB*  1 1 
       1500 1 2 1 1  99 LEU MD1  .  99 . HD1* 1 1 
       1501 1 1 1 1  22 ALA HA   .  22 . HA   1 1 
       1501 1 2 1 1  31 ILE MD   .  31 . HD1* 1 1 
       1502 1 1 1 1  22 ALA HA   .  22 . HA   1 1 
       1502 1 2 1 1  25 ASN HB3  .  25 . HB1  1 1 
       1503 1 1 1 1  22 ALA MB   .  22 . HB*  1 1 
       1503 1 2 1 1  25 ASN H    .  25 . HN   1 1 
       1504 1 1 1 1  22 ALA MB   .  22 . HB*  1 1 
       1504 1 2 1 1  26 TYR QE   .  26 . HE*  1 1 
       1505 1 1 1 1  72 GLU HA   .  72 . HA   1 1 
       1505 1 2 1 1  73 ALA MB   .  73 . HB*  1 1 
       1506 1 1 1 1  26 TYR QD   .  26 . HD*  1 1 
       1506 1 2 1 1  95 VAL MG1  .  95 . HG1* 1 1 
       1507 1 1 1 1  26 TYR HA   .  26 . HA   1 1 
       1507 1 2 1 1  27 PRO HD3  .  27 . HD1  1 1 
       1508 1 1 1 1  26 TYR HA   .  26 . HA   1 1 
       1508 1 2 1 1  27 PRO HD2  .  27 . HD2  1 1 
       1509 1 1 1 1  36 SER HB2  .  36 . HB2  1 1 
       1509 1 2 1 1  39 ASP H    .  39 . HN   1 1 
       1510 1 1 1 1  40 ILE MD   .  40 . HD1* 1 1 
       1510 1 2 1 1  69 PHE HB3  .  69 . HB1  1 1 
       1511 1 1 1 1  40 ILE MD   .  40 . HD1* 1 1 
       1511 1 2 1 1  66 VAL HA   .  66 . HA   1 1 
       1512 1 1 1 1  40 ILE MD   .  40 . HD1* 1 1 
       1512 1 2 1 1  41 ARG HA   .  41 . HA   1 1 
       1513 1 1 1 1  34 ALA HA   .  34 . HA   1 1 
       1513 1 2 1 1  40 ILE MD   .  40 . HD1* 1 1 
       1514 1 1 1 1  40 ILE HB   .  40 . HB   1 1 
       1514 1 2 1 1  41 ARG HA   .  41 . HA   1 1 
       1515 1 1 1 1  40 ILE HA   .  40 . HA   1 1 
       1515 1 2 1 1  69 PHE QD   .  69 . HD*  1 1 
       1516 1 1 1 1  40 ILE MG   .  40 . HG2* 1 1 
       1516 1 2 1 1  69 PHE QE   .  69 . HE*  1 1 
       1517 1 1 1 1  44 ILE MG   .  44 . HG2* 1 1 
       1517 1 2 1 1  69 PHE QE   .  69 . HE*  1 1 
       1518 1 1 1 1  40 ILE HG12 .  40 . HG12 1 1 
       1518 1 2 1 1  69 PHE QD   .  69 . HD*  1 1 
       1519 1 1 1 1  63 GLN HB3  .  63 . HB1  1 1 
       1519 1 2 1 1  66 VAL MG2  .  66 . HG2* 1 1 
       1520 1 1 1 1  40 ILE MG   .  40 . HG2* 1 1 
       1520 1 2 1 1  41 ARG HA   .  41 . HA   1 1 
       1521 1 1 1 1  41 ARG HA   .  41 . HA   1 1 
       1521 1 2 1 1  44 ILE MD   .  44 . HD1* 1 1 
       1522 1 1 1 1  41 ARG HA   .  41 . HA   1 1 
       1522 1 2 1 1  41 ARG HG3  .  41 . HG1  1 1 
       1523 1 1 1 1  40 ILE MG   .  40 . HG2* 1 1 
       1523 1 2 1 1  41 ARG HB2  .  41 . HB2  1 1 
       1524 1 1 1 1  40 ILE MG   .  40 . HG2* 1 1 
       1524 1 2 1 1  41 ARG HB3  .  41 . HB1  1 1 
       1525 1 1 1 1  42 ASP HB3  .  42 . HB1  1 1 
       1525 1 2 1 1  45 LYS HB2  .  45 . HB2  1 1 
       1526 1 1 1 1  42 ASP HB3  .  42 . HB1  1 1 
       1526 1 2 1 1  45 LYS HB3  .  45 . HB1  1 1 
       1527 1 1 1 1  42 ASP HB2  .  42 . HB2  1 1 
       1527 1 2 1 1  45 LYS HB2  .  45 . HB2  1 1 
       1528 1 1 1 1  42 ASP HB2  .  42 . HB2  1 1 
       1528 1 2 1 1  45 LYS HB3  .  45 . HB1  1 1 
       1529 1 1 1 1  43 ILE HB   .  43 . HB   1 1 
       1529 1 2 1 1  44 ILE MD   .  44 . HD1* 1 1 
       1530 1 1 1 1  43 ILE MD   .  43 . HD1* 1 1 
       1530 1 2 1 1  56 VAL MG1  .  56 . HG1* 1 1 
       1531 1 1 1 1  39 ASP HB3  .  39 . HB1  1 1 
       1531 1 2 1 1  43 ILE MD   .  43 . HD1* 1 1 
       1532 1 1 1 1  39 ASP HA   .  39 . HA   1 1 
       1532 1 2 1 1  43 ILE MD   .  43 . HD1* 1 1 
       1533 1 1 1 1  32 ARG HA   .  32 . HA   1 1 
       1533 1 2 1 1  43 ILE MD   .  43 . HD1* 1 1 
       1534 1 1 1 1  43 ILE MD   .  43 . HD1* 1 1 
       1534 1 2 1 1  69 PHE QE   .  69 . HE*  1 1 
       1535 1 1 1 1  43 ILE MD   .  43 . HD1* 1 1 
       1535 1 2 1 1  69 PHE QD   .  69 . HD*  1 1 
       1536 1 1 1 1  40 ILE H    .  40 . HN   1 1 
       1536 1 2 1 1  43 ILE MD   .  43 . HD1* 1 1 
       1537 1 1 1 1  44 ILE MD   .  44 . HD1* 1 1 
       1537 1 2 1 1  69 PHE QD   .  69 . HD*  1 1 
       1538 1 1 1 1  44 ILE MD   .  44 . HD1* 1 1 
       1538 1 2 1 1  69 PHE QE   .  69 . HE*  1 1 
       1539 1 1 1 1  44 ILE HG13 .  44 . HG11 1 1 
       1539 1 2 1 1  69 PHE HZ   .  69 . HZ   1 1 
       1540 1 1 1 1  44 ILE HG12 .  44 . HG12 1 1 
       1540 1 2 1 1  69 PHE HZ   .  69 . HZ   1 1 
       1541 1 1 1 1  44 ILE MD   .  44 . HD1* 1 1 
       1541 1 2 1 1  69 PHE HA   .  69 . HA   1 1 
       1542 1 1 1 1  44 ILE MD   .  44 . HD1* 1 1 
       1542 1 2 1 1  72 GLU HG2  .  72 . HG2  1 1 
       1543 1 1 1 1  44 ILE MD   .  44 . HD1* 1 1 
       1543 1 2 1 1  72 GLU HB2  .  72 . HB2  1 1 
       1544 1 1 1 1  44 ILE MD   .  44 . HD1* 1 1 
       1544 1 2 1 1  72 GLU HB3  .  72 . HB1  1 1 
       1545 1 1 1 1  44 ILE HG13 .  44 . HG11 1 1 
       1545 1 2 1 1  72 GLU HB2  .  72 . HB2  1 1 
       1546 1 1 1 1  44 ILE HG13 .  44 . HG11 1 1 
       1546 1 2 1 1  72 GLU HB3  .  72 . HB1  1 1 
       1547 1 1 1 1  44 ILE MG   .  44 . HG2* 1 1 
       1547 1 2 1 1  73 ALA HA   .  73 . HA   1 1 
       1548 1 1 1 1  44 ILE MD   .  44 . HD1* 1 1 
       1548 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       1549 1 1 1 1  44 ILE MG   .  44 . HG2* 1 1 
       1549 1 2 1 1  45 LYS HA   .  45 . HA   1 1 
       1550 1 1 1 1  43 ILE HA   .  43 . HA   1 1 
       1550 1 2 1 1  46 SER HA   .  46 . HA   1 1 
       1551 1 1 1 1  47 MET ME   .  47 . HE*  1 1 
       1551 1 2 1 1  98 PHE HZ   .  98 . HZ   1 1 
       1552 1 1 1 1   4 VAL HA   .   4 . HA   1 1 
       1552 1 2 1 1  47 MET ME   .  47 . HE*  1 1 
       1553 1 1 1 1  47 MET ME   .  47 . HE*  1 1 
       1553 1 2 1 1  54 LEU HA   .  54 . HA   1 1 
       1554 1 1 1 1  47 MET ME   .  47 . HE*  1 1 
       1554 1 2 1 1  53 PRO HA   .  53 . HA   1 1 
       1555 1 1 1 1  47 MET ME   .  47 . HE*  1 1 
       1555 1 2 1 1  48 LYS HA   .  48 . HA   1 1 
       1556 1 1 1 1  47 MET ME   .  47 . HE*  1 1 
       1556 1 2 1 1  78 VAL HA   .  78 . HA   1 1 
       1557 1 1 1 1  47 MET HG2  .  47 . HG2  1 1 
       1557 1 2 1 1  78 VAL MG1  .  78 . HG1* 1 1 
       1558 1 1 1 1   4 VAL MG2  .   4 . HG2* 1 1 
       1558 1 2 1 1  47 MET ME   .  47 . HE*  1 1 
       1559 1 1 1 1   4 VAL MG1  .   4 . HG1* 1 1 
       1559 1 2 1 1  47 MET ME   .  47 . HE*  1 1 
       1560 1 1 1 1  44 ILE MD   .  44 . HD1* 1 1 
       1560 1 2 1 1  47 MET ME   .  47 . HE*  1 1 
       1561 1 1 1 1  48 LYS HA   .  48 . HA   1 1 
       1561 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       1562 1 1 1 1  23 LYS HB2  .  23 . HB2  1 1 
       1562 1 2 1 1  31 ILE MD   .  31 . HD1* 1 1 
       1563 1 1 1 1  23 LYS HB3  .  23 . HB1  1 1 
       1563 1 2 1 1  31 ILE MD   .  31 . HD1* 1 1 
       1564 1 1 1 1  53 PRO HA   .  53 . HA   1 1 
       1564 1 2 1 1  98 PHE QE   .  98 . HE*  1 1 
       1565 1 1 1 1  52 LYS H    .  52 . HN   1 1 
       1565 1 2 1 1  53 PRO HD2  .  53 . HD2  1 1 
       1566 1 1 1 1  61 ALA MB   .  61 . HB*  1 1 
       1566 1 2 1 1  65 ASP HB2  .  65 . HB2  1 1 
       1567 1 1 1 1  61 ALA MB   .  61 . HB*  1 1 
       1567 1 2 1 1  66 VAL HB   .  66 . HB   1 1 
       1568 1 1 1 1  15 ILE MD   .  15 . HD1* 1 1 
       1568 1 2 1 1  60 GLY HA2  .  60 . HA2  1 1 
       1569 1 1 1 1  15 ILE MD   .  15 . HD1* 1 1 
       1569 1 2 1 1  60 GLY HA3  .  60 . HA1  1 1 
       1570 1 1 1 1   8 ILE MG   .   8 . HG2* 1 1 
       1570 1 2 1 1  61 ALA HA   .  61 . HA   1 1 
       1571 1 1 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       1571 1 2 1 1  61 ALA HA   .  61 . HA   1 1 
       1572 1 1 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       1572 1 2 1 1  61 ALA MB   .  61 . HB*  1 1 
       1573 1 1 1 1  40 ILE MD   .  40 . HD1* 1 1 
       1573 1 2 1 1  61 ALA MB   .  61 . HB*  1 1 
       1574 1 1 1 1  30 GLU HA   .  30 . HA   1 1 
       1574 1 2 1 1  54 LEU MD2  .  54 . HD2* 1 1 
       1575 1 1 1 1  40 ILE MD   .  40 . HD1* 1 1 
       1575 1 2 1 1  65 ASP HA   .  65 . HA   1 1 
       1576 1 1 1 1  61 ALA MB   .  61 . HB*  1 1 
       1576 1 2 1 1  65 ASP HB3  .  65 . HB1  1 1 
       1577 1 1 1 1  65 ASP HB3  .  65 . HB1  1 1 
       1577 1 2 1 1  66 VAL MG2  .  66 . HG2* 1 1 
       1578 1 1 1 1  40 ILE MD   .  40 . HD1* 1 1 
       1578 1 2 1 1  65 ASP HB3  .  65 . HB1  1 1 
       1579 1 1 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       1579 1 2 1 1  65 ASP HB2  .  65 . HB2  1 1 
       1580 1 1 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       1580 1 2 1 1  65 ASP HB2  .  65 . HB2  1 1 
       1581 1 1 1 1   6 LEU MD1  .   6 . HD1* 1 1 
       1581 1 2 1 1  66 VAL HA   .  66 . HA   1 1 
       1582 1 1 1 1  66 VAL MG1  .  66 . HG1* 1 1 
       1582 1 2 1 1  67 ASN HA   .  67 . HA   1 1 
       1583 1 1 1 1  68 GLU HB2  .  68 . HB2  1 1 
       1583 1 2 1 1  69 PHE HA   .  69 . HA   1 1 
       1584 1 1 1 1  69 PHE HA   .  69 . HA   1 1 
       1584 1 2 1 1  73 ALA MB   .  73 . HB*  1 1 
       1585 1 1 1 1  40 ILE MD   .  40 . HD1* 1 1 
       1585 1 2 1 1  69 PHE HA   .  69 . HA   1 1 
       1586 1 1 1 1  40 ILE MG   .  40 . HG2* 1 1 
       1586 1 2 1 1  69 PHE HB2  .  69 . HB2  1 1 
       1587 1 1 1 1  40 ILE MD   .  40 . HD1* 1 1 
       1587 1 2 1 1  69 PHE HB2  .  69 . HB2  1 1 
       1588 1 1 1 1  40 ILE MG   .  40 . HG2* 1 1 
       1588 1 2 1 1  69 PHE HB3  .  69 . HB1  1 1 
       1589 1 1 1 1  70 GLN HG3  .  70 . HG1  1 1 
       1589 1 2 1 1  82 VAL MG2  .  82 . HG2* 1 1 
       1590 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       1590 1 2 1 1  70 GLN HG3  .  70 . HG1  1 1 
       1591 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       1591 1 2 1 1  70 GLN HG2  .  70 . HG2  1 1 
       1592 1 1 1 1  70 GLN HA   .  70 . HA   1 1 
       1592 1 2 1 1  71 ASN HA   .  71 . HA   1 1 
       1593 1 1 1 1  67 ASN HA   .  67 . HA   1 1 
       1593 1 2 1 1  70 GLN HG3  .  70 . HG1  1 1 
       1594 1 1 1 1  67 ASN HA   .  67 . HA   1 1 
       1594 1 2 1 1  70 GLN HG2  .  70 . HG2  1 1 
       1595 1 1 1 1  72 GLU HB2  .  72 . HB2  1 1 
       1595 1 2 1 1  73 ALA MB   .  73 . HB*  1 1 
       1596 1 1 1 1  72 GLU HB3  .  72 . HB1  1 1 
       1596 1 2 1 1  73 ALA MB   .  73 . HB*  1 1 
       1597 1 1 1 1  44 ILE MD   .  44 . HD1* 1 1 
       1597 1 2 1 1  72 GLU HG3  .  72 . HG1  1 1 
       1598 1 1 1 1  73 ALA HA   .  73 . HA   1 1 
       1598 1 2 1 1  80 TYR QE   .  80 . HE*  1 1 
       1599 1 1 1 1  74 LYS HA   .  74 . HA   1 1 
       1599 1 2 1 1  80 TYR QD   .  80 . HD*  1 1 
       1600 1 1 1 1  74 LYS HA   .  74 . HA   1 1 
       1600 1 2 1 1  80 TYR QE   .  80 . HE*  1 1 
       1601 1 1 1 1  73 ALA HA   .  73 . HA   1 1 
       1601 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       1602 1 1 1 1  44 ILE MG   .  44 . HG2* 1 1 
       1602 1 2 1 1  73 ALA MB   .  73 . HB*  1 1 
       1603 1 1 1 1  73 ALA MB   .  73 . HB*  1 1 
       1603 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       1604 1 1 1 1  73 ALA MB   .  73 . HB*  1 1 
       1604 1 2 1 1  78 VAL HB   .  78 . HB   1 1 
       1605 1 1 1 1  70 GLN HB3  .  70 . HB1  1 1 
       1605 1 2 1 1  73 ALA MB   .  73 . HB*  1 1 
       1606 1 1 1 1  73 ALA HA   .  73 . HA   1 1 
       1606 1 2 1 1  76 GLU HB2  .  76 . HB2  1 1 
       1607 1 1 1 1  73 ALA HA   .  73 . HA   1 1 
       1607 1 2 1 1  78 VAL HB   .  78 . HB   1 1 
       1608 1 1 1 1  73 ALA HA   .  73 . HA   1 1 
       1608 1 2 1 1  76 GLU HG3  .  76 . HG1  1 1 
       1609 1 1 1 1  73 ALA HA   .  73 . HA   1 1 
       1609 1 2 1 1  76 GLU HG2  .  76 . HG2  1 1 
       1610 1 1 1 1  76 GLU HG2  .  76 . HG2  1 1 
       1610 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       1611 1 1 1 1  76 GLU HG3  .  76 . HG1  1 1 
       1611 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       1612 1 1 1 1  77 GLY HA3  .  77 . HA1  1 1 
       1612 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       1613 1 1 1 1  52 LYS HA   .  52 . HA   1 1 
       1613 1 2 1 1  53 PRO HD3  .  53 . HD1  1 1 
       1614 1 1 1 1  22 ALA HA   .  22 . HA   1 1 
       1614 1 2 1 1  25 ASN HB2  .  25 . HB2  1 1 
       1615 1 1 1 1  65 ASP HB2  .  65 . HB2  1 1 
       1615 1 2 1 1  66 VAL MG2  .  66 . HG2* 1 1 
       1616 1 1 1 1   3 LYS HD2  .   3 . HD2  1 1 
       1616 1 2 1 1  98 PHE QE   .  98 . HE*  1 1 
       1617 1 1 1 1   3 LYS HD3  .   3 . HD1  1 1 
       1617 1 2 1 1  98 PHE QE   .  98 . HE*  1 1 
       1618 1 1 1 1   4 VAL MG2  .   4 . HG2* 1 1 
       1618 1 2 1 1  56 VAL HA   .  56 . HA   1 1 
       1619 1 1 1 1   4 VAL MG2  .   4 . HG2* 1 1 
       1619 1 2 1 1  43 ILE HA   .  43 . HA   1 1 
       1620 1 1 1 1   5 LEU HB2  .   5 . HB2  1 1 
       1620 1 2 1 1  98 PHE QE   .  98 . HE*  1 1 
       1621 1 1 1 1   5 LEU HB3  .   5 . HB1  1 1 
       1621 1 2 1 1  98 PHE QE   .  98 . HE*  1 1 
       1622 1 1 1 1  54 LEU MD2  .  54 . HD2* 1 1 
       1622 1 2 1 1  98 PHE QE   .  98 . HE*  1 1 
       1623 1 1 1 1   5 LEU MD2  .   5 . HD2* 1 1 
       1623 1 2 1 1  98 PHE QD   .  98 . HD*  1 1 
       1624 1 1 1 1   4 VAL MG1  .   4 . HG1* 1 1 
       1624 1 2 1 1  56 VAL MG2  .  56 . HG2* 1 1 
       1625 1 1 1 1   7 VAL HB   .   7 . HB   1 1 
       1625 1 2 1 1  57 PHE HB2  .  57 . HB2  1 1 
       1626 1 1 1 1  12 THR MG   .  12 . HG2* 1 1 
       1626 1 2 1 1  59 ASN HA   .  59 . HA   1 1 
       1627 1 1 1 1  12 THR HA   .  12 . HA   1 1 
       1627 1 2 1 1  59 ASN HA   .  59 . HA   1 1 
       1628 1 1 1 1  26 TYR HB2  .  26 . HB2  1 1 
       1628 1 2 1 1  99 LEU MD1  .  99 . HD1* 1 1 
       1629 1 1 1 1  26 TYR HB3  .  26 . HB1  1 1 
       1629 1 2 1 1  99 LEU MD1  .  99 . HD1* 1 1 
       1630 1 1 1 1  33 THR HA   .  33 . HA   1 1 
       1630 1 2 1 1  57 PHE HB2  .  57 . HB2  1 1 
       1631 1 1 1 1  33 THR HA   .  33 . HA   1 1 
       1631 1 2 1 1  57 PHE HB3  .  57 . HB1  1 1 
       1632 1 1 1 1  78 VAL MG1  .  78 . HG1* 1 1 
       1632 1 2 1 1  80 TYR HA   .  80 . HA   1 1 
       1633 1 1 1 1   6 LEU MD1  .   6 . HD1* 1 1 
       1633 1 2 1 1  80 TYR QE   .  80 . HE*  1 1 
       1634 1 1 1 1  17 SER HB2  .  17 . HB2  1 1 
       1634 1 2 1 1  18 VAL HA   .  18 . HA   1 1 
       1635 1 1 1 1  17 SER HB3  .  17 . HB1  1 1 
       1635 1 2 1 1  18 VAL HA   .  18 . HA   1 1 
       1636 1 1 1 1   6 LEU HB2  .   6 . HB2  1 1 
       1636 1 2 1 1  82 VAL HA   .  82 . HA   1 1 
       1637 1 1 1 1   6 LEU HB3  .   6 . HB1  1 1 
       1637 1 2 1 1  82 VAL HA   .  82 . HA   1 1 
       1638 1 1 1 1   6 LEU HG   .   6 . HG   1 1 
       1638 1 2 1 1  82 VAL HA   .  82 . HA   1 1 
       1639 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       1639 1 2 1 1  82 VAL HA   .  82 . HA   1 1 
       1640 1 1 1 1   6 LEU MD1  .   6 . HD1* 1 1 
       1640 1 2 1 1  34 ALA HA   .  34 . HA   1 1 
       1641 1 1 1 1  15 ILE MG   .  15 . HG2* 1 1 
       1641 1 2 1 1  57 PHE HB2  .  57 . HB2  1 1 
       1642 1 1 1 1  15 ILE MG   .  15 . HG2* 1 1 
       1642 1 2 1 1  59 ASN HA   .  59 . HA   1 1 
       1643 1 1 1 1  18 VAL MG2  .  18 . HG2* 1 1 
       1643 1 2 1 1  92 THR H    .  92 . HN   1 1 
       1644 1 1 1 1  52 LYS HB2  .  52 . HB2  1 1 
       1644 1 2 1 1  53 PRO HD2  .  53 . HD2  1 1 
       1645 1 1 1 1  52 LYS HB2  .  52 . HB2  1 1 
       1645 1 2 1 1  53 PRO HD3  .  53 . HD1  1 1 
       1646 1 1 1 1   3 LYS HG2  .   3 . HG2  1 1 
       1646 1 2 1 1  80 TYR HA   .  80 . HA   1 1 
       1647 1 1 1 1   3 LYS HG3  .   3 . HG1  1 1 
       1647 1 2 1 1  80 TYR HA   .  80 . HA   1 1 
       1648 1 1 1 1   3 LYS HG2  .   3 . HG2  1 1 
       1648 1 2 1 1   4 VAL HA   .   4 . HA   1 1 
       1649 1 1 1 1   3 LYS HG3  .   3 . HG1  1 1 
       1649 1 2 1 1   4 VAL HA   .   4 . HA   1 1 
       1650 1 1 1 1  31 ILE HG13 .  31 . HG11 1 1 
       1650 1 2 1 1  55 VAL HB   .  55 . HB   1 1 
       1651 1 1 1 1  32 ARG HB2  .  32 . HB2  1 1 
       1651 1 2 1 1  56 VAL HA   .  56 . HA   1 1 
       1652 1 1 1 1  32 ARG HB3  .  32 . HB1  1 1 
       1652 1 2 1 1  56 VAL HA   .  56 . HA   1 1 
       1653 1 1 1 1  44 ILE MG   .  44 . HG2* 1 1 
       1653 1 2 1 1  78 VAL HB   .  78 . HB   1 1 
       1654 1 1 1 1  44 ILE MG   .  44 . HG2* 1 1 
       1654 1 2 1 1  48 LYS HG2  .  48 . HG2  1 1 
       1655 1 1 1 1  45 LYS HA   .  45 . HA   1 1 
       1655 1 2 1 1  48 LYS HG2  .  48 . HG2  1 1 
       1656 1 1 1 1  52 LYS HG3  .  52 . HG1  1 1 
       1656 1 2 1 1  53 PRO HD2  .  53 . HD2  1 1 
       1657 1 1 1 1  52 LYS HG3  .  52 . HG1  1 1 
       1657 1 2 1 1  53 PRO HD3  .  53 . HD1  1 1 
       1658 1 1 1 1  52 LYS H    .  52 . HN   1 1 
       1658 1 2 1 1  52 LYS HD2  .  52 . HD2  1 1 
       1659 1 1 1 1  52 LYS H    .  52 . HN   1 1 
       1659 1 2 1 1  52 LYS HD3  .  52 . HD1  1 1 
       1660 1 1 1 1  53 PRO HG3  .  53 . HG1  1 1 
       1660 1 2 1 1  98 PHE QD   .  98 . HD*  1 1 
       1661 1 1 1 1  53 PRO HG2  .  53 . HG2  1 1 
       1661 1 2 1 1  98 PHE QD   .  98 . HD*  1 1 
       1662 1 1 1 1  52 LYS H    .  52 . HN   1 1 
       1662 1 2 1 1  53 PRO HD3  .  53 . HD1  1 1 
       1663 1 1 1 1  31 ILE HB   .  31 . HB   1 1 
       1663 1 2 1 1  54 LEU MD2  .  54 . HD2* 1 1 
       1664 1 1 1 1  31 ILE MG   .  31 . HG2* 1 1 
       1664 1 2 1 1  54 LEU MD2  .  54 . HD2* 1 1 
       1665 1 1 1 1   4 VAL MG2  .   4 . HG2* 1 1 
       1665 1 2 1 1  54 LEU MD1  .  54 . HD1* 1 1 
       1666 1 1 1 1  18 VAL MG1  .  18 . HG1* 1 1 
       1666 1 2 1 1  91 LEU MD2  .  91 . HD2* 1 1 
       1667 1 1 1 1  54 LEU MD2  .  54 . HD2* 1 1 
       1667 1 2 1 1  55 VAL HB   .  55 . HB   1 1 
       1668 1 1 1 1   5 LEU MD2  .   5 . HD2* 1 1 
       1668 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       1669 1 1 1 1   8 ILE HA   .   8 . HA   1 1 
       1669 1 2 1 1  58 VAL HB   .  58 . HB   1 1 
       1670 1 1 1 1   6 LEU HB2  .   6 . HB2  1 1 
       1670 1 2 1 1  82 VAL MG1  .  82 . HG1* 1 1 
       1671 1 1 1 1   6 LEU HB3  .   6 . HB1  1 1 
       1671 1 2 1 1  82 VAL MG1  .  82 . HG1* 1 1 
       1672 1 1 1 1   6 LEU MD1  .   6 . HD1* 1 1 
       1672 1 2 1 1  82 VAL MG2  .  82 . HG2* 1 1 
       1673 1 1 1 1  93 GLN HE22 .  93 . HE22 1 1 
       1673 1 2 1 1  97 GLU HG2  .  97 . HG2  1 1 
       1674 1 1 1 1   7 VAL HB   .   7 . HB   1 1 
       1674 1 2 1 1  57 PHE HA   .  57 . HA   1 1 
       1675 1 1 1 1   7 VAL MG1  .   7 . HG1* 1 1 
       1675 1 2 1 1  57 PHE HA   .  57 . HA   1 1 
       1676 1 1 1 1   7 VAL MG2  .   7 . HG2* 1 1 
       1676 1 2 1 1  57 PHE HA   .  57 . HA   1 1 
       1677 1 1 1 1   6 LEU HA   .   6 . HA   1 1 
       1677 1 2 1 1   7 VAL MG2  .   7 . HG2* 1 1 
       1678 1 1 1 1   7 VAL MG1  .   7 . HG1* 1 1 
       1678 1 2 1 1   8 ILE HA   .   8 . HA   1 1 
       1679 1 1 1 1   7 VAL HB   .   7 . HB   1 1 
       1679 1 2 1 1   8 ILE HA   .   8 . HA   1 1 
       1680 1 1 1 1   7 VAL MG1  .   7 . HG1* 1 1 
       1680 1 2 1 1  18 VAL MG1  .  18 . HG1* 1 1 
       1681 1 1 1 1   7 VAL MG1  .   7 . HG1* 1 1 
       1681 1 2 1 1  83 LEU MD2  .  83 . HD2* 1 1 
       1682 1 1 1 1   7 VAL MG1  .   7 . HG1* 1 1 
       1682 1 2 1 1  95 VAL MG2  .  95 . HG2* 1 1 
       1683 1 1 1 1   7 VAL MG1  .   7 . HG1* 1 1 
       1683 1 2 1 1  91 LEU HG   .  91 . HG   1 1 
       1684 1 1 1 1  70 GLN HA   .  70 . HA   1 1 
       1684 1 2 1 1  80 TYR QD   .  80 . HD*  1 1 
       1685 1 1 1 1  70 GLN HA   .  70 . HA   1 1 
       1685 1 2 1 1  80 TYR QE   .  80 . HE*  1 1 
       1686 1 1 1 1  66 VAL MG1  .  66 . HG1* 1 1 
       1686 1 2 1 1  70 GLN HG2  .  70 . HG2  1 1 
       1687 1 1 1 1  72 GLU HB2  .  72 . HB2  1 1 
       1687 1 2 1 1  75 LYS H    .  75 . HN   1 1 
       1688 1 1 1 1  72 GLU HB3  .  72 . HB1  1 1 
       1688 1 2 1 1  75 LYS H    .  75 . HN   1 1 
       1689 1 1 1 1  73 ALA MB   .  73 . HB*  1 1 
       1689 1 2 1 1  78 VAL MG1  .  78 . HG1* 1 1 
       1690 1 1 1 1   8 ILE MD   .   8 . HD1* 1 1 
       1690 1 2 1 1  82 VAL MG2  .  82 . HG2* 1 1 
       1691 1 1 1 1   7 VAL MG2  .   7 . HG2* 1 1 
       1691 1 2 1 1  91 LEU MD2  .  91 . HD2* 1 1 
       1692 1 1 1 1   7 VAL MG2  .   7 . HG2* 1 1 
       1692 1 2 1 1  91 LEU MD1  .  91 . HD1* 1 1 
       1693 1 1 1 1  18 VAL MG1  .  18 . HG1* 1 1 
       1693 1 2 1 1  91 LEU MD1  .  91 . HD1* 1 1 
       1694 1 1 1 1  18 VAL MG2  .  18 . HG2* 1 1 
       1694 1 2 1 1  91 LEU MD1  .  91 . HD1* 1 1 
       1695 1 1 1 1  94 ARG HD2  .  94 . HD2  1 1 
       1695 1 2 1 1  97 GLU H    .  97 . HN   1 1 
       1696 1 1 1 1  94 ARG HD3  .  94 . HD1  1 1 
       1696 1 2 1 1  97 GLU H    .  97 . HN   1 1 
       1697 1 1 1 1  31 ILE MD   .  31 . HD1* 1 1 
       1697 1 2 1 1  99 LEU MD2  .  99 . HD2* 1 1 
       1698 1 1 1 1  98 PHE HB2  .  98 . HB2  1 1 
       1698 1 2 1 1  99 LEU HG   .  99 . HG   1 1 
       1699 1 1 1 1  44 ILE MG   .  44 . HG2* 1 1 
       1699 1 2 1 1  48 LYS HD2  .  48 . HD2  1 1 
       1700 1 1 1 1  44 ILE MG   .  44 . HG2* 1 1 
       1700 1 2 1 1  48 LYS HD3  .  48 . HD1  1 1 
       1701 1 1 1 1  74 LYS HA   .  74 . HA   1 1 
       1701 1 2 1 1  78 VAL H    .  78 . HN   1 1 
       1702 1 1 1 1  37 SER HA   .  37 . HA   1 1 
       1702 1 2 1 1  40 ILE MD   .  40 . HD1* 1 1 
       1703 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
       1703 1 2 1 1  88 PRO HA   .  88 . HA   1 1 
       1704 1 1 1 1   2 GLY HA3  .   2 . HA1  1 1 
       1704 1 2 1 1  47 MET ME   .  47 . HE*  1 1 
       1705 1 1 1 1   2 GLY HA2  .   2 . HA2  1 1 
       1705 1 2 1 1  47 MET ME   .  47 . HE*  1 1 
       1706 1 1 1 1   3 LYS HB2  .   3 . HB2  1 1 
       1706 1 2 1 1  53 PRO HA   .  53 . HA   1 1 
       1707 1 1 1 1   3 LYS HB3  .   3 . HB1  1 1 
       1707 1 2 1 1  53 PRO HA   .  53 . HA   1 1 
       1708 1 1 1 1   3 LYS HG2  .   3 . HG2  1 1 
       1708 1 2 1 1  53 PRO HA   .  53 . HA   1 1 
       1709 1 1 1 1   3 LYS HG3  .   3 . HG1  1 1 
       1709 1 2 1 1  53 PRO HA   .  53 . HA   1 1 
       1710 1 1 1 1  44 ILE MG   .  44 . HG2* 1 1 
       1710 1 2 1 1  72 GLU HA   .  72 . HA   1 1 
       1711 1 1 1 1  71 ASN HA   .  71 . HA   1 1 
       1711 1 2 1 1  74 LYS HD2  .  74 . HD2  1 1 
       1712 1 1 1 1  71 ASN HA   .  71 . HA   1 1 
       1712 1 2 1 1  74 LYS HD3  .  74 . HD1  1 1 
       1713 1 1 1 1  73 ALA MB   .  73 . HB*  1 1 
       1713 1 2 1 1  74 LYS HA   .  74 . HA   1 1 
       1714 1 1 1 1  75 LYS HA   .  75 . HA   1 1 
       1714 1 2 1 1  76 GLU HA   .  76 . HA   1 1 
       1715 1 1 1 1   4 VAL MG1  .   4 . HG1* 1 1 
       1715 1 2 1 1  80 TYR QD   .  80 . HD*  1 1 
       1716 1 1 1 1  63 GLN HA   .  63 . HA   1 1 
       1716 1 2 1 1  66 VAL MG2  .  66 . HG2* 1 1 
       1717 1 1 1 1  63 GLN HB2  .  63 . HB2  1 1 
       1717 1 2 1 1  66 VAL MG2  .  66 . HG2* 1 1 
       1718 1 1 1 1  92 THR MG   .  92 . HG2* 1 1 
       1718 1 2 1 1  93 GLN HG3  .  93 . HG1  1 1 
       1719 1 1 1 1  34 ALA HA   .  34 . HA   1 1 
       1719 1 2 1 1  43 ILE MD   .  43 . HD1* 1 1 
       1720 1 1 1 1  74 LYS HD2  .  74 . HD2  1 1 
       1720 1 2 1 1  80 TYR QE   .  80 . HE*  1 1 
       1721 1 1 1 1  74 LYS HD3  .  74 . HD1  1 1 
       1721 1 2 1 1  80 TYR QE   .  80 . HE*  1 1 
       1722 1 1 1 1  21 ARG HB2  .  21 . HB2  1 1 
       1722 1 2 1 1  92 THR MG   .  92 . HG2* 1 1 
       1723 1 1 1 1  21 ARG HB3  .  21 . HB1  1 1 
       1723 1 2 1 1  92 THR MG   .  92 . HG2* 1 1 
       1724 1 1 1 1  44 ILE HA   .  44 . HA   1 1 
       1724 1 2 1 1  47 MET ME   .  47 . HE*  1 1 
       1725 1 1 1 1   5 LEU HG   .   5 . HG   1 1 
       1725 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       1726 1 1 1 1  34 ALA MB   .  34 . HB*  1 1 
       1726 1 2 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       1727 1 1 1 1  61 ALA MB   .  61 . HB*  1 1 
       1727 1 2 1 1  66 VAL H    .  66 . HN   1 1 
       1728 1 1 1 1  65 ASP HA   .  65 . HA   1 1 
       1728 1 2 1 1  68 GLU HG3  .  68 . HG1  1 1 
       1729 1 1 1 1  65 ASP HA   .  65 . HA   1 1 
       1729 1 2 1 1  68 GLU HG2  .  68 . HG2  1 1 
       1730 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       1730 1 2 1 1  82 VAL HB   .  82 . HB   1 1 
       1731 1 1 1 1   7 VAL HB   .   7 . HB   1 1 
       1731 1 2 1 1  57 PHE HB3  .  57 . HB1  1 1 
       1732 1 1 1 1   9 SER HB2  .   9 . HB2  1 1 
       1732 1 2 1 1  15 ILE HG12 .  15 . HG12 1 1 
       1733 1 1 1 1   9 SER HB3  .   9 . HB1  1 1 
       1733 1 2 1 1  15 ILE HG12 .  15 . HG12 1 1 
       1734 1 1 1 1  10 THR HA   .  10 . HA   1 1 
       1734 1 2 1 1  12 THR MG   .  12 . HG2* 1 1 
       1735 1 1 1 1  10 THR HB   .  10 . HB   1 1 
       1735 1 2 1 1  86 THR MG   .  86 . HG2* 1 1 
       1736 1 1 1 1  33 THR MG   .  33 . HG2* 1 1 
       1736 1 2 1 1  57 PHE QD   .  57 . HD*  1 1 
       1737 1 1 1 1  12 THR HB   .  12 . HB   1 1 
       1737 1 2 1 1  59 ASN HA   .  59 . HA   1 1 
       1738 1 1 1 1  12 THR HA   .  12 . HA   1 1 
       1738 1 2 1 1  15 ILE HG12 .  15 . HG12 1 1 
       1739 1 1 1 1  12 THR HB   .  12 . HB   1 1 
       1739 1 2 1 1  15 ILE MG   .  15 . HG2* 1 1 
       1740 1 1 1 1  12 THR HB   .  12 . HB   1 1 
       1740 1 2 1 1  15 ILE HB   .  15 . HB   1 1 
       1741 1 1 1 1  12 THR MG   .  12 . HG2* 1 1 
       1741 1 2 1 1  15 ILE MG   .  15 . HG2* 1 1 
       1742 1 1 1 1  14 ILE MD   .  14 . HD1* 1 1 
       1742 1 2 1 1  88 PRO HA   .  88 . HA   1 1 
       1743 1 1 1 1  15 ILE HB   .  15 . HB   1 1 
       1743 1 2 1 1  57 PHE QD   .  57 . HD*  1 1 
       1744 1 1 1 1   9 SER H    .   9 . HN   1 1 
       1744 1 2 1 1  15 ILE MD   .  15 . HD1* 1 1 
       1745 1 1 1 1   8 ILE HA   .   8 . HA   1 1 
       1745 1 2 1 1  15 ILE MD   .  15 . HD1* 1 1 
       1746 1 1 1 1  15 ILE MD   .  15 . HD1* 1 1 
       1746 1 2 1 1  59 ASN HA   .  59 . HA   1 1 
       1747 1 1 1 1  15 ILE MG   .  15 . HG2* 1 1 
       1747 1 2 1 1  58 VAL HA   .  58 . HA   1 1 
       1748 1 1 1 1  12 THR MG   .  12 . HG2* 1 1 
       1748 1 2 1 1  15 ILE HB   .  15 . HB   1 1 
       1749 1 1 1 1  14 ILE MD   .  14 . HD1* 1 1 
       1749 1 2 1 1  17 SER HA   .  17 . HA   1 1 
       1750 1 1 1 1  15 ILE HA   .  15 . HA   1 1 
       1750 1 2 1 1  18 VAL MG2  .  18 . HG2* 1 1 
       1751 1 1 1 1  18 VAL MG1  .  18 . HG1* 1 1 
       1751 1 2 1 1  19 GLN HA   .  19 . HA   1 1 
       1752 1 1 1 1  18 VAL HA   .  18 . HA   1 1 
       1752 1 2 1 1  95 VAL MG2  .  95 . HG2* 1 1 
       1753 1 1 1 1  18 VAL MG1  .  18 . HG1* 1 1 
       1753 1 2 1 1  91 LEU HG   .  91 . HG   1 1 
       1754 1 1 1 1  18 VAL MG2  .  18 . HG2* 1 1 
       1754 1 2 1 1  91 LEU HB3  .  91 . HB1  1 1 
       1755 1 1 1 1  18 VAL MG1  .  18 . HG1* 1 1 
       1755 1 2 1 1  95 VAL MG2  .  95 . HG2* 1 1 
       1756 1 1 1 1  70 GLN HB2  .  70 . HB2  1 1 
       1756 1 2 1 1  80 TYR QE   .  80 . HE*  1 1 
       1757 1 1 1 1  22 ALA MB   .  22 . HB*  1 1 
       1757 1 2 1 1  23 LYS HA   .  23 . HA   1 1 
       1758 1 1 1 1  23 LYS HG2  .  23 . HG2  1 1 
       1758 1 2 1 1  24 HIS H    .  24 . HN   1 1 
       1759 1 1 1 1  31 ILE MG   .  31 . HG2* 1 1 
       1759 1 2 1 1  55 VAL H    .  55 . HN   1 1 
       1760 1 1 1 1  23 LYS H    .  23 . HN   1 1 
       1760 1 2 1 1  31 ILE MG   .  31 . HG2* 1 1 
       1761 1 1 1 1  31 ILE MG   .  31 . HG2* 1 1 
       1761 1 2 1 1  99 LEU MD2  .  99 . HD2* 1 1 
       1762 1 1 1 1  32 ARG HG3  .  32 . HG1  1 1 
       1762 1 2 1 1  54 LEU MD1  .  54 . HD1* 1 1 
       1763 1 1 1 1  33 THR MG   .  33 . HG2* 1 1 
       1763 1 2 1 1  57 PHE HA   .  57 . HA   1 1 
       1764 1 1 1 1  33 THR HB   .  33 . HB   1 1 
       1764 1 2 1 1  57 PHE H    .  57 . HN   1 1 
       1765 1 1 1 1  33 THR HB   .  33 . HB   1 1 
       1765 1 2 1 1  35 THR H    .  35 . HN   1 1 
       1766 1 1 1 1  30 GLU HA   .  30 . HA   1 1 
       1766 1 2 1 1  31 ILE HB   .  31 . HB   1 1 
       1767 1 1 1 1  30 GLU HB3  .  30 . HB1  1 1 
       1767 1 2 1 1  54 LEU HA   .  54 . HA   1 1 
       1768 1 1 1 1  30 GLU HB2  .  30 . HB2  1 1 
       1768 1 2 1 1  54 LEU HA   .  54 . HA   1 1 
       1769 1 1 1 1  29 ARG HG2  .  29 . HG2  1 1 
       1769 1 2 1 1  30 GLU H    .  30 . HN   1 1 
       1770 1 1 1 1  29 ARG HG3  .  29 . HG1  1 1 
       1770 1 2 1 1  30 GLU H    .  30 . HN   1 1 
       1771 1 1 1 1  34 ALA MB   .  34 . HB*  1 1 
       1771 1 2 1 1  35 THR HB   .  35 . HB   1 1 
       1772 1 1 1 1  39 ASP HB2  .  39 . HB2  1 1 
       1772 1 2 1 1  43 ILE MD   .  43 . HD1* 1 1 
       1773 1 1 1 1  39 ASP HA   .  39 . HA   1 1 
       1773 1 2 1 1  43 ILE HA   .  43 . HA   1 1 
       1774 1 1 1 1  44 ILE HA   .  44 . HA   1 1 
       1774 1 2 1 1  47 MET HG2  .  47 . HG2  1 1 
       1775 1 1 1 1  44 ILE HA   .  44 . HA   1 1 
       1775 1 2 1 1  47 MET HG3  .  47 . HG1  1 1 
       1776 1 1 1 1  52 LYS HG2  .  52 . HG2  1 1 
       1776 1 2 1 1  53 PRO HD3  .  53 . HD1  1 1 
       1777 1 1 1 1  52 LYS HG2  .  52 . HG2  1 1 
       1777 1 2 1 1  53 PRO HD2  .  53 . HD2  1 1 
       1778 1 1 1 1  52 LYS HB3  .  52 . HB1  1 1 
       1778 1 2 1 1  53 PRO HD2  .  53 . HD2  1 1 
       1779 1 1 1 1  52 LYS HB3  .  52 . HB1  1 1 
       1779 1 2 1 1  53 PRO HD3  .  53 . HD1  1 1 
       1780 1 1 1 1  53 PRO HB2  .  53 . HB2  1 1 
       1780 1 2 1 1  99 LEU MD2  .  99 . HD2* 1 1 
       1781 1 1 1 1  53 PRO HG3  .  53 . HG1  1 1 
       1781 1 2 1 1 102 ALA MB   . 102 . HB*  1 1 
       1782 1 1 1 1  53 PRO HG3  .  53 . HG1  1 1 
       1782 1 2 1 1  99 LEU MD2  .  99 . HD2* 1 1 
       1783 1 1 1 1  53 PRO HG2  .  53 . HG2  1 1 
       1783 1 2 1 1 102 ALA MB   . 102 . HB*  1 1 
       1784 1 1 1 1  53 PRO HG2  .  53 . HG2  1 1 
       1784 1 2 1 1  99 LEU MD2  .  99 . HD2* 1 1 
       1785 1 1 1 1  32 ARG HA   .  32 . HA   1 1 
       1785 1 2 1 1  54 LEU MD1  .  54 . HD1* 1 1 
       1786 1 1 1 1  32 ARG HA   .  32 . HA   1 1 
       1786 1 2 1 1  54 LEU MD2  .  54 . HD2* 1 1 
       1787 1 1 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       1787 1 2 1 1  99 LEU MD2  .  99 . HD2* 1 1 
       1788 1 1 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       1788 1 2 1 1  99 LEU HG   .  99 . HG   1 1 
       1789 1 1 1 1  31 ILE HG12 .  31 . HG12 1 1 
       1789 1 2 1 1  55 VAL HB   .  55 . HB   1 1 
       1790 1 1 1 1  31 ILE HA   .  31 . HA   1 1 
       1790 1 2 1 1  55 VAL HB   .  55 . HB   1 1 
       1791 1 1 1 1   5 LEU H    .   5 . HN   1 1 
       1791 1 2 1 1  56 VAL MG2  .  56 . HG2* 1 1 
       1792 1 1 1 1   5 LEU H    .   5 . HN   1 1 
       1792 1 2 1 1  56 VAL MG1  .  56 . HG1* 1 1 
       1793 1 1 1 1  34 ALA H    .  34 . HN   1 1 
       1793 1 2 1 1  56 VAL MG2  .  56 . HG2* 1 1 
       1794 1 1 1 1  40 ILE HA   .  40 . HA   1 1 
       1794 1 2 1 1  56 VAL MG2  .  56 . HG2* 1 1 
       1795 1 1 1 1  43 ILE HA   .  43 . HA   1 1 
       1795 1 2 1 1  56 VAL MG2  .  56 . HG2* 1 1 
       1796 1 1 1 1  56 VAL MG1  .  56 . HG1* 1 1 
       1796 1 2 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       1797 1 1 1 1  15 ILE MG   .  15 . HG2* 1 1 
       1797 1 2 1 1  57 PHE HB3  .  57 . HB1  1 1 
       1798 1 1 1 1  57 PHE QD   .  57 . HD*  1 1 
       1798 1 2 1 1  95 VAL MG2  .  95 . HG2* 1 1 
       1799 1 1 1 1  34 ALA H    .  34 . HN   1 1 
       1799 1 2 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       1800 1 1 1 1  15 ILE MG   .  15 . HG2* 1 1 
       1800 1 2 1 1  59 ASN HB3  .  59 . HB1  1 1 
       1801 1 1 1 1  15 ILE MG   .  15 . HG2* 1 1 
       1801 1 2 1 1  59 ASN HB2  .  59 . HB2  1 1 
       1802 1 1 1 1  63 GLN HG2  .  63 . HG2  1 1 
       1802 1 2 1 1  67 ASN HD21 .  67 . HD21 1 1 
       1803 1 1 1 1   6 LEU MD1  .   6 . HD1* 1 1 
       1803 1 2 1 1  66 VAL MG1  .  66 . HG1* 1 1 
       1804 1 1 1 1   6 LEU MD1  .   6 . HD1* 1 1 
       1804 1 2 1 1  66 VAL MG2  .  66 . HG2* 1 1 
       1805 1 1 1 1   7 VAL MG2  .   7 . HG2* 1 1 
       1805 1 2 1 1  83 LEU MD1  .  83 . HD1* 1 1 
       1806 1 1 1 1  40 ILE MD   .  40 . HD1* 1 1 
       1806 1 2 1 1  68 GLU HB3  .  68 . HB1  1 1 
       1807 1 1 1 1  40 ILE MG   .  40 . HG2* 1 1 
       1807 1 2 1 1  68 GLU HB3  .  68 . HB1  1 1 
       1808 1 1 1 1  40 ILE MD   .  40 . HD1* 1 1 
       1808 1 2 1 1  68 GLU HB2  .  68 . HB2  1 1 
       1809 1 1 1 1  40 ILE MG   .  40 . HG2* 1 1 
       1809 1 2 1 1  68 GLU HB2  .  68 . HB2  1 1 
       1810 1 1 1 1  40 ILE MG   .  40 . HG2* 1 1 
       1810 1 2 1 1  68 GLU HG2  .  68 . HG2  1 1 
       1811 1 1 1 1  40 ILE MD   .  40 . HD1* 1 1 
       1811 1 2 1 1  68 GLU HG2  .  68 . HG2  1 1 
       1812 1 1 1 1  40 ILE MG   .  40 . HG2* 1 1 
       1812 1 2 1 1  68 GLU HG3  .  68 . HG1  1 1 
       1813 1 1 1 1  40 ILE MD   .  40 . HD1* 1 1 
       1813 1 2 1 1  68 GLU HG3  .  68 . HG1  1 1 
       1814 1 1 1 1  70 GLN HB2  .  70 . HB2  1 1 
       1814 1 2 1 1  73 ALA MB   .  73 . HB*  1 1 
       1815 1 1 1 1  70 GLN HB2  .  70 . HB2  1 1 
       1815 1 2 1 1  82 VAL MG2  .  82 . HG2* 1 1 
       1816 1 1 1 1  70 GLN HG2  .  70 . HG2  1 1 
       1816 1 2 1 1  82 VAL MG2  .  82 . HG2* 1 1 
       1817 1 1 1 1  70 GLN HB3  .  70 . HB1  1 1 
       1817 1 2 1 1  82 VAL MG2  .  82 . HG2* 1 1 
       1818 1 1 1 1  44 ILE HG12 .  44 . HG12 1 1 
       1818 1 2 1 1  72 GLU HB2  .  72 . HB2  1 1 
       1819 1 1 1 1  44 ILE HG12 .  44 . HG12 1 1 
       1819 1 2 1 1  72 GLU HB3  .  72 . HB1  1 1 
       1820 1 1 1 1  73 ALA HA   .  73 . HA   1 1 
       1820 1 2 1 1  76 GLU HB3  .  76 . HB1  1 1 
       1821 1 1 1 1  77 GLY HA3  .  77 . HA1  1 1 
       1821 1 2 1 1  78 VAL HB   .  78 . HB   1 1 
       1822 1 1 1 1  73 ALA H    .  73 . HN   1 1 
       1822 1 2 1 1  78 VAL HB   .  78 . HB   1 1 
       1823 1 1 1 1  77 GLY HA2  .  77 . HA2  1 1 
       1823 1 2 1 1  78 VAL HB   .  78 . HB   1 1 
       1824 1 1 1 1   5 LEU MD1  .   5 . HD1* 1 1 
       1824 1 2 1 1  82 VAL MG2  .  82 . HG2* 1 1 
       1825 1 1 1 1  83 LEU HG   .  83 . HG   1 1 
       1825 1 2 1 1  85 SER HB3  .  85 . HB1  1 1 
       1826 1 1 1 1  83 LEU HG   .  83 . HG   1 1 
       1826 1 2 1 1  85 SER HB2  .  85 . HB2  1 1 
       1827 1 1 1 1  15 ILE HA   .  15 . HA   1 1 
       1827 1 2 1 1  91 LEU MD1  .  91 . HD1* 1 1 
       1828 1 1 1 1  18 VAL HA   .  18 . HA   1 1 
       1828 1 2 1 1  91 LEU MD1  .  91 . HD1* 1 1 
       1829 1 1 1 1  89 GLU HA   .  89 . HA   1 1 
       1829 1 2 1 1  92 THR MG   .  92 . HG2* 1 1 
       1830 1 1 1 1  83 LEU MD1  .  83 . HD1* 1 1 
       1830 1 2 1 1  94 ARG HA   .  94 . HA   1 1 
       1831 1 1 1 1  94 ARG HA   .  94 . HA   1 1 
       1831 1 2 1 1  95 VAL MG2  .  95 . HG2* 1 1 
       1832 1 1 1 1   5 LEU MD2  .   5 . HD2* 1 1 
       1832 1 2 1 1  94 ARG HG3  .  94 . HG1  1 1 
       1833 1 1 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       1833 1 2 1 1  99 LEU HG   .  99 . HG   1 1 
       1834 1 1 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       1834 1 2 1 1  95 VAL HA   .  95 . HA   1 1 
       1835 1 1 1 1  94 ARG HA   .  94 . HA   1 1 
       1835 1 2 1 1  95 VAL HA   .  95 . HA   1 1 
       1836 1 1 1 1  96 ARG HA   .  96 . HA   1 1 
       1836 1 2 1 1  99 LEU MD1  .  99 . HD1* 1 1 
       1837 1 1 1 1  68 GLU HA   .  68 . HA   1 1 
       1837 1 2 1 1  68 GLU HG2  .  68 . HG2  1 1 
       1838 1 1 1 1  98 PHE HA   .  98 . HA   1 1 
       1838 1 2 1 1  99 LEU HG   .  99 . HG   1 1 
       1839 1 1 1 1   5 LEU MD1  .   5 . HD1* 1 1 
       1839 1 2 1 1  98 PHE HB3  .  98 . HB1  1 1 
       1840 1 1 1 1  98 PHE HB3  .  98 . HB1  1 1 
       1840 1 2 1 1  99 LEU HG   .  99 . HG   1 1 
       1841 1 1 1 1  96 ARG HA   .  96 . HA   1 1 
       1841 1 2 1 1  99 LEU MD2  .  99 . HD2* 1 1 
       1842 1 1 1 1  98 PHE HA   .  98 . HA   1 1 
       1842 1 2 1 1 101 THR MG   . 101 . HG2* 1 1 
       1843 1 1 1 1 100 LYS HA   . 100 . HA   1 1 
       1843 1 2 1 1 101 THR HA   . 101 . HA   1 1 
       1844 1 1 1 1 101 THR MG   . 101 . HG2* 1 1 
       1844 1 2 1 1 102 ALA HA   . 102 . HA   1 1 
       1845 1 1 1 1  99 LEU MD2  .  99 . HD2* 1 1 
       1845 1 2 1 1 102 ALA MB   . 102 . HB*  1 1 
       1846 1 1 1 1 101 THR HA   . 101 . HA   1 1 
       1846 1 2 1 1 102 ALA MB   . 102 . HB*  1 1 
       1847 1 1 1 1 101 THR HB   . 101 . HB   1 1 
       1847 1 2 1 1 102 ALA MB   . 102 . HB*  1 1 
       1848 1 1 1 1  40 ILE MG   .  40 . HG2* 1 1 
       1848 1 2 1 1  65 ASP HA   .  65 . HA   1 1 
       1849 1 1 1 1  80 TYR QE   .  80 . HE*  1 1 
       1849 1 2 1 1  82 VAL HA   .  82 . HA   1 1 
       1850 1 1 1 1  23 LYS HB2  .  23 . HB2  1 1 
       1850 1 2 1 1  24 HIS HA   .  24 . HA   1 1 
       1851 1 1 1 1  23 LYS HB3  .  23 . HB1  1 1 
       1851 1 2 1 1  24 HIS HA   .  24 . HA   1 1 
       1852 1 1 1 1   3 LYS HD2  .   3 . HD2  1 1 
       1852 1 2 1 1   4 VAL H    .   4 . HN   1 1 
       1853 1 1 1 1   3 LYS HD3  .   3 . HD1  1 1 
       1853 1 2 1 1   4 VAL H    .   4 . HN   1 1 
       1854 1 1 1 1   4 VAL MG2  .   4 . HG2* 1 1 
       1854 1 2 1 1   5 LEU HA   .   5 . HA   1 1 
       1855 1 1 1 1   4 VAL HB   .   4 . HB   1 1 
       1855 1 2 1 1  47 MET ME   .  47 . HE*  1 1 
       1856 1 1 1 1   5 LEU HG   .   5 . HG   1 1 
       1856 1 2 1 1  56 VAL H    .  56 . HN   1 1 
       1857 1 1 1 1   6 LEU HG   .   6 . HG   1 1 
       1857 1 2 1 1   8 ILE HG12 .   8 . HG12 1 1 
       1858 1 1 1 1   4 VAL MG2  .   4 . HG2* 1 1 
       1858 1 2 1 1   6 LEU HA   .   6 . HA   1 1 
       1859 1 1 1 1  14 ILE MD   .  14 . HD1* 1 1 
       1859 1 2 1 1  87 ASP HA   .  87 . HA   1 1 
       1860 1 1 1 1  40 ILE MG   .  40 . HG2* 1 1 
       1860 1 2 1 1  69 PHE HA   .  69 . HA   1 1 
       1861 1 1 1 1  21 ARG HB2  .  21 . HB2  1 1 
       1861 1 2 1 1  22 ALA HA   .  22 . HA   1 1 
       1862 1 1 1 1  21 ARG HB3  .  21 . HB1  1 1 
       1862 1 2 1 1  22 ALA HA   .  22 . HA   1 1 
       1863 1 1 1 1   3 LYS HD2  .   3 . HD2  1 1 
       1863 1 2 1 1 102 ALA HA   . 102 . HA   1 1 
       1864 1 1 1 1   3 LYS HD3  .   3 . HD1  1 1 
       1864 1 2 1 1 102 ALA HA   . 102 . HA   1 1 
       1865 1 1 1 1  34 ALA MB   .  34 . HB*  1 1 
       1865 1 2 1 1  40 ILE MD   .  40 . HD1* 1 1 
       1866 1 1 1 1  37 SER HA   .  37 . HA   1 1 
       1866 1 2 1 1  40 ILE HG13 .  40 . HG11 1 1 
       1867 1 1 1 1  37 SER HA   .  37 . HA   1 1 
       1867 1 2 1 1  40 ILE HG12 .  40 . HG12 1 1 
       1868 1 1 1 1  37 SER HA   .  37 . HA   1 1 
       1868 1 2 1 1  40 ILE MG   .  40 . HG2* 1 1 
       1869 1 1 1 1  34 ALA HA   .  34 . HA   1 1 
       1869 1 2 1 1  39 ASP HB2  .  39 . HB2  1 1 
       1870 1 1 1 1  34 ALA HA   .  34 . HA   1 1 
       1870 1 2 1 1  39 ASP HB3  .  39 . HB1  1 1 
       1871 1 1 1 1   4 VAL HA   .   4 . HA   1 1 
       1871 1 2 1 1  54 LEU H    .  54 . HN   1 1 
       1872 1 1 1 1   4 VAL MG2  .   4 . HG2* 1 1 
       1872 1 2 1 1  55 VAL H    .  55 . HN   1 1 
       1873 1 1 1 1   4 VAL MG1  .   4 . HG1* 1 1 
       1873 1 2 1 1  54 LEU H    .  54 . HN   1 1 
       1874 1 1 1 1  40 ILE MD   .  40 . HD1* 1 1 
       1874 1 2 1 1  56 VAL MG1  .  56 . HG1* 1 1 
       1875 1 1 1 1  44 ILE MG   .  44 . HG2* 1 1 
       1875 1 2 1 1  48 LYS H    .  48 . HN   1 1 
       1876 1 1 1 1  44 ILE MG   .  44 . HG2* 1 1 
       1876 1 2 1 1  80 TYR QD   .  80 . HD*  1 1 
       1877 1 1 1 1  41 ARG H    .  41 . HN   1 1 
       1877 1 2 1 1  43 ILE HB   .  43 . HB   1 1 
       1878 1 1 1 1  43 ILE HB   .  43 . HB   1 1 
       1878 1 2 1 1  45 LYS H    .  45 . HN   1 1 
       1879 1 1 1 1  44 ILE MD   .  44 . HD1* 1 1 
       1879 1 2 1 1  73 ALA HA   .  73 . HA   1 1 
       1880 1 1 1 1  44 ILE MD   .  44 . HD1* 1 1 
       1880 1 2 1 1  71 ASN H    .  71 . HN   1 1 
       1881 1 1 1 1  44 ILE MD   .  44 . HD1* 1 1 
       1881 1 2 1 1  45 LYS H    .  45 . HN   1 1 
       1882 1 1 1 1  44 ILE MG   .  44 . HG2* 1 1 
       1882 1 2 1 1  47 MET H    .  47 . HN   1 1 
       1883 1 1 1 1  44 ILE MD   .  44 . HD1* 1 1 
       1883 1 2 1 1  73 ALA MB   .  73 . HB*  1 1 
       1884 1 1 1 1  44 ILE HA   .  44 . HA   1 1 
       1884 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       1885 1 1 1 1   3 LYS HA   .   3 . HA   1 1 
       1885 1 2 1 1  47 MET ME   .  47 . HE*  1 1 
       1886 1 1 1 1  48 LYS HD2  .  48 . HD2  1 1 
       1886 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       1887 1 1 1 1  48 LYS HD3  .  48 . HD1  1 1 
       1887 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       1888 1 1 1 1   5 LEU MD2  .   5 . HD2* 1 1 
       1888 1 2 1 1  99 LEU MD2  .  99 . HD2* 1 1 
       1889 1 1 1 1  86 THR HA   .  86 . HA   1 1 
       1889 1 2 1 1  91 LEU MD2  .  91 . HD2* 1 1 
       1890 1 1 1 1   4 VAL MG2  .   4 . HG2* 1 1 
       1890 1 2 1 1  56 VAL MG1  .  56 . HG1* 1 1 
       1891 1 1 1 1   5 LEU MD2  .   5 . HD2* 1 1 
       1891 1 2 1 1   7 VAL MG1  .   7 . HG1* 1 1 
       1892 1 1 1 1   9 SER HA   .   9 . HA   1 1 
       1892 1 2 1 1  86 THR MG   .  86 . HG2* 1 1 
       1893 1 1 1 1  47 MET ME   .  47 . HE*  1 1 
       1893 1 2 1 1  54 LEU MD1  .  54 . HD1* 1 1 
       1894 1 1 1 1  91 LEU HB3  .  91 . HB1  1 1 
       1894 1 2 1 1  95 VAL MG2  .  95 . HG2* 1 1 
       1895 1 1 1 1  53 PRO HB3  .  53 . HB1  1 1 
       1895 1 2 1 1  99 LEU MD2  .  99 . HD2* 1 1 
       1896 1 1 1 1  42 ASP H    .  42 . HN   1 1 
       1896 1 2 1 1  43 ILE HA   .  43 . HA   1 1 
       1897 1 1 1 1  42 ASP H    .  42 . HN   1 1 
       1897 1 2 1 1  43 ILE HB   .  43 . HB   1 1 
       1898 1 1 1 1   8 ILE MG   .   8 . HG2* 1 1 
       1898 1 2 1 1  10 THR H    .  10 . HN   1 1 
       1899 1 1 1 1  43 ILE MG   .  43 . HG2* 1 1 
       1899 1 2 1 1  45 LYS H    .  45 . HN   1 1 
       1900 1 1 1 1  43 ILE MG   .  43 . HG2* 1 1 
       1900 1 2 1 1  47 MET H    .  47 . HN   1 1 
       1901 1 1 1 1  43 ILE MG   .  43 . HG2* 1 1 
       1901 1 2 1 1  69 PHE HZ   .  69 . HZ   1 1 
       1902 1 1 1 1  43 ILE MG   .  43 . HG2* 1 1 
       1902 1 2 1 1  69 PHE QE   .  69 . HE*  1 1 
       1903 1 1 1 1  43 ILE MG   .  43 . HG2* 1 1 
       1903 1 2 1 1  56 VAL MG1  .  56 . HG1* 1 1 
       1904 1 1 1 1  15 ILE MG   .  15 . HG2* 1 1 
       1904 1 2 1 1  16 SER HA   .  16 . HA   1 1 
       1905 1 1 1 1  29 ARG HD3  .  29 . HD1  1 1 
       1905 1 2 1 1  99 LEU MD2  .  99 . HD2* 1 1 
       1906 1 1 1 1  29 ARG HD2  .  29 . HD2  1 1 
       1906 1 2 1 1  99 LEU MD2  .  99 . HD2* 1 1 
       1907 1 1 1 1  19 GLN HB2  .  19 . HB2  1 1 
       1907 1 2 1 1  57 PHE QD   .  57 . HD*  1 1 
       1908 1 1 1 1  25 ASN HA   .  25 . HA   1 1 
       1908 1 2 1 1  26 TYR QE   .  26 . HE*  1 1 
       1909 1 1 1 1  30 GLU HA   .  30 . HA   1 1 
       1909 1 2 1 1  54 LEU HA   .  54 . HA   1 1 
       1910 1 1 1 1  30 GLU HB2  .  30 . HB2  1 1 
       1910 1 2 1 1  54 LEU HG   .  54 . HG   1 1 
       1911 1 1 1 1   6 LEU MD1  .   6 . HD1* 1 1 
       1911 1 2 1 1  40 ILE MD   .  40 . HD1* 1 1 
       1912 1 1 1 1   4 VAL MG2  .   4 . HG2* 1 1 
       1912 1 2 1 1  54 LEU HG   .  54 . HG   1 1 
       1913 1 1 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       1913 1 2 1 1  57 PHE QD   .  57 . HD*  1 1 
       1914 1 1 1 1   9 SER H    .   9 . HN   1 1 
       1914 1 2 1 1  58 VAL HB   .  58 . HB   1 1 
       1915 1 1 1 1  40 ILE MG   .  40 . HG2* 1 1 
       1915 1 2 1 1  68 GLU HA   .  68 . HA   1 1 
       1916 1 1 1 1   8 ILE MG   .   8 . HG2* 1 1 
       1916 1 2 1 1  59 ASN HA   .  59 . HA   1 1 
       1917 1 1 1 1   8 ILE MD   .   8 . HD1* 1 1 
       1917 1 2 1 1  61 ALA MB   .  61 . HB*  1 1 
       1918 1 1 1 1  58 VAL HB   .  58 . HB   1 1 
       1918 1 2 1 1  61 ALA MB   .  61 . HB*  1 1 
       1919 1 1 1 1  92 THR MG   .  92 . HG2* 1 1 
       1919 1 2 1 1  93 GLN HA   .  93 . HA   1 1 
       1920 1 1 1 1  34 ALA MB   .  34 . HB*  1 1 
       1920 1 2 1 1  61 ALA MB   .  61 . HB*  1 1 
       1921 1 1 1 1  63 GLN HA   .  63 . HA   1 1 
       1921 1 2 1 1  66 VAL HA   .  66 . HA   1 1 
       1922 1 1 1 1  37 SER HA   .  37 . HA   1 1 
       1922 1 2 1 1  65 ASP HB3  .  65 . HB1  1 1 
       1923 1 1 1 1  37 SER HA   .  37 . HA   1 1 
       1923 1 2 1 1  65 ASP HB2  .  65 . HB2  1 1 
       1924 1 1 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       1924 1 2 1 1  65 ASP HB3  .  65 . HB1  1 1 
       1925 1 1 1 1  40 ILE MD   .  40 . HD1* 1 1 
       1925 1 2 1 1  65 ASP HB2  .  65 . HB2  1 1 
       1926 1 1 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       1926 1 2 1 1  65 ASP HB3  .  65 . HB1  1 1 
       1927 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       1927 1 2 1 1  66 VAL HB   .  66 . HB   1 1 
       1928 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       1928 1 2 1 1  66 VAL MG2  .  66 . HG2* 1 1 
       1929 1 1 1 1  63 GLN HA   .  63 . HA   1 1 
       1929 1 2 1 1  66 VAL MG1  .  66 . HG1* 1 1 
       1930 1 1 1 1  82 VAL MG1  .  82 . HG1* 1 1 
       1930 1 2 1 1  83 LEU HA   .  83 . HA   1 1 
       1931 1 1 1 1  97 GLU HA   .  97 . HA   1 1 
       1931 1 2 1 1  97 GLU HG2  .  97 . HG2  1 1 
       1932 1 1 1 1  96 ARG HD2  .  96 . HD2  1 1 
       1932 1 2 1 1  97 GLU HG2  .  97 . HG2  1 1 
       1933 1 1 1 1  96 ARG HD3  .  96 . HD1  1 1 
       1933 1 2 1 1  97 GLU HG2  .  97 . HG2  1 1 
       1934 1 1 1 1  69 PHE HA   .  69 . HA   1 1 
       1934 1 2 1 1  69 PHE QE   .  69 . HE*  1 1 
       1935 1 1 1 1  68 GLU HB3  .  68 . HB1  1 1 
       1935 1 2 1 1  69 PHE HA   .  69 . HA   1 1 
       1936 1 1 1 1  71 ASN HB2  .  71 . HB2  1 1 
       1936 1 2 1 1  72 GLU HA   .  72 . HA   1 1 
       1937 1 1 1 1  71 ASN HB3  .  71 . HB1  1 1 
       1937 1 2 1 1  72 GLU HA   .  72 . HA   1 1 
       1938 1 1 1 1  44 ILE HB   .  44 . HB   1 1 
       1938 1 2 1 1  73 ALA HA   .  73 . HA   1 1 
       1939 1 1 1 1  78 VAL HA   .  78 . HA   1 1 
       1939 1 2 1 1  79 SER HA   .  79 . HA   1 1 
       1940 1 1 1 1  78 VAL MG1  .  78 . HG1* 1 1 
       1940 1 2 1 1  79 SER HA   .  79 . HA   1 1 
       1941 1 1 1 1   4 VAL MG2  .   4 . HG2* 1 1 
       1941 1 2 1 1  81 ASP H    .  81 . HN   1 1 
       1942 1 1 1 1   5 LEU MD1  .   5 . HD1* 1 1 
       1942 1 2 1 1  83 LEU HA   .  83 . HA   1 1 
       1943 1 1 1 1   4 VAL MG1  .   4 . HG1* 1 1 
       1943 1 2 1 1   6 LEU HA   .   6 . HA   1 1 
       1944 1 1 1 1  91 LEU HA   .  91 . HA   1 1 
       1944 1 2 1 1  95 VAL MG2  .  95 . HG2* 1 1 
       1945 1 1 1 1  18 VAL MG1  .  18 . HG1* 1 1 
       1945 1 2 1 1  91 LEU HA   .  91 . HA   1 1 
       1946 1 1 1 1  98 PHE HA   .  98 . HA   1 1 
       1946 1 2 1 1  98 PHE QE   .  98 . HE*  1 1 
       1947 1 1 1 1  44 ILE MG   .  44 . HG2* 1 1 
       1947 1 2 1 1  48 LYS HG3  .  48 . HG1  1 1 
       1948 1 1 1 1   4 VAL H    .   4 . HN   1 1 
       1948 1 2 1 1 102 ALA MB   . 102 . HB*  1 1 
       1949 1 1 1 1  26 TYR HA   .  26 . HA   1 1 
       1949 1 2 1 1  26 TYR QD   .  26 . HD*  1 1 
       1950 1 1 1 1  57 PHE HA   .  57 . HA   1 1 
       1950 1 2 1 1  57 PHE QD   .  57 . HD*  1 1 
       1951 1 1 1 1  80 TYR HA   .  80 . HA   1 1 
       1951 1 2 1 1  80 TYR QD   .  80 . HD*  1 1 
       1952 1 1 1 1  22 ALA MB   .  22 . HB*  1 1 
       1952 1 2 1 1  26 TYR QD   .  26 . HD*  1 1 
       1953 1 1 1 1  26 TYR QD   .  26 . HD*  1 1 
       1953 1 2 1 1  31 ILE MD   .  31 . HD1* 1 1 
       1954 1 1 1 1  26 TYR QD   .  26 . HD*  1 1 
       1954 1 2 1 1  99 LEU MD1  .  99 . HD1* 1 1 
       1955 1 1 1 1  26 TYR HA   .  26 . HA   1 1 
       1955 1 2 1 1  26 TYR QE   .  26 . HE*  1 1 
       1956 1 1 1 1  22 ALA HA   .  22 . HA   1 1 
       1956 1 2 1 1  26 TYR QD   .  26 . HD*  1 1 
       1957 1 1 1 1  22 ALA HA   .  22 . HA   1 1 
       1957 1 2 1 1  26 TYR QE   .  26 . HE*  1 1 
       1958 1 1 1 1  26 TYR QE   .  26 . HE*  1 1 
       1958 1 2 1 1  96 ARG HA   .  96 . HA   1 1 
       1959 1 1 1 1  26 TYR QE   .  26 . HE*  1 1 
       1959 1 2 1 1  95 VAL HB   .  95 . HB   1 1 
       1960 1 1 1 1  26 TYR QE   .  26 . HE*  1 1 
       1960 1 2 1 1  95 VAL MG1  .  95 . HG1* 1 1 
       1961 1 1 1 1  26 TYR QE   .  26 . HE*  1 1 
       1961 1 2 1 1  99 LEU MD1  .  99 . HD1* 1 1 
       1962 1 1 1 1  57 PHE H    .  57 . HN   1 1 
       1962 1 2 1 1  57 PHE QD   .  57 . HD*  1 1 
       1963 1 1 1 1  57 PHE QD   .  57 . HD*  1 1 
       1963 1 2 1 1  58 VAL H    .  58 . HN   1 1 
       1964 1 1 1 1  33 THR HA   .  33 . HA   1 1 
       1964 1 2 1 1  57 PHE QD   .  57 . HD*  1 1 
       1965 1 1 1 1  57 PHE HA   .  57 . HA   1 1 
       1965 1 2 1 1  57 PHE QE   .  57 . HE*  1 1 
       1966 1 1 1 1  19 GLN HA   .  19 . HA   1 1 
       1966 1 2 1 1  57 PHE QE   .  57 . HE*  1 1 
       1967 1 1 1 1  55 VAL HB   .  55 . HB   1 1 
       1967 1 2 1 1  57 PHE QD   .  57 . HD*  1 1 
       1968 1 1 1 1  15 ILE HG13 .  15 . HG11 1 1 
       1968 1 2 1 1  57 PHE QD   .  57 . HD*  1 1 
       1969 1 1 1 1   7 VAL HB   .   7 . HB   1 1 
       1969 1 2 1 1  57 PHE QD   .  57 . HD*  1 1 
       1970 1 1 1 1  19 GLN HB3  .  19 . HB1  1 1 
       1970 1 2 1 1  57 PHE QD   .  57 . HD*  1 1 
       1971 1 1 1 1  15 ILE HG12 .  15 . HG12 1 1 
       1971 1 2 1 1  57 PHE QD   .  57 . HD*  1 1 
       1972 1 1 1 1  31 ILE MG   .  31 . HG2* 1 1 
       1972 1 2 1 1  57 PHE QD   .  57 . HD*  1 1 
       1973 1 1 1 1  31 ILE MD   .  31 . HD1* 1 1 
       1973 1 2 1 1  57 PHE QD   .  57 . HD*  1 1 
       1974 1 1 1 1   7 VAL MG1  .   7 . HG1* 1 1 
       1974 1 2 1 1  57 PHE QD   .  57 . HD*  1 1 
       1975 1 1 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       1975 1 2 1 1  57 PHE QD   .  57 . HD*  1 1 
       1976 1 1 1 1   7 VAL MG2  .   7 . HG2* 1 1 
       1976 1 2 1 1  57 PHE QD   .  57 . HD*  1 1 
       1977 1 1 1 1  22 ALA MB   .  22 . HB*  1 1 
       1977 1 2 1 1  57 PHE QE   .  57 . HE*  1 1 
       1978 1 1 1 1   7 VAL HB   .   7 . HB   1 1 
       1978 1 2 1 1  57 PHE QE   .  57 . HE*  1 1 
       1979 1 1 1 1  31 ILE MG   .  31 . HG2* 1 1 
       1979 1 2 1 1  57 PHE QE   .  57 . HE*  1 1 
       1980 1 1 1 1  57 PHE QE   .  57 . HE*  1 1 
       1980 1 2 1 1  95 VAL MG2  .  95 . HG2* 1 1 
       1981 1 1 1 1   7 VAL MG1  .   7 . HG1* 1 1 
       1981 1 2 1 1  57 PHE QE   .  57 . HE*  1 1 
       1982 1 1 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       1982 1 2 1 1  57 PHE QE   .  57 . HE*  1 1 
       1983 1 1 1 1   7 VAL MG2  .   7 . HG2* 1 1 
       1983 1 2 1 1  57 PHE QE   .  57 . HE*  1 1 
       1984 1 1 1 1  19 GLN HA   .  19 . HA   1 1 
       1984 1 2 1 1  57 PHE HZ   .  57 . HZ   1 1 
       1985 1 1 1 1  18 VAL HB   .  18 . HB   1 1 
       1985 1 2 1 1  57 PHE HZ   .  57 . HZ   1 1 
       1986 1 1 1 1  22 ALA MB   .  22 . HB*  1 1 
       1986 1 2 1 1  57 PHE HZ   .  57 . HZ   1 1 
       1987 1 1 1 1  18 VAL MG1  .  18 . HG1* 1 1 
       1987 1 2 1 1  57 PHE HZ   .  57 . HZ   1 1 
       1988 1 1 1 1  57 PHE HZ   .  57 . HZ   1 1 
       1988 1 2 1 1  95 VAL MG2  .  95 . HG2* 1 1 
       1989 1 1 1 1   7 VAL MG1  .   7 . HG1* 1 1 
       1989 1 2 1 1  57 PHE HZ   .  57 . HZ   1 1 
       1990 1 1 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       1990 1 2 1 1  57 PHE HZ   .  57 . HZ   1 1 
       1991 1 1 1 1   7 VAL MG2  .   7 . HG2* 1 1 
       1991 1 2 1 1  57 PHE HZ   .  57 . HZ   1 1 
       1992 1 1 1 1  69 PHE QD   .  69 . HD*  1 1 
       1992 1 2 1 1  70 GLN HG3  .  70 . HG1  1 1 
       1993 1 1 1 1  69 PHE QD   .  69 . HD*  1 1 
       1993 1 2 1 1  70 GLN HG2  .  70 . HG2  1 1 
       1994 1 1 1 1  40 ILE HG13 .  40 . HG11 1 1 
       1994 1 2 1 1  69 PHE QD   .  69 . HD*  1 1 
       1995 1 1 1 1  69 PHE QD   .  69 . HD*  1 1 
       1995 1 2 1 1  73 ALA MB   .  73 . HB*  1 1 
       1996 1 1 1 1  40 ILE MG   .  40 . HG2* 1 1 
       1996 1 2 1 1  69 PHE QD   .  69 . HD*  1 1 
       1997 1 1 1 1  40 ILE MD   .  40 . HD1* 1 1 
       1997 1 2 1 1  69 PHE QD   .  69 . HD*  1 1 
       1998 1 1 1 1  69 PHE QE   .  69 . HE*  1 1 
       1998 1 2 1 1  80 TYR HB2  .  80 . HB2  1 1 
       1999 1 1 1 1  69 PHE QE   .  69 . HE*  1 1 
       1999 1 2 1 1  80 TYR HB3  .  80 . HB1  1 1 
       2000 1 1 1 1  69 PHE HZ   .  69 . HZ   1 1 
       2000 1 2 1 1  80 TYR HB2  .  80 . HB2  1 1 
       2001 1 1 1 1  69 PHE HZ   .  69 . HZ   1 1 
       2001 1 2 1 1  80 TYR HB3  .  80 . HB1  1 1 
       2002 1 1 1 1  43 ILE HB   .  43 . HB   1 1 
       2002 1 2 1 1  69 PHE QE   .  69 . HE*  1 1 
       2003 1 1 1 1  47 MET ME   .  47 . HE*  1 1 
       2003 1 2 1 1  69 PHE QE   .  69 . HE*  1 1 
       2004 1 1 1 1  69 PHE QE   .  69 . HE*  1 1 
       2004 1 2 1 1  73 ALA MB   .  73 . HB*  1 1 
       2005 1 1 1 1   4 VAL MG1  .   4 . HG1* 1 1 
       2005 1 2 1 1  69 PHE QE   .  69 . HE*  1 1 
       2006 1 1 1 1  56 VAL MG1  .  56 . HG1* 1 1 
       2006 1 2 1 1  69 PHE QE   .  69 . HE*  1 1 
       2007 1 1 1 1   4 VAL HB   .   4 . HB   1 1 
       2007 1 2 1 1  69 PHE HZ   .  69 . HZ   1 1 
       2008 1 1 1 1   4 VAL MG2  .   4 . HG2* 1 1 
       2008 1 2 1 1  69 PHE HZ   .  69 . HZ   1 1 
       2009 1 1 1 1   4 VAL MG1  .   4 . HG1* 1 1 
       2009 1 2 1 1  69 PHE HZ   .  69 . HZ   1 1 
       2010 1 1 1 1  44 ILE MD   .  44 . HD1* 1 1 
       2010 1 2 1 1  69 PHE HZ   .  69 . HZ   1 1 
       2011 1 1 1 1   6 LEU MD1  .   6 . HD1* 1 1 
       2011 1 2 1 1  69 PHE HZ   .  69 . HZ   1 1 
       2012 1 1 1 1  80 TYR QD   .  80 . HD*  1 1 
       2012 1 2 1 1  81 ASP H    .  81 . HN   1 1 
       2013 1 1 1 1  80 TYR QD   .  80 . HD*  1 1 
       2013 1 2 1 1  81 ASP HA   .  81 . HA   1 1 
       2014 1 1 1 1  79 SER HA   .  79 . HA   1 1 
       2014 1 2 1 1  80 TYR QD   .  80 . HD*  1 1 
       2015 1 1 1 1  74 LYS HG2  .  74 . HG2  1 1 
       2015 1 2 1 1  80 TYR QE   .  80 . HE*  1 1 
       2016 1 1 1 1  74 LYS HG3  .  74 . HG1  1 1 
       2016 1 2 1 1  80 TYR QE   .  80 . HE*  1 1 
       2017 1 1 1 1  73 ALA MB   .  73 . HB*  1 1 
       2017 1 2 1 1  80 TYR QE   .  80 . HE*  1 1 
       2018 1 1 1 1  78 VAL HB   .  78 . HB   1 1 
       2018 1 2 1 1  80 TYR QD   .  80 . HD*  1 1 
       2019 1 1 1 1  73 ALA MB   .  73 . HB*  1 1 
       2019 1 2 1 1  80 TYR QD   .  80 . HD*  1 1 
       2020 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       2020 1 2 1 1  80 TYR QD   .  80 . HD*  1 1 
       2021 1 1 1 1   6 LEU MD1  .   6 . HD1* 1 1 
       2021 1 2 1 1  80 TYR QD   .  80 . HD*  1 1 
       2022 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       2022 1 2 1 1  80 TYR QE   .  80 . HE*  1 1 
       2023 1 1 1 1  98 PHE QD   .  98 . HD*  1 1 
       2023 1 2 1 1  99 LEU HG   .  99 . HG   1 1 
       2024 1 1 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       2024 1 2 1 1  98 PHE QD   .  98 . HD*  1 1 
       2025 1 1 1 1  98 PHE QE   .  98 . HE*  1 1 
       2025 1 2 1 1  99 LEU HG   .  99 . HG   1 1 
       2026 1 1 1 1  98 PHE QE   .  98 . HE*  1 1 
       2026 1 2 1 1  99 LEU MD2  .  99 . HD2* 1 1 
       2027 1 1 1 1  98 PHE QD   .  98 . HD*  1 1 
       2027 1 2 1 1  99 LEU MD2  .  99 . HD2* 1 1 
       2028 1 1 1 1   5 LEU MD1  .   5 . HD1* 1 1 
       2028 1 2 1 1  98 PHE QD   .  98 . HD*  1 1 
       2029 1 1 1 1  69 PHE QD   .  69 . HD*  1 1 
       2029 1 2 1 1  70 GLN HA   .  70 . HA   1 1 
       2030 1 1 1 1  70 GLN HB3  .  70 . HB1  1 1 
       2030 1 2 1 1  80 TYR QE   .  80 . HE*  1 1 
       2031 1 1 1 1   4 VAL MG2  .   4 . HG2* 1 1 
       2031 1 2 1 1  98 PHE HZ   .  98 . HZ   1 1 
       2032 1 1 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       2032 1 2 1 1  98 PHE HZ   .  98 . HZ   1 1 
       2033 1 1 1 1  26 TYR QE   .  26 . HE*  1 1 
       2033 1 2 1 1  96 ARG H    .  96 . HN   1 1 
       2034 1 1 1 1  26 TYR QE   .  26 . HE*  1 1 
       2034 1 2 1 1  99 LEU MD2  .  99 . HD2* 1 1 
       2035 1 1 1 1  26 TYR QD   .  26 . HD*  1 1 
       2035 1 2 1 1  99 LEU MD2  .  99 . HD2* 1 1 
       2036 1 1 1 1  80 TYR H    .  80 . HN   1 1 
       2036 1 2 1 1  80 TYR QE   .  80 . HE*  1 1 
       2037 1 1 1 1  19 GLN H    .  19 . HN   1 1 
       2037 1 2 1 1  57 PHE QE   .  57 . HE*  1 1 
       2038 1 1 1 1  32 ARG H    .  32 . HN   1 1 
       2038 1 2 1 1  57 PHE QD   .  57 . HD*  1 1 
       2039 1 1 1 1  18 VAL MG2  .  18 . HG2* 1 1 
       2039 1 2 1 1  57 PHE QE   .  57 . HE*  1 1 
       2040 1 1 1 1  47 MET ME   .  47 . HE*  1 1 
       2040 1 2 1 1  69 PHE HZ   .  69 . HZ   1 1 
       2041 1 1 1 1  21 ARG HA   .  21 . HA   1 1 
       2041 1 2 1 1  24 HIS HD2  .  24 . HD2  1 1 
       2042 1 1 1 1  15 ILE HA   .  15 . HA   1 1 
       2042 1 2 1 1  57 PHE QD   .  57 . HD*  1 1 
       2043 1 1 1 1  95 VAL HA   .  95 . HA   1 1 
       2043 1 2 1 1  98 PHE QD   .  98 . HD*  1 1 
       2044 1 1 1 1   2 GLY QA   .   2 . HA*  1 1 
       2044 1 2 1 1  53 PRO HA   .  53 . HA   1 1 
       2045 1 1 1 1   3 LYS HA   .   3 . HA   1 1 
       2045 1 2 1 1   3 LYS QG   .   3 . HG*  1 1 
       2046 1 1 1 1   3 LYS HA   .   3 . HA   1 1 
       2046 1 2 1 1   3 LYS QD   .   3 . HD*  1 1 
       2047 1 1 1 1   3 LYS HA   .   3 . HA   1 1 
       2047 1 2 1 1   3 LYS QE   .   3 . HE*  1 1 
       2048 1 1 1 1   3 LYS HA   .   3 . HA   1 1 
       2048 1 2 1 1  79 SER QB   .  79 . HB*  1 1 
       2049 1 1 1 1   3 LYS HA   .   3 . HA   1 1 
       2049 1 2 1 1  80 TYR QB   .  80 . HB*  1 1 
       2050 1 1 1 1   3 LYS QB   .   3 . HB*  1 1 
       2050 1 2 1 1   3 LYS QD   .   3 . HD*  1 1 
       2051 1 1 1 1   3 LYS QB   .   3 . HB*  1 1 
       2051 1 2 1 1   3 LYS QE   .   3 . HE*  1 1 
       2052 1 1 1 1   3 LYS QB   .   3 . HB*  1 1 
       2052 1 2 1 1   4 VAL H    .   4 . HN   1 1 
       2053 1 1 1 1   3 LYS QB   .   3 . HB*  1 1 
       2053 1 2 1 1  53 PRO HA   .  53 . HA   1 1 
       2054 1 1 1 1   3 LYS QB   .   3 . HB*  1 1 
       2054 1 2 1 1  54 LEU H    .  54 . HN   1 1 
       2055 1 1 1 1   3 LYS QB   .   3 . HB*  1 1 
       2055 1 2 1 1  78 VAL MG1  .  78 . HG1* 1 1 
       2056 1 1 1 1   3 LYS QB   .   3 . HB*  1 1 
       2056 1 2 1 1  79 SER QB   .  79 . HB*  1 1 
       2057 1 1 1 1   3 LYS QB   .   3 . HB*  1 1 
       2057 1 2 1 1  98 PHE QD   .  98 . HD*  1 1 
       2058 1 1 1 1   3 LYS QB   .   3 . HB*  1 1 
       2058 1 2 1 1  98 PHE QE   .  98 . HE*  1 1 
       2059 1 1 1 1   3 LYS QB   .   3 . HB*  1 1 
       2059 1 2 1 1 102 ALA HA   . 102 . HA   1 1 
       2060 1 1 1 1   3 LYS QB   .   3 . HB*  1 1 
       2060 1 2 1 1 102 ALA MB   . 102 . HB*  1 1 
       2061 1 1 1 1   3 LYS QE   .   3 . HE*  1 1 
       2061 1 2 1 1   3 LYS QG   .   3 . HG*  1 1 
       2062 1 1 1 1   3 LYS QG   .   3 . HG*  1 1 
       2062 1 2 1 1   4 VAL H    .   4 . HN   1 1 
       2063 1 1 1 1   3 LYS QG   .   3 . HG*  1 1 
       2063 1 2 1 1  53 PRO HA   .  53 . HA   1 1 
       2064 1 1 1 1   3 LYS QG   .   3 . HG*  1 1 
       2064 1 2 1 1  53 PRO QB   .  53 . HB*  1 1 
       2065 1 1 1 1   3 LYS QG   .   3 . HG*  1 1 
       2065 1 2 1 1  79 SER QB   .  79 . HB*  1 1 
       2066 1 1 1 1   3 LYS QG   .   3 . HG*  1 1 
       2066 1 2 1 1  98 PHE HZ   .  98 . HZ   1 1 
       2067 1 1 1 1   3 LYS QD   .   3 . HD*  1 1 
       2067 1 2 1 1  79 SER QB   .  79 . HB*  1 1 
       2068 1 1 1 1   3 LYS QD   .   3 . HD*  1 1 
       2068 1 2 1 1  98 PHE QE   .  98 . HE*  1 1 
       2069 1 1 1 1   3 LYS QD   .   3 . HD*  1 1 
       2069 1 2 1 1 102 ALA HA   . 102 . HA   1 1 
       2070 1 1 1 1   3 LYS QD   .   3 . HD*  1 1 
       2070 1 2 1 1 102 ALA MB   . 102 . HB*  1 1 
       2071 1 1 1 1   3 LYS QE   .   3 . HE*  1 1 
       2071 1 2 1 1  79 SER QB   .  79 . HB*  1 1 
       2072 1 1 1 1   3 LYS QE   .   3 . HE*  1 1 
       2072 1 2 1 1  98 PHE QE   .  98 . HE*  1 1 
       2073 1 1 1 1   3 LYS QE   .   3 . HE*  1 1 
       2073 1 2 1 1 102 ALA MB   . 102 . HB*  1 1 
       2074 1 1 1 1   4 VAL H    .   4 . HN   1 1 
       2074 1 2 1 1  80 TYR QB   .  80 . HB*  1 1 
       2075 1 1 1 1   4 VAL HA   .   4 . HA   1 1 
       2075 1 2 1 1  54 LEU QB   .  54 . HB*  1 1 
       2076 1 1 1 1   4 VAL HB   .   4 . HB   1 1 
       2076 1 2 1 1  54 LEU QB   .  54 . HB*  1 1 
       2077 1 1 1 1   4 VAL HB   .   4 . HB   1 1 
       2077 1 2 1 1  80 TYR QB   .  80 . HB*  1 1 
       2078 1 1 1 1   4 VAL MG1  .   4 . HG1* 1 1 
       2078 1 2 1 1   6 LEU QB   .   6 . HB*  1 1 
       2079 1 1 1 1   4 VAL MG1  .   4 . HG1* 1 1 
       2079 1 2 1 1  80 TYR QB   .  80 . HB*  1 1 
       2080 1 1 1 1   4 VAL MG2  .   4 . HG2* 1 1 
       2080 1 2 1 1  32 ARG QG   .  32 . HG*  1 1 
       2081 1 1 1 1   4 VAL MG2  .   4 . HG2* 1 1 
       2081 1 2 1 1  47 MET QB   .  47 . HB*  1 1 
       2082 1 1 1 1   4 VAL MG2  .   4 . HG2* 1 1 
       2082 1 2 1 1  47 MET QG   .  47 . HG*  1 1 
       2083 1 1 1 1   4 VAL MG2  .   4 . HG2* 1 1 
       2083 1 2 1 1  54 LEU QB   .  54 . HB*  1 1 
       2084 1 1 1 1   4 VAL MG2  .   4 . HG2* 1 1 
       2084 1 2 1 1  80 TYR QB   .  80 . HB*  1 1 
       2085 1 1 1 1   5 LEU H    .   5 . HN   1 1 
       2085 1 2 1 1   5 LEU QB   .   5 . HB*  1 1 
       2086 1 1 1 1   5 LEU HA   .   5 . HA   1 1 
       2086 1 2 1 1   6 LEU QB   .   6 . HB*  1 1 
       2087 1 1 1 1   5 LEU HA   .   5 . HA   1 1 
       2087 1 2 1 1  81 ASP QB   .  81 . HB*  1 1 
       2088 1 1 1 1   5 LEU QB   .   5 . HB*  1 1 
       2088 1 2 1 1   5 LEU HG   .   5 . HG   1 1 
       2089 1 1 1 1   5 LEU QB   .   5 . HB*  1 1 
       2089 1 2 1 1   5 LEU MD2  .   5 . HD2* 1 1 
       2090 1 1 1 1   5 LEU QB   .   5 . HB*  1 1 
       2090 1 2 1 1   6 LEU H    .   6 . HN   1 1 
       2091 1 1 1 1   5 LEU QB   .   5 . HB*  1 1 
       2091 1 2 1 1   7 VAL MG2  .   7 . HG2* 1 1 
       2092 1 1 1 1   5 LEU QB   .   5 . HB*  1 1 
       2092 1 2 1 1  55 VAL HA   .  55 . HA   1 1 
       2093 1 1 1 1   5 LEU QB   .   5 . HB*  1 1 
       2093 1 2 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       2094 1 1 1 1   5 LEU QB   .   5 . HB*  1 1 
       2094 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       2095 1 1 1 1   5 LEU QB   .   5 . HB*  1 1 
       2095 1 2 1 1  56 VAL H    .  56 . HN   1 1 
       2096 1 1 1 1   5 LEU QB   .   5 . HB*  1 1 
       2096 1 2 1 1  81 ASP QB   .  81 . HB*  1 1 
       2097 1 1 1 1   5 LEU QB   .   5 . HB*  1 1 
       2097 1 2 1 1  95 VAL HA   .  95 . HA   1 1 
       2098 1 1 1 1   5 LEU QB   .   5 . HB*  1 1 
       2098 1 2 1 1  98 PHE QE   .  98 . HE*  1 1 
       2099 1 1 1 1   5 LEU HG   .   5 . HG   1 1 
       2099 1 2 1 1  81 ASP QB   .  81 . HB*  1 1 
       2100 1 1 1 1   5 LEU MD1  .   5 . HD1* 1 1 
       2100 1 2 1 1  81 ASP QB   .  81 . HB*  1 1 
       2101 1 1 1 1   5 LEU MD1  .   5 . HD1* 1 1 
       2101 1 2 1 1  83 LEU QB   .  83 . HB*  1 1 
       2102 1 1 1 1   5 LEU MD1  .   5 . HD1* 1 1 
       2102 1 2 1 1  94 ARG QB   .  94 . HB*  1 1 
       2103 1 1 1 1   5 LEU MD1  .   5 . HD1* 1 1 
       2103 1 2 1 1  94 ARG QG   .  94 . HG*  1 1 
       2104 1 1 1 1   5 LEU MD1  .   5 . HD1* 1 1 
       2104 1 2 1 1  94 ARG QD   .  94 . HD*  1 1 
       2105 1 1 1 1   5 LEU MD1  .   5 . HD1* 1 1 
       2105 1 2 1 1  98 PHE QB   .  98 . HB*  1 1 
       2106 1 1 1 1   5 LEU MD2  .   5 . HD2* 1 1 
       2106 1 2 1 1  81 ASP QB   .  81 . HB*  1 1 
       2107 1 1 1 1   5 LEU MD2  .   5 . HD2* 1 1 
       2107 1 2 1 1  83 LEU QB   .  83 . HB*  1 1 
       2108 1 1 1 1   5 LEU MD2  .   5 . HD2* 1 1 
       2108 1 2 1 1  94 ARG QB   .  94 . HB*  1 1 
       2109 1 1 1 1   5 LEU MD2  .   5 . HD2* 1 1 
       2109 1 2 1 1  94 ARG QG   .  94 . HG*  1 1 
       2110 1 1 1 1   5 LEU MD2  .   5 . HD2* 1 1 
       2110 1 2 1 1  94 ARG QD   .  94 . HD*  1 1 
       2111 1 1 1 1   5 LEU MD2  .   5 . HD2* 1 1 
       2111 1 2 1 1  98 PHE QB   .  98 . HB*  1 1 
       2112 1 1 1 1   6 LEU H    .   6 . HN   1 1 
       2112 1 2 1 1   6 LEU QB   .   6 . HB*  1 1 
       2113 1 1 1 1   6 LEU H    .   6 . HN   1 1 
       2113 1 2 1 1  80 TYR QB   .  80 . HB*  1 1 
       2114 1 1 1 1   6 LEU H    .   6 . HN   1 1 
       2114 1 2 1 1  81 ASP QB   .  81 . HB*  1 1 
       2115 1 1 1 1   6 LEU QB   .   6 . HB*  1 1 
       2115 1 2 1 1   8 ILE MD   .   8 . HD1* 1 1 
       2116 1 1 1 1   6 LEU QB   .   6 . HB*  1 1 
       2116 1 2 1 1  69 PHE QD   .  69 . HD*  1 1 
       2117 1 1 1 1   6 LEU QB   .   6 . HB*  1 1 
       2117 1 2 1 1  80 TYR QB   .  80 . HB*  1 1 
       2118 1 1 1 1   6 LEU QB   .   6 . HB*  1 1 
       2118 1 2 1 1  80 TYR QD   .  80 . HD*  1 1 
       2119 1 1 1 1   6 LEU QB   .   6 . HB*  1 1 
       2119 1 2 1 1  80 TYR QE   .  80 . HE*  1 1 
       2120 1 1 1 1   6 LEU QB   .   6 . HB*  1 1 
       2120 1 2 1 1  82 VAL HA   .  82 . HA   1 1 
       2121 1 1 1 1   6 LEU QB   .   6 . HB*  1 1 
       2121 1 2 1 1  82 VAL MG1  .  82 . HG1* 1 1 
       2122 1 1 1 1   6 LEU QB   .   6 . HB*  1 1 
       2122 1 2 1 1  82 VAL MG2  .  82 . HG2* 1 1 
       2123 1 1 1 1   6 LEU HG   .   6 . HG   1 1 
       2123 1 2 1 1   8 ILE QG   .   8 . HG1* 1 1 
       2124 1 1 1 1   6 LEU HG   .   6 . HG   1 1 
       2124 1 2 1 1  84 LYS QE   .  84 . HE*  1 1 
       2125 1 1 1 1   6 LEU MD1  .   6 . HD1* 1 1 
       2125 1 2 1 1   8 ILE QG   .   8 . HG1* 1 1 
       2126 1 1 1 1   6 LEU MD1  .   6 . HD1* 1 1 
       2126 1 2 1 1  69 PHE QB   .  69 . HB*  1 1 
       2127 1 1 1 1   6 LEU MD1  .   6 . HD1* 1 1 
       2127 1 2 1 1  84 LYS QE   .  84 . HE*  1 1 
       2128 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       2128 1 2 1 1  69 PHE QB   .  69 . HB*  1 1 
       2129 1 1 1 1   6 LEU MD2  .   6 . HD2* 1 1 
       2129 1 2 1 1  70 GLN QG   .  70 . HG*  1 1 
       2130 1 1 1 1   7 VAL HA   .   7 . HA   1 1 
       2130 1 2 1 1   8 ILE QG   .   8 . HG1* 1 1 
       2131 1 1 1 1   7 VAL HA   .   7 . HA   1 1 
       2131 1 2 1 1  83 LEU QB   .  83 . HB*  1 1 
       2132 1 1 1 1   7 VAL MG1  .   7 . HG1* 1 1 
       2132 1 2 1 1   9 SER QB   .   9 . HB*  1 1 
       2133 1 1 1 1   7 VAL MG1  .   7 . HG1* 1 1 
       2133 1 2 1 1  83 LEU QB   .  83 . HB*  1 1 
       2134 1 1 1 1   7 VAL MG1  .   7 . HG1* 1 1 
       2134 1 2 1 1  85 SER QB   .  85 . HB*  1 1 
       2135 1 1 1 1   7 VAL MG2  .   7 . HG2* 1 1 
       2135 1 2 1 1  19 GLN QB   .  19 . HB*  1 1 
       2136 1 1 1 1   7 VAL MG2  .   7 . HG2* 1 1 
       2136 1 2 1 1  83 LEU QB   .  83 . HB*  1 1 
       2137 1 1 1 1   8 ILE H    .   8 . HN   1 1 
       2137 1 2 1 1   8 ILE QG   .   8 . HG1* 1 1 
       2138 1 1 1 1   8 ILE H    .   8 . HN   1 1 
       2138 1 2 1 1  84 LYS QB   .  84 . HB*  1 1 
       2139 1 1 1 1   8 ILE H    .   8 . HN   1 1 
       2139 1 2 1 1  84 LYS QG   .  84 . HG*  1 1 
       2140 1 1 1 1   8 ILE HA   .   8 . HA   1 1 
       2140 1 2 1 1   8 ILE QG   .   8 . HG1* 1 1 
       2141 1 1 1 1   8 ILE HA   .   8 . HA   1 1 
       2141 1 2 1 1  60 GLY QA   .  60 . HA*  1 1 
       2142 1 1 1 1   8 ILE HB   .   8 . HB   1 1 
       2142 1 2 1 1  84 LYS QG   .  84 . HG*  1 1 
       2143 1 1 1 1   8 ILE HB   .   8 . HB   1 1 
       2143 1 2 1 1  84 LYS QE   .  84 . HE*  1 1 
       2144 1 1 1 1   8 ILE QG   .   8 . HG1* 1 1 
       2144 1 2 1 1   8 ILE MG   .   8 . HG2* 1 1 
       2145 1 1 1 1   8 ILE MG   .   8 . HG2* 1 1 
       2145 1 2 1 1  60 GLY QA   .  60 . HA*  1 1 
       2146 1 1 1 1   8 ILE MG   .   8 . HG2* 1 1 
       2146 1 2 1 1  84 LYS QG   .  84 . HG*  1 1 
       2147 1 1 1 1   8 ILE MG   .   8 . HG2* 1 1 
       2147 1 2 1 1  84 LYS QD   .  84 . HD*  1 1 
       2148 1 1 1 1   8 ILE MG   .   8 . HG2* 1 1 
       2148 1 2 1 1  84 LYS QE   .  84 . HE*  1 1 
       2149 1 1 1 1   8 ILE QG   .   8 . HG1* 1 1 
       2149 1 2 1 1   9 SER H    .   9 . HN   1 1 
       2150 1 1 1 1   8 ILE QG   .   8 . HG1* 1 1 
       2150 1 2 1 1  58 VAL H    .  58 . HN   1 1 
       2151 1 1 1 1   8 ILE QG   .   8 . HG1* 1 1 
       2151 1 2 1 1  58 VAL HB   .  58 . HB   1 1 
       2152 1 1 1 1   8 ILE QG   .   8 . HG1* 1 1 
       2152 1 2 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       2153 1 1 1 1   8 ILE QG   .   8 . HG1* 1 1 
       2153 1 2 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       2154 1 1 1 1   8 ILE QG   .   8 . HG1* 1 1 
       2154 1 2 1 1  82 VAL MG1  .  82 . HG1* 1 1 
       2155 1 1 1 1   8 ILE QG   .   8 . HG1* 1 1 
       2155 1 2 1 1  83 LEU H    .  83 . HN   1 1 
       2156 1 1 1 1   8 ILE QG   .   8 . HG1* 1 1 
       2156 1 2 1 1  84 LYS HA   .  84 . HA   1 1 
       2157 1 1 1 1   8 ILE QG   .   8 . HG1* 1 1 
       2157 1 2 1 1  84 LYS QB   .  84 . HB*  1 1 
       2158 1 1 1 1   8 ILE MD   .   8 . HD1* 1 1 
       2158 1 2 1 1  60 GLY QA   .  60 . HA*  1 1 
       2159 1 1 1 1   8 ILE MD   .   8 . HD1* 1 1 
       2159 1 2 1 1  84 LYS QB   .  84 . HB*  1 1 
       2160 1 1 1 1   8 ILE MD   .   8 . HD1* 1 1 
       2160 1 2 1 1  84 LYS QG   .  84 . HG*  1 1 
       2161 1 1 1 1   8 ILE MD   .   8 . HD1* 1 1 
       2161 1 2 1 1  84 LYS QD   .  84 . HD*  1 1 
       2162 1 1 1 1   8 ILE MD   .   8 . HD1* 1 1 
       2162 1 2 1 1  84 LYS QE   .  84 . HE*  1 1 
       2163 1 1 1 1   9 SER H    .   9 . HN   1 1 
       2163 1 2 1 1   9 SER QB   .   9 . HB*  1 1 
       2164 1 1 1 1   9 SER H    .   9 . HN   1 1 
       2164 1 2 1 1  15 ILE QG   .  15 . HG1* 1 1 
       2165 1 1 1 1   9 SER H    .   9 . HN   1 1 
       2165 1 2 1 1  84 LYS QG   .  84 . HG*  1 1 
       2166 1 1 1 1   9 SER HA   .   9 . HA   1 1 
       2166 1 2 1 1  84 LYS QG   .  84 . HG*  1 1 
       2167 1 1 1 1   9 SER QB   .   9 . HB*  1 1 
       2167 1 2 1 1  14 ILE HB   .  14 . HB   1 1 
       2168 1 1 1 1   9 SER QB   .   9 . HB*  1 1 
       2168 1 2 1 1  15 ILE H    .  15 . HN   1 1 
       2169 1 1 1 1   9 SER QB   .   9 . HB*  1 1 
       2169 1 2 1 1  15 ILE HB   .  15 . HB   1 1 
       2170 1 1 1 1   9 SER QB   .   9 . HB*  1 1 
       2170 1 2 1 1  15 ILE MG   .  15 . HG2* 1 1 
       2171 1 1 1 1   9 SER QB   .   9 . HB*  1 1 
       2171 1 2 1 1  15 ILE QG   .  15 . HG1* 1 1 
       2172 1 1 1 1   9 SER QB   .   9 . HB*  1 1 
       2172 1 2 1 1  15 ILE MD   .  15 . HD1* 1 1 
       2173 1 1 1 1   9 SER QB   .   9 . HB*  1 1 
       2173 1 2 1 1  86 THR HA   .  86 . HA   1 1 
       2174 1 1 1 1   9 SER QB   .   9 . HB*  1 1 
       2174 1 2 1 1  86 THR MG   .  86 . HG2* 1 1 
       2175 1 1 1 1   9 SER QB   .   9 . HB*  1 1 
       2175 1 2 1 1  91 LEU MD1  .  91 . HD1* 1 1 
       2176 1 1 1 1   9 SER QB   .   9 . HB*  1 1 
       2176 1 2 1 1  91 LEU MD2  .  91 . HD2* 1 1 
       2177 1 1 1 1  11 ASP QB   .  11 . HB*  1 1 
       2177 1 2 1 1  14 ILE H    .  14 . HN   1 1 
       2178 1 1 1 1  11 ASP QB   .  11 . HB*  1 1 
       2178 1 2 1 1  14 ILE HA   .  14 . HA   1 1 
       2179 1 1 1 1  11 ASP QB   .  11 . HB*  1 1 
       2179 1 2 1 1  14 ILE HB   .  14 . HB   1 1 
       2180 1 1 1 1  11 ASP QB   .  11 . HB*  1 1 
       2180 1 2 1 1  14 ILE MG   .  14 . HG2* 1 1 
       2181 1 1 1 1  11 ASP QB   .  11 . HB*  1 1 
       2181 1 2 1 1  14 ILE QG   .  14 . HG1* 1 1 
       2182 1 1 1 1  11 ASP QB   .  11 . HB*  1 1 
       2182 1 2 1 1  86 THR HB   .  86 . HB   1 1 
       2183 1 1 1 1  11 ASP QB   .  11 . HB*  1 1 
       2183 1 2 1 1  86 THR MG   .  86 . HG2* 1 1 
       2184 1 1 1 1  12 THR HA   .  12 . HA   1 1 
       2184 1 2 1 1  15 ILE QG   .  15 . HG1* 1 1 
       2185 1 1 1 1  12 THR MG   .  12 . HG2* 1 1 
       2185 1 2 1 1  15 ILE QG   .  15 . HG1* 1 1 
       2186 1 1 1 1  12 THR MG   .  12 . HG2* 1 1 
       2186 1 2 1 1  59 ASN QB   .  59 . HB*  1 1 
       2187 1 1 1 1  13 ASN H    .  13 . HN   1 1 
       2187 1 2 1 1  13 ASN QB   .  13 . HB*  1 1 
       2188 1 1 1 1  13 ASN H    .  13 . HN   1 1 
       2188 1 2 1 1  14 ILE QG   .  14 . HG1* 1 1 
       2189 1 1 1 1  13 ASN HA   .  13 . HA   1 1 
       2189 1 2 1 1  16 SER QB   .  16 . HB*  1 1 
       2190 1 1 1 1  13 ASN QB   .  13 . HB*  1 1 
       2190 1 2 1 1  14 ILE H    .  14 . HN   1 1 
       2191 1 1 1 1  13 ASN QB   .  13 . HB*  1 1 
       2191 1 2 1 1  14 ILE HA   .  14 . HA   1 1 
       2192 1 1 1 1  14 ILE HA   .  14 . HA   1 1 
       2192 1 2 1 1  14 ILE QG   .  14 . HG1* 1 1 
       2193 1 1 1 1  14 ILE HA   .  14 . HA   1 1 
       2193 1 2 1 1  88 PRO QB   .  88 . HB*  1 1 
       2194 1 1 1 1  14 ILE HA   .  14 . HA   1 1 
       2194 1 2 1 1  88 PRO QD   .  88 . HD*  1 1 
       2195 1 1 1 1  14 ILE QG   .  14 . HG1* 1 1 
       2195 1 2 1 1  14 ILE MG   .  14 . HG2* 1 1 
       2196 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
       2196 1 2 1 1  88 PRO QB   .  88 . HB*  1 1 
       2197 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
       2197 1 2 1 1  88 PRO QG   .  88 . HG*  1 1 
       2198 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
       2198 1 2 1 1  88 PRO QD   .  88 . HD*  1 1 
       2199 1 1 1 1  14 ILE MG   .  14 . HG2* 1 1 
       2199 1 2 1 1  91 LEU QB   .  91 . HB*  1 1 
       2200 1 1 1 1  14 ILE QG   .  14 . HG1* 1 1 
       2200 1 2 1 1  15 ILE H    .  15 . HN   1 1 
       2201 1 1 1 1  14 ILE QG   .  14 . HG1* 1 1 
       2201 1 2 1 1  15 ILE QG   .  15 . HG1* 1 1 
       2202 1 1 1 1  14 ILE QG   .  14 . HG1* 1 1 
       2202 1 2 1 1  86 THR HA   .  86 . HA   1 1 
       2203 1 1 1 1  14 ILE QG   .  14 . HG1* 1 1 
       2203 1 2 1 1  86 THR HB   .  86 . HB   1 1 
       2204 1 1 1 1  14 ILE QG   .  14 . HG1* 1 1 
       2204 1 2 1 1  88 PRO QB   .  88 . HB*  1 1 
       2205 1 1 1 1  14 ILE QG   .  14 . HG1* 1 1 
       2205 1 2 1 1  88 PRO QG   .  88 . HG*  1 1 
       2206 1 1 1 1  14 ILE QG   .  14 . HG1* 1 1 
       2206 1 2 1 1  88 PRO QD   .  88 . HD*  1 1 
       2207 1 1 1 1  14 ILE MD   .  14 . HD1* 1 1 
       2207 1 2 1 1  88 PRO QB   .  88 . HB*  1 1 
       2208 1 1 1 1  14 ILE MD   .  14 . HD1* 1 1 
       2208 1 2 1 1  88 PRO QG   .  88 . HG*  1 1 
       2209 1 1 1 1  14 ILE MD   .  14 . HD1* 1 1 
       2209 1 2 1 1  88 PRO QD   .  88 . HD*  1 1 
       2210 1 1 1 1  15 ILE H    .  15 . HN   1 1 
       2210 1 2 1 1  15 ILE QG   .  15 . HG1* 1 1 
       2211 1 1 1 1  15 ILE H    .  15 . HN   1 1 
       2211 1 2 1 1  16 SER QB   .  16 . HB*  1 1 
       2212 1 1 1 1  15 ILE MG   .  15 . HG2* 1 1 
       2212 1 2 1 1  19 GLN QB   .  19 . HB*  1 1 
       2213 1 1 1 1  15 ILE MG   .  15 . HG2* 1 1 
       2213 1 2 1 1  19 GLN QE   .  19 . HE*  1 1 
       2214 1 1 1 1  15 ILE MG   .  15 . HG2* 1 1 
       2214 1 2 1 1  57 PHE QB   .  57 . HB*  1 1 
       2215 1 1 1 1  15 ILE MG   .  15 . HG2* 1 1 
       2215 1 2 1 1  59 ASN QB   .  59 . HB*  1 1 
       2216 1 1 1 1  15 ILE QG   .  15 . HG1* 1 1 
       2216 1 2 1 1  16 SER H    .  16 . HN   1 1 
       2217 1 1 1 1  15 ILE QG   .  15 . HG1* 1 1 
       2217 1 2 1 1  57 PHE QD   .  57 . HD*  1 1 
       2218 1 1 1 1  15 ILE QG   .  15 . HG1* 1 1 
       2218 1 2 1 1  91 LEU MD1  .  91 . HD1* 1 1 
       2219 1 1 1 1  15 ILE MD   .  15 . HD1* 1 1 
       2219 1 2 1 1  57 PHE QB   .  57 . HB*  1 1 
       2220 1 1 1 1  15 ILE MD   .  15 . HD1* 1 1 
       2220 1 2 1 1  59 ASN QB   .  59 . HB*  1 1 
       2221 1 1 1 1  15 ILE MD   .  15 . HD1* 1 1 
       2221 1 2 1 1  60 GLY QA   .  60 . HA*  1 1 
       2222 1 1 1 1  16 SER HA   .  16 . HA   1 1 
       2222 1 2 1 1  19 GLN QB   .  19 . HB*  1 1 
       2223 1 1 1 1  16 SER HA   .  16 . HA   1 1 
       2223 1 2 1 1  19 GLN QG   .  19 . HG*  1 1 
       2224 1 1 1 1  16 SER HA   .  16 . HA   1 1 
       2224 1 2 1 1  19 GLN QE   .  19 . HE*  1 1 
       2225 1 1 1 1  16 SER HA   .  16 . HA   1 1 
       2225 1 2 1 1  20 GLU QB   .  20 . HB*  1 1 
       2226 1 1 1 1  16 SER QB   .  16 . HB*  1 1 
       2226 1 2 1 1  17 SER H    .  17 . HN   1 1 
       2227 1 1 1 1  17 SER H    .  17 . HN   1 1 
       2227 1 2 1 1  17 SER QB   .  17 . HB*  1 1 
       2228 1 1 1 1  17 SER H    .  17 . HN   1 1 
       2228 1 2 1 1  20 GLU QB   .  20 . HB*  1 1 
       2229 1 1 1 1  17 SER HA   .  17 . HA   1 1 
       2229 1 2 1 1  20 GLU QB   .  20 . HB*  1 1 
       2230 1 1 1 1  17 SER HA   .  17 . HA   1 1 
       2230 1 2 1 1  20 GLU QG   .  20 . HG*  1 1 
       2231 1 1 1 1  17 SER QB   .  17 . HB*  1 1 
       2231 1 2 1 1  18 VAL H    .  18 . HN   1 1 
       2232 1 1 1 1  17 SER QB   .  17 . HB*  1 1 
       2232 1 2 1 1  18 VAL HA   .  18 . HA   1 1 
       2233 1 1 1 1  17 SER QB   .  17 . HB*  1 1 
       2233 1 2 1 1  18 VAL HB   .  18 . HB   1 1 
       2234 1 1 1 1  17 SER QB   .  17 . HB*  1 1 
       2234 1 2 1 1  18 VAL MG1  .  18 . HG1* 1 1 
       2235 1 1 1 1  17 SER QB   .  17 . HB*  1 1 
       2235 1 2 1 1  18 VAL MG2  .  18 . HG2* 1 1 
       2236 1 1 1 1  17 SER QB   .  17 . HB*  1 1 
       2236 1 2 1 1  19 GLN H    .  19 . HN   1 1 
       2237 1 1 1 1  17 SER QB   .  17 . HB*  1 1 
       2237 1 2 1 1  88 PRO QB   .  88 . HB*  1 1 
       2238 1 1 1 1  17 SER QB   .  17 . HB*  1 1 
       2238 1 2 1 1  91 LEU MD1  .  91 . HD1* 1 1 
       2239 1 1 1 1  18 VAL H    .  18 . HN   1 1 
       2239 1 2 1 1  19 GLN QB   .  19 . HB*  1 1 
       2240 1 1 1 1  18 VAL H    .  18 . HN   1 1 
       2240 1 2 1 1  21 ARG QG   .  21 . HG*  1 1 
       2241 1 1 1 1  18 VAL HA   .  18 . HA   1 1 
       2241 1 2 1 1  21 ARG QB   .  21 . HB*  1 1 
       2242 1 1 1 1  18 VAL HA   .  18 . HA   1 1 
       2242 1 2 1 1  21 ARG QG   .  21 . HG*  1 1 
       2243 1 1 1 1  18 VAL HA   .  18 . HA   1 1 
       2243 1 2 1 1  21 ARG QD   .  21 . HD*  1 1 
       2244 1 1 1 1  18 VAL MG1  .  18 . HG1* 1 1 
       2244 1 2 1 1  19 GLN QB   .  19 . HB*  1 1 
       2245 1 1 1 1  18 VAL MG1  .  18 . HG1* 1 1 
       2245 1 2 1 1  19 GLN QE   .  19 . HE*  1 1 
       2246 1 1 1 1  18 VAL MG1  .  18 . HG1* 1 1 
       2246 1 2 1 1  21 ARG QG   .  21 . HG*  1 1 
       2247 1 1 1 1  18 VAL MG1  .  18 . HG1* 1 1 
       2247 1 2 1 1  91 LEU QB   .  91 . HB*  1 1 
       2248 1 1 1 1  18 VAL MG1  .  18 . HG1* 1 1 
       2248 1 2 1 1  94 ARG QB   .  94 . HB*  1 1 
       2249 1 1 1 1  18 VAL MG2  .  18 . HG2* 1 1 
       2249 1 2 1 1  21 ARG QG   .  21 . HG*  1 1 
       2250 1 1 1 1  18 VAL MG2  .  18 . HG2* 1 1 
       2250 1 2 1 1  21 ARG QD   .  21 . HD*  1 1 
       2251 1 1 1 1  18 VAL MG2  .  18 . HG2* 1 1 
       2251 1 2 1 1  88 PRO QB   .  88 . HB*  1 1 
       2252 1 1 1 1  19 GLN H    .  19 . HN   1 1 
       2252 1 2 1 1  19 GLN QG   .  19 . HG*  1 1 
       2253 1 1 1 1  19 GLN HA   .  19 . HA   1 1 
       2253 1 2 1 1  19 GLN QG   .  19 . HG*  1 1 
       2254 1 1 1 1  19 GLN QB   .  19 . HB*  1 1 
       2254 1 2 1 1  20 GLU H    .  20 . HN   1 1 
       2255 1 1 1 1  19 GLN QB   .  19 . HB*  1 1 
       2255 1 2 1 1  31 ILE MG   .  31 . HG2* 1 1 
       2256 1 1 1 1  19 GLN QB   .  19 . HB*  1 1 
       2256 1 2 1 1  31 ILE MD   .  31 . HD1* 1 1 
       2257 1 1 1 1  19 GLN QB   .  19 . HB*  1 1 
       2257 1 2 1 1  57 PHE QD   .  57 . HD*  1 1 
       2258 1 1 1 1  19 GLN QB   .  19 . HB*  1 1 
       2258 1 2 1 1  57 PHE QE   .  57 . HE*  1 1 
       2259 1 1 1 1  19 GLN QG   .  19 . HG*  1 1 
       2259 1 2 1 1  20 GLU H    .  20 . HN   1 1 
       2260 1 1 1 1  19 GLN QG   .  19 . HG*  1 1 
       2260 1 2 1 1  20 GLU HA   .  20 . HA   1 1 
       2261 1 1 1 1  19 GLN QG   .  19 . HG*  1 1 
       2261 1 2 1 1  20 GLU QB   .  20 . HB*  1 1 
       2262 1 1 1 1  19 GLN QG   .  19 . HG*  1 1 
       2262 1 2 1 1  20 GLU QG   .  20 . HG*  1 1 
       2263 1 1 1 1  19 GLN QG   .  19 . HG*  1 1 
       2263 1 2 1 1  22 ALA MB   .  22 . HB*  1 1 
       2264 1 1 1 1  19 GLN QG   .  19 . HG*  1 1 
       2264 1 2 1 1  23 LYS H    .  23 . HN   1 1 
       2265 1 1 1 1  19 GLN QG   .  19 . HG*  1 1 
       2265 1 2 1 1  23 LYS QD   .  23 . HD*  1 1 
       2266 1 1 1 1  19 GLN QG   .  19 . HG*  1 1 
       2266 1 2 1 1  31 ILE MG   .  31 . HG2* 1 1 
       2267 1 1 1 1  19 GLN QG   .  19 . HG*  1 1 
       2267 1 2 1 1  31 ILE MD   .  31 . HD1* 1 1 
       2268 1 1 1 1  19 GLN QG   .  19 . HG*  1 1 
       2268 1 2 1 1  57 PHE QD   .  57 . HD*  1 1 
       2269 1 1 1 1  19 GLN QG   .  19 . HG*  1 1 
       2269 1 2 1 1  57 PHE QE   .  57 . HE*  1 1 
       2270 1 1 1 1  19 GLN QG   .  19 . HG*  1 1 
       2270 1 2 1 1  57 PHE HZ   .  57 . HZ   1 1 
       2271 1 1 1 1  19 GLN QE   .  19 . HE*  1 1 
       2271 1 2 1 1  31 ILE MG   .  31 . HG2* 1 1 
       2272 1 1 1 1  19 GLN QE   .  19 . HE*  1 1 
       2272 1 2 1 1  33 THR HB   .  33 . HB   1 1 
       2273 1 1 1 1  19 GLN QE   .  19 . HE*  1 1 
       2273 1 2 1 1  33 THR MG   .  33 . HG2* 1 1 
       2274 1 1 1 1  20 GLU H    .  20 . HN   1 1 
       2274 1 2 1 1  20 GLU QB   .  20 . HB*  1 1 
       2275 1 1 1 1  20 GLU H    .  20 . HN   1 1 
       2275 1 2 1 1  20 GLU QG   .  20 . HG*  1 1 
       2276 1 1 1 1  20 GLU HA   .  20 . HA   1 1 
       2276 1 2 1 1  20 GLU QG   .  20 . HG*  1 1 
       2277 1 1 1 1  20 GLU HA   .  20 . HA   1 1 
       2277 1 2 1 1  23 LYS QB   .  23 . HB*  1 1 
       2278 1 1 1 1  20 GLU HA   .  20 . HA   1 1 
       2278 1 2 1 1  23 LYS QD   .  23 . HD*  1 1 
       2279 1 1 1 1  20 GLU QB   .  20 . HB*  1 1 
       2279 1 2 1 1  21 ARG H    .  21 . HN   1 1 
       2280 1 1 1 1  20 GLU QG   .  20 . HG*  1 1 
       2280 1 2 1 1  21 ARG H    .  21 . HN   1 1 
       2281 1 1 1 1  21 ARG H    .  21 . HN   1 1 
       2281 1 2 1 1  21 ARG QB   .  21 . HB*  1 1 
       2282 1 1 1 1  21 ARG H    .  21 . HN   1 1 
       2282 1 2 1 1  21 ARG QG   .  21 . HG*  1 1 
       2283 1 1 1 1  21 ARG H    .  21 . HN   1 1 
       2283 1 2 1 1  21 ARG QD   .  21 . HD*  1 1 
       2284 1 1 1 1  21 ARG H    .  21 . HN   1 1 
       2284 1 2 1 1  24 HIS QB   .  24 . HB*  1 1 
       2285 1 1 1 1  21 ARG HA   .  21 . HA   1 1 
       2285 1 2 1 1  21 ARG QG   .  21 . HG*  1 1 
       2286 1 1 1 1  21 ARG HA   .  21 . HA   1 1 
       2286 1 2 1 1  21 ARG QD   .  21 . HD*  1 1 
       2287 1 1 1 1  21 ARG HA   .  21 . HA   1 1 
       2287 1 2 1 1  24 HIS QB   .  24 . HB*  1 1 
       2288 1 1 1 1  21 ARG QB   .  21 . HB*  1 1 
       2288 1 2 1 1  21 ARG QD   .  21 . HD*  1 1 
       2289 1 1 1 1  21 ARG QB   .  21 . HB*  1 1 
       2289 1 2 1 1  22 ALA H    .  22 . HN   1 1 
       2290 1 1 1 1  21 ARG QB   .  21 . HB*  1 1 
       2290 1 2 1 1  22 ALA HA   .  22 . HA   1 1 
       2291 1 1 1 1  21 ARG QB   .  21 . HB*  1 1 
       2291 1 2 1 1  22 ALA MB   .  22 . HB*  1 1 
       2292 1 1 1 1  21 ARG QB   .  21 . HB*  1 1 
       2292 1 2 1 1  92 THR MG   .  92 . HG2* 1 1 
       2293 1 1 1 1  21 ARG QG   .  21 . HG*  1 1 
       2293 1 2 1 1  22 ALA H    .  22 . HN   1 1 
       2294 1 1 1 1  21 ARG QG   .  21 . HG*  1 1 
       2294 1 2 1 1  24 HIS QB   .  24 . HB*  1 1 
       2295 1 1 1 1  21 ARG QG   .  21 . HG*  1 1 
       2295 1 2 1 1  92 THR MG   .  92 . HG2* 1 1 
       2296 1 1 1 1  21 ARG QD   .  21 . HD*  1 1 
       2296 1 2 1 1  24 HIS HD2  .  24 . HD2  1 1 
       2297 1 1 1 1  21 ARG QD   .  21 . HD*  1 1 
       2297 1 2 1 1  92 THR MG   .  92 . HG2* 1 1 
       2298 1 1 1 1  22 ALA H    .  22 . HN   1 1 
       2298 1 2 1 1  23 LYS QB   .  23 . HB*  1 1 
       2299 1 1 1 1  22 ALA HA   .  22 . HA   1 1 
       2299 1 2 1 1  25 ASN QB   .  25 . HB*  1 1 
       2300 1 1 1 1  22 ALA MB   .  22 . HB*  1 1 
       2300 1 2 1 1  23 LYS QB   .  23 . HB*  1 1 
       2301 1 1 1 1  22 ALA MB   .  22 . HB*  1 1 
       2301 1 2 1 1  26 TYR QB   .  26 . HB*  1 1 
       2302 1 1 1 1  22 ALA MB   .  22 . HB*  1 1 
       2302 1 2 1 1  31 ILE QG   .  31 . HG1* 1 1 
       2303 1 1 1 1  23 LYS H    .  23 . HN   1 1 
       2303 1 2 1 1  23 LYS QB   .  23 . HB*  1 1 
       2304 1 1 1 1  23 LYS H    .  23 . HN   1 1 
       2304 1 2 1 1  23 LYS QG   .  23 . HG*  1 1 
       2305 1 1 1 1  23 LYS H    .  23 . HN   1 1 
       2305 1 2 1 1  23 LYS QD   .  23 . HD*  1 1 
       2306 1 1 1 1  23 LYS H    .  23 . HN   1 1 
       2306 1 2 1 1  23 LYS QE   .  23 . HE*  1 1 
       2307 1 1 1 1  23 LYS HA   .  23 . HA   1 1 
       2307 1 2 1 1  26 TYR QB   .  26 . HB*  1 1 
       2308 1 1 1 1  23 LYS QB   .  23 . HB*  1 1 
       2308 1 2 1 1  23 LYS QD   .  23 . HD*  1 1 
       2309 1 1 1 1  23 LYS QB   .  23 . HB*  1 1 
       2309 1 2 1 1  23 LYS QE   .  23 . HE*  1 1 
       2310 1 1 1 1  23 LYS QB   .  23 . HB*  1 1 
       2310 1 2 1 1  24 HIS H    .  24 . HN   1 1 
       2311 1 1 1 1  23 LYS QB   .  23 . HB*  1 1 
       2311 1 2 1 1  24 HIS HA   .  24 . HA   1 1 
       2312 1 1 1 1  23 LYS QB   .  23 . HB*  1 1 
       2312 1 2 1 1  24 HIS QB   .  24 . HB*  1 1 
       2313 1 1 1 1  23 LYS QB   .  23 . HB*  1 1 
       2313 1 2 1 1  31 ILE MD   .  31 . HD1* 1 1 
       2314 1 1 1 1  23 LYS QD   .  23 . HD*  1 1 
       2314 1 2 1 1  23 LYS QG   .  23 . HG*  1 1 
       2315 1 1 1 1  23 LYS QE   .  23 . HE*  1 1 
       2315 1 2 1 1  23 LYS QG   .  23 . HG*  1 1 
       2316 1 1 1 1  23 LYS QG   .  23 . HG*  1 1 
       2316 1 2 1 1  24 HIS H    .  24 . HN   1 1 
       2317 1 1 1 1  23 LYS QG   .  23 . HG*  1 1 
       2317 1 2 1 1  31 ILE HB   .  31 . HB   1 1 
       2318 1 1 1 1  23 LYS QG   .  23 . HG*  1 1 
       2318 1 2 1 1  31 ILE QG   .  31 . HG1* 1 1 
       2319 1 1 1 1  23 LYS QG   .  23 . HG*  1 1 
       2319 1 2 1 1  31 ILE MD   .  31 . HD1* 1 1 
       2320 1 1 1 1  23 LYS QD   .  23 . HD*  1 1 
       2320 1 2 1 1  31 ILE MG   .  31 . HG2* 1 1 
       2321 1 1 1 1  23 LYS QE   .  23 . HE*  1 1 
       2321 1 2 1 1  31 ILE MG   .  31 . HG2* 1 1 
       2322 1 1 1 1  24 HIS H    .  24 . HN   1 1 
       2322 1 2 1 1  24 HIS QB   .  24 . HB*  1 1 
       2323 1 1 1 1  24 HIS QB   .  24 . HB*  1 1 
       2323 1 2 1 1  24 HIS HD2  .  24 . HD2  1 1 
       2324 1 1 1 1  25 ASN QB   .  25 . HB*  1 1 
       2324 1 2 1 1  26 TYR H    .  26 . HN   1 1 
       2325 1 1 1 1  25 ASN QB   .  25 . HB*  1 1 
       2325 1 2 1 1  26 TYR QD   .  26 . HD*  1 1 
       2326 1 1 1 1  25 ASN QB   .  25 . HB*  1 1 
       2326 1 2 1 1  26 TYR QE   .  26 . HE*  1 1 
       2327 1 1 1 1  26 TYR H    .  26 . HN   1 1 
       2327 1 2 1 1  26 TYR QB   .  26 . HB*  1 1 
       2328 1 1 1 1  26 TYR H    .  26 . HN   1 1 
       2328 1 2 1 1  27 PRO QD   .  27 . HD*  1 1 
       2329 1 1 1 1  26 TYR HA   .  26 . HA   1 1 
       2329 1 2 1 1  27 PRO QG   .  27 . HG*  1 1 
       2330 1 1 1 1  26 TYR HA   .  26 . HA   1 1 
       2330 1 2 1 1  27 PRO QD   .  27 . HD*  1 1 
       2331 1 1 1 1  26 TYR QB   .  26 . HB*  1 1 
       2331 1 2 1 1  27 PRO QD   .  27 . HD*  1 1 
       2332 1 1 1 1  26 TYR QB   .  26 . HB*  1 1 
       2332 1 2 1 1  29 ARG QB   .  29 . HB*  1 1 
       2333 1 1 1 1  26 TYR QB   .  26 . HB*  1 1 
       2333 1 2 1 1  29 ARG QG   .  29 . HG*  1 1 
       2334 1 1 1 1  26 TYR QB   .  26 . HB*  1 1 
       2334 1 2 1 1  29 ARG QD   .  29 . HD*  1 1 
       2335 1 1 1 1  26 TYR QB   .  26 . HB*  1 1 
       2335 1 2 1 1  31 ILE QG   .  31 . HG1* 1 1 
       2336 1 1 1 1  26 TYR QB   .  26 . HB*  1 1 
       2336 1 2 1 1  31 ILE MD   .  31 . HD1* 1 1 
       2337 1 1 1 1  26 TYR QB   .  26 . HB*  1 1 
       2337 1 2 1 1  99 LEU MD1  .  99 . HD1* 1 1 
       2338 1 1 1 1  26 TYR QD   .  26 . HD*  1 1 
       2338 1 2 1 1  27 PRO QG   .  27 . HG*  1 1 
       2339 1 1 1 1  26 TYR QD   .  26 . HD*  1 1 
       2339 1 2 1 1  27 PRO QD   .  27 . HD*  1 1 
       2340 1 1 1 1  26 TYR QD   .  26 . HD*  1 1 
       2340 1 2 1 1  29 ARG QB   .  29 . HB*  1 1 
       2341 1 1 1 1  26 TYR QD   .  26 . HD*  1 1 
       2341 1 2 1 1  96 ARG QG   .  96 . HG*  1 1 
       2342 1 1 1 1  26 TYR QD   .  26 . HD*  1 1 
       2342 1 2 1 1  99 LEU QB   .  99 . HB*  1 1 
       2343 1 1 1 1  26 TYR QE   .  26 . HE*  1 1 
       2343 1 2 1 1  27 PRO QD   .  27 . HD*  1 1 
       2344 1 1 1 1  26 TYR QE   .  26 . HE*  1 1 
       2344 1 2 1 1  96 ARG QB   .  96 . HB*  1 1 
       2345 1 1 1 1  26 TYR QE   .  26 . HE*  1 1 
       2345 1 2 1 1  96 ARG QG   .  96 . HG*  1 1 
       2346 1 1 1 1  26 TYR QE   .  26 . HE*  1 1 
       2346 1 2 1 1  99 LEU QB   .  99 . HB*  1 1 
       2347 1 1 1 1  29 ARG QB   .  29 . HB*  1 1 
       2347 1 2 1 1  29 ARG QD   .  29 . HD*  1 1 
       2348 1 1 1 1  29 ARG QB   .  29 . HB*  1 1 
       2348 1 2 1 1  30 GLU H    .  30 . HN   1 1 
       2349 1 1 1 1  29 ARG QB   .  29 . HB*  1 1 
       2349 1 2 1 1  99 LEU MD2  .  99 . HD2* 1 1 
       2350 1 1 1 1  29 ARG QG   .  29 . HG*  1 1 
       2350 1 2 1 1  30 GLU H    .  30 . HN   1 1 
       2351 1 1 1 1  29 ARG QG   .  29 . HG*  1 1 
       2351 1 2 1 1  99 LEU QB   .  99 . HB*  1 1 
       2352 1 1 1 1  29 ARG QD   .  29 . HD*  1 1 
       2352 1 2 1 1  99 LEU MD2  .  99 . HD2* 1 1 
       2353 1 1 1 1  30 GLU H    .  30 . HN   1 1 
       2353 1 2 1 1  30 GLU QG   .  30 . HG*  1 1 
       2354 1 1 1 1  30 GLU HA   .  30 . HA   1 1 
       2354 1 2 1 1  30 GLU QG   .  30 . HG*  1 1 
       2355 1 1 1 1  30 GLU QB   .  30 . HB*  1 1 
       2355 1 2 1 1  31 ILE H    .  31 . HN   1 1 
       2356 1 1 1 1  30 GLU QB   .  30 . HB*  1 1 
       2356 1 2 1 1  54 LEU QB   .  54 . HB*  1 1 
       2357 1 1 1 1  30 GLU QB   .  30 . HB*  1 1 
       2357 1 2 1 1  54 LEU MD1  .  54 . HD1* 1 1 
       2358 1 1 1 1  30 GLU QB   .  30 . HB*  1 1 
       2358 1 2 1 1  54 LEU MD2  .  54 . HD2* 1 1 
       2359 1 1 1 1  30 GLU QG   .  30 . HG*  1 1 
       2359 1 2 1 1  31 ILE H    .  31 . HN   1 1 
       2360 1 1 1 1  30 GLU QG   .  30 . HG*  1 1 
       2360 1 2 1 1  54 LEU HG   .  54 . HG   1 1 
       2361 1 1 1 1  31 ILE H    .  31 . HN   1 1 
       2361 1 2 1 1  31 ILE QG   .  31 . HG1* 1 1 
       2362 1 1 1 1  31 ILE HA   .  31 . HA   1 1 
       2362 1 2 1 1  31 ILE QG   .  31 . HG1* 1 1 
       2363 1 1 1 1  31 ILE QG   .  31 . HG1* 1 1 
       2363 1 2 1 1  31 ILE MG   .  31 . HG2* 1 1 
       2364 1 1 1 1  31 ILE MG   .  31 . HG2* 1 1 
       2364 1 2 1 1  32 ARG QB   .  32 . HB*  1 1 
       2365 1 1 1 1  31 ILE QG   .  31 . HG1* 1 1 
       2365 1 2 1 1  32 ARG H    .  32 . HN   1 1 
       2366 1 1 1 1  31 ILE QG   .  31 . HG1* 1 1 
       2366 1 2 1 1  55 VAL H    .  55 . HN   1 1 
       2367 1 1 1 1  31 ILE QG   .  31 . HG1* 1 1 
       2367 1 2 1 1  99 LEU MD1  .  99 . HD1* 1 1 
       2368 1 1 1 1  32 ARG H    .  32 . HN   1 1 
       2368 1 2 1 1  32 ARG QG   .  32 . HG*  1 1 
       2369 1 1 1 1  32 ARG H    .  32 . HN   1 1 
       2369 1 2 1 1  32 ARG QD   .  32 . HD*  1 1 
       2370 1 1 1 1  32 ARG HA   .  32 . HA   1 1 
       2370 1 2 1 1  32 ARG QD   .  32 . HD*  1 1 
       2371 1 1 1 1  32 ARG QB   .  32 . HB*  1 1 
       2371 1 2 1 1  32 ARG QD   .  32 . HD*  1 1 
       2372 1 1 1 1  32 ARG QB   .  32 . HB*  1 1 
       2372 1 2 1 1  33 THR H    .  33 . HN   1 1 
       2373 1 1 1 1  32 ARG QB   .  32 . HB*  1 1 
       2373 1 2 1 1  33 THR MG   .  33 . HG2* 1 1 
       2374 1 1 1 1  32 ARG QB   .  32 . HB*  1 1 
       2374 1 2 1 1  43 ILE MG   .  43 . HG2* 1 1 
       2375 1 1 1 1  32 ARG QB   .  32 . HB*  1 1 
       2375 1 2 1 1  43 ILE QG   .  43 . HG1* 1 1 
       2376 1 1 1 1  32 ARG QB   .  32 . HB*  1 1 
       2376 1 2 1 1  57 PHE H    .  57 . HN   1 1 
       2377 1 1 1 1  32 ARG QG   .  32 . HG*  1 1 
       2377 1 2 1 1  33 THR H    .  33 . HN   1 1 
       2378 1 1 1 1  32 ARG QG   .  32 . HG*  1 1 
       2378 1 2 1 1  43 ILE HB   .  43 . HB   1 1 
       2379 1 1 1 1  32 ARG QG   .  32 . HG*  1 1 
       2379 1 2 1 1  43 ILE MD   .  43 . HD1* 1 1 
       2380 1 1 1 1  32 ARG QG   .  32 . HG*  1 1 
       2380 1 2 1 1  56 VAL HA   .  56 . HA   1 1 
       2381 1 1 1 1  32 ARG QG   .  32 . HG*  1 1 
       2381 1 2 1 1  56 VAL MG1  .  56 . HG1* 1 1 
       2382 1 1 1 1  32 ARG QG   .  32 . HG*  1 1 
       2382 1 2 1 1  56 VAL MG2  .  56 . HG2* 1 1 
       2383 1 1 1 1  32 ARG QD   .  32 . HD*  1 1 
       2383 1 2 1 1  43 ILE MG   .  43 . HG2* 1 1 
       2384 1 1 1 1  32 ARG QD   .  32 . HD*  1 1 
       2384 1 2 1 1  43 ILE QG   .  43 . HG1* 1 1 
       2385 1 1 1 1  32 ARG QD   .  32 . HD*  1 1 
       2385 1 2 1 1  43 ILE MD   .  43 . HD1* 1 1 
       2386 1 1 1 1  32 ARG QD   .  32 . HD*  1 1 
       2386 1 2 1 1  54 LEU MD2  .  54 . HD2* 1 1 
       2387 1 1 1 1  32 ARG QD   .  32 . HD*  1 1 
       2387 1 2 1 1  56 VAL MG2  .  56 . HG2* 1 1 
       2388 1 1 1 1  33 THR HB   .  33 . HB   1 1 
       2388 1 2 1 1  57 PHE QB   .  57 . HB*  1 1 
       2389 1 1 1 1  33 THR MG   .  33 . HG2* 1 1 
       2389 1 2 1 1  57 PHE QB   .  57 . HB*  1 1 
       2390 1 1 1 1  33 THR MG   .  33 . HG2* 1 1 
       2390 1 2 1 1  59 ASN QB   .  59 . HB*  1 1 
       2391 1 1 1 1  34 ALA H    .  34 . HN   1 1 
       2391 1 2 1 1  57 PHE QB   .  57 . HB*  1 1 
       2392 1 1 1 1  34 ALA MB   .  34 . HB*  1 1 
       2392 1 2 1 1  40 ILE QG   .  40 . HG1* 1 1 
       2393 1 1 1 1  34 ALA MB   .  34 . HB*  1 1 
       2393 1 2 1 1  43 ILE QG   .  43 . HG1* 1 1 
       2394 1 1 1 1  35 THR HA   .  35 . HA   1 1 
       2394 1 2 1 1  39 ASP QB   .  39 . HB*  1 1 
       2395 1 1 1 1  35 THR HB   .  35 . HB   1 1 
       2395 1 2 1 1  39 ASP QB   .  39 . HB*  1 1 
       2396 1 1 1 1  35 THR MG   .  35 . HG2* 1 1 
       2396 1 2 1 1  36 SER QB   .  36 . HB*  1 1 
       2397 1 1 1 1  36 SER H    .  36 . HN   1 1 
       2397 1 2 1 1  39 ASP QB   .  39 . HB*  1 1 
       2398 1 1 1 1  36 SER H    .  36 . HN   1 1 
       2398 1 2 1 1  40 ILE QG   .  40 . HG1* 1 1 
       2399 1 1 1 1  36 SER QB   .  36 . HB*  1 1 
       2399 1 2 1 1  38 GLN QB   .  38 . HB*  1 1 
       2400 1 1 1 1  36 SER QB   .  36 . HB*  1 1 
       2400 1 2 1 1  39 ASP H    .  39 . HN   1 1 
       2401 1 1 1 1  37 SER HA   .  37 . HA   1 1 
       2401 1 2 1 1  40 ILE QG   .  40 . HG1* 1 1 
       2402 1 1 1 1  37 SER HA   .  37 . HA   1 1 
       2402 1 2 1 1  65 ASP QB   .  65 . HB*  1 1 
       2403 1 1 1 1  37 SER QB   .  37 . HB*  1 1 
       2403 1 2 1 1  38 GLN H    .  38 . HN   1 1 
       2404 1 1 1 1  37 SER QB   .  37 . HB*  1 1 
       2404 1 2 1 1  40 ILE H    .  40 . HN   1 1 
       2405 1 1 1 1  37 SER QB   .  37 . HB*  1 1 
       2405 1 2 1 1  40 ILE HB   .  40 . HB   1 1 
       2406 1 1 1 1  38 GLN H    .  38 . HN   1 1 
       2406 1 2 1 1  38 GLN QB   .  38 . HB*  1 1 
       2407 1 1 1 1  38 GLN H    .  38 . HN   1 1 
       2407 1 2 1 1  38 GLN QG   .  38 . HG*  1 1 
       2408 1 1 1 1  38 GLN H    .  38 . HN   1 1 
       2408 1 2 1 1  38 GLN QE   .  38 . HE*  1 1 
       2409 1 1 1 1  38 GLN HA   .  38 . HA   1 1 
       2409 1 2 1 1  41 ARG QB   .  41 . HB*  1 1 
       2410 1 1 1 1  38 GLN HA   .  38 . HA   1 1 
       2410 1 2 1 1  41 ARG QG   .  41 . HG*  1 1 
       2411 1 1 1 1  38 GLN QB   .  38 . HB*  1 1 
       2411 1 2 1 1  38 GLN QE   .  38 . HE*  1 1 
       2412 1 1 1 1  38 GLN QE   .  38 . HE*  1 1 
       2412 1 2 1 1  38 GLN QG   .  38 . HG*  1 1 
       2413 1 1 1 1  38 GLN QG   .  38 . HG*  1 1 
       2413 1 2 1 1  39 ASP H    .  39 . HN   1 1 
       2414 1 1 1 1  38 GLN QG   .  38 . HG*  1 1 
       2414 1 2 1 1  39 ASP HA   .  39 . HA   1 1 
       2415 1 1 1 1  39 ASP H    .  39 . HN   1 1 
       2415 1 2 1 1  39 ASP QB   .  39 . HB*  1 1 
       2416 1 1 1 1  39 ASP H    .  39 . HN   1 1 
       2416 1 2 1 1  40 ILE QG   .  40 . HG1* 1 1 
       2417 1 1 1 1  39 ASP HA   .  39 . HA   1 1 
       2417 1 2 1 1  42 ASP QB   .  42 . HB*  1 1 
       2418 1 1 1 1  39 ASP QB   .  39 . HB*  1 1 
       2418 1 2 1 1  40 ILE H    .  40 . HN   1 1 
       2419 1 1 1 1  39 ASP QB   .  39 . HB*  1 1 
       2419 1 2 1 1  43 ILE QG   .  43 . HG1* 1 1 
       2420 1 1 1 1  39 ASP QB   .  39 . HB*  1 1 
       2420 1 2 1 1  43 ILE MD   .  43 . HD1* 1 1 
       2421 1 1 1 1  40 ILE H    .  40 . HN   1 1 
       2421 1 2 1 1  41 ARG QB   .  41 . HB*  1 1 
       2422 1 1 1 1  40 ILE HA   .  40 . HA   1 1 
       2422 1 2 1 1  40 ILE QG   .  40 . HG1* 1 1 
       2423 1 1 1 1  40 ILE HA   .  40 . HA   1 1 
       2423 1 2 1 1  43 ILE QG   .  43 . HG1* 1 1 
       2424 1 1 1 1  40 ILE HB   .  40 . HB   1 1 
       2424 1 2 1 1  41 ARG QB   .  41 . HB*  1 1 
       2425 1 1 1 1  40 ILE HB   .  40 . HB   1 1 
       2425 1 2 1 1  65 ASP QB   .  65 . HB*  1 1 
       2426 1 1 1 1  40 ILE MG   .  40 . HG2* 1 1 
       2426 1 2 1 1  41 ARG QB   .  41 . HB*  1 1 
       2427 1 1 1 1  40 ILE MG   .  40 . HG2* 1 1 
       2427 1 2 1 1  41 ARG QG   .  41 . HG*  1 1 
       2428 1 1 1 1  40 ILE MG   .  40 . HG2* 1 1 
       2428 1 2 1 1  41 ARG QD   .  41 . HD*  1 1 
       2429 1 1 1 1  40 ILE MG   .  40 . HG2* 1 1 
       2429 1 2 1 1  65 ASP QB   .  65 . HB*  1 1 
       2430 1 1 1 1  40 ILE MG   .  40 . HG2* 1 1 
       2430 1 2 1 1  68 GLU QB   .  68 . HB*  1 1 
       2431 1 1 1 1  40 ILE MG   .  40 . HG2* 1 1 
       2431 1 2 1 1  68 GLU QG   .  68 . HG*  1 1 
       2432 1 1 1 1  40 ILE MG   .  40 . HG2* 1 1 
       2432 1 2 1 1  69 PHE QB   .  69 . HB*  1 1 
       2433 1 1 1 1  40 ILE MG   .  40 . HG2* 1 1 
       2433 1 2 1 1  72 GLU QB   .  72 . HB*  1 1 
       2434 1 1 1 1  40 ILE MG   .  40 . HG2* 1 1 
       2434 1 2 1 1  72 GLU QG   .  72 . HG*  1 1 
       2435 1 1 1 1  40 ILE QG   .  40 . HG1* 1 1 
       2435 1 2 1 1  41 ARG H    .  41 . HN   1 1 
       2436 1 1 1 1  40 ILE QG   .  40 . HG1* 1 1 
       2436 1 2 1 1  61 ALA MB   .  61 . HB*  1 1 
       2437 1 1 1 1  40 ILE QG   .  40 . HG1* 1 1 
       2437 1 2 1 1  65 ASP HA   .  65 . HA   1 1 
       2438 1 1 1 1  40 ILE QG   .  40 . HG1* 1 1 
       2438 1 2 1 1  65 ASP QB   .  65 . HB*  1 1 
       2439 1 1 1 1  40 ILE QG   .  40 . HG1* 1 1 
       2439 1 2 1 1  69 PHE QD   .  69 . HD*  1 1 
       2440 1 1 1 1  40 ILE MD   .  40 . HD1* 1 1 
       2440 1 2 1 1  65 ASP QB   .  65 . HB*  1 1 
       2441 1 1 1 1  40 ILE MD   .  40 . HD1* 1 1 
       2441 1 2 1 1  68 GLU QB   .  68 . HB*  1 1 
       2442 1 1 1 1  40 ILE MD   .  40 . HD1* 1 1 
       2442 1 2 1 1  68 GLU QG   .  68 . HG*  1 1 
       2443 1 1 1 1  40 ILE MD   .  40 . HD1* 1 1 
       2443 1 2 1 1  69 PHE QB   .  69 . HB*  1 1 
       2444 1 1 1 1  41 ARG H    .  41 . HN   1 1 
       2444 1 2 1 1  41 ARG QB   .  41 . HB*  1 1 
       2445 1 1 1 1  41 ARG H    .  41 . HN   1 1 
       2445 1 2 1 1  41 ARG QG   .  41 . HG*  1 1 
       2446 1 1 1 1  41 ARG H    .  41 . HN   1 1 
       2446 1 2 1 1  42 ASP QB   .  42 . HB*  1 1 
       2447 1 1 1 1  41 ARG HA   .  41 . HA   1 1 
       2447 1 2 1 1  41 ARG QG   .  41 . HG*  1 1 
       2448 1 1 1 1  41 ARG HA   .  41 . HA   1 1 
       2448 1 2 1 1  41 ARG QD   .  41 . HD*  1 1 
       2449 1 1 1 1  41 ARG HA   .  41 . HA   1 1 
       2449 1 2 1 1  44 ILE QG   .  44 . HG1* 1 1 
       2450 1 1 1 1  41 ARG HA   .  41 . HA   1 1 
       2450 1 2 1 1  72 GLU QG   .  72 . HG*  1 1 
       2451 1 1 1 1  41 ARG QB   .  41 . HB*  1 1 
       2451 1 2 1 1  41 ARG QD   .  41 . HD*  1 1 
       2452 1 1 1 1  41 ARG QB   .  41 . HB*  1 1 
       2452 1 2 1 1  42 ASP H    .  42 . HN   1 1 
       2453 1 1 1 1  41 ARG QG   .  41 . HG*  1 1 
       2453 1 2 1 1  42 ASP H    .  42 . HN   1 1 
       2454 1 1 1 1  41 ARG QG   .  41 . HG*  1 1 
       2454 1 2 1 1  72 GLU QG   .  72 . HG*  1 1 
       2455 1 1 1 1  41 ARG QD   .  41 . HD*  1 1 
       2455 1 2 1 1  72 GLU QG   .  72 . HG*  1 1 
       2456 1 1 1 1  42 ASP H    .  42 . HN   1 1 
       2456 1 2 1 1  42 ASP QB   .  42 . HB*  1 1 
       2457 1 1 1 1  42 ASP HA   .  42 . HA   1 1 
       2457 1 2 1 1  45 LYS QB   .  45 . HB*  1 1 
       2458 1 1 1 1  42 ASP HA   .  42 . HA   1 1 
       2458 1 2 1 1  45 LYS QG   .  45 . HG*  1 1 
       2459 1 1 1 1  42 ASP QB   .  42 . HB*  1 1 
       2459 1 2 1 1  43 ILE H    .  43 . HN   1 1 
       2460 1 1 1 1  42 ASP QB   .  42 . HB*  1 1 
       2460 1 2 1 1  43 ILE HB   .  43 . HB   1 1 
       2461 1 1 1 1  42 ASP QB   .  42 . HB*  1 1 
       2461 1 2 1 1  45 LYS H    .  45 . HN   1 1 
       2462 1 1 1 1  42 ASP QB   .  42 . HB*  1 1 
       2462 1 2 1 1  45 LYS QB   .  45 . HB*  1 1 
       2463 1 1 1 1  43 ILE H    .  43 . HN   1 1 
       2463 1 2 1 1  43 ILE QG   .  43 . HG1* 1 1 
       2464 1 1 1 1  43 ILE H    .  43 . HN   1 1 
       2464 1 2 1 1  46 SER QB   .  46 . HB*  1 1 
       2465 1 1 1 1  43 ILE HA   .  43 . HA   1 1 
       2465 1 2 1 1  43 ILE QG   .  43 . HG1* 1 1 
       2466 1 1 1 1  43 ILE HA   .  43 . HA   1 1 
       2466 1 2 1 1  46 SER QB   .  46 . HB*  1 1 
       2467 1 1 1 1  43 ILE HB   .  43 . HB   1 1 
       2467 1 2 1 1  44 ILE QG   .  44 . HG1* 1 1 
       2468 1 1 1 1  43 ILE MG   .  43 . HG2* 1 1 
       2468 1 2 1 1  46 SER QB   .  46 . HB*  1 1 
       2469 1 1 1 1  43 ILE MG   .  43 . HG2* 1 1 
       2469 1 2 1 1  47 MET QG   .  47 . HG*  1 1 
       2470 1 1 1 1  43 ILE QG   .  43 . HG1* 1 1 
       2470 1 2 1 1  44 ILE H    .  44 . HN   1 1 
       2471 1 1 1 1  44 ILE HA   .  44 . HA   1 1 
       2471 1 2 1 1  44 ILE QG   .  44 . HG1* 1 1 
       2472 1 1 1 1  44 ILE HA   .  44 . HA   1 1 
       2472 1 2 1 1  47 MET QB   .  47 . HB*  1 1 
       2473 1 1 1 1  44 ILE HA   .  44 . HA   1 1 
       2473 1 2 1 1  47 MET QG   .  47 . HG*  1 1 
       2474 1 1 1 1  44 ILE MG   .  44 . HG2* 1 1 
       2474 1 2 1 1  45 LYS QB   .  45 . HB*  1 1 
       2475 1 1 1 1  44 ILE MG   .  44 . HG2* 1 1 
       2475 1 2 1 1  45 LYS QG   .  45 . HG*  1 1 
       2476 1 1 1 1  44 ILE MG   .  44 . HG2* 1 1 
       2476 1 2 1 1  47 MET QG   .  47 . HG*  1 1 
       2477 1 1 1 1  44 ILE MG   .  44 . HG2* 1 1 
       2477 1 2 1 1  48 LYS QG   .  48 . HG*  1 1 
       2478 1 1 1 1  44 ILE MG   .  44 . HG2* 1 1 
       2478 1 2 1 1  48 LYS QD   .  48 . HD*  1 1 
       2479 1 1 1 1  44 ILE MG   .  44 . HG2* 1 1 
       2479 1 2 1 1  72 GLU QB   .  72 . HB*  1 1 
       2480 1 1 1 1  44 ILE MG   .  44 . HG2* 1 1 
       2480 1 2 1 1  75 LYS QG   .  75 . HG*  1 1 
       2481 1 1 1 1  44 ILE MG   .  44 . HG2* 1 1 
       2481 1 2 1 1  76 GLU QB   .  76 . HB*  1 1 
       2482 1 1 1 1  44 ILE MG   .  44 . HG2* 1 1 
       2482 1 2 1 1  76 GLU QG   .  76 . HG*  1 1 
       2483 1 1 1 1  44 ILE QG   .  44 . HG1* 1 1 
       2483 1 2 1 1  45 LYS H    .  45 . HN   1 1 
       2484 1 1 1 1  44 ILE QG   .  44 . HG1* 1 1 
       2484 1 2 1 1  47 MET ME   .  47 . HE*  1 1 
       2485 1 1 1 1  44 ILE QG   .  44 . HG1* 1 1 
       2485 1 2 1 1  69 PHE HA   .  69 . HA   1 1 
       2486 1 1 1 1  44 ILE QG   .  44 . HG1* 1 1 
       2486 1 2 1 1  69 PHE QD   .  69 . HD*  1 1 
       2487 1 1 1 1  44 ILE QG   .  44 . HG1* 1 1 
       2487 1 2 1 1  69 PHE QE   .  69 . HE*  1 1 
       2488 1 1 1 1  44 ILE QG   .  44 . HG1* 1 1 
       2488 1 2 1 1  69 PHE HZ   .  69 . HZ   1 1 
       2489 1 1 1 1  44 ILE QG   .  44 . HG1* 1 1 
       2489 1 2 1 1  72 GLU QB   .  72 . HB*  1 1 
       2490 1 1 1 1  44 ILE MD   .  44 . HD1* 1 1 
       2490 1 2 1 1  72 GLU QB   .  72 . HB*  1 1 
       2491 1 1 1 1  44 ILE MD   .  44 . HD1* 1 1 
       2491 1 2 1 1  72 GLU QG   .  72 . HG*  1 1 
       2492 1 1 1 1  45 LYS H    .  45 . HN   1 1 
       2492 1 2 1 1  45 LYS QB   .  45 . HB*  1 1 
       2493 1 1 1 1  45 LYS H    .  45 . HN   1 1 
       2493 1 2 1 1  45 LYS QG   .  45 . HG*  1 1 
       2494 1 1 1 1  45 LYS H    .  45 . HN   1 1 
       2494 1 2 1 1  45 LYS QD   .  45 . HD*  1 1 
       2495 1 1 1 1  45 LYS HA   .  45 . HA   1 1 
       2495 1 2 1 1  45 LYS QB   .  45 . HB*  1 1 
       2496 1 1 1 1  45 LYS HA   .  45 . HA   1 1 
       2496 1 2 1 1  45 LYS QG   .  45 . HG*  1 1 
       2497 1 1 1 1  45 LYS HA   .  45 . HA   1 1 
       2497 1 2 1 1  45 LYS QD   .  45 . HD*  1 1 
       2498 1 1 1 1  45 LYS HA   .  45 . HA   1 1 
       2498 1 2 1 1  45 LYS QE   .  45 . HE*  1 1 
       2499 1 1 1 1  45 LYS HA   .  45 . HA   1 1 
       2499 1 2 1 1  48 LYS QB   .  48 . HB*  1 1 
       2500 1 1 1 1  45 LYS HA   .  45 . HA   1 1 
       2500 1 2 1 1  48 LYS QG   .  48 . HG*  1 1 
       2501 1 1 1 1  45 LYS HA   .  45 . HA   1 1 
       2501 1 2 1 1  48 LYS QE   .  48 . HE*  1 1 
       2502 1 1 1 1  45 LYS QB   .  45 . HB*  1 1 
       2502 1 2 1 1  45 LYS QE   .  45 . HE*  1 1 
       2503 1 1 1 1  45 LYS QB   .  45 . HB*  1 1 
       2503 1 2 1 1  46 SER H    .  46 . HN   1 1 
       2504 1 1 1 1  45 LYS QB   .  45 . HB*  1 1 
       2504 1 2 1 1  46 SER HA   .  46 . HA   1 1 
       2505 1 1 1 1  45 LYS QB   .  45 . HB*  1 1 
       2505 1 2 1 1  46 SER QB   .  46 . HB*  1 1 
       2506 1 1 1 1  45 LYS QD   .  45 . HD*  1 1 
       2506 1 2 1 1  45 LYS QG   .  45 . HG*  1 1 
       2507 1 1 1 1  45 LYS QE   .  45 . HE*  1 1 
       2507 1 2 1 1  45 LYS QG   .  45 . HG*  1 1 
       2508 1 1 1 1  45 LYS QG   .  45 . HG*  1 1 
       2508 1 2 1 1  46 SER H    .  46 . HN   1 1 
       2509 1 1 1 1  45 LYS QG   .  45 . HG*  1 1 
       2509 1 2 1 1  46 SER HA   .  46 . HA   1 1 
       2510 1 1 1 1  45 LYS QD   .  45 . HD*  1 1 
       2510 1 2 1 1  45 LYS QE   .  45 . HE*  1 1 
       2511 1 1 1 1  45 LYS QD   .  45 . HD*  1 1 
       2511 1 2 1 1  46 SER H    .  46 . HN   1 1 
       2512 1 1 1 1  45 LYS QE   .  45 . HE*  1 1 
       2512 1 2 1 1  46 SER H    .  46 . HN   1 1 
       2513 1 1 1 1  46 SER H    .  46 . HN   1 1 
       2513 1 2 1 1  46 SER QB   .  46 . HB*  1 1 
       2514 1 1 1 1  46 SER H    .  46 . HN   1 1 
       2514 1 2 1 1  47 MET QB   .  47 . HB*  1 1 
       2515 1 1 1 1  46 SER QB   .  46 . HB*  1 1 
       2515 1 2 1 1  47 MET H    .  47 . HN   1 1 
       2516 1 1 1 1  46 SER QB   .  46 . HB*  1 1 
       2516 1 2 1 1  47 MET QG   .  47 . HG*  1 1 
       2517 1 1 1 1  46 SER QB   .  46 . HB*  1 1 
       2517 1 2 1 1  47 MET ME   .  47 . HE*  1 1 
       2518 1 1 1 1  46 SER QB   .  46 . HB*  1 1 
       2518 1 2 1 1  54 LEU MD1  .  54 . HD1* 1 1 
       2519 1 1 1 1  47 MET H    .  47 . HN   1 1 
       2519 1 2 1 1  47 MET QB   .  47 . HB*  1 1 
       2520 1 1 1 1  47 MET H    .  47 . HN   1 1 
       2520 1 2 1 1  47 MET QG   .  47 . HG*  1 1 
       2521 1 1 1 1  47 MET H    .  47 . HN   1 1 
       2521 1 2 1 1  48 LYS QG   .  48 . HG*  1 1 
       2522 1 1 1 1  47 MET HA   .  47 . HA   1 1 
       2522 1 2 1 1  47 MET QG   .  47 . HG*  1 1 
       2523 1 1 1 1  47 MET QB   .  47 . HB*  1 1 
       2523 1 2 1 1  47 MET ME   .  47 . HE*  1 1 
       2524 1 1 1 1  47 MET QB   .  47 . HB*  1 1 
       2524 1 2 1 1  48 LYS H    .  48 . HN   1 1 
       2525 1 1 1 1  47 MET QB   .  47 . HB*  1 1 
       2525 1 2 1 1  48 LYS QG   .  48 . HG*  1 1 
       2526 1 1 1 1  47 MET QB   .  47 . HB*  1 1 
       2526 1 2 1 1  54 LEU QB   .  54 . HB*  1 1 
       2527 1 1 1 1  47 MET QB   .  47 . HB*  1 1 
       2527 1 2 1 1  54 LEU MD1  .  54 . HD1* 1 1 
       2528 1 1 1 1  47 MET QB   .  47 . HB*  1 1 
       2528 1 2 1 1  78 VAL MG1  .  78 . HG1* 1 1 
       2529 1 1 1 1  47 MET QB   .  47 . HB*  1 1 
       2529 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       2530 1 1 1 1  47 MET QG   .  47 . HG*  1 1 
       2530 1 2 1 1  48 LYS H    .  48 . HN   1 1 
       2531 1 1 1 1  47 MET QG   .  47 . HG*  1 1 
       2531 1 2 1 1  54 LEU MD1  .  54 . HD1* 1 1 
       2532 1 1 1 1  47 MET QG   .  47 . HG*  1 1 
       2532 1 2 1 1  54 LEU MD2  .  54 . HD2* 1 1 
       2533 1 1 1 1  47 MET QG   .  47 . HG*  1 1 
       2533 1 2 1 1  78 VAL MG1  .  78 . HG1* 1 1 
       2534 1 1 1 1  47 MET QG   .  47 . HG*  1 1 
       2534 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       2535 1 1 1 1  47 MET ME   .  47 . HE*  1 1 
       2535 1 2 1 1  48 LYS QG   .  48 . HG*  1 1 
       2536 1 1 1 1  47 MET ME   .  47 . HE*  1 1 
       2536 1 2 1 1  48 LYS QE   .  48 . HE*  1 1 
       2537 1 1 1 1  47 MET ME   .  47 . HE*  1 1 
       2537 1 2 1 1  54 LEU QB   .  54 . HB*  1 1 
       2538 1 1 1 1  47 MET ME   .  47 . HE*  1 1 
       2538 1 2 1 1  79 SER QB   .  79 . HB*  1 1 
       2539 1 1 1 1  47 MET ME   .  47 . HE*  1 1 
       2539 1 2 1 1  80 TYR QB   .  80 . HB*  1 1 
       2540 1 1 1 1  48 LYS H    .  48 . HN   1 1 
       2540 1 2 1 1  48 LYS QB   .  48 . HB*  1 1 
       2541 1 1 1 1  48 LYS H    .  48 . HN   1 1 
       2541 1 2 1 1  48 LYS QG   .  48 . HG*  1 1 
       2542 1 1 1 1  48 LYS H    .  48 . HN   1 1 
       2542 1 2 1 1  48 LYS QD   .  48 . HD*  1 1 
       2543 1 1 1 1  48 LYS HA   .  48 . HA   1 1 
       2543 1 2 1 1  48 LYS QG   .  48 . HG*  1 1 
       2544 1 1 1 1  48 LYS HA   .  48 . HA   1 1 
       2544 1 2 1 1  48 LYS QE   .  48 . HE*  1 1 
       2545 1 1 1 1  48 LYS QB   .  48 . HB*  1 1 
       2545 1 2 1 1  48 LYS QD   .  48 . HD*  1 1 
       2546 1 1 1 1  48 LYS QB   .  48 . HB*  1 1 
       2546 1 2 1 1  48 LYS QE   .  48 . HE*  1 1 
       2547 1 1 1 1  48 LYS QB   .  48 . HB*  1 1 
       2547 1 2 1 1  49 ASP H    .  49 . HN   1 1 
       2548 1 1 1 1  48 LYS QE   .  48 . HE*  1 1 
       2548 1 2 1 1  48 LYS QG   .  48 . HG*  1 1 
       2549 1 1 1 1  48 LYS QG   .  48 . HG*  1 1 
       2549 1 2 1 1  49 ASP H    .  49 . HN   1 1 
       2550 1 1 1 1  48 LYS QG   .  48 . HG*  1 1 
       2550 1 2 1 1  76 GLU QB   .  76 . HB*  1 1 
       2551 1 1 1 1  48 LYS QG   .  48 . HG*  1 1 
       2551 1 2 1 1  76 GLU QG   .  76 . HG*  1 1 
       2552 1 1 1 1  48 LYS QG   .  48 . HG*  1 1 
       2552 1 2 1 1  78 VAL MG1  .  78 . HG1* 1 1 
       2553 1 1 1 1  48 LYS QG   .  48 . HG*  1 1 
       2553 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       2554 1 1 1 1  48 LYS QD   .  48 . HD*  1 1 
       2554 1 2 1 1  76 GLU QB   .  76 . HB*  1 1 
       2555 1 1 1 1  48 LYS QD   .  48 . HD*  1 1 
       2555 1 2 1 1  78 VAL MG1  .  78 . HG1* 1 1 
       2556 1 1 1 1  48 LYS QD   .  48 . HD*  1 1 
       2556 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       2557 1 1 1 1  48 LYS QE   .  48 . HE*  1 1 
       2557 1 2 1 1  76 GLU QB   .  76 . HB*  1 1 
       2558 1 1 1 1  50 ASN QB   .  50 . HB*  1 1 
       2558 1 2 1 1  52 LYS H    .  52 . HN   1 1 
       2559 1 1 1 1  50 ASN QB   .  50 . HB*  1 1 
       2559 1 2 1 1  52 LYS QB   .  52 . HB*  1 1 
       2560 1 1 1 1  50 ASN QB   .  50 . HB*  1 1 
       2560 1 2 1 1  52 LYS QG   .  52 . HG*  1 1 
       2561 1 1 1 1  51 GLY QA   .  51 . HA*  1 1 
       2561 1 2 1 1  52 LYS QB   .  52 . HB*  1 1 
       2562 1 1 1 1  52 LYS H    .  52 . HN   1 1 
       2562 1 2 1 1  52 LYS QB   .  52 . HB*  1 1 
       2563 1 1 1 1  52 LYS H    .  52 . HN   1 1 
       2563 1 2 1 1  52 LYS QG   .  52 . HG*  1 1 
       2564 1 1 1 1  52 LYS HA   .  52 . HA   1 1 
       2564 1 2 1 1  52 LYS QE   .  52 . HE*  1 1 
       2565 1 1 1 1  52 LYS HA   .  52 . HA   1 1 
       2565 1 2 1 1  53 PRO QD   .  53 . HD*  1 1 
       2566 1 1 1 1  52 LYS QB   .  52 . HB*  1 1 
       2566 1 2 1 1  52 LYS QD   .  52 . HD*  1 1 
       2567 1 1 1 1  52 LYS QB   .  52 . HB*  1 1 
       2567 1 2 1 1  52 LYS QE   .  52 . HE*  1 1 
       2568 1 1 1 1  52 LYS QB   .  52 . HB*  1 1 
       2568 1 2 1 1  53 PRO QD   .  53 . HD*  1 1 
       2569 1 1 1 1  52 LYS QD   .  52 . HD*  1 1 
       2569 1 2 1 1  52 LYS QG   .  52 . HG*  1 1 
       2570 1 1 1 1  52 LYS QE   .  52 . HE*  1 1 
       2570 1 2 1 1  52 LYS QG   .  52 . HG*  1 1 
       2571 1 1 1 1  52 LYS QG   .  52 . HG*  1 1 
       2571 1 2 1 1  53 PRO QD   .  53 . HD*  1 1 
       2572 1 1 1 1  52 LYS QG   .  52 . HG*  1 1 
       2572 1 2 1 1  54 LEU MD1  .  54 . HD1* 1 1 
       2573 1 1 1 1  52 LYS QD   .  52 . HD*  1 1 
       2573 1 2 1 1  52 LYS QE   .  52 . HE*  1 1 
       2574 1 1 1 1  52 LYS QD   .  52 . HD*  1 1 
       2574 1 2 1 1  53 PRO QD   .  53 . HD*  1 1 
       2575 1 1 1 1  52 LYS QD   .  52 . HD*  1 1 
       2575 1 2 1 1  54 LEU MD1  .  54 . HD1* 1 1 
       2576 1 1 1 1  52 LYS QD   .  52 . HD*  1 1 
       2576 1 2 1 1  54 LEU MD2  .  54 . HD2* 1 1 
       2577 1 1 1 1  52 LYS QE   .  52 . HE*  1 1 
       2577 1 2 1 1  54 LEU MD2  .  54 . HD2* 1 1 
       2578 1 1 1 1  53 PRO HA   .  53 . HA   1 1 
       2578 1 2 1 1  54 LEU QB   .  54 . HB*  1 1 
       2579 1 1 1 1  53 PRO QB   .  53 . HB*  1 1 
       2579 1 2 1 1  54 LEU H    .  54 . HN   1 1 
       2580 1 1 1 1  53 PRO QB   .  53 . HB*  1 1 
       2580 1 2 1 1  54 LEU HA   .  54 . HA   1 1 
       2581 1 1 1 1  53 PRO QB   .  53 . HB*  1 1 
       2581 1 2 1 1  54 LEU QB   .  54 . HB*  1 1 
       2582 1 1 1 1  53 PRO QB   .  53 . HB*  1 1 
       2582 1 2 1 1  98 PHE QD   .  98 . HD*  1 1 
       2583 1 1 1 1  53 PRO QB   .  53 . HB*  1 1 
       2583 1 2 1 1  98 PHE QE   .  98 . HE*  1 1 
       2584 1 1 1 1  53 PRO QB   .  53 . HB*  1 1 
       2584 1 2 1 1  99 LEU MD2  .  99 . HD2* 1 1 
       2585 1 1 1 1  53 PRO QB   .  53 . HB*  1 1 
       2585 1 2 1 1 102 ALA MB   . 102 . HB*  1 1 
       2586 1 1 1 1  53 PRO QG   .  53 . HG*  1 1 
       2586 1 2 1 1  54 LEU H    .  54 . HN   1 1 
       2587 1 1 1 1  53 PRO QG   .  53 . HG*  1 1 
       2587 1 2 1 1  98 PHE HZ   .  98 . HZ   1 1 
       2588 1 1 1 1  53 PRO QG   .  53 . HG*  1 1 
       2588 1 2 1 1  99 LEU HA   .  99 . HA   1 1 
       2589 1 1 1 1  53 PRO QG   .  53 . HG*  1 1 
       2589 1 2 1 1  99 LEU QB   .  99 . HB*  1 1 
       2590 1 1 1 1  53 PRO QG   .  53 . HG*  1 1 
       2590 1 2 1 1  99 LEU MD2  .  99 . HD2* 1 1 
       2591 1 1 1 1  53 PRO QG   .  53 . HG*  1 1 
       2591 1 2 1 1 102 ALA MB   . 102 . HB*  1 1 
       2592 1 1 1 1  53 PRO QG   .  53 . HG*  1 1 
       2592 1 2 1 1 103 GLY QA   . 103 . HA*  1 1 
       2593 1 1 1 1  53 PRO QD   .  53 . HD*  1 1 
       2593 1 2 1 1  54 LEU MD2  .  54 . HD2* 1 1 
       2594 1 1 1 1  53 PRO QD   .  53 . HD*  1 1 
       2594 1 2 1 1 102 ALA MB   . 102 . HB*  1 1 
       2595 1 1 1 1  54 LEU H    .  54 . HN   1 1 
       2595 1 2 1 1  54 LEU QB   .  54 . HB*  1 1 
       2596 1 1 1 1  54 LEU QB   .  54 . HB*  1 1 
       2596 1 2 1 1  54 LEU HG   .  54 . HG   1 1 
       2597 1 1 1 1  54 LEU QB   .  54 . HB*  1 1 
       2597 1 2 1 1  54 LEU MD2  .  54 . HD2* 1 1 
       2598 1 1 1 1  54 LEU QB   .  54 . HB*  1 1 
       2598 1 2 1 1  55 VAL H    .  55 . HN   1 1 
       2599 1 1 1 1  54 LEU QB   .  54 . HB*  1 1 
       2599 1 2 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       2600 1 1 1 1  54 LEU QB   .  54 . HB*  1 1 
       2600 1 2 1 1  56 VAL MG2  .  56 . HG2* 1 1 
       2601 1 1 1 1  55 VAL MG1  .  55 . HG1* 1 1 
       2601 1 2 1 1  57 PHE QB   .  57 . HB*  1 1 
       2602 1 1 1 1  55 VAL MG2  .  55 . HG2* 1 1 
       2602 1 2 1 1  98 PHE QB   .  98 . HB*  1 1 
       2603 1 1 1 1  56 VAL MG1  .  56 . HG1* 1 1 
       2603 1 2 1 1  57 PHE QB   .  57 . HB*  1 1 
       2604 1 1 1 1  56 VAL MG2  .  56 . HG2* 1 1 
       2604 1 2 1 1  69 PHE QB   .  69 . HB*  1 1 
       2605 1 1 1 1  57 PHE H    .  57 . HN   1 1 
       2605 1 2 1 1  57 PHE QB   .  57 . HB*  1 1 
       2606 1 1 1 1  57 PHE QB   .  57 . HB*  1 1 
       2606 1 2 1 1  58 VAL H    .  58 . HN   1 1 
       2607 1 1 1 1  57 PHE QE   .  57 . HE*  1 1 
       2607 1 2 1 1  91 LEU QB   .  91 . HB*  1 1 
       2608 1 1 1 1  57 PHE HZ   .  57 . HZ   1 1 
       2608 1 2 1 1  91 LEU QB   .  91 . HB*  1 1 
       2609 1 1 1 1  58 VAL HA   .  58 . HA   1 1 
       2609 1 2 1 1  59 ASN QB   .  59 . HB*  1 1 
       2610 1 1 1 1  58 VAL MG1  .  58 . HG1* 1 1 
       2610 1 2 1 1  65 ASP QB   .  65 . HB*  1 1 
       2611 1 1 1 1  58 VAL MG2  .  58 . HG2* 1 1 
       2611 1 2 1 1  65 ASP QB   .  65 . HB*  1 1 
       2612 1 1 1 1  59 ASN HA   .  59 . HA   1 1 
       2612 1 2 1 1  60 GLY QA   .  60 . HA*  1 1 
       2613 1 1 1 1  59 ASN QB   .  59 . HB*  1 1 
       2613 1 2 1 1  61 ALA HA   .  61 . HA   1 1 
       2614 1 1 1 1  59 ASN QB   .  59 . HB*  1 1 
       2614 1 2 1 1  61 ALA MB   .  61 . HB*  1 1 
       2615 1 1 1 1  61 ALA HA   .  61 . HA   1 1 
       2615 1 2 1 1  65 ASP QB   .  65 . HB*  1 1 
       2616 1 1 1 1  62 SER H    .  62 . HN   1 1 
       2616 1 2 1 1  65 ASP QB   .  65 . HB*  1 1 
       2617 1 1 1 1  62 SER QB   .  62 . HB*  1 1 
       2617 1 2 1 1  65 ASP H    .  65 . HN   1 1 
       2618 1 1 1 1  62 SER QB   .  62 . HB*  1 1 
       2618 1 2 1 1  65 ASP QB   .  65 . HB*  1 1 
       2619 1 1 1 1  63 GLN HA   .  63 . HA   1 1 
       2619 1 2 1 1  63 GLN QB   .  63 . HB*  1 1 
       2620 1 1 1 1  63 GLN HA   .  63 . HA   1 1 
       2620 1 2 1 1  63 GLN QG   .  63 . HG*  1 1 
       2621 1 1 1 1  63 GLN QG   .  63 . HG*  1 1 
       2621 1 2 1 1  64 ASN HA   .  64 . HA   1 1 
       2622 1 1 1 1  63 GLN QG   .  63 . HG*  1 1 
       2622 1 2 1 1  66 VAL MG1  .  66 . HG1* 1 1 
       2623 1 1 1 1  63 GLN QG   .  63 . HG*  1 1 
       2623 1 2 1 1  66 VAL MG2  .  66 . HG2* 1 1 
       2624 1 1 1 1  63 GLN QG   .  63 . HG*  1 1 
       2624 1 2 1 1  67 ASN H    .  67 . HN   1 1 
       2625 1 1 1 1  63 GLN QE   .  63 . HE*  1 1 
       2625 1 2 1 1  66 VAL MG1  .  66 . HG1* 1 1 
       2626 1 1 1 1  64 ASN HA   .  64 . HA   1 1 
       2626 1 2 1 1  67 ASN QB   .  67 . HB*  1 1 
       2627 1 1 1 1  65 ASP H    .  65 . HN   1 1 
       2627 1 2 1 1  65 ASP QB   .  65 . HB*  1 1 
       2628 1 1 1 1  65 ASP HA   .  65 . HA   1 1 
       2628 1 2 1 1  68 GLU QB   .  68 . HB*  1 1 
       2629 1 1 1 1  65 ASP HA   .  65 . HA   1 1 
       2629 1 2 1 1  68 GLU QG   .  68 . HG*  1 1 
       2630 1 1 1 1  65 ASP QB   .  65 . HB*  1 1 
       2630 1 2 1 1  66 VAL H    .  66 . HN   1 1 
       2631 1 1 1 1  65 ASP QB   .  65 . HB*  1 1 
       2631 1 2 1 1  66 VAL MG2  .  66 . HG2* 1 1 
       2632 1 1 1 1  65 ASP QB   .  65 . HB*  1 1 
       2632 1 2 1 1  68 GLU QB   .  68 . HB*  1 1 
       2633 1 1 1 1  65 ASP QB   .  65 . HB*  1 1 
       2633 1 2 1 1  69 PHE QD   .  69 . HD*  1 1 
       2634 1 1 1 1  66 VAL HA   .  66 . HA   1 1 
       2634 1 2 1 1  69 PHE QB   .  69 . HB*  1 1 
       2635 1 1 1 1  66 VAL HB   .  66 . HB   1 1 
       2635 1 2 1 1  67 ASN QB   .  67 . HB*  1 1 
       2636 1 1 1 1  66 VAL HB   .  66 . HB   1 1 
       2636 1 2 1 1  70 GLN QE   .  70 . HE*  1 1 
       2637 1 1 1 1  66 VAL MG1  .  66 . HG1* 1 1 
       2637 1 2 1 1  67 ASN QB   .  67 . HB*  1 1 
       2638 1 1 1 1  66 VAL MG1  .  66 . HG1* 1 1 
       2638 1 2 1 1  70 GLN QG   .  70 . HG*  1 1 
       2639 1 1 1 1  66 VAL MG1  .  66 . HG1* 1 1 
       2639 1 2 1 1  70 GLN QE   .  70 . HE*  1 1 
       2640 1 1 1 1  67 ASN H    .  67 . HN   1 1 
       2640 1 2 1 1  67 ASN QB   .  67 . HB*  1 1 
       2641 1 1 1 1  67 ASN H    .  67 . HN   1 1 
       2641 1 2 1 1  68 GLU QB   .  68 . HB*  1 1 
       2642 1 1 1 1  67 ASN H    .  67 . HN   1 1 
       2642 1 2 1 1  70 GLN QB   .  70 . HB*  1 1 
       2643 1 1 1 1  67 ASN HA   .  67 . HA   1 1 
       2643 1 2 1 1  67 ASN QB   .  67 . HB*  1 1 
       2644 1 1 1 1  67 ASN HA   .  67 . HA   1 1 
       2644 1 2 1 1  70 GLN QB   .  70 . HB*  1 1 
       2645 1 1 1 1  67 ASN HA   .  67 . HA   1 1 
       2645 1 2 1 1  70 GLN QE   .  70 . HE*  1 1 
       2646 1 1 1 1  67 ASN QB   .  67 . HB*  1 1 
       2646 1 2 1 1  68 GLU QB   .  68 . HB*  1 1 
       2647 1 1 1 1  67 ASN QB   .  67 . HB*  1 1 
       2647 1 2 1 1  68 GLU QG   .  68 . HG*  1 1 
       2648 1 1 1 1  67 ASN QB   .  67 . HB*  1 1 
       2648 1 2 1 1  70 GLN QB   .  70 . HB*  1 1 
       2649 1 1 1 1  68 GLU H    .  68 . HN   1 1 
       2649 1 2 1 1  68 GLU QB   .  68 . HB*  1 1 
       2650 1 1 1 1  68 GLU H    .  68 . HN   1 1 
       2650 1 2 1 1  68 GLU QG   .  68 . HG*  1 1 
       2651 1 1 1 1  68 GLU HA   .  68 . HA   1 1 
       2651 1 2 1 1  68 GLU QG   .  68 . HG*  1 1 
       2652 1 1 1 1  68 GLU HA   .  68 . HA   1 1 
       2652 1 2 1 1  71 ASN QB   .  71 . HB*  1 1 
       2653 1 1 1 1  68 GLU HA   .  68 . HA   1 1 
       2653 1 2 1 1  72 GLU QG   .  72 . HG*  1 1 
       2654 1 1 1 1  68 GLU QB   .  68 . HB*  1 1 
       2654 1 2 1 1  68 GLU QG   .  68 . HG*  1 1 
       2655 1 1 1 1  68 GLU QB   .  68 . HB*  1 1 
       2655 1 2 1 1  69 PHE H    .  69 . HN   1 1 
       2656 1 1 1 1  68 GLU QG   .  68 . HG*  1 1 
       2656 1 2 1 1  69 PHE H    .  69 . HN   1 1 
       2657 1 1 1 1  69 PHE H    .  69 . HN   1 1 
       2657 1 2 1 1  70 GLN QG   .  70 . HG*  1 1 
       2658 1 1 1 1  69 PHE H    .  69 . HN   1 1 
       2658 1 2 1 1  71 ASN QB   .  71 . HB*  1 1 
       2659 1 1 1 1  69 PHE HA   .  69 . HA   1 1 
       2659 1 2 1 1  72 GLU QB   .  72 . HB*  1 1 
       2660 1 1 1 1  69 PHE HA   .  69 . HA   1 1 
       2660 1 2 1 1  72 GLU QG   .  72 . HG*  1 1 
       2661 1 1 1 1  69 PHE QB   .  69 . HB*  1 1 
       2661 1 2 1 1  70 GLN H    .  70 . HN   1 1 
       2662 1 1 1 1  69 PHE QB   .  69 . HB*  1 1 
       2662 1 2 1 1  70 GLN QG   .  70 . HG*  1 1 
       2663 1 1 1 1  69 PHE QD   .  69 . HD*  1 1 
       2663 1 2 1 1  70 GLN QG   .  70 . HG*  1 1 
       2664 1 1 1 1  69 PHE QE   .  69 . HE*  1 1 
       2664 1 2 1 1  80 TYR QB   .  80 . HB*  1 1 
       2665 1 1 1 1  69 PHE HZ   .  69 . HZ   1 1 
       2665 1 2 1 1  80 TYR QB   .  80 . HB*  1 1 
       2666 1 1 1 1  70 GLN H    .  70 . HN   1 1 
       2666 1 2 1 1  70 GLN QB   .  70 . HB*  1 1 
       2667 1 1 1 1  70 GLN H    .  70 . HN   1 1 
       2667 1 2 1 1  70 GLN QG   .  70 . HG*  1 1 
       2668 1 1 1 1  70 GLN H    .  70 . HN   1 1 
       2668 1 2 1 1  71 ASN QB   .  71 . HB*  1 1 
       2669 1 1 1 1  70 GLN HA   .  70 . HA   1 1 
       2669 1 2 1 1  70 GLN QG   .  70 . HG*  1 1 
       2670 1 1 1 1  70 GLN QB   .  70 . HB*  1 1 
       2670 1 2 1 1  71 ASN H    .  71 . HN   1 1 
       2671 1 1 1 1  70 GLN QB   .  70 . HB*  1 1 
       2671 1 2 1 1  71 ASN HA   .  71 . HA   1 1 
       2672 1 1 1 1  70 GLN QB   .  70 . HB*  1 1 
       2672 1 2 1 1  71 ASN QB   .  71 . HB*  1 1 
       2673 1 1 1 1  70 GLN QB   .  70 . HB*  1 1 
       2673 1 2 1 1  73 ALA MB   .  73 . HB*  1 1 
       2674 1 1 1 1  70 GLN QG   .  70 . HG*  1 1 
       2674 1 2 1 1  71 ASN H    .  71 . HN   1 1 
       2675 1 1 1 1  70 GLN QG   .  70 . HG*  1 1 
       2675 1 2 1 1  80 TYR QE   .  80 . HE*  1 1 
       2676 1 1 1 1  70 GLN QG   .  70 . HG*  1 1 
       2676 1 2 1 1  82 VAL MG2  .  82 . HG2* 1 1 
       2677 1 1 1 1  70 GLN QE   .  70 . HE*  1 1 
       2677 1 2 1 1  71 ASN H    .  71 . HN   1 1 
       2678 1 1 1 1  70 GLN QE   .  70 . HE*  1 1 
       2678 1 2 1 1  82 VAL MG2  .  82 . HG2* 1 1 
       2679 1 1 1 1  71 ASN H    .  71 . HN   1 1 
       2679 1 2 1 1  71 ASN QB   .  71 . HB*  1 1 
       2680 1 1 1 1  71 ASN HA   .  71 . HA   1 1 
       2680 1 2 1 1  74 LYS QB   .  74 . HB*  1 1 
       2681 1 1 1 1  71 ASN HA   .  71 . HA   1 1 
       2681 1 2 1 1  74 LYS QG   .  74 . HG*  1 1 
       2682 1 1 1 1  71 ASN HA   .  71 . HA   1 1 
       2682 1 2 1 1  74 LYS QD   .  74 . HD*  1 1 
       2683 1 1 1 1  71 ASN HA   .  71 . HA   1 1 
       2683 1 2 1 1  75 LYS QB   .  75 . HB*  1 1 
       2684 1 1 1 1  71 ASN HA   .  71 . HA   1 1 
       2684 1 2 1 1  75 LYS QG   .  75 . HG*  1 1 
       2685 1 1 1 1  71 ASN QB   .  71 . HB*  1 1 
       2685 1 2 1 1  72 GLU H    .  72 . HN   1 1 
       2686 1 1 1 1  71 ASN QB   .  71 . HB*  1 1 
       2686 1 2 1 1  72 GLU HA   .  72 . HA   1 1 
       2687 1 1 1 1  71 ASN QB   .  71 . HB*  1 1 
       2687 1 2 1 1  72 GLU QB   .  72 . HB*  1 1 
       2688 1 1 1 1  71 ASN QB   .  71 . HB*  1 1 
       2688 1 2 1 1  72 GLU QG   .  72 . HG*  1 1 
       2689 1 1 1 1  71 ASN QB   .  71 . HB*  1 1 
       2689 1 2 1 1  73 ALA H    .  73 . HN   1 1 
       2690 1 1 1 1  71 ASN QB   .  71 . HB*  1 1 
       2690 1 2 1 1  75 LYS H    .  75 . HN   1 1 
       2691 1 1 1 1  72 GLU H    .  72 . HN   1 1 
       2691 1 2 1 1  72 GLU QB   .  72 . HB*  1 1 
       2692 1 1 1 1  72 GLU HA   .  72 . HA   1 1 
       2692 1 2 1 1  72 GLU QG   .  72 . HG*  1 1 
       2693 1 1 1 1  72 GLU HA   .  72 . HA   1 1 
       2693 1 2 1 1  75 LYS QB   .  75 . HB*  1 1 
       2694 1 1 1 1  72 GLU HA   .  72 . HA   1 1 
       2694 1 2 1 1  75 LYS QG   .  75 . HG*  1 1 
       2695 1 1 1 1  72 GLU HA   .  72 . HA   1 1 
       2695 1 2 1 1  75 LYS QD   .  75 . HD*  1 1 
       2696 1 1 1 1  72 GLU HA   .  72 . HA   1 1 
       2696 1 2 1 1  75 LYS QE   .  75 . HE*  1 1 
       2697 1 1 1 1  72 GLU QB   .  72 . HB*  1 1 
       2697 1 2 1 1  73 ALA H    .  73 . HN   1 1 
       2698 1 1 1 1  72 GLU QB   .  72 . HB*  1 1 
       2698 1 2 1 1  73 ALA MB   .  73 . HB*  1 1 
       2699 1 1 1 1  72 GLU QG   .  72 . HG*  1 1 
       2699 1 2 1 1  73 ALA H    .  73 . HN   1 1 
       2700 1 1 1 1  72 GLU QG   .  72 . HG*  1 1 
       2700 1 2 1 1  75 LYS QG   .  75 . HG*  1 1 
       2701 1 1 1 1  73 ALA H    .  73 . HN   1 1 
       2701 1 2 1 1  76 GLU QG   .  76 . HG*  1 1 
       2702 1 1 1 1  73 ALA HA   .  73 . HA   1 1 
       2702 1 2 1 1  76 GLU QB   .  76 . HB*  1 1 
       2703 1 1 1 1  73 ALA MB   .  73 . HB*  1 1 
       2703 1 2 1 1  74 LYS QB   .  74 . HB*  1 1 
       2704 1 1 1 1  73 ALA MB   .  73 . HB*  1 1 
       2704 1 2 1 1  74 LYS QG   .  74 . HG*  1 1 
       2705 1 1 1 1  73 ALA MB   .  73 . HB*  1 1 
       2705 1 2 1 1  76 GLU QB   .  76 . HB*  1 1 
       2706 1 1 1 1  73 ALA MB   .  73 . HB*  1 1 
       2706 1 2 1 1  80 TYR QB   .  80 . HB*  1 1 
       2707 1 1 1 1  74 LYS H    .  74 . HN   1 1 
       2707 1 2 1 1  74 LYS QB   .  74 . HB*  1 1 
       2708 1 1 1 1  74 LYS H    .  74 . HN   1 1 
       2708 1 2 1 1  74 LYS QG   .  74 . HG*  1 1 
       2709 1 1 1 1  74 LYS H    .  74 . HN   1 1 
       2709 1 2 1 1  74 LYS QD   .  74 . HD*  1 1 
       2710 1 1 1 1  74 LYS HA   .  74 . HA   1 1 
       2710 1 2 1 1  74 LYS QG   .  74 . HG*  1 1 
       2711 1 1 1 1  74 LYS HA   .  74 . HA   1 1 
       2711 1 2 1 1  74 LYS QD   .  74 . HD*  1 1 
       2712 1 1 1 1  74 LYS QB   .  74 . HB*  1 1 
       2712 1 2 1 1  74 LYS QD   .  74 . HD*  1 1 
       2713 1 1 1 1  74 LYS QB   .  74 . HB*  1 1 
       2713 1 2 1 1  75 LYS H    .  75 . HN   1 1 
       2714 1 1 1 1  74 LYS QB   .  74 . HB*  1 1 
       2714 1 2 1 1  77 GLY H    .  77 . HN   1 1 
       2715 1 1 1 1  74 LYS QB   .  74 . HB*  1 1 
       2715 1 2 1 1  80 TYR QD   .  80 . HD*  1 1 
       2716 1 1 1 1  74 LYS QB   .  74 . HB*  1 1 
       2716 1 2 1 1  80 TYR QE   .  80 . HE*  1 1 
       2717 1 1 1 1  74 LYS QD   .  74 . HD*  1 1 
       2717 1 2 1 1  74 LYS QG   .  74 . HG*  1 1 
       2718 1 1 1 1  74 LYS QE   .  74 . HE*  1 1 
       2718 1 2 1 1  74 LYS QG   .  74 . HG*  1 1 
       2719 1 1 1 1  74 LYS QG   .  74 . HG*  1 1 
       2719 1 2 1 1  75 LYS H    .  75 . HN   1 1 
       2720 1 1 1 1  74 LYS QG   .  74 . HG*  1 1 
       2720 1 2 1 1  75 LYS HA   .  75 . HA   1 1 
       2721 1 1 1 1  74 LYS QG   .  74 . HG*  1 1 
       2721 1 2 1 1  75 LYS QB   .  75 . HB*  1 1 
       2722 1 1 1 1  74 LYS QG   .  74 . HG*  1 1 
       2722 1 2 1 1  80 TYR QD   .  80 . HD*  1 1 
       2723 1 1 1 1  74 LYS QG   .  74 . HG*  1 1 
       2723 1 2 1 1  80 TYR QE   .  80 . HE*  1 1 
       2724 1 1 1 1  74 LYS QD   .  74 . HD*  1 1 
       2724 1 2 1 1  75 LYS H    .  75 . HN   1 1 
       2725 1 1 1 1  74 LYS QE   .  74 . HE*  1 1 
       2725 1 2 1 1  75 LYS H    .  75 . HN   1 1 
       2726 1 1 1 1  74 LYS QE   .  74 . HE*  1 1 
       2726 1 2 1 1  75 LYS QB   .  75 . HB*  1 1 
       2727 1 1 1 1  75 LYS H    .  75 . HN   1 1 
       2727 1 2 1 1  75 LYS QB   .  75 . HB*  1 1 
       2728 1 1 1 1  75 LYS H    .  75 . HN   1 1 
       2728 1 2 1 1  75 LYS QG   .  75 . HG*  1 1 
       2729 1 1 1 1  75 LYS H    .  75 . HN   1 1 
       2729 1 2 1 1  75 LYS QD   .  75 . HD*  1 1 
       2730 1 1 1 1  75 LYS HA   .  75 . HA   1 1 
       2730 1 2 1 1  75 LYS QB   .  75 . HB*  1 1 
       2731 1 1 1 1  75 LYS HA   .  75 . HA   1 1 
       2731 1 2 1 1  75 LYS QE   .  75 . HE*  1 1 
       2732 1 1 1 1  75 LYS QB   .  75 . HB*  1 1 
       2732 1 2 1 1  75 LYS QD   .  75 . HD*  1 1 
       2733 1 1 1 1  75 LYS QB   .  75 . HB*  1 1 
       2733 1 2 1 1  75 LYS QE   .  75 . HE*  1 1 
       2734 1 1 1 1  75 LYS QB   .  75 . HB*  1 1 
       2734 1 2 1 1  76 GLU H    .  76 . HN   1 1 
       2735 1 1 1 1  75 LYS QD   .  75 . HD*  1 1 
       2735 1 2 1 1  75 LYS QG   .  75 . HG*  1 1 
       2736 1 1 1 1  75 LYS QE   .  75 . HE*  1 1 
       2736 1 2 1 1  75 LYS QG   .  75 . HG*  1 1 
       2737 1 1 1 1  75 LYS QG   .  75 . HG*  1 1 
       2737 1 2 1 1  76 GLU H    .  76 . HN   1 1 
       2738 1 1 1 1  75 LYS QG   .  75 . HG*  1 1 
       2738 1 2 1 1  76 GLU HA   .  76 . HA   1 1 
       2739 1 1 1 1  75 LYS QG   .  75 . HG*  1 1 
       2739 1 2 1 1  76 GLU QB   .  76 . HB*  1 1 
       2740 1 1 1 1  75 LYS QG   .  75 . HG*  1 1 
       2740 1 2 1 1  76 GLU QG   .  76 . HG*  1 1 
       2741 1 1 1 1  75 LYS QD   .  75 . HD*  1 1 
       2741 1 2 1 1  76 GLU H    .  76 . HN   1 1 
       2742 1 1 1 1  75 LYS QD   .  75 . HD*  1 1 
       2742 1 2 1 1  76 GLU QG   .  76 . HG*  1 1 
       2743 1 1 1 1  76 GLU H    .  76 . HN   1 1 
       2743 1 2 1 1  76 GLU QB   .  76 . HB*  1 1 
       2744 1 1 1 1  76 GLU H    .  76 . HN   1 1 
       2744 1 2 1 1  76 GLU QG   .  76 . HG*  1 1 
       2745 1 1 1 1  76 GLU HA   .  76 . HA   1 1 
       2745 1 2 1 1  76 GLU QG   .  76 . HG*  1 1 
       2746 1 1 1 1  76 GLU HA   .  76 . HA   1 1 
       2746 1 2 1 1  77 GLY QA   .  77 . HA*  1 1 
       2747 1 1 1 1  76 GLU QB   .  76 . HB*  1 1 
       2747 1 2 1 1  77 GLY H    .  77 . HN   1 1 
       2748 1 1 1 1  76 GLU QB   .  76 . HB*  1 1 
       2748 1 2 1 1  78 VAL HB   .  78 . HB   1 1 
       2749 1 1 1 1  76 GLU QB   .  76 . HB*  1 1 
       2749 1 2 1 1  78 VAL MG1  .  78 . HG1* 1 1 
       2750 1 1 1 1  76 GLU QB   .  76 . HB*  1 1 
       2750 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       2751 1 1 1 1  76 GLU QG   .  76 . HG*  1 1 
       2751 1 2 1 1  77 GLY H    .  77 . HN   1 1 
       2752 1 1 1 1  76 GLU QG   .  76 . HG*  1 1 
       2752 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       2753 1 1 1 1  77 GLY QA   .  77 . HA*  1 1 
       2753 1 2 1 1  78 VAL HB   .  78 . HB   1 1 
       2754 1 1 1 1  77 GLY QA   .  77 . HA*  1 1 
       2754 1 2 1 1  78 VAL MG2  .  78 . HG2* 1 1 
       2755 1 1 1 1  78 VAL MG1  .  78 . HG1* 1 1 
       2755 1 2 1 1  79 SER QB   .  79 . HB*  1 1 
       2756 1 1 1 1  78 VAL MG1  .  78 . HG1* 1 1 
       2756 1 2 1 1  80 TYR QB   .  80 . HB*  1 1 
       2757 1 1 1 1  79 SER H    .  79 . HN   1 1 
       2757 1 2 1 1  79 SER QB   .  79 . HB*  1 1 
       2758 1 1 1 1  79 SER QB   .  79 . HB*  1 1 
       2758 1 2 1 1  80 TYR H    .  80 . HN   1 1 
       2759 1 1 1 1  79 SER QB   .  79 . HB*  1 1 
       2759 1 2 1 1  80 TYR HA   .  80 . HA   1 1 
       2760 1 1 1 1  80 TYR H    .  80 . HN   1 1 
       2760 1 2 1 1  80 TYR QB   .  80 . HB*  1 1 
       2761 1 1 1 1  80 TYR HA   .  80 . HA   1 1 
       2761 1 2 1 1  81 ASP QB   .  81 . HB*  1 1 
       2762 1 1 1 1  80 TYR QB   .  80 . HB*  1 1 
       2762 1 2 1 1  81 ASP H    .  81 . HN   1 1 
       2763 1 1 1 1  81 ASP H    .  81 . HN   1 1 
       2763 1 2 1 1  81 ASP QB   .  81 . HB*  1 1 
       2764 1 1 1 1  81 ASP QB   .  81 . HB*  1 1 
       2764 1 2 1 1  82 VAL H    .  82 . HN   1 1 
       2765 1 1 1 1  81 ASP QB   .  81 . HB*  1 1 
       2765 1 2 1 1  82 VAL MG1  .  82 . HG1* 1 1 
       2766 1 1 1 1  81 ASP QB   .  81 . HB*  1 1 
       2766 1 2 1 1  98 PHE QD   .  98 . HD*  1 1 
       2767 1 1 1 1  81 ASP QB   .  81 . HB*  1 1 
       2767 1 2 1 1  98 PHE QE   .  98 . HE*  1 1 
       2768 1 1 1 1  82 VAL MG1  .  82 . HG1* 1 1 
       2768 1 2 1 1  84 LYS QB   .  84 . HB*  1 1 
       2769 1 1 1 1  82 VAL MG1  .  82 . HG1* 1 1 
       2769 1 2 1 1  84 LYS QD   .  84 . HD*  1 1 
       2770 1 1 1 1  82 VAL MG1  .  82 . HG1* 1 1 
       2770 1 2 1 1  84 LYS QE   .  84 . HE*  1 1 
       2771 1 1 1 1  82 VAL MG2  .  82 . HG2* 1 1 
       2771 1 2 1 1  84 LYS QE   .  84 . HE*  1 1 
       2772 1 1 1 1  83 LEU H    .  83 . HN   1 1 
       2772 1 2 1 1  83 LEU QB   .  83 . HB*  1 1 
       2773 1 1 1 1  83 LEU HA   .  83 . HA   1 1 
       2773 1 2 1 1  84 LYS QB   .  84 . HB*  1 1 
       2774 1 1 1 1  83 LEU QB   .  83 . HB*  1 1 
       2774 1 2 1 1  83 LEU MD1  .  83 . HD1* 1 1 
       2775 1 1 1 1  83 LEU QB   .  83 . HB*  1 1 
       2775 1 2 1 1  84 LYS H    .  84 . HN   1 1 
       2776 1 1 1 1  83 LEU QB   .  83 . HB*  1 1 
       2776 1 2 1 1  91 LEU HA   .  91 . HA   1 1 
       2777 1 1 1 1  83 LEU HG   .  83 . HG   1 1 
       2777 1 2 1 1  85 SER QB   .  85 . HB*  1 1 
       2778 1 1 1 1  83 LEU MD1  .  83 . HD1* 1 1 
       2778 1 2 1 1  85 SER QB   .  85 . HB*  1 1 
       2779 1 1 1 1  83 LEU MD1  .  83 . HD1* 1 1 
       2779 1 2 1 1  90 GLU QG   .  90 . HG*  1 1 
       2780 1 1 1 1  83 LEU MD1  .  83 . HD1* 1 1 
       2780 1 2 1 1  94 ARG QB   .  94 . HB*  1 1 
       2781 1 1 1 1  83 LEU MD1  .  83 . HD1* 1 1 
       2781 1 2 1 1  94 ARG QG   .  94 . HG*  1 1 
       2782 1 1 1 1  83 LEU MD1  .  83 . HD1* 1 1 
       2782 1 2 1 1  94 ARG QD   .  94 . HD*  1 1 
       2783 1 1 1 1  83 LEU MD2  .  83 . HD2* 1 1 
       2783 1 2 1 1  85 SER QB   .  85 . HB*  1 1 
       2784 1 1 1 1  83 LEU MD2  .  83 . HD2* 1 1 
       2784 1 2 1 1  91 LEU QB   .  91 . HB*  1 1 
       2785 1 1 1 1  83 LEU MD2  .  83 . HD2* 1 1 
       2785 1 2 1 1  94 ARG QB   .  94 . HB*  1 1 
       2786 1 1 1 1  83 LEU MD2  .  83 . HD2* 1 1 
       2786 1 2 1 1  94 ARG QG   .  94 . HG*  1 1 
       2787 1 1 1 1  83 LEU MD2  .  83 . HD2* 1 1 
       2787 1 2 1 1  94 ARG QD   .  94 . HD*  1 1 
       2788 1 1 1 1  84 LYS H    .  84 . HN   1 1 
       2788 1 2 1 1  84 LYS QG   .  84 . HG*  1 1 
       2789 1 1 1 1  84 LYS H    .  84 . HN   1 1 
       2789 1 2 1 1  84 LYS QD   .  84 . HD*  1 1 
       2790 1 1 1 1  84 LYS H    .  84 . HN   1 1 
       2790 1 2 1 1  85 SER QB   .  85 . HB*  1 1 
       2791 1 1 1 1  84 LYS HA   .  84 . HA   1 1 
       2791 1 2 1 1  84 LYS QG   .  84 . HG*  1 1 
       2792 1 1 1 1  84 LYS HA   .  84 . HA   1 1 
       2792 1 2 1 1  84 LYS QD   .  84 . HD*  1 1 
       2793 1 1 1 1  84 LYS HA   .  84 . HA   1 1 
       2793 1 2 1 1  84 LYS QE   .  84 . HE*  1 1 
       2794 1 1 1 1  84 LYS HA   .  84 . HA   1 1 
       2794 1 2 1 1  85 SER QB   .  85 . HB*  1 1 
       2795 1 1 1 1  84 LYS QB   .  84 . HB*  1 1 
       2795 1 2 1 1  84 LYS QD   .  84 . HD*  1 1 
       2796 1 1 1 1  84 LYS QB   .  84 . HB*  1 1 
       2796 1 2 1 1  84 LYS QE   .  84 . HE*  1 1 
       2797 1 1 1 1  84 LYS QB   .  84 . HB*  1 1 
       2797 1 2 1 1  85 SER H    .  85 . HN   1 1 
       2798 1 1 1 1  84 LYS QB   .  84 . HB*  1 1 
       2798 1 2 1 1  85 SER HA   .  85 . HA   1 1 
       2799 1 1 1 1  84 LYS QE   .  84 . HE*  1 1 
       2799 1 2 1 1  84 LYS QG   .  84 . HG*  1 1 
       2800 1 1 1 1  84 LYS QG   .  84 . HG*  1 1 
       2800 1 2 1 1  85 SER H    .  85 . HN   1 1 
       2801 1 1 1 1  84 LYS QD   .  84 . HD*  1 1 
       2801 1 2 1 1  85 SER H    .  85 . HN   1 1 
       2802 1 1 1 1  85 SER H    .  85 . HN   1 1 
       2802 1 2 1 1  85 SER QB   .  85 . HB*  1 1 
       2803 1 1 1 1  85 SER QB   .  85 . HB*  1 1 
       2803 1 2 1 1  86 THR MG   .  86 . HG2* 1 1 
       2804 1 1 1 1  85 SER QB   .  85 . HB*  1 1 
       2804 1 2 1 1  87 ASP H    .  87 . HN   1 1 
       2805 1 1 1 1  85 SER QB   .  85 . HB*  1 1 
       2805 1 2 1 1  90 GLU QB   .  90 . HB*  1 1 
       2806 1 1 1 1  85 SER QB   .  85 . HB*  1 1 
       2806 1 2 1 1  91 LEU H    .  91 . HN   1 1 
       2807 1 1 1 1  85 SER QB   .  85 . HB*  1 1 
       2807 1 2 1 1  91 LEU HA   .  91 . HA   1 1 
       2808 1 1 1 1  85 SER QB   .  85 . HB*  1 1 
       2808 1 2 1 1  91 LEU QB   .  91 . HB*  1 1 
       2809 1 1 1 1  85 SER QB   .  85 . HB*  1 1 
       2809 1 2 1 1  91 LEU HG   .  91 . HG   1 1 
       2810 1 1 1 1  85 SER QB   .  85 . HB*  1 1 
       2810 1 2 1 1  91 LEU MD1  .  91 . HD1* 1 1 
       2811 1 1 1 1  85 SER QB   .  85 . HB*  1 1 
       2811 1 2 1 1  91 LEU MD2  .  91 . HD2* 1 1 
       2812 1 1 1 1  87 ASP H    .  87 . HN   1 1 
       2812 1 2 1 1  87 ASP QB   .  87 . HB*  1 1 
       2813 1 1 1 1  87 ASP H    .  87 . HN   1 1 
       2813 1 2 1 1  88 PRO QD   .  88 . HD*  1 1 
       2814 1 1 1 1  87 ASP H    .  87 . HN   1 1 
       2814 1 2 1 1  90 GLU QB   .  90 . HB*  1 1 
       2815 1 1 1 1  87 ASP HA   .  87 . HA   1 1 
       2815 1 2 1 1  88 PRO QB   .  88 . HB*  1 1 
       2816 1 1 1 1  87 ASP HA   .  87 . HA   1 1 
       2816 1 2 1 1  88 PRO QG   .  88 . HG*  1 1 
       2817 1 1 1 1  87 ASP HA   .  87 . HA   1 1 
       2817 1 2 1 1  88 PRO QD   .  88 . HD*  1 1 
       2818 1 1 1 1  87 ASP QB   .  87 . HB*  1 1 
       2818 1 2 1 1  88 PRO HA   .  88 . HA   1 1 
       2819 1 1 1 1  87 ASP QB   .  87 . HB*  1 1 
       2819 1 2 1 1  88 PRO QG   .  88 . HG*  1 1 
       2820 1 1 1 1  87 ASP QB   .  87 . HB*  1 1 
       2820 1 2 1 1  88 PRO QD   .  88 . HD*  1 1 
       2821 1 1 1 1  87 ASP QB   .  87 . HB*  1 1 
       2821 1 2 1 1  89 GLU QG   .  89 . HG*  1 1 
       2822 1 1 1 1  87 ASP QB   .  87 . HB*  1 1 
       2822 1 2 1 1  90 GLU H    .  90 . HN   1 1 
       2823 1 1 1 1  87 ASP QB   .  87 . HB*  1 1 
       2823 1 2 1 1  90 GLU HA   .  90 . HA   1 1 
       2824 1 1 1 1  87 ASP QB   .  87 . HB*  1 1 
       2824 1 2 1 1  90 GLU QB   .  90 . HB*  1 1 
       2825 1 1 1 1  87 ASP QB   .  87 . HB*  1 1 
       2825 1 2 1 1  91 LEU H    .  91 . HN   1 1 
       2826 1 1 1 1  87 ASP QB   .  87 . HB*  1 1 
       2826 1 2 1 1  91 LEU HG   .  91 . HG   1 1 
       2827 1 1 1 1  88 PRO HA   .  88 . HA   1 1 
       2827 1 2 1 1  91 LEU QB   .  91 . HB*  1 1 
       2828 1 1 1 1  88 PRO QB   .  88 . HB*  1 1 
       2828 1 2 1 1  89 GLU H    .  89 . HN   1 1 
       2829 1 1 1 1  88 PRO QB   .  88 . HB*  1 1 
       2829 1 2 1 1  89 GLU HA   .  89 . HA   1 1 
       2830 1 1 1 1  88 PRO QB   .  88 . HB*  1 1 
       2830 1 2 1 1  91 LEU QB   .  91 . HB*  1 1 
       2831 1 1 1 1  88 PRO QB   .  88 . HB*  1 1 
       2831 1 2 1 1  91 LEU MD1  .  91 . HD1* 1 1 
       2832 1 1 1 1  88 PRO QB   .  88 . HB*  1 1 
       2832 1 2 1 1  92 THR H    .  92 . HN   1 1 
       2833 1 1 1 1  88 PRO QG   .  88 . HG*  1 1 
       2833 1 2 1 1  89 GLU H    .  89 . HN   1 1 
       2834 1 1 1 1  88 PRO QG   .  88 . HG*  1 1 
       2834 1 2 1 1  90 GLU H    .  90 . HN   1 1 
       2835 1 1 1 1  88 PRO QD   .  88 . HD*  1 1 
       2835 1 2 1 1  89 GLU H    .  89 . HN   1 1 
       2836 1 1 1 1  88 PRO QD   .  88 . HD*  1 1 
       2836 1 2 1 1  89 GLU QG   .  89 . HG*  1 1 
       2837 1 1 1 1  88 PRO QD   .  88 . HD*  1 1 
       2837 1 2 1 1  90 GLU H    .  90 . HN   1 1 
       2838 1 1 1 1  89 GLU H    .  89 . HN   1 1 
       2838 1 2 1 1  89 GLU QB   .  89 . HB*  1 1 
       2839 1 1 1 1  89 GLU H    .  89 . HN   1 1 
       2839 1 2 1 1  89 GLU QG   .  89 . HG*  1 1 
       2840 1 1 1 1  89 GLU HA   .  89 . HA   1 1 
       2840 1 2 1 1  93 GLN QG   .  93 . HG*  1 1 
       2841 1 1 1 1  89 GLU QB   .  89 . HB*  1 1 
       2841 1 2 1 1  89 GLU QG   .  89 . HG*  1 1 
       2842 1 1 1 1  89 GLU QB   .  89 . HB*  1 1 
       2842 1 2 1 1  90 GLU H    .  90 . HN   1 1 
       2843 1 1 1 1  89 GLU QG   .  89 . HG*  1 1 
       2843 1 2 1 1  90 GLU H    .  90 . HN   1 1 
       2844 1 1 1 1  90 GLU HA   .  90 . HA   1 1 
       2844 1 2 1 1  90 GLU QG   .  90 . HG*  1 1 
       2845 1 1 1 1  90 GLU HA   .  90 . HA   1 1 
       2845 1 2 1 1  93 GLN QB   .  93 . HB*  1 1 
       2846 1 1 1 1  90 GLU HA   .  90 . HA   1 1 
       2846 1 2 1 1  93 GLN QG   .  93 . HG*  1 1 
       2847 1 1 1 1  90 GLU QB   .  90 . HB*  1 1 
       2847 1 2 1 1  90 GLU QG   .  90 . HG*  1 1 
       2848 1 1 1 1  90 GLU QB   .  90 . HB*  1 1 
       2848 1 2 1 1  91 LEU H    .  91 . HN   1 1 
       2849 1 1 1 1  90 GLU QB   .  90 . HB*  1 1 
       2849 1 2 1 1  91 LEU HA   .  91 . HA   1 1 
       2850 1 1 1 1  90 GLU QB   .  90 . HB*  1 1 
       2850 1 2 1 1  91 LEU QB   .  91 . HB*  1 1 
       2851 1 1 1 1  90 GLU QB   .  90 . HB*  1 1 
       2851 1 2 1 1  91 LEU MD1  .  91 . HD1* 1 1 
       2852 1 1 1 1  90 GLU QB   .  90 . HB*  1 1 
       2852 1 2 1 1  91 LEU MD2  .  91 . HD2* 1 1 
       2853 1 1 1 1  90 GLU QB   .  90 . HB*  1 1 
       2853 1 2 1 1  92 THR H    .  92 . HN   1 1 
       2854 1 1 1 1  90 GLU QG   .  90 . HG*  1 1 
       2854 1 2 1 1  91 LEU H    .  91 . HN   1 1 
       2855 1 1 1 1  90 GLU QG   .  90 . HG*  1 1 
       2855 1 2 1 1  94 ARG H    .  94 . HN   1 1 
       2856 1 1 1 1  90 GLU QG   .  90 . HG*  1 1 
       2856 1 2 1 1  94 ARG QG   .  94 . HG*  1 1 
       2857 1 1 1 1  90 GLU QG   .  90 . HG*  1 1 
       2857 1 2 1 1  94 ARG QD   .  94 . HD*  1 1 
       2858 1 1 1 1  91 LEU HA   .  91 . HA   1 1 
       2858 1 2 1 1  94 ARG QB   .  94 . HB*  1 1 
       2859 1 1 1 1  91 LEU HA   .  91 . HA   1 1 
       2859 1 2 1 1  94 ARG QG   .  94 . HG*  1 1 
       2860 1 1 1 1  91 LEU QB   .  91 . HB*  1 1 
       2860 1 2 1 1  92 THR H    .  92 . HN   1 1 
       2861 1 1 1 1  91 LEU QB   .  91 . HB*  1 1 
       2861 1 2 1 1  92 THR HA   .  92 . HA   1 1 
       2862 1 1 1 1  91 LEU QB   .  91 . HB*  1 1 
       2862 1 2 1 1  92 THR HB   .  92 . HB   1 1 
       2863 1 1 1 1  91 LEU QB   .  91 . HB*  1 1 
       2863 1 2 1 1  95 VAL MG2  .  95 . HG2* 1 1 
       2864 1 1 1 1  92 THR H    .  92 . HN   1 1 
       2864 1 2 1 1  94 ARG QB   .  94 . HB*  1 1 
       2865 1 1 1 1  92 THR HA   .  92 . HA   1 1 
       2865 1 2 1 1  96 ARG QG   .  96 . HG*  1 1 
       2866 1 1 1 1  92 THR HB   .  92 . HB   1 1 
       2866 1 2 1 1  93 GLN QB   .  93 . HB*  1 1 
       2867 1 1 1 1  92 THR HB   .  92 . HB   1 1 
       2867 1 2 1 1  93 GLN QG   .  93 . HG*  1 1 
       2868 1 1 1 1  92 THR MG   .  92 . HG2* 1 1 
       2868 1 2 1 1  93 GLN QB   .  93 . HB*  1 1 
       2869 1 1 1 1  92 THR MG   .  92 . HG2* 1 1 
       2869 1 2 1 1  93 GLN QE   .  93 . HE*  1 1 
       2870 1 1 1 1  92 THR MG   .  92 . HG2* 1 1 
       2870 1 2 1 1  96 ARG QB   .  96 . HB*  1 1 
       2871 1 1 1 1  92 THR MG   .  92 . HG2* 1 1 
       2871 1 2 1 1  96 ARG QG   .  96 . HG*  1 1 
       2872 1 1 1 1  92 THR MG   .  92 . HG2* 1 1 
       2872 1 2 1 1  96 ARG QD   .  96 . HD*  1 1 
       2873 1 1 1 1  93 GLN H    .  93 . HN   1 1 
       2873 1 2 1 1  93 GLN QB   .  93 . HB*  1 1 
       2874 1 1 1 1  93 GLN HA   .  93 . HA   1 1 
       2874 1 2 1 1  93 GLN QG   .  93 . HG*  1 1 
       2875 1 1 1 1  93 GLN HA   .  93 . HA   1 1 
       2875 1 2 1 1  93 GLN QE   .  93 . HE*  1 1 
       2876 1 1 1 1  93 GLN HA   .  93 . HA   1 1 
       2876 1 2 1 1  96 ARG QG   .  96 . HG*  1 1 
       2877 1 1 1 1  93 GLN HA   .  93 . HA   1 1 
       2877 1 2 1 1  96 ARG QD   .  96 . HD*  1 1 
       2878 1 1 1 1  93 GLN QB   .  93 . HB*  1 1 
       2878 1 2 1 1  94 ARG H    .  94 . HN   1 1 
       2879 1 1 1 1  93 GLN QB   .  93 . HB*  1 1 
       2879 1 2 1 1  96 ARG QD   .  96 . HD*  1 1 
       2880 1 1 1 1  93 GLN QG   .  93 . HG*  1 1 
       2880 1 2 1 1  94 ARG HA   .  94 . HA   1 1 
       2881 1 1 1 1  93 GLN QG   .  93 . HG*  1 1 
       2881 1 2 1 1  94 ARG QB   .  94 . HB*  1 1 
       2882 1 1 1 1  93 GLN QG   .  93 . HG*  1 1 
       2882 1 2 1 1  94 ARG QG   .  94 . HG*  1 1 
       2883 1 1 1 1  93 GLN QG   .  93 . HG*  1 1 
       2883 1 2 1 1  94 ARG QD   .  94 . HD*  1 1 
       2884 1 1 1 1  93 GLN QG   .  93 . HG*  1 1 
       2884 1 2 1 1  96 ARG QD   .  96 . HD*  1 1 
       2885 1 1 1 1  93 GLN QE   .  93 . HE*  1 1 
       2885 1 2 1 1  96 ARG QD   .  96 . HD*  1 1 
       2886 1 1 1 1  93 GLN QE   .  93 . HE*  1 1 
       2886 1 2 1 1  97 GLU QG   .  97 . HG*  1 1 
       2887 1 1 1 1  94 ARG H    .  94 . HN   1 1 
       2887 1 2 1 1  94 ARG QB   .  94 . HB*  1 1 
       2888 1 1 1 1  94 ARG H    .  94 . HN   1 1 
       2888 1 2 1 1  94 ARG QG   .  94 . HG*  1 1 
       2889 1 1 1 1  94 ARG H    .  94 . HN   1 1 
       2889 1 2 1 1  94 ARG QD   .  94 . HD*  1 1 
       2890 1 1 1 1  94 ARG HA   .  94 . HA   1 1 
       2890 1 2 1 1  94 ARG QG   .  94 . HG*  1 1 
       2891 1 1 1 1  94 ARG HA   .  94 . HA   1 1 
       2891 1 2 1 1  94 ARG QD   .  94 . HD*  1 1 
       2892 1 1 1 1  94 ARG HA   .  94 . HA   1 1 
       2892 1 2 1 1  97 GLU QB   .  97 . HB*  1 1 
       2893 1 1 1 1  94 ARG HA   .  94 . HA   1 1 
       2893 1 2 1 1  97 GLU QG   .  97 . HG*  1 1 
       2894 1 1 1 1  94 ARG QB   .  94 . HB*  1 1 
       2894 1 2 1 1  94 ARG QD   .  94 . HD*  1 1 
       2895 1 1 1 1  94 ARG QB   .  94 . HB*  1 1 
       2895 1 2 1 1  95 VAL H    .  95 . HN   1 1 
       2896 1 1 1 1  94 ARG QB   .  94 . HB*  1 1 
       2896 1 2 1 1  95 VAL HA   .  95 . HA   1 1 
       2897 1 1 1 1  94 ARG QB   .  94 . HB*  1 1 
       2897 1 2 1 1  95 VAL HB   .  95 . HB   1 1 
       2898 1 1 1 1  94 ARG QB   .  94 . HB*  1 1 
       2898 1 2 1 1  95 VAL MG2  .  95 . HG2* 1 1 
       2899 1 1 1 1  94 ARG QG   .  94 . HG*  1 1 
       2899 1 2 1 1  95 VAL H    .  95 . HN   1 1 
       2900 1 1 1 1  94 ARG QD   .  94 . HD*  1 1 
       2900 1 2 1 1  95 VAL H    .  95 . HN   1 1 
       2901 1 1 1 1  94 ARG QD   .  94 . HD*  1 1 
       2901 1 2 1 1  97 GLU QB   .  97 . HB*  1 1 
       2902 1 1 1 1  95 VAL HA   .  95 . HA   1 1 
       2902 1 2 1 1  98 PHE QB   .  98 . HB*  1 1 
       2903 1 1 1 1  95 VAL MG1  .  95 . HG1* 1 1 
       2903 1 2 1 1  96 ARG QG   .  96 . HG*  1 1 
       2904 1 1 1 1  95 VAL MG1  .  95 . HG1* 1 1 
       2904 1 2 1 1  98 PHE QB   .  98 . HB*  1 1 
       2905 1 1 1 1  95 VAL MG2  .  95 . HG2* 1 1 
       2905 1 2 1 1  96 ARG QG   .  96 . HG*  1 1 
       2906 1 1 1 1  96 ARG H    .  96 . HN   1 1 
       2906 1 2 1 1  96 ARG QB   .  96 . HB*  1 1 
       2907 1 1 1 1  96 ARG H    .  96 . HN   1 1 
       2907 1 2 1 1  96 ARG QG   .  96 . HG*  1 1 
       2908 1 1 1 1  96 ARG H    .  96 . HN   1 1 
       2908 1 2 1 1  96 ARG QD   .  96 . HD*  1 1 
       2909 1 1 1 1  96 ARG HA   .  96 . HA   1 1 
       2909 1 2 1 1  96 ARG QG   .  96 . HG*  1 1 
       2910 1 1 1 1  96 ARG HA   .  96 . HA   1 1 
       2910 1 2 1 1  96 ARG QD   .  96 . HD*  1 1 
       2911 1 1 1 1  96 ARG HA   .  96 . HA   1 1 
       2911 1 2 1 1  99 LEU QB   .  99 . HB*  1 1 
       2912 1 1 1 1  96 ARG QB   .  96 . HB*  1 1 
       2912 1 2 1 1  96 ARG QG   .  96 . HG*  1 1 
       2913 1 1 1 1  96 ARG QB   .  96 . HB*  1 1 
       2913 1 2 1 1  96 ARG QD   .  96 . HD*  1 1 
       2914 1 1 1 1  96 ARG QB   .  96 . HB*  1 1 
       2914 1 2 1 1  97 GLU H    .  97 . HN   1 1 
       2915 1 1 1 1  96 ARG QB   .  96 . HB*  1 1 
       2915 1 2 1 1  97 GLU HA   .  97 . HA   1 1 
       2916 1 1 1 1  96 ARG QG   .  96 . HG*  1 1 
       2916 1 2 1 1  97 GLU H    .  97 . HN   1 1 
       2917 1 1 1 1  96 ARG QG   .  96 . HG*  1 1 
       2917 1 2 1 1  97 GLU QG   .  97 . HG*  1 1 
       2918 1 1 1 1  96 ARG QG   .  96 . HG*  1 1 
       2918 1 2 1 1  99 LEU MD1  .  99 . HD1* 1 1 
       2919 1 1 1 1  96 ARG QD   .  96 . HD*  1 1 
       2919 1 2 1 1  97 GLU H    .  97 . HN   1 1 
       2920 1 1 1 1  96 ARG QD   .  96 . HD*  1 1 
       2920 1 2 1 1  97 GLU QG   .  97 . HG*  1 1 
       2921 1 1 1 1  97 GLU H    .  97 . HN   1 1 
       2921 1 2 1 1  97 GLU QB   .  97 . HB*  1 1 
       2922 1 1 1 1  97 GLU H    .  97 . HN   1 1 
       2922 1 2 1 1  97 GLU QG   .  97 . HG*  1 1 
       2923 1 1 1 1  97 GLU H    .  97 . HN   1 1 
       2923 1 2 1 1  98 PHE QB   .  98 . HB*  1 1 
       2924 1 1 1 1  97 GLU HA   .  97 . HA   1 1 
       2924 1 2 1 1  97 GLU QG   .  97 . HG*  1 1 
       2925 1 1 1 1  97 GLU QB   .  97 . HB*  1 1 
       2925 1 2 1 1  98 PHE HA   .  98 . HA   1 1 
       2926 1 1 1 1  97 GLU QG   .  97 . HG*  1 1 
       2926 1 2 1 1  98 PHE H    .  98 . HN   1 1 
       2927 1 1 1 1  98 PHE H    .  98 . HN   1 1 
       2927 1 2 1 1  99 LEU QB   .  99 . HB*  1 1 
       2928 1 1 1 1  98 PHE H    .  98 . HN   1 1 
       2928 1 2 1 1 100 LYS QB   . 100 . HB*  1 1 
       2929 1 1 1 1  98 PHE QB   .  98 . HB*  1 1 
       2929 1 2 1 1  99 LEU H    .  99 . HN   1 1 
       2930 1 1 1 1  98 PHE QB   .  98 . HB*  1 1 
       2930 1 2 1 1 101 THR MG   . 101 . HG2* 1 1 
       2931 1 1 1 1  98 PHE QB   .  98 . HB*  1 1 
       2931 1 2 1 1 102 ALA MB   . 102 . HB*  1 1 
       2932 1 1 1 1  99 LEU QB   .  99 . HB*  1 1 
       2932 1 2 1 1 100 LYS H    . 100 . HN   1 1 
       2933 1 1 1 1 100 LYS H    . 100 . HN   1 1 
       2933 1 2 1 1 100 LYS QB   . 100 . HB*  1 1 
       2934 1 1 1 1 100 LYS H    . 100 . HN   1 1 
       2934 1 2 1 1 100 LYS QG   . 100 . HG*  1 1 
       2935 1 1 1 1 100 LYS H    . 100 . HN   1 1 
       2935 1 2 1 1 100 LYS QD   . 100 . HD*  1 1 
       2936 1 1 1 1 100 LYS HA   . 100 . HA   1 1 
       2936 1 2 1 1 100 LYS QG   . 100 . HG*  1 1 
       2937 1 1 1 1 100 LYS HA   . 100 . HA   1 1 
       2937 1 2 1 1 100 LYS QD   . 100 . HD*  1 1 
       2938 1 1 1 1 100 LYS QB   . 100 . HB*  1 1 
       2938 1 2 1 1 101 THR H    . 101 . HN   1 1 
       2939 1 1 1 1 100 LYS QB   . 100 . HB*  1 1 
       2939 1 2 1 1 101 THR HA   . 101 . HA   1 1 
       2940 1 1 1 1 100 LYS QB   . 100 . HB*  1 1 
       2940 1 2 1 1 101 THR HB   . 101 . HB   1 1 
       2941 1 1 1 1 100 LYS QB   . 100 . HB*  1 1 
       2941 1 2 1 1 101 THR MG   . 101 . HG2* 1 1 
       2942 1 1 1 1 100 LYS QE   . 100 . HE*  1 1 
       2942 1 2 1 1 100 LYS QG   . 100 . HG*  1 1 
       2943 1 1 1 1 100 LYS QG   . 100 . HG*  1 1 
       2943 1 2 1 1 101 THR H    . 101 . HN   1 1 
       2944 1 1 1 1 100 LYS QG   . 100 . HG*  1 1 
       2944 1 2 1 1 101 THR HA   . 101 . HA   1 1 
       2945 1 1 1 1 102 ALA MB   . 102 . HB*  1 1 
       2945 1 2 1 1 103 GLY QA   . 103 . HA*  1 1 
       2946 1 1 1 1 105 LEU QB   . 105 . HB*  1 1 
       2946 1 2 1 1 106 GLU H    . 106 . HN   1 1 
       2947 1 1 1 1 106 GLU H    . 106 . HN   1 1 
       2947 1 2 1 1 106 GLU QB   . 106 . HB*  1 1 
       2948 1 1 1 1 106 GLU H    . 106 . HN   1 1 
       2948 1 2 1 1 106 GLU QG   . 106 . HG*  1 1 
       2949 1 1 1 1 106 GLU HA   . 106 . HA   1 1 
       2949 1 2 1 1 106 GLU QG   . 106 . HG*  1 1 
       2950 1 1 1 1 107 HIS H    . 107 . HN   1 1 
       2950 1 2 1 1 107 HIS QB   . 107 . HB*  1 1 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

          1 1 . . . . . 2.96 1.8  3.4 1 1 
          2 1 . . . . . 4.53 1.8 5.21 1 1 
          3 1 . . . . . 4.53 1.8 5.21 1 1 
          4 1 . . . . .  4.4 1.8 5.06 1 1 
          5 1 . . . . . 5.04 1.8  5.8 1 1 
          6 1 . . . . . 5.04 1.8  5.8 1 1 
          7 1 . . . . . 4.53 1.8 5.21 1 1 
          8 1 . . . . . 2.97 1.8 3.42 1 1 
          9 1 . . . . . 4.51 1.8 5.19 1 1 
         10 1 . . . . . 3.92 1.8 4.51 1 1 
         11 1 . . . . . 3.28 1.8 3.77 1 1 
         12 1 . . . . . 3.13 1.8  3.6 1 1 
         13 1 . . . . . 5.15 1.8 5.92 1 1 
         14 1 . . . . . 5.15 1.8 5.92 1 1 
         15 1 . . . . . 4.23 1.8 4.86 1 1 
         16 1 . . . . . 5.26 1.8 6.05 1 1 
         17 1 . . . . . 3.17 1.8 3.65 1 1 
         18 1 . . . . . 3.88 1.8 4.46 1 1 
         19 1 . . . . . 5.26 1.8 6.05 1 1 
         20 1 . . . . . 4.59 1.8 5.28 1 1 
         21 1 . . . . . 5.32 1.8 6.12 1 1 
         22 1 . . . . . 4.51 1.8 5.19 1 1 
         23 1 . . . . . 3.48 1.8  4.0 1 1 
         24 1 . . . . . 4.58 1.8 5.27 1 1 
         25 1 . . . . . 2.87 1.8  3.3 1 1 
         26 1 . . . . . 4.31 1.8 4.96 1 1 
         27 1 . . . . . 3.09 1.8 3.55 1 1 
         28 1 . . . . .  5.4 1.8 6.21 1 1 
         29 1 . . . . .  5.4 1.8 6.21 1 1 
         30 1 . . . . . 5.45 1.8 6.27 1 1 
         31 1 . . . . . 5.09 1.8 5.85 1 1 
         32 1 . . . . . 4.86 1.8 5.59 1 1 
         33 1 . . . . . 4.62 1.8 5.31 1 1 
         34 1 . . . . . 5.28 1.8 6.07 1 1 
         35 1 . . . . . 3.99 1.8 4.59 1 1 
         36 1 . . . . . 3.99 1.8 4.59 1 1 
         37 1 . . . . . 3.34 1.8 3.84 1 1 
         38 1 . . . . . 3.54 1.8 4.07 1 1 
         39 1 . . . . . 3.64 1.8 4.19 1 1 
         40 1 . . . . . 4.55 1.8 5.23 1 1 
         41 1 . . . . . 3.51 1.8 4.04 1 1 
         42 1 . . . . . 3.36 1.8 3.86 1 1 
         43 1 . . . . .  3.6 1.8 4.14 1 1 
         44 1 . . . . . 4.85 1.8 5.58 1 1 
         45 1 . . . . . 5.17 1.8 5.95 1 1 
         46 1 . . . . . 3.62 1.8 4.16 1 1 
         47 1 . . . . .  3.7 1.8 4.26 1 1 
         48 1 . . . . . 3.29 1.8 3.78 1 1 
         49 1 . . . . . 3.27 1.8 3.76 1 1 
         50 1 . . . . . 3.88 1.8 4.46 1 1 
         51 1 . . . . . 4.16 1.8 4.78 1 1 
         52 1 . . . . . 3.25 1.8 3.74 1 1 
         53 1 . . . . . 3.31 1.8 3.81 1 1 
         54 1 . . . . . 4.53 1.8 5.21 1 1 
         55 1 . . . . . 4.53 1.8 5.21 1 1 
         56 1 . . . . . 5.15 1.8 5.92 1 1 
         57 1 . . . . . 5.15 1.8 5.92 1 1 
         58 1 . . . . . 3.79 1.8 4.36 1 1 
         59 1 . . . . . 4.43 1.8 5.09 1 1 
         60 1 . . . . .  5.5 1.8 6.33 1 1 
         61 1 . . . . . 5.06 1.8 5.82 1 1 
         62 1 . . . . . 3.01 1.8 3.46 1 1 
         63 1 . . . . . 4.45 1.8 5.12 1 1 
         64 1 . . . . .  3.5 1.8 4.03 1 1 
         65 1 . . . . . 4.25 1.8 4.89 1 1 
         66 1 . . . . . 5.02 1.8 5.77 1 1 
         67 1 . . . . . 5.07 1.8 5.83 1 1 
         68 1 . . . . . 4.96 1.8  5.7 1 1 
         69 1 . . . . . 3.25 1.8 3.74 1 1 
         70 1 . . . . . 4.05 1.8 4.66 1 1 
         71 1 . . . . . 4.61 1.8  5.3 1 1 
         72 1 . . . . . 4.61 1.8  5.3 1 1 
         73 1 . . . . . 4.91 1.8 5.65 1 1 
         74 1 . . . . . 4.91 1.8 5.65 1 1 
         75 1 . . . . . 4.52 1.8  5.2 1 1 
         76 1 . . . . . 2.95 1.8 3.39 1 1 
         77 1 . . . . . 3.34 1.8 3.84 1 1 
         78 1 . . . . . 3.49 1.8 4.01 1 1 
         79 1 . . . . . 4.29 1.8 4.93 1 1 
         80 1 . . . . . 4.15 1.8 4.77 1 1 
         81 1 . . . . . 4.03 1.8 4.63 1 1 
         82 1 . . . . . 3.92 1.8 4.51 1 1 
         83 1 . . . . . 3.92 1.8 4.51 1 1 
         84 1 . . . . . 4.41 1.8 5.07 1 1 
         85 1 . . . . . 4.41 1.8 5.07 1 1 
         86 1 . . . . . 3.58 1.8 4.12 1 1 
         87 1 . . . . . 3.51 1.8 4.04 1 1 
         88 1 . . . . . 3.77 1.8 4.34 1 1 
         89 1 . . . . . 4.12 1.8 4.74 1 1 
         90 1 . . . . . 5.52 1.8 6.35 1 1 
         91 1 . . . . .  5.0 1.8 5.75 1 1 
         92 1 . . . . .  5.0 1.8 5.75 1 1 
         93 1 . . . . . 4.19 1.8 4.82 1 1 
         94 1 . . . . . 3.49 1.8 4.01 1 1 
         95 1 . . . . .  3.2 1.8 3.68 1 1 
         96 1 . . . . . 3.55 1.8 4.08 1 1 
         97 1 . . . . . 5.26 1.8 6.05 1 1 
         98 1 . . . . . 5.26 1.8 6.05 1 1 
         99 1 . . . . . 3.45 1.8 3.97 1 1 
        100 1 . . . . . 5.71 1.8 6.57 1 1 
        101 1 . . . . . 4.54 1.8 5.22 1 1 
        102 1 . . . . . 4.54 1.8 5.22 1 1 
        103 1 . . . . . 5.26 1.8 6.05 1 1 
        104 1 . . . . . 5.22 1.8  6.0 1 1 
        105 1 . . . . . 5.22 1.8  6.0 1 1 
        106 1 . . . . . 3.47 1.8 3.99 1 1 
        107 1 . . . . . 4.39 1.8 5.05 1 1 
        108 1 . . . . . 4.39 1.8 5.05 1 1 
        109 1 . . . . . 4.33 1.8 4.98 1 1 
        110 1 . . . . . 4.33 1.8 4.98 1 1 
        111 1 . . . . . 2.72 1.8 3.13 1 1 
        112 1 . . . . . 4.53 1.8 5.21 1 1 
        113 1 . . . . . 4.24 1.8 4.88 1 1 
        114 1 . . . . . 2.98 1.8 3.43 1 1 
        115 1 . . . . .  3.1 1.8 3.57 1 1 
        116 1 . . . . . 4.59 1.8 5.28 1 1 
        117 1 . . . . . 3.63 1.8 4.17 1 1 
        118 1 . . . . . 3.12 1.8 3.59 1 1 
        119 1 . . . . . 4.58 1.8 5.27 1 1 
        120 1 . . . . . 3.07 1.8 3.53 1 1 
        121 1 . . . . . 4.45 1.8 5.12 1 1 
        122 1 . . . . . 4.14 1.8 4.76 1 1 
        123 1 . . . . . 3.47 1.8 3.99 1 1 
        124 1 . . . . . 3.47 1.8 3.99 1 1 
        125 1 . . . . . 4.32 1.8 4.97 1 1 
        126 1 . . . . . 4.32 1.8 4.97 1 1 
        127 1 . . . . . 3.25 1.8 3.74 1 1 
        128 1 . . . . . 3.14 1.8 3.61 1 1 
        129 1 . . . . . 3.32 1.8 3.82 1 1 
        130 1 . . . . . 3.93 1.8 4.52 1 1 
        131 1 . . . . . 3.27 1.8 3.76 1 1 
        132 1 . . . . . 3.61 1.8 4.15 1 1 
        133 1 . . . . . 5.11 1.8 5.88 1 1 
        134 1 . . . . .  3.7 1.8 4.26 1 1 
        135 1 . . . . .  3.7 1.8 4.26 1 1 
        136 1 . . . . . 3.79 1.8 4.36 1 1 
        137 1 . . . . . 3.91 1.8  4.5 1 1 
        138 1 . . . . . 3.91 1.8  4.5 1 1 
        139 1 . . . . . 3.71 1.8 4.27 1 1 
        140 1 . . . . . 3.71 1.8 4.27 1 1 
        141 1 . . . . . 3.13 1.8  3.6 1 1 
        142 1 . . . . . 3.17 1.8 3.65 1 1 
        143 1 . . . . . 2.93 1.8 3.37 1 1 
        144 1 . . . . . 3.74 1.8  4.3 1 1 
        145 1 . . . . . 3.74 1.8  4.3 1 1 
        146 1 . . . . .  6.0 1.8  6.9 1 1 
        147 1 . . . . .  6.0 1.8  6.9 1 1 
        148 1 . . . . . 4.77 1.8 5.49 1 1 
        149 1 . . . . . 4.77 1.8 5.49 1 1 
        150 1 . . . . . 4.37 1.8 5.03 1 1 
        151 1 . . . . . 4.37 1.8 5.03 1 1 
        152 1 . . . . . 4.55 1.8 5.23 1 1 
        153 1 . . . . . 2.88 1.8 3.31 1 1 
        154 1 . . . . .  4.8 1.8 5.52 1 1 
        155 1 . . . . . 4.08 1.8 4.69 1 1 
        156 1 . . . . . 3.37 1.8 3.88 1 1 
        157 1 . . . . . 4.63 1.8 5.32 1 1 
        158 1 . . . . . 2.75 1.8 3.16 1 1 
        159 1 . . . . . 2.95 1.8 3.39 1 1 
        160 1 . . . . . 2.68 1.8 3.08 1 1 
        161 1 . . . . . 3.89 1.8 4.47 1 1 
        162 1 . . . . . 4.72 1.8 5.43 1 1 
        163 1 . . . . . 2.96 1.8  3.4 1 1 
        164 1 . . . . . 4.54 1.8 5.22 1 1 
        165 1 . . . . . 3.11 1.8 3.58 1 1 
        166 1 . . . . . 4.46 1.8 5.13 1 1 
        167 1 . . . . . 2.65 1.8 3.05 1 1 
        168 1 . . . . . 4.28 1.8 4.92 1 1 
        169 1 . . . . . 2.95 1.8 3.39 1 1 
        170 1 . . . . . 4.31 1.8 4.96 1 1 
        171 1 . . . . . 2.64 1.8 3.04 1 1 
        172 1 . . . . . 4.63 1.8 5.32 1 1 
        173 1 . . . . . 4.63 1.8 5.32 1 1 
        174 1 . . . . . 4.68 1.8 5.38 1 1 
        175 1 . . . . .  4.6 1.8 5.29 1 1 
        176 1 . . . . . 3.73 1.8 4.29 1 1 
        177 1 . . . . . 3.58 1.8 4.12 1 1 
        178 1 . . . . . 3.23 1.8 3.71 1 1 
        179 1 . . . . .  3.8 1.8 4.37 1 1 
        180 1 . . . . .  3.8 1.8 4.37 1 1 
        181 1 . . . . . 4.97 1.8 5.72 1 1 
        182 1 . . . . . 4.97 1.8 5.72 1 1 
        183 1 . . . . . 3.26 1.8 3.75 1 1 
        184 1 . . . . . 3.67 1.8 4.22 1 1 
        185 1 . . . . . 4.61 1.8  5.3 1 1 
        186 1 . . . . . 4.61 1.8  5.3 1 1 
        187 1 . . . . . 3.87 1.8 4.45 1 1 
        188 1 . . . . . 3.68 1.8 4.23 1 1 
        189 1 . . . . . 3.87 1.8 4.45 1 1 
        190 1 . . . . . 3.14 1.8 3.61 1 1 
        191 1 . . . . . 3.16 1.8 3.63 1 1 
        192 1 . . . . . 3.15 1.8 3.62 1 1 
        193 1 . . . . .  4.2 1.8 4.83 1 1 
        194 1 . . . . .  4.2 1.8 4.83 1 1 
        195 1 . . . . . 5.04 1.8  5.8 1 1 
        196 1 . . . . . 5.04 1.8  5.8 1 1 
        197 1 . . . . .  3.2 1.8 3.68 1 1 
        198 1 . . . . . 3.49 1.8 4.01 1 1 
        199 1 . . . . . 3.49 1.8 4.01 1 1 
        200 1 . . . . . 5.23 1.8 6.01 1 1 
        201 1 . . . . . 2.88 1.8 3.31 1 1 
        202 1 . . . . . 4.11 1.8 4.73 1 1 
        203 1 . . . . . 4.11 1.8 4.73 1 1 
        204 1 . . . . .  4.0 1.8  4.6 1 1 
        205 1 . . . . . 3.17 1.8 3.65 1 1 
        206 1 . . . . . 4.11 1.8 4.73 1 1 
        207 1 . . . . . 4.88 1.8 5.61 1 1 
        208 1 . . . . .  5.1 1.8 5.87 1 1 
        209 1 . . . . . 5.12 1.8 5.89 1 1 
        210 1 . . . . . 4.23 1.8 4.86 1 1 
        211 1 . . . . . 5.15 1.8 5.92 1 1 
        212 1 . . . . . 5.54 1.8 6.37 1 1 
        213 1 . . . . . 5.54 1.8 6.37 1 1 
        214 1 . . . . . 3.16 1.8 3.63 1 1 
        215 1 . . . . .  4.5 1.8 5.18 1 1 
        216 1 . . . . .  4.5 1.8 5.18 1 1 
        217 1 . . . . . 4.48 1.8 5.15 1 1 
        218 1 . . . . . 4.08 1.8 4.69 1 1 
        219 1 . . . . . 4.08 1.8 4.69 1 1 
        220 1 . . . . . 4.65 1.8 5.35 1 1 
        221 1 . . . . . 4.77 1.8 5.49 1 1 
        222 1 . . . . . 4.01 1.8 4.61 1 1 
        223 1 . . . . . 4.01 1.8 4.61 1 1 
        224 1 . . . . . 4.43 1.8 5.09 1 1 
        225 1 . . . . . 4.43 1.8 5.09 1 1 
        226 1 . . . . . 5.81 1.8 6.68 1 1 
        227 1 . . . . . 3.34 1.8 3.84 1 1 
        228 1 . . . . . 3.47 1.8 3.99 1 1 
        229 1 . . . . . 4.02 1.8 4.62 1 1 
        230 1 . . . . . 4.02 1.8 4.62 1 1 
        231 1 . . . . . 4.77 1.8 5.49 1 1 
        232 1 . . . . . 4.98 1.8 5.73 1 1 
        233 1 . . . . . 3.94 1.8 4.53 1 1 
        234 1 . . . . . 3.94 1.8 4.53 1 1 
        235 1 . . . . . 4.66 1.8 5.36 1 1 
        236 1 . . . . .  4.8 1.8 5.52 1 1 
        237 1 . . . . .  5.3 1.8  6.1 1 1 
        238 1 . . . . . 3.69 1.8 4.24 1 1 
        239 1 . . . . . 3.46 1.8 3.98 1 1 
        240 1 . . . . . 3.51 1.8 4.04 1 1 
        241 1 . . . . . 4.43 1.8 5.09 1 1 
        242 1 . . . . . 4.08 1.8 4.69 1 1 
        243 1 . . . . . 4.08 1.8 4.69 1 1 
        244 1 . . . . . 4.11 1.8 4.73 1 1 
        245 1 . . . . . 3.76 1.8 4.32 1 1 
        246 1 . . . . . 3.76 1.8 4.32 1 1 
        247 1 . . . . . 4.04 1.8 4.65 1 1 
        248 1 . . . . . 4.04 1.8 4.65 1 1 
        249 1 . . . . . 3.11 1.8 3.58 1 1 
        250 1 . . . . . 3.82 1.8 4.39 1 1 
        251 1 . . . . . 3.67 1.8 4.22 1 1 
        252 1 . . . . . 3.71 1.8 4.27 1 1 
        253 1 . . . . . 3.24 1.8 3.73 1 1 
        254 1 . . . . . 3.79 1.8 4.36 1 1 
        255 1 . . . . . 3.75 1.8 4.31 1 1 
        256 1 . . . . . 3.75 1.8 4.31 1 1 
        257 1 . . . . . 3.41 1.8 3.92 1 1 
        258 1 . . . . . 3.02 1.8 3.47 1 1 
        259 1 . . . . . 3.11 1.8 3.58 1 1 
        260 1 . . . . . 3.89 1.8 4.47 1 1 
        261 1 . . . . . 3.12 1.8 3.59 1 1 
        262 1 . . . . . 3.34 1.8 3.84 1 1 
        263 1 . . . . . 3.34 1.8 3.84 1 1 
        264 1 . . . . . 3.76 1.8 4.32 1 1 
        265 1 . . . . . 3.76 1.8 4.32 1 1 
        266 1 . . . . . 2.89 1.8 3.32 1 1 
        267 1 . . . . . 3.34 1.8 3.84 1 1 
        268 1 . . . . . 4.74 1.8 5.45 1 1 
        269 1 . . . . . 3.81 1.8 4.38 1 1 
        270 1 . . . . . 3.81 1.8 4.38 1 1 
        271 1 . . . . . 5.07 1.8 5.83 1 1 
        272 1 . . . . . 3.73 1.8 4.29 1 1 
        273 1 . . . . . 3.73 1.8 4.29 1 1 
        274 1 . . . . . 4.25 1.8 4.89 1 1 
        275 1 . . . . . 3.59 1.8 4.13 1 1 
        276 1 . . . . . 4.12 1.8 4.74 1 1 
        277 1 . . . . . 3.12 1.8 3.59 1 1 
        278 1 . . . . . 3.95 1.8 4.54 1 1 
        279 1 . . . . . 3.98 1.8 4.58 1 1 
        280 1 . . . . . 3.98 1.8 4.58 1 1 
        281 1 . . . . . 5.27 1.8 6.06 1 1 
        282 1 . . . . . 3.84 1.8 4.42 1 1 
        283 1 . . . . . 3.84 1.8 4.42 1 1 
        284 1 . . . . . 3.41 1.8 3.92 1 1 
        285 1 . . . . . 4.18 1.8 4.81 1 1 
        286 1 . . . . . 3.82 1.8 4.39 1 1 
        287 1 . . . . . 3.82 1.8 4.39 1 1 
        288 1 . . . . . 4.23 1.8 4.86 1 1 
        289 1 . . . . . 3.62 1.8 4.16 1 1 
        290 1 . . . . . 3.62 1.8 4.16 1 1 
        291 1 . . . . . 3.54 1.8 4.07 1 1 
        292 1 . . . . .  4.1 1.8 4.72 1 1 
        293 1 . . . . . 3.72 1.8 4.28 1 1 
        294 1 . . . . . 2.91 1.8 3.35 1 1 
        295 1 . . . . .  3.3 1.8  3.8 1 1 
        296 1 . . . . . 3.22 1.8  3.7 1 1 
        297 1 . . . . . 3.51 1.8 4.04 1 1 
        298 1 . . . . . 3.51 1.8 4.04 1 1 
        299 1 . . . . . 3.97 1.8 4.57 1 1 
        300 1 . . . . . 4.13 1.8 4.75 1 1 
        301 1 . . . . . 4.13 1.8 4.75 1 1 
        302 1 . . . . . 4.72 1.8 5.43 1 1 
        303 1 . . . . . 3.68 1.8 4.23 1 1 
        304 1 . . . . . 3.68 1.8 4.23 1 1 
        305 1 . . . . . 4.31 1.8 4.96 1 1 
        306 1 . . . . . 4.31 1.8 4.96 1 1 
        307 1 . . . . . 4.39 1.8 5.05 1 1 
        308 1 . . . . . 4.75 1.8 5.46 1 1 
        309 1 . . . . . 5.03 1.8 5.78 1 1 
        310 1 . . . . . 3.17 1.8 3.65 1 1 
        311 1 . . . . . 3.22 1.8  3.7 1 1 
        312 1 . . . . . 3.96 1.8 4.55 1 1 
        313 1 . . . . . 3.81 1.8 4.38 1 1 
        314 1 . . . . . 3.81 1.8 4.38 1 1 
        315 1 . . . . . 5.45 1.8 6.27 1 1 
        316 1 . . . . . 3.75 1.8 4.31 1 1 
        317 1 . . . . . 3.62 1.8 4.16 1 1 
        318 1 . . . . . 3.36 1.8 3.86 1 1 
        319 1 . . . . . 3.71 1.8 4.27 1 1 
        320 1 . . . . . 3.71 1.8 4.27 1 1 
        321 1 . . . . . 3.65 1.8  4.2 1 1 
        322 1 . . . . . 3.65 1.8  4.2 1 1 
        323 1 . . . . . 3.13 1.8  3.6 1 1 
        324 1 . . . . . 3.85 1.8 4.43 1 1 
        325 1 . . . . .  2.9 1.8 3.34 1 1 
        326 1 . . . . . 3.73 1.8 4.29 1 1 
        327 1 . . . . . 3.06 1.8 3.52 1 1 
        328 1 . . . . . 3.06 1.8 3.52 1 1 
        329 1 . . . . . 4.41 1.8 5.07 1 1 
        330 1 . . . . . 3.65 1.8  4.2 1 1 
        331 1 . . . . . 3.56 1.8 4.09 1 1 
        332 1 . . . . . 3.56 1.8 4.09 1 1 
        333 1 . . . . . 3.78 1.8 4.35 1 1 
        334 1 . . . . . 3.78 1.8 4.35 1 1 
        335 1 . . . . . 3.85 1.8 4.43 1 1 
        336 1 . . . . . 3.85 1.8 4.43 1 1 
        337 1 . . . . . 2.81 1.8 3.23 1 1 
        338 1 . . . . . 4.05 1.8 4.66 1 1 
        339 1 . . . . . 4.05 1.8 4.66 1 1 
        340 1 . . . . . 3.68 1.8 4.23 1 1 
        341 1 . . . . . 3.68 1.8 4.23 1 1 
        342 1 . . . . . 3.74 1.8  4.3 1 1 
        343 1 . . . . . 3.74 1.8  4.3 1 1 
        344 1 . . . . . 4.38 1.8 5.04 1 1 
        345 1 . . . . . 3.02 1.8 3.47 1 1 
        346 1 . . . . . 3.09 1.8 3.55 1 1 
        347 1 . . . . . 3.45 1.8 3.97 1 1 
        348 1 . . . . . 3.84 1.8 4.42 1 1 
        349 1 . . . . .  2.9 1.8 3.34 1 1 
        350 1 . . . . . 3.31 1.8 3.81 1 1 
        351 1 . . . . . 4.04 1.8 4.65 1 1 
        352 1 . . . . . 3.66 1.8 4.21 1 1 
        353 1 . . . . . 3.66 1.8 4.21 1 1 
        354 1 . . . . . 4.78 1.8  5.5 1 1 
        355 1 . . . . . 3.36 1.8 3.86 1 1 
        356 1 . . . . . 3.36 1.8 3.86 1 1 
        357 1 . . . . . 3.63 1.8 4.17 1 1 
        358 1 . . . . . 3.63 1.8 4.17 1 1 
        359 1 . . . . . 3.68 1.8 4.23 1 1 
        360 1 . . . . . 3.68 1.8 4.23 1 1 
        361 1 . . . . . 3.27 1.8 3.76 1 1 
        362 1 . . . . . 3.27 1.8 3.76 1 1 
        363 1 . . . . . 3.13 1.8  3.6 1 1 
        364 1 . . . . . 3.13 1.8  3.6 1 1 
        365 1 . . . . . 3.73 1.8 4.29 1 1 
        366 1 . . . . . 3.66 1.8 4.21 1 1 
        367 1 . . . . . 3.66 1.8 4.21 1 1 
        368 1 . . . . . 3.12 1.8 3.59 1 1 
        369 1 . . . . .  3.6 1.8 4.14 1 1 
        370 1 . . . . . 3.94 1.8 4.53 1 1 
        371 1 . . . . . 2.91 1.8 3.35 1 1 
        372 1 . . . . . 3.79 1.8 4.36 1 1 
        373 1 . . . . . 3.79 1.8 4.36 1 1 
        374 1 . . . . . 3.55 1.8 4.08 1 1 
        375 1 . . . . . 3.55 1.8 4.08 1 1 
        376 1 . . . . . 5.56 1.8 6.39 1 1 
        377 1 . . . . . 5.56 1.8 6.39 1 1 
        378 1 . . . . . 2.94 1.8 3.38 1 1 
        379 1 . . . . . 2.89 1.8 3.32 1 1 
        380 1 . . . . . 3.81 1.8 4.38 1 1 
        381 1 . . . . . 3.81 1.8 4.38 1 1 
        382 1 . . . . .  5.2 1.8 5.98 1 1 
        383 1 . . . . .  5.2 1.8 5.98 1 1 
        384 1 . . . . . 3.63 1.8 4.17 1 1 
        385 1 . . . . . 3.86 1.8 4.44 1 1 
        386 1 . . . . . 3.07 1.8 3.53 1 1 
        387 1 . . . . . 3.07 1.8 3.53 1 1 
        388 1 . . . . .  4.3 1.8 4.95 1 1 
        389 1 . . . . . 3.65 1.8  4.2 1 1 
        390 1 . . . . . 3.65 1.8  4.2 1 1 
        391 1 . . . . . 3.64 1.8 4.19 1 1 
        392 1 . . . . .  4.1 1.8 4.72 1 1 
        393 1 . . . . . 4.21 1.8 4.84 1 1 
        394 1 . . . . . 3.47 1.8 3.99 1 1 
        395 1 . . . . . 3.47 1.8 3.99 1 1 
        396 1 . . . . . 4.11 1.8 4.73 1 1 
        397 1 . . . . . 3.92 1.8 4.51 1 1 
        398 1 . . . . . 5.55 1.8 6.38 1 1 
        399 1 . . . . . 3.68 1.8 4.23 1 1 
        400 1 . . . . . 3.59 1.8 4.13 1 1 
        401 1 . . . . . 4.86 1.8 5.59 1 1 
        402 1 . . . . . 4.82 1.8 5.54 1 1 
        403 1 . . . . .  6.0 1.8  6.9 1 1 
        404 1 . . . . . 3.88 1.8 4.46 1 1 
        405 1 . . . . . 3.61 1.8 4.15 1 1 
        406 1 . . . . . 3.36 1.8 3.86 1 1 
        407 1 . . . . . 3.61 1.8 4.15 1 1 
        408 1 . . . . . 4.96 1.8  5.7 1 1 
        409 1 . . . . .  4.2 1.8 4.83 1 1 
        410 1 . . . . . 3.68 1.8 4.23 1 1 
        411 1 . . . . .  3.4 1.8 3.91 1 1 
        412 1 . . . . . 3.04 1.8  3.5 1 1 
        413 1 . . . . . 2.99 1.8 3.44 1 1 
        414 1 . . . . . 3.14 1.8 3.61 1 1 
        415 1 . . . . . 4.38 1.8 5.04 1 1 
        416 1 . . . . . 4.45 1.8 5.12 1 1 
        417 1 . . . . . 4.06 1.8 4.67 1 1 
        418 1 . . . . . 3.32 1.8 3.82 1 1 
        419 1 . . . . . 3.47 1.8 3.99 1 1 
        420 1 . . . . .  2.9 1.8 3.34 1 1 
        421 1 . . . . . 3.05 1.8 3.51 1 1 
        422 1 . . . . . 3.16 1.8 3.63 1 1 
        423 1 . . . . . 4.67 1.8 5.37 1 1 
        424 1 . . . . . 2.88 1.8 3.31 1 1 
        425 1 . . . . . 3.24 1.8 3.73 1 1 
        426 1 . . . . . 3.19 1.8 3.67 1 1 
        427 1 . . . . . 3.33 1.8 3.83 1 1 
        428 1 . . . . . 3.26 1.8 3.75 1 1 
        429 1 . . . . . 3.22 1.8  3.7 1 1 
        430 1 . . . . . 4.65 1.8 5.35 1 1 
        431 1 . . . . . 4.23 1.8 4.86 1 1 
        432 1 . . . . . 4.27 1.8 4.91 1 1 
        433 1 . . . . . 5.07 1.8 5.83 1 1 
        434 1 . . . . .  3.7 1.8 4.26 1 1 
        435 1 . . . . . 4.01 1.8 4.61 1 1 
        436 1 . . . . . 3.02 1.8 3.47 1 1 
        437 1 . . . . . 4.67 1.8 5.37 1 1 
        438 1 . . . . . 5.19 1.8 5.97 1 1 
        439 1 . . . . . 4.33 1.8 4.98 1 1 
        440 1 . . . . . 4.88 1.8 5.61 1 1 
        441 1 . . . . . 4.22 1.8 4.85 1 1 
        442 1 . . . . . 4.26 1.8  4.9 1 1 
        443 1 . . . . . 4.89 1.8 5.62 1 1 
        444 1 . . . . . 5.32 1.8 6.12 1 1 
        445 1 . . . . . 4.94 1.8 5.68 1 1 
        446 1 . . . . . 3.96 1.8 4.55 1 1 
        447 1 . . . . . 4.13 1.8 4.75 1 1 
        448 1 . . . . . 5.42 1.8 6.23 1 1 
        449 1 . . . . . 4.77 1.8 5.49 1 1 
        450 1 . . . . . 4.25 1.8 4.89 1 1 
        451 1 . . . . . 4.46 1.8 5.13 1 1 
        452 1 . . . . . 4.65 1.8 5.35 1 1 
        453 1 . . . . . 4.43 1.8 5.09 1 1 
        454 1 . . . . . 5.03 1.8 5.78 1 1 
        455 1 . . . . .  4.6 1.8 5.29 1 1 
        456 1 . . . . . 5.06 1.8 5.82 1 1 
        457 1 . . . . . 4.98 1.8 5.73 1 1 
        458 1 . . . . . 4.48 1.8 5.15 1 1 
        459 1 . . . . . 4.93 1.8 5.67 1 1 
        460 1 . . . . .  4.6 1.8 5.29 1 1 
        461 1 . . . . . 4.95 1.8 5.69 1 1 
        462 1 . . . . . 4.82 1.8 5.54 1 1 
        463 1 . . . . . 5.18 1.8 5.96 1 1 
        464 1 . . . . . 3.55 1.8 4.08 1 1 
        465 1 . . . . . 4.57 1.8 5.26 1 1 
        466 1 . . . . . 5.07 1.8 5.83 1 1 
        467 1 . . . . . 4.03 1.8 4.63 1 1 
        468 1 . . . . . 4.54 1.8 5.22 1 1 
        469 1 . . . . . 4.76 1.8 5.47 1 1 
        470 1 . . . . . 4.12 1.8 4.74 1 1 
        471 1 . . . . . 4.91 1.8 5.65 1 1 
        472 1 . . . . . 4.34 1.8 4.99 1 1 
        473 1 . . . . .  4.9 1.8 5.64 1 1 
        474 1 . . . . . 4.91 1.8 5.65 1 1 
        475 1 . . . . . 4.96 1.8  5.7 1 1 
        476 1 . . . . . 3.96 1.8 4.55 1 1 
        477 1 . . . . . 4.54 1.8 5.22 1 1 
        478 1 . . . . . 4.94 1.8 5.68 1 1 
        479 1 . . . . .  4.7 1.8  5.4 1 1 
        480 1 . . . . . 3.89 1.8 4.47 1 1 
        481 1 . . . . . 4.46 1.8 5.13 1 1 
        482 1 . . . . . 5.16 1.8 5.93 1 1 
        483 1 . . . . . 4.69 1.8 5.39 1 1 
        484 1 . . . . . 3.73 1.8 4.29 1 1 
        485 1 . . . . . 4.22 1.8 4.85 1 1 
        486 1 . . . . . 4.15 1.8 4.77 1 1 
        487 1 . . . . . 5.03 1.8 5.78 1 1 
        488 1 . . . . . 5.37 1.8 6.18 1 1 
        489 1 . . . . . 4.24 1.8 4.88 1 1 
        490 1 . . . . . 4.39 1.8 5.05 1 1 
        491 1 . . . . .  4.7 1.8  5.4 1 1 
        492 1 . . . . . 5.56 1.8 6.39 1 1 
        493 1 . . . . .  6.0 1.8  6.9 1 1 
        494 1 . . . . . 3.67 1.8 4.22 1 1 
        495 1 . . . . . 4.48 1.8 5.15 1 1 
        496 1 . . . . . 4.84 1.8 5.57 1 1 
        497 1 . . . . . 4.42 1.8 5.08 1 1 
        498 1 . . . . . 4.06 1.8 4.67 1 1 
        499 1 . . . . . 4.53 1.8 5.21 1 1 
        500 1 . . . . . 4.42 1.8 5.08 1 1 
        501 1 . . . . . 4.97 1.8 5.72 1 1 
        502 1 . . . . . 3.68 1.8 4.23 1 1 
        503 1 . . . . . 4.87 1.8  5.6 1 1 
        504 1 . . . . . 4.56 1.8 5.24 1 1 
        505 1 . . . . . 4.01 1.8 4.61 1 1 
        506 1 . . . . . 3.92 1.8 4.51 1 1 
        507 1 . . . . . 5.22 1.8  6.0 1 1 
        508 1 . . . . . 4.12 1.8 4.74 1 1 
        509 1 . . . . . 4.44 1.8 5.11 1 1 
        510 1 . . . . . 4.35 1.8  5.0 1 1 
        511 1 . . . . . 3.93 1.8 4.52 1 1 
        512 1 . . . . .  4.4 1.8 5.06 1 1 
        513 1 . . . . .  4.6 1.8 5.29 1 1 
        514 1 . . . . . 4.52 1.8  5.2 1 1 
        515 1 . . . . . 4.16 1.8 4.78 1 1 
        516 1 . . . . . 4.69 1.8 5.39 1 1 
        517 1 . . . . . 4.45 1.8 5.12 1 1 
        518 1 . . . . . 4.91 1.8 5.65 1 1 
        519 1 . . . . . 3.65 1.8  4.2 1 1 
        520 1 . . . . . 3.81 1.8 4.38 1 1 
        521 1 . . . . . 4.41 1.8 5.07 1 1 
        522 1 . . . . . 3.92 1.8 4.51 1 1 
        523 1 . . . . . 3.83 1.8  4.4 1 1 
        524 1 . . . . . 4.19 1.8 4.82 1 1 
        525 1 . . . . . 4.32 1.8 4.97 1 1 
        526 1 . . . . . 3.73 1.8 4.29 1 1 
        527 1 . . . . . 5.28 1.8 6.07 1 1 
        528 1 . . . . . 5.28 1.8 6.07 1 1 
        529 1 . . . . . 4.69 1.8 5.39 1 1 
        530 1 . . . . . 4.48 1.8 5.15 1 1 
        531 1 . . . . .  5.1 1.8 5.87 1 1 
        532 1 . . . . . 4.51 1.8 5.19 1 1 
        533 1 . . . . . 5.06 1.8 5.82 1 1 
        534 1 . . . . . 5.28 1.8 6.07 1 1 
        535 1 . . . . .  5.8 1.8 6.67 1 1 
        536 1 . . . . . 4.86 1.8 5.59 1 1 
        537 1 . . . . . 4.88 1.8 5.61 1 1 
        538 1 . . . . .  6.0 1.8  6.9 1 1 
        539 1 . . . . . 3.89 1.8 4.47 1 1 
        540 1 . . . . . 4.86 1.8 5.59 1 1 
        541 1 . . . . . 4.81 1.8 5.53 1 1 
        542 1 . . . . . 4.81 1.8 5.53 1 1 
        543 1 . . . . . 4.43 1.8 5.09 1 1 
        544 1 . . . . . 5.58 1.8 6.42 1 1 
        545 1 . . . . . 5.82 1.8 6.69 1 1 
        546 1 . . . . . 3.97 1.8 4.57 1 1 
        547 1 . . . . . 4.54 1.8 5.22 1 1 
        548 1 . . . . . 4.41 1.8 5.07 1 1 
        549 1 . . . . . 4.06 1.8 4.67 1 1 
        550 1 . . . . . 5.37 1.8 6.18 1 1 
        551 1 . . . . . 4.32 1.8 4.97 1 1 
        552 1 . . . . . 4.08 1.8 4.69 1 1 
        553 1 . . . . . 3.81 1.8 4.38 1 1 
        554 1 . . . . . 3.98 1.8 4.58 1 1 
        555 1 . . . . . 5.16 1.8 5.93 1 1 
        556 1 . . . . . 4.51 1.8 5.19 1 1 
        557 1 . . . . . 4.51 1.8 5.19 1 1 
        558 1 . . . . . 4.37 1.8 5.03 1 1 
        559 1 . . . . . 4.26 1.8  4.9 1 1 
        560 1 . . . . . 3.88 1.8 4.46 1 1 
        561 1 . . . . .  3.6 1.8 4.14 1 1 
        562 1 . . . . . 3.92 1.8 4.51 1 1 
        563 1 . . . . . 4.56 1.8 5.24 1 1 
        564 1 . . . . .  5.5 1.8 6.33 1 1 
        565 1 . . . . . 5.95 1.8 6.84 1 1 
        566 1 . . . . . 4.72 1.8 5.43 1 1 
        567 1 . . . . . 4.93 1.8 5.67 1 1 
        568 1 . . . . . 4.53 1.8 5.21 1 1 
        569 1 . . . . . 4.59 1.8 5.28 1 1 
        570 1 . . . . . 4.19 1.8 4.82 1 1 
        571 1 . . . . . 4.23 1.8 4.86 1 1 
        572 1 . . . . .  4.2 1.8 4.83 1 1 
        573 1 . . . . . 5.83 1.8  6.7 1 1 
        574 1 . . . . . 4.61 1.8  5.3 1 1 
        575 1 . . . . . 4.13 1.8 4.75 1 1 
        576 1 . . . . . 4.43 1.8 5.09 1 1 
        577 1 . . . . . 4.32 1.8 4.97 1 1 
        578 1 . . . . . 4.48 1.8 5.15 1 1 
        579 1 . . . . . 5.33 1.8 6.13 1 1 
        580 1 . . . . . 3.96 1.8 4.55 1 1 
        581 1 . . . . . 4.21 1.8 4.84 1 1 
        582 1 . . . . . 4.21 1.8 4.84 1 1 
        583 1 . . . . . 3.96 1.8 4.55 1 1 
        584 1 . . . . . 5.16 1.8 5.93 1 1 
        585 1 . . . . . 5.04 1.8  5.8 1 1 
        586 1 . . . . . 5.13 1.8  5.9 1 1 
        587 1 . . . . . 4.56 1.8 5.24 1 1 
        588 1 . . . . .  4.7 1.8  5.4 1 1 
        589 1 . . . . .  4.5 1.8 5.18 1 1 
        590 1 . . . . . 4.37 1.8 5.03 1 1 
        591 1 . . . . . 4.36 1.8 5.01 1 1 
        592 1 . . . . . 3.62 1.8 4.16 1 1 
        593 1 . . . . . 5.85 1.8 6.73 1 1 
        594 1 . . . . . 5.03 1.8 5.78 1 1 
        595 1 . . . . . 4.09 1.8  4.7 1 1 
        596 1 . . . . . 5.23 1.8 6.01 1 1 
        597 1 . . . . . 4.37 1.8 5.03 1 1 
        598 1 . . . . . 3.83 1.8  4.4 1 1 
        599 1 . . . . . 5.44 1.8 6.26 1 1 
        600 1 . . . . . 4.37 1.8 5.03 1 1 
        601 1 . . . . . 4.73 1.8 5.44 1 1 
        602 1 . . . . .  3.7 1.8 4.26 1 1 
        603 1 . . . . . 4.16 1.8 4.78 1 1 
        604 1 . . . . . 4.24 1.8 4.88 1 1 
        605 1 . . . . .  4.2 1.8 4.83 1 1 
        606 1 . . . . . 4.32 1.8 4.97 1 1 
        607 1 . . . . .  6.0 1.8  6.9 1 1 
        608 1 . . . . .  6.0 1.8  6.9 1 1 
        609 1 . . . . . 4.55 1.8 5.23 1 1 
        610 1 . . . . . 5.73 1.8 6.59 1 1 
        611 1 . . . . . 5.73 1.8 6.59 1 1 
        612 1 . . . . . 4.69 1.8 5.39 1 1 
        613 1 . . . . . 4.69 1.8 5.39 1 1 
        614 1 . . . . . 4.79 1.8 5.51 1 1 
        615 1 . . . . . 5.23 1.8 6.01 1 1 
        616 1 . . . . . 4.38 1.8 5.04 1 1 
        617 1 . . . . . 4.65 1.8 5.35 1 1 
        618 1 . . . . . 5.35 1.8 6.15 1 1 
        619 1 . . . . .  4.6 1.8 5.29 1 1 
        620 1 . . . . . 4.93 1.8 5.67 1 1 
        621 1 . . . . .  6.0 1.8  6.9 1 1 
        622 1 . . . . . 5.04 1.8  5.8 1 1 
        623 1 . . . . . 4.28 1.8 4.92 1 1 
        624 1 . . . . . 4.28 1.8 4.92 1 1 
        625 1 . . . . . 4.89 1.8 5.62 1 1 
        626 1 . . . . . 3.89 1.8 4.47 1 1 
        627 1 . . . . . 4.95 1.8 5.69 1 1 
        628 1 . . . . . 4.14 1.8 4.76 1 1 
        629 1 . . . . . 4.05 1.8 4.66 1 1 
        630 1 . . . . . 4.89 1.8 5.62 1 1 
        631 1 . . . . . 4.35 1.8  5.0 1 1 
        632 1 . . . . . 4.89 1.8 5.62 1 1 
        633 1 . . . . . 4.62 1.8 5.31 1 1 
        634 1 . . . . . 4.78 1.8  5.5 1 1 
        635 1 . . . . . 4.91 1.8 5.65 1 1 
        636 1 . . . . . 4.46 1.8 5.13 1 1 
        637 1 . . . . . 4.39 1.8 5.05 1 1 
        638 1 . . . . . 4.12 1.8 4.74 1 1 
        639 1 . . . . . 4.78 1.8  5.5 1 1 
        640 1 . . . . . 4.91 1.8 5.65 1 1 
        641 1 . . . . . 4.49 1.8 5.16 1 1 
        642 1 . . . . . 4.36 1.8 5.01 1 1 
        643 1 . . . . .  5.6 1.8 6.44 1 1 
        644 1 . . . . .  6.0 1.8  6.9 1 1 
        645 1 . . . . .  6.0 1.8  6.9 1 1 
        646 1 . . . . .  6.0 1.8  6.9 1 1 
        647 1 . . . . . 4.75 1.8 5.46 1 1 
        648 1 . . . . . 4.25 1.8 4.89 1 1 
        649 1 . . . . . 3.87 1.8 4.45 1 1 
        650 1 . . . . . 3.87 1.8 4.45 1 1 
        651 1 . . . . . 4.88 1.8 5.61 1 1 
        652 1 . . . . . 4.23 1.8 4.86 1 1 
        653 1 . . . . .  4.9 1.8 5.64 1 1 
        654 1 . . . . . 4.93 1.8 5.67 1 1 
        655 1 . . . . . 4.94 1.8 5.68 1 1 
        656 1 . . . . . 3.91 1.8  4.5 1 1 
        657 1 . . . . . 4.59 1.8 5.28 1 1 
        658 1 . . . . . 4.85 1.8 5.58 1 1 
        659 1 . . . . .  5.5 1.8 6.33 1 1 
        660 1 . . . . . 4.72 1.8 5.43 1 1 
        661 1 . . . . . 4.35 1.8  5.0 1 1 
        662 1 . . . . . 4.84 1.8 5.57 1 1 
        663 1 . . . . . 4.95 1.8 5.69 1 1 
        664 1 . . . . . 4.87 1.8  5.6 1 1 
        665 1 . . . . . 4.87 1.8  5.6 1 1 
        666 1 . . . . . 4.87 1.8  5.6 1 1 
        667 1 . . . . . 3.58 1.8 4.12 1 1 
        668 1 . . . . . 4.21 1.8 4.84 1 1 
        669 1 . . . . . 5.04 1.8  5.8 1 1 
        670 1 . . . . . 4.86 1.8 5.59 1 1 
        671 1 . . . . .  4.0 1.8  4.6 1 1 
        672 1 . . . . . 4.85 1.8 5.58 1 1 
        673 1 . . . . . 4.64 1.8 5.34 1 1 
        674 1 . . . . . 5.01 1.8 5.76 1 1 
        675 1 . . . . . 5.08 1.8 5.84 1 1 
        676 1 . . . . . 4.92 1.8 5.66 1 1 
        677 1 . . . . . 4.16 1.8 4.78 1 1 
        678 1 . . . . . 5.93 1.8 6.82 1 1 
        679 1 . . . . . 4.43 1.8 5.09 1 1 
        680 1 . . . . . 4.17 1.8  4.8 1 1 
        681 1 . . . . . 4.86 1.8 5.59 1 1 
        682 1 . . . . . 4.99 1.8 5.74 1 1 
        683 1 . . . . .  6.0 1.8  6.9 1 1 
        684 1 . . . . .  6.0 1.8  6.9 1 1 
        685 1 . . . . . 5.45 1.8 6.27 1 1 
        686 1 . . . . . 4.38 1.8 5.04 1 1 
        687 1 . . . . .  6.0 1.8  6.9 1 1 
        688 1 . . . . .  6.0 1.8  6.9 1 1 
        689 1 . . . . . 4.15 1.8 4.77 1 1 
        690 1 . . . . . 4.15 1.8 4.77 1 1 
        691 1 . . . . . 4.06 1.8 4.67 1 1 
        692 1 . . . . . 4.49 1.8 5.16 1 1 
        693 1 . . . . . 3.78 1.8 4.35 1 1 
        694 1 . . . . . 5.62 1.8 6.46 1 1 
        695 1 . . . . . 4.26 1.8  4.9 1 1 
        696 1 . . . . . 4.18 1.8 4.81 1 1 
        697 1 . . . . . 4.37 1.8 5.03 1 1 
        698 1 . . . . . 4.37 1.8 5.03 1 1 
        699 1 . . . . .  6.0 1.8  6.9 1 1 
        700 1 . . . . .  6.0 1.8  6.9 1 1 
        701 1 . . . . . 4.96 1.8  5.7 1 1 
        702 1 . . . . .  6.0 1.8  6.9 1 1 
        703 1 . . . . .  5.4 1.8 6.21 1 1 
        704 1 . . . . . 3.68 1.8 4.23 1 1 
        705 1 . . . . . 5.19 1.8 5.97 1 1 
        706 1 . . . . .  4.0 1.8  4.6 1 1 
        707 1 . . . . . 3.89 1.8 4.47 1 1 
        708 1 . . . . . 4.39 1.8 5.05 1 1 
        709 1 . . . . . 4.82 1.8 5.54 1 1 
        710 1 . . . . . 4.56 1.8 5.24 1 1 
        711 1 . . . . . 4.56 1.8 5.24 1 1 
        712 1 . . . . . 3.81 1.8 4.38 1 1 
        713 1 . . . . . 4.25 1.8 4.89 1 1 
        714 1 . . . . . 4.25 1.8 4.89 1 1 
        715 1 . . . . .  6.0 1.8  6.9 1 1 
        716 1 . . . . . 5.22 1.8  6.0 1 1 
        717 1 . . . . . 3.86 1.8 4.44 1 1 
        718 1 . . . . . 4.78 1.8  5.5 1 1 
        719 1 . . . . . 3.31 1.8 3.81 1 1 
        720 1 . . . . . 4.18 1.8 4.81 1 1 
        721 1 . . . . . 5.36 1.8 6.16 1 1 
        722 1 . . . . . 4.65 1.8 5.35 1 1 
        723 1 . . . . . 5.21 1.8 5.99 1 1 
        724 1 . . . . . 5.15 1.8 5.92 1 1 
        725 1 . . . . . 5.04 1.8  5.8 1 1 
        726 1 . . . . . 4.35 1.8  5.0 1 1 
        727 1 . . . . . 4.24 1.8 4.88 1 1 
        728 1 . . . . . 5.51 1.8 6.34 1 1 
        729 1 . . . . . 4.46 1.8 5.13 1 1 
        730 1 . . . . . 4.46 1.8 5.13 1 1 
        731 1 . . . . . 5.09 1.8 5.85 1 1 
        732 1 . . . . . 4.56 1.8 5.24 1 1 
        733 1 . . . . . 5.37 1.8 6.18 1 1 
        734 1 . . . . . 5.18 1.8 5.96 1 1 
        735 1 . . . . . 5.18 1.8 5.96 1 1 
        736 1 . . . . . 3.39 1.8  3.9 1 1 
        737 1 . . . . . 4.98 1.8 5.73 1 1 
        738 1 . . . . . 4.49 1.8 5.16 1 1 
        739 1 . . . . . 4.38 1.8 5.04 1 1 
        740 1 . . . . . 4.27 1.8 4.91 1 1 
        741 1 . . . . . 5.52 1.8 6.35 1 1 
        742 1 . . . . . 5.19 1.8 5.97 1 1 
        743 1 . . . . .  4.9 1.8 5.64 1 1 
        744 1 . . . . . 5.33 1.8 6.13 1 1 
        745 1 . . . . . 4.32 1.8 4.97 1 1 
        746 1 . . . . . 5.02 1.8 5.77 1 1 
        747 1 . . . . .  5.6 1.8 6.44 1 1 
        748 1 . . . . . 4.84 1.8 5.57 1 1 
        749 1 . . . . .  5.0 1.8 5.75 1 1 
        750 1 . . . . .  5.0 1.8 5.75 1 1 
        751 1 . . . . . 4.87 1.8  5.6 1 1 
        752 1 . . . . . 4.39 1.8 5.05 1 1 
        753 1 . . . . . 5.44 1.8 6.26 1 1 
        754 1 . . . . . 4.55 1.8 5.23 1 1 
        755 1 . . . . . 4.33 1.8 4.98 1 1 
        756 1 . . . . . 4.91 1.8 5.65 1 1 
        757 1 . . . . . 5.29 1.8 6.08 1 1 
        758 1 . . . . . 5.06 1.8 5.82 1 1 
        759 1 . . . . . 4.84 1.8 5.57 1 1 
        760 1 . . . . . 5.65 1.8  6.5 1 1 
        761 1 . . . . . 4.11 1.8 4.73 1 1 
        762 1 . . . . . 5.01 1.8 5.76 1 1 
        763 1 . . . . . 5.42 1.8 6.23 1 1 
        764 1 . . . . . 5.42 1.8 6.23 1 1 
        765 1 . . . . . 5.42 1.8 6.23 1 1 
        766 1 . . . . . 5.42 1.8 6.23 1 1 
        767 1 . . . . .  4.1 1.8 4.72 1 1 
        768 1 . . . . . 3.36 1.8 3.86 1 1 
        769 1 . . . . . 3.35 1.8 3.85 1 1 
        770 1 . . . . . 4.11 1.8 4.73 1 1 
        771 1 . . . . . 4.73 1.8 5.44 1 1 
        772 1 . . . . . 3.12 1.8 3.59 1 1 
        773 1 . . . . . 3.49 1.8 4.01 1 1 
        774 1 . . . . . 4.58 1.8 5.27 1 1 
        775 1 . . . . . 4.01 1.8 4.61 1 1 
        776 1 . . . . .  3.2 1.8 3.68 1 1 
        777 1 . . . . . 3.99 1.8 4.59 1 1 
        778 1 . . . . . 4.58 1.8 5.27 1 1 
        779 1 . . . . . 4.13 1.8 4.75 1 1 
        780 1 . . . . . 3.81 1.8 4.38 1 1 
        781 1 . . . . . 3.27 1.8 3.76 1 1 
        782 1 . . . . . 3.41 1.8 3.92 1 1 
        783 1 . . . . . 3.29 1.8 3.78 1 1 
        784 1 . . . . . 3.32 1.8 3.82 1 1 
        785 1 . . . . . 4.14 1.8 4.76 1 1 
        786 1 . . . . . 4.29 1.8 4.93 1 1 
        787 1 . . . . . 4.13 1.8 4.75 1 1 
        788 1 . . . . . 2.43 1.8 2.79 1 1 
        789 1 . . . . . 4.11 1.8 4.73 1 1 
        790 1 . . . . . 4.41 1.8 5.07 1 1 
        791 1 . . . . . 3.06 1.8 3.52 1 1 
        792 1 . . . . . 3.21 1.8 3.69 1 1 
        793 1 . . . . . 3.39 1.8  3.9 1 1 
        794 1 . . . . . 3.21 1.8 3.69 1 1 
        795 1 . . . . .  2.4 1.8 2.76 1 1 
        796 1 . . . . . 3.99 1.8 4.59 1 1 
        797 1 . . . . . 3.46 1.8 3.98 1 1 
        798 1 . . . . . 3.67 1.8 4.22 1 1 
        799 1 . . . . . 3.99 1.8 4.59 1 1 
        800 1 . . . . . 3.46 1.8 3.98 1 1 
        801 1 . . . . . 3.38 1.8 3.89 1 1 
        802 1 . . . . . 4.04 1.8 4.65 1 1 
        803 1 . . . . . 3.49 1.8 4.01 1 1 
        804 1 . . . . .  2.7 1.8 3.11 1 1 
        805 1 . . . . . 3.25 1.8 3.74 1 1 
        806 1 . . . . . 3.26 1.8 3.75 1 1 
        807 1 . . . . . 5.31 1.8 6.11 1 1 
        808 1 . . . . . 5.31 1.8 6.11 1 1 
        809 1 . . . . . 4.04 1.8 4.65 1 1 
        810 1 . . . . . 5.85 1.8 6.73 1 1 
        811 1 . . . . . 5.85 1.8 6.73 1 1 
        812 1 . . . . . 3.68 1.8 4.23 1 1 
        813 1 . . . . . 3.68 1.8 4.23 1 1 
        814 1 . . . . . 4.74 1.8 5.45 1 1 
        815 1 . . . . . 3.88 1.8 4.46 1 1 
        816 1 . . . . . 3.88 1.8 4.46 1 1 
        817 1 . . . . . 4.09 1.8  4.7 1 1 
        818 1 . . . . . 4.09 1.8  4.7 1 1 
        819 1 . . . . . 4.91 1.8 5.65 1 1 
        820 1 . . . . . 4.02 1.8 4.62 1 1 
        821 1 . . . . . 3.49 1.8 4.01 1 1 
        822 1 . . . . . 2.98 1.8 3.43 1 1 
        823 1 . . . . . 3.95 1.8 4.54 1 1 
        824 1 . . . . . 4.13 1.8 4.75 1 1 
        825 1 . . . . . 4.13 1.8 4.75 1 1 
        826 1 . . . . . 3.94 1.8 4.53 1 1 
        827 1 . . . . . 3.94 1.8 4.53 1 1 
        828 1 . . . . . 3.95 1.8 4.54 1 1 
        829 1 . . . . . 3.94 1.8 4.53 1 1 
        830 1 . . . . . 3.94 1.8 4.53 1 1 
        831 1 . . . . . 3.34 1.8 3.84 1 1 
        832 1 . . . . . 3.17 1.8 3.65 1 1 
        833 1 . . . . .  4.0 1.8  4.6 1 1 
        834 1 . . . . . 5.27 1.8 6.06 1 1 
        835 1 . . . . .  4.0 1.8  4.6 1 1 
        836 1 . . . . . 3.91 1.8  4.5 1 1 
        837 1 . . . . . 3.27 1.8 3.76 1 1 
        838 1 . . . . .  3.4 1.8 3.91 1 1 
        839 1 . . . . .  3.4 1.8 3.91 1 1 
        840 1 . . . . . 3.15 1.8 3.62 1 1 
        841 1 . . . . . 3.82 1.8 4.39 1 1 
        842 1 . . . . . 3.99 1.8 4.59 1 1 
        843 1 . . . . . 5.15 1.8 5.92 1 1 
        844 1 . . . . . 4.39 1.8 5.05 1 1 
        845 1 . . . . . 5.15 1.8 5.92 1 1 
        846 1 . . . . . 4.39 1.8 5.05 1 1 
        847 1 . . . . . 3.54 1.8 4.07 1 1 
        848 1 . . . . . 3.01 1.8 3.46 1 1 
        849 1 . . . . . 4.11 1.8 4.73 1 1 
        850 1 . . . . . 4.07 1.8 4.68 1 1 
        851 1 . . . . .  3.8 1.8 4.37 1 1 
        852 1 . . . . . 4.11 1.8 4.73 1 1 
        853 1 . . . . .  3.3 1.8  3.8 1 1 
        854 1 . . . . . 2.88 1.8 3.31 1 1 
        855 1 . . . . . 3.05 1.8 3.51 1 1 
        856 1 . . . . . 4.05 1.8 4.66 1 1 
        857 1 . . . . . 4.05 1.8 4.66 1 1 
        858 1 . . . . . 3.79 1.8 4.36 1 1 
        859 1 . . . . . 3.14 1.8 3.61 1 1 
        860 1 . . . . .  3.0 1.8 3.45 1 1 
        861 1 . . . . . 2.94 1.8 3.38 1 1 
        862 1 . . . . . 3.86 1.8 4.44 1 1 
        863 1 . . . . . 4.92 1.8 5.66 1 1 
        864 1 . . . . . 3.84 1.8 4.42 1 1 
        865 1 . . . . . 3.84 1.8 4.42 1 1 
        866 1 . . . . . 4.22 1.8 4.85 1 1 
        867 1 . . . . . 3.67 1.8 4.22 1 1 
        868 1 . . . . . 3.67 1.8 4.22 1 1 
        869 1 . . . . . 4.04 1.8 4.65 1 1 
        870 1 . . . . . 4.08 1.8 4.69 1 1 
        871 1 . . . . .  6.0 1.8  6.9 1 1 
        872 1 . . . . .  6.0 1.8  6.9 1 1 
        873 1 . . . . . 5.38 1.8 6.19 1 1 
        874 1 . . . . . 5.38 1.8 6.19 1 1 
        875 1 . . . . . 5.38 1.8 6.19 1 1 
        876 1 . . . . . 5.38 1.8 6.19 1 1 
        877 1 . . . . . 3.86 1.8 4.44 1 1 
        878 1 . . . . . 3.59 1.8 4.13 1 1 
        879 1 . . . . . 4.57 1.8 5.26 1 1 
        880 1 . . . . . 4.04 1.8 4.65 1 1 
        881 1 . . . . . 3.64 1.8 4.19 1 1 
        882 1 . . . . . 4.16 1.8 4.78 1 1 
        883 1 . . . . . 3.87 1.8 4.45 1 1 
        884 1 . . . . . 3.36 1.8 3.86 1 1 
        885 1 . . . . . 4.57 1.8 5.26 1 1 
        886 1 . . . . . 3.57 1.8 4.11 1 1 
        887 1 . . . . . 3.53 1.8 4.06 1 1 
        888 1 . . . . . 2.78 1.8  3.2 1 1 
        889 1 . . . . . 4.65 1.8 5.35 1 1 
        890 1 . . . . . 3.06 1.8 3.52 1 1 
        891 1 . . . . . 2.98 1.8 3.43 1 1 
        892 1 . . . . . 3.73 1.8 4.29 1 1 
        893 1 . . . . . 3.96 1.8 4.55 1 1 
        894 1 . . . . . 3.59 1.8 4.13 1 1 
        895 1 . . . . . 4.02 1.8 4.62 1 1 
        896 1 . . . . . 4.32 1.8 4.97 1 1 
        897 1 . . . . . 4.02 1.8 4.62 1 1 
        898 1 . . . . . 4.14 1.8 4.76 1 1 
        899 1 . . . . . 4.04 1.8 4.65 1 1 
        900 1 . . . . . 4.04 1.8 4.65 1 1 
        901 1 . . . . . 3.65 1.8  4.2 1 1 
        902 1 . . . . .  3.7 1.8 4.26 1 1 
        903 1 . . . . .  3.7 1.8 4.26 1 1 
        904 1 . . . . . 4.24 1.8 4.88 1 1 
        905 1 . . . . . 4.24 1.8 4.88 1 1 
        906 1 . . . . . 5.19 1.8 5.97 1 1 
        907 1 . . . . . 5.19 1.8 5.97 1 1 
        908 1 . . . . .  6.0 1.8  6.9 1 1 
        909 1 . . . . .  6.0 1.8  6.9 1 1 
        910 1 . . . . .  6.0 1.8  6.9 1 1 
        911 1 . . . . .  6.0 1.8  6.9 1 1 
        912 1 . . . . . 4.72 1.8 5.43 1 1 
        913 1 . . . . . 3.84 1.8 4.42 1 1 
        914 1 . . . . . 3.84 1.8 4.42 1 1 
        915 1 . . . . . 3.85 1.8 4.43 1 1 
        916 1 . . . . . 3.85 1.8 4.43 1 1 
        917 1 . . . . . 4.18 1.8 4.81 1 1 
        918 1 . . . . . 4.18 1.8 4.81 1 1 
        919 1 . . . . . 3.09 1.8 3.55 1 1 
        920 1 . . . . . 3.11 1.8 3.58 1 1 
        921 1 . . . . . 3.85 1.8 4.43 1 1 
        922 1 . . . . . 2.97 1.8 3.42 1 1 
        923 1 . . . . . 3.84 1.8 4.42 1 1 
        924 1 . . . . . 3.25 1.8 3.74 1 1 
        925 1 . . . . . 3.26 1.8 3.75 1 1 
        926 1 . . . . . 4.03 1.8 4.63 1 1 
        927 1 . . . . . 4.27 1.8 4.91 1 1 
        928 1 . . . . . 3.96 1.8 4.55 1 1 
        929 1 . . . . . 3.02 1.8 3.47 1 1 
        930 1 . . . . . 3.47 1.8 3.99 1 1 
        931 1 . . . . . 3.27 1.8 3.76 1 1 
        932 1 . . . . .  4.9 1.8 5.64 1 1 
        933 1 . . . . . 3.47 1.8 3.99 1 1 
        934 1 . . . . . 4.85 1.8 5.58 1 1 
        935 1 . . . . . 3.47 1.8 3.99 1 1 
        936 1 . . . . . 3.47 1.8 3.99 1 1 
        937 1 . . . . . 5.36 1.8 6.16 1 1 
        938 1 . . . . . 5.36 1.8 6.16 1 1 
        939 1 . . . . . 5.99 1.8 6.89 1 1 
        940 1 . . . . . 5.99 1.8 6.89 1 1 
        941 1 . . . . . 2.95 1.8 3.39 1 1 
        942 1 . . . . . 3.91 1.8  4.5 1 1 
        943 1 . . . . . 3.91 1.8  4.5 1 1 
        944 1 . . . . . 3.71 1.8 4.27 1 1 
        945 1 . . . . . 3.71 1.8 4.27 1 1 
        946 1 . . . . . 3.03 1.8 3.48 1 1 
        947 1 . . . . . 4.14 1.8 4.76 1 1 
        948 1 . . . . . 3.18 1.8 3.66 1 1 
        949 1 . . . . . 3.86 1.8 4.44 1 1 
        950 1 . . . . . 3.44 1.8 3.96 1 1 
        951 1 . . . . . 3.44 1.8 3.96 1 1 
        952 1 . . . . . 2.52 1.8  2.9 1 1 
        953 1 . . . . . 3.76 1.8 4.32 1 1 
        954 1 . . . . . 2.99 1.8 3.44 1 1 
        955 1 . . . . . 3.74 1.8  4.3 1 1 
        956 1 . . . . .  3.8 1.8 4.37 1 1 
        957 1 . . . . .  3.8 1.8 4.37 1 1 
        958 1 . . . . . 3.42 1.8 3.93 1 1 
        959 1 . . . . . 3.42 1.8 3.93 1 1 
        960 1 . . . . .  2.9 1.8 3.34 1 1 
        961 1 . . . . . 3.04 1.8  3.5 1 1 
        962 1 . . . . . 3.94 1.8 4.53 1 1 
        963 1 . . . . . 3.94 1.8 4.53 1 1 
        964 1 . . . . . 3.63 1.8 4.17 1 1 
        965 1 . . . . . 3.86 1.8 4.44 1 1 
        966 1 . . . . . 3.55 1.8 4.08 1 1 
        967 1 . . . . . 4.16 1.8 4.78 1 1 
        968 1 . . . . . 3.15 1.8 3.62 1 1 
        969 1 . . . . . 4.45 1.8 5.12 1 1 
        970 1 . . . . . 3.78 1.8 4.35 1 1 
        971 1 . . . . . 4.05 1.8 4.66 1 1 
        972 1 . . . . . 4.08 1.8 4.69 1 1 
        973 1 . . . . . 4.21 1.8 4.84 1 1 
        974 1 . . . . . 4.21 1.8 4.84 1 1 
        975 1 . . . . .  6.0 1.8  6.9 1 1 
        976 1 . . . . .  6.0 1.8  6.9 1 1 
        977 1 . . . . . 3.32 1.8 3.82 1 1 
        978 1 . . . . . 4.47 1.8 5.14 1 1 
        979 1 . . . . . 2.97 1.8 3.42 1 1 
        980 1 . . . . . 3.28 1.8 3.77 1 1 
        981 1 . . . . . 3.42 1.8 3.93 1 1 
        982 1 . . . . . 4.85 1.8 5.58 1 1 
        983 1 . . . . . 3.89 1.8 4.47 1 1 
        984 1 . . . . . 3.91 1.8  4.5 1 1 
        985 1 . . . . . 3.28 1.8 3.77 1 1 
        986 1 . . . . . 3.42 1.8 3.93 1 1 
        987 1 . . . . . 4.05 1.8 4.66 1 1 
        988 1 . . . . . 4.05 1.8 4.66 1 1 
        989 1 . . . . . 4.86 1.8 5.59 1 1 
        990 1 . . . . . 5.52 1.8 6.35 1 1 
        991 1 . . . . . 3.42 1.8 3.93 1 1 
        992 1 . . . . . 5.26 1.8 6.05 1 1 
        993 1 . . . . . 4.47 1.8 5.14 1 1 
        994 1 . . . . . 3.03 1.8 3.48 1 1 
        995 1 . . . . . 4.36 1.8 5.01 1 1 
        996 1 . . . . . 4.61 1.8  5.3 1 1 
        997 1 . . . . . 5.12 1.8 5.89 1 1 
        998 1 . . . . . 4.75 1.8 5.46 1 1 
        999 1 . . . . . 4.59 1.8 5.28 1 1 
       1000 1 . . . . . 4.65 1.8 5.35 1 1 
       1001 1 . . . . .  6.0 1.8  6.9 1 1 
       1002 1 . . . . .  6.0 1.8  6.9 1 1 
       1003 1 . . . . . 5.05 1.8 5.81 1 1 
       1004 1 . . . . . 5.05 1.8 5.81 1 1 
       1005 1 . . . . . 5.02 1.8 5.77 1 1 
       1006 1 . . . . . 4.05 1.8 4.66 1 1 
       1007 1 . . . . .  4.2 1.8 4.83 1 1 
       1008 1 . . . . . 4.19 1.8 4.82 1 1 
       1009 1 . . . . .  4.6 1.8 5.29 1 1 
       1010 1 . . . . . 4.71 1.8 5.42 1 1 
       1011 1 . . . . . 5.71 1.8 6.57 1 1 
       1012 1 . . . . . 5.06 1.8 5.82 1 1 
       1013 1 . . . . . 5.26 1.8 6.05 1 1 
       1014 1 . . . . . 4.37 1.8 5.03 1 1 
       1015 1 . . . . . 3.97 1.8 4.57 1 1 
       1016 1 . . . . . 3.27 1.8 3.76 1 1 
       1017 1 . . . . . 5.99 1.8 6.89 1 1 
       1018 1 . . . . . 5.99 1.8 6.89 1 1 
       1019 1 . . . . . 4.35 1.8  5.0 1 1 
       1020 1 . . . . .  3.8 1.8 4.37 1 1 
       1021 1 . . . . .  3.8 1.8 4.37 1 1 
       1022 1 . . . . . 3.61 1.8 4.15 1 1 
       1023 1 . . . . . 5.11 1.8 5.88 1 1 
       1024 1 . . . . .  4.5 1.8 5.18 1 1 
       1025 1 . . . . . 4.45 1.8 5.12 1 1 
       1026 1 . . . . . 4.47 1.8 5.14 1 1 
       1027 1 . . . . . 4.47 1.8 5.14 1 1 
       1028 1 . . . . . 4.38 1.8 5.04 1 1 
       1029 1 . . . . . 4.81 1.8 5.53 1 1 
       1030 1 . . . . . 3.89 1.8 4.47 1 1 
       1031 1 . . . . . 4.21 1.8 4.84 1 1 
       1032 1 . . . . . 3.58 1.8 4.12 1 1 
       1033 1 . . . . . 4.92 1.8 5.66 1 1 
       1034 1 . . . . . 4.75 1.8 5.46 1 1 
       1035 1 . . . . . 4.75 1.8 5.46 1 1 
       1036 1 . . . . . 5.33 1.8 6.13 1 1 
       1037 1 . . . . . 5.33 1.8 6.13 1 1 
       1038 1 . . . . . 4.21 1.8 4.84 1 1 
       1039 1 . . . . . 5.23 1.8 6.01 1 1 
       1040 1 . . . . . 4.78 1.8  5.5 1 1 
       1041 1 . . . . . 4.78 1.8  5.5 1 1 
       1042 1 . . . . . 5.22 1.8  6.0 1 1 
       1043 1 . . . . .  5.8 1.8 6.67 1 1 
       1044 1 . . . . . 3.67 1.8 4.22 1 1 
       1045 1 . . . . . 5.17 1.8 5.95 1 1 
       1046 1 . . . . . 4.09 1.8  4.7 1 1 
       1047 1 . . . . . 4.09 1.8  4.7 1 1 
       1048 1 . . . . . 4.43 1.8 5.09 1 1 
       1049 1 . . . . . 3.85 1.8 4.43 1 1 
       1050 1 . . . . . 4.15 1.8 4.77 1 1 
       1051 1 . . . . . 4.97 1.8 5.72 1 1 
       1052 1 . . . . . 4.97 1.8 5.72 1 1 
       1053 1 . . . . . 3.72 1.8 4.28 1 1 
       1054 1 . . . . . 5.39 1.8  6.2 1 1 
       1055 1 . . . . . 4.88 1.8 5.61 1 1 
       1056 1 . . . . . 4.94 1.8 5.68 1 1 
       1057 1 . . . . . 3.95 1.8 4.54 1 1 
       1058 1 . . . . . 4.45 1.8 5.12 1 1 
       1059 1 . . . . . 3.33 1.8 3.83 1 1 
       1060 1 . . . . . 3.33 1.8 3.83 1 1 
       1061 1 . . . . . 3.86 1.8 4.44 1 1 
       1062 1 . . . . . 4.89 1.8 5.62 1 1 
       1063 1 . . . . . 3.96 1.8 4.55 1 1 
       1064 1 . . . . . 4.93 1.8 5.67 1 1 
       1065 1 . . . . . 4.79 1.8 5.51 1 1 
       1066 1 . . . . . 3.91 1.8  4.5 1 1 
       1067 1 . . . . .  4.9 1.8 5.64 1 1 
       1068 1 . . . . . 3.68 1.8 4.23 1 1 
       1069 1 . . . . . 3.68 1.8 4.23 1 1 
       1070 1 . . . . . 4.72 1.8 5.43 1 1 
       1071 1 . . . . . 4.55 1.8 5.23 1 1 
       1072 1 . . . . . 4.55 1.8 5.23 1 1 
       1073 1 . . . . . 4.69 1.8 5.39 1 1 
       1074 1 . . . . . 3.97 1.8 4.57 1 1 
       1075 1 . . . . . 3.54 1.8 4.07 1 1 
       1076 1 . . . . . 4.51 1.8 5.19 1 1 
       1077 1 . . . . . 5.32 1.8 6.12 1 1 
       1078 1 . . . . . 4.23 1.8 4.86 1 1 
       1079 1 . . . . . 4.17 1.8  4.8 1 1 
       1080 1 . . . . . 4.17 1.8  4.8 1 1 
       1081 1 . . . . . 4.11 1.8 4.73 1 1 
       1082 1 . . . . . 4.11 1.8 4.73 1 1 
       1083 1 . . . . . 4.63 1.8 5.32 1 1 
       1084 1 . . . . . 4.47 1.8 5.14 1 1 
       1085 1 . . . . . 3.66 1.8 4.21 1 1 
       1086 1 . . . . . 4.94 1.8 5.68 1 1 
       1087 1 . . . . . 4.71 1.8 5.42 1 1 
       1088 1 . . . . . 4.12 1.8 4.74 1 1 
       1089 1 . . . . . 4.31 1.8 4.96 1 1 
       1090 1 . . . . . 4.31 1.8 4.96 1 1 
       1091 1 . . . . . 3.31 1.8 3.81 1 1 
       1092 1 . . . . . 4.31 1.8 4.96 1 1 
       1093 1 . . . . . 3.85 1.8 4.43 1 1 
       1094 1 . . . . . 4.13 1.8 4.75 1 1 
       1095 1 . . . . . 4.13 1.8 4.75 1 1 
       1096 1 . . . . . 5.47 1.8 6.29 1 1 
       1097 1 . . . . . 4.28 1.8 4.92 1 1 
       1098 1 . . . . . 3.73 1.8 4.29 1 1 
       1099 1 . . . . . 4.57 1.8 5.26 1 1 
       1100 1 . . . . . 5.12 1.8 5.89 1 1 
       1101 1 . . . . . 3.89 1.8 4.47 1 1 
       1102 1 . . . . . 3.89 1.8 4.47 1 1 
       1103 1 . . . . . 5.27 1.8 6.06 1 1 
       1104 1 . . . . . 4.39 1.8 5.05 1 1 
       1105 1 . . . . . 4.39 1.8 5.05 1 1 
       1106 1 . . . . . 4.42 1.8 5.08 1 1 
       1107 1 . . . . . 4.55 1.8 5.23 1 1 
       1108 1 . . . . . 3.66 1.8 4.21 1 1 
       1109 1 . . . . . 3.79 1.8 4.36 1 1 
       1110 1 . . . . . 4.93 1.8 5.67 1 1 
       1111 1 . . . . . 5.02 1.8 5.77 1 1 
       1112 1 . . . . . 4.38 1.8 5.04 1 1 
       1113 1 . . . . . 4.02 1.8 4.62 1 1 
       1114 1 . . . . . 5.05 1.8 5.81 1 1 
       1115 1 . . . . . 4.51 1.8 5.19 1 1 
       1116 1 . . . . . 4.35 1.8  5.0 1 1 
       1117 1 . . . . . 3.96 1.8 4.55 1 1 
       1118 1 . . . . . 3.96 1.8 4.55 1 1 
       1119 1 . . . . . 3.64 1.8 4.19 1 1 
       1120 1 . . . . . 4.77 1.8 5.49 1 1 
       1121 1 . . . . . 4.94 1.8 5.68 1 1 
       1122 1 . . . . . 5.26 1.8 6.05 1 1 
       1123 1 . . . . .  5.2 1.8 5.98 1 1 
       1124 1 . . . . . 4.94 1.8 5.68 1 1 
       1125 1 . . . . .  4.9 1.8 5.64 1 1 
       1126 1 . . . . . 4.22 1.8 4.85 1 1 
       1127 1 . . . . . 4.59 1.8 5.28 1 1 
       1128 1 . . . . . 4.18 1.8 4.81 1 1 
       1129 1 . . . . . 4.49 1.8 5.16 1 1 
       1130 1 . . . . . 4.49 1.8 5.16 1 1 
       1131 1 . . . . . 4.73 1.8 5.44 1 1 
       1132 1 . . . . . 4.73 1.8 5.44 1 1 
       1133 1 . . . . . 5.28 1.8 6.07 1 1 
       1134 1 . . . . . 5.36 1.8 6.16 1 1 
       1135 1 . . . . . 4.82 1.8 5.54 1 1 
       1136 1 . . . . . 4.31 1.8 4.96 1 1 
       1137 1 . . . . .  5.9 1.8 6.79 1 1 
       1138 1 . . . . .  5.3 1.8  6.1 1 1 
       1139 1 . . . . . 5.14 1.8 5.91 1 1 
       1140 1 . . . . . 3.55 1.8 4.08 1 1 
       1141 1 . . . . . 3.95 1.8 4.54 1 1 
       1142 1 . . . . . 3.95 1.8 4.54 1 1 
       1143 1 . . . . . 3.79 1.8 4.36 1 1 
       1144 1 . . . . . 3.85 1.8 4.43 1 1 
       1145 1 . . . . . 5.19 1.8 5.97 1 1 
       1146 1 . . . . .  3.2 1.8 3.68 1 1 
       1147 1 . . . . . 5.02 1.8 5.77 1 1 
       1148 1 . . . . . 4.05 1.8 4.66 1 1 
       1149 1 . . . . . 3.33 1.8 3.83 1 1 
       1150 1 . . . . . 3.19 1.8 3.67 1 1 
       1151 1 . . . . . 4.52 1.8  5.2 1 1 
       1152 1 . . . . .  4.7 1.8  5.4 1 1 
       1153 1 . . . . . 4.89 1.8 5.62 1 1 
       1154 1 . . . . . 4.61 1.8  5.3 1 1 
       1155 1 . . . . . 5.59 1.8 6.43 1 1 
       1156 1 . . . . . 5.56 1.8 6.39 1 1 
       1157 1 . . . . .  6.0 1.8  6.9 1 1 
       1158 1 . . . . . 3.93 1.8 4.52 1 1 
       1159 1 . . . . . 5.11 1.8 5.88 1 1 
       1160 1 . . . . . 4.59 1.8 5.28 1 1 
       1161 1 . . . . . 5.19 1.8 5.97 1 1 
       1162 1 . . . . . 5.77 1.8 6.64 1 1 
       1163 1 . . . . . 5.46 1.8 6.28 1 1 
       1164 1 . . . . . 5.28 1.8 6.07 1 1 
       1165 1 . . . . . 5.44 1.8 6.26 1 1 
       1166 1 . . . . . 5.06 1.8 5.82 1 1 
       1167 1 . . . . . 5.02 1.8 5.77 1 1 
       1168 1 . . . . .  3.9 1.8 4.49 1 1 
       1169 1 . . . . . 4.84 1.8 5.57 1 1 
       1170 1 . . . . . 4.91 1.8 5.65 1 1 
       1171 1 . . . . . 5.23 1.8 6.01 1 1 
       1172 1 . . . . . 4.41 1.8 5.07 1 1 
       1173 1 . . . . . 5.22 1.8  6.0 1 1 
       1174 1 . . . . . 4.41 1.8 5.07 1 1 
       1175 1 . . . . . 4.42 1.8 5.08 1 1 
       1176 1 . . . . . 4.04 1.8 4.65 1 1 
       1177 1 . . . . .  3.1 1.8 3.57 1 1 
       1178 1 . . . . . 3.47 1.8 3.99 1 1 
       1179 1 . . . . . 3.08 1.8 3.54 1 1 
       1180 1 . . . . . 3.15 1.8 3.62 1 1 
       1181 1 . . . . . 4.39 1.8 5.05 1 1 
       1182 1 . . . . . 4.92 1.8 5.66 1 1 
       1183 1 . . . . . 4.92 1.8 5.66 1 1 
       1184 1 . . . . . 5.06 1.8 5.82 1 1 
       1185 1 . . . . . 5.06 1.8 5.82 1 1 
       1186 1 . . . . . 5.04 1.8  5.8 1 1 
       1187 1 . . . . .  3.7 1.8 4.26 1 1 
       1188 1 . . . . . 4.08 1.8 4.69 1 1 
       1189 1 . . . . . 3.89 1.8 4.47 1 1 
       1190 1 . . . . . 4.46 1.8 5.13 1 1 
       1191 1 . . . . . 5.04 1.8  5.8 1 1 
       1192 1 . . . . . 5.97 1.8 6.87 1 1 
       1193 1 . . . . . 5.31 1.8 6.11 1 1 
       1194 1 . . . . . 4.73 1.8 5.44 1 1 
       1195 1 . . . . .  4.7 1.8  5.4 1 1 
       1196 1 . . . . . 4.73 1.8 5.44 1 1 
       1197 1 . . . . .  4.7 1.8  5.4 1 1 
       1198 1 . . . . . 5.06 1.8 5.82 1 1 
       1199 1 . . . . .  4.4 1.8 5.06 1 1 
       1200 1 . . . . . 4.39 1.8 5.05 1 1 
       1201 1 . . . . . 4.54 1.8 5.22 1 1 
       1202 1 . . . . . 4.54 1.8 5.22 1 1 
       1203 1 . . . . . 4.15 1.8 4.77 1 1 
       1204 1 . . . . . 4.54 1.8 5.22 1 1 
       1205 1 . . . . . 4.87 1.8  5.6 1 1 
       1206 1 . . . . . 3.67 1.8 4.22 1 1 
       1207 1 . . . . . 4.61 1.8  5.3 1 1 
       1208 1 . . . . . 3.77 1.8 4.34 1 1 
       1209 1 . . . . . 5.27 1.8 6.06 1 1 
       1210 1 . . . . . 5.61 1.8 6.45 1 1 
       1211 1 . . . . .  6.0 1.8  6.9 1 1 
       1212 1 . . . . . 5.41 1.8 6.22 1 1 
       1213 1 . . . . . 4.89 1.8 5.62 1 1 
       1214 1 . . . . . 4.56 1.8 5.24 1 1 
       1215 1 . . . . . 4.56 1.8 5.24 1 1 
       1216 1 . . . . . 4.54 1.8 5.22 1 1 
       1217 1 . . . . . 4.31 1.8 4.96 1 1 
       1218 1 . . . . . 4.15 1.8 4.77 1 1 
       1219 1 . . . . . 5.32 1.8 6.12 1 1 
       1220 1 . . . . . 4.17 1.8  4.8 1 1 
       1221 1 . . . . . 5.89 1.8 6.77 1 1 
       1222 1 . . . . .  6.0 1.8  6.9 1 1 
       1223 1 . . . . . 3.78 1.8 4.35 1 1 
       1224 1 . . . . . 4.55 1.8 5.23 1 1 
       1225 1 . . . . .  4.4 1.8 5.06 1 1 
       1226 1 . . . . . 5.66 1.8 6.51 1 1 
       1227 1 . . . . . 4.78 1.8  5.5 1 1 
       1228 1 . . . . . 5.67 1.8 6.52 1 1 
       1229 1 . . . . . 5.32 1.8 6.12 1 1 
       1230 1 . . . . . 5.05 1.8 5.81 1 1 
       1231 1 . . . . . 3.55 1.8 4.08 1 1 
       1232 1 . . . . . 4.49 1.8 5.16 1 1 
       1233 1 . . . . . 3.77 1.8 4.34 1 1 
       1234 1 . . . . . 4.65 1.8 5.35 1 1 
       1235 1 . . . . . 4.68 1.8 5.38 1 1 
       1236 1 . . . . . 3.67 1.8 4.22 1 1 
       1237 1 . . . . .  6.0 1.8  6.9 1 1 
       1238 1 . . . . . 5.29 1.8 6.08 1 1 
       1239 1 . . . . . 5.29 1.8 6.08 1 1 
       1240 1 . . . . . 5.51 1.8 6.34 1 1 
       1241 1 . . . . . 5.14 1.8 5.91 1 1 
       1242 1 . . . . . 4.78 1.8  5.5 1 1 
       1243 1 . . . . .  6.0 1.8  6.9 1 1 
       1244 1 . . . . . 3.45 1.8 3.97 1 1 
       1245 1 . . . . . 4.59 1.8 5.28 1 1 
       1246 1 . . . . .  4.6 1.8 5.29 1 1 
       1247 1 . . . . . 4.81 1.8 5.53 1 1 
       1248 1 . . . . . 4.92 1.8 5.66 1 1 
       1249 1 . . . . . 4.26 1.8  4.9 1 1 
       1250 1 . . . . . 5.06 1.8 5.82 1 1 
       1251 1 . . . . . 5.75 1.8 6.61 1 1 
       1252 1 . . . . . 5.75 1.8 6.61 1 1 
       1253 1 . . . . . 4.74 1.8 5.45 1 1 
       1254 1 . . . . . 5.62 1.8 6.46 1 1 
       1255 1 . . . . . 3.09 1.8 3.55 1 1 
       1256 1 . . . . . 3.75 1.8 4.31 1 1 
       1257 1 . . . . . 5.04 1.8  5.8 1 1 
       1258 1 . . . . . 3.69 1.8 4.24 1 1 
       1259 1 . . . . . 3.72 1.8 4.28 1 1 
       1260 1 . . . . . 3.73 1.8 4.29 1 1 
       1261 1 . . . . .  6.0 1.8  6.9 1 1 
       1262 1 . . . . .  6.0 1.8  6.9 1 1 
       1263 1 . . . . .  6.0 1.8  6.9 1 1 
       1264 1 . . . . .  6.0 1.8  6.9 1 1 
       1265 1 . . . . . 4.77 1.8 5.49 1 1 
       1266 1 . . . . . 3.72 1.8 4.28 1 1 
       1267 1 . . . . . 4.93 1.8 5.67 1 1 
       1268 1 . . . . . 4.93 1.8 5.67 1 1 
       1269 1 . . . . . 3.52 1.8 4.05 1 1 
       1270 1 . . . . . 4.26 1.8  4.9 1 1 
       1271 1 . . . . . 4.78 1.8  5.5 1 1 
       1272 1 . . . . . 4.26 1.8  4.9 1 1 
       1273 1 . . . . . 4.78 1.8  5.5 1 1 
       1274 1 . . . . . 4.86 1.8 5.59 1 1 
       1275 1 . . . . . 5.05 1.8 5.81 1 1 
       1276 1 . . . . . 4.66 1.8 5.36 1 1 
       1277 1 . . . . . 4.39 1.8 5.05 1 1 
       1278 1 . . . . . 4.85 1.8 5.58 1 1 
       1279 1 . . . . . 5.81 1.8 6.68 1 1 
       1280 1 . . . . . 5.08 1.8 5.84 1 1 
       1281 1 . . . . . 4.66 1.8 5.36 1 1 
       1282 1 . . . . . 4.07 1.8 4.68 1 1 
       1283 1 . . . . . 3.37 1.8 3.88 1 1 
       1284 1 . . . . . 4.62 1.8 5.31 1 1 
       1285 1 . . . . . 4.73 1.8 5.44 1 1 
       1286 1 . . . . . 4.27 1.8 4.91 1 1 
       1287 1 . . . . . 5.41 1.8 6.22 1 1 
       1288 1 . . . . . 5.74 1.8  6.6 1 1 
       1289 1 . . . . . 5.12 1.8 5.89 1 1 
       1290 1 . . . . . 4.27 1.8 4.91 1 1 
       1291 1 . . . . . 4.27 1.8 4.91 1 1 
       1292 1 . . . . . 4.07 1.8 4.68 1 1 
       1293 1 . . . . . 5.47 1.8 6.29 1 1 
       1294 1 . . . . . 5.47 1.8 6.29 1 1 
       1295 1 . . . . . 4.28 1.8 4.92 1 1 
       1296 1 . . . . . 4.56 1.8 5.24 1 1 
       1297 1 . . . . .  5.2 1.8 5.98 1 1 
       1298 1 . . . . .  5.2 1.8 5.98 1 1 
       1299 1 . . . . . 3.85 1.8 4.43 1 1 
       1300 1 . . . . . 4.93 1.8 5.67 1 1 
       1301 1 . . . . . 4.53 1.8 5.21 1 1 
       1302 1 . . . . .  4.7 1.8  5.4 1 1 
       1303 1 . . . . . 5.65 1.8  6.5 1 1 
       1304 1 . . . . .  5.0 1.8 5.75 1 1 
       1305 1 . . . . . 3.13 1.8  3.6 1 1 
       1306 1 . . . . . 5.21 1.8 5.99 1 1 
       1307 1 . . . . . 4.91 1.8 5.65 1 1 
       1308 1 . . . . . 4.92 1.8 5.66 1 1 
       1309 1 . . . . . 5.51 1.8 6.34 1 1 
       1310 1 . . . . .  6.0 1.8  6.9 1 1 
       1311 1 . . . . . 5.35 1.8 6.15 1 1 
       1312 1 . . . . . 4.89 1.8 5.62 1 1 
       1313 1 . . . . . 4.58 1.8 5.27 1 1 
       1314 1 . . . . . 4.74 1.8 5.45 1 1 
       1315 1 . . . . . 4.58 1.8 5.27 1 1 
       1316 1 . . . . . 4.69 1.8 5.39 1 1 
       1317 1 . . . . . 4.67 1.8 5.37 1 1 
       1318 1 . . . . . 5.23 1.8 6.01 1 1 
       1319 1 . . . . .  6.0 1.8  6.9 1 1 
       1320 1 . . . . . 4.23 1.8 4.86 1 1 
       1321 1 . . . . . 3.63 1.8 4.17 1 1 
       1322 1 . . . . . 4.75 1.8 5.46 1 1 
       1323 1 . . . . . 4.32 1.8 4.97 1 1 
       1324 1 . . . . . 3.66 1.8 4.21 1 1 
       1325 1 . . . . .  4.3 1.8 4.95 1 1 
       1326 1 . . . . . 3.52 1.8 4.05 1 1 
       1327 1 . . . . . 4.48 1.8 5.15 1 1 
       1328 1 . . . . . 5.89 1.8 6.77 1 1 
       1329 1 . . . . .  6.0 1.8  6.9 1 1 
       1330 1 . . . . . 4.52 1.8  5.2 1 1 
       1331 1 . . . . . 4.92 1.8 5.66 1 1 
       1332 1 . . . . . 5.42 1.8 6.23 1 1 
       1333 1 . . . . . 4.09 1.8  4.7 1 1 
       1334 1 . . . . . 3.57 1.8 4.11 1 1 
       1335 1 . . . . . 3.69 1.8 4.24 1 1 
       1336 1 . . . . . 3.91 1.8  4.5 1 1 
       1337 1 . . . . .  5.0 1.8 5.75 1 1 
       1338 1 . . . . . 5.59 1.8 6.43 1 1 
       1339 1 . . . . . 3.95 1.8 4.54 1 1 
       1340 1 . . . . . 4.76 1.8 5.47 1 1 
       1341 1 . . . . . 4.32 1.8 4.97 1 1 
       1342 1 . . . . . 4.32 1.8 4.97 1 1 
       1343 1 . . . . . 4.96 1.8  5.7 1 1 
       1344 1 . . . . . 4.79 1.8 5.51 1 1 
       1345 1 . . . . .  4.1 1.8 4.72 1 1 
       1346 1 . . . . . 5.17 1.8 5.95 1 1 
       1347 1 . . . . . 5.93 1.8 6.82 1 1 
       1348 1 . . . . . 5.12 1.8 5.89 1 1 
       1349 1 . . . . . 4.67 1.8 5.37 1 1 
       1350 1 . . . . . 3.38 1.8 3.89 1 1 
       1351 1 . . . . . 2.81 1.8 3.23 1 1 
       1352 1 . . . . . 4.51 1.8 5.19 1 1 
       1353 1 . . . . . 4.66 1.8 5.36 1 1 
       1354 1 . . . . .  6.0 1.8  6.9 1 1 
       1355 1 . . . . .  6.0 1.8  6.9 1 1 
       1356 1 . . . . . 5.11 1.8 5.88 1 1 
       1357 1 . . . . . 5.44 1.8 6.26 1 1 
       1358 1 . . . . . 5.56 1.8 6.39 1 1 
       1359 1 . . . . . 5.93 1.8 6.82 1 1 
       1360 1 . . . . . 3.55 1.8 4.08 1 1 
       1361 1 . . . . . 4.52 1.8  5.2 1 1 
       1362 1 . . . . . 4.52 1.8  5.2 1 1 
       1363 1 . . . . . 5.12 1.8 5.89 1 1 
       1364 1 . . . . . 5.12 1.8 5.89 1 1 
       1365 1 . . . . . 3.15 1.8 3.62 1 1 
       1366 1 . . . . .  3.1 1.8 3.57 1 1 
       1367 1 . . . . .  5.2 1.8 5.98 1 1 
       1368 1 . . . . . 4.31 1.8 4.96 1 1 
       1369 1 . . . . .  5.9 1.8 6.79 1 1 
       1370 1 . . . . .  5.4 1.8 6.21 1 1 
       1371 1 . . . . . 5.16 1.8 5.93 1 1 
       1372 1 . . . . . 4.53 1.8 5.21 1 1 
       1373 1 . . . . . 3.56 1.8 4.09 1 1 
       1374 1 . . . . . 4.77 1.8 5.49 1 1 
       1375 1 . . . . . 5.34 1.8 6.14 1 1 
       1376 1 . . . . . 3.34 1.8 3.84 1 1 
       1377 1 . . . . .  5.4 1.8 6.21 1 1 
       1378 1 . . . . . 5.92 1.8 6.81 1 1 
       1379 1 . . . . . 4.02 1.8 4.62 1 1 
       1380 1 . . . . .  4.1 1.8 4.72 1 1 
       1381 1 . . . . .  4.1 1.8 4.72 1 1 
       1382 1 . . . . . 4.32 1.8 4.97 1 1 
       1383 1 . . . . . 4.12 1.8 4.74 1 1 
       1384 1 . . . . . 4.57 1.8 5.26 1 1 
       1385 1 . . . . . 4.34 1.8 4.99 1 1 
       1386 1 . . . . . 5.73 1.8 6.59 1 1 
       1387 1 . . . . . 5.32 1.8 6.12 1 1 
       1388 1 . . . . . 4.62 1.8 5.31 1 1 
       1389 1 . . . . .  5.3 1.8  6.1 1 1 
       1390 1 . . . . . 5.72 1.8 6.58 1 1 
       1391 1 . . . . . 4.52 1.8  5.2 1 1 
       1392 1 . . . . . 5.38 1.8 6.19 1 1 
       1393 1 . . . . . 4.26 1.8  4.9 1 1 
       1394 1 . . . . . 4.26 1.8  4.9 1 1 
       1395 1 . . . . . 3.49 1.8 4.01 1 1 
       1396 1 . . . . .  4.0 1.8  4.6 1 1 
       1397 1 . . . . . 3.49 1.8 4.01 1 1 
       1398 1 . . . . .  4.0 1.8  4.6 1 1 
       1399 1 . . . . . 5.23 1.8 6.01 1 1 
       1400 1 . . . . .  6.0 1.8  6.9 1 1 
       1401 1 . . . . .  6.0 1.8  6.9 1 1 
       1402 1 . . . . . 4.42 1.8 5.08 1 1 
       1403 1 . . . . . 5.82 1.8 6.69 1 1 
       1404 1 . . . . . 5.82 1.8 6.69 1 1 
       1405 1 . . . . . 3.48 1.8  4.0 1 1 
       1406 1 . . . . . 3.48 1.8  4.0 1 1 
       1407 1 . . . . . 4.72 1.8 5.43 1 1 
       1408 1 . . . . . 4.72 1.8 5.43 1 1 
       1409 1 . . . . . 3.93 1.8 4.52 1 1 
       1410 1 . . . . . 3.82 1.8 4.39 1 1 
       1411 1 . . . . . 5.33 1.8 6.13 1 1 
       1412 1 . . . . . 5.27 1.8 6.06 1 1 
       1413 1 . . . . . 4.65 1.8 5.35 1 1 
       1414 1 . . . . . 5.46 1.8 6.28 1 1 
       1415 1 . . . . . 5.76 1.8 6.62 1 1 
       1416 1 . . . . . 4.77 1.8 5.49 1 1 
       1417 1 . . . . .  6.0 1.8  6.9 1 1 
       1418 1 . . . . . 5.55 1.8 6.38 1 1 
       1419 1 . . . . . 5.55 1.8 6.38 1 1 
       1420 1 . . . . . 4.53 1.8 5.21 1 1 
       1421 1 . . . . . 4.53 1.8 5.21 1 1 
       1422 1 . . . . . 4.53 1.8 5.21 1 1 
       1423 1 . . . . . 4.57 1.8 5.26 1 1 
       1424 1 . . . . .  3.5 1.8 4.03 1 1 
       1425 1 . . . . . 4.13 1.8 4.75 1 1 
       1426 1 . . . . . 5.09 1.8 5.85 1 1 
       1427 1 . . . . . 4.35 1.8  5.0 1 1 
       1428 1 . . . . . 4.34 1.8 4.99 1 1 
       1429 1 . . . . . 5.09 1.8 5.85 1 1 
       1430 1 . . . . . 4.35 1.8  5.0 1 1 
       1431 1 . . . . . 4.34 1.8 4.99 1 1 
       1432 1 . . . . . 4.31 1.8 4.96 1 1 
       1433 1 . . . . . 4.13 1.8 4.75 1 1 
       1434 1 . . . . . 4.72 1.8 5.43 1 1 
       1435 1 . . . . . 4.27 1.8 4.91 1 1 
       1436 1 . . . . . 4.27 1.8 4.91 1 1 
       1437 1 . . . . . 4.16 1.8 4.78 1 1 
       1438 1 . . . . . 4.59 1.8 5.28 1 1 
       1439 1 . . . . . 5.35 1.8 6.15 1 1 
       1440 1 . . . . . 5.84 1.8 6.72 1 1 
       1441 1 . . . . . 4.08 1.8 4.69 1 1 
       1442 1 . . . . . 5.27 1.8 6.06 1 1 
       1443 1 . . . . . 4.57 1.8 5.26 1 1 
       1444 1 . . . . . 5.04 1.8  5.8 1 1 
       1445 1 . . . . . 4.31 1.8 4.96 1 1 
       1446 1 . . . . . 5.73 1.8 6.59 1 1 
       1447 1 . . . . . 5.07 1.8 5.83 1 1 
       1448 1 . . . . . 5.54 1.8 6.37 1 1 
       1449 1 . . . . . 4.72 1.8 5.43 1 1 
       1450 1 . . . . . 4.75 1.8 5.46 1 1 
       1451 1 . . . . . 3.75 1.8 4.31 1 1 
       1452 1 . . . . . 3.72 1.8 4.28 1 1 
       1453 1 . . . . .  6.0 1.8  6.9 1 1 
       1454 1 . . . . .  6.0 1.8  6.9 1 1 
       1455 1 . . . . . 5.54 1.8 6.37 1 1 
       1456 1 . . . . . 5.45 1.8 6.27 1 1 
       1457 1 . . . . . 4.54 1.8 5.22 1 1 
       1458 1 . . . . . 4.32 1.8 4.97 1 1 
       1459 1 . . . . . 4.12 1.8 4.74 1 1 
       1460 1 . . . . . 5.82 1.8 6.69 1 1 
       1461 1 . . . . . 4.96 1.8  5.7 1 1 
       1462 1 . . . . . 4.96 1.8  5.7 1 1 
       1463 1 . . . . . 4.34 1.8 4.99 1 1 
       1464 1 . . . . .  3.4 1.8 3.91 1 1 
       1465 1 . . . . . 4.41 1.8 5.07 1 1 
       1466 1 . . . . . 4.44 1.8 5.11 1 1 
       1467 1 . . . . . 4.84 1.8 5.57 1 1 
       1468 1 . . . . . 4.98 1.8 5.73 1 1 
       1469 1 . . . . . 4.84 1.8 5.57 1 1 
       1470 1 . . . . . 3.34 1.8 3.84 1 1 
       1471 1 . . . . . 3.29 1.8 3.78 1 1 
       1472 1 . . . . . 5.44 1.8 6.26 1 1 
       1473 1 . . . . .  6.0 1.8  6.9 1 1 
       1474 1 . . . . . 5.35 1.8 6.15 1 1 
       1475 1 . . . . . 5.57 1.8 6.41 1 1 
       1476 1 . . . . . 5.35 1.8 6.15 1 1 
       1477 1 . . . . . 5.34 1.8 6.14 1 1 
       1478 1 . . . . . 5.99 1.8 6.89 1 1 
       1479 1 . . . . .  6.0 1.8  6.9 1 1 
       1480 1 . . . . . 5.59 1.8 6.43 1 1 
       1481 1 . . . . .  3.9 1.8 4.49 1 1 
       1482 1 . . . . . 4.01 1.8 4.61 1 1 
       1483 1 . . . . . 4.52 1.8  5.2 1 1 
       1484 1 . . . . . 4.68 1.8 5.38 1 1 
       1485 1 . . . . . 5.81 1.8 6.68 1 1 
       1486 1 . . . . . 5.81 1.8 6.68 1 1 
       1487 1 . . . . . 4.32 1.8 4.97 1 1 
       1488 1 . . . . .  6.0 1.8  6.9 1 1 
       1489 1 . . . . .  6.0 1.8  6.9 1 1 
       1490 1 . . . . . 4.93 1.8 5.67 1 1 
       1491 1 . . . . . 4.99 1.8 5.74 1 1 
       1492 1 . . . . . 4.37 1.8 5.03 1 1 
       1493 1 . . . . . 5.13 1.8  5.9 1 1 
       1494 1 . . . . . 4.28 1.8 4.92 1 1 
       1495 1 . . . . . 3.79 1.8 4.36 1 1 
       1496 1 . . . . . 5.88 1.8 6.76 1 1 
       1497 1 . . . . .  4.0 1.8  4.6 1 1 
       1498 1 . . . . . 4.73 1.8 5.44 1 1 
       1499 1 . . . . . 3.62 1.8 4.16 1 1 
       1500 1 . . . . .  4.0 1.8  4.6 1 1 
       1501 1 . . . . . 4.47 1.8 5.14 1 1 
       1502 1 . . . . .  4.8 1.8 5.52 1 1 
       1503 1 . . . . . 5.04 1.8  5.8 1 1 
       1504 1 . . . . . 4.66 1.8 5.36 1 1 
       1505 1 . . . . . 5.01 1.8 5.76 1 1 
       1506 1 . . . . .  6.0 1.8  6.9 1 1 
       1507 1 . . . . . 3.59 1.8 4.13 1 1 
       1508 1 . . . . . 3.59 1.8 4.13 1 1 
       1509 1 . . . . . 5.22 1.8  6.0 1 1 
       1510 1 . . . . . 4.62 1.8 5.31 1 1 
       1511 1 . . . . . 5.37 1.8 6.18 1 1 
       1512 1 . . . . . 5.96 1.8 6.85 1 1 
       1513 1 . . . . . 5.66 1.8 6.51 1 1 
       1514 1 . . . . .  6.0 1.8  6.9 1 1 
       1515 1 . . . . . 5.54 1.8 6.37 1 1 
       1516 1 . . . . . 4.54 1.8 5.22 1 1 
       1517 1 . . . . . 4.94 1.8 5.68 1 1 
       1518 1 . . . . . 5.29 1.8 6.08 1 1 
       1519 1 . . . . . 5.13 1.8  5.9 1 1 
       1520 1 . . . . . 3.85 1.8 4.43 1 1 
       1521 1 . . . . . 4.12 1.8 4.74 1 1 
       1522 1 . . . . . 3.99 1.8 4.59 1 1 
       1523 1 . . . . . 5.79 1.8 6.66 1 1 
       1524 1 . . . . . 5.79 1.8 6.66 1 1 
       1525 1 . . . . .  6.0 1.8  6.9 1 1 
       1526 1 . . . . .  6.0 1.8  6.9 1 1 
       1527 1 . . . . .  6.0 1.8  6.9 1 1 
       1528 1 . . . . .  6.0 1.8  6.9 1 1 
       1529 1 . . . . . 5.56 1.8 6.39 1 1 
       1530 1 . . . . . 3.21 1.8 3.69 1 1 
       1531 1 . . . . . 4.57 1.8 5.26 1 1 
       1532 1 . . . . . 5.02 1.8 5.77 1 1 
       1533 1 . . . . . 5.69 1.8 6.54 1 1 
       1534 1 . . . . . 4.88 1.8 5.61 1 1 
       1535 1 . . . . .  5.0 1.8 5.75 1 1 
       1536 1 . . . . . 5.21 1.8 5.99 1 1 
       1537 1 . . . . . 4.55 1.8 5.23 1 1 
       1538 1 . . . . . 4.72 1.8 5.43 1 1 
       1539 1 . . . . .  6.0 1.8  6.9 1 1 
       1540 1 . . . . .  6.0 1.8  6.9 1 1 
       1541 1 . . . . . 4.01 1.8 4.61 1 1 
       1542 1 . . . . .  4.6 1.8 5.29 1 1 
       1543 1 . . . . . 4.33 1.8 4.98 1 1 
       1544 1 . . . . . 4.33 1.8 4.98 1 1 
       1545 1 . . . . . 5.66 1.8 6.51 1 1 
       1546 1 . . . . . 5.66 1.8 6.51 1 1 
       1547 1 . . . . . 3.28 1.8 3.77 1 1 
       1548 1 . . . . . 4.87 1.8  5.6 1 1 
       1549 1 . . . . . 4.56 1.8 5.24 1 1 
       1550 1 . . . . .  6.0 1.8  6.9 1 1 
       1551 1 . . . . . 5.07 1.8 5.83 1 1 
       1552 1 . . . . . 4.55 1.8 5.23 1 1 
       1553 1 . . . . .  6.0 1.8  6.9 1 1 
       1554 1 . . . . . 4.67 1.8 5.37 1 1 
       1555 1 . . . . .  6.0 1.8  6.9 1 1 
       1556 1 . . . . .  6.0 1.8  6.9 1 1 
       1557 1 . . . . . 4.76 1.8 5.47 1 1 
       1558 1 . . . . . 3.32 1.8 3.82 1 1 
       1559 1 . . . . . 3.29 1.8 3.78 1 1 
       1560 1 . . . . .  5.5 1.8 6.33 1 1 
       1561 1 . . . . . 4.48 1.8 5.15 1 1 
       1562 1 . . . . . 5.46 1.8 6.28 1 1 
       1563 1 . . . . . 5.46 1.8 6.28 1 1 
       1564 1 . . . . . 4.25 1.8 4.89 1 1 
       1565 1 . . . . . 5.67 1.8 6.52 1 1 
       1566 1 . . . . . 4.07 1.8 4.68 1 1 
       1567 1 . . . . .  6.0 1.8  6.9 1 1 
       1568 1 . . . . . 4.72 1.8 5.43 1 1 
       1569 1 . . . . . 4.72 1.8 5.43 1 1 
       1570 1 . . . . .  6.0 1.8  6.9 1 1 
       1571 1 . . . . .  6.0 1.8  6.9 1 1 
       1572 1 . . . . . 3.15 1.8 3.62 1 1 
       1573 1 . . . . . 3.95 1.8 4.54 1 1 
       1574 1 . . . . .  4.9 1.8 5.64 1 1 
       1575 1 . . . . .  4.5 1.8 5.18 1 1 
       1576 1 . . . . . 4.07 1.8 4.68 1 1 
       1577 1 . . . . . 4.74 1.8 5.45 1 1 
       1578 1 . . . . . 4.82 1.8 5.54 1 1 
       1579 1 . . . . . 4.88 1.8 5.61 1 1 
       1580 1 . . . . .  6.0 1.8  6.9 1 1 
       1581 1 . . . . .  4.9 1.8 5.64 1 1 
       1582 1 . . . . . 4.07 1.8 4.68 1 1 
       1583 1 . . . . .  5.5 1.8 6.33 1 1 
       1584 1 . . . . . 5.83 1.8  6.7 1 1 
       1585 1 . . . . . 5.02 1.8 5.77 1 1 
       1586 1 . . . . . 4.07 1.8 4.68 1 1 
       1587 1 . . . . . 4.62 1.8 5.31 1 1 
       1588 1 . . . . . 4.07 1.8 4.68 1 1 
       1589 1 . . . . . 5.44 1.8 6.26 1 1 
       1590 1 . . . . . 5.35 1.8 6.15 1 1 
       1591 1 . . . . . 5.35 1.8 6.15 1 1 
       1592 1 . . . . . 5.21 1.8 5.99 1 1 
       1593 1 . . . . . 5.35 1.8 6.15 1 1 
       1594 1 . . . . . 5.35 1.8 6.15 1 1 
       1595 1 . . . . . 5.41 1.8 6.22 1 1 
       1596 1 . . . . . 5.41 1.8 6.22 1 1 
       1597 1 . . . . .  4.6 1.8 5.29 1 1 
       1598 1 . . . . . 5.49 1.8 6.31 1 1 
       1599 1 . . . . . 5.51 1.8 6.34 1 1 
       1600 1 . . . . . 4.76 1.8 5.47 1 1 
       1601 1 . . . . . 3.62 1.8 4.16 1 1 
       1602 1 . . . . . 4.02 1.8 4.62 1 1 
       1603 1 . . . . . 4.22 1.8 4.85 1 1 
       1604 1 . . . . . 3.35 1.8 3.85 1 1 
       1605 1 . . . . . 5.85 1.8 6.73 1 1 
       1606 1 . . . . . 4.81 1.8 5.53 1 1 
       1607 1 . . . . .  3.3 1.8  3.8 1 1 
       1608 1 . . . . . 5.42 1.8 6.23 1 1 
       1609 1 . . . . . 5.42 1.8 6.23 1 1 
       1610 1 . . . . . 4.58 1.8 5.27 1 1 
       1611 1 . . . . . 4.58 1.8 5.27 1 1 
       1612 1 . . . . . 5.34 1.8 6.14 1 1 
       1613 1 . . . . . 4.07 1.8 4.68 1 1 
       1614 1 . . . . .  4.8 1.8 5.52 1 1 
       1615 1 . . . . . 4.74 1.8 5.45 1 1 
       1616 1 . . . . . 5.42 1.8 6.23 1 1 
       1617 1 . . . . . 5.42 1.8 6.23 1 1 
       1618 1 . . . . . 4.58 1.8 5.27 1 1 
       1619 1 . . . . . 5.99 1.8 6.89 1 1 
       1620 1 . . . . . 5.09 1.8 5.85 1 1 
       1621 1 . . . . . 5.09 1.8 5.85 1 1 
       1622 1 . . . . . 5.27 1.8 6.06 1 1 
       1623 1 . . . . . 3.84 1.8 4.42 1 1 
       1624 1 . . . . . 3.07 1.8 3.53 1 1 
       1625 1 . . . . . 5.53 1.8 6.36 1 1 
       1626 1 . . . . . 3.91 1.8  4.5 1 1 
       1627 1 . . . . . 4.76 1.8 5.47 1 1 
       1628 1 . . . . . 5.25 1.8 6.04 1 1 
       1629 1 . . . . . 5.25 1.8 6.04 1 1 
       1630 1 . . . . . 4.53 1.8 5.21 1 1 
       1631 1 . . . . . 4.53 1.8 5.21 1 1 
       1632 1 . . . . . 5.24 1.8 6.03 1 1 
       1633 1 . . . . .  6.0 1.8  6.9 1 1 
       1634 1 . . . . . 5.75 1.8 6.61 1 1 
       1635 1 . . . . . 5.75 1.8 6.61 1 1 
       1636 1 . . . . . 5.04 1.8  5.8 1 1 
       1637 1 . . . . . 5.04 1.8  5.8 1 1 
       1638 1 . . . . .  5.5 1.8 6.33 1 1 
       1639 1 . . . . . 4.65 1.8 5.35 1 1 
       1640 1 . . . . .  6.0 1.8  6.9 1 1 
       1641 1 . . . . . 4.41 1.8 5.07 1 1 
       1642 1 . . . . .  4.6 1.8 5.29 1 1 
       1643 1 . . . . . 4.65 1.8 5.35 1 1 
       1644 1 . . . . .  4.9 1.8 5.64 1 1 
       1645 1 . . . . .  4.9 1.8 5.64 1 1 
       1646 1 . . . . .  6.0 1.8  6.9 1 1 
       1647 1 . . . . .  6.0 1.8  6.9 1 1 
       1648 1 . . . . .  6.0 1.8  6.9 1 1 
       1649 1 . . . . .  6.0 1.8  6.9 1 1 
       1650 1 . . . . .  4.5 1.8 5.18 1 1 
       1651 1 . . . . . 4.66 1.8 5.36 1 1 
       1652 1 . . . . . 4.66 1.8 5.36 1 1 
       1653 1 . . . . . 3.62 1.8 4.16 1 1 
       1654 1 . . . . . 5.04 1.8  5.8 1 1 
       1655 1 . . . . . 4.92 1.8 5.66 1 1 
       1656 1 . . . . .  5.4 1.8 6.21 1 1 
       1657 1 . . . . .  5.4 1.8 6.21 1 1 
       1658 1 . . . . .  6.0 1.8  6.9 1 1 
       1659 1 . . . . .  6.0 1.8  6.9 1 1 
       1660 1 . . . . .  6.0 1.8  6.9 1 1 
       1661 1 . . . . .  6.0 1.8  6.9 1 1 
       1662 1 . . . . . 5.67 1.8 6.52 1 1 
       1663 1 . . . . . 4.98 1.8 5.73 1 1 
       1664 1 . . . . . 4.02 1.8 4.62 1 1 
       1665 1 . . . . . 5.07 1.8 5.83 1 1 
       1666 1 . . . . . 5.86 1.8 6.74 1 1 
       1667 1 . . . . . 4.79 1.8 5.51 1 1 
       1668 1 . . . . . 3.34 1.8 3.84 1 1 
       1669 1 . . . . . 4.76 1.8 5.47 1 1 
       1670 1 . . . . . 4.93 1.8 5.67 1 1 
       1671 1 . . . . . 4.93 1.8 5.67 1 1 
       1672 1 . . . . . 4.38 1.8 5.04 1 1 
       1673 1 . . . . . 5.81 1.8 6.68 1 1 
       1674 1 . . . . . 3.76 1.8 4.32 1 1 
       1675 1 . . . . . 4.41 1.8 5.07 1 1 
       1676 1 . . . . . 4.36 1.8 5.01 1 1 
       1677 1 . . . . . 4.76 1.8 5.47 1 1 
       1678 1 . . . . . 4.53 1.8 5.21 1 1 
       1679 1 . . . . . 5.61 1.8 6.45 1 1 
       1680 1 . . . . . 4.25 1.8 4.89 1 1 
       1681 1 . . . . . 2.78 1.8  3.2 1 1 
       1682 1 . . . . . 3.78 1.8 4.35 1 1 
       1683 1 . . . . . 4.64 1.8 5.34 1 1 
       1684 1 . . . . . 5.19 1.8 5.97 1 1 
       1685 1 . . . . . 4.07 1.8 4.68 1 1 
       1686 1 . . . . . 4.77 1.8 5.49 1 1 
       1687 1 . . . . .  6.0 1.8  6.9 1 1 
       1688 1 . . . . .  6.0 1.8  6.9 1 1 
       1689 1 . . . . . 2.89 1.8 3.32 1 1 
       1690 1 . . . . . 3.79 1.8 4.36 1 1 
       1691 1 . . . . .  4.3 1.8 4.95 1 1 
       1692 1 . . . . .  4.6 1.8 5.29 1 1 
       1693 1 . . . . . 3.88 1.8 4.46 1 1 
       1694 1 . . . . . 3.51 1.8 4.04 1 1 
       1695 1 . . . . .  6.0 1.8  6.9 1 1 
       1696 1 . . . . .  6.0 1.8  6.9 1 1 
       1697 1 . . . . . 3.71 1.8 4.27 1 1 
       1698 1 . . . . . 5.24 1.8 6.03 1 1 
       1699 1 . . . . . 5.01 1.8 5.76 1 1 
       1700 1 . . . . . 5.01 1.8 5.76 1 1 
       1701 1 . . . . . 4.28 1.8 4.92 1 1 
       1702 1 . . . . .  4.7 1.8  5.4 1 1 
       1703 1 . . . . . 3.48 1.8  4.0 1 1 
       1704 1 . . . . . 4.64 1.8 5.34 1 1 
       1705 1 . . . . . 4.64 1.8 5.34 1 1 
       1706 1 . . . . .  5.7 1.8 6.56 1 1 
       1707 1 . . . . .  5.7 1.8 6.56 1 1 
       1708 1 . . . . . 5.73 1.8 6.59 1 1 
       1709 1 . . . . . 5.73 1.8 6.59 1 1 
       1710 1 . . . . . 5.28 1.8 6.07 1 1 
       1711 1 . . . . . 4.73 1.8 5.44 1 1 
       1712 1 . . . . . 4.73 1.8 5.44 1 1 
       1713 1 . . . . . 4.36 1.8 5.01 1 1 
       1714 1 . . . . . 5.26 1.8 6.05 1 1 
       1715 1 . . . . . 4.61 1.8  5.3 1 1 
       1716 1 . . . . . 3.26 1.8 3.75 1 1 
       1717 1 . . . . . 5.13 1.8  5.9 1 1 
       1718 1 . . . . . 5.45 1.8 6.27 1 1 
       1719 1 . . . . . 4.17 1.8  4.8 1 1 
       1720 1 . . . . .  6.0 1.8  6.9 1 1 
       1721 1 . . . . .  6.0 1.8  6.9 1 1 
       1722 1 . . . . . 5.01 1.8 5.76 1 1 
       1723 1 . . . . . 5.01 1.8 5.76 1 1 
       1724 1 . . . . . 4.16 1.8 4.78 1 1 
       1725 1 . . . . . 3.78 1.8 4.35 1 1 
       1726 1 . . . . . 3.69 1.8 4.24 1 1 
       1727 1 . . . . . 5.68 1.8 6.53 1 1 
       1728 1 . . . . .  4.9 1.8 5.64 1 1 
       1729 1 . . . . .  4.9 1.8 5.64 1 1 
       1730 1 . . . . . 5.14 1.8 5.91 1 1 
       1731 1 . . . . . 5.53 1.8 6.36 1 1 
       1732 1 . . . . . 4.73 1.8 5.44 1 1 
       1733 1 . . . . . 4.73 1.8 5.44 1 1 
       1734 1 . . . . . 4.97 1.8 5.72 1 1 
       1735 1 . . . . . 4.21 1.8 4.84 1 1 
       1736 1 . . . . . 4.47 1.8 5.14 1 1 
       1737 1 . . . . . 5.13 1.8  5.9 1 1 
       1738 1 . . . . . 4.87 1.8  5.6 1 1 
       1739 1 . . . . . 5.07 1.8 5.83 1 1 
       1740 1 . . . . . 5.17 1.8 5.95 1 1 
       1741 1 . . . . . 4.46 1.8 5.13 1 1 
       1742 1 . . . . . 4.09 1.8  4.7 1 1 
       1743 1 . . . . . 5.28 1.8 6.07 1 1 
       1744 1 . . . . . 4.61 1.8  5.3 1 1 
       1745 1 . . . . . 4.64 1.8 5.34 1 1 
       1746 1 . . . . . 4.31 1.8 4.96 1 1 
       1747 1 . . . . . 5.79 1.8 6.66 1 1 
       1748 1 . . . . . 4.71 1.8 5.42 1 1 
       1749 1 . . . . .  6.0 1.8  6.9 1 1 
       1750 1 . . . . . 4.13 1.8 4.75 1 1 
       1751 1 . . . . . 4.69 1.8 5.39 1 1 
       1752 1 . . . . . 4.96 1.8  5.7 1 1 
       1753 1 . . . . .  6.0 1.8  6.9 1 1 
       1754 1 . . . . . 3.67 1.8 4.22 1 1 
       1755 1 . . . . . 2.91 1.8 3.35 1 1 
       1756 1 . . . . . 4.83 1.8 5.55 1 1 
       1757 1 . . . . . 4.83 1.8 5.55 1 1 
       1758 1 . . . . .  5.5 1.8 6.33 1 1 
       1759 1 . . . . . 4.85 1.8 5.58 1 1 
       1760 1 . . . . . 5.61 1.8 6.45 1 1 
       1761 1 . . . . . 4.82 1.8 5.54 1 1 
       1762 1 . . . . . 3.64 1.8 4.19 1 1 
       1763 1 . . . . . 4.37 1.8 5.03 1 1 
       1764 1 . . . . . 5.26 1.8 6.05 1 1 
       1765 1 . . . . . 5.84 1.8 6.72 1 1 
       1766 1 . . . . . 5.15 1.8 5.92 1 1 
       1767 1 . . . . .  4.9 1.8 5.64 1 1 
       1768 1 . . . . .  4.9 1.8 5.64 1 1 
       1769 1 . . . . . 5.93 1.8 6.82 1 1 
       1770 1 . . . . . 5.93 1.8 6.82 1 1 
       1771 1 . . . . . 5.42 1.8 6.23 1 1 
       1772 1 . . . . . 4.57 1.8 5.26 1 1 
       1773 1 . . . . .  6.0 1.8  6.9 1 1 
       1774 1 . . . . . 4.76 1.8 5.47 1 1 
       1775 1 . . . . . 4.76 1.8 5.47 1 1 
       1776 1 . . . . .  5.4 1.8 6.21 1 1 
       1777 1 . . . . .  5.4 1.8 6.21 1 1 
       1778 1 . . . . .  4.9 1.8 5.64 1 1 
       1779 1 . . . . .  4.9 1.8 5.64 1 1 
       1780 1 . . . . . 4.81 1.8 5.53 1 1 
       1781 1 . . . . . 4.39 1.8 5.05 1 1 
       1782 1 . . . . . 4.98 1.8 5.73 1 1 
       1783 1 . . . . . 4.39 1.8 5.05 1 1 
       1784 1 . . . . . 4.98 1.8 5.73 1 1 
       1785 1 . . . . . 4.84 1.8 5.57 1 1 
       1786 1 . . . . . 4.49 1.8 5.16 1 1 
       1787 1 . . . . . 3.01 1.8 3.46 1 1 
       1788 1 . . . . . 3.64 1.8 4.19 1 1 
       1789 1 . . . . .  4.5 1.8 5.18 1 1 
       1790 1 . . . . . 3.95 1.8 4.54 1 1 
       1791 1 . . . . . 4.83 1.8 5.55 1 1 
       1792 1 . . . . .  6.0 1.8  6.9 1 1 
       1793 1 . . . . . 5.31 1.8 6.11 1 1 
       1794 1 . . . . . 5.96 1.8 6.85 1 1 
       1795 1 . . . . .  6.0 1.8  6.9 1 1 
       1796 1 . . . . . 3.27 1.8 3.76 1 1 
       1797 1 . . . . . 4.41 1.8 5.07 1 1 
       1798 1 . . . . .  6.0 1.8  6.9 1 1 
       1799 1 . . . . . 5.27 1.8 6.06 1 1 
       1800 1 . . . . . 5.25 1.8 6.04 1 1 
       1801 1 . . . . . 5.25 1.8 6.04 1 1 
       1802 1 . . . . . 4.87 1.8  5.6 1 1 
       1803 1 . . . . . 4.24 1.8 4.88 1 1 
       1804 1 . . . . . 4.55 1.8 5.23 1 1 
       1805 1 . . . . . 5.08 1.8 5.84 1 1 
       1806 1 . . . . . 5.13 1.8  5.9 1 1 
       1807 1 . . . . . 4.51 1.8 5.19 1 1 
       1808 1 . . . . . 5.13 1.8  5.9 1 1 
       1809 1 . . . . . 4.51 1.8 5.19 1 1 
       1810 1 . . . . . 4.59 1.8 5.28 1 1 
       1811 1 . . . . .  6.0 1.8  6.9 1 1 
       1812 1 . . . . . 4.59 1.8 5.28 1 1 
       1813 1 . . . . .  6.0 1.8  6.9 1 1 
       1814 1 . . . . . 5.85 1.8 6.73 1 1 
       1815 1 . . . . .  6.0 1.8  6.9 1 1 
       1816 1 . . . . . 5.44 1.8 6.26 1 1 
       1817 1 . . . . .  6.0 1.8  6.9 1 1 
       1818 1 . . . . . 5.66 1.8 6.51 1 1 
       1819 1 . . . . . 5.66 1.8 6.51 1 1 
       1820 1 . . . . . 4.81 1.8 5.53 1 1 
       1821 1 . . . . . 5.84 1.8 6.72 1 1 
       1822 1 . . . . . 5.14 1.8 5.91 1 1 
       1823 1 . . . . . 5.84 1.8 6.72 1 1 
       1824 1 . . . . . 5.16 1.8 5.93 1 1 
       1825 1 . . . . . 5.43 1.8 6.24 1 1 
       1826 1 . . . . . 5.43 1.8 6.24 1 1 
       1827 1 . . . . . 4.95 1.8 5.69 1 1 
       1828 1 . . . . .  5.7 1.8 6.56 1 1 
       1829 1 . . . . . 4.11 1.8 4.73 1 1 
       1830 1 . . . . . 5.37 1.8 6.18 1 1 
       1831 1 . . . . . 5.84 1.8 6.72 1 1 
       1832 1 . . . . . 5.82 1.8 6.69 1 1 
       1833 1 . . . . .  6.0 1.8  6.9 1 1 
       1834 1 . . . . . 4.26 1.8  4.9 1 1 
       1835 1 . . . . . 4.96 1.8  5.7 1 1 
       1836 1 . . . . .  4.1 1.8 4.72 1 1 
       1837 1 . . . . . 3.96 1.8 4.55 1 1 
       1838 1 . . . . . 5.48 1.8  6.3 1 1 
       1839 1 . . . . . 5.14 1.8 5.91 1 1 
       1840 1 . . . . . 5.24 1.8 6.03 1 1 
       1841 1 . . . . . 4.75 1.8 5.46 1 1 
       1842 1 . . . . . 3.98 1.8 4.58 1 1 
       1843 1 . . . . . 4.82 1.8 5.54 1 1 
       1844 1 . . . . . 4.15 1.8 4.77 1 1 
       1845 1 . . . . . 4.18 1.8 4.81 1 1 
       1846 1 . . . . .  5.5 1.8 6.33 1 1 
       1847 1 . . . . .  6.0 1.8  6.9 1 1 
       1848 1 . . . . . 4.08 1.8 4.69 1 1 
       1849 1 . . . . . 5.87 1.8 6.75 1 1 
       1850 1 . . . . . 5.55 1.8 6.38 1 1 
       1851 1 . . . . . 5.55 1.8 6.38 1 1 
       1852 1 . . . . .  6.0 1.8  6.9 1 1 
       1853 1 . . . . .  6.0 1.8  6.9 1 1 
       1854 1 . . . . . 4.98 1.8 5.73 1 1 
       1855 1 . . . . . 4.45 1.8 5.12 1 1 
       1856 1 . . . . . 4.91 1.8 5.65 1 1 
       1857 1 . . . . . 4.52 1.8  5.2 1 1 
       1858 1 . . . . . 4.56 1.8 5.24 1 1 
       1859 1 . . . . . 4.67 1.8 5.37 1 1 
       1860 1 . . . . . 3.61 1.8 4.15 1 1 
       1861 1 . . . . . 5.65 1.8  6.5 1 1 
       1862 1 . . . . . 5.65 1.8  6.5 1 1 
       1863 1 . . . . . 5.37 1.8 6.18 1 1 
       1864 1 . . . . . 5.37 1.8 6.18 1 1 
       1865 1 . . . . .  3.5 1.8 4.03 1 1 
       1866 1 . . . . . 5.17 1.8 5.95 1 1 
       1867 1 . . . . . 5.17 1.8 5.95 1 1 
       1868 1 . . . . . 4.53 1.8 5.21 1 1 
       1869 1 . . . . . 4.03 1.8 4.63 1 1 
       1870 1 . . . . . 4.03 1.8 4.63 1 1 
       1871 1 . . . . . 4.17 1.8  4.8 1 1 
       1872 1 . . . . . 4.87 1.8  5.6 1 1 
       1873 1 . . . . . 5.18 1.8 5.96 1 1 
       1874 1 . . . . . 3.93 1.8 4.52 1 1 
       1875 1 . . . . . 3.82 1.8 4.39 1 1 
       1876 1 . . . . . 5.86 1.8 6.74 1 1 
       1877 1 . . . . .  6.0 1.8  6.9 1 1 
       1878 1 . . . . .  6.0 1.8  6.9 1 1 
       1879 1 . . . . . 4.02 1.8 4.62 1 1 
       1880 1 . . . . . 5.08 1.8 5.84 1 1 
       1881 1 . . . . . 4.91 1.8 5.65 1 1 
       1882 1 . . . . .  4.2 1.8 4.83 1 1 
       1883 1 . . . . . 3.54 1.8 4.07 1 1 
       1884 1 . . . . .  5.1 1.8 5.87 1 1 
       1885 1 . . . . . 4.14 1.8 4.76 1 1 
       1886 1 . . . . . 4.94 1.8 5.68 1 1 
       1887 1 . . . . . 4.94 1.8 5.68 1 1 
       1888 1 . . . . .  6.0 1.8  6.9 1 1 
       1889 1 . . . . .  5.1 1.8 5.87 1 1 
       1890 1 . . . . . 4.81 1.8 5.53 1 1 
       1891 1 . . . . . 4.67 1.8 5.37 1 1 
       1892 1 . . . . . 3.81 1.8 4.38 1 1 
       1893 1 . . . . . 4.91 1.8 5.65 1 1 
       1894 1 . . . . . 4.98 1.8 5.73 1 1 
       1895 1 . . . . . 4.81 1.8 5.53 1 1 
       1896 1 . . . . . 5.31 1.8 6.11 1 1 
       1897 1 . . . . . 4.81 1.8 5.53 1 1 
       1898 1 . . . . . 5.36 1.8 6.16 1 1 
       1899 1 . . . . .  6.0 1.8  6.9 1 1 
       1900 1 . . . . . 5.89 1.8 6.77 1 1 
       1901 1 . . . . . 4.05 1.8 4.66 1 1 
       1902 1 . . . . . 4.05 1.8 4.66 1 1 
       1903 1 . . . . . 3.68 1.8 4.23 1 1 
       1904 1 . . . . . 4.28 1.8 4.92 1 1 
       1905 1 . . . . . 4.62 1.8 5.31 1 1 
       1906 1 . . . . . 4.62 1.8 5.31 1 1 
       1907 1 . . . . . 5.39 1.8  6.2 1 1 
       1908 1 . . . . . 5.52 1.8 6.35 1 1 
       1909 1 . . . . . 5.91 1.8  6.8 1 1 
       1910 1 . . . . .  4.6 1.8 5.29 1 1 
       1911 1 . . . . . 5.15 1.8 5.92 1 1 
       1912 1 . . . . . 5.29 1.8 6.08 1 1 
       1913 1 . . . . . 5.01 1.8 5.76 1 1 
       1914 1 . . . . . 5.27 1.8 6.06 1 1 
       1915 1 . . . . . 4.39 1.8 5.05 1 1 
       1916 1 . . . . . 5.56 1.8 6.39 1 1 
       1917 1 . . . . . 4.71 1.8 5.42 1 1 
       1918 1 . . . . . 5.22 1.8  6.0 1 1 
       1919 1 . . . . . 3.53 1.8 4.06 1 1 
       1920 1 . . . . . 3.35 1.8 3.85 1 1 
       1921 1 . . . . . 5.44 1.8 6.26 1 1 
       1922 1 . . . . . 5.69 1.8 6.54 1 1 
       1923 1 . . . . . 5.69 1.8 6.54 1 1 
       1924 1 . . . . . 4.88 1.8 5.61 1 1 
       1925 1 . . . . . 4.82 1.8 5.54 1 1 
       1926 1 . . . . .  6.0 1.8  6.9 1 1 
       1927 1 . . . . . 5.42 1.8 6.23 1 1 
       1928 1 . . . . . 4.18 1.8 4.81 1 1 
       1929 1 . . . . . 4.47 1.8 5.14 1 1 
       1930 1 . . . . .  4.3 1.8 4.95 1 1 
       1931 1 . . . . . 3.74 1.8  4.3 1 1 
       1932 1 . . . . .  6.0 1.8  6.9 1 1 
       1933 1 . . . . .  6.0 1.8  6.9 1 1 
       1934 1 . . . . . 5.31 1.8 6.11 1 1 
       1935 1 . . . . .  5.5 1.8 6.33 1 1 
       1936 1 . . . . . 4.84 1.8 5.57 1 1 
       1937 1 . . . . . 4.84 1.8 5.57 1 1 
       1938 1 . . . . . 5.48 1.8  6.3 1 1 
       1939 1 . . . . . 5.22 1.8  6.0 1 1 
       1940 1 . . . . . 4.69 1.8 5.39 1 1 
       1941 1 . . . . . 4.84 1.8 5.57 1 1 
       1942 1 . . . . . 5.61 1.8 6.45 1 1 
       1943 1 . . . . . 4.03 1.8 4.63 1 1 
       1944 1 . . . . .  4.2 1.8 4.83 1 1 
       1945 1 . . . . . 5.59 1.8 6.43 1 1 
       1946 1 . . . . . 4.91 1.8 5.65 1 1 
       1947 1 . . . . . 5.04 1.8  5.8 1 1 
       1948 1 . . . . . 5.91 1.8  6.8 1 1 
       1949 1 . . . . . 3.42 1.8 3.93 1 1 
       1950 1 . . . . . 3.66 1.8 4.21 1 1 
       1951 1 . . . . . 3.83 1.8  4.4 1 1 
       1952 1 . . . . . 3.52 1.8 4.05 1 1 
       1953 1 . . . . . 3.57 1.8 4.11 1 1 
       1954 1 . . . . . 3.62 1.8 4.16 1 1 
       1955 1 . . . . . 4.81 1.8 5.53 1 1 
       1956 1 . . . . . 3.53 1.8 4.06 1 1 
       1957 1 . . . . . 4.03 1.8 4.63 1 1 
       1958 1 . . . . . 3.81 1.8 4.38 1 1 
       1959 1 . . . . . 4.09 1.8  4.7 1 1 
       1960 1 . . . . . 3.46 1.8 3.98 1 1 
       1961 1 . . . . . 3.87 1.8 4.45 1 1 
       1962 1 . . . . . 3.51 1.8 4.04 1 1 
       1963 1 . . . . . 4.11 1.8 4.73 1 1 
       1964 1 . . . . . 4.44 1.8 5.11 1 1 
       1965 1 . . . . .  4.6 1.8 5.29 1 1 
       1966 1 . . . . . 4.02 1.8 4.62 1 1 
       1967 1 . . . . . 5.02 1.8 5.77 1 1 
       1968 1 . . . . . 4.51 1.8 5.19 1 1 
       1969 1 . . . . . 3.72 1.8 4.28 1 1 
       1970 1 . . . . . 5.39 1.8  6.2 1 1 
       1971 1 . . . . . 4.51 1.8 5.19 1 1 
       1972 1 . . . . . 3.28 1.8 3.77 1 1 
       1973 1 . . . . . 4.97 1.8 5.72 1 1 
       1974 1 . . . . . 3.18 1.8 3.66 1 1 
       1975 1 . . . . . 3.83 1.8  4.4 1 1 
       1976 1 . . . . . 4.06 1.8 4.67 1 1 
       1977 1 . . . . . 3.71 1.8 4.27 1 1 
       1978 1 . . . . . 4.51 1.8 5.19 1 1 
       1979 1 . . . . . 2.92 1.8 3.36 1 1 
       1980 1 . . . . . 3.21 1.8 3.69 1 1 
       1981 1 . . . . . 3.23 1.8 3.71 1 1 
       1982 1 . . . . . 3.46 1.8 3.98 1 1 
       1983 1 . . . . .  3.9 1.8 4.49 1 1 
       1984 1 . . . . . 4.44 1.8 5.11 1 1 
       1985 1 . . . . . 4.97 1.8 5.72 1 1 
       1986 1 . . . . . 4.16 1.8 4.78 1 1 
       1987 1 . . . . .  3.3 1.8  3.8 1 1 
       1988 1 . . . . . 3.15 1.8 3.62 1 1 
       1989 1 . . . . . 4.26 1.8  4.9 1 1 
       1990 1 . . . . . 3.95 1.8 4.54 1 1 
       1991 1 . . . . . 4.67 1.8 5.37 1 1 
       1992 1 . . . . . 4.98 1.8 5.73 1 1 
       1993 1 . . . . . 4.98 1.8 5.73 1 1 
       1994 1 . . . . . 5.29 1.8 6.08 1 1 
       1995 1 . . . . . 4.29 1.8 4.93 1 1 
       1996 1 . . . . . 3.64 1.8 4.19 1 1 
       1997 1 . . . . .  4.5 1.8 5.18 1 1 
       1998 1 . . . . . 5.41 1.8 6.22 1 1 
       1999 1 . . . . . 5.41 1.8 6.22 1 1 
       2000 1 . . . . .  5.6 1.8 6.44 1 1 
       2001 1 . . . . .  5.6 1.8 6.44 1 1 
       2002 1 . . . . . 4.84 1.8 5.57 1 1 
       2003 1 . . . . . 5.06 1.8 5.82 1 1 
       2004 1 . . . . . 4.26 1.8  4.9 1 1 
       2005 1 . . . . . 3.86 1.8 4.44 1 1 
       2006 1 . . . . . 5.27 1.8 6.06 1 1 
       2007 1 . . . . . 4.48 1.8 5.15 1 1 
       2008 1 . . . . . 3.72 1.8 4.28 1 1 
       2009 1 . . . . . 3.56 1.8 4.09 1 1 
       2010 1 . . . . . 4.52 1.8  5.2 1 1 
       2011 1 . . . . . 5.03 1.8 5.78 1 1 
       2012 1 . . . . . 3.88 1.8 4.46 1 1 
       2013 1 . . . . . 4.02 1.8 4.62 1 1 
       2014 1 . . . . . 3.91 1.8  4.5 1 1 
       2015 1 . . . . .  4.5 1.8 5.18 1 1 
       2016 1 . . . . .  4.5 1.8 5.18 1 1 
       2017 1 . . . . . 3.01 1.8 3.46 1 1 
       2018 1 . . . . . 4.61 1.8  5.3 1 1 
       2019 1 . . . . . 2.76 1.8 3.17 1 1 
       2020 1 . . . . . 4.03 1.8 4.63 1 1 
       2021 1 . . . . . 5.33 1.8 6.13 1 1 
       2022 1 . . . . . 4.05 1.8 4.66 1 1 
       2023 1 . . . . . 3.87 1.8 4.45 1 1 
       2024 1 . . . . . 3.42 1.8 3.93 1 1 
       2025 1 . . . . .  5.7 1.8 6.56 1 1 
       2026 1 . . . . . 4.47 1.8 5.14 1 1 
       2027 1 . . . . . 3.81 1.8 4.38 1 1 
       2028 1 . . . . . 4.17 1.8  4.8 1 1 
       2029 1 . . . . . 4.57 1.8 5.26 1 1 
       2030 1 . . . . . 4.83 1.8 5.55 1 1 
       2031 1 . . . . . 4.28 1.8 4.92 1 1 
       2032 1 . . . . . 4.75 1.8 5.46 1 1 
       2033 1 . . . . . 4.69 1.8 5.39 1 1 
       2034 1 . . . . . 5.73 1.8 6.59 1 1 
       2035 1 . . . . . 4.88 1.8 5.61 1 1 
       2036 1 . . . . . 4.52 1.8  5.2 1 1 
       2037 1 . . . . .  4.5 1.8 5.18 1 1 
       2038 1 . . . . . 4.61 1.8  5.3 1 1 
       2039 1 . . . . . 3.97 1.8 4.57 1 1 
       2040 1 . . . . . 4.52 1.8  5.2 1 1 
       2041 1 . . . . . 4.62 1.8 5.31 1 1 
       2042 1 . . . . . 4.89 1.8 5.62 1 1 
       2043 1 . . . . . 4.79 1.8 5.51 1 1 
       2044 1 . . . . . 5.26 1.8 6.05 1 1 
       2045 1 . . . . . 3.61 1.8 4.15 1 1 
       2046 1 . . . . . 4.52 1.8  5.2 1 1 
       2047 1 . . . . . 4.52 1.8  5.2 1 1 
       2048 1 . . . . .  3.7 1.8 4.26 1 1 
       2049 1 . . . . . 5.81 1.8 6.68 1 1 
       2050 1 . . . . . 3.24 1.8 3.73 1 1 
       2051 1 . . . . . 4.12 1.8 4.74 1 1 
       2052 1 . . . . . 3.74 1.8  4.3 1 1 
       2053 1 . . . . . 4.84 1.8 5.57 1 1 
       2054 1 . . . . . 4.61 1.8  5.3 1 1 
       2055 1 . . . . . 5.79 1.8 6.66 1 1 
       2056 1 . . . . . 4.71 1.8 5.42 1 1 
       2057 1 . . . . . 5.12 1.8 5.89 1 1 
       2058 1 . . . . . 4.48 1.8 5.15 1 1 
       2059 1 . . . . . 5.69 1.8 6.54 1 1 
       2060 1 . . . . . 4.21 1.8 4.84 1 1 
       2061 1 . . . . . 3.27 1.8 3.76 1 1 
       2062 1 . . . . . 4.21 1.8 4.84 1 1 
       2063 1 . . . . . 5.02 1.8 5.77 1 1 
       2064 1 . . . . .  4.9 1.8 5.64 1 1 
       2065 1 . . . . . 3.67 1.8 4.22 1 1 
       2066 1 . . . . . 4.34 1.8 4.99 1 1 
       2067 1 . . . . . 5.01 1.8 5.76 1 1 
       2068 1 . . . . . 4.72 1.8 5.43 1 1 
       2069 1 . . . . .  4.7 1.8  5.4 1 1 
       2070 1 . . . . . 3.99 1.8 4.59 1 1 
       2071 1 . . . . . 4.87 1.8  5.6 1 1 
       2072 1 . . . . .  4.8 1.8 5.52 1 1 
       2073 1 . . . . .  5.4 1.8 6.21 1 1 
       2074 1 . . . . .  4.5 1.8 5.18 1 1 
       2075 1 . . . . . 4.39 1.8 5.05 1 1 
       2076 1 . . . . . 4.82 1.8 5.54 1 1 
       2077 1 . . . . . 4.07 1.8 4.68 1 1 
       2078 1 . . . . .  3.4 1.8 3.91 1 1 
       2079 1 . . . . . 3.68 1.8 4.23 1 1 
       2080 1 . . . . .  4.8 1.8 5.52 1 1 
       2081 1 . . . . . 4.99 1.8 5.74 1 1 
       2082 1 . . . . . 3.73 1.8 4.29 1 1 
       2083 1 . . . . . 3.27 1.8 3.76 1 1 
       2084 1 . . . . . 4.39 1.8 5.05 1 1 
       2085 1 . . . . . 3.26 1.8 3.75 1 1 
       2086 1 . . . . . 5.45 1.8 6.27 1 1 
       2087 1 . . . . . 3.97 1.8 4.57 1 1 
       2088 1 . . . . . 2.62 1.8 3.01 1 1 
       2089 1 . . . . . 2.73 1.8 3.14 1 1 
       2090 1 . . . . . 4.34 1.8 4.99 1 1 
       2091 1 . . . . . 4.88 1.8 5.61 1 1 
       2092 1 . . . . . 3.96 1.8 4.55 1 1 
       2093 1 . . . . . 2.76 1.8 3.17 1 1 
       2094 1 . . . . . 2.39 1.8 2.75 1 1 
       2095 1 . . . . . 4.84 1.8 5.57 1 1 
       2096 1 . . . . . 5.61 1.8 6.45 1 1 
       2097 1 . . . . .  5.2 1.8 5.98 1 1 
       2098 1 . . . . . 4.39 1.8 5.05 1 1 
       2099 1 . . . . . 5.81 1.8 6.68 1 1 
       2100 1 . . . . . 3.06 1.8 3.52 1 1 
       2101 1 . . . . . 3.35 1.8 3.85 1 1 
       2102 1 . . . . . 5.55 1.8 6.38 1 1 
       2103 1 . . . . .  5.5 1.8 6.33 1 1 
       2104 1 . . . . . 4.97 1.8 5.72 1 1 
       2105 1 . . . . . 4.38 1.8 5.04 1 1 
       2106 1 . . . . . 5.21 1.8 5.99 1 1 
       2107 1 . . . . .  4.4 1.8 5.06 1 1 
       2108 1 . . . . . 4.33 1.8 4.98 1 1 
       2109 1 . . . . . 5.09 1.8 5.85 1 1 
       2110 1 . . . . . 5.17 1.8 5.95 1 1 
       2111 1 . . . . . 3.43 1.8 3.94 1 1 
       2112 1 . . . . .  3.4 1.8 3.91 1 1 
       2113 1 . . . . . 5.11 1.8 5.88 1 1 
       2114 1 . . . . . 4.44 1.8 5.11 1 1 
       2115 1 . . . . . 4.96 1.8  5.7 1 1 
       2116 1 . . . . . 4.72 1.8 5.43 1 1 
       2117 1 . . . . . 5.61 1.8 6.45 1 1 
       2118 1 . . . . . 4.07 1.8 4.68 1 1 
       2119 1 . . . . . 5.24 1.8 6.03 1 1 
       2120 1 . . . . .  4.3 1.8 4.95 1 1 
       2121 1 . . . . . 4.31 1.8 4.96 1 1 
       2122 1 . . . . . 3.61 1.8 4.15 1 1 
       2123 1 . . . . . 3.71 1.8 4.27 1 1 
       2124 1 . . . . . 5.38 1.8 6.19 1 1 
       2125 1 . . . . .  4.4 1.8 5.06 1 1 
       2126 1 . . . . . 5.46 1.8 6.28 1 1 
       2127 1 . . . . . 5.81 1.8 6.68 1 1 
       2128 1 . . . . . 4.58 1.8 5.27 1 1 
       2129 1 . . . . . 4.67 1.8 5.37 1 1 
       2130 1 . . . . . 4.84 1.8 5.57 1 1 
       2131 1 . . . . .  3.6 1.8 4.14 1 1 
       2132 1 . . . . . 4.39 1.8 5.05 1 1 
       2133 1 . . . . . 3.71 1.8 4.27 1 1 
       2134 1 . . . . . 5.27 1.8 6.06 1 1 
       2135 1 . . . . . 5.81 1.8 6.68 1 1 
       2136 1 . . . . . 3.64 1.8 4.19 1 1 
       2137 1 . . . . . 3.47 1.8 3.99 1 1 
       2138 1 . . . . . 5.81 1.8 6.68 1 1 
       2139 1 . . . . . 4.91 1.8 5.65 1 1 
       2140 1 . . . . . 3.57 1.8 4.11 1 1 
       2141 1 . . . . . 5.29 1.8 6.08 1 1 
       2142 1 . . . . . 3.61 1.8 4.15 1 1 
       2143 1 . . . . .  4.8 1.8 5.52 1 1 
       2144 1 . . . . . 2.66 1.8 3.06 1 1 
       2145 1 . . . . . 4.03 1.8 4.63 1 1 
       2146 1 . . . . . 3.91 1.8  4.5 1 1 
       2147 1 . . . . . 3.47 1.8 3.99 1 1 
       2148 1 . . . . . 4.21 1.8 4.84 1 1 
       2149 1 . . . . . 4.59 1.8 5.28 1 1 
       2150 1 . . . . . 5.35 1.8 6.15 1 1 
       2151 1 . . . . . 4.76 1.8 5.47 1 1 
       2152 1 . . . . . 5.02 1.8 5.77 1 1 
       2153 1 . . . . . 4.24 1.8 4.88 1 1 
       2154 1 . . . . . 4.02 1.8 4.62 1 1 
       2155 1 . . . . . 4.24 1.8 4.88 1 1 
       2156 1 . . . . . 5.09 1.8 5.85 1 1 
       2157 1 . . . . .  5.1 1.8 5.87 1 1 
       2158 1 . . . . . 5.81 1.8 6.68 1 1 
       2159 1 . . . . . 4.38 1.8 5.04 1 1 
       2160 1 . . . . . 3.84 1.8 4.42 1 1 
       2161 1 . . . . . 3.11 1.8 3.58 1 1 
       2162 1 . . . . . 3.59 1.8 4.13 1 1 
       2163 1 . . . . . 3.45 1.8 3.97 1 1 
       2164 1 . . . . . 4.83 1.8 5.55 1 1 
       2165 1 . . . . . 5.81 1.8 6.68 1 1 
       2166 1 . . . . . 5.19 1.8 5.97 1 1 
       2167 1 . . . . . 4.28 1.8 4.92 1 1 
       2168 1 . . . . .  5.5 1.8 6.33 1 1 
       2169 1 . . . . . 4.54 1.8 5.22 1 1 
       2170 1 . . . . . 4.72 1.8 5.43 1 1 
       2171 1 . . . . . 3.57 1.8 4.11 1 1 
       2172 1 . . . . . 3.12 1.8 3.59 1 1 
       2173 1 . . . . . 4.54 1.8 5.22 1 1 
       2174 1 . . . . . 4.13 1.8 4.75 1 1 
       2175 1 . . . . . 3.52 1.8 4.05 1 1 
       2176 1 . . . . . 4.18 1.8 4.81 1 1 
       2177 1 . . . . . 4.19 1.8 4.82 1 1 
       2178 1 . . . . .  5.6 1.8 6.44 1 1 
       2179 1 . . . . .  3.7 1.8 4.26 1 1 
       2180 1 . . . . . 5.14 1.8 5.91 1 1 
       2181 1 . . . . .  3.1 1.8 3.57 1 1 
       2182 1 . . . . . 4.09 1.8  4.7 1 1 
       2183 1 . . . . . 3.98 1.8 4.58 1 1 
       2184 1 . . . . . 4.17 1.8  4.8 1 1 
       2185 1 . . . . . 5.42 1.8 6.23 1 1 
       2186 1 . . . . . 4.53 1.8 5.21 1 1 
       2187 1 . . . . . 3.51 1.8 4.04 1 1 
       2188 1 . . . . . 5.39 1.8  6.2 1 1 
       2189 1 . . . . . 3.45 1.8 3.97 1 1 
       2190 1 . . . . . 3.45 1.8 3.97 1 1 
       2191 1 . . . . . 4.43 1.8 5.09 1 1 
       2192 1 . . . . . 3.44 1.8 3.96 1 1 
       2193 1 . . . . . 5.02 1.8 5.77 1 1 
       2194 1 . . . . . 5.13 1.8  5.9 1 1 
       2195 1 . . . . . 2.98 1.8 3.43 1 1 
       2196 1 . . . . . 3.49 1.8 4.01 1 1 
       2197 1 . . . . . 3.61 1.8 4.15 1 1 
       2198 1 . . . . . 3.78 1.8 4.35 1 1 
       2199 1 . . . . . 3.52 1.8 4.05 1 1 
       2200 1 . . . . . 3.99 1.8 4.59 1 1 
       2201 1 . . . . . 5.61 1.8 6.45 1 1 
       2202 1 . . . . .  4.8 1.8 5.52 1 1 
       2203 1 . . . . .  5.0 1.8 5.75 1 1 
       2204 1 . . . . . 4.86 1.8 5.59 1 1 
       2205 1 . . . . . 4.86 1.8 5.59 1 1 
       2206 1 . . . . . 5.11 1.8 5.88 1 1 
       2207 1 . . . . . 3.56 1.8 4.09 1 1 
       2208 1 . . . . . 3.53 1.8 4.06 1 1 
       2209 1 . . . . . 3.63 1.8 4.17 1 1 
       2210 1 . . . . . 3.18 1.8 3.66 1 1 
       2211 1 . . . . . 5.81 1.8 6.68 1 1 
       2212 1 . . . . .  4.3 1.8 4.95 1 1 
       2213 1 . . . . . 4.43 1.8 5.09 1 1 
       2214 1 . . . . . 3.68 1.8 4.23 1 1 
       2215 1 . . . . . 4.47 1.8 5.14 1 1 
       2216 1 . . . . . 4.82 1.8 5.54 1 1 
       2217 1 . . . . . 3.64 1.8 4.19 1 1 
       2218 1 . . . . . 4.16 1.8 4.78 1 1 
       2219 1 . . . . . 4.88 1.8 5.61 1 1 
       2220 1 . . . . . 4.56 1.8 5.24 1 1 
       2221 1 . . . . .  4.1 1.8 4.72 1 1 
       2222 1 . . . . . 4.12 1.8 4.74 1 1 
       2223 1 . . . . . 4.57 1.8 5.26 1 1 
       2224 1 . . . . . 5.28 1.8 6.07 1 1 
       2225 1 . . . . . 4.79 1.8 5.51 1 1 
       2226 1 . . . . . 3.83 1.8  4.4 1 1 
       2227 1 . . . . . 2.99 1.8 3.44 1 1 
       2228 1 . . . . .  5.7 1.8 6.56 1 1 
       2229 1 . . . . . 3.72 1.8 4.28 1 1 
       2230 1 . . . . . 5.04 1.8  5.8 1 1 
       2231 1 . . . . . 3.39 1.8  3.9 1 1 
       2232 1 . . . . . 4.88 1.8 5.61 1 1 
       2233 1 . . . . . 5.35 1.8 6.15 1 1 
       2234 1 . . . . . 5.11 1.8 5.88 1 1 
       2235 1 . . . . . 4.27 1.8 4.91 1 1 
       2236 1 . . . . . 4.94 1.8 5.68 1 1 
       2237 1 . . . . . 4.52 1.8  5.2 1 1 
       2238 1 . . . . . 5.54 1.8 6.37 1 1 
       2239 1 . . . . .  5.0 1.8 5.75 1 1 
       2240 1 . . . . . 5.43 1.8 6.24 1 1 
       2241 1 . . . . . 3.64 1.8 4.19 1 1 
       2242 1 . . . . . 4.56 1.8 5.24 1 1 
       2243 1 . . . . . 4.89 1.8 5.62 1 1 
       2244 1 . . . . . 5.51 1.8 6.34 1 1 
       2245 1 . . . . . 5.81 1.8 6.68 1 1 
       2246 1 . . . . . 5.35 1.8 6.15 1 1 
       2247 1 . . . . . 3.73 1.8 4.29 1 1 
       2248 1 . . . . . 5.81 1.8 6.68 1 1 
       2249 1 . . . . . 5.64 1.8 6.49 1 1 
       2250 1 . . . . . 5.63 1.8 6.47 1 1 
       2251 1 . . . . . 3.84 1.8 4.42 1 1 
       2252 1 . . . . . 4.52 1.8  5.2 1 1 
       2253 1 . . . . .  3.7 1.8 4.26 1 1 
       2254 1 . . . . . 3.26 1.8 3.75 1 1 
       2255 1 . . . . . 5.81 1.8 6.68 1 1 
       2256 1 . . . . .  5.8 1.8 6.67 1 1 
       2257 1 . . . . . 4.63 1.8 5.32 1 1 
       2258 1 . . . . . 4.96 1.8  5.7 1 1 
       2259 1 . . . . . 3.61 1.8 4.15 1 1 
       2260 1 . . . . . 5.28 1.8 6.07 1 1 
       2261 1 . . . . .  4.9 1.8 5.64 1 1 
       2262 1 . . . . . 5.61 1.8 6.45 1 1 
       2263 1 . . . . . 4.41 1.8 5.07 1 1 
       2264 1 . . . . . 5.21 1.8 5.99 1 1 
       2265 1 . . . . . 3.82 1.8 4.39 1 1 
       2266 1 . . . . . 3.69 1.8 4.24 1 1 
       2267 1 . . . . .  3.8 1.8 4.37 1 1 
       2268 1 . . . . . 3.98 1.8 4.58 1 1 
       2269 1 . . . . . 4.28 1.8 4.92 1 1 
       2270 1 . . . . . 5.53 1.8 6.36 1 1 
       2271 1 . . . . . 4.44 1.8 5.11 1 1 
       2272 1 . . . . . 5.36 1.8 6.16 1 1 
       2273 1 . . . . . 4.26 1.8  4.9 1 1 
       2274 1 . . . . . 2.67 1.8 3.07 1 1 
       2275 1 . . . . . 3.21 1.8 3.69 1 1 
       2276 1 . . . . . 3.54 1.8 4.07 1 1 
       2277 1 . . . . . 3.59 1.8 4.13 1 1 
       2278 1 . . . . . 4.16 1.8 4.78 1 1 
       2279 1 . . . . . 3.96 1.8 4.55 1 1 
       2280 1 . . . . . 4.65 1.8 5.35 1 1 
       2281 1 . . . . . 2.91 1.8 3.35 1 1 
       2282 1 . . . . . 3.21 1.8 3.69 1 1 
       2283 1 . . . . . 5.02 1.8 5.77 1 1 
       2284 1 . . . . . 5.25 1.8 6.04 1 1 
       2285 1 . . . . . 3.27 1.8 3.76 1 1 
       2286 1 . . . . . 3.61 1.8 4.15 1 1 
       2287 1 . . . . .  3.8 1.8 4.37 1 1 
       2288 1 . . . . . 2.97 1.8 3.42 1 1 
       2289 1 . . . . . 3.39 1.8  3.9 1 1 
       2290 1 . . . . . 4.87 1.8  5.6 1 1 
       2291 1 . . . . . 4.41 1.8 5.07 1 1 
       2292 1 . . . . . 4.31 1.8 4.96 1 1 
       2293 1 . . . . . 4.51 1.8 5.19 1 1 
       2294 1 . . . . . 4.91 1.8 5.65 1 1 
       2295 1 . . . . . 5.49 1.8 6.31 1 1 
       2296 1 . . . . . 5.81 1.8 6.68 1 1 
       2297 1 . . . . . 4.28 1.8 4.92 1 1 
       2298 1 . . . . . 5.39 1.8  6.2 1 1 
       2299 1 . . . . . 4.04 1.8 4.65 1 1 
       2300 1 . . . . . 4.88 1.8 5.61 1 1 
       2301 1 . . . . . 5.15 1.8 5.92 1 1 
       2302 1 . . . . . 4.31 1.8 4.96 1 1 
       2303 1 . . . . .  3.2 1.8 3.68 1 1 
       2304 1 . . . . . 3.95 1.8 4.54 1 1 
       2305 1 . . . . . 4.61 1.8  5.3 1 1 
       2306 1 . . . . . 4.83 1.8 5.55 1 1 
       2307 1 . . . . . 3.99 1.8 4.59 1 1 
       2308 1 . . . . . 2.97 1.8 3.42 1 1 
       2309 1 . . . . . 3.97 1.8 4.57 1 1 
       2310 1 . . . . . 3.55 1.8 4.08 1 1 
       2311 1 . . . . . 4.77 1.8 5.49 1 1 
       2312 1 . . . . . 5.16 1.8 5.93 1 1 
       2313 1 . . . . . 4.59 1.8 5.28 1 1 
       2314 1 . . . . . 2.36 1.8 2.71 1 1 
       2315 1 . . . . . 3.18 1.8 3.66 1 1 
       2316 1 . . . . . 4.69 1.8 5.39 1 1 
       2317 1 . . . . . 3.65 1.8  4.2 1 1 
       2318 1 . . . . . 4.66 1.8 5.36 1 1 
       2319 1 . . . . . 4.34 1.8 4.99 1 1 
       2320 1 . . . . . 4.27 1.8 4.91 1 1 
       2321 1 . . . . . 5.24 1.8 6.03 1 1 
       2322 1 . . . . . 3.34 1.8 3.84 1 1 
       2323 1 . . . . . 3.35 1.8 3.85 1 1 
       2324 1 . . . . . 3.78 1.8 4.35 1 1 
       2325 1 . . . . . 3.76 1.8 4.32 1 1 
       2326 1 . . . . . 3.93 1.8 4.52 1 1 
       2327 1 . . . . . 3.21 1.8 3.69 1 1 
       2328 1 . . . . . 3.88 1.8 4.46 1 1 
       2329 1 . . . . . 4.27 1.8 4.91 1 1 
       2330 1 . . . . . 3.01 1.8 3.46 1 1 
       2331 1 . . . . . 4.09 1.8  4.7 1 1 
       2332 1 . . . . . 4.39 1.8 5.05 1 1 
       2333 1 . . . . . 3.88 1.8 4.46 1 1 
       2334 1 . . . . .  4.5 1.8 5.18 1 1 
       2335 1 . . . . . 5.03 1.8 5.78 1 1 
       2336 1 . . . . . 3.86 1.8 4.44 1 1 
       2337 1 . . . . . 4.54 1.8 5.22 1 1 
       2338 1 . . . . . 5.81 1.8 6.68 1 1 
       2339 1 . . . . . 4.47 1.8 5.14 1 1 
       2340 1 . . . . . 4.69 1.8 5.39 1 1 
       2341 1 . . . . . 5.81 1.8 6.68 1 1 
       2342 1 . . . . . 5.07 1.8 5.83 1 1 
       2343 1 . . . . . 5.81 1.8 6.68 1 1 
       2344 1 . . . . . 5.36 1.8 6.16 1 1 
       2345 1 . . . . . 3.73 1.8 4.29 1 1 
       2346 1 . . . . . 5.02 1.8 5.77 1 1 
       2347 1 . . . . . 3.17 1.8 3.65 1 1 
       2348 1 . . . . . 4.46 1.8 5.13 1 1 
       2349 1 . . . . . 4.16 1.8 4.78 1 1 
       2350 1 . . . . . 5.15 1.8 5.92 1 1 
       2351 1 . . . . . 4.66 1.8 5.36 1 1 
       2352 1 . . . . . 4.05 1.8 4.66 1 1 
       2353 1 . . . . . 4.32 1.8 4.97 1 1 
       2354 1 . . . . . 3.58 1.8 4.12 1 1 
       2355 1 . . . . . 4.22 1.8 4.85 1 1 
       2356 1 . . . . . 5.55 1.8 6.38 1 1 
       2357 1 . . . . . 3.84 1.8 4.42 1 1 
       2358 1 . . . . .  4.5 1.8 5.18 1 1 
       2359 1 . . . . . 4.85 1.8 5.58 1 1 
       2360 1 . . . . . 5.59 1.8 6.43 1 1 
       2361 1 . . . . . 4.56 1.8 5.24 1 1 
       2362 1 . . . . . 3.48 1.8  4.0 1 1 
       2363 1 . . . . . 2.44 1.8 2.81 1 1 
       2364 1 . . . . . 4.69 1.8 5.39 1 1 
       2365 1 . . . . .  4.2 1.8 4.83 1 1 
       2366 1 . . . . . 4.93 1.8 5.67 1 1 
       2367 1 . . . . . 4.16 1.8 4.78 1 1 
       2368 1 . . . . . 3.54 1.8 4.07 1 1 
       2369 1 . . . . . 5.74 1.8  6.6 1 1 
       2370 1 . . . . . 3.43 1.8 3.94 1 1 
       2371 1 . . . . . 3.06 1.8 3.52 1 1 
       2372 1 . . . . . 3.23 1.8 3.71 1 1 
       2373 1 . . . . . 5.46 1.8 6.28 1 1 
       2374 1 . . . . . 3.51 1.8 4.04 1 1 
       2375 1 . . . . . 3.73 1.8 4.29 1 1 
       2376 1 . . . . . 4.67 1.8 5.37 1 1 
       2377 1 . . . . . 4.04 1.8 4.65 1 1 
       2378 1 . . . . . 5.81 1.8 6.68 1 1 
       2379 1 . . . . . 4.86 1.8 5.59 1 1 
       2380 1 . . . . . 5.62 1.8 6.46 1 1 
       2381 1 . . . . . 5.45 1.8 6.27 1 1 
       2382 1 . . . . . 3.79 1.8 4.36 1 1 
       2383 1 . . . . .  4.5 1.8 5.18 1 1 
       2384 1 . . . . . 3.72 1.8 4.28 1 1 
       2385 1 . . . . .  4.2 1.8 4.83 1 1 
       2386 1 . . . . . 4.98 1.8 5.73 1 1 
       2387 1 . . . . . 5.71 1.8 6.57 1 1 
       2388 1 . . . . .  5.3 1.8  6.1 1 1 
       2389 1 . . . . . 3.71 1.8 4.27 1 1 
       2390 1 . . . . .  4.8 1.8 5.52 1 1 
       2391 1 . . . . . 4.64 1.8 5.34 1 1 
       2392 1 . . . . . 4.03 1.8 4.63 1 1 
       2393 1 . . . . . 5.81 1.8 6.68 1 1 
       2394 1 . . . . . 4.92 1.8 5.66 1 1 
       2395 1 . . . . .  4.1 1.8 4.72 1 1 
       2396 1 . . . . . 5.34 1.8 6.14 1 1 
       2397 1 . . . . . 3.25 1.8 3.74 1 1 
       2398 1 . . . . . 4.56 1.8 5.24 1 1 
       2399 1 . . . . . 4.95 1.8 5.69 1 1 
       2400 1 . . . . . 4.56 1.8 5.24 1 1 
       2401 1 . . . . .  4.5 1.8 5.18 1 1 
       2402 1 . . . . . 4.83 1.8 5.55 1 1 
       2403 1 . . . . . 4.36 1.8 5.01 1 1 
       2404 1 . . . . . 5.81 1.8 6.68 1 1 
       2405 1 . . . . . 5.55 1.8 6.38 1 1 
       2406 1 . . . . . 3.35 1.8 3.85 1 1 
       2407 1 . . . . . 4.62 1.8 5.31 1 1 
       2408 1 . . . . . 4.73 1.8 5.44 1 1 
       2409 1 . . . . . 3.82 1.8 4.39 1 1 
       2410 1 . . . . . 3.96 1.8 4.55 1 1 
       2411 1 . . . . . 3.46 1.8 3.98 1 1 
       2412 1 . . . . .  2.8 1.8 3.22 1 1 
       2413 1 . . . . . 4.94 1.8 5.68 1 1 
       2414 1 . . . . . 5.18 1.8 5.96 1 1 
       2415 1 . . . . . 3.34 1.8 3.84 1 1 
       2416 1 . . . . . 4.85 1.8 5.58 1 1 
       2417 1 . . . . . 2.91 1.8 3.35 1 1 
       2418 1 . . . . . 3.76 1.8 4.32 1 1 
       2419 1 . . . . . 4.98 1.8 5.73 1 1 
       2420 1 . . . . . 3.99 1.8 4.59 1 1 
       2421 1 . . . . . 5.22 1.8  6.0 1 1 
       2422 1 . . . . . 3.66 1.8 4.21 1 1 
       2423 1 . . . . . 4.32 1.8 4.97 1 1 
       2424 1 . . . . .  5.2 1.8 5.98 1 1 
       2425 1 . . . . . 4.76 1.8 5.47 1 1 
       2426 1 . . . . . 4.96 1.8  5.7 1 1 
       2427 1 . . . . . 3.73 1.8 4.29 1 1 
       2428 1 . . . . .  4.4 1.8 5.06 1 1 
       2429 1 . . . . . 4.39 1.8 5.05 1 1 
       2430 1 . . . . . 3.88 1.8 4.46 1 1 
       2431 1 . . . . . 3.89 1.8 4.47 1 1 
       2432 1 . . . . . 3.51 1.8 4.04 1 1 
       2433 1 . . . . .  4.2 1.8 4.83 1 1 
       2434 1 . . . . . 3.75 1.8 4.31 1 1 
       2435 1 . . . . . 4.89 1.8 5.62 1 1 
       2436 1 . . . . . 4.79 1.8 5.51 1 1 
       2437 1 . . . . . 4.41 1.8 5.07 1 1 
       2438 1 . . . . . 4.78 1.8  5.5 1 1 
       2439 1 . . . . .  4.6 1.8 5.29 1 1 
       2440 1 . . . . . 4.04 1.8 4.65 1 1 
       2441 1 . . . . . 4.27 1.8 4.91 1 1 
       2442 1 . . . . . 5.27 1.8 6.06 1 1 
       2443 1 . . . . . 4.03 1.8 4.63 1 1 
       2444 1 . . . . .  2.9 1.8 3.34 1 1 
       2445 1 . . . . . 3.11 1.8 3.58 1 1 
       2446 1 . . . . . 4.77 1.8 5.49 1 1 
       2447 1 . . . . . 3.27 1.8 3.76 1 1 
       2448 1 . . . . . 3.71 1.8 4.27 1 1 
       2449 1 . . . . .  5.0 1.8 5.75 1 1 
       2450 1 . . . . . 4.52 1.8  5.2 1 1 
       2451 1 . . . . . 2.95 1.8 3.39 1 1 
       2452 1 . . . . . 3.49 1.8 4.01 1 1 
       2453 1 . . . . . 4.33 1.8 4.98 1 1 
       2454 1 . . . . . 4.42 1.8 5.08 1 1 
       2455 1 . . . . . 5.61 1.8 6.45 1 1 
       2456 1 . . . . . 3.03 1.8 3.48 1 1 
       2457 1 . . . . . 3.13 1.8  3.6 1 1 
       2458 1 . . . . . 5.22 1.8  6.0 1 1 
       2459 1 . . . . . 3.45 1.8 3.97 1 1 
       2460 1 . . . . . 5.81 1.8 6.68 1 1 
       2461 1 . . . . . 5.81 1.8 6.68 1 1 
       2462 1 . . . . . 4.71 1.8 5.42 1 1 
       2463 1 . . . . . 2.97 1.8 3.42 1 1 
       2464 1 . . . . .  5.6 1.8 6.44 1 1 
       2465 1 . . . . . 3.55 1.8 4.08 1 1 
       2466 1 . . . . . 3.81 1.8 4.38 1 1 
       2467 1 . . . . . 4.86 1.8 5.59 1 1 
       2468 1 . . . . . 4.47 1.8 5.14 1 1 
       2469 1 . . . . . 4.25 1.8 4.89 1 1 
       2470 1 . . . . . 4.31 1.8 4.96 1 1 
       2471 1 . . . . . 3.51 1.8 4.04 1 1 
       2472 1 . . . . . 3.84 1.8 4.42 1 1 
       2473 1 . . . . . 4.07 1.8 4.68 1 1 
       2474 1 . . . . . 4.96 1.8  5.7 1 1 
       2475 1 . . . . . 5.72 1.8 6.58 1 1 
       2476 1 . . . . . 4.88 1.8 5.61 1 1 
       2477 1 . . . . . 4.29 1.8 4.93 1 1 
       2478 1 . . . . . 4.29 1.8 4.93 1 1 
       2479 1 . . . . . 3.38 1.8 3.89 1 1 
       2480 1 . . . . . 5.81 1.8 6.68 1 1 
       2481 1 . . . . . 3.46 1.8 3.98 1 1 
       2482 1 . . . . . 3.62 1.8 4.16 1 1 
       2483 1 . . . . . 5.26 1.8 6.05 1 1 
       2484 1 . . . . . 5.31 1.8 6.11 1 1 
       2485 1 . . . . . 5.15 1.8 5.92 1 1 
       2486 1 . . . . . 5.22 1.8  6.0 1 1 
       2487 1 . . . . . 5.06 1.8 5.82 1 1 
       2488 1 . . . . . 5.26 1.8 6.05 1 1 
       2489 1 . . . . . 4.13 1.8 4.75 1 1 
       2490 1 . . . . . 3.68 1.8 4.23 1 1 
       2491 1 . . . . . 3.84 1.8 4.42 1 1 
       2492 1 . . . . .  3.0 1.8 3.45 1 1 
       2493 1 . . . . . 4.17 1.8  4.8 1 1 
       2494 1 . . . . .  5.4 1.8 6.21 1 1 
       2495 1 . . . . . 2.56 1.8 2.94 1 1 
       2496 1 . . . . .  3.2 1.8 3.68 1 1 
       2497 1 . . . . . 3.42 1.8 3.93 1 1 
       2498 1 . . . . . 4.46 1.8 5.13 1 1 
       2499 1 . . . . . 3.68 1.8 4.23 1 1 
       2500 1 . . . . . 4.11 1.8 4.73 1 1 
       2501 1 . . . . . 5.41 1.8 6.22 1 1 
       2502 1 . . . . . 3.33 1.8 3.83 1 1 
       2503 1 . . . . . 3.11 1.8 3.58 1 1 
       2504 1 . . . . . 4.84 1.8 5.57 1 1 
       2505 1 . . . . . 4.38 1.8 5.04 1 1 
       2506 1 . . . . . 2.34 1.8 2.69 1 1 
       2507 1 . . . . . 3.32 1.8 3.82 1 1 
       2508 1 . . . . . 4.56 1.8 5.24 1 1 
       2509 1 . . . . . 5.81 1.8 6.68 1 1 
       2510 1 . . . . . 2.36 1.8 2.71 1 1 
       2511 1 . . . . . 5.26 1.8 6.05 1 1 
       2512 1 . . . . . 4.99 1.8 5.74 1 1 
       2513 1 . . . . .  3.0 1.8 3.45 1 1 
       2514 1 . . . . . 4.95 1.8 5.69 1 1 
       2515 1 . . . . . 3.49 1.8 4.01 1 1 
       2516 1 . . . . . 4.79 1.8 5.51 1 1 
       2517 1 . . . . . 5.81 1.8 6.68 1 1 
       2518 1 . . . . .  4.6 1.8 5.29 1 1 
       2519 1 . . . . . 3.17 1.8 3.65 1 1 
       2520 1 . . . . . 3.55 1.8 4.08 1 1 
       2521 1 . . . . .  5.0 1.8 5.75 1 1 
       2522 1 . . . . . 3.33 1.8 3.83 1 1 
       2523 1 . . . . . 3.29 1.8 3.78 1 1 
       2524 1 . . . . .  4.1 1.8 4.72 1 1 
       2525 1 . . . . .  5.4 1.8 6.21 1 1 
       2526 1 . . . . . 5.34 1.8 6.14 1 1 
       2527 1 . . . . . 4.81 1.8 5.53 1 1 
       2528 1 . . . . . 3.62 1.8 4.16 1 1 
       2529 1 . . . . . 3.49 1.8 4.01 1 1 
       2530 1 . . . . . 4.85 1.8 5.58 1 1 
       2531 1 . . . . . 3.92 1.8 4.51 1 1 
       2532 1 . . . . . 5.81 1.8 6.68 1 1 
       2533 1 . . . . . 4.14 1.8 4.76 1 1 
       2534 1 . . . . . 5.16 1.8 5.93 1 1 
       2535 1 . . . . . 5.32 1.8 6.12 1 1 
       2536 1 . . . . . 5.81 1.8 6.68 1 1 
       2537 1 . . . . . 3.81 1.8 4.38 1 1 
       2538 1 . . . . .  5.6 1.8 6.44 1 1 
       2539 1 . . . . . 5.26 1.8 6.05 1 1 
       2540 1 . . . . .  3.2 1.8 3.68 1 1 
       2541 1 . . . . . 3.71 1.8 4.27 1 1 
       2542 1 . . . . . 5.03 1.8 5.78 1 1 
       2543 1 . . . . . 3.51 1.8 4.04 1 1 
       2544 1 . . . . . 5.28 1.8 6.07 1 1 
       2545 1 . . . . . 2.87 1.8  3.3 1 1 
       2546 1 . . . . . 4.05 1.8 4.66 1 1 
       2547 1 . . . . . 3.98 1.8 4.58 1 1 
       2548 1 . . . . . 3.17 1.8 3.65 1 1 
       2549 1 . . . . . 4.63 1.8 5.32 1 1 
       2550 1 . . . . . 5.08 1.8 5.84 1 1 
       2551 1 . . . . . 4.01 1.8 4.61 1 1 
       2552 1 . . . . . 5.04 1.8  5.8 1 1 
       2553 1 . . . . . 4.15 1.8 4.77 1 1 
       2554 1 . . . . . 4.37 1.8 5.03 1 1 
       2555 1 . . . . . 5.53 1.8 6.36 1 1 
       2556 1 . . . . . 4.24 1.8 4.88 1 1 
       2557 1 . . . . . 4.25 1.8 4.89 1 1 
       2558 1 . . . . . 4.27 1.8 4.91 1 1 
       2559 1 . . . . . 4.96 1.8  5.7 1 1 
       2560 1 . . . . . 5.55 1.8 6.38 1 1 
       2561 1 . . . . .  4.5 1.8 5.18 1 1 
       2562 1 . . . . . 3.42 1.8 3.93 1 1 
       2563 1 . . . . . 3.47 1.8 3.99 1 1 
       2564 1 . . . . . 5.81 1.8 6.68 1 1 
       2565 1 . . . . . 3.29 1.8 3.78 1 1 
       2566 1 . . . . . 2.69 1.8 3.09 1 1 
       2567 1 . . . . . 3.13 1.8  3.6 1 1 
       2568 1 . . . . . 3.33 1.8 3.83 1 1 
       2569 1 . . . . . 2.28 1.8 2.62 1 1 
       2570 1 . . . . . 3.33 1.8 3.83 1 1 
       2571 1 . . . . . 3.87 1.8 4.45 1 1 
       2572 1 . . . . . 5.74 1.8  6.6 1 1 
       2573 1 . . . . . 2.35 1.8  2.7 1 1 
       2574 1 . . . . .  4.2 1.8 4.83 1 1 
       2575 1 . . . . .  4.4 1.8 5.06 1 1 
       2576 1 . . . . . 4.11 1.8 4.73 1 1 
       2577 1 . . . . . 4.26 1.8  4.9 1 1 
       2578 1 . . . . . 4.53 1.8 5.21 1 1 
       2579 1 . . . . . 3.85 1.8 4.43 1 1 
       2580 1 . . . . . 4.63 1.8 5.32 1 1 
       2581 1 . . . . . 5.62 1.8 6.46 1 1 
       2582 1 . . . . . 3.93 1.8 4.52 1 1 
       2583 1 . . . . . 3.86 1.8 4.44 1 1 
       2584 1 . . . . . 4.13 1.8 4.75 1 1 
       2585 1 . . . . . 3.68 1.8 4.23 1 1 
       2586 1 . . . . . 4.69 1.8 5.39 1 1 
       2587 1 . . . . . 5.81 1.8 6.68 1 1 
       2588 1 . . . . . 5.02 1.8 5.77 1 1 
       2589 1 . . . . . 5.62 1.8 6.46 1 1 
       2590 1 . . . . . 4.27 1.8 4.91 1 1 
       2591 1 . . . . . 3.79 1.8 4.36 1 1 
       2592 1 . . . . .  4.4 1.8 5.06 1 1 
       2593 1 . . . . . 5.75 1.8 6.61 1 1 
       2594 1 . . . . . 4.81 1.8 5.53 1 1 
       2595 1 . . . . . 3.62 1.8 4.16 1 1 
       2596 1 . . . . . 2.48 1.8 2.85 1 1 
       2597 1 . . . . . 3.09 1.8 3.55 1 1 
       2598 1 . . . . . 3.91 1.8  4.5 1 1 
       2599 1 . . . . . 4.66 1.8 5.36 1 1 
       2600 1 . . . . . 4.55 1.8 5.23 1 1 
       2601 1 . . . . . 5.41 1.8 6.22 1 1 
       2602 1 . . . . .  4.2 1.8 4.83 1 1 
       2603 1 . . . . . 5.22 1.8  6.0 1 1 
       2604 1 . . . . . 5.81 1.8 6.68 1 1 
       2605 1 . . . . . 3.22 1.8  3.7 1 1 
       2606 1 . . . . . 3.96 1.8 4.55 1 1 
       2607 1 . . . . . 4.88 1.8 5.61 1 1 
       2608 1 . . . . . 5.61 1.8 6.45 1 1 
       2609 1 . . . . . 5.26 1.8 6.05 1 1 
       2610 1 . . . . . 4.05 1.8 4.66 1 1 
       2611 1 . . . . . 5.27 1.8 6.06 1 1 
       2612 1 . . . . . 4.96 1.8  5.7 1 1 
       2613 1 . . . . . 5.81 1.8 6.68 1 1 
       2614 1 . . . . . 5.09 1.8 5.85 1 1 
       2615 1 . . . . .  5.6 1.8 6.44 1 1 
       2616 1 . . . . . 4.71 1.8 5.42 1 1 
       2617 1 . . . . . 4.11 1.8 4.73 1 1 
       2618 1 . . . . . 5.14 1.8 5.91 1 1 
       2619 1 . . . . . 2.64 1.8 3.04 1 1 
       2620 1 . . . . . 3.29 1.8 3.78 1 1 
       2621 1 . . . . . 4.55 1.8 5.23 1 1 
       2622 1 . . . . . 4.68 1.8 5.38 1 1 
       2623 1 . . . . . 5.03 1.8 5.78 1 1 
       2624 1 . . . . .  4.7 1.8  5.4 1 1 
       2625 1 . . . . .  3.9 1.8 4.49 1 1 
       2626 1 . . . . . 3.48 1.8  4.0 1 1 
       2627 1 . . . . . 2.99 1.8 3.44 1 1 
       2628 1 . . . . . 3.35 1.8 3.85 1 1 
       2629 1 . . . . . 4.03 1.8 4.63 1 1 
       2630 1 . . . . . 3.54 1.8 4.07 1 1 
       2631 1 . . . . . 4.08 1.8 4.69 1 1 
       2632 1 . . . . . 5.23 1.8 6.01 1 1 
       2633 1 . . . . . 5.81 1.8 6.68 1 1 
       2634 1 . . . . . 3.44 1.8 3.96 1 1 
       2635 1 . . . . . 4.53 1.8 5.21 1 1 
       2636 1 . . . . . 5.23 1.8 6.01 1 1 
       2637 1 . . . . . 5.44 1.8 6.26 1 1 
       2638 1 . . . . . 4.07 1.8 4.68 1 1 
       2639 1 . . . . . 3.67 1.8 4.22 1 1 
       2640 1 . . . . .  3.0 1.8 3.45 1 1 
       2641 1 . . . . . 5.04 1.8  5.8 1 1 
       2642 1 . . . . . 5.49 1.8 6.31 1 1 
       2643 1 . . . . . 2.63 1.8 3.02 1 1 
       2644 1 . . . . . 3.24 1.8 3.73 1 1 
       2645 1 . . . . . 4.26 1.8  4.9 1 1 
       2646 1 . . . . . 4.62 1.8 5.31 1 1 
       2647 1 . . . . .  4.4 1.8 5.06 1 1 
       2648 1 . . . . . 4.57 1.8 5.26 1 1 
       2649 1 . . . . . 2.84 1.8 3.27 1 1 
       2650 1 . . . . . 3.53 1.8 4.06 1 1 
       2651 1 . . . . . 3.15 1.8 3.62 1 1 
       2652 1 . . . . .  3.5 1.8 4.03 1 1 
       2653 1 . . . . . 4.21 1.8 4.84 1 1 
       2654 1 . . . . . 2.01 1.8 2.31 1 1 
       2655 1 . . . . . 3.06 1.8 3.52 1 1 
       2656 1 . . . . . 4.33 1.8 4.98 1 1 
       2657 1 . . . . . 4.63 1.8 5.32 1 1 
       2658 1 . . . . . 5.21 1.8 5.99 1 1 
       2659 1 . . . . . 4.13 1.8 4.75 1 1 
       2660 1 . . . . . 4.69 1.8 5.39 1 1 
       2661 1 . . . . . 3.18 1.8 3.66 1 1 
       2662 1 . . . . . 5.28 1.8 6.07 1 1 
       2663 1 . . . . . 4.33 1.8 4.98 1 1 
       2664 1 . . . . . 4.59 1.8 5.28 1 1 
       2665 1 . . . . . 4.75 1.8 5.46 1 1 
       2666 1 . . . . . 3.07 1.8 3.53 1 1 
       2667 1 . . . . . 2.99 1.8 3.44 1 1 
       2668 1 . . . . . 5.56 1.8 6.39 1 1 
       2669 1 . . . . . 3.42 1.8 3.93 1 1 
       2670 1 . . . . . 3.42 1.8 3.93 1 1 
       2671 1 . . . . .  5.1 1.8 5.87 1 1 
       2672 1 . . . . . 5.33 1.8 6.13 1 1 
       2673 1 . . . . .  5.0 1.8 5.75 1 1 
       2674 1 . . . . . 4.42 1.8 5.08 1 1 
       2675 1 . . . . . 3.52 1.8 4.05 1 1 
       2676 1 . . . . . 4.66 1.8 5.36 1 1 
       2677 1 . . . . . 5.81 1.8 6.68 1 1 
       2678 1 . . . . . 4.64 1.8 5.34 1 1 
       2679 1 . . . . . 3.23 1.8 3.71 1 1 
       2680 1 . . . . . 4.28 1.8 4.92 1 1 
       2681 1 . . . . . 4.81 1.8 5.53 1 1 
       2682 1 . . . . . 4.14 1.8 4.76 1 1 
       2683 1 . . . . . 4.18 1.8 4.81 1 1 
       2684 1 . . . . . 5.54 1.8 6.37 1 1 
       2685 1 . . . . . 3.22 1.8  3.7 1 1 
       2686 1 . . . . . 4.21 1.8 4.84 1 1 
       2687 1 . . . . . 5.35 1.8 6.15 1 1 
       2688 1 . . . . . 4.48 1.8 5.15 1 1 
       2689 1 . . . . . 5.44 1.8 6.26 1 1 
       2690 1 . . . . . 4.93 1.8 5.67 1 1 
       2691 1 . . . . . 2.96 1.8  3.4 1 1 
       2692 1 . . . . . 3.22 1.8  3.7 1 1 
       2693 1 . . . . . 3.75 1.8 4.31 1 1 
       2694 1 . . . . . 3.21 1.8 3.69 1 1 
       2695 1 . . . . . 3.35 1.8 3.85 1 1 
       2696 1 . . . . . 4.95 1.8 5.69 1 1 
       2697 1 . . . . . 3.16 1.8 3.63 1 1 
       2698 1 . . . . . 4.55 1.8 5.23 1 1 
       2699 1 . . . . . 4.69 1.8 5.39 1 1 
       2700 1 . . . . . 4.72 1.8 5.43 1 1 
       2701 1 . . . . . 5.81 1.8 6.68 1 1 
       2702 1 . . . . . 4.02 1.8 4.62 1 1 
       2703 1 . . . . . 4.27 1.8 4.91 1 1 
       2704 1 . . . . . 4.51 1.8 5.19 1 1 
       2705 1 . . . . . 5.54 1.8 6.37 1 1 
       2706 1 . . . . . 4.02 1.8 4.62 1 1 
       2707 1 . . . . . 2.75 1.8 3.16 1 1 
       2708 1 . . . . . 3.25 1.8 3.74 1 1 
       2709 1 . . . . . 4.38 1.8 5.04 1 1 
       2710 1 . . . . . 3.47 1.8 3.99 1 1 
       2711 1 . . . . . 4.08 1.8 4.69 1 1 
       2712 1 . . . . . 2.82 1.8 3.24 1 1 
       2713 1 . . . . . 4.02 1.8 4.62 1 1 
       2714 1 . . . . .  5.7 1.8 6.56 1 1 
       2715 1 . . . . . 4.43 1.8 5.09 1 1 
       2716 1 . . . . .  4.0 1.8  4.6 1 1 
       2717 1 . . . . . 2.31 1.8 2.66 1 1 
       2718 1 . . . . . 2.65 1.8 3.05 1 1 
       2719 1 . . . . . 3.24 1.8 3.73 1 1 
       2720 1 . . . . . 4.22 1.8 4.85 1 1 
       2721 1 . . . . . 3.57 1.8 4.11 1 1 
       2722 1 . . . . . 5.81 1.8 6.68 1 1 
       2723 1 . . . . . 3.74 1.8  4.3 1 1 
       2724 1 . . . . . 4.52 1.8  5.2 1 1 
       2725 1 . . . . . 5.22 1.8  6.0 1 1 
       2726 1 . . . . . 5.36 1.8 6.16 1 1 
       2727 1 . . . . . 2.41 1.8 2.77 1 1 
       2728 1 . . . . . 2.93 1.8 3.37 1 1 
       2729 1 . . . . . 4.27 1.8 4.91 1 1 
       2730 1 . . . . . 2.62 1.8 3.01 1 1 
       2731 1 . . . . . 4.41 1.8 5.07 1 1 
       2732 1 . . . . . 2.68 1.8 3.08 1 1 
       2733 1 . . . . . 3.38 1.8 3.89 1 1 
       2734 1 . . . . . 4.13 1.8 4.75 1 1 
       2735 1 . . . . . 2.23 1.8 2.56 1 1 
       2736 1 . . . . . 3.31 1.8 3.81 1 1 
       2737 1 . . . . . 3.77 1.8 4.34 1 1 
       2738 1 . . . . . 4.79 1.8 5.51 1 1 
       2739 1 . . . . . 5.61 1.8 6.45 1 1 
       2740 1 . . . . . 4.39 1.8 5.05 1 1 
       2741 1 . . . . . 5.81 1.8 6.68 1 1 
       2742 1 . . . . . 4.42 1.8 5.08 1 1 
       2743 1 . . . . .  3.2 1.8 3.68 1 1 
       2744 1 . . . . . 3.52 1.8 4.05 1 1 
       2745 1 . . . . . 3.66 1.8 4.21 1 1 
       2746 1 . . . . . 5.43 1.8 6.24 1 1 
       2747 1 . . . . . 3.73 1.8 4.29 1 1 
       2748 1 . . . . .  4.8 1.8 5.52 1 1 
       2749 1 . . . . . 5.72 1.8 6.58 1 1 
       2750 1 . . . . . 3.16 1.8 3.63 1 1 
       2751 1 . . . . . 4.97 1.8 5.72 1 1 
       2752 1 . . . . . 3.97 1.8 4.57 1 1 
       2753 1 . . . . . 5.06 1.8 5.82 1 1 
       2754 1 . . . . . 4.59 1.8 5.28 1 1 
       2755 1 . . . . . 4.31 1.8 4.96 1 1 
       2756 1 . . . . . 4.36 1.8 5.01 1 1 
       2757 1 . . . . . 3.07 1.8 3.53 1 1 
       2758 1 . . . . . 3.45 1.8 3.97 1 1 
       2759 1 . . . . . 4.99 1.8 5.74 1 1 
       2760 1 . . . . . 3.52 1.8 4.05 1 1 
       2761 1 . . . . . 4.92 1.8 5.66 1 1 
       2762 1 . . . . . 3.11 1.8 3.58 1 1 
       2763 1 . . . . . 3.17 1.8 3.65 1 1 
       2764 1 . . . . .  3.1 1.8 3.57 1 1 
       2765 1 . . . . . 5.81 1.8 6.68 1 1 
       2766 1 . . . . . 5.05 1.8 5.81 1 1 
       2767 1 . . . . . 5.29 1.8 6.08 1 1 
       2768 1 . . . . . 3.65 1.8  4.2 1 1 
       2769 1 . . . . . 3.38 1.8 3.89 1 1 
       2770 1 . . . . . 3.24 1.8 3.73 1 1 
       2771 1 . . . . . 4.45 1.8 5.12 1 1 
       2772 1 . . . . . 3.05 1.8 3.51 1 1 
       2773 1 . . . . . 4.36 1.8 5.01 1 1 
       2774 1 . . . . . 2.94 1.8 3.38 1 1 
       2775 1 . . . . . 4.28 1.8 4.92 1 1 
       2776 1 . . . . . 5.74 1.8  6.6 1 1 
       2777 1 . . . . . 4.72 1.8 5.43 1 1 
       2778 1 . . . . . 3.47 1.8 3.99 1 1 
       2779 1 . . . . . 3.97 1.8 4.57 1 1 
       2780 1 . . . . . 3.57 1.8 4.11 1 1 
       2781 1 . . . . . 3.31 1.8 3.81 1 1 
       2782 1 . . . . . 3.63 1.8 4.17 1 1 
       2783 1 . . . . . 4.61 1.8  5.3 1 1 
       2784 1 . . . . . 3.66 1.8 4.21 1 1 
       2785 1 . . . . .  3.5 1.8 4.03 1 1 
       2786 1 . . . . . 3.51 1.8 4.04 1 1 
       2787 1 . . . . . 4.33 1.8 4.98 1 1 
       2788 1 . . . . . 4.56 1.8 5.24 1 1 
       2789 1 . . . . . 3.98 1.8 4.58 1 1 
       2790 1 . . . . . 5.46 1.8 6.28 1 1 
       2791 1 . . . . . 3.56 1.8 4.09 1 1 
       2792 1 . . . . .  4.1 1.8 4.72 1 1 
       2793 1 . . . . . 5.18 1.8 5.96 1 1 
       2794 1 . . . . . 5.33 1.8 6.13 1 1 
       2795 1 . . . . . 2.65 1.8 3.05 1 1 
       2796 1 . . . . . 3.91 1.8  4.5 1 1 
       2797 1 . . . . . 3.91 1.8  4.5 1 1 
       2798 1 . . . . .  4.4 1.8 5.06 1 1 
       2799 1 . . . . . 2.82 1.8 3.24 1 1 
       2800 1 . . . . . 3.62 1.8 4.16 1 1 
       2801 1 . . . . . 4.59 1.8 5.28 1 1 
       2802 1 . . . . . 3.14 1.8 3.61 1 1 
       2803 1 . . . . . 4.94 1.8 5.68 1 1 
       2804 1 . . . . . 3.98 1.8 4.58 1 1 
       2805 1 . . . . . 4.88 1.8 5.61 1 1 
       2806 1 . . . . . 4.71 1.8 5.42 1 1 
       2807 1 . . . . . 4.71 1.8 5.42 1 1 
       2808 1 . . . . . 5.61 1.8 6.45 1 1 
       2809 1 . . . . . 3.58 1.8 4.12 1 1 
       2810 1 . . . . . 4.51 1.8 5.19 1 1 
       2811 1 . . . . . 3.01 1.8 3.46 1 1 
       2812 1 . . . . . 3.13 1.8  3.6 1 1 
       2813 1 . . . . .  4.9 1.8 5.64 1 1 
       2814 1 . . . . .  4.0 1.8  4.6 1 1 
       2815 1 . . . . . 4.71 1.8 5.42 1 1 
       2816 1 . . . . . 3.97 1.8 4.57 1 1 
       2817 1 . . . . . 2.97 1.8 3.42 1 1 
       2818 1 . . . . . 5.36 1.8 6.16 1 1 
       2819 1 . . . . . 4.43 1.8 5.09 1 1 
       2820 1 . . . . . 4.29 1.8 4.93 1 1 
       2821 1 . . . . . 4.29 1.8 4.93 1 1 
       2822 1 . . . . . 3.65 1.8  4.2 1 1 
       2823 1 . . . . . 5.81 1.8 6.68 1 1 
       2824 1 . . . . . 3.13 1.8  3.6 1 1 
       2825 1 . . . . . 4.35 1.8  5.0 1 1 
       2826 1 . . . . . 4.64 1.8 5.34 1 1 
       2827 1 . . . . . 3.68 1.8 4.23 1 1 
       2828 1 . . . . . 3.14 1.8 3.61 1 1 
       2829 1 . . . . . 4.92 1.8 5.66 1 1 
       2830 1 . . . . . 4.58 1.8 5.27 1 1 
       2831 1 . . . . . 5.34 1.8 6.14 1 1 
       2832 1 . . . . . 5.05 1.8 5.81 1 1 
       2833 1 . . . . . 3.04 1.8  3.5 1 1 
       2834 1 . . . . . 5.41 1.8 6.22 1 1 
       2835 1 . . . . . 3.11 1.8 3.58 1 1 
       2836 1 . . . . . 3.69 1.8 4.24 1 1 
       2837 1 . . . . . 5.36 1.8 6.16 1 1 
       2838 1 . . . . .  2.6 1.8 2.99 1 1 
       2839 1 . . . . . 2.86 1.8 3.29 1 1 
       2840 1 . . . . . 5.46 1.8 6.28 1 1 
       2841 1 . . . . . 2.19 1.8 2.52 1 1 
       2842 1 . . . . .  3.7 1.8 4.26 1 1 
       2843 1 . . . . . 3.21 1.8 3.69 1 1 
       2844 1 . . . . . 3.15 1.8 3.62 1 1 
       2845 1 . . . . .  4.0 1.8  4.6 1 1 
       2846 1 . . . . . 3.63 1.8 4.17 1 1 
       2847 1 . . . . . 2.27 1.8 2.61 1 1 
       2848 1 . . . . . 3.12 1.8 3.59 1 1 
       2849 1 . . . . . 5.02 1.8 5.77 1 1 
       2850 1 . . . . . 5.42 1.8 6.23 1 1 
       2851 1 . . . . . 5.72 1.8 6.58 1 1 
       2852 1 . . . . . 4.28 1.8 4.92 1 1 
       2853 1 . . . . . 4.66 1.8 5.36 1 1 
       2854 1 . . . . . 4.27 1.8 4.91 1 1 
       2855 1 . . . . . 5.02 1.8 5.77 1 1 
       2856 1 . . . . . 4.11 1.8 4.73 1 1 
       2857 1 . . . . . 4.81 1.8 5.53 1 1 
       2858 1 . . . . . 3.63 1.8 4.17 1 1 
       2859 1 . . . . .  4.9 1.8 5.64 1 1 
       2860 1 . . . . . 3.07 1.8 3.53 1 1 
       2861 1 . . . . .  5.0 1.8 5.75 1 1 
       2862 1 . . . . . 5.65 1.8  6.5 1 1 
       2863 1 . . . . . 4.12 1.8 4.74 1 1 
       2864 1 . . . . . 5.16 1.8 5.93 1 1 
       2865 1 . . . . . 5.69 1.8 6.54 1 1 
       2866 1 . . . . . 4.72 1.8 5.43 1 1 
       2867 1 . . . . . 4.73 1.8 5.44 1 1 
       2868 1 . . . . . 5.04 1.8  5.8 1 1 
       2869 1 . . . . . 5.81 1.8 6.68 1 1 
       2870 1 . . . . . 4.92 1.8 5.66 1 1 
       2871 1 . . . . .  3.7 1.8 4.26 1 1 
       2872 1 . . . . . 4.58 1.8 5.27 1 1 
       2873 1 . . . . . 2.82 1.8 3.24 1 1 
       2874 1 . . . . . 3.52 1.8 4.05 1 1 
       2875 1 . . . . .  5.4 1.8 6.21 1 1 
       2876 1 . . . . . 3.22 1.8  3.7 1 1 
       2877 1 . . . . . 3.88 1.8 4.46 1 1 
       2878 1 . . . . .  4.1 1.8 4.72 1 1 
       2879 1 . . . . . 4.97 1.8 5.72 1 1 
       2880 1 . . . . . 4.68 1.8 5.38 1 1 
       2881 1 . . . . . 4.73 1.8 5.44 1 1 
       2882 1 . . . . . 4.06 1.8 4.67 1 1 
       2883 1 . . . . . 5.62 1.8 6.46 1 1 
       2884 1 . . . . . 5.17 1.8 5.95 1 1 
       2885 1 . . . . . 5.61 1.8 6.45 1 1 
       2886 1 . . . . . 4.24 1.8 4.88 1 1 
       2887 1 . . . . . 2.94 1.8 3.38 1 1 
       2888 1 . . . . . 3.22 1.8  3.7 1 1 
       2889 1 . . . . . 4.78 1.8  5.5 1 1 
       2890 1 . . . . .  3.3 1.8  3.8 1 1 
       2891 1 . . . . . 2.97 1.8 3.42 1 1 
       2892 1 . . . . . 3.23 1.8 3.71 1 1 
       2893 1 . . . . . 3.61 1.8 4.15 1 1 
       2894 1 . . . . . 3.24 1.8 3.73 1 1 
       2895 1 . . . . . 3.35 1.8 3.85 1 1 
       2896 1 . . . . . 4.67 1.8 5.37 1 1 
       2897 1 . . . . .  5.6 1.8 6.44 1 1 
       2898 1 . . . . . 4.12 1.8 4.74 1 1 
       2899 1 . . . . .  4.6 1.8 5.29 1 1 
       2900 1 . . . . . 5.35 1.8 6.15 1 1 
       2901 1 . . . . . 3.91 1.8  4.5 1 1 
       2902 1 . . . . . 3.57 1.8 4.11 1 1 
       2903 1 . . . . . 5.32 1.8 6.12 1 1 
       2904 1 . . . . . 4.87 1.8  5.6 1 1 
       2905 1 . . . . . 5.81 1.8 6.68 1 1 
       2906 1 . . . . . 2.72 1.8 3.13 1 1 
       2907 1 . . . . . 3.06 1.8 3.52 1 1 
       2908 1 . . . . . 4.44 1.8 5.11 1 1 
       2909 1 . . . . .  3.4 1.8 3.91 1 1 
       2910 1 . . . . . 4.76 1.8 5.47 1 1 
       2911 1 . . . . . 4.04 1.8 4.65 1 1 
       2912 1 . . . . . 2.34 1.8 2.69 1 1 
       2913 1 . . . . . 2.97 1.8 3.42 1 1 
       2914 1 . . . . . 3.55 1.8 4.08 1 1 
       2915 1 . . . . . 4.21 1.8 4.84 1 1 
       2916 1 . . . . . 3.62 1.8 4.16 1 1 
       2917 1 . . . . . 4.32 1.8 4.97 1 1 
       2918 1 . . . . . 5.06 1.8 5.82 1 1 
       2919 1 . . . . . 4.36 1.8 5.01 1 1 
       2920 1 . . . . . 4.59 1.8 5.28 1 1 
       2921 1 . . . . . 2.84 1.8 3.27 1 1 
       2922 1 . . . . . 3.23 1.8 3.71 1 1 
       2923 1 . . . . .  4.9 1.8 5.64 1 1 
       2924 1 . . . . . 3.26 1.8 3.75 1 1 
       2925 1 . . . . . 4.91 1.8 5.65 1 1 
       2926 1 . . . . . 4.53 1.8 5.21 1 1 
       2927 1 . . . . . 4.98 1.8 5.73 1 1 
       2928 1 . . . . . 4.94 1.8 5.68 1 1 
       2929 1 . . . . .  3.5 1.8 4.03 1 1 
       2930 1 . . . . . 5.14 1.8 5.91 1 1 
       2931 1 . . . . . 5.19 1.8 5.97 1 1 
       2932 1 . . . . . 3.42 1.8 3.93 1 1 
       2933 1 . . . . . 3.03 1.8 3.48 1 1 
       2934 1 . . . . . 4.31 1.8 4.96 1 1 
       2935 1 . . . . . 5.35 1.8 6.15 1 1 
       2936 1 . . . . . 3.46 1.8 3.98 1 1 
       2937 1 . . . . . 4.37 1.8 5.03 1 1 
       2938 1 . . . . . 2.98 1.8 3.43 1 1 
       2939 1 . . . . . 5.01 1.8 5.76 1 1 
       2940 1 . . . . . 4.82 1.8 5.54 1 1 
       2941 1 . . . . . 4.17 1.8  4.8 1 1 
       2942 1 . . . . . 3.32 1.8 3.82 1 1 
       2943 1 . . . . . 5.13 1.8  5.9 1 1 
       2944 1 . . . . . 5.22 1.8  6.0 1 1 
       2945 1 . . . . . 4.63 1.8 5.32 1 1 
       2946 1 . . . . . 3.78 1.8 4.35 1 1 
       2947 1 . . . . . 3.13 1.8  3.6 1 1 
       2948 1 . . . . . 4.04 1.8 4.65 1 1 
       2949 1 . . . . . 3.53 1.8 4.06 1 1 
       2950 1 . . . . . 3.58 1.8 4.12 1 1 
    stop_

save_


save_CNS/XPLOR_distance_constraints_3_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  2
    _Distance_constraint_list.Constraint_type     "hydrogen bond"
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

        1 1 . . . 1 2 
        2 1 . . . 1 2 
        3 1 . . . 1 2 
        4 1 . . . 1 2 
        5 1 . . . 1 2 
        6 1 . . . 1 2 
        7 1 . . . 1 2 
        8 1 . . . 1 2 
        9 1 . . . 1 2 
       10 1 . . . 1 2 
       11 1 . . . 1 2 
       12 1 . . . 1 2 
       13 1 . . . 1 2 
       14 1 . . . 1 2 
       15 1 . . . 1 2 
       16 1 . . . 1 2 
       17 1 . . . 1 2 
       18 1 . . . 1 2 
       19 1 . . . 1 2 
       20 1 . . . 1 2 
       21 1 . . . 1 2 
       22 1 . . . 1 2 
       23 1 . . . 1 2 
       24 1 . . . 1 2 
       25 1 . . . 1 2 
       26 1 . . . 1 2 
       27 1 . . . 1 2 
       28 1 . . . 1 2 
       29 1 . . . 1 2 
       30 1 . . . 1 2 
       31 1 . . . 1 2 
       32 1 . . . 1 2 
       33 1 . . . 1 2 
       34 1 . . . 1 2 
       35 1 . . . 1 2 
       36 1 . . . 1 2 
       37 1 . . . 1 2 
       38 1 . . . 1 2 
       39 1 . . . 1 2 
       40 1 . . . 1 2 
       41 1 . . . 1 2 
       42 1 . . . 1 2 
       43 1 . . . 1 2 
       44 1 . . . 1 2 
       45 1 . . . 1 2 
       46 1 . . . 1 2 
       47 1 . . . 1 2 
       48 1 . . . 1 2 
       49 1 . . . 1 2 
       50 1 . . . 1 2 
       51 1 . . . 1 2 
       52 1 . . . 1 2 
       53 1 . . . 1 2 
       54 1 . . . 1 2 
       55 1 . . . 1 2 
       56 1 . . . 1 2 
       57 1 . . . 1 2 
       58 1 . . . 1 2 
       59 1 . . . 1 2 
       60 1 . . . 1 2 
       61 1 . . . 1 2 
       62 1 . . . 1 2 
       63 1 . . . 1 2 
       64 1 . . . 1 2 
       65 1 . . . 1 2 
       66 1 . . . 1 2 
       67 1 . . . 1 2 
       68 1 . . . 1 2 
       69 1 . . . 1 2 
       70 1 . . . 1 2 
       71 1 . . . 1 2 
       72 1 . . . 1 2 
       73 1 . . . 1 2 
       74 1 . . . 1 2 
       75 1 . . . 1 2 
       76 1 . . . 1 2 
       77 1 . . . 1 2 
       78 1 . . . 1 2 
       79 1 . . . 1 2 
       80 1 . . . 1 2 
       81 1 . . . 1 2 
       82 1 . . . 1 2 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

        1 1 1 1 1   5 LEU H .   5 . HN 1 2 
        1 1 2 1 1  54 LEU O .  54 . O  1 2 
        2 1 1 1 1   5 LEU N .   5 . N  1 2 
        2 1 2 1 1  54 LEU O .  54 . O  1 2 
        3 1 1 1 1   6 LEU H .   6 . HN 1 2 
        3 1 2 1 1  81 ASP O .  81 . O  1 2 
        4 1 1 1 1   6 LEU N .   6 . N  1 2 
        4 1 2 1 1  81 ASP O .  81 . O  1 2 
        5 1 1 1 1   7 VAL H .   7 . HN 1 2 
        5 1 2 1 1  56 VAL O .  56 . O  1 2 
        6 1 1 1 1   7 VAL N .   7 . N  1 2 
        6 1 2 1 1  56 VAL O .  56 . O  1 2 
        7 1 1 1 1   8 ILE H .   8 . HN 1 2 
        7 1 2 1 1  83 LEU O .  83 . O  1 2 
        8 1 1 1 1   8 ILE N .   8 . N  1 2 
        8 1 2 1 1  83 LEU O .  83 . O  1 2 
        9 1 1 1 1  12 THR O .  12 . O  1 2 
        9 1 2 1 1  16 SER H .  16 . HN 1 2 
       10 1 1 1 1  12 THR O .  12 . O  1 2 
       10 1 2 1 1  16 SER N .  16 . N  1 2 
       11 1 1 1 1  14 ILE O .  14 . O  1 2 
       11 1 2 1 1  18 VAL H .  18 . HN 1 2 
       12 1 1 1 1  14 ILE O .  14 . O  1 2 
       12 1 2 1 1  18 VAL N .  18 . N  1 2 
       13 1 1 1 1  15 ILE O .  15 . O  1 2 
       13 1 2 1 1  19 GLN H .  19 . HN 1 2 
       14 1 1 1 1  15 ILE O .  15 . O  1 2 
       14 1 2 1 1  19 GLN N .  19 . N  1 2 
       15 1 1 1 1  18 VAL O .  18 . O  1 2 
       15 1 2 1 1  22 ALA H .  22 . HN 1 2 
       16 1 1 1 1  18 VAL O .  18 . O  1 2 
       16 1 2 1 1  22 ALA N .  22 . N  1 2 
       17 1 1 1 1  19 GLN O .  19 . O  1 2 
       17 1 2 1 1  23 LYS H .  23 . HN 1 2 
       18 1 1 1 1  19 GLN O .  19 . O  1 2 
       18 1 2 1 1  23 LYS N .  23 . N  1 2 
       19 1 1 1 1  21 ARG O .  21 . O  1 2 
       19 1 2 1 1  25 ASN H .  25 . HN 1 2 
       20 1 1 1 1  21 ARG O .  21 . O  1 2 
       20 1 2 1 1  25 ASN N .  25 . N  1 2 
       21 1 1 1 1  22 ALA O .  22 . O  1 2 
       21 1 2 1 1  26 TYR H .  26 . HN 1 2 
       22 1 1 1 1  22 ALA O .  22 . O  1 2 
       22 1 2 1 1  26 TYR N .  26 . N  1 2 
       23 1 1 1 1  34 ALA H .  34 . HN 1 2 
       23 1 2 1 1  57 PHE O .  57 . O  1 2 
       24 1 1 1 1  34 ALA N .  34 . N  1 2 
       24 1 2 1 1  57 PHE O .  57 . O  1 2 
       25 1 1 1 1  38 GLN O .  38 . O  1 2 
       25 1 2 1 1  42 ASP H .  42 . HN 1 2 
       26 1 1 1 1  38 GLN O .  38 . O  1 2 
       26 1 2 1 1  42 ASP N .  42 . N  1 2 
       27 1 1 1 1  39 ASP O .  39 . O  1 2 
       27 1 2 1 1  43 ILE H .  43 . HN 1 2 
       28 1 1 1 1  39 ASP O .  39 . O  1 2 
       28 1 2 1 1  43 ILE N .  43 . N  1 2 
       29 1 1 1 1  41 ARG O .  41 . O  1 2 
       29 1 2 1 1  45 LYS H .  45 . HN 1 2 
       30 1 1 1 1  41 ARG O .  41 . O  1 2 
       30 1 2 1 1  45 LYS N .  45 . N  1 2 
       31 1 1 1 1  42 ASP O .  42 . O  1 2 
       31 1 2 1 1  46 SER H .  46 . HN 1 2 
       32 1 1 1 1  42 ASP O .  42 . O  1 2 
       32 1 2 1 1  46 SER N .  46 . N  1 2 
       33 1 1 1 1  44 ILE O .  44 . O  1 2 
       33 1 2 1 1  48 LYS H .  48 . HN 1 2 
       34 1 1 1 1  44 ILE O .  44 . O  1 2 
       34 1 2 1 1  48 LYS N .  48 . N  1 2 
       35 1 1 1 1   3 LYS O .   3 . O  1 2 
       35 1 2 1 1  54 LEU H .  54 . HN 1 2 
       36 1 1 1 1   3 LYS O .   3 . O  1 2 
       36 1 2 1 1  54 LEU N .  54 . N  1 2 
       37 1 1 1 1   7 VAL O .   7 . O  1 2 
       37 1 2 1 1  58 VAL H .  58 . HN 1 2 
       38 1 1 1 1   7 VAL O .   7 . O  1 2 
       38 1 2 1 1  58 VAL N .  58 . N  1 2 
       39 1 1 1 1  63 GLN O .  63 . O  1 2 
       39 1 2 1 1  67 ASN H .  67 . HN 1 2 
       40 1 1 1 1  63 GLN O .  63 . O  1 2 
       40 1 2 1 1  67 ASN N .  67 . N  1 2 
       41 1 1 1 1  64 ASN O .  64 . O  1 2 
       41 1 2 1 1  68 GLU H .  68 . HN 1 2 
       42 1 1 1 1  64 ASN O .  64 . O  1 2 
       42 1 2 1 1  68 GLU N .  68 . N  1 2 
       43 1 1 1 1  65 ASP O .  65 . O  1 2 
       43 1 2 1 1  69 PHE H .  69 . HN 1 2 
       44 1 1 1 1  65 ASP O .  65 . O  1 2 
       44 1 2 1 1  69 PHE N .  69 . N  1 2 
       45 1 1 1 1  66 VAL O .  66 . O  1 2 
       45 1 2 1 1  70 GLN H .  70 . HN 1 2 
       46 1 1 1 1  66 VAL O .  66 . O  1 2 
       46 1 2 1 1  70 GLN N .  70 . N  1 2 
       47 1 1 1 1  67 ASN O .  67 . O  1 2 
       47 1 2 1 1  71 ASN H .  71 . HN 1 2 
       48 1 1 1 1  67 ASN O .  67 . O  1 2 
       48 1 2 1 1  71 ASN N .  71 . N  1 2 
       49 1 1 1 1  68 GLU O .  68 . O  1 2 
       49 1 2 1 1  72 GLU H .  72 . HN 1 2 
       50 1 1 1 1  68 GLU O .  68 . O  1 2 
       50 1 2 1 1  72 GLU N .  72 . N  1 2 
       51 1 1 1 1  69 PHE O .  69 . O  1 2 
       51 1 2 1 1  73 ALA H .  73 . HN 1 2 
       52 1 1 1 1  69 PHE O .  69 . O  1 2 
       52 1 2 1 1  73 ALA N .  73 . N  1 2 
       53 1 1 1 1  70 GLN O .  70 . O  1 2 
       53 1 2 1 1  74 LYS H .  74 . HN 1 2 
       54 1 1 1 1  70 GLN O .  70 . O  1 2 
       54 1 2 1 1  74 LYS N .  74 . N  1 2 
       55 1 1 1 1  71 ASN O .  71 . O  1 2 
       55 1 2 1 1  75 LYS H .  75 . HN 1 2 
       56 1 1 1 1  71 ASN O .  71 . O  1 2 
       56 1 2 1 1  75 LYS N .  75 . N  1 2 
       57 1 1 1 1  73 ALA O .  73 . O  1 2 
       57 1 2 1 1  78 VAL H .  78 . HN 1 2 
       58 1 1 1 1  73 ALA O .  73 . O  1 2 
       58 1 2 1 1  78 VAL N .  78 . N  1 2 
       59 1 1 1 1   4 VAL O .   4 . O  1 2 
       59 1 2 1 1  81 ASP H .  81 . HN 1 2 
       60 1 1 1 1   4 VAL O .   4 . O  1 2 
       60 1 2 1 1  81 ASP N .  81 . N  1 2 
       61 1 1 1 1   6 LEU O .   6 . O  1 2 
       61 1 2 1 1  83 LEU H .  83 . HN 1 2 
       62 1 1 1 1   6 LEU O .   6 . O  1 2 
       62 1 2 1 1  83 LEU N .  83 . N  1 2 
       63 1 1 1 1   8 ILE O .   8 . O  1 2 
       63 1 2 1 1  85 SER H .  85 . HN 1 2 
       64 1 1 1 1   8 ILE O .   8 . O  1 2 
       64 1 2 1 1  85 SER N .  85 . N  1 2 
       65 1 1 1 1  87 ASP O .  87 . O  1 2 
       65 1 2 1 1  91 LEU H .  91 . HN 1 2 
       66 1 1 1 1  87 ASP O .  87 . O  1 2 
       66 1 2 1 1  91 LEU N .  91 . N  1 2 
       67 1 1 1 1  88 PRO O .  88 . O  1 2 
       67 1 2 1 1  92 THR H .  92 . HN 1 2 
       68 1 1 1 1  88 PRO O .  88 . O  1 2 
       68 1 2 1 1  92 THR N .  92 . N  1 2 
       69 1 1 1 1  89 GLU O .  89 . O  1 2 
       69 1 2 1 1  93 GLN H .  93 . HN 1 2 
       70 1 1 1 1  89 GLU O .  89 . O  1 2 
       70 1 2 1 1  93 GLN N .  93 . N  1 2 
       71 1 1 1 1  90 GLU O .  90 . O  1 2 
       71 1 2 1 1  94 ARG H .  94 . HN 1 2 
       72 1 1 1 1  90 GLU O .  90 . O  1 2 
       72 1 2 1 1  94 ARG N .  94 . N  1 2 
       73 1 1 1 1  94 ARG O .  94 . O  1 2 
       73 1 2 1 1  98 PHE H .  98 . HN 1 2 
       74 1 1 1 1  94 ARG O .  94 . O  1 2 
       74 1 2 1 1  98 PHE N .  98 . N  1 2 
       75 1 1 1 1  95 VAL O .  95 . O  1 2 
       75 1 2 1 1  99 LEU H .  99 . HN 1 2 
       76 1 1 1 1  95 VAL O .  95 . O  1 2 
       76 1 2 1 1  99 LEU N .  99 . N  1 2 
       77 1 1 1 1  96 ARG O .  96 . O  1 2 
       77 1 2 1 1 100 LYS H . 100 . HN 1 2 
       78 1 1 1 1  96 ARG O .  96 . O  1 2 
       78 1 2 1 1 100 LYS N . 100 . N  1 2 
       79 1 1 1 1  97 GLU O .  97 . O  1 2 
       79 1 2 1 1 101 THR H . 101 . HN 1 2 
       80 1 1 1 1  97 GLU O .  97 . O  1 2 
       80 1 2 1 1 101 THR N . 101 . N  1 2 
       81 1 1 1 1  98 PHE O .  98 . O  1 2 
       81 1 2 1 1 102 ALA H . 102 . HN 1 2 
       82 1 1 1 1  98 PHE O .  98 . O  1 2 
       82 1 2 1 1 102 ALA N . 102 . N  1 2 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

        1 1 . . . . .  1.9 1.8 2.18 1 2 
        2 1 . . . . . 2.85 2.7 3.28 1 2 
        3 1 . . . . .  1.9 1.8 2.18 1 2 
        4 1 . . . . . 2.85 2.7 3.28 1 2 
        5 1 . . . . .  1.9 1.8 2.18 1 2 
        6 1 . . . . . 2.85 2.7 3.28 1 2 
        7 1 . . . . .  1.9 1.8 2.18 1 2 
        8 1 . . . . . 2.85 2.7 3.28 1 2 
        9 1 . . . . .  1.9 1.8 2.18 1 2 
       10 1 . . . . . 2.85 2.7 3.28 1 2 
       11 1 . . . . .  1.9 1.8 2.18 1 2 
       12 1 . . . . . 2.85 2.7 3.28 1 2 
       13 1 . . . . .  1.9 1.8 2.18 1 2 
       14 1 . . . . . 2.85 2.7 3.28 1 2 
       15 1 . . . . .  1.9 1.8 2.18 1 2 
       16 1 . . . . . 2.85 2.7 3.28 1 2 
       17 1 . . . . .  1.9 1.8 2.18 1 2 
       18 1 . . . . . 2.85 2.7 3.28 1 2 
       19 1 . . . . .  1.9 1.8 2.18 1 2 
       20 1 . . . . . 2.85 2.7 3.28 1 2 
       21 1 . . . . .  1.9 1.8 2.18 1 2 
       22 1 . . . . . 2.85 2.7 3.28 1 2 
       23 1 . . . . .  1.9 1.8 2.18 1 2 
       24 1 . . . . . 2.85 2.7 3.28 1 2 
       25 1 . . . . .  1.9 1.8 2.18 1 2 
       26 1 . . . . . 2.85 2.7 3.28 1 2 
       27 1 . . . . .  1.9 1.8 2.18 1 2 
       28 1 . . . . . 2.85 2.7 3.28 1 2 
       29 1 . . . . .  1.9 1.8 2.18 1 2 
       30 1 . . . . . 2.85 2.7 3.28 1 2 
       31 1 . . . . .  1.9 1.8 2.18 1 2 
       32 1 . . . . . 2.85 2.7 3.28 1 2 
       33 1 . . . . .  1.9 1.8 2.18 1 2 
       34 1 . . . . . 2.85 2.7 3.28 1 2 
       35 1 . . . . .  1.9 1.8 2.18 1 2 
       36 1 . . . . . 2.85 2.7 3.28 1 2 
       37 1 . . . . .  1.9 1.8 2.18 1 2 
       38 1 . . . . . 2.85 2.7 3.28 1 2 
       39 1 . . . . .  1.9 1.8 2.18 1 2 
       40 1 . . . . . 2.85 2.7 3.28 1 2 
       41 1 . . . . .  1.9 1.8 2.18 1 2 
       42 1 . . . . . 2.85 2.7 3.28 1 2 
       43 1 . . . . .  1.9 1.8 2.18 1 2 
       44 1 . . . . . 2.85 2.7 3.28 1 2 
       45 1 . . . . .  1.9 1.8 2.18 1 2 
       46 1 . . . . . 2.85 2.7 3.28 1 2 
       47 1 . . . . .  1.9 1.8 2.18 1 2 
       48 1 . . . . . 2.85 2.7 3.28 1 2 
       49 1 . . . . .  1.9 1.8 2.18 1 2 
       50 1 . . . . . 2.85 2.7 3.28 1 2 
       51 1 . . . . .  1.9 1.8 2.18 1 2 
       52 1 . . . . . 2.85 2.7 3.28 1 2 
       53 1 . . . . .  1.9 1.8 2.18 1 2 
       54 1 . . . . . 2.85 2.7 3.28 1 2 
       55 1 . . . . .  1.9 1.8 2.18 1 2 
       56 1 . . . . . 2.85 2.7 3.28 1 2 
       57 1 . . . . .  1.9 1.8 2.18 1 2 
       58 1 . . . . . 2.85 2.7 3.28 1 2 
       59 1 . . . . .  1.9 1.8 2.18 1 2 
       60 1 . . . . . 2.85 2.7 3.28 1 2 
       61 1 . . . . .  1.9 1.8 2.18 1 2 
       62 1 . . . . . 2.85 2.7 3.28 1 2 
       63 1 . . . . .  1.9 1.8 2.18 1 2 
       64 1 . . . . . 2.85 2.7 3.28 1 2 
       65 1 . . . . .  1.9 1.8 2.18 1 2 
       66 1 . . . . . 2.85 2.7 3.28 1 2 
       67 1 . . . . .  1.9 1.8 2.18 1 2 
       68 1 . . . . . 2.85 2.7 3.28 1 2 
       69 1 . . . . .  1.9 1.8 2.18 1 2 
       70 1 . . . . . 2.85 2.7 3.28 1 2 
       71 1 . . . . .  1.9 1.8 2.18 1 2 
       72 1 . . . . . 2.85 2.7 3.28 1 2 
       73 1 . . . . .  1.9 1.8 2.18 1 2 
       74 1 . . . . . 2.85 2.7 3.28 1 2 
       75 1 . . . . .  1.9 1.8 2.18 1 2 
       76 1 . . . . . 2.85 2.7 3.28 1 2 
       77 1 . . . . .  1.9 1.8 2.18 1 2 
       78 1 . . . . . 2.85 2.7 3.28 1 2 
       79 1 . . . . .  1.9 1.8 2.18 1 2 
       80 1 . . . . . 2.85 2.7 3.28 1 2 
       81 1 . . . . .  1.9 1.8 2.18 1 2 
       82 1 . . . . . 2.85 2.7 3.28 1 2 
    stop_

save_


save_CNS/XPLOR_dihedral_2
    _Torsion_angle_constraint_list.Sf_category         torsion_angle_constraints
    _Torsion_angle_constraint_list.Entry_ID            1
    _Torsion_angle_constraint_list.ID                  1
    _Torsion_angle_constraint_list.Constraint_file_ID  .
    _Torsion_angle_constraint_list.Block_ID            .

    loop_
       _Torsion_angle_constraint.ID
       _Torsion_angle_constraint.Torsion_angle_name
       _Torsion_angle_constraint.Entity_assembly_ID_1
       _Torsion_angle_constraint.Entity_ID_1
       _Torsion_angle_constraint.Comp_index_ID_1
       _Torsion_angle_constraint.Comp_ID_1
       _Torsion_angle_constraint.Atom_ID_1
       _Torsion_angle_constraint.Entity_assembly_ID_2
       _Torsion_angle_constraint.Entity_ID_2
       _Torsion_angle_constraint.Comp_index_ID_2
       _Torsion_angle_constraint.Comp_ID_2
       _Torsion_angle_constraint.Atom_ID_2
       _Torsion_angle_constraint.Entity_assembly_ID_3
       _Torsion_angle_constraint.Entity_ID_3
       _Torsion_angle_constraint.Comp_index_ID_3
       _Torsion_angle_constraint.Comp_ID_3
       _Torsion_angle_constraint.Atom_ID_3
       _Torsion_angle_constraint.Entity_assembly_ID_4
       _Torsion_angle_constraint.Entity_ID_4
       _Torsion_angle_constraint.Comp_index_ID_4
       _Torsion_angle_constraint.Comp_ID_4
       _Torsion_angle_constraint.Atom_ID_4
       _Torsion_angle_constraint.Angle_lower_bound_val
       _Torsion_angle_constraint.Angle_upper_bound_val
       _Torsion_angle_constraint.Auth_asym_ID_1
       _Torsion_angle_constraint.Auth_seq_ID_1
       _Torsion_angle_constraint.Auth_comp_ID_1
       _Torsion_angle_constraint.Auth_atom_ID_1
       _Torsion_angle_constraint.Auth_asym_ID_2
       _Torsion_angle_constraint.Auth_seq_ID_2
       _Torsion_angle_constraint.Auth_comp_ID_2
       _Torsion_angle_constraint.Auth_atom_ID_2
       _Torsion_angle_constraint.Auth_asym_ID_3
       _Torsion_angle_constraint.Auth_seq_ID_3
       _Torsion_angle_constraint.Auth_comp_ID_3
       _Torsion_angle_constraint.Auth_atom_ID_3
       _Torsion_angle_constraint.Auth_asym_ID_4
       _Torsion_angle_constraint.Auth_seq_ID_4
       _Torsion_angle_constraint.Auth_comp_ID_4
       _Torsion_angle_constraint.Auth_atom_ID_4
       _Torsion_angle_constraint.Entry_ID
       _Torsion_angle_constraint.Torsion_angle_constraint_list_ID

         1 . 1 1   2 GLY C 1 1   3 LYS N  1 1   3 LYS CA 1 1   3 LYS C      -171.4 -31.399998 .   2 . C .   3 . N  .   3 . CA .   3 . C 1 1 
         2 . 1 1   3 LYS N 1 1   3 LYS CA 1 1   3 LYS C  1 1   4 VAL N        63.3      179.6 .   3 . N .   3 . CA .   3 . C  .   4 . N 1 1 
         3 . 1 1   3 LYS C 1 1   4 VAL N  1 1   4 VAL CA 1 1   4 VAL C      -204.1      -64.1 .   3 . C .   4 . N  .   4 . CA .   4 . C 1 1 
         4 . 1 1   4 VAL N 1 1   4 VAL CA 1 1   4 VAL C  1 1   5 LEU N       108.1      152.9 .   4 . N .   4 . CA .   4 . C  .   5 . N 1 1 
         5 . 1 1   4 VAL C 1 1   5 LEU N  1 1   5 LEU CA 1 1   5 LEU C      -146.2      -69.8 .   4 . C .   5 . N  .   5 . CA .   5 . C 1 1 
         6 . 1 1   5 LEU N 1 1   5 LEU CA 1 1   5 LEU C  1 1   6 LEU N   97.899994      137.9 .   5 . N .   5 . CA .   5 . C  .   6 . N 1 1 
         7 . 1 1   5 LEU C 1 1   6 LEU N  1 1   6 LEU CA 1 1   6 LEU C      -153.3      -68.1 .   5 . C .   6 . N  .   6 . CA .   6 . C 1 1 
         8 . 1 1   6 LEU N 1 1   6 LEU CA 1 1   6 LEU C  1 1   7 VAL N        95.1      138.0 .   6 . N .   6 . CA .   6 . C  .   7 . N 1 1 
         9 . 1 1   6 LEU C 1 1   7 VAL N  1 1   7 VAL CA 1 1   7 VAL C      -130.5      -80.8 .   6 . C .   7 . N  .   7 . CA .   7 . C 1 1 
        10 . 1 1   7 VAL N 1 1   7 VAL CA 1 1   7 VAL C  1 1   8 ILE N        96.4      154.1 .   7 . N .   7 . CA .   7 . C  .   8 . N 1 1 
        11 . 1 1   7 VAL C 1 1   8 ILE N  1 1   8 ILE CA 1 1   8 ILE C      -142.1      -82.0 .   7 . C .   8 . N  .   8 . CA .   8 . C 1 1 
        12 . 1 1   8 ILE N 1 1   8 ILE CA 1 1   8 ILE C  1 1   9 SER N       109.0      172.5 .   8 . N .   8 . CA .   8 . C  .   9 . N 1 1 
        13 . 1 1   8 ILE C 1 1   9 SER N  1 1   9 SER CA 1 1   9 SER C  -176.19998      -69.9 .   8 . C .   9 . N  .   9 . CA .   9 . C 1 1 
        14 . 1 1   9 SER N 1 1   9 SER CA 1 1   9 SER C  1 1  10 THR N       135.1  176.19998 .   9 . N .   9 . CA .   9 . C  .  10 . N 1 1 
        15 . 1 1  11 ASP C 1 1  12 THR N  1 1  12 THR CA 1 1  12 THR C      -106.3      -20.5 .  11 . C .  12 . N  .  12 . CA .  12 . C 1 1 
        16 . 1 1  12 THR N 1 1  12 THR CA 1 1  12 THR C  1 1  13 ASN N       -64.5  7.6000004 .  12 . N .  12 . CA .  12 . C  .  13 . N 1 1 
        17 . 1 1  12 THR C 1 1  13 ASN N  1 1  13 ASN CA 1 1  13 ASN C       -82.2      -42.2 .  12 . C .  13 . N  .  13 . CA .  13 . C 1 1 
        18 . 1 1  13 ASN N 1 1  13 ASN CA 1 1  13 ASN C  1 1  14 ILE N  -62.599995      -22.6 .  13 . N .  13 . CA .  13 . C  .  14 . N 1 1 
        19 . 1 1  13 ASN C 1 1  14 ILE N  1 1  14 ILE CA 1 1  14 ILE C       -88.2      -48.2 .  13 . C .  14 . N  .  14 . CA .  14 . C 1 1 
        20 . 1 1  14 ILE N 1 1  14 ILE CA 1 1  14 ILE C  1 1  15 ILE N  -57.699997      -17.7 .  14 . N .  14 . CA .  14 . C  .  15 . N 1 1 
        21 . 1 1  14 ILE C 1 1  15 ILE N  1 1  15 ILE CA 1 1  15 ILE C       -84.4      -44.4 .  14 . C .  15 . N  .  15 . CA .  15 . C 1 1 
        22 . 1 1  15 ILE N 1 1  15 ILE CA 1 1  15 ILE C  1 1  16 SER N  -60.299995      -20.3 .  15 . N .  15 . CA .  15 . C  .  16 . N 1 1 
        23 . 1 1  15 ILE C 1 1  16 SER N  1 1  16 SER CA 1 1  16 SER C       -81.6      -41.6 .  15 . C .  16 . N  .  16 . CA .  16 . C 1 1 
        24 . 1 1  16 SER N 1 1  16 SER CA 1 1  16 SER C  1 1  17 SER N       -59.9 -19.899998 .  16 . N .  16 . CA .  16 . C  .  17 . N 1 1 
        25 . 1 1  16 SER C 1 1  17 SER N  1 1  17 SER CA 1 1  17 SER C       -88.0 -47.999996 .  16 . C .  17 . N  .  17 . CA .  17 . C 1 1 
        26 . 1 1  17 SER N 1 1  17 SER CA 1 1  17 SER C  1 1  18 VAL N       -60.0      -20.0 .  17 . N .  17 . CA .  17 . C  .  18 . N 1 1 
        27 . 1 1  17 SER C 1 1  18 VAL N  1 1  18 VAL CA 1 1  18 VAL C   -86.19999      -46.2 .  17 . C .  18 . N  .  18 . CA .  18 . C 1 1 
        28 . 1 1  18 VAL N 1 1  18 VAL CA 1 1  18 VAL C  1 1  19 GLN N  -63.500004      -23.5 .  18 . N .  18 . CA .  18 . C  .  19 . N 1 1 
        29 . 1 1  18 VAL C 1 1  19 GLN N  1 1  19 GLN CA 1 1  19 GLN C       -83.0      -43.0 .  18 . C .  19 . N  .  19 . CA .  19 . C 1 1 
        30 . 1 1  19 GLN N 1 1  19 GLN CA 1 1  19 GLN C  1 1  20 GLU N  -59.099995      -19.1 .  19 . N .  19 . CA .  19 . C  .  20 . N 1 1 
        31 . 1 1  19 GLN C 1 1  20 GLU N  1 1  20 GLU CA 1 1  20 GLU C       -82.0      -42.0 .  19 . C .  20 . N  .  20 . CA .  20 . C 1 1 
        32 . 1 1  20 GLU N 1 1  20 GLU CA 1 1  20 GLU C  1 1  21 ARG N       -65.2      -25.2 .  20 . N .  20 . CA .  20 . C  .  21 . N 1 1 
        33 . 1 1  20 GLU C 1 1  21 ARG N  1 1  21 ARG CA 1 1  21 ARG C       -86.6      -46.6 .  20 . C .  21 . N  .  21 . CA .  21 . C 1 1 
        34 . 1 1  21 ARG N 1 1  21 ARG CA 1 1  21 ARG C  1 1  22 ALA N       -61.5      -21.5 .  21 . N .  21 . CA .  21 . C  .  22 . N 1 1 
        35 . 1 1  21 ARG C 1 1  22 ALA N  1 1  22 ALA CA 1 1  22 ALA C       -83.3      -43.3 .  21 . C .  22 . N  .  22 . CA .  22 . C 1 1 
        36 . 1 1  22 ALA N 1 1  22 ALA CA 1 1  22 ALA C  1 1  23 LYS N       -59.6      -19.6 .  22 . N .  22 . CA .  22 . C  .  23 . N 1 1 
        37 . 1 1  22 ALA C 1 1  23 LYS N  1 1  23 LYS CA 1 1  23 LYS C       -82.6      -42.6 .  22 . C .  23 . N  .  23 . CA .  23 . C 1 1 
        38 . 1 1  23 LYS N 1 1  23 LYS CA 1 1  23 LYS C  1 1  24 HIS N       -63.3       -2.6 .  23 . N .  23 . CA .  23 . C  .  24 . N 1 1 
        39 . 1 1  23 LYS C 1 1  24 HIS N  1 1  24 HIS CA 1 1  24 HIS C       -86.8      -46.8 .  23 . C .  24 . N  .  24 . CA .  24 . C 1 1 
        40 . 1 1  24 HIS N 1 1  24 HIS CA 1 1  24 HIS C  1 1  25 ASN N       -57.0 -11.999999 .  24 . N .  24 . CA .  24 . C  .  25 . N 1 1 
        41 . 1 1  24 HIS C 1 1  25 ASN N  1 1  25 ASN CA 1 1  25 ASN C       -98.3      -57.2 .  24 . C .  25 . N  .  25 . CA .  25 . C 1 1 
        42 . 1 1  25 ASN N 1 1  25 ASN CA 1 1  25 ASN C  1 1  26 TYR N       -64.0       -5.6 .  25 . N .  25 . CA .  25 . C  .  26 . N 1 1 
        43 . 1 1  29 ARG C 1 1  30 GLU N  1 1  30 GLU CA 1 1  30 GLU C      -151.3      -11.3 .  29 . C .  30 . N  .  30 . CA .  30 . C 1 1 
        44 . 1 1  30 GLU N 1 1  30 GLU CA 1 1  30 GLU C  1 1  31 ILE N    83.69999      173.9 .  30 . N .  30 . CA .  30 . C  .  31 . N 1 1 
        45 . 1 1  30 GLU C 1 1  31 ILE N  1 1  31 ILE CA 1 1  31 ILE C      -141.9      -81.6 .  30 . C .  31 . N  .  31 . CA .  31 . C 1 1 
        46 . 1 1  31 ILE N 1 1  31 ILE CA 1 1  31 ILE C  1 1  32 ARG N       107.5      158.3 .  31 . N .  31 . CA .  31 . C  .  32 . N 1 1 
        47 . 1 1  31 ILE C 1 1  32 ARG N  1 1  32 ARG CA 1 1  32 ARG C      -151.9     -104.8 .  31 . C .  32 . N  .  32 . CA .  32 . C 1 1 
        48 . 1 1  32 ARG N 1 1  32 ARG CA 1 1  32 ARG C  1 1  33 THR N  120.299995      181.8 .  32 . N .  32 . CA .  32 . C  .  33 . N 1 1 
        49 . 1 1  32 ARG C 1 1  33 THR N  1 1  33 THR CA 1 1  33 THR C  -162.99998      -63.0 .  32 . C .  33 . N  .  33 . CA .  33 . C 1 1 
        50 . 1 1  33 THR N 1 1  33 THR CA 1 1  33 THR C  1 1  34 ALA N        97.2      167.5 .  33 . N .  33 . CA .  33 . C  .  34 . N 1 1 
        51 . 1 1  33 THR C 1 1  34 ALA N  1 1  34 ALA CA 1 1  34 ALA C      -139.0      -79.5 .  33 . C .  34 . N  .  34 . CA .  34 . C 1 1 
        52 . 1 1  34 ALA N 1 1  34 ALA CA 1 1  34 ALA C  1 1  35 THR N       107.4      168.1 .  34 . N .  34 . CA .  34 . C  .  35 . N 1 1 
        53 . 1 1  36 SER C 1 1  37 SER N  1 1  37 SER CA 1 1  37 SER C       -82.8 -42.799995 .  36 . C .  37 . N  .  37 . CA .  37 . C 1 1 
        54 . 1 1  37 SER N 1 1  37 SER CA 1 1  37 SER C  1 1  38 GLN N       -56.3      -16.3 .  37 . N .  37 . CA .  37 . C  .  38 . N 1 1 
        55 . 1 1  37 SER C 1 1  38 GLN N  1 1  38 GLN CA 1 1  38 GLN C       -87.9      -47.9 .  37 . C .  38 . N  .  38 . CA .  38 . C 1 1 
        56 . 1 1  38 GLN N 1 1  38 GLN CA 1 1  38 GLN C  1 1  39 ASP N       -61.7      -21.7 .  38 . N .  38 . CA .  38 . C  .  39 . N 1 1 
        57 . 1 1  38 GLN C 1 1  39 ASP N  1 1  39 ASP CA 1 1  39 ASP C       -83.3      -43.3 .  38 . C .  39 . N  .  39 . CA .  39 . C 1 1 
        58 . 1 1  39 ASP N 1 1  39 ASP CA 1 1  39 ASP C  1 1  40 ILE N       -65.5 -25.499998 .  39 . N .  39 . CA .  39 . C  .  40 . N 1 1 
        59 . 1 1  39 ASP C 1 1  40 ILE N  1 1  40 ILE CA 1 1  40 ILE C       -82.8 -42.799995 .  39 . C .  40 . N  .  40 . CA .  40 . C 1 1 
        60 . 1 1  40 ILE N 1 1  40 ILE CA 1 1  40 ILE C  1 1  41 ARG N   -65.09999      -25.1 .  40 . N .  40 . CA .  40 . C  .  41 . N 1 1 
        61 . 1 1  40 ILE C 1 1  41 ARG N  1 1  41 ARG CA 1 1  41 ARG C       -82.6      -42.6 .  40 . C .  41 . N  .  41 . CA .  41 . C 1 1 
        62 . 1 1  41 ARG N 1 1  41 ARG CA 1 1  41 ARG C  1 1  42 ASP N  -60.999996      -21.0 .  41 . N .  41 . CA .  41 . C  .  42 . N 1 1 
        63 . 1 1  41 ARG C 1 1  42 ASP N  1 1  42 ASP CA 1 1  42 ASP C       -85.8      -45.8 .  41 . C .  42 . N  .  42 . CA .  42 . C 1 1 
        64 . 1 1  42 ASP N 1 1  42 ASP CA 1 1  42 ASP C  1 1  43 ILE N       -59.2      -19.2 .  42 . N .  42 . CA .  42 . C  .  43 . N 1 1 
        65 . 1 1  42 ASP C 1 1  43 ILE N  1 1  43 ILE CA 1 1  43 ILE C       -90.2      -45.6 .  42 . C .  43 . N  .  43 . CA .  43 . C 1 1 
        66 . 1 1  43 ILE N 1 1  43 ILE CA 1 1  43 ILE C  1 1  44 ILE N       -60.9      -20.9 .  43 . N .  43 . CA .  43 . C  .  44 . N 1 1 
        67 . 1 1  43 ILE C 1 1  44 ILE N  1 1  44 ILE CA 1 1  44 ILE C       -84.7 -44.699997 .  43 . C .  44 . N  .  44 . CA .  44 . C 1 1 
        68 . 1 1  44 ILE N 1 1  44 ILE CA 1 1  44 ILE C  1 1  45 LYS N       -66.0      -26.0 .  44 . N .  44 . CA .  44 . C  .  45 . N 1 1 
        69 . 1 1  44 ILE C 1 1  45 LYS N  1 1  45 LYS CA 1 1  45 LYS C       -80.0      -40.0 .  44 . C .  45 . N  .  45 . CA .  45 . C 1 1 
        70 . 1 1  45 LYS N 1 1  45 LYS CA 1 1  45 LYS C  1 1  46 SER N  -59.400005      -18.7 .  45 . N .  45 . CA .  45 . C  .  46 . N 1 1 
        71 . 1 1  45 LYS C 1 1  46 SER N  1 1  46 SER CA 1 1  46 SER C       -84.7 -44.699997 .  45 . C .  46 . N  .  46 . CA .  46 . C 1 1 
        72 . 1 1  46 SER N 1 1  46 SER CA 1 1  46 SER C  1 1  47 MET N  -61.999996      -22.0 .  46 . N .  46 . CA .  46 . C  .  47 . N 1 1 
        73 . 1 1  46 SER C 1 1  47 MET N  1 1  47 MET CA 1 1  47 MET C       -83.1 -43.099995 .  46 . C .  47 . N  .  47 . CA .  47 . C 1 1 
        74 . 1 1  47 MET N 1 1  47 MET CA 1 1  47 MET C  1 1  48 LYS N       -68.7      -19.6 .  47 . N .  47 . CA .  47 . C  .  48 . N 1 1 
        75 . 1 1  47 MET C 1 1  48 LYS N  1 1  48 LYS CA 1 1  48 LYS C       -85.5      -45.5 .  47 . C .  48 . N  .  48 . CA .  48 . C 1 1 
        76 . 1 1  48 LYS N 1 1  48 LYS CA 1 1  48 LYS C  1 1  49 ASP N       -54.7       -8.0 .  48 . N .  48 . CA .  48 . C  .  49 . N 1 1 
        77 . 1 1  48 LYS C 1 1  49 ASP N  1 1  49 ASP CA 1 1  49 ASP C       -90.5      -50.5 .  48 . C .  49 . N  .  49 . CA .  49 . C 1 1 
        78 . 1 1  49 ASP N 1 1  49 ASP CA 1 1  49 ASP C  1 1  50 ASN N       -60.7       -2.1 .  49 . N .  49 . CA .  49 . C  .  50 . N 1 1 
        79 . 1 1  53 PRO C 1 1  54 LEU N  1 1  54 LEU CA 1 1  54 LEU C      -157.8      -79.5 .  53 . C .  54 . N  .  54 . CA .  54 . C 1 1 
        80 . 1 1  54 LEU N 1 1  54 LEU CA 1 1  54 LEU C  1 1  55 VAL N   118.19999      175.1 .  54 . N .  54 . CA .  54 . C  .  55 . N 1 1 
        81 . 1 1  54 LEU C 1 1  55 VAL N  1 1  55 VAL CA 1 1  55 VAL C      -140.4      -82.2 .  54 . C .  55 . N  .  55 . CA .  55 . C 1 1 
        82 . 1 1  55 VAL N 1 1  55 VAL CA 1 1  55 VAL C  1 1  56 VAL N       103.4  143.39998 .  55 . N .  55 . CA .  55 . C  .  56 . N 1 1 
        83 . 1 1  55 VAL C 1 1  56 VAL N  1 1  56 VAL CA 1 1  56 VAL C      -137.7      -90.8 .  55 . C .  56 . N  .  56 . CA .  56 . C 1 1 
        84 . 1 1  56 VAL N 1 1  56 VAL CA 1 1  56 VAL C  1 1  57 PHE N        92.7      181.8 .  56 . N .  56 . CA .  56 . C  .  57 . N 1 1 
        85 . 1 1  56 VAL C 1 1  57 PHE N  1 1  57 PHE CA 1 1  57 PHE C -120.299995      -76.6 .  56 . C .  57 . N  .  57 . CA .  57 . C 1 1 
        86 . 1 1  57 PHE N 1 1  57 PHE CA 1 1  57 PHE C  1 1  58 VAL N       110.4      152.2 .  57 . N .  57 . CA .  57 . C  .  58 . N 1 1 
        87 . 1 1  57 PHE C 1 1  58 VAL N  1 1  58 VAL CA 1 1  58 VAL C      -118.1      -45.1 .  57 . C .  58 . N  .  58 . CA .  58 . C 1 1 
        88 . 1 1  58 VAL N 1 1  58 VAL CA 1 1  58 VAL C  1 1  59 ASN N        91.8      164.1 .  58 . N .  58 . CA .  58 . C  .  59 . N 1 1 
        89 . 1 1  58 VAL C 1 1  59 ASN N  1 1  59 ASN CA 1 1  59 ASN C      -177.6      -37.6 .  58 . C .  59 . N  .  59 . CA .  59 . C 1 1 
        90 . 1 1  59 ASN N 1 1  59 ASN CA 1 1  59 ASN C  1 1  60 GLY N        77.1      165.9 .  59 . N .  59 . CA .  59 . C  .  60 . N 1 1 
        91 . 1 1  62 SER C 1 1  63 GLN N  1 1  63 GLN CA 1 1  63 GLN C      -106.6      -26.7 .  62 . C .  63 . N  .  63 . CA .  63 . C 1 1 
        92 . 1 1  63 GLN N 1 1  63 GLN CA 1 1  63 GLN C  1 1  64 ASN N       -65.5       11.1 .  63 . N .  63 . CA .  63 . C  .  64 . N 1 1 
        93 . 1 1  63 GLN C 1 1  64 ASN N  1 1  64 ASN CA 1 1  64 ASN C       -86.6      -46.6 .  63 . C .  64 . N  .  64 . CA .  64 . C 1 1 
        94 . 1 1  64 ASN N 1 1  64 ASN CA 1 1  64 ASN C  1 1  65 ASP N       -59.7      -19.7 .  64 . N .  64 . CA .  64 . C  .  65 . N 1 1 
        95 . 1 1  64 ASN C 1 1  65 ASP N  1 1  65 ASP CA 1 1  65 ASP C       -85.8      -45.8 .  64 . C .  65 . N  .  65 . CA .  65 . C 1 1 
        96 . 1 1  65 ASP N 1 1  65 ASP CA 1 1  65 ASP C  1 1  66 VAL N  -62.599995      -22.6 .  65 . N .  65 . CA .  65 . C  .  66 . N 1 1 
        97 . 1 1  65 ASP C 1 1  66 VAL N  1 1  66 VAL CA 1 1  66 VAL C       -82.3      -42.3 .  65 . C .  66 . N  .  66 . CA .  66 . C 1 1 
        98 . 1 1  66 VAL N 1 1  66 VAL CA 1 1  66 VAL C  1 1  67 ASN N       -65.9      -25.9 .  66 . N .  66 . CA .  66 . C  .  67 . N 1 1 
        99 . 1 1  66 VAL C 1 1  67 ASN N  1 1  67 ASN CA 1 1  67 ASN C   -81.49999      -41.5 .  66 . C .  67 . N  .  67 . CA .  67 . C 1 1 
       100 . 1 1  67 ASN N 1 1  67 ASN CA 1 1  67 ASN C  1 1  68 GLU N       -63.0      -23.0 .  67 . N .  67 . CA .  67 . C  .  68 . N 1 1 
       101 . 1 1  67 ASN C 1 1  68 GLU N  1 1  68 GLU CA 1 1  68 GLU C       -84.0      -44.0 .  67 . C .  68 . N  .  68 . CA .  68 . C 1 1 
       102 . 1 1  68 GLU N 1 1  68 GLU CA 1 1  68 GLU C  1 1  69 PHE N  -62.599995      -22.6 .  68 . N .  68 . CA .  68 . C  .  69 . N 1 1 
       103 . 1 1  68 GLU C 1 1  69 PHE N  1 1  69 PHE CA 1 1  69 PHE C       -83.0      -43.0 .  68 . C .  69 . N  .  69 . CA .  69 . C 1 1 
       104 . 1 1  69 PHE N 1 1  69 PHE CA 1 1  69 PHE C  1 1  70 GLN N  -63.599995      -23.6 .  69 . N .  69 . CA .  69 . C  .  70 . N 1 1 
       105 . 1 1  69 PHE C 1 1  70 GLN N  1 1  70 GLN CA 1 1  70 GLN C       -80.0      -40.0 .  69 . C .  70 . N  .  70 . CA .  70 . C 1 1 
       106 . 1 1  70 GLN N 1 1  70 GLN CA 1 1  70 GLN C  1 1  71 ASN N  -62.899998      -22.9 .  70 . N .  70 . CA .  70 . C  .  71 . N 1 1 
       107 . 1 1  70 GLN C 1 1  71 ASN N  1 1  71 ASN CA 1 1  71 ASN C       -84.5      -44.5 .  70 . C .  71 . N  .  71 . CA .  71 . C 1 1 
       108 . 1 1  71 ASN N 1 1  71 ASN CA 1 1  71 ASN C  1 1  72 GLU N       -58.2      -18.2 .  71 . N .  71 . CA .  71 . C  .  72 . N 1 1 
       109 . 1 1  71 ASN C 1 1  72 GLU N  1 1  72 GLU CA 1 1  72 GLU C       -84.7 -44.699997 .  71 . C .  72 . N  .  72 . CA .  72 . C 1 1 
       110 . 1 1  72 GLU N 1 1  72 GLU CA 1 1  72 GLU C  1 1  73 ALA N       -63.3      -23.3 .  72 . N .  72 . CA .  72 . C  .  73 . N 1 1 
       111 . 1 1  72 GLU C 1 1  73 ALA N  1 1  73 ALA CA 1 1  73 ALA C       -82.1      -42.1 .  72 . C .  73 . N  .  73 . CA .  73 . C 1 1 
       112 . 1 1  73 ALA N 1 1  73 ALA CA 1 1  73 ALA C  1 1  74 LYS N       -61.5      -21.5 .  73 . N .  73 . CA .  73 . C  .  74 . N 1 1 
       113 . 1 1  73 ALA C 1 1  74 LYS N  1 1  74 LYS CA 1 1  74 LYS C       -86.5      -46.5 .  73 . C .  74 . N  .  74 . CA .  74 . C 1 1 
       114 . 1 1  74 LYS N 1 1  74 LYS CA 1 1  74 LYS C  1 1  75 LYS N       -60.0      -20.0 .  74 . N .  74 . CA .  74 . C  .  75 . N 1 1 
       115 . 1 1  74 LYS C 1 1  75 LYS N  1 1  75 LYS CA 1 1  75 LYS C       -86.4      -46.4 .  74 . C .  75 . N  .  75 . CA .  75 . C 1 1 
       116 . 1 1  75 LYS N 1 1  75 LYS CA 1 1  75 LYS C  1 1  76 GLU N       -54.2      -14.2 .  75 . N .  75 . CA .  75 . C  .  76 . N 1 1 
       117 . 1 1  75 LYS C 1 1  76 GLU N  1 1  76 GLU CA 1 1  76 GLU C      -105.3      -65.3 .  75 . C .  76 . N  .  76 . CA .  76 . C 1 1 
       118 . 1 1  76 GLU N 1 1  76 GLU CA 1 1  76 GLU C  1 1  77 GLY N       -34.5       18.0 .  76 . N .  76 . CA .  76 . C  .  77 . N 1 1 
       119 . 1 1  78 VAL C 1 1  79 SER N  1 1  79 SER CA 1 1  79 SER C  -126.49999      -56.9 .  78 . C .  79 . N  .  79 . CA .  79 . C 1 1 
       120 . 1 1  79 SER N 1 1  79 SER CA 1 1  79 SER C  1 1  80 TYR N        92.1      169.1 .  79 . N .  79 . CA .  79 . C  .  80 . N 1 1 
       121 . 1 1  79 SER C 1 1  80 TYR N  1 1  80 TYR CA 1 1  80 TYR C      -173.6      -84.9 .  79 . C .  80 . N  .  80 . CA .  80 . C 1 1 
       122 . 1 1  80 TYR N 1 1  80 TYR CA 1 1  80 TYR C  1 1  81 ASP N       136.2  176.19998 .  80 . N .  80 . CA .  80 . C  .  81 . N 1 1 
       123 . 1 1  80 TYR C 1 1  81 ASP N  1 1  81 ASP CA 1 1  81 ASP C      -168.8      -91.7 .  80 . C .  81 . N  .  81 . CA .  81 . C 1 1 
       124 . 1 1  81 ASP N 1 1  81 ASP CA 1 1  81 ASP C  1 1  82 VAL N   123.09999      174.3 .  81 . N .  81 . CA .  81 . C  .  82 . N 1 1 
       125 . 1 1  81 ASP C 1 1  82 VAL N  1 1  82 VAL CA 1 1  82 VAL C      -157.0 -85.299995 .  81 . C .  82 . N  .  82 . CA .  82 . C 1 1 
       126 . 1 1  82 VAL N 1 1  82 VAL CA 1 1  82 VAL C  1 1  83 LEU N       103.0  147.19998 .  82 . N .  82 . CA .  82 . C  .  83 . N 1 1 
       127 . 1 1  82 VAL C 1 1  83 LEU N  1 1  83 LEU CA 1 1  83 LEU C      -134.8      -81.1 .  82 . C .  83 . N  .  83 . CA .  83 . C 1 1 
       128 . 1 1  83 LEU N 1 1  83 LEU CA 1 1  83 LEU C  1 1  84 LYS N   97.899994      147.0 .  83 . N .  83 . CA .  83 . C  .  84 . N 1 1 
       129 . 1 1  83 LEU C 1 1  84 LYS N  1 1  84 LYS CA 1 1  84 LYS C  -140.89998      -92.5 .  83 . C .  84 . N  .  84 . CA .  84 . C 1 1 
       130 . 1 1  84 LYS N 1 1  84 LYS CA 1 1  84 LYS C  1 1  85 SER N       101.6      172.6 .  84 . N .  84 . CA .  84 . C  .  85 . N 1 1 
       131 . 1 1  84 LYS C 1 1  85 SER N  1 1  85 SER CA 1 1  85 SER C      -171.5      -44.3 .  84 . C .  85 . N  .  85 . CA .  85 . C 1 1 
       132 . 1 1  85 SER N 1 1  85 SER CA 1 1  85 SER C  1 1  86 THR N       118.0      181.6 .  85 . N .  85 . CA .  85 . C  .  86 . N 1 1 
       133 . 1 1  88 PRO C 1 1  89 GLU N  1 1  89 GLU CA 1 1  89 GLU C       -87.0      -47.0 .  88 . C .  89 . N  .  89 . CA .  89 . C 1 1 
       134 . 1 1  89 GLU N 1 1  89 GLU CA 1 1  89 GLU C  1 1  90 GLU N       -54.6      -14.6 .  89 . N .  89 . CA .  89 . C  .  90 . N 1 1 
       135 . 1 1  89 GLU C 1 1  90 GLU N  1 1  90 GLU CA 1 1  90 GLU C       -82.2      -42.2 .  89 . C .  90 . N  .  90 . CA .  90 . C 1 1 
       136 . 1 1  90 GLU N 1 1  90 GLU CA 1 1  90 GLU C  1 1  91 LEU N       -56.3      -16.3 .  90 . N .  90 . CA .  90 . C  .  91 . N 1 1 
       137 . 1 1  90 GLU C 1 1  91 LEU N  1 1  91 LEU CA 1 1  91 LEU C       -85.7      -45.7 .  90 . C .  91 . N  .  91 . CA .  91 . C 1 1 
       138 . 1 1  91 LEU N 1 1  91 LEU CA 1 1  91 LEU C  1 1  92 THR N  -58.300003      -18.3 .  91 . N .  91 . CA .  91 . C  .  92 . N 1 1 
       139 . 1 1  91 LEU C 1 1  92 THR N  1 1  92 THR CA 1 1  92 THR C       -83.1 -43.099995 .  91 . C .  92 . N  .  92 . CA .  92 . C 1 1 
       140 . 1 1  92 THR N 1 1  92 THR CA 1 1  92 THR C  1 1  93 GLN N       -62.3      -22.3 .  92 . N .  92 . CA .  92 . C  .  93 . N 1 1 
       141 . 1 1  92 THR C 1 1  93 GLN N  1 1  93 GLN CA 1 1  93 GLN C  -85.299995      -45.3 .  92 . C .  93 . N  .  93 . CA .  93 . C 1 1 
       142 . 1 1  93 GLN N 1 1  93 GLN CA 1 1  93 GLN C  1 1  94 ARG N       -58.9      -18.9 .  93 . N .  93 . CA .  93 . C  .  94 . N 1 1 
       143 . 1 1  93 GLN C 1 1  94 ARG N  1 1  94 ARG CA 1 1  94 ARG C       -85.4      -45.4 .  93 . C .  94 . N  .  94 . CA .  94 . C 1 1 
       144 . 1 1  94 ARG N 1 1  94 ARG CA 1 1  94 ARG C  1 1  95 VAL N  -62.700005      -22.7 .  94 . N .  94 . CA .  94 . C  .  95 . N 1 1 
       145 . 1 1  94 ARG C 1 1  95 VAL N  1 1  95 VAL CA 1 1  95 VAL C       -83.5      -43.5 .  94 . C .  95 . N  .  95 . CA .  95 . C 1 1 
       146 . 1 1  95 VAL N 1 1  95 VAL CA 1 1  95 VAL C  1 1  96 ARG N       -64.1      -24.1 .  95 . N .  95 . CA .  95 . C  .  96 . N 1 1 
       147 . 1 1  95 VAL C 1 1  96 ARG N  1 1  96 ARG CA 1 1  96 ARG C       -82.0      -42.0 .  95 . C .  96 . N  .  96 . CA .  96 . C 1 1 
       148 . 1 1  96 ARG N 1 1  96 ARG CA 1 1  96 ARG C  1 1  97 GLU N       -59.0      -19.0 .  96 . N .  96 . CA .  96 . C  .  97 . N 1 1 
       149 . 1 1  96 ARG C 1 1  97 GLU N  1 1  97 GLU CA 1 1  97 GLU C       -87.2      -47.2 .  96 . C .  97 . N  .  97 . CA .  97 . C 1 1 
       150 . 1 1  97 GLU N 1 1  97 GLU CA 1 1  97 GLU C  1 1  98 PHE N       -61.3      -21.3 .  97 . N .  97 . CA .  97 . C  .  98 . N 1 1 
       151 . 1 1  97 GLU C 1 1  98 PHE N  1 1  98 PHE CA 1 1  98 PHE C       -83.8      -43.8 .  97 . C .  98 . N  .  98 . CA .  98 . C 1 1 
       152 . 1 1  98 PHE N 1 1  98 PHE CA 1 1  98 PHE C  1 1  99 LEU N       -64.5      -24.5 .  98 . N .  98 . CA .  98 . C  .  99 . N 1 1 
       153 . 1 1  98 PHE C 1 1  99 LEU N  1 1  99 LEU CA 1 1  99 LEU C       -84.4      -44.4 .  98 . C .  99 . N  .  99 . CA .  99 . C 1 1 
       154 . 1 1  99 LEU N 1 1  99 LEU CA 1 1  99 LEU C  1 1 100 LYS N       -73.1  5.9999995 .  99 . N .  99 . CA .  99 . C  . 100 . N 1 1 
       155 . 1 1  99 LEU C 1 1 100 LYS N  1 1 100 LYS CA 1 1 100 LYS C       -86.5      -46.5 .  99 . C . 100 . N  . 100 . CA . 100 . C 1 1 
       156 . 1 1 100 LYS N 1 1 100 LYS CA 1 1 100 LYS C  1 1 101 THR N       -55.3 -15.299999 . 100 . N . 100 . CA . 100 . C  . 101 . N 1 1 
       157 . 1 1 100 LYS C 1 1 101 THR N  1 1 101 THR CA 1 1 101 THR C       -83.1 -43.099995 . 100 . C . 101 . N  . 101 . CA . 101 . C 1 1 
       158 . 1 1 101 THR N 1 1 101 THR CA 1 1 101 THR C  1 1 102 ALA N  -63.500004      -20.1 . 101 . N . 101 . CA . 101 . C  . 102 . N 1 1 
       159 . 1 1 101 THR C 1 1 102 ALA N  1 1 102 ALA CA 1 1 102 ALA C       -82.2      -37.9 . 101 . C . 102 . N  . 102 . CA . 102 . C 1 1 
       160 . 1 1 102 ALA N 1 1 102 ALA CA 1 1 102 ALA C  1 1 103 GLY N  -58.499996      -18.5 . 102 . N . 102 . CA . 102 . C  . 103 . N 1 1 
    stop_

save_


save_conformer_family_coord_set_1
    _Conformer_family_coord_set.Sf_category  conformer_family_coord_set
    _Conformer_family_coord_set.Entry_ID     1
    _Conformer_family_coord_set.ID           1

    loop_
       _Atom_site.Model_ID
       _Atom_site.ID
       _Atom_site.Label_entity_assembly_ID
       _Atom_site.Label_entity_ID
       _Atom_site.Label_comp_index_ID
       _Atom_site.Label_comp_ID
       _Atom_site.Label_atom_ID
       _Atom_site.Type_symbol
       _Atom_site.Cartn_x
       _Atom_site.Cartn_y
       _Atom_site.Cartn_z
       _Atom_site.Occupancy
       _Atom_site.Uncertainty
       _Atom_site.PDBX_label_asym_ID
       _Atom_site.PDB_strand_ID
       _Atom_site.PDB_ins_code
       _Atom_site.PDB_residue_no
       _Atom_site.PDB_residue_name
       _Atom_site.PDB_atom_name
       _Atom_site.Entry_ID
       _Atom_site.Conformer_family_coord_set_ID

        1     1 1 1   1 MET C    C   5.348  14.038  -1.349 1.00 . A A .   1 MET C    1 1 
        1     2 1 1   1 MET CA   C   6.879  14.166  -1.288 1.00 . A A .   1 MET CA   1 1 
        1     3 1 1   1 MET CB   C   7.325  15.271  -0.295 1.00 . A A .   1 MET CB   1 1 
        1     4 1 1   1 MET CE   C   6.057  13.866   3.443 1.00 . A A .   1 MET CE   1 1 
        1     5 1 1   1 MET CG   C   6.680  15.198   1.099 1.00 . A A .   1 MET CG   1 1 
        1     6 1 1   1 MET H1   H   7.176  13.690  -3.290 1.00 . A A .   1 MET H1   1 1 
        1     7 1 1   1 MET H2   H   8.453  14.539  -2.585 1.00 . A A .   1 MET H2   1 1 
        1     8 1 1   1 MET H3   H   7.026  15.346  -2.991 1.00 . A A .   1 MET H3   1 1 
        1     9 1 1   1 MET HA   H   7.294  13.215  -0.972 1.00 . A A .   1 MET HA   1 1 
        1    10 1 1   1 MET HB2  H   8.399  15.202  -0.169 1.00 . A A .   1 MET HB2  1 1 
        1    11 1 1   1 MET HB3  H   7.095  16.242  -0.725 1.00 . A A .   1 MET HB3  1 1 
        1    12 1 1   1 MET HE1  H   6.155  12.989   4.066 1.00 . A A .   1 MET HE1  1 1 
        1    13 1 1   1 MET HE2  H   5.010  14.043   3.235 1.00 . A A .   1 MET HE2  1 1 
        1    14 1 1   1 MET HE3  H   6.472  14.720   3.958 1.00 . A A .   1 MET HE3  1 1 
        1    15 1 1   1 MET HG2  H   7.104  15.976   1.726 1.00 . A A .   1 MET HG2  1 1 
        1    16 1 1   1 MET HG3  H   5.614  15.365   1.002 1.00 . A A .   1 MET HG3  1 1 
        1    17 1 1   1 MET N    N   7.424  14.454  -2.631 1.00 . A A .   1 MET N    1 1 
        1    18 1 1   1 MET O    O   4.678  14.826  -2.027 1.00 . A A .   1 MET O    1 1 
        1    19 1 1   1 MET SD   S   6.942  13.606   1.907 1.00 . A A .   1 MET SD   1 1 
        1    20 1 1   2 GLY C    C   2.982  11.906   0.584 1.00 . A A .   2 GLY C    1 1 
        1    21 1 1   2 GLY CA   C   3.376  12.757  -0.616 1.00 . A A .   2 GLY CA   1 1 
        1    22 1 1   2 GLY H    H   5.410  12.468  -0.104 1.00 . A A .   2 GLY H    1 1 
        1    23 1 1   2 GLY HA2  H   2.833  13.693  -0.571 1.00 . A A .   2 GLY HA2  1 1 
        1    24 1 1   2 GLY HA3  H   3.108  12.237  -1.526 1.00 . A A .   2 GLY HA3  1 1 
        1    25 1 1   2 GLY N    N   4.812  13.032  -0.641 1.00 . A A .   2 GLY N    1 1 
        1    26 1 1   2 GLY O    O   3.548  12.069   1.676 1.00 . A A .   2 GLY O    1 1 
        1    27 1 1   3 LYS C    C   1.049   8.756   0.824 1.00 . A A .   3 LYS C    1 1 
        1    28 1 1   3 LYS CA   C   1.535  10.083   1.442 1.00 . A A .   3 LYS CA   1 1 
        1    29 1 1   3 LYS CB   C   0.429  10.774   2.273 1.00 . A A .   3 LYS CB   1 1 
        1    30 1 1   3 LYS CD   C  -1.172  10.651   4.316 1.00 . A A .   3 LYS CD   1 1 
        1    31 1 1   3 LYS CE   C  -2.386  11.247   3.565 1.00 . A A .   3 LYS CE   1 1 
        1    32 1 1   3 LYS CG   C  -0.152   9.917   3.420 1.00 . A A .   3 LYS CG   1 1 
        1    33 1 1   3 LYS H    H   1.636  10.897  -0.516 1.00 . A A .   3 LYS H    1 1 
        1    34 1 1   3 LYS HA   H   2.378   9.857   2.096 1.00 . A A .   3 LYS HA   1 1 
        1    35 1 1   3 LYS HB2  H   0.839  11.684   2.702 1.00 . A A .   3 LYS HB2  1 1 
        1    36 1 1   3 LYS HB3  H  -0.385  11.050   1.609 1.00 . A A .   3 LYS HB3  1 1 
        1    37 1 1   3 LYS HD2  H  -1.542   9.950   5.058 1.00 . A A .   3 LYS HD2  1 1 
        1    38 1 1   3 LYS HD3  H  -0.658  11.456   4.833 1.00 . A A .   3 LYS HD3  1 1 
        1    39 1 1   3 LYS HE2  H  -2.765  10.518   2.858 1.00 . A A .   3 LYS HE2  1 1 
        1    40 1 1   3 LYS HE3  H  -3.168  11.471   4.284 1.00 . A A .   3 LYS HE3  1 1 
        1    41 1 1   3 LYS HG2  H  -0.639   9.050   2.992 1.00 . A A .   3 LYS HG2  1 1 
        1    42 1 1   3 LYS HG3  H   0.672   9.576   4.044 1.00 . A A .   3 LYS HG3  1 1 
        1    43 1 1   3 LYS HZ1  H  -1.410  13.089   3.392 1.00 . A A .   3 LYS HZ1  1 1 
        1    44 1 1   3 LYS HZ2  H  -2.916  13.041   2.627 1.00 . A A .   3 LYS HZ2  1 1 
        1    45 1 1   3 LYS HZ3  H  -1.588  12.275   1.922 1.00 . A A .   3 LYS HZ3  1 1 
        1    46 1 1   3 LYS N    N   2.024  10.984   0.384 1.00 . A A .   3 LYS N    1 1 
        1    47 1 1   3 LYS NZ   N  -2.054  12.501   2.827 1.00 . A A .   3 LYS NZ   1 1 
        1    48 1 1   3 LYS O    O   0.607   8.721  -0.339 1.00 . A A .   3 LYS O    1 1 
        1    49 1 1   4 VAL C    C   0.064   5.482   2.215 1.00 . A A .   4 VAL C    1 1 
        1    50 1 1   4 VAL CA   C   0.834   6.298   1.141 1.00 . A A .   4 VAL CA   1 1 
        1    51 1 1   4 VAL CB   C   2.160   5.566   0.729 1.00 . A A .   4 VAL CB   1 1 
        1    52 1 1   4 VAL CG1  C   3.107   5.389   1.920 1.00 . A A .   4 VAL CG1  1 1 
        1    53 1 1   4 VAL CG2  C   1.889   4.218   0.041 1.00 . A A .   4 VAL CG2  1 1 
        1    54 1 1   4 VAL H    H   1.432   7.777   2.543 1.00 . A A .   4 VAL H    1 1 
        1    55 1 1   4 VAL HA   H   0.202   6.380   0.256 1.00 . A A .   4 VAL HA   1 1 
        1    56 1 1   4 VAL HB   H   2.666   6.205   0.016 1.00 . A A .   4 VAL HB   1 1 
        1    57 1 1   4 VAL HG11 H   4.043   4.963   1.580 1.00 . A A .   4 VAL HG11 1 1 
        1    58 1 1   4 VAL HG12 H   2.654   4.710   2.637 1.00 . A A .   4 VAL HG12 1 1 
        1    59 1 1   4 VAL HG13 H   3.295   6.343   2.395 1.00 . A A .   4 VAL HG13 1 1 
        1    60 1 1   4 VAL HG21 H   1.251   4.369  -0.820 1.00 . A A .   4 VAL HG21 1 1 
        1    61 1 1   4 VAL HG22 H   1.395   3.546   0.733 1.00 . A A .   4 VAL HG22 1 1 
        1    62 1 1   4 VAL HG23 H   2.822   3.774  -0.286 1.00 . A A .   4 VAL HG23 1 1 
        1    63 1 1   4 VAL N    N   1.139   7.662   1.612 1.00 . A A .   4 VAL N    1 1 
        1    64 1 1   4 VAL O    O   0.203   5.732   3.416 1.00 . A A .   4 VAL O    1 1 
        1    65 1 1   5 LEU C    C  -0.885   2.185   2.374 1.00 . A A .   5 LEU C    1 1 
        1    66 1 1   5 LEU CA   C  -1.503   3.576   2.595 1.00 . A A .   5 LEU CA   1 1 
        1    67 1 1   5 LEU CB   C  -3.017   3.551   2.233 1.00 . A A .   5 LEU CB   1 1 
        1    68 1 1   5 LEU CD1  C  -3.868   2.720   4.517 1.00 . A A .   5 LEU CD1  1 1 
        1    69 1 1   5 LEU CD2  C  -5.349   2.491   2.457 1.00 . A A .   5 LEU CD2  1 1 
        1    70 1 1   5 LEU CG   C  -3.901   2.499   2.993 1.00 . A A .   5 LEU CG   1 1 
        1    71 1 1   5 LEU H    H  -0.937   4.506   0.784 1.00 . A A .   5 LEU H    1 1 
        1    72 1 1   5 LEU HA   H  -1.387   3.866   3.639 1.00 . A A .   5 LEU HA   1 1 
        1    73 1 1   5 LEU HB2  H  -3.420   4.540   2.429 1.00 . A A .   5 LEU HB2  1 1 
        1    74 1 1   5 LEU HB3  H  -3.106   3.364   1.166 1.00 . A A .   5 LEU HB3  1 1 
        1    75 1 1   5 LEU HD11 H  -4.494   1.983   5.006 1.00 . A A .   5 LEU HD11 1 1 
        1    76 1 1   5 LEU HD12 H  -4.236   3.712   4.754 1.00 . A A .   5 LEU HD12 1 1 
        1    77 1 1   5 LEU HD13 H  -2.855   2.620   4.877 1.00 . A A .   5 LEU HD13 1 1 
        1    78 1 1   5 LEU HD21 H  -5.796   3.469   2.586 1.00 . A A .   5 LEU HD21 1 1 
        1    79 1 1   5 LEU HD22 H  -5.935   1.755   2.996 1.00 . A A .   5 LEU HD22 1 1 
        1    80 1 1   5 LEU HD23 H  -5.343   2.236   1.407 1.00 . A A .   5 LEU HD23 1 1 
        1    81 1 1   5 LEU HG   H  -3.491   1.510   2.816 1.00 . A A .   5 LEU HG   1 1 
        1    82 1 1   5 LEU N    N  -0.789   4.547   1.748 1.00 . A A .   5 LEU N    1 1 
        1    83 1 1   5 LEU O    O  -0.962   1.640   1.270 1.00 . A A .   5 LEU O    1 1 
        1    84 1 1   6 LEU C    C  -0.755  -0.752   3.729 1.00 . A A .   6 LEU C    1 1 
        1    85 1 1   6 LEU CA   C   0.330   0.287   3.376 1.00 . A A .   6 LEU CA   1 1 
        1    86 1 1   6 LEU CB   C   1.526   0.215   4.373 1.00 . A A .   6 LEU CB   1 1 
        1    87 1 1   6 LEU CD1  C   2.992  -1.448   3.080 1.00 . A A .   6 LEU CD1  1 1 
        1    88 1 1   6 LEU CD2  C   3.349  -1.132   5.579 1.00 . A A .   6 LEU CD2  1 1 
        1    89 1 1   6 LEU CG   C   2.320  -1.134   4.427 1.00 . A A .   6 LEU CG   1 1 
        1    90 1 1   6 LEU H    H  -0.233   2.123   4.252 1.00 . A A .   6 LEU H    1 1 
        1    91 1 1   6 LEU HA   H   0.697   0.103   2.368 1.00 . A A .   6 LEU HA   1 1 
        1    92 1 1   6 LEU HB2  H   2.222   1.008   4.115 1.00 . A A .   6 LEU HB2  1 1 
        1    93 1 1   6 LEU HB3  H   1.142   0.424   5.368 1.00 . A A .   6 LEU HB3  1 1 
        1    94 1 1   6 LEU HD11 H   3.519  -2.390   3.150 1.00 . A A .   6 LEU HD11 1 1 
        1    95 1 1   6 LEU HD12 H   3.695  -0.662   2.828 1.00 . A A .   6 LEU HD12 1 1 
        1    96 1 1   6 LEU HD13 H   2.240  -1.518   2.306 1.00 . A A .   6 LEU HD13 1 1 
        1    97 1 1   6 LEU HD21 H   4.067  -0.338   5.431 1.00 . A A .   6 LEU HD21 1 1 
        1    98 1 1   6 LEU HD22 H   3.866  -2.084   5.608 1.00 . A A .   6 LEU HD22 1 1 
        1    99 1 1   6 LEU HD23 H   2.838  -0.981   6.519 1.00 . A A .   6 LEU HD23 1 1 
        1   100 1 1   6 LEU HG   H   1.622  -1.940   4.625 1.00 . A A .   6 LEU HG   1 1 
        1   101 1 1   6 LEU N    N  -0.269   1.627   3.420 1.00 . A A .   6 LEU N    1 1 
        1   102 1 1   6 LEU O    O  -0.995  -1.041   4.897 1.00 . A A .   6 LEU O    1 1 
        1   103 1 1   7 VAL C    C  -1.725  -3.691   2.957 1.00 . A A .   7 VAL C    1 1 
        1   104 1 1   7 VAL CA   C  -2.439  -2.338   2.841 1.00 . A A .   7 VAL CA   1 1 
        1   105 1 1   7 VAL CB   C  -3.425  -2.353   1.615 1.00 . A A .   7 VAL CB   1 1 
        1   106 1 1   7 VAL CG1  C  -4.411  -3.546   1.675 1.00 . A A .   7 VAL CG1  1 1 
        1   107 1 1   7 VAL CG2  C  -4.183  -1.014   1.509 1.00 . A A .   7 VAL CG2  1 1 
        1   108 1 1   7 VAL H    H  -1.259  -0.917   1.804 1.00 . A A .   7 VAL H    1 1 
        1   109 1 1   7 VAL HA   H  -3.016  -2.151   3.749 1.00 . A A .   7 VAL HA   1 1 
        1   110 1 1   7 VAL HB   H  -2.829  -2.467   0.713 1.00 . A A .   7 VAL HB   1 1 
        1   111 1 1   7 VAL HG11 H  -5.070  -3.522   0.815 1.00 . A A .   7 VAL HG11 1 1 
        1   112 1 1   7 VAL HG12 H  -5.005  -3.485   2.577 1.00 . A A .   7 VAL HG12 1 1 
        1   113 1 1   7 VAL HG13 H  -3.862  -4.481   1.675 1.00 . A A .   7 VAL HG13 1 1 
        1   114 1 1   7 VAL HG21 H  -4.775  -0.857   2.403 1.00 . A A .   7 VAL HG21 1 1 
        1   115 1 1   7 VAL HG22 H  -4.837  -1.030   0.644 1.00 . A A .   7 VAL HG22 1 1 
        1   116 1 1   7 VAL HG23 H  -3.475  -0.199   1.404 1.00 . A A .   7 VAL HG23 1 1 
        1   117 1 1   7 VAL N    N  -1.433  -1.271   2.699 1.00 . A A .   7 VAL N    1 1 
        1   118 1 1   7 VAL O    O  -1.092  -4.151   1.997 1.00 . A A .   7 VAL O    1 1 
        1   119 1 1   8 ILE C    C  -2.256  -6.669   4.663 1.00 . A A .   8 ILE C    1 1 
        1   120 1 1   8 ILE CA   C  -1.180  -5.613   4.421 1.00 . A A .   8 ILE CA   1 1 
        1   121 1 1   8 ILE CB   C  -0.206  -5.564   5.657 1.00 . A A .   8 ILE CB   1 1 
        1   122 1 1   8 ILE CD1  C   1.847  -4.300   6.592 1.00 . A A .   8 ILE CD1  1 1 
        1   123 1 1   8 ILE CG1  C   0.853  -4.439   5.462 1.00 . A A .   8 ILE CG1  1 1 
        1   124 1 1   8 ILE CG2  C   0.472  -6.946   5.897 1.00 . A A .   8 ILE CG2  1 1 
        1   125 1 1   8 ILE H    H  -2.311  -3.883   4.861 1.00 . A A .   8 ILE H    1 1 
        1   126 1 1   8 ILE HA   H  -0.594  -5.900   3.545 1.00 . A A .   8 ILE HA   1 1 
        1   127 1 1   8 ILE HB   H  -0.799  -5.329   6.539 1.00 . A A .   8 ILE HB   1 1 
        1   128 1 1   8 ILE HD11 H   2.596  -3.576   6.315 1.00 . A A .   8 ILE HD11 1 1 
        1   129 1 1   8 ILE HD12 H   2.328  -5.252   6.781 1.00 . A A .   8 ILE HD12 1 1 
        1   130 1 1   8 ILE HD13 H   1.339  -3.967   7.478 1.00 . A A .   8 ILE HD13 1 1 
        1   131 1 1   8 ILE HG12 H   1.416  -4.627   4.558 1.00 . A A .   8 ILE HG12 1 1 
        1   132 1 1   8 ILE HG13 H   0.345  -3.485   5.361 1.00 . A A .   8 ILE HG13 1 1 
        1   133 1 1   8 ILE HG21 H  -0.285  -7.704   6.071 1.00 . A A .   8 ILE HG21 1 1 
        1   134 1 1   8 ILE HG22 H   1.122  -6.895   6.760 1.00 . A A .   8 ILE HG22 1 1 
        1   135 1 1   8 ILE HG23 H   1.055  -7.222   5.027 1.00 . A A .   8 ILE HG23 1 1 
        1   136 1 1   8 ILE N    N  -1.804  -4.312   4.145 1.00 . A A .   8 ILE N    1 1 
        1   137 1 1   8 ILE O    O  -3.198  -6.447   5.433 1.00 . A A .   8 ILE O    1 1 
        1   138 1 1   9 SER C    C  -2.083 -10.223   3.781 1.00 . A A .   9 SER C    1 1 
        1   139 1 1   9 SER CA   C  -2.920  -8.997   4.169 1.00 . A A .   9 SER CA   1 1 
        1   140 1 1   9 SER CB   C  -4.209  -8.888   3.308 1.00 . A A .   9 SER CB   1 1 
        1   141 1 1   9 SER H    H  -1.357  -7.862   3.347 1.00 . A A .   9 SER H    1 1 
        1   142 1 1   9 SER HA   H  -3.191  -9.078   5.221 1.00 . A A .   9 SER HA   1 1 
        1   143 1 1   9 SER HB2  H  -4.863  -8.139   3.732 1.00 . A A .   9 SER HB2  1 1 
        1   144 1 1   9 SER HB3  H  -3.945  -8.591   2.304 1.00 . A A .   9 SER HB3  1 1 
        1   145 1 1   9 SER HG   H  -5.345 -10.193   2.375 1.00 . A A .   9 SER HG   1 1 
        1   146 1 1   9 SER N    N  -2.090  -7.811   3.997 1.00 . A A .   9 SER N    1 1 
        1   147 1 1   9 SER O    O  -1.140 -10.118   2.986 1.00 . A A .   9 SER O    1 1 
        1   148 1 1   9 SER OG   O  -4.929 -10.114   3.240 1.00 . A A .   9 SER OG   1 1 
        1   149 1 1  10 THR C    C  -2.597 -13.366   2.933 1.00 . A A .  10 THR C    1 1 
        1   150 1 1  10 THR CA   C  -1.784 -12.655   4.036 1.00 . A A .  10 THR CA   1 1 
        1   151 1 1  10 THR CB   C  -1.677 -13.542   5.315 1.00 . A A .  10 THR CB   1 1 
        1   152 1 1  10 THR CG2  C  -0.600 -13.011   6.281 1.00 . A A .  10 THR CG2  1 1 
        1   153 1 1  10 THR H    H  -3.085 -11.351   5.084 1.00 . A A .  10 THR H    1 1 
        1   154 1 1  10 THR HA   H  -0.779 -12.472   3.659 1.00 . A A .  10 THR HA   1 1 
        1   155 1 1  10 THR HB   H  -1.413 -14.556   5.025 1.00 . A A .  10 THR HB   1 1 
        1   156 1 1  10 THR HG1  H  -3.186 -14.483   6.182 1.00 . A A .  10 THR HG1  1 1 
        1   157 1 1  10 THR HG21 H  -0.855 -12.007   6.599 1.00 . A A .  10 THR HG21 1 1 
        1   158 1 1  10 THR HG22 H   0.364 -12.994   5.785 1.00 . A A .  10 THR HG22 1 1 
        1   159 1 1  10 THR HG23 H  -0.540 -13.654   7.148 1.00 . A A .  10 THR HG23 1 1 
        1   160 1 1  10 THR N    N  -2.403 -11.365   4.380 1.00 . A A .  10 THR N    1 1 
        1   161 1 1  10 THR O    O  -2.100 -14.285   2.269 1.00 . A A .  10 THR O    1 1 
        1   162 1 1  10 THR OG1  O  -2.949 -13.570   5.986 1.00 . A A .  10 THR OG1  1 1 
        1   163 1 1  11 ASP C    C  -4.613 -12.685   0.415 1.00 . A A .  11 ASP C    1 1 
        1   164 1 1  11 ASP CA   C  -4.780 -13.435   1.742 1.00 . A A .  11 ASP CA   1 1 
        1   165 1 1  11 ASP CB   C  -6.235 -13.303   2.262 1.00 . A A .  11 ASP CB   1 1 
        1   166 1 1  11 ASP CG   C  -6.539 -14.241   3.434 1.00 . A A .  11 ASP CG   1 1 
        1   167 1 1  11 ASP H    H  -4.154 -12.181   3.321 1.00 . A A .  11 ASP H    1 1 
        1   168 1 1  11 ASP HA   H  -4.557 -14.492   1.582 1.00 . A A .  11 ASP HA   1 1 
        1   169 1 1  11 ASP HB2  H  -6.402 -12.279   2.586 1.00 . A A .  11 ASP HB2  1 1 
        1   170 1 1  11 ASP HB3  H  -6.927 -13.520   1.452 1.00 . A A .  11 ASP HB3  1 1 
        1   171 1 1  11 ASP N    N  -3.846 -12.909   2.747 1.00 . A A .  11 ASP N    1 1 
        1   172 1 1  11 ASP O    O  -5.248 -11.650   0.207 1.00 . A A .  11 ASP O    1 1 
        1   173 1 1  11 ASP OD1  O  -6.228 -13.891   4.589 1.00 . A A .  11 ASP OD1  1 1 
        1   174 1 1  11 ASP OD2  O  -7.086 -15.338   3.206 1.00 . A A .  11 ASP OD2  1 1 
        1   175 1 1  12 THR C    C  -4.693 -12.636  -2.718 1.00 . A A .  12 THR C    1 1 
        1   176 1 1  12 THR CA   C  -3.459 -12.624  -1.797 1.00 . A A .  12 THR CA   1 1 
        1   177 1 1  12 THR CB   C  -2.264 -13.360  -2.490 1.00 . A A .  12 THR CB   1 1 
        1   178 1 1  12 THR CG2  C  -0.931 -13.093  -1.764 1.00 . A A .  12 THR CG2  1 1 
        1   179 1 1  12 THR H    H  -3.259 -14.024  -0.215 1.00 . A A .  12 THR H    1 1 
        1   180 1 1  12 THR HA   H  -3.172 -11.588  -1.643 1.00 . A A .  12 THR HA   1 1 
        1   181 1 1  12 THR HB   H  -2.176 -13.002  -3.512 1.00 . A A .  12 THR HB   1 1 
        1   182 1 1  12 THR HG1  H  -3.345 -14.951  -2.993 1.00 . A A .  12 THR HG1  1 1 
        1   183 1 1  12 THR HG21 H  -0.130 -13.615  -2.270 1.00 . A A .  12 THR HG21 1 1 
        1   184 1 1  12 THR HG22 H  -0.994 -13.442  -0.739 1.00 . A A .  12 THR HG22 1 1 
        1   185 1 1  12 THR HG23 H  -0.719 -12.030  -1.767 1.00 . A A .  12 THR HG23 1 1 
        1   186 1 1  12 THR N    N  -3.742 -13.210  -0.469 1.00 . A A .  12 THR N    1 1 
        1   187 1 1  12 THR O    O  -4.788 -11.824  -3.639 1.00 . A A .  12 THR O    1 1 
        1   188 1 1  12 THR OG1  O  -2.515 -14.779  -2.526 1.00 . A A .  12 THR OG1  1 1 
        1   189 1 1  13 ASN C    C  -7.787 -12.399  -2.842 1.00 . A A .  13 ASN C    1 1 
        1   190 1 1  13 ASN CA   C  -6.914 -13.631  -3.176 1.00 . A A .  13 ASN CA   1 1 
        1   191 1 1  13 ASN CB   C  -7.649 -14.969  -2.858 1.00 . A A .  13 ASN CB   1 1 
        1   192 1 1  13 ASN CG   C  -7.954 -15.199  -1.364 1.00 . A A .  13 ASN CG   1 1 
        1   193 1 1  13 ASN H    H  -5.455 -14.224  -1.752 1.00 . A A .  13 ASN H    1 1 
        1   194 1 1  13 ASN HA   H  -6.685 -13.609  -4.238 1.00 . A A .  13 ASN HA   1 1 
        1   195 1 1  13 ASN HB2  H  -8.583 -14.993  -3.405 1.00 . A A .  13 ASN HB2  1 1 
        1   196 1 1  13 ASN HB3  H  -7.032 -15.792  -3.201 1.00 . A A .  13 ASN HB3  1 1 
        1   197 1 1  13 ASN HD21 H  -9.467 -16.414  -1.803 1.00 . A A .  13 ASN HD21 1 1 
        1   198 1 1  13 ASN HD22 H  -9.157 -16.171  -0.122 1.00 . A A .  13 ASN HD22 1 1 
        1   199 1 1  13 ASN N    N  -5.630 -13.564  -2.456 1.00 . A A .  13 ASN N    1 1 
        1   200 1 1  13 ASN ND2  N  -8.963 -16.006  -1.067 1.00 . A A .  13 ASN ND2  1 1 
        1   201 1 1  13 ASN O    O  -8.468 -11.867  -3.718 1.00 . A A .  13 ASN O    1 1 
        1   202 1 1  13 ASN OD1  O  -7.266 -14.692  -0.483 1.00 . A A .  13 ASN OD1  1 1 
        1   203 1 1  14 ILE C    C  -7.720  -9.455  -1.647 1.00 . A A .  14 ILE C    1 1 
        1   204 1 1  14 ILE CA   C  -8.437 -10.715  -1.131 1.00 . A A .  14 ILE CA   1 1 
        1   205 1 1  14 ILE CB   C  -8.555 -10.663   0.438 1.00 . A A .  14 ILE CB   1 1 
        1   206 1 1  14 ILE CD1  C -10.818 -11.973   0.410 1.00 . A A .  14 ILE CD1  1 1 
        1   207 1 1  14 ILE CG1  C  -9.406 -11.861   0.976 1.00 . A A .  14 ILE CG1  1 1 
        1   208 1 1  14 ILE CG2  C  -9.118  -9.310   0.934 1.00 . A A .  14 ILE CG2  1 1 
        1   209 1 1  14 ILE H    H  -7.193 -12.430  -0.918 1.00 . A A .  14 ILE H    1 1 
        1   210 1 1  14 ILE HA   H  -9.439 -10.741  -1.547 1.00 . A A .  14 ILE HA   1 1 
        1   211 1 1  14 ILE HB   H  -7.546 -10.758   0.839 1.00 . A A .  14 ILE HB   1 1 
        1   212 1 1  14 ILE HD11 H -11.373 -11.068   0.617 1.00 . A A .  14 ILE HD11 1 1 
        1   213 1 1  14 ILE HD12 H -11.316 -12.811   0.872 1.00 . A A .  14 ILE HD12 1 1 
        1   214 1 1  14 ILE HD13 H -10.776 -12.133  -0.660 1.00 . A A .  14 ILE HD13 1 1 
        1   215 1 1  14 ILE HG12 H  -8.896 -12.789   0.747 1.00 . A A .  14 ILE HG12 1 1 
        1   216 1 1  14 ILE HG13 H  -9.494 -11.778   2.054 1.00 . A A .  14 ILE HG13 1 1 
        1   217 1 1  14 ILE HG21 H  -8.463  -8.502   0.625 1.00 . A A .  14 ILE HG21 1 1 
        1   218 1 1  14 ILE HG22 H  -9.184  -9.314   2.015 1.00 . A A .  14 ILE HG22 1 1 
        1   219 1 1  14 ILE HG23 H -10.101  -9.149   0.517 1.00 . A A .  14 ILE HG23 1 1 
        1   220 1 1  14 ILE N    N  -7.729 -11.934  -1.576 1.00 . A A .  14 ILE N    1 1 
        1   221 1 1  14 ILE O    O  -8.368  -8.535  -2.150 1.00 . A A .  14 ILE O    1 1 
        1   222 1 1  15 ILE C    C  -5.753  -8.004  -3.412 1.00 . A A .  15 ILE C    1 1 
        1   223 1 1  15 ILE CA   C  -5.517  -8.329  -1.939 1.00 . A A .  15 ILE CA   1 1 
        1   224 1 1  15 ILE CB   C  -4.002  -8.672  -1.712 1.00 . A A .  15 ILE CB   1 1 
        1   225 1 1  15 ILE CD1  C  -2.367  -9.549   0.071 1.00 . A A .  15 ILE CD1  1 1 
        1   226 1 1  15 ILE CG1  C  -3.722  -8.941  -0.213 1.00 . A A .  15 ILE CG1  1 1 
        1   227 1 1  15 ILE CG2  C  -3.079  -7.555  -2.242 1.00 . A A .  15 ILE CG2  1 1 
        1   228 1 1  15 ILE H    H  -5.948 -10.229  -1.116 1.00 . A A .  15 ILE H    1 1 
        1   229 1 1  15 ILE HA   H  -5.769  -7.462  -1.332 1.00 . A A .  15 ILE HA   1 1 
        1   230 1 1  15 ILE HB   H  -3.781  -9.580  -2.275 1.00 . A A .  15 ILE HB   1 1 
        1   231 1 1  15 ILE HD11 H  -2.252  -9.676   1.136 1.00 . A A .  15 ILE HD11 1 1 
        1   232 1 1  15 ILE HD12 H  -1.589  -8.898  -0.297 1.00 . A A .  15 ILE HD12 1 1 
        1   233 1 1  15 ILE HD13 H  -2.290 -10.513  -0.412 1.00 . A A .  15 ILE HD13 1 1 
        1   234 1 1  15 ILE HG12 H  -3.784  -8.015   0.341 1.00 . A A .  15 ILE HG12 1 1 
        1   235 1 1  15 ILE HG13 H  -4.468  -9.626   0.174 1.00 . A A .  15 ILE HG13 1 1 
        1   236 1 1  15 ILE HG21 H  -2.042  -7.821  -2.070 1.00 . A A .  15 ILE HG21 1 1 
        1   237 1 1  15 ILE HG22 H  -3.297  -6.627  -1.731 1.00 . A A .  15 ILE HG22 1 1 
        1   238 1 1  15 ILE HG23 H  -3.237  -7.421  -3.306 1.00 . A A .  15 ILE HG23 1 1 
        1   239 1 1  15 ILE N    N  -6.378  -9.446  -1.517 1.00 . A A .  15 ILE N    1 1 
        1   240 1 1  15 ILE O    O  -6.105  -6.881  -3.738 1.00 . A A .  15 ILE O    1 1 
        1   241 1 1  16 SER C    C  -7.216  -8.495  -6.077 1.00 . A A .  16 SER C    1 1 
        1   242 1 1  16 SER CA   C  -5.780  -8.921  -5.719 1.00 . A A .  16 SER CA   1 1 
        1   243 1 1  16 SER CB   C  -5.422 -10.261  -6.399 1.00 . A A .  16 SER CB   1 1 
        1   244 1 1  16 SER H    H  -5.353  -9.907  -3.904 1.00 . A A .  16 SER H    1 1 
        1   245 1 1  16 SER HA   H  -5.090  -8.160  -6.071 1.00 . A A .  16 SER HA   1 1 
        1   246 1 1  16 SER HB2  H  -4.399 -10.521  -6.162 1.00 . A A .  16 SER HB2  1 1 
        1   247 1 1  16 SER HB3  H  -6.076 -11.045  -6.032 1.00 . A A .  16 SER HB3  1 1 
        1   248 1 1  16 SER HG   H  -5.890 -11.028  -8.138 1.00 . A A .  16 SER HG   1 1 
        1   249 1 1  16 SER N    N  -5.604  -9.033  -4.268 1.00 . A A .  16 SER N    1 1 
        1   250 1 1  16 SER O    O  -7.401  -7.706  -6.999 1.00 . A A .  16 SER O    1 1 
        1   251 1 1  16 SER OG   O  -5.544 -10.193  -7.811 1.00 . A A .  16 SER OG   1 1 
        1   252 1 1  17 SER C    C  -9.930  -7.215  -5.366 1.00 . A A .  17 SER C    1 1 
        1   253 1 1  17 SER CA   C  -9.638  -8.710  -5.558 1.00 . A A .  17 SER CA   1 1 
        1   254 1 1  17 SER CB   C -10.541  -9.563  -4.633 1.00 . A A .  17 SER CB   1 1 
        1   255 1 1  17 SER H    H  -7.982  -9.568  -4.547 1.00 . A A .  17 SER H    1 1 
        1   256 1 1  17 SER HA   H  -9.849  -8.977  -6.589 1.00 . A A .  17 SER HA   1 1 
        1   257 1 1  17 SER HB2  H -10.253 -10.605  -4.706 1.00 . A A .  17 SER HB2  1 1 
        1   258 1 1  17 SER HB3  H -10.436  -9.236  -3.604 1.00 . A A .  17 SER HB3  1 1 
        1   259 1 1  17 SER HG   H -11.988  -9.716  -5.934 1.00 . A A .  17 SER HG   1 1 
        1   260 1 1  17 SER N    N  -8.215  -8.995  -5.308 1.00 . A A .  17 SER N    1 1 
        1   261 1 1  17 SER O    O -10.440  -6.559  -6.273 1.00 . A A .  17 SER O    1 1 
        1   262 1 1  17 SER OG   O -11.900  -9.451  -5.012 1.00 . A A .  17 SER OG   1 1 
        1   263 1 1  18 VAL C    C  -8.876  -4.374  -4.704 1.00 . A A .  18 VAL C    1 1 
        1   264 1 1  18 VAL CA   C  -9.731  -5.285  -3.812 1.00 . A A .  18 VAL CA   1 1 
        1   265 1 1  18 VAL CB   C  -9.355  -5.050  -2.306 1.00 . A A .  18 VAL CB   1 1 
        1   266 1 1  18 VAL CG1  C  -9.471  -3.557  -1.925 1.00 . A A .  18 VAL CG1  1 1 
        1   267 1 1  18 VAL CG2  C -10.229  -5.926  -1.385 1.00 . A A .  18 VAL CG2  1 1 
        1   268 1 1  18 VAL H    H  -9.133  -7.291  -3.535 1.00 . A A .  18 VAL H    1 1 
        1   269 1 1  18 VAL HA   H -10.780  -5.033  -3.950 1.00 . A A .  18 VAL HA   1 1 
        1   270 1 1  18 VAL HB   H  -8.316  -5.350  -2.167 1.00 . A A .  18 VAL HB   1 1 
        1   271 1 1  18 VAL HG11 H -10.487  -3.218  -2.083 1.00 . A A .  18 VAL HG11 1 1 
        1   272 1 1  18 VAL HG12 H  -8.800  -2.965  -2.535 1.00 . A A .  18 VAL HG12 1 1 
        1   273 1 1  18 VAL HG13 H  -9.208  -3.423  -0.885 1.00 . A A .  18 VAL HG13 1 1 
        1   274 1 1  18 VAL HG21 H -11.270  -5.648  -1.497 1.00 . A A .  18 VAL HG21 1 1 
        1   275 1 1  18 VAL HG22 H  -9.932  -5.786  -0.351 1.00 . A A .  18 VAL HG22 1 1 
        1   276 1 1  18 VAL HG23 H -10.110  -6.971  -1.649 1.00 . A A .  18 VAL HG23 1 1 
        1   277 1 1  18 VAL N    N  -9.557  -6.698  -4.184 1.00 . A A .  18 VAL N    1 1 
        1   278 1 1  18 VAL O    O  -9.290  -3.276  -5.051 1.00 . A A .  18 VAL O    1 1 
        1   279 1 1  19 GLN C    C  -7.339  -3.936  -7.315 1.00 . A A .  19 GLN C    1 1 
        1   280 1 1  19 GLN CA   C  -6.733  -4.174  -5.932 1.00 . A A .  19 GLN CA   1 1 
        1   281 1 1  19 GLN CB   C  -5.463  -5.035  -6.023 1.00 . A A .  19 GLN CB   1 1 
        1   282 1 1  19 GLN CD   C  -3.196  -5.528  -7.069 1.00 . A A .  19 GLN CD   1 1 
        1   283 1 1  19 GLN CG   C  -4.330  -4.509  -6.905 1.00 . A A .  19 GLN CG   1 1 
        1   284 1 1  19 GLN H    H  -7.441  -5.745  -4.719 1.00 . A A .  19 GLN H    1 1 
        1   285 1 1  19 GLN HA   H  -6.485  -3.221  -5.474 1.00 . A A .  19 GLN HA   1 1 
        1   286 1 1  19 GLN HB2  H  -5.065  -5.153  -5.019 1.00 . A A .  19 GLN HB2  1 1 
        1   287 1 1  19 GLN HB3  H  -5.748  -6.019  -6.386 1.00 . A A .  19 GLN HB3  1 1 
        1   288 1 1  19 GLN HE21 H  -3.437  -6.250  -5.211 1.00 . A A .  19 GLN HE21 1 1 
        1   289 1 1  19 GLN HE22 H  -2.187  -6.978  -6.150 1.00 . A A .  19 GLN HE22 1 1 
        1   290 1 1  19 GLN HG2  H  -4.728  -4.266  -7.885 1.00 . A A .  19 GLN HG2  1 1 
        1   291 1 1  19 GLN HG3  H  -3.924  -3.612  -6.455 1.00 . A A .  19 GLN HG3  1 1 
        1   292 1 1  19 GLN N    N  -7.689  -4.865  -5.057 1.00 . A A .  19 GLN N    1 1 
        1   293 1 1  19 GLN NE2  N  -2.918  -6.333  -6.037 1.00 . A A .  19 GLN NE2  1 1 
        1   294 1 1  19 GLN O    O  -7.200  -2.846  -7.869 1.00 . A A .  19 GLN O    1 1 
        1   295 1 1  19 GLN OE1  O  -2.547  -5.581  -8.114 1.00 . A A .  19 GLN OE1  1 1 
        1   296 1 1  20 GLU C    C  -9.890  -3.773  -8.932 1.00 . A A .  20 GLU C    1 1 
        1   297 1 1  20 GLU CA   C  -8.806  -4.844  -9.087 1.00 . A A .  20 GLU CA   1 1 
        1   298 1 1  20 GLU CB   C  -9.451  -6.203  -9.483 1.00 . A A .  20 GLU CB   1 1 
        1   299 1 1  20 GLU CD   C  -7.654  -6.880 -11.197 1.00 . A A .  20 GLU CD   1 1 
        1   300 1 1  20 GLU CG   C  -8.461  -7.286  -9.949 1.00 . A A .  20 GLU CG   1 1 
        1   301 1 1  20 GLU H    H  -8.043  -5.821  -7.365 1.00 . A A .  20 GLU H    1 1 
        1   302 1 1  20 GLU HA   H  -8.112  -4.540  -9.864 1.00 . A A .  20 GLU HA   1 1 
        1   303 1 1  20 GLU HB2  H  -9.992  -6.591  -8.625 1.00 . A A .  20 GLU HB2  1 1 
        1   304 1 1  20 GLU HB3  H -10.163  -6.032 -10.286 1.00 . A A .  20 GLU HB3  1 1 
        1   305 1 1  20 GLU HG2  H  -7.776  -7.499  -9.133 1.00 . A A .  20 GLU HG2  1 1 
        1   306 1 1  20 GLU HG3  H  -9.018  -8.192 -10.173 1.00 . A A .  20 GLU HG3  1 1 
        1   307 1 1  20 GLU N    N  -8.041  -4.961  -7.839 1.00 . A A .  20 GLU N    1 1 
        1   308 1 1  20 GLU O    O  -9.936  -2.822  -9.706 1.00 . A A .  20 GLU O    1 1 
        1   309 1 1  20 GLU OE1  O  -8.205  -6.914 -12.320 1.00 . A A .  20 GLU OE1  1 1 
        1   310 1 1  20 GLU OE2  O  -6.477  -6.492 -11.062 1.00 . A A .  20 GLU OE2  1 1 
        1   311 1 1  21 ARG C    C -11.371  -1.565  -7.467 1.00 . A A .  21 ARG C    1 1 
        1   312 1 1  21 ARG CA   C -11.841  -3.025  -7.581 1.00 . A A .  21 ARG CA   1 1 
        1   313 1 1  21 ARG CB   C -12.524  -3.454  -6.264 1.00 . A A .  21 ARG CB   1 1 
        1   314 1 1  21 ARG CD   C -13.585  -5.326  -4.876 1.00 . A A .  21 ARG CD   1 1 
        1   315 1 1  21 ARG CG   C -13.078  -4.893  -6.264 1.00 . A A .  21 ARG CG   1 1 
        1   316 1 1  21 ARG CZ   C -14.319  -7.440  -3.745 1.00 . A A .  21 ARG CZ   1 1 
        1   317 1 1  21 ARG H    H -10.551  -4.680  -7.269 1.00 . A A .  21 ARG H    1 1 
        1   318 1 1  21 ARG HA   H -12.558  -3.110  -8.397 1.00 . A A .  21 ARG HA   1 1 
        1   319 1 1  21 ARG HB2  H -11.797  -3.373  -5.459 1.00 . A A .  21 ARG HB2  1 1 
        1   320 1 1  21 ARG HB3  H -13.346  -2.775  -6.054 1.00 . A A .  21 ARG HB3  1 1 
        1   321 1 1  21 ARG HD2  H -12.895  -4.961  -4.123 1.00 . A A .  21 ARG HD2  1 1 
        1   322 1 1  21 ARG HD3  H -14.560  -4.885  -4.711 1.00 . A A .  21 ARG HD3  1 1 
        1   323 1 1  21 ARG HE   H -13.248  -7.330  -5.439 1.00 . A A .  21 ARG HE   1 1 
        1   324 1 1  21 ARG HG2  H -13.898  -4.955  -6.972 1.00 . A A .  21 ARG HG2  1 1 
        1   325 1 1  21 ARG HG3  H -12.292  -5.570  -6.579 1.00 . A A .  21 ARG HG3  1 1 
        1   326 1 1  21 ARG HH11 H -14.946  -5.769  -2.768 1.00 . A A .  21 ARG HH11 1 1 
        1   327 1 1  21 ARG HH12 H -15.412  -7.269  -2.032 1.00 . A A .  21 ARG HH12 1 1 
        1   328 1 1  21 ARG HH21 H -13.790  -9.282  -4.416 1.00 . A A .  21 ARG HH21 1 1 
        1   329 1 1  21 ARG HH22 H -14.748  -9.264  -2.976 1.00 . A A .  21 ARG HH22 1 1 
        1   330 1 1  21 ARG N    N -10.715  -3.929  -7.880 1.00 . A A .  21 ARG N    1 1 
        1   331 1 1  21 ARG NE   N -13.687  -6.793  -4.740 1.00 . A A .  21 ARG NE   1 1 
        1   332 1 1  21 ARG NH1  N -14.942  -6.775  -2.769 1.00 . A A .  21 ARG NH1  1 1 
        1   333 1 1  21 ARG NH2  N -14.282  -8.767  -3.707 1.00 . A A .  21 ARG NH2  1 1 
        1   334 1 1  21 ARG O    O -12.039  -0.664  -7.943 1.00 . A A .  21 ARG O    1 1 
        1   335 1 1  22 ALA C    C  -9.114   0.603  -7.895 1.00 . A A .  22 ALA C    1 1 
        1   336 1 1  22 ALA CA   C  -9.619  -0.049  -6.600 1.00 . A A .  22 ALA CA   1 1 
        1   337 1 1  22 ALA CB   C  -8.487  -0.164  -5.571 1.00 . A A .  22 ALA CB   1 1 
        1   338 1 1  22 ALA H    H  -9.666  -2.157  -6.620 1.00 . A A .  22 ALA H    1 1 
        1   339 1 1  22 ALA HA   H -10.404   0.570  -6.171 1.00 . A A .  22 ALA HA   1 1 
        1   340 1 1  22 ALA HB1  H  -8.864  -0.613  -4.660 1.00 . A A .  22 ALA HB1  1 1 
        1   341 1 1  22 ALA HB2  H  -8.098   0.823  -5.344 1.00 . A A .  22 ALA HB2  1 1 
        1   342 1 1  22 ALA HB3  H  -7.689  -0.780  -5.968 1.00 . A A .  22 ALA HB3  1 1 
        1   343 1 1  22 ALA N    N -10.187  -1.372  -6.870 1.00 . A A .  22 ALA N    1 1 
        1   344 1 1  22 ALA O    O  -9.335   1.788  -8.118 1.00 . A A .  22 ALA O    1 1 
        1   345 1 1  23 LYS C    C  -8.939   0.533 -11.080 1.00 . A A .  23 LYS C    1 1 
        1   346 1 1  23 LYS CA   C  -7.856   0.290 -10.016 1.00 . A A .  23 LYS CA   1 1 
        1   347 1 1  23 LYS CB   C  -6.794  -0.713 -10.553 1.00 . A A .  23 LYS CB   1 1 
        1   348 1 1  23 LYS CD   C  -4.482  -1.806 -10.265 1.00 . A A .  23 LYS CD   1 1 
        1   349 1 1  23 LYS CE   C  -3.223  -1.932  -9.391 1.00 . A A .  23 LYS CE   1 1 
        1   350 1 1  23 LYS CG   C  -5.523  -0.821  -9.678 1.00 . A A .  23 LYS CG   1 1 
        1   351 1 1  23 LYS H    H  -8.322  -1.140  -8.505 1.00 . A A .  23 LYS H    1 1 
        1   352 1 1  23 LYS HA   H  -7.359   1.235  -9.807 1.00 . A A .  23 LYS HA   1 1 
        1   353 1 1  23 LYS HB2  H  -7.244  -1.700 -10.621 1.00 . A A .  23 LYS HB2  1 1 
        1   354 1 1  23 LYS HB3  H  -6.488  -0.404 -11.551 1.00 . A A .  23 LYS HB3  1 1 
        1   355 1 1  23 LYS HD2  H  -4.936  -2.786 -10.356 1.00 . A A .  23 LYS HD2  1 1 
        1   356 1 1  23 LYS HD3  H  -4.188  -1.460 -11.252 1.00 . A A .  23 LYS HD3  1 1 
        1   357 1 1  23 LYS HE2  H  -2.777  -0.954  -9.267 1.00 . A A .  23 LYS HE2  1 1 
        1   358 1 1  23 LYS HE3  H  -3.501  -2.324  -8.421 1.00 . A A .  23 LYS HE3  1 1 
        1   359 1 1  23 LYS HG2  H  -5.069   0.161  -9.601 1.00 . A A .  23 LYS HG2  1 1 
        1   360 1 1  23 LYS HG3  H  -5.808  -1.160  -8.686 1.00 . A A .  23 LYS HG3  1 1 
        1   361 1 1  23 LYS HZ1  H  -1.915  -2.475 -10.932 1.00 . A A .  23 LYS HZ1  1 1 
        1   362 1 1  23 LYS HZ2  H  -2.603  -3.792 -10.121 1.00 . A A .  23 LYS HZ2  1 1 
        1   363 1 1  23 LYS HZ3  H  -1.368  -2.900  -9.388 1.00 . A A .  23 LYS HZ3  1 1 
        1   364 1 1  23 LYS N    N  -8.437  -0.196  -8.744 1.00 . A A .  23 LYS N    1 1 
        1   365 1 1  23 LYS NZ   N  -2.209  -2.838 -10.001 1.00 . A A .  23 LYS NZ   1 1 
        1   366 1 1  23 LYS O    O  -8.800   1.431 -11.909 1.00 . A A .  23 LYS O    1 1 
        1   367 1 1  24 HIS C    C -12.140   0.855 -11.669 1.00 . A A .  24 HIS C    1 1 
        1   368 1 1  24 HIS CA   C -11.090  -0.203 -12.067 1.00 . A A .  24 HIS CA   1 1 
        1   369 1 1  24 HIS CB   C -11.756  -1.587 -12.288 1.00 . A A .  24 HIS CB   1 1 
        1   370 1 1  24 HIS CD2  C -10.529  -3.889 -12.425 1.00 . A A .  24 HIS CD2  1 1 
        1   371 1 1  24 HIS CE1  C  -9.408  -3.559 -14.270 1.00 . A A .  24 HIS CE1  1 1 
        1   372 1 1  24 HIS CG   C -10.836  -2.643 -12.860 1.00 . A A .  24 HIS CG   1 1 
        1   373 1 1  24 HIS H    H -10.076  -0.947 -10.351 1.00 . A A .  24 HIS H    1 1 
        1   374 1 1  24 HIS HA   H -10.639   0.111 -13.009 1.00 . A A .  24 HIS HA   1 1 
        1   375 1 1  24 HIS HB2  H -12.134  -1.953 -11.338 1.00 . A A .  24 HIS HB2  1 1 
        1   376 1 1  24 HIS HB3  H -12.591  -1.477 -12.971 1.00 . A A .  24 HIS HB3  1 1 
        1   377 1 1  24 HIS HD1  H -10.108  -1.664 -14.588 1.00 . A A .  24 HIS HD1  1 1 
        1   378 1 1  24 HIS HD2  H -10.909  -4.368 -11.525 1.00 . A A .  24 HIS HD2  1 1 
        1   379 1 1  24 HIS HE1  H  -8.747  -3.711 -15.114 1.00 . A A .  24 HIS HE1  1 1 
        1   380 1 1  24 HIS HE2  H  -9.348  -5.365 -13.316 1.00 . A A .  24 HIS HE2  1 1 
        1   381 1 1  24 HIS N    N -10.008  -0.282 -11.064 1.00 . A A .  24 HIS N    1 1 
        1   382 1 1  24 HIS ND1  N -10.110  -2.471 -14.025 1.00 . A A .  24 HIS ND1  1 1 
        1   383 1 1  24 HIS NE2  N  -9.645  -4.430 -13.313 1.00 . A A .  24 HIS NE2  1 1 
        1   384 1 1  24 HIS O    O -12.743   1.485 -12.543 1.00 . A A .  24 HIS O    1 1 
        1   385 1 1  25 ASN C    C -12.596   3.442  -9.817 1.00 . A A .  25 ASN C    1 1 
        1   386 1 1  25 ASN CA   C -13.290   2.074  -9.831 1.00 . A A .  25 ASN CA   1 1 
        1   387 1 1  25 ASN CB   C -13.791   1.728  -8.396 1.00 . A A .  25 ASN CB   1 1 
        1   388 1 1  25 ASN CG   C -15.015   2.538  -7.965 1.00 . A A .  25 ASN CG   1 1 
        1   389 1 1  25 ASN H    H -11.875   0.480  -9.708 1.00 . A A .  25 ASN H    1 1 
        1   390 1 1  25 ASN HA   H -14.146   2.120 -10.506 1.00 . A A .  25 ASN HA   1 1 
        1   391 1 1  25 ASN HB2  H -14.061   0.681  -8.366 1.00 . A A .  25 ASN HB2  1 1 
        1   392 1 1  25 ASN HB3  H -12.993   1.895  -7.678 1.00 . A A .  25 ASN HB3  1 1 
        1   393 1 1  25 ASN HD21 H -13.899   4.108  -7.501 1.00 . A A .  25 ASN HD21 1 1 
        1   394 1 1  25 ASN HD22 H -15.595   4.293  -7.245 1.00 . A A .  25 ASN HD22 1 1 
        1   395 1 1  25 ASN N    N -12.354   1.045 -10.349 1.00 . A A .  25 ASN N    1 1 
        1   396 1 1  25 ASN ND2  N -14.812   3.768  -7.523 1.00 . A A .  25 ASN ND2  1 1 
        1   397 1 1  25 ASN O    O -13.233   4.473 -10.045 1.00 . A A .  25 ASN O    1 1 
        1   398 1 1  25 ASN OD1  O -16.149   2.072  -8.069 1.00 . A A .  25 ASN OD1  1 1 
        1   399 1 1  26 TYR C    C  -9.285   4.482 -10.564 1.00 . A A .  26 TYR C    1 1 
        1   400 1 1  26 TYR CA   C -10.429   4.649  -9.524 1.00 . A A .  26 TYR CA   1 1 
        1   401 1 1  26 TYR CB   C  -9.870   4.921  -8.082 1.00 . A A .  26 TYR CB   1 1 
        1   402 1 1  26 TYR CD1  C -11.853   5.928  -6.792 1.00 . A A .  26 TYR CD1  1 1 
        1   403 1 1  26 TYR CD2  C -11.096   3.747  -6.148 1.00 . A A .  26 TYR CD2  1 1 
        1   404 1 1  26 TYR CE1  C -12.854   5.855  -5.837 1.00 . A A .  26 TYR CE1  1 1 
        1   405 1 1  26 TYR CE2  C -12.089   3.681  -5.184 1.00 . A A .  26 TYR CE2  1 1 
        1   406 1 1  26 TYR CG   C -10.950   4.872  -6.977 1.00 . A A .  26 TYR CG   1 1 
        1   407 1 1  26 TYR CZ   C -12.967   4.734  -5.039 1.00 . A A .  26 TYR CZ   1 1 
        1   408 1 1  26 TYR H    H -10.848   2.576  -9.314 1.00 . A A .  26 TYR H    1 1 
        1   409 1 1  26 TYR HA   H -11.037   5.500  -9.824 1.00 . A A .  26 TYR HA   1 1 
        1   410 1 1  26 TYR HB2  H  -9.109   4.182  -7.849 1.00 . A A .  26 TYR HB2  1 1 
        1   411 1 1  26 TYR HB3  H  -9.414   5.904  -8.058 1.00 . A A .  26 TYR HB3  1 1 
        1   412 1 1  26 TYR HD1  H -11.770   6.812  -7.412 1.00 . A A .  26 TYR HD1  1 1 
        1   413 1 1  26 TYR HD2  H -10.406   2.918  -6.258 1.00 . A A .  26 TYR HD2  1 1 
        1   414 1 1  26 TYR HE1  H -13.544   6.685  -5.708 1.00 . A A .  26 TYR HE1  1 1 
        1   415 1 1  26 TYR HE2  H -12.178   2.804  -4.553 1.00 . A A .  26 TYR HE2  1 1 
        1   416 1 1  26 TYR HH   H -14.797   5.015  -4.504 1.00 . A A .  26 TYR HH   1 1 
        1   417 1 1  26 TYR N    N -11.273   3.435  -9.531 1.00 . A A .  26 TYR N    1 1 
        1   418 1 1  26 TYR O    O  -8.142   4.169 -10.197 1.00 . A A .  26 TYR O    1 1 
        1   419 1 1  26 TYR OH   O -13.989   4.651  -4.119 1.00 . A A .  26 TYR OH   1 1 
        1   420 1 1  27 PRO C    C  -7.606   5.582 -13.162 1.00 . A A .  27 PRO C    1 1 
        1   421 1 1  27 PRO CA   C  -8.613   4.426 -12.987 1.00 . A A .  27 PRO CA   1 1 
        1   422 1 1  27 PRO CB   C  -9.523   4.251 -14.224 1.00 . A A .  27 PRO CB   1 1 
        1   423 1 1  27 PRO CD   C -10.913   5.112 -12.439 1.00 . A A .  27 PRO CD   1 1 
        1   424 1 1  27 PRO CG   C -10.718   5.122 -13.949 1.00 . A A .  27 PRO CG   1 1 
        1   425 1 1  27 PRO HA   H  -8.057   3.508 -12.816 1.00 . A A .  27 PRO HA   1 1 
        1   426 1 1  27 PRO HB2  H  -9.006   4.555 -15.133 1.00 . A A .  27 PRO HB2  1 1 
        1   427 1 1  27 PRO HB3  H  -9.834   3.215 -14.311 1.00 . A A .  27 PRO HB3  1 1 
        1   428 1 1  27 PRO HD2  H -11.157   6.104 -12.073 1.00 . A A .  27 PRO HD2  1 1 
        1   429 1 1  27 PRO HD3  H -11.698   4.415 -12.157 1.00 . A A .  27 PRO HD3  1 1 
        1   430 1 1  27 PRO HG2  H -10.525   6.136 -14.303 1.00 . A A .  27 PRO HG2  1 1 
        1   431 1 1  27 PRO HG3  H -11.597   4.724 -14.443 1.00 . A A .  27 PRO HG3  1 1 
        1   432 1 1  27 PRO N    N  -9.592   4.662 -11.897 1.00 . A A .  27 PRO N    1 1 
        1   433 1 1  27 PRO O    O  -6.544   5.399 -13.768 1.00 . A A .  27 PRO O    1 1 
        1   434 1 1  28 GLY C    C  -6.307   8.100 -11.344 1.00 . A A .  28 GLY C    1 1 
        1   435 1 1  28 GLY CA   C  -7.089   7.938 -12.635 1.00 . A A .  28 GLY CA   1 1 
        1   436 1 1  28 GLY H    H  -8.805   6.818 -12.138 1.00 . A A .  28 GLY H    1 1 
        1   437 1 1  28 GLY HA2  H  -6.393   7.877 -13.467 1.00 . A A .  28 GLY HA2  1 1 
        1   438 1 1  28 GLY HA3  H  -7.718   8.808 -12.776 1.00 . A A .  28 GLY HA3  1 1 
        1   439 1 1  28 GLY N    N  -7.949   6.757 -12.604 1.00 . A A .  28 GLY N    1 1 
        1   440 1 1  28 GLY O    O  -6.029   9.224 -10.922 1.00 . A A .  28 GLY O    1 1 
        1   441 1 1  29 ARG C    C  -3.936   6.041  -9.656 1.00 . A A .  29 ARG C    1 1 
        1   442 1 1  29 ARG CA   C  -5.154   6.952  -9.475 1.00 . A A .  29 ARG CA   1 1 
        1   443 1 1  29 ARG CB   C  -6.005   6.478  -8.266 1.00 . A A .  29 ARG CB   1 1 
        1   444 1 1  29 ARG CD   C  -4.672   7.858  -6.538 1.00 . A A .  29 ARG CD   1 1 
        1   445 1 1  29 ARG CG   C  -5.262   6.478  -6.901 1.00 . A A .  29 ARG CG   1 1 
        1   446 1 1  29 ARG CZ   C  -5.484  10.233  -6.625 1.00 . A A .  29 ARG CZ   1 1 
        1   447 1 1  29 ARG H    H  -6.256   6.107 -11.074 1.00 . A A .  29 ARG H    1 1 
        1   448 1 1  29 ARG HA   H  -4.806   7.970  -9.283 1.00 . A A .  29 ARG HA   1 1 
        1   449 1 1  29 ARG HB2  H  -6.870   7.127  -8.177 1.00 . A A .  29 ARG HB2  1 1 
        1   450 1 1  29 ARG HB3  H  -6.357   5.468  -8.461 1.00 . A A .  29 ARG HB3  1 1 
        1   451 1 1  29 ARG HD2  H  -4.222   7.797  -5.550 1.00 . A A .  29 ARG HD2  1 1 
        1   452 1 1  29 ARG HD3  H  -3.902   8.117  -7.260 1.00 . A A .  29 ARG HD3  1 1 
        1   453 1 1  29 ARG HE   H  -6.634   8.606  -6.429 1.00 . A A .  29 ARG HE   1 1 
        1   454 1 1  29 ARG HG2  H  -5.961   6.188  -6.123 1.00 . A A .  29 ARG HG2  1 1 
        1   455 1 1  29 ARG HG3  H  -4.458   5.748  -6.939 1.00 . A A .  29 ARG HG3  1 1 
        1   456 1 1  29 ARG HH11 H  -3.461  10.110  -6.736 1.00 . A A .  29 ARG HH11 1 1 
        1   457 1 1  29 ARG HH12 H  -4.108  11.720  -6.798 1.00 . A A .  29 ARG HH12 1 1 
        1   458 1 1  29 ARG HH21 H  -7.453  10.712  -6.605 1.00 . A A .  29 ARG HH21 1 1 
        1   459 1 1  29 ARG HH22 H  -6.363  12.057  -6.726 1.00 . A A .  29 ARG HH22 1 1 
        1   460 1 1  29 ARG N    N  -5.959   6.967 -10.705 1.00 . A A .  29 ARG N    1 1 
        1   461 1 1  29 ARG NE   N  -5.706   8.910  -6.527 1.00 . A A .  29 ARG NE   1 1 
        1   462 1 1  29 ARG NH1  N  -4.252  10.725  -6.727 1.00 . A A .  29 ARG NH1  1 1 
        1   463 1 1  29 ARG NH2  N  -6.514  11.064  -6.654 1.00 . A A .  29 ARG NH2  1 1 
        1   464 1 1  29 ARG O    O  -4.049   4.933 -10.202 1.00 . A A .  29 ARG O    1 1 
        1   465 1 1  30 GLU C    C  -1.718   4.822  -7.838 1.00 . A A .  30 GLU C    1 1 
        1   466 1 1  30 GLU CA   C  -1.565   5.728  -9.074 1.00 . A A .  30 GLU CA   1 1 
        1   467 1 1  30 GLU CB   C  -0.329   6.650  -8.930 1.00 . A A .  30 GLU CB   1 1 
        1   468 1 1  30 GLU CD   C   0.171   6.982 -11.435 1.00 . A A .  30 GLU CD   1 1 
        1   469 1 1  30 GLU CG   C  -0.109   7.653 -10.080 1.00 . A A .  30 GLU CG   1 1 
        1   470 1 1  30 GLU H    H  -2.740   7.465  -8.917 1.00 . A A .  30 GLU H    1 1 
        1   471 1 1  30 GLU HA   H  -1.458   5.116  -9.970 1.00 . A A .  30 GLU HA   1 1 
        1   472 1 1  30 GLU HB2  H  -0.433   7.220  -8.012 1.00 . A A .  30 GLU HB2  1 1 
        1   473 1 1  30 GLU HB3  H   0.561   6.031  -8.846 1.00 . A A .  30 GLU HB3  1 1 
        1   474 1 1  30 GLU HG2  H  -0.997   8.277 -10.165 1.00 . A A .  30 GLU HG2  1 1 
        1   475 1 1  30 GLU HG3  H   0.733   8.292  -9.827 1.00 . A A .  30 GLU HG3  1 1 
        1   476 1 1  30 GLU N    N  -2.774   6.529  -9.200 1.00 . A A .  30 GLU N    1 1 
        1   477 1 1  30 GLU O    O  -1.711   5.299  -6.698 1.00 . A A .  30 GLU O    1 1 
        1   478 1 1  30 GLU OE1  O   1.304   6.500 -11.646 1.00 . A A .  30 GLU OE1  1 1 
        1   479 1 1  30 GLU OE2  O  -0.733   6.935 -12.294 1.00 . A A .  30 GLU OE2  1 1 
        1   480 1 1  31 ILE C    C  -0.839   1.560  -7.213 1.00 . A A .  31 ILE C    1 1 
        1   481 1 1  31 ILE CA   C  -2.035   2.501  -7.034 1.00 . A A .  31 ILE CA   1 1 
        1   482 1 1  31 ILE CB   C  -3.401   1.725  -7.133 1.00 . A A .  31 ILE CB   1 1 
        1   483 1 1  31 ILE CD1  C  -5.960   2.104  -7.045 1.00 . A A .  31 ILE CD1  1 1 
        1   484 1 1  31 ILE CG1  C  -4.585   2.715  -6.898 1.00 . A A .  31 ILE CG1  1 1 
        1   485 1 1  31 ILE CG2  C  -3.465   0.524  -6.150 1.00 . A A .  31 ILE CG2  1 1 
        1   486 1 1  31 ILE H    H  -2.071   3.258  -9.010 1.00 . A A .  31 ILE H    1 1 
        1   487 1 1  31 ILE HA   H  -1.973   2.977  -6.052 1.00 . A A .  31 ILE HA   1 1 
        1   488 1 1  31 ILE HB   H  -3.483   1.326  -8.139 1.00 . A A .  31 ILE HB   1 1 
        1   489 1 1  31 ILE HD11 H  -6.065   1.686  -8.036 1.00 . A A .  31 ILE HD11 1 1 
        1   490 1 1  31 ILE HD12 H  -6.707   2.867  -6.896 1.00 . A A .  31 ILE HD12 1 1 
        1   491 1 1  31 ILE HD13 H  -6.094   1.320  -6.308 1.00 . A A .  31 ILE HD13 1 1 
        1   492 1 1  31 ILE HG12 H  -4.519   3.121  -5.896 1.00 . A A .  31 ILE HG12 1 1 
        1   493 1 1  31 ILE HG13 H  -4.515   3.532  -7.608 1.00 . A A .  31 ILE HG13 1 1 
        1   494 1 1  31 ILE HG21 H  -3.390   0.880  -5.130 1.00 . A A .  31 ILE HG21 1 1 
        1   495 1 1  31 ILE HG22 H  -2.643  -0.156  -6.347 1.00 . A A .  31 ILE HG22 1 1 
        1   496 1 1  31 ILE HG23 H  -4.400  -0.009  -6.277 1.00 . A A .  31 ILE HG23 1 1 
        1   497 1 1  31 ILE N    N  -1.954   3.536  -8.080 1.00 . A A .  31 ILE N    1 1 
        1   498 1 1  31 ILE O    O  -0.400   1.338  -8.345 1.00 . A A .  31 ILE O    1 1 
        1   499 1 1  32 ARG C    C   0.583  -1.221  -5.528 1.00 . A A .  32 ARG C    1 1 
        1   500 1 1  32 ARG CA   C   0.895   0.162  -6.108 1.00 . A A .  32 ARG CA   1 1 
        1   501 1 1  32 ARG CB   C   2.057   0.828  -5.320 1.00 . A A .  32 ARG CB   1 1 
        1   502 1 1  32 ARG CD   C   3.324   1.559  -7.428 1.00 . A A .  32 ARG CD   1 1 
        1   503 1 1  32 ARG CG   C   2.757   1.990  -6.058 1.00 . A A .  32 ARG CG   1 1 
        1   504 1 1  32 ARG CZ   C   5.646   2.231  -8.067 1.00 . A A .  32 ARG CZ   1 1 
        1   505 1 1  32 ARG H    H  -0.731   1.215  -5.240 1.00 . A A .  32 ARG H    1 1 
        1   506 1 1  32 ARG HA   H   1.212   0.021  -7.142 1.00 . A A .  32 ARG HA   1 1 
        1   507 1 1  32 ARG HB2  H   1.669   1.209  -4.380 1.00 . A A .  32 ARG HB2  1 1 
        1   508 1 1  32 ARG HB3  H   2.811   0.076  -5.094 1.00 . A A .  32 ARG HB3  1 1 
        1   509 1 1  32 ARG HD2  H   3.773   0.575  -7.332 1.00 . A A .  32 ARG HD2  1 1 
        1   510 1 1  32 ARG HD3  H   2.508   1.499  -8.140 1.00 . A A .  32 ARG HD3  1 1 
        1   511 1 1  32 ARG HE   H   4.007   3.381  -8.251 1.00 . A A .  32 ARG HE   1 1 
        1   512 1 1  32 ARG HG2  H   2.046   2.793  -6.207 1.00 . A A .  32 ARG HG2  1 1 
        1   513 1 1  32 ARG HG3  H   3.574   2.352  -5.438 1.00 . A A .  32 ARG HG3  1 1 
        1   514 1 1  32 ARG HH11 H   5.532   0.345  -7.316 1.00 . A A .  32 ARG HH11 1 1 
        1   515 1 1  32 ARG HH12 H   7.116   0.857  -7.780 1.00 . A A .  32 ARG HH12 1 1 
        1   516 1 1  32 ARG HH21 H   6.116   4.016  -8.886 1.00 . A A .  32 ARG HH21 1 1 
        1   517 1 1  32 ARG HH22 H   7.442   2.926  -8.663 1.00 . A A .  32 ARG HH22 1 1 
        1   518 1 1  32 ARG N    N  -0.297   1.033  -6.102 1.00 . A A .  32 ARG N    1 1 
        1   519 1 1  32 ARG NE   N   4.333   2.502  -7.954 1.00 . A A .  32 ARG NE   1 1 
        1   520 1 1  32 ARG NH1  N   6.137   1.051  -7.690 1.00 . A A .  32 ARG NH1  1 1 
        1   521 1 1  32 ARG NH2  N   6.463   3.131  -8.579 1.00 . A A .  32 ARG NH2  1 1 
        1   522 1 1  32 ARG O    O  -0.450  -1.425  -4.877 1.00 . A A .  32 ARG O    1 1 
        1   523 1 1  33 THR C    C   2.817  -4.122  -5.131 1.00 . A A .  33 THR C    1 1 
        1   524 1 1  33 THR CA   C   1.402  -3.549  -5.328 1.00 . A A .  33 THR CA   1 1 
        1   525 1 1  33 THR CB   C   0.600  -4.429  -6.347 1.00 . A A .  33 THR CB   1 1 
        1   526 1 1  33 THR CG2  C   0.367  -5.854  -5.809 1.00 . A A .  33 THR CG2  1 1 
        1   527 1 1  33 THR H    H   2.296  -1.908  -6.300 1.00 . A A .  33 THR H    1 1 
        1   528 1 1  33 THR HA   H   0.873  -3.558  -4.371 1.00 . A A .  33 THR HA   1 1 
        1   529 1 1  33 THR HB   H   1.163  -4.496  -7.272 1.00 . A A .  33 THR HB   1 1 
        1   530 1 1  33 THR HG1  H  -1.000  -3.375  -5.849 1.00 . A A .  33 THR HG1  1 1 
        1   531 1 1  33 THR HG21 H   1.321  -6.335  -5.618 1.00 . A A .  33 THR HG21 1 1 
        1   532 1 1  33 THR HG22 H  -0.183  -6.434  -6.538 1.00 . A A .  33 THR HG22 1 1 
        1   533 1 1  33 THR HG23 H  -0.200  -5.812  -4.888 1.00 . A A .  33 THR HG23 1 1 
        1   534 1 1  33 THR N    N   1.502  -2.163  -5.783 1.00 . A A .  33 THR N    1 1 
        1   535 1 1  33 THR O    O   3.539  -4.348  -6.111 1.00 . A A .  33 THR O    1 1 
        1   536 1 1  33 THR OG1  O  -0.669  -3.815  -6.639 1.00 . A A .  33 THR OG1  1 1 
        1   537 1 1  34 ALA C    C   4.621  -6.287  -3.208 1.00 . A A .  34 ALA C    1 1 
        1   538 1 1  34 ALA CA   C   4.585  -4.789  -3.542 1.00 . A A .  34 ALA CA   1 1 
        1   539 1 1  34 ALA CB   C   5.146  -3.974  -2.371 1.00 . A A .  34 ALA CB   1 1 
        1   540 1 1  34 ALA H    H   2.581  -4.208  -3.143 1.00 . A A .  34 ALA H    1 1 
        1   541 1 1  34 ALA HA   H   5.229  -4.608  -4.406 1.00 . A A .  34 ALA HA   1 1 
        1   542 1 1  34 ALA HB1  H   5.149  -2.924  -2.630 1.00 . A A .  34 ALA HB1  1 1 
        1   543 1 1  34 ALA HB2  H   6.163  -4.287  -2.157 1.00 . A A .  34 ALA HB2  1 1 
        1   544 1 1  34 ALA HB3  H   4.535  -4.121  -1.492 1.00 . A A .  34 ALA HB3  1 1 
        1   545 1 1  34 ALA N    N   3.223  -4.337  -3.871 1.00 . A A .  34 ALA N    1 1 
        1   546 1 1  34 ALA O    O   3.732  -6.806  -2.539 1.00 . A A .  34 ALA O    1 1 
        1   547 1 1  35 THR C    C   7.054  -8.330  -2.211 1.00 . A A .  35 THR C    1 1 
        1   548 1 1  35 THR CA   C   5.990  -8.345  -3.332 1.00 . A A .  35 THR CA   1 1 
        1   549 1 1  35 THR CB   C   6.521  -9.138  -4.576 1.00 . A A .  35 THR CB   1 1 
        1   550 1 1  35 THR CG2  C   6.902 -10.589  -4.234 1.00 . A A .  35 THR CG2  1 1 
        1   551 1 1  35 THR H    H   6.213  -6.521  -4.380 1.00 . A A .  35 THR H    1 1 
        1   552 1 1  35 THR HA   H   5.092  -8.837  -2.961 1.00 . A A .  35 THR HA   1 1 
        1   553 1 1  35 THR HB   H   7.401  -8.628  -4.952 1.00 . A A .  35 THR HB   1 1 
        1   554 1 1  35 THR HG1  H   4.647  -9.171  -5.224 1.00 . A A .  35 THR HG1  1 1 
        1   555 1 1  35 THR HG21 H   7.304 -11.074  -5.111 1.00 . A A .  35 THR HG21 1 1 
        1   556 1 1  35 THR HG22 H   6.029 -11.129  -3.898 1.00 . A A .  35 THR HG22 1 1 
        1   557 1 1  35 THR HG23 H   7.651 -10.596  -3.447 1.00 . A A .  35 THR HG23 1 1 
        1   558 1 1  35 THR N    N   5.654  -6.964  -3.712 1.00 . A A .  35 THR N    1 1 
        1   559 1 1  35 THR O    O   6.939  -9.055  -1.211 1.00 . A A .  35 THR O    1 1 
        1   560 1 1  35 THR OG1  O   5.529  -9.134  -5.617 1.00 . A A .  35 THR OG1  1 1 
        1   561 1 1  36 SER C    C   9.830  -5.991  -1.454 1.00 . A A .  36 SER C    1 1 
        1   562 1 1  36 SER CA   C   9.243  -7.414  -1.481 1.00 . A A .  36 SER CA   1 1 
        1   563 1 1  36 SER CB   C  10.312  -8.465  -1.899 1.00 . A A .  36 SER CB   1 1 
        1   564 1 1  36 SER H    H   8.065  -6.880  -3.166 1.00 . A A .  36 SER H    1 1 
        1   565 1 1  36 SER HA   H   8.901  -7.648  -0.476 1.00 . A A .  36 SER HA   1 1 
        1   566 1 1  36 SER HB2  H  10.653  -8.265  -2.906 1.00 . A A .  36 SER HB2  1 1 
        1   567 1 1  36 SER HB3  H  11.157  -8.413  -1.221 1.00 . A A .  36 SER HB3  1 1 
        1   568 1 1  36 SER HG   H   9.146  -9.857  -1.144 1.00 . A A .  36 SER HG   1 1 
        1   569 1 1  36 SER N    N   8.086  -7.486  -2.392 1.00 . A A .  36 SER N    1 1 
        1   570 1 1  36 SER O    O   9.271  -5.070  -2.069 1.00 . A A .  36 SER O    1 1 
        1   571 1 1  36 SER OG   O   9.790  -9.789  -1.861 1.00 . A A .  36 SER OG   1 1 
        1   572 1 1  37 SER C    C  12.087  -3.798  -1.735 1.00 . A A .  37 SER C    1 1 
        1   573 1 1  37 SER CA   C  11.637  -4.552  -0.460 1.00 . A A .  37 SER CA   1 1 
        1   574 1 1  37 SER CB   C  12.845  -4.793   0.467 1.00 . A A .  37 SER CB   1 1 
        1   575 1 1  37 SER H    H  11.377  -6.648  -0.349 1.00 . A A .  37 SER H    1 1 
        1   576 1 1  37 SER HA   H  10.922  -3.932   0.071 1.00 . A A .  37 SER HA   1 1 
        1   577 1 1  37 SER HB2  H  13.590  -5.383  -0.049 1.00 . A A .  37 SER HB2  1 1 
        1   578 1 1  37 SER HB3  H  13.273  -3.844   0.757 1.00 . A A .  37 SER HB3  1 1 
        1   579 1 1  37 SER HG   H  11.526  -5.705   1.599 1.00 . A A .  37 SER HG   1 1 
        1   580 1 1  37 SER N    N  10.971  -5.842  -0.735 1.00 . A A .  37 SER N    1 1 
        1   581 1 1  37 SER O    O  12.244  -2.576  -1.696 1.00 . A A .  37 SER O    1 1 
        1   582 1 1  37 SER OG   O  12.465  -5.492   1.640 1.00 . A A .  37 SER OG   1 1 
        1   583 1 1  38 GLN C    C  11.517  -3.031  -4.613 1.00 . A A .  38 GLN C    1 1 
        1   584 1 1  38 GLN CA   C  12.633  -3.988  -4.160 1.00 . A A .  38 GLN CA   1 1 
        1   585 1 1  38 GLN CB   C  12.825  -5.158  -5.173 1.00 . A A .  38 GLN CB   1 1 
        1   586 1 1  38 GLN CD   C  14.195  -3.914  -6.987 1.00 . A A .  38 GLN CD   1 1 
        1   587 1 1  38 GLN CG   C  12.964  -4.764  -6.665 1.00 . A A .  38 GLN CG   1 1 
        1   588 1 1  38 GLN H    H  12.263  -5.521  -2.742 1.00 . A A .  38 GLN H    1 1 
        1   589 1 1  38 GLN HA   H  13.564  -3.435  -4.071 1.00 . A A .  38 GLN HA   1 1 
        1   590 1 1  38 GLN HB2  H  13.716  -5.709  -4.893 1.00 . A A .  38 GLN HB2  1 1 
        1   591 1 1  38 GLN HB3  H  11.978  -5.831  -5.083 1.00 . A A .  38 GLN HB3  1 1 
        1   592 1 1  38 GLN HE21 H  15.295  -5.536  -7.323 1.00 . A A .  38 GLN HE21 1 1 
        1   593 1 1  38 GLN HE22 H  16.094  -4.021  -7.540 1.00 . A A .  38 GLN HE22 1 1 
        1   594 1 1  38 GLN HG2  H  13.013  -5.670  -7.262 1.00 . A A .  38 GLN HG2  1 1 
        1   595 1 1  38 GLN HG3  H  12.077  -4.209  -6.959 1.00 . A A .  38 GLN HG3  1 1 
        1   596 1 1  38 GLN N    N  12.311  -4.548  -2.832 1.00 . A A .  38 GLN N    1 1 
        1   597 1 1  38 GLN NE2  N  15.307  -4.555  -7.311 1.00 . A A .  38 GLN NE2  1 1 
        1   598 1 1  38 GLN O    O  11.776  -1.863  -4.950 1.00 . A A .  38 GLN O    1 1 
        1   599 1 1  38 GLN OE1  O  14.149  -2.687  -6.941 1.00 . A A .  38 GLN OE1  1 1 
        1   600 1 1  39 ASP C    C   8.869  -1.632  -3.944 1.00 . A A .  39 ASP C    1 1 
        1   601 1 1  39 ASP CA   C   9.077  -2.773  -4.936 1.00 . A A .  39 ASP CA   1 1 
        1   602 1 1  39 ASP CB   C   7.817  -3.672  -4.957 1.00 . A A .  39 ASP CB   1 1 
        1   603 1 1  39 ASP CG   C   7.979  -4.924  -5.822 1.00 . A A .  39 ASP CG   1 1 
        1   604 1 1  39 ASP H    H  10.153  -4.466  -4.258 1.00 . A A .  39 ASP H    1 1 
        1   605 1 1  39 ASP HA   H   9.241  -2.364  -5.931 1.00 . A A .  39 ASP HA   1 1 
        1   606 1 1  39 ASP HB2  H   7.578  -3.975  -3.939 1.00 . A A .  39 ASP HB2  1 1 
        1   607 1 1  39 ASP HB3  H   6.980  -3.099  -5.344 1.00 . A A .  39 ASP HB3  1 1 
        1   608 1 1  39 ASP N    N  10.271  -3.541  -4.564 1.00 . A A .  39 ASP N    1 1 
        1   609 1 1  39 ASP O    O   8.690  -0.496  -4.352 1.00 . A A .  39 ASP O    1 1 
        1   610 1 1  39 ASP OD1  O   7.981  -4.807  -7.065 1.00 . A A .  39 ASP OD1  1 1 
        1   611 1 1  39 ASP OD2  O   8.092  -6.036  -5.266 1.00 . A A .  39 ASP OD2  1 1 
        1   612 1 1  40 ILE C    C   9.617   0.270  -1.729 1.00 . A A .  40 ILE C    1 1 
        1   613 1 1  40 ILE CA   C   8.802  -1.035  -1.503 1.00 . A A .  40 ILE CA   1 1 
        1   614 1 1  40 ILE CB   C   9.277  -1.747  -0.172 1.00 . A A .  40 ILE CB   1 1 
        1   615 1 1  40 ILE CD1  C   6.888  -2.471   0.639 1.00 . A A .  40 ILE CD1  1 1 
        1   616 1 1  40 ILE CG1  C   8.299  -2.900   0.265 1.00 . A A .  40 ILE CG1  1 1 
        1   617 1 1  40 ILE CG2  C   9.538  -0.756   0.977 1.00 . A A .  40 ILE CG2  1 1 
        1   618 1 1  40 ILE H    H   9.100  -2.919  -2.427 1.00 . A A .  40 ILE H    1 1 
        1   619 1 1  40 ILE HA   H   7.753  -0.785  -1.404 1.00 . A A .  40 ILE HA   1 1 
        1   620 1 1  40 ILE HB   H  10.238  -2.205  -0.400 1.00 . A A .  40 ILE HB   1 1 
        1   621 1 1  40 ILE HD11 H   6.315  -3.343   0.916 1.00 . A A .  40 ILE HD11 1 1 
        1   622 1 1  40 ILE HD12 H   6.414  -1.985  -0.203 1.00 . A A .  40 ILE HD12 1 1 
        1   623 1 1  40 ILE HD13 H   6.924  -1.787   1.477 1.00 . A A .  40 ILE HD13 1 1 
        1   624 1 1  40 ILE HG12 H   8.204  -3.609  -0.547 1.00 . A A .  40 ILE HG12 1 1 
        1   625 1 1  40 ILE HG13 H   8.718  -3.414   1.121 1.00 . A A .  40 ILE HG13 1 1 
        1   626 1 1  40 ILE HG21 H  10.308  -0.048   0.688 1.00 . A A .  40 ILE HG21 1 1 
        1   627 1 1  40 ILE HG22 H   9.868  -1.293   1.858 1.00 . A A .  40 ILE HG22 1 1 
        1   628 1 1  40 ILE HG23 H   8.630  -0.215   1.209 1.00 . A A .  40 ILE HG23 1 1 
        1   629 1 1  40 ILE N    N   8.938  -1.975  -2.638 1.00 . A A .  40 ILE N    1 1 
        1   630 1 1  40 ILE O    O   9.077   1.378  -1.623 1.00 . A A .  40 ILE O    1 1 
        1   631 1 1  41 ARG C    C  11.526   1.960  -3.617 1.00 . A A .  41 ARG C    1 1 
        1   632 1 1  41 ARG CA   C  11.838   1.224  -2.297 1.00 . A A .  41 ARG CA   1 1 
        1   633 1 1  41 ARG CB   C  13.304   0.712  -2.263 1.00 . A A .  41 ARG CB   1 1 
        1   634 1 1  41 ARG CD   C  15.193  -0.331  -0.854 1.00 . A A .  41 ARG CD   1 1 
        1   635 1 1  41 ARG CG   C  13.789   0.304  -0.852 1.00 . A A .  41 ARG CG   1 1 
        1   636 1 1  41 ARG CZ   C  15.732  -1.369   1.380 1.00 . A A .  41 ARG CZ   1 1 
        1   637 1 1  41 ARG H    H  11.239  -0.808  -2.192 1.00 . A A .  41 ARG H    1 1 
        1   638 1 1  41 ARG HA   H  11.697   1.928  -1.477 1.00 . A A .  41 ARG HA   1 1 
        1   639 1 1  41 ARG HB2  H  13.390  -0.150  -2.919 1.00 . A A .  41 ARG HB2  1 1 
        1   640 1 1  41 ARG HB3  H  13.963   1.494  -2.631 1.00 . A A .  41 ARG HB3  1 1 
        1   641 1 1  41 ARG HD2  H  15.122  -1.343  -1.239 1.00 . A A .  41 ARG HD2  1 1 
        1   642 1 1  41 ARG HD3  H  15.842   0.247  -1.501 1.00 . A A .  41 ARG HD3  1 1 
        1   643 1 1  41 ARG HE   H  16.270   0.454   0.770 1.00 . A A .  41 ARG HE   1 1 
        1   644 1 1  41 ARG HG2  H  13.811   1.188  -0.223 1.00 . A A .  41 ARG HG2  1 1 
        1   645 1 1  41 ARG HG3  H  13.085  -0.409  -0.429 1.00 . A A .  41 ARG HG3  1 1 
        1   646 1 1  41 ARG HH11 H  14.653  -2.611   0.204 1.00 . A A .  41 ARG HH11 1 1 
        1   647 1 1  41 ARG HH12 H  15.067  -3.246   1.764 1.00 . A A .  41 ARG HH12 1 1 
        1   648 1 1  41 ARG HH21 H  16.805  -0.377   2.787 1.00 . A A .  41 ARG HH21 1 1 
        1   649 1 1  41 ARG HH22 H  16.294  -1.972   3.231 1.00 . A A .  41 ARG HH22 1 1 
        1   650 1 1  41 ARG N    N  10.906   0.104  -2.073 1.00 . A A .  41 ARG N    1 1 
        1   651 1 1  41 ARG NE   N  15.790  -0.359   0.499 1.00 . A A .  41 ARG NE   1 1 
        1   652 1 1  41 ARG NH1  N  15.098  -2.497   1.094 1.00 . A A .  41 ARG NH1  1 1 
        1   653 1 1  41 ARG NH2  N  16.324  -1.229   2.560 1.00 . A A .  41 ARG NH2  1 1 
        1   654 1 1  41 ARG O    O  11.651   3.185  -3.685 1.00 . A A .  41 ARG O    1 1 
        1   655 1 1  42 ASP C    C   9.425   2.687  -5.779 1.00 . A A .  42 ASP C    1 1 
        1   656 1 1  42 ASP CA   C  10.677   1.776  -5.956 1.00 . A A .  42 ASP CA   1 1 
        1   657 1 1  42 ASP CB   C  10.396   0.629  -6.971 1.00 . A A .  42 ASP CB   1 1 
        1   658 1 1  42 ASP CG   C  10.036   1.131  -8.388 1.00 . A A .  42 ASP CG   1 1 
        1   659 1 1  42 ASP H    H  11.084   0.226  -4.545 1.00 . A A .  42 ASP H    1 1 
        1   660 1 1  42 ASP HA   H  11.500   2.383  -6.330 1.00 . A A .  42 ASP HA   1 1 
        1   661 1 1  42 ASP HB2  H  11.277  -0.003  -7.043 1.00 . A A .  42 ASP HB2  1 1 
        1   662 1 1  42 ASP HB3  H   9.578   0.017  -6.598 1.00 . A A .  42 ASP HB3  1 1 
        1   663 1 1  42 ASP N    N  11.105   1.204  -4.653 1.00 . A A .  42 ASP N    1 1 
        1   664 1 1  42 ASP O    O   9.261   3.686  -6.493 1.00 . A A .  42 ASP O    1 1 
        1   665 1 1  42 ASP OD1  O  10.945   1.337  -9.211 1.00 . A A .  42 ASP OD1  1 1 
        1   666 1 1  42 ASP OD2  O   8.848   1.334  -8.681 1.00 . A A .  42 ASP OD2  1 1 
        1   667 1 1  43 ILE C    C   7.631   4.380  -3.744 1.00 . A A .  43 ILE C    1 1 
        1   668 1 1  43 ILE CA   C   7.330   3.046  -4.459 1.00 . A A .  43 ILE CA   1 1 
        1   669 1 1  43 ILE CB   C   6.415   2.142  -3.545 1.00 . A A .  43 ILE CB   1 1 
        1   670 1 1  43 ILE CD1  C   5.322  -0.215  -3.445 1.00 . A A .  43 ILE CD1  1 1 
        1   671 1 1  43 ILE CG1  C   5.956   0.860  -4.314 1.00 . A A .  43 ILE CG1  1 1 
        1   672 1 1  43 ILE CG2  C   5.202   2.925  -2.996 1.00 . A A .  43 ILE CG2  1 1 
        1   673 1 1  43 ILE H    H   8.806   1.539  -4.257 1.00 . A A .  43 ILE H    1 1 
        1   674 1 1  43 ILE HA   H   6.795   3.248  -5.384 1.00 . A A .  43 ILE HA   1 1 
        1   675 1 1  43 ILE HB   H   7.013   1.831  -2.691 1.00 . A A .  43 ILE HB   1 1 
        1   676 1 1  43 ILE HD11 H   6.005  -0.495  -2.656 1.00 . A A .  43 ILE HD11 1 1 
        1   677 1 1  43 ILE HD12 H   5.103  -1.080  -4.052 1.00 . A A .  43 ILE HD12 1 1 
        1   678 1 1  43 ILE HD13 H   4.406   0.160  -3.016 1.00 . A A .  43 ILE HD13 1 1 
        1   679 1 1  43 ILE HG12 H   5.232   1.135  -5.068 1.00 . A A .  43 ILE HG12 1 1 
        1   680 1 1  43 ILE HG13 H   6.811   0.413  -4.806 1.00 . A A .  43 ILE HG13 1 1 
        1   681 1 1  43 ILE HG21 H   4.617   2.286  -2.351 1.00 . A A .  43 ILE HG21 1 1 
        1   682 1 1  43 ILE HG22 H   4.584   3.260  -3.817 1.00 . A A .  43 ILE HG22 1 1 
        1   683 1 1  43 ILE HG23 H   5.542   3.785  -2.431 1.00 . A A .  43 ILE HG23 1 1 
        1   684 1 1  43 ILE N    N   8.578   2.330  -4.792 1.00 . A A .  43 ILE N    1 1 
        1   685 1 1  43 ILE O    O   7.123   5.430  -4.138 1.00 . A A .  43 ILE O    1 1 
        1   686 1 1  44 ILE C    C   9.674   6.484  -2.784 1.00 . A A .  44 ILE C    1 1 
        1   687 1 1  44 ILE CA   C   8.864   5.492  -1.895 1.00 . A A .  44 ILE CA   1 1 
        1   688 1 1  44 ILE CB   C   9.665   5.019  -0.614 1.00 . A A .  44 ILE CB   1 1 
        1   689 1 1  44 ILE CD1  C   9.477   3.396   1.430 1.00 . A A .  44 ILE CD1  1 1 
        1   690 1 1  44 ILE CG1  C   8.769   4.061   0.257 1.00 . A A .  44 ILE CG1  1 1 
        1   691 1 1  44 ILE CG2  C  10.184   6.214   0.227 1.00 . A A .  44 ILE CG2  1 1 
        1   692 1 1  44 ILE H    H   8.826   3.437  -2.439 1.00 . A A .  44 ILE H    1 1 
        1   693 1 1  44 ILE HA   H   7.954   5.990  -1.562 1.00 . A A .  44 ILE HA   1 1 
        1   694 1 1  44 ILE HB   H  10.531   4.458  -0.957 1.00 . A A .  44 ILE HB   1 1 
        1   695 1 1  44 ILE HD11 H   9.829   4.150   2.123 1.00 . A A .  44 ILE HD11 1 1 
        1   696 1 1  44 ILE HD12 H  10.316   2.820   1.066 1.00 . A A .  44 ILE HD12 1 1 
        1   697 1 1  44 ILE HD13 H   8.787   2.738   1.939 1.00 . A A .  44 ILE HD13 1 1 
        1   698 1 1  44 ILE HG12 H   7.934   4.618   0.662 1.00 . A A .  44 ILE HG12 1 1 
        1   699 1 1  44 ILE HG13 H   8.380   3.268  -0.373 1.00 . A A .  44 ILE HG13 1 1 
        1   700 1 1  44 ILE HG21 H  10.749   5.849   1.080 1.00 . A A .  44 ILE HG21 1 1 
        1   701 1 1  44 ILE HG22 H   9.348   6.802   0.583 1.00 . A A .  44 ILE HG22 1 1 
        1   702 1 1  44 ILE HG23 H  10.826   6.840  -0.381 1.00 . A A .  44 ILE HG23 1 1 
        1   703 1 1  44 ILE N    N   8.463   4.314  -2.693 1.00 . A A .  44 ILE N    1 1 
        1   704 1 1  44 ILE O    O   9.572   7.712  -2.635 1.00 . A A .  44 ILE O    1 1 
        1   705 1 1  45 LYS C    C  10.114   7.355  -5.777 1.00 . A A .  45 LYS C    1 1 
        1   706 1 1  45 LYS CA   C  11.122   6.685  -4.810 1.00 . A A .  45 LYS CA   1 1 
        1   707 1 1  45 LYS CB   C  12.129   5.741  -5.543 1.00 . A A .  45 LYS CB   1 1 
        1   708 1 1  45 LYS CD   C  12.148   6.028  -8.137 1.00 . A A .  45 LYS CD   1 1 
        1   709 1 1  45 LYS CE   C  12.081   4.519  -8.451 1.00 . A A .  45 LYS CE   1 1 
        1   710 1 1  45 LYS CG   C  12.867   6.328  -6.789 1.00 . A A .  45 LYS CG   1 1 
        1   711 1 1  45 LYS H    H  10.484   4.944  -3.781 1.00 . A A .  45 LYS H    1 1 
        1   712 1 1  45 LYS HA   H  11.687   7.468  -4.316 1.00 . A A .  45 LYS HA   1 1 
        1   713 1 1  45 LYS HB2  H  12.885   5.446  -4.822 1.00 . A A .  45 LYS HB2  1 1 
        1   714 1 1  45 LYS HB3  H  11.598   4.843  -5.847 1.00 . A A .  45 LYS HB3  1 1 
        1   715 1 1  45 LYS HD2  H  11.137   6.417  -8.087 1.00 . A A .  45 LYS HD2  1 1 
        1   716 1 1  45 LYS HD3  H  12.681   6.531  -8.937 1.00 . A A .  45 LYS HD3  1 1 
        1   717 1 1  45 LYS HE2  H  13.088   4.135  -8.568 1.00 . A A .  45 LYS HE2  1 1 
        1   718 1 1  45 LYS HE3  H  11.601   4.003  -7.628 1.00 . A A .  45 LYS HE3  1 1 
        1   719 1 1  45 LYS HG2  H  12.944   7.403  -6.674 1.00 . A A .  45 LYS HG2  1 1 
        1   720 1 1  45 LYS HG3  H  13.872   5.912  -6.831 1.00 . A A .  45 LYS HG3  1 1 
        1   721 1 1  45 LYS HZ1  H  11.326   3.209  -9.892 1.00 . A A .  45 LYS HZ1  1 1 
        1   722 1 1  45 LYS HZ2  H  11.751   4.726 -10.503 1.00 . A A .  45 LYS HZ2  1 1 
        1   723 1 1  45 LYS HZ3  H  10.338   4.545  -9.596 1.00 . A A .  45 LYS HZ3  1 1 
        1   724 1 1  45 LYS N    N  10.416   5.921  -3.761 1.00 . A A .  45 LYS N    1 1 
        1   725 1 1  45 LYS NZ   N  11.322   4.231  -9.697 1.00 . A A .  45 LYS NZ   1 1 
        1   726 1 1  45 LYS O    O  10.333   8.490  -6.215 1.00 . A A .  45 LYS O    1 1 
        1   727 1 1  46 SER C    C   7.240   8.423  -6.231 1.00 . A A .  46 SER C    1 1 
        1   728 1 1  46 SER CA   C   7.904   7.197  -6.919 1.00 . A A .  46 SER CA   1 1 
        1   729 1 1  46 SER CB   C   6.860   6.089  -7.194 1.00 . A A .  46 SER CB   1 1 
        1   730 1 1  46 SER H    H   8.932   5.726  -5.764 1.00 . A A .  46 SER H    1 1 
        1   731 1 1  46 SER HA   H   8.330   7.517  -7.863 1.00 . A A .  46 SER HA   1 1 
        1   732 1 1  46 SER HB2  H   7.358   5.231  -7.626 1.00 . A A .  46 SER HB2  1 1 
        1   733 1 1  46 SER HB3  H   6.387   5.790  -6.265 1.00 . A A .  46 SER HB3  1 1 
        1   734 1 1  46 SER HG   H   6.260   6.689  -8.958 1.00 . A A .  46 SER HG   1 1 
        1   735 1 1  46 SER N    N   9.008   6.649  -6.091 1.00 . A A .  46 SER N    1 1 
        1   736 1 1  46 SER O    O   6.694   9.316  -6.899 1.00 . A A .  46 SER O    1 1 
        1   737 1 1  46 SER OG   O   5.856   6.515  -8.096 1.00 . A A .  46 SER OG   1 1 
        1   738 1 1  47 MET C    C   7.823  10.726  -4.074 1.00 . A A .  47 MET C    1 1 
        1   739 1 1  47 MET CA   C   6.814   9.561  -4.059 1.00 . A A .  47 MET CA   1 1 
        1   740 1 1  47 MET CB   C   6.568   9.079  -2.606 1.00 . A A .  47 MET CB   1 1 
        1   741 1 1  47 MET CE   C   4.426   8.604  -0.187 1.00 . A A .  47 MET CE   1 1 
        1   742 1 1  47 MET CG   C   5.679   7.835  -2.515 1.00 . A A .  47 MET CG   1 1 
        1   743 1 1  47 MET H    H   7.715   7.679  -4.431 1.00 . A A .  47 MET H    1 1 
        1   744 1 1  47 MET HA   H   5.874   9.907  -4.479 1.00 . A A .  47 MET HA   1 1 
        1   745 1 1  47 MET HB2  H   7.520   8.843  -2.141 1.00 . A A .  47 MET HB2  1 1 
        1   746 1 1  47 MET HB3  H   6.095   9.876  -2.040 1.00 . A A .  47 MET HB3  1 1 
        1   747 1 1  47 MET HE1  H   4.161   8.390   0.836 1.00 . A A .  47 MET HE1  1 1 
        1   748 1 1  47 MET HE2  H   3.524   8.700  -0.776 1.00 . A A .  47 MET HE2  1 1 
        1   749 1 1  47 MET HE3  H   4.984   9.529  -0.228 1.00 . A A .  47 MET HE3  1 1 
        1   750 1 1  47 MET HG2  H   4.715   8.057  -2.953 1.00 . A A .  47 MET HG2  1 1 
        1   751 1 1  47 MET HG3  H   6.143   7.033  -3.071 1.00 . A A .  47 MET HG3  1 1 
        1   752 1 1  47 MET N    N   7.307   8.445  -4.884 1.00 . A A .  47 MET N    1 1 
        1   753 1 1  47 MET O    O   7.437  11.889  -3.960 1.00 . A A .  47 MET O    1 1 
        1   754 1 1  47 MET SD   S   5.420   7.270  -0.828 1.00 . A A .  47 MET SD   1 1 
        1   755 1 1  48 LYS C    C  10.117  12.182  -5.661 1.00 . A A .  48 LYS C    1 1 
        1   756 1 1  48 LYS CA   C  10.202  11.403  -4.328 1.00 . A A .  48 LYS CA   1 1 
        1   757 1 1  48 LYS CB   C  11.607  10.760  -4.201 1.00 . A A .  48 LYS CB   1 1 
        1   758 1 1  48 LYS CD   C  11.568  10.913  -1.643 1.00 . A A .  48 LYS CD   1 1 
        1   759 1 1  48 LYS CE   C  12.035  10.249  -0.353 1.00 . A A .  48 LYS CE   1 1 
        1   760 1 1  48 LYS CG   C  11.859  10.029  -2.876 1.00 . A A .  48 LYS CG   1 1 
        1   761 1 1  48 LYS H    H   9.379   9.446  -4.057 1.00 . A A .  48 LYS H    1 1 
        1   762 1 1  48 LYS HA   H  10.086  12.117  -3.517 1.00 . A A .  48 LYS HA   1 1 
        1   763 1 1  48 LYS HB2  H  11.745  10.047  -5.010 1.00 . A A .  48 LYS HB2  1 1 
        1   764 1 1  48 LYS HB3  H  12.360  11.540  -4.302 1.00 . A A .  48 LYS HB3  1 1 
        1   765 1 1  48 LYS HD2  H  12.082  11.865  -1.754 1.00 . A A .  48 LYS HD2  1 1 
        1   766 1 1  48 LYS HD3  H  10.497  11.095  -1.581 1.00 . A A .  48 LYS HD3  1 1 
        1   767 1 1  48 LYS HE2  H  11.778  10.879   0.490 1.00 . A A .  48 LYS HE2  1 1 
        1   768 1 1  48 LYS HE3  H  11.543   9.289  -0.245 1.00 . A A .  48 LYS HE3  1 1 
        1   769 1 1  48 LYS HG2  H  11.222   9.151  -2.836 1.00 . A A .  48 LYS HG2  1 1 
        1   770 1 1  48 LYS HG3  H  12.898   9.712  -2.849 1.00 . A A .  48 LYS HG3  1 1 
        1   771 1 1  48 LYS HZ1  H  13.789   9.527  -1.221 1.00 . A A .  48 LYS HZ1  1 1 
        1   772 1 1  48 LYS HZ2  H  13.794   9.482   0.464 1.00 . A A .  48 LYS HZ2  1 1 
        1   773 1 1  48 LYS HZ3  H  13.999  10.947  -0.335 1.00 . A A .  48 LYS HZ3  1 1 
        1   774 1 1  48 LYS N    N   9.126  10.393  -4.166 1.00 . A A .  48 LYS N    1 1 
        1   775 1 1  48 LYS NZ   N  13.504  10.036  -0.362 1.00 . A A .  48 LYS NZ   1 1 
        1   776 1 1  48 LYS O    O  10.433  13.379  -5.690 1.00 . A A .  48 LYS O    1 1 
        1   777 1 1  49 ASP C    C   8.738  13.317  -8.171 1.00 . A A .  49 ASP C    1 1 
        1   778 1 1  49 ASP CA   C   9.673  12.087  -8.119 1.00 . A A .  49 ASP CA   1 1 
        1   779 1 1  49 ASP CB   C   9.249  11.030  -9.176 1.00 . A A .  49 ASP CB   1 1 
        1   780 1 1  49 ASP CG   C  10.244   9.861  -9.309 1.00 . A A .  49 ASP CG   1 1 
        1   781 1 1  49 ASP H    H   9.448  10.552  -6.649 1.00 . A A .  49 ASP H    1 1 
        1   782 1 1  49 ASP HA   H  10.680  12.423  -8.353 1.00 . A A .  49 ASP HA   1 1 
        1   783 1 1  49 ASP HB2  H   8.275  10.633  -8.904 1.00 . A A .  49 ASP HB2  1 1 
        1   784 1 1  49 ASP HB3  H   9.164  11.509 -10.148 1.00 . A A .  49 ASP HB3  1 1 
        1   785 1 1  49 ASP N    N   9.719  11.491  -6.758 1.00 . A A .  49 ASP N    1 1 
        1   786 1 1  49 ASP O    O   9.070  14.336  -8.785 1.00 . A A .  49 ASP O    1 1 
        1   787 1 1  49 ASP OD1  O  11.449  10.109  -9.529 1.00 . A A .  49 ASP OD1  1 1 
        1   788 1 1  49 ASP OD2  O   9.825   8.692  -9.242 1.00 . A A .  49 ASP OD2  1 1 
        1   789 1 1  50 ASN C    C   5.963  14.142  -5.925 1.00 . A A .  50 ASN C    1 1 
        1   790 1 1  50 ASN CA   C   6.658  14.337  -7.274 1.00 . A A .  50 ASN CA   1 1 
        1   791 1 1  50 ASN CB   C   5.611  14.480  -8.416 1.00 . A A .  50 ASN CB   1 1 
        1   792 1 1  50 ASN CG   C   4.653  15.667  -8.206 1.00 . A A .  50 ASN CG   1 1 
        1   793 1 1  50 ASN H    H   7.339  12.327  -7.137 1.00 . A A .  50 ASN H    1 1 
        1   794 1 1  50 ASN HA   H   7.252  15.250  -7.222 1.00 . A A .  50 ASN HA   1 1 
        1   795 1 1  50 ASN HB2  H   6.132  14.615  -9.356 1.00 . A A .  50 ASN HB2  1 1 
        1   796 1 1  50 ASN HB3  H   5.025  13.567  -8.471 1.00 . A A .  50 ASN HB3  1 1 
        1   797 1 1  50 ASN HD21 H   5.912  16.903  -9.119 1.00 . A A .  50 ASN HD21 1 1 
        1   798 1 1  50 ASN HD22 H   4.451  17.616  -8.533 1.00 . A A .  50 ASN HD22 1 1 
        1   799 1 1  50 ASN N    N   7.579  13.204  -7.504 1.00 . A A .  50 ASN N    1 1 
        1   800 1 1  50 ASN ND2  N   5.041  16.845  -8.670 1.00 . A A .  50 ASN ND2  1 1 
        1   801 1 1  50 ASN O    O   6.126  14.950  -5.006 1.00 . A A .  50 ASN O    1 1 
        1   802 1 1  50 ASN OD1  O   3.578  15.527  -7.619 1.00 . A A .  50 ASN OD1  1 1 
        1   803 1 1  51 GLY C    C   2.977  12.662  -4.824 1.00 . A A .  51 GLY C    1 1 
        1   804 1 1  51 GLY CA   C   4.473  12.688  -4.604 1.00 . A A .  51 GLY CA   1 1 
        1   805 1 1  51 GLY H    H   5.142  12.450  -6.598 1.00 . A A .  51 GLY H    1 1 
        1   806 1 1  51 GLY HA2  H   4.806  11.714  -4.277 1.00 . A A .  51 GLY HA2  1 1 
        1   807 1 1  51 GLY HA3  H   4.693  13.399  -3.815 1.00 . A A .  51 GLY HA3  1 1 
        1   808 1 1  51 GLY N    N   5.208  13.037  -5.822 1.00 . A A .  51 GLY N    1 1 
        1   809 1 1  51 GLY O    O   2.346  13.714  -4.934 1.00 . A A .  51 GLY O    1 1 
        1   810 1 1  52 LYS C    C   0.395  10.347  -3.958 1.00 . A A .  52 LYS C    1 1 
        1   811 1 1  52 LYS CA   C   0.974  11.218  -5.104 1.00 . A A .  52 LYS CA   1 1 
        1   812 1 1  52 LYS CB   C   0.728  10.534  -6.491 1.00 . A A .  52 LYS CB   1 1 
        1   813 1 1  52 LYS CD   C   2.759   8.953  -6.946 1.00 . A A .  52 LYS CD   1 1 
        1   814 1 1  52 LYS CE   C   3.097   9.340  -8.399 1.00 . A A .  52 LYS CE   1 1 
        1   815 1 1  52 LYS CG   C   1.245   9.077  -6.624 1.00 . A A .  52 LYS CG   1 1 
        1   816 1 1  52 LYS H    H   2.990  10.668  -4.762 1.00 . A A .  52 LYS H    1 1 
        1   817 1 1  52 LYS HA   H   0.466  12.181  -5.092 1.00 . A A .  52 LYS HA   1 1 
        1   818 1 1  52 LYS HB2  H  -0.343  10.525  -6.678 1.00 . A A .  52 LYS HB2  1 1 
        1   819 1 1  52 LYS HB3  H   1.197  11.135  -7.260 1.00 . A A .  52 LYS HB3  1 1 
        1   820 1 1  52 LYS HD2  H   3.314   9.599  -6.274 1.00 . A A .  52 LYS HD2  1 1 
        1   821 1 1  52 LYS HD3  H   3.066   7.926  -6.777 1.00 . A A .  52 LYS HD3  1 1 
        1   822 1 1  52 LYS HE2  H   2.432   8.812  -9.073 1.00 . A A .  52 LYS HE2  1 1 
        1   823 1 1  52 LYS HE3  H   2.960  10.407  -8.526 1.00 . A A .  52 LYS HE3  1 1 
        1   824 1 1  52 LYS HG2  H   1.049   8.554  -5.695 1.00 . A A .  52 LYS HG2  1 1 
        1   825 1 1  52 LYS HG3  H   0.681   8.587  -7.414 1.00 . A A .  52 LYS HG3  1 1 
        1   826 1 1  52 LYS HZ1  H   4.656   7.972  -8.611 1.00 . A A .  52 LYS HZ1  1 1 
        1   827 1 1  52 LYS HZ2  H   5.165   9.515  -8.153 1.00 . A A .  52 LYS HZ2  1 1 
        1   828 1 1  52 LYS HZ3  H   4.690   9.220  -9.746 1.00 . A A .  52 LYS HZ3  1 1 
        1   829 1 1  52 LYS N    N   2.415  11.449  -4.885 1.00 . A A .  52 LYS N    1 1 
        1   830 1 1  52 LYS NZ   N   4.497   8.989  -8.750 1.00 . A A .  52 LYS NZ   1 1 
        1   831 1 1  52 LYS O    O   1.167   9.675  -3.244 1.00 . A A .  52 LYS O    1 1 
        1   832 1 1  53 PRO C    C  -1.516   7.954  -3.424 1.00 . A A .  53 PRO C    1 1 
        1   833 1 1  53 PRO CA   C  -1.649   9.390  -2.863 1.00 . A A .  53 PRO CA   1 1 
        1   834 1 1  53 PRO CB   C  -3.137   9.862  -2.856 1.00 . A A .  53 PRO CB   1 1 
        1   835 1 1  53 PRO CD   C  -1.925  11.398  -4.242 1.00 . A A .  53 PRO CD   1 1 
        1   836 1 1  53 PRO CG   C  -3.087  11.305  -3.276 1.00 . A A .  53 PRO CG   1 1 
        1   837 1 1  53 PRO HA   H  -1.251   9.421  -1.850 1.00 . A A .  53 PRO HA   1 1 
        1   838 1 1  53 PRO HB2  H  -3.725   9.273  -3.563 1.00 . A A .  53 PRO HB2  1 1 
        1   839 1 1  53 PRO HB3  H  -3.563   9.771  -1.865 1.00 . A A .  53 PRO HB3  1 1 
        1   840 1 1  53 PRO HD2  H  -2.241  11.151  -5.255 1.00 . A A .  53 PRO HD2  1 1 
        1   841 1 1  53 PRO HD3  H  -1.485  12.390  -4.223 1.00 . A A .  53 PRO HD3  1 1 
        1   842 1 1  53 PRO HG2  H  -4.021  11.585  -3.761 1.00 . A A .  53 PRO HG2  1 1 
        1   843 1 1  53 PRO HG3  H  -2.909  11.943  -2.417 1.00 . A A .  53 PRO HG3  1 1 
        1   844 1 1  53 PRO N    N  -0.965  10.376  -3.728 1.00 . A A .  53 PRO N    1 1 
        1   845 1 1  53 PRO O    O  -2.248   7.568  -4.345 1.00 . A A .  53 PRO O    1 1 
        1   846 1 1  54 LEU C    C  -1.026   4.853  -2.309 1.00 . A A .  54 LEU C    1 1 
        1   847 1 1  54 LEU CA   C  -0.325   5.787  -3.299 1.00 . A A .  54 LEU CA   1 1 
        1   848 1 1  54 LEU CB   C   1.197   5.462  -3.371 1.00 . A A .  54 LEU CB   1 1 
        1   849 1 1  54 LEU CD1  C   3.473   5.761  -4.528 1.00 . A A .  54 LEU CD1  1 1 
        1   850 1 1  54 LEU CD2  C   1.386   5.415  -5.917 1.00 . A A .  54 LEU CD2  1 1 
        1   851 1 1  54 LEU CG   C   1.957   6.014  -4.618 1.00 . A A .  54 LEU CG   1 1 
        1   852 1 1  54 LEU H    H   0.054   7.599  -2.226 1.00 . A A .  54 LEU H    1 1 
        1   853 1 1  54 LEU HA   H  -0.764   5.634  -4.285 1.00 . A A .  54 LEU HA   1 1 
        1   854 1 1  54 LEU HB2  H   1.667   5.870  -2.480 1.00 . A A .  54 LEU HB2  1 1 
        1   855 1 1  54 LEU HB3  H   1.326   4.382  -3.349 1.00 . A A .  54 LEU HB3  1 1 
        1   856 1 1  54 LEU HD11 H   3.859   6.206  -3.621 1.00 . A A .  54 LEU HD11 1 1 
        1   857 1 1  54 LEU HD12 H   3.969   6.210  -5.378 1.00 . A A .  54 LEU HD12 1 1 
        1   858 1 1  54 LEU HD13 H   3.673   4.696  -4.517 1.00 . A A .  54 LEU HD13 1 1 
        1   859 1 1  54 LEU HD21 H   0.352   5.709  -6.027 1.00 . A A .  54 LEU HD21 1 1 
        1   860 1 1  54 LEU HD22 H   1.449   4.333  -5.890 1.00 . A A .  54 LEU HD22 1 1 
        1   861 1 1  54 LEU HD23 H   1.945   5.783  -6.768 1.00 . A A .  54 LEU HD23 1 1 
        1   862 1 1  54 LEU HG   H   1.816   7.087  -4.667 1.00 . A A .  54 LEU HG   1 1 
        1   863 1 1  54 LEU N    N  -0.542   7.197  -2.906 1.00 . A A .  54 LEU N    1 1 
        1   864 1 1  54 LEU O    O  -1.125   5.162  -1.125 1.00 . A A .  54 LEU O    1 1 
        1   865 1 1  55 VAL C    C  -1.317   1.360  -2.292 1.00 . A A .  55 VAL C    1 1 
        1   866 1 1  55 VAL CA   C  -2.099   2.645  -1.979 1.00 . A A .  55 VAL CA   1 1 
        1   867 1 1  55 VAL CB   C  -3.644   2.440  -2.256 1.00 . A A .  55 VAL CB   1 1 
        1   868 1 1  55 VAL CG1  C  -4.244   1.343  -1.340 1.00 . A A .  55 VAL CG1  1 1 
        1   869 1 1  55 VAL CG2  C  -4.425   3.771  -2.108 1.00 . A A .  55 VAL CG2  1 1 
        1   870 1 1  55 VAL H    H  -1.526   3.603  -3.786 1.00 . A A .  55 VAL H    1 1 
        1   871 1 1  55 VAL HA   H  -1.959   2.898  -0.922 1.00 . A A .  55 VAL HA   1 1 
        1   872 1 1  55 VAL HB   H  -3.755   2.105  -3.286 1.00 . A A .  55 VAL HB   1 1 
        1   873 1 1  55 VAL HG11 H  -3.735   0.401  -1.513 1.00 . A A .  55 VAL HG11 1 1 
        1   874 1 1  55 VAL HG12 H  -5.299   1.218  -1.555 1.00 . A A .  55 VAL HG12 1 1 
        1   875 1 1  55 VAL HG13 H  -4.123   1.626  -0.301 1.00 . A A .  55 VAL HG13 1 1 
        1   876 1 1  55 VAL HG21 H  -5.476   3.609  -2.322 1.00 . A A .  55 VAL HG21 1 1 
        1   877 1 1  55 VAL HG22 H  -4.030   4.506  -2.802 1.00 . A A .  55 VAL HG22 1 1 
        1   878 1 1  55 VAL HG23 H  -4.321   4.147  -1.098 1.00 . A A .  55 VAL HG23 1 1 
        1   879 1 1  55 VAL N    N  -1.531   3.721  -2.813 1.00 . A A .  55 VAL N    1 1 
        1   880 1 1  55 VAL O    O  -1.525   0.754  -3.345 1.00 . A A .  55 VAL O    1 1 
        1   881 1 1  56 VAL C    C  -0.253  -1.487  -1.045 1.00 . A A .  56 VAL C    1 1 
        1   882 1 1  56 VAL CA   C   0.452  -0.236  -1.585 1.00 . A A .  56 VAL CA   1 1 
        1   883 1 1  56 VAL CB   C   1.846  -0.100  -0.864 1.00 . A A .  56 VAL CB   1 1 
        1   884 1 1  56 VAL CG1  C   2.713  -1.377  -1.034 1.00 . A A .  56 VAL CG1  1 1 
        1   885 1 1  56 VAL CG2  C   2.598   1.129  -1.371 1.00 . A A .  56 VAL CG2  1 1 
        1   886 1 1  56 VAL H    H  -0.223   1.531  -0.599 1.00 . A A .  56 VAL H    1 1 
        1   887 1 1  56 VAL HA   H   0.636  -0.360  -2.651 1.00 . A A .  56 VAL HA   1 1 
        1   888 1 1  56 VAL HB   H   1.660   0.037   0.200 1.00 . A A .  56 VAL HB   1 1 
        1   889 1 1  56 VAL HG11 H   3.657  -1.252  -0.515 1.00 . A A .  56 VAL HG11 1 1 
        1   890 1 1  56 VAL HG12 H   2.905  -1.555  -2.083 1.00 . A A .  56 VAL HG12 1 1 
        1   891 1 1  56 VAL HG13 H   2.193  -2.236  -0.618 1.00 . A A .  56 VAL HG13 1 1 
        1   892 1 1  56 VAL HG21 H   3.514   1.258  -0.804 1.00 . A A .  56 VAL HG21 1 1 
        1   893 1 1  56 VAL HG22 H   1.984   2.012  -1.255 1.00 . A A .  56 VAL HG22 1 1 
        1   894 1 1  56 VAL HG23 H   2.845   1.004  -2.418 1.00 . A A .  56 VAL HG23 1 1 
        1   895 1 1  56 VAL N    N  -0.382   0.970  -1.396 1.00 . A A .  56 VAL N    1 1 
        1   896 1 1  56 VAL O    O  -0.345  -1.683   0.165 1.00 . A A .  56 VAL O    1 1 
        1   897 1 1  57 PHE C    C   0.013  -4.592  -1.629 1.00 . A A .  57 PHE C    1 1 
        1   898 1 1  57 PHE CA   C  -1.214  -3.662  -1.650 1.00 . A A .  57 PHE CA   1 1 
        1   899 1 1  57 PHE CB   C  -2.219  -4.136  -2.736 1.00 . A A .  57 PHE CB   1 1 
        1   900 1 1  57 PHE CD1  C  -3.736  -2.245  -3.517 1.00 . A A .  57 PHE CD1  1 1 
        1   901 1 1  57 PHE CD2  C  -4.631  -3.861  -1.994 1.00 . A A .  57 PHE CD2  1 1 
        1   902 1 1  57 PHE CE1  C  -4.952  -1.587  -3.525 1.00 . A A .  57 PHE CE1  1 1 
        1   903 1 1  57 PHE CE2  C  -5.842  -3.199  -2.003 1.00 . A A .  57 PHE CE2  1 1 
        1   904 1 1  57 PHE CG   C  -3.552  -3.396  -2.746 1.00 . A A .  57 PHE CG   1 1 
        1   905 1 1  57 PHE CZ   C  -6.002  -2.065  -2.772 1.00 . A A .  57 PHE CZ   1 1 
        1   906 1 1  57 PHE H    H  -0.841  -1.989  -2.884 1.00 . A A .  57 PHE H    1 1 
        1   907 1 1  57 PHE HA   H  -1.696  -3.666  -0.676 1.00 . A A .  57 PHE HA   1 1 
        1   908 1 1  57 PHE HB2  H  -1.764  -4.021  -3.714 1.00 . A A .  57 PHE HB2  1 1 
        1   909 1 1  57 PHE HB3  H  -2.426  -5.187  -2.586 1.00 . A A .  57 PHE HB3  1 1 
        1   910 1 1  57 PHE HD1  H  -2.915  -1.861  -4.111 1.00 . A A .  57 PHE HD1  1 1 
        1   911 1 1  57 PHE HD2  H  -4.515  -4.753  -1.387 1.00 . A A .  57 PHE HD2  1 1 
        1   912 1 1  57 PHE HE1  H  -5.081  -0.694  -4.130 1.00 . A A .  57 PHE HE1  1 1 
        1   913 1 1  57 PHE HE2  H  -6.668  -3.575  -1.410 1.00 . A A .  57 PHE HE2  1 1 
        1   914 1 1  57 PHE HZ   H  -6.956  -1.549  -2.781 1.00 . A A .  57 PHE HZ   1 1 
        1   915 1 1  57 PHE N    N  -0.765  -2.306  -1.963 1.00 . A A .  57 PHE N    1 1 
        1   916 1 1  57 PHE O    O   0.564  -4.905  -2.681 1.00 . A A .  57 PHE O    1 1 
        1   917 1 1  58 VAL C    C   0.975  -7.426  -0.465 1.00 . A A .  58 VAL C    1 1 
        1   918 1 1  58 VAL CA   C   1.561  -6.004  -0.355 1.00 . A A .  58 VAL CA   1 1 
        1   919 1 1  58 VAL CB   C   2.465  -5.828   0.933 1.00 . A A .  58 VAL CB   1 1 
        1   920 1 1  58 VAL CG1  C   3.137  -4.440   0.959 1.00 . A A .  58 VAL CG1  1 1 
        1   921 1 1  58 VAL CG2  C   1.707  -6.074   2.246 1.00 . A A .  58 VAL CG2  1 1 
        1   922 1 1  58 VAL H    H   0.051  -4.692   0.381 1.00 . A A .  58 VAL H    1 1 
        1   923 1 1  58 VAL HA   H   2.209  -5.843  -1.224 1.00 . A A .  58 VAL HA   1 1 
        1   924 1 1  58 VAL HB   H   3.260  -6.569   0.869 1.00 . A A .  58 VAL HB   1 1 
        1   925 1 1  58 VAL HG11 H   2.379  -3.665   1.000 1.00 . A A .  58 VAL HG11 1 1 
        1   926 1 1  58 VAL HG12 H   3.734  -4.304   0.070 1.00 . A A .  58 VAL HG12 1 1 
        1   927 1 1  58 VAL HG13 H   3.779  -4.354   1.831 1.00 . A A .  58 VAL HG13 1 1 
        1   928 1 1  58 VAL HG21 H   2.373  -5.947   3.091 1.00 . A A .  58 VAL HG21 1 1 
        1   929 1 1  58 VAL HG22 H   1.309  -7.080   2.255 1.00 . A A .  58 VAL HG22 1 1 
        1   930 1 1  58 VAL HG23 H   0.886  -5.370   2.332 1.00 . A A .  58 VAL HG23 1 1 
        1   931 1 1  58 VAL N    N   0.463  -5.028  -0.443 1.00 . A A .  58 VAL N    1 1 
        1   932 1 1  58 VAL O    O   0.189  -7.845   0.385 1.00 . A A .  58 VAL O    1 1 
        1   933 1 1  59 ASN C    C   1.565 -10.479  -0.863 1.00 . A A .  59 ASN C    1 1 
        1   934 1 1  59 ASN CA   C   0.855  -9.514  -1.823 1.00 . A A .  59 ASN CA   1 1 
        1   935 1 1  59 ASN CB   C   1.093  -9.953  -3.308 1.00 . A A .  59 ASN CB   1 1 
        1   936 1 1  59 ASN CG   C   0.132  -9.336  -4.328 1.00 . A A .  59 ASN CG   1 1 
        1   937 1 1  59 ASN H    H   1.863  -7.690  -2.245 1.00 . A A .  59 ASN H    1 1 
        1   938 1 1  59 ASN HA   H  -0.211  -9.557  -1.612 1.00 . A A .  59 ASN HA   1 1 
        1   939 1 1  59 ASN HB2  H   2.102  -9.687  -3.593 1.00 . A A .  59 ASN HB2  1 1 
        1   940 1 1  59 ASN HB3  H   0.996 -11.034  -3.378 1.00 . A A .  59 ASN HB3  1 1 
        1   941 1 1  59 ASN HD21 H   1.487  -9.508  -5.770 1.00 . A A .  59 ASN HD21 1 1 
        1   942 1 1  59 ASN HD22 H  -0.025  -8.818  -6.232 1.00 . A A .  59 ASN HD22 1 1 
        1   943 1 1  59 ASN N    N   1.302  -8.126  -1.573 1.00 . A A .  59 ASN N    1 1 
        1   944 1 1  59 ASN ND2  N   0.577  -9.206  -5.567 1.00 . A A .  59 ASN ND2  1 1 
        1   945 1 1  59 ASN O    O   2.532 -11.148  -1.247 1.00 . A A .  59 ASN O    1 1 
        1   946 1 1  59 ASN OD1  O  -1.010  -9.021  -4.023 1.00 . A A .  59 ASN OD1  1 1 
        1   947 1 1  60 GLY C    C   3.143 -11.172   1.653 1.00 . A A .  60 GLY C    1 1 
        1   948 1 1  60 GLY CA   C   1.645 -11.364   1.441 1.00 . A A .  60 GLY CA   1 1 
        1   949 1 1  60 GLY H    H   0.329  -9.930   0.622 1.00 . A A .  60 GLY H    1 1 
        1   950 1 1  60 GLY HA2  H   1.138 -11.148   2.371 1.00 . A A .  60 GLY HA2  1 1 
        1   951 1 1  60 GLY HA3  H   1.455 -12.400   1.181 1.00 . A A .  60 GLY HA3  1 1 
        1   952 1 1  60 GLY N    N   1.086 -10.510   0.398 1.00 . A A .  60 GLY N    1 1 
        1   953 1 1  60 GLY O    O   3.879 -12.153   1.797 1.00 . A A .  60 GLY O    1 1 
        1   954 1 1  61 ALA C    C   5.416  -9.879   3.307 1.00 . A A .  61 ALA C    1 1 
        1   955 1 1  61 ALA CA   C   5.017  -9.563   1.859 1.00 . A A .  61 ALA CA   1 1 
        1   956 1 1  61 ALA CB   C   5.288  -8.085   1.529 1.00 . A A .  61 ALA CB   1 1 
        1   957 1 1  61 ALA H    H   2.962  -9.176   1.468 1.00 . A A .  61 ALA H    1 1 
        1   958 1 1  61 ALA HA   H   5.613 -10.173   1.180 1.00 . A A .  61 ALA HA   1 1 
        1   959 1 1  61 ALA HB1  H   4.999  -7.881   0.505 1.00 . A A .  61 ALA HB1  1 1 
        1   960 1 1  61 ALA HB2  H   6.343  -7.867   1.648 1.00 . A A .  61 ALA HB2  1 1 
        1   961 1 1  61 ALA HB3  H   4.714  -7.445   2.191 1.00 . A A .  61 ALA HB3  1 1 
        1   962 1 1  61 ALA N    N   3.597  -9.901   1.637 1.00 . A A .  61 ALA N    1 1 
        1   963 1 1  61 ALA O    O   4.606  -9.705   4.231 1.00 . A A .  61 ALA O    1 1 
        1   964 1 1  62 SER C    C   7.255  -9.479   5.733 1.00 . A A .  62 SER C    1 1 
        1   965 1 1  62 SER CA   C   7.212 -10.704   4.803 1.00 . A A .  62 SER CA   1 1 
        1   966 1 1  62 SER CB   C   8.631 -11.288   4.626 1.00 . A A .  62 SER CB   1 1 
        1   967 1 1  62 SER H    H   7.259 -10.393   2.711 1.00 . A A .  62 SER H    1 1 
        1   968 1 1  62 SER HA   H   6.565 -11.463   5.241 1.00 . A A .  62 SER HA   1 1 
        1   969 1 1  62 SER HB2  H   9.305 -10.517   4.275 1.00 . A A .  62 SER HB2  1 1 
        1   970 1 1  62 SER HB3  H   8.991 -11.669   5.576 1.00 . A A .  62 SER HB3  1 1 
        1   971 1 1  62 SER HG   H   8.979 -12.029   2.844 1.00 . A A .  62 SER HG   1 1 
        1   972 1 1  62 SER N    N   6.669 -10.331   3.490 1.00 . A A .  62 SER N    1 1 
        1   973 1 1  62 SER O    O   7.317  -8.334   5.253 1.00 . A A .  62 SER O    1 1 
        1   974 1 1  62 SER OG   O   8.642 -12.348   3.686 1.00 . A A .  62 SER OG   1 1 
        1   975 1 1  63 GLN C    C   8.655  -7.886   7.925 1.00 . A A .  63 GLN C    1 1 
        1   976 1 1  63 GLN CA   C   7.331  -8.662   8.077 1.00 . A A .  63 GLN CA   1 1 
        1   977 1 1  63 GLN CB   C   7.165  -9.233   9.520 1.00 . A A .  63 GLN CB   1 1 
        1   978 1 1  63 GLN CD   C   6.124  -7.055  10.464 1.00 . A A .  63 GLN CD   1 1 
        1   979 1 1  63 GLN CG   C   7.172  -8.167  10.649 1.00 . A A .  63 GLN CG   1 1 
        1   980 1 1  63 GLN H    H   7.146 -10.655   7.361 1.00 . A A .  63 GLN H    1 1 
        1   981 1 1  63 GLN HA   H   6.512  -7.972   7.887 1.00 . A A .  63 GLN HA   1 1 
        1   982 1 1  63 GLN HB2  H   6.222  -9.768   9.571 1.00 . A A .  63 GLN HB2  1 1 
        1   983 1 1  63 GLN HB3  H   7.967  -9.941   9.713 1.00 . A A .  63 GLN HB3  1 1 
        1   984 1 1  63 GLN HE21 H   7.341  -5.731  11.296 1.00 . A A .  63 GLN HE21 1 1 
        1   985 1 1  63 GLN HE22 H   5.809  -5.124  10.778 1.00 . A A .  63 GLN HE22 1 1 
        1   986 1 1  63 GLN HG2  H   6.978  -8.657  11.598 1.00 . A A .  63 GLN HG2  1 1 
        1   987 1 1  63 GLN HG3  H   8.157  -7.711  10.687 1.00 . A A .  63 GLN HG3  1 1 
        1   988 1 1  63 GLN N    N   7.235  -9.728   7.061 1.00 . A A .  63 GLN N    1 1 
        1   989 1 1  63 GLN NE2  N   6.458  -5.850  10.889 1.00 . A A .  63 GLN NE2  1 1 
        1   990 1 1  63 GLN O    O   8.728  -6.715   8.278 1.00 . A A .  63 GLN O    1 1 
        1   991 1 1  63 GLN OE1  O   5.035  -7.269   9.927 1.00 . A A .  63 GLN OE1  1 1 
        1   992 1 1  64 ASN C    C  10.698  -6.772   5.995 1.00 . A A .  64 ASN C    1 1 
        1   993 1 1  64 ASN CA   C  10.946  -7.941   6.962 1.00 . A A .  64 ASN CA   1 1 
        1   994 1 1  64 ASN CB   C  11.884  -8.999   6.323 1.00 . A A .  64 ASN CB   1 1 
        1   995 1 1  64 ASN CG   C  13.251  -8.432   5.922 1.00 . A A .  64 ASN CG   1 1 
        1   996 1 1  64 ASN H    H   9.561  -9.516   7.182 1.00 . A A .  64 ASN H    1 1 
        1   997 1 1  64 ASN HA   H  11.412  -7.560   7.865 1.00 . A A .  64 ASN HA   1 1 
        1   998 1 1  64 ASN HB2  H  12.045  -9.798   7.034 1.00 . A A .  64 ASN HB2  1 1 
        1   999 1 1  64 ASN HB3  H  11.408  -9.417   5.439 1.00 . A A .  64 ASN HB3  1 1 
        1  1000 1 1  64 ASN HD21 H  12.592  -7.954   4.103 1.00 . A A .  64 ASN HD21 1 1 
        1  1001 1 1  64 ASN HD22 H  14.248  -7.591   4.428 1.00 . A A .  64 ASN HD22 1 1 
        1  1002 1 1  64 ASN N    N   9.675  -8.561   7.350 1.00 . A A .  64 ASN N    1 1 
        1  1003 1 1  64 ASN ND2  N  13.375  -7.942   4.694 1.00 . A A .  64 ASN ND2  1 1 
        1  1004 1 1  64 ASN O    O  11.158  -5.669   6.249 1.00 . A A .  64 ASN O    1 1 
        1  1005 1 1  64 ASN OD1  O  14.189  -8.424   6.717 1.00 . A A .  64 ASN OD1  1 1 
        1  1006 1 1  65 ASP C    C   8.740  -4.869   4.459 1.00 . A A .  65 ASP C    1 1 
        1  1007 1 1  65 ASP CA   C   9.597  -6.014   3.882 1.00 . A A .  65 ASP CA   1 1 
        1  1008 1 1  65 ASP CB   C   8.853  -6.655   2.680 1.00 . A A .  65 ASP CB   1 1 
        1  1009 1 1  65 ASP CG   C   9.565  -7.883   2.097 1.00 . A A .  65 ASP CG   1 1 
        1  1010 1 1  65 ASP H    H   9.530  -7.926   4.827 1.00 . A A .  65 ASP H    1 1 
        1  1011 1 1  65 ASP HA   H  10.539  -5.605   3.533 1.00 . A A .  65 ASP HA   1 1 
        1  1012 1 1  65 ASP HB2  H   7.858  -6.947   2.998 1.00 . A A .  65 ASP HB2  1 1 
        1  1013 1 1  65 ASP HB3  H   8.756  -5.915   1.889 1.00 . A A .  65 ASP HB3  1 1 
        1  1014 1 1  65 ASP N    N   9.916  -7.027   4.920 1.00 . A A .  65 ASP N    1 1 
        1  1015 1 1  65 ASP O    O   8.848  -3.720   4.021 1.00 . A A .  65 ASP O    1 1 
        1  1016 1 1  65 ASP OD1  O  10.699  -7.750   1.593 1.00 . A A .  65 ASP OD1  1 1 
        1  1017 1 1  65 ASP OD2  O   9.007  -8.996   2.148 1.00 . A A .  65 ASP OD2  1 1 
        1  1018 1 1  66 VAL C    C   7.960  -3.292   6.992 1.00 . A A .  66 VAL C    1 1 
        1  1019 1 1  66 VAL CA   C   7.056  -4.240   6.182 1.00 . A A .  66 VAL CA   1 1 
        1  1020 1 1  66 VAL CB   C   6.047  -4.975   7.140 1.00 . A A .  66 VAL CB   1 1 
        1  1021 1 1  66 VAL CG1  C   5.214  -3.974   7.984 1.00 . A A .  66 VAL CG1  1 1 
        1  1022 1 1  66 VAL CG2  C   5.131  -5.928   6.330 1.00 . A A .  66 VAL CG2  1 1 
        1  1023 1 1  66 VAL H    H   7.793  -6.159   5.675 1.00 . A A .  66 VAL H    1 1 
        1  1024 1 1  66 VAL HA   H   6.484  -3.661   5.459 1.00 . A A .  66 VAL HA   1 1 
        1  1025 1 1  66 VAL HB   H   6.627  -5.585   7.834 1.00 . A A .  66 VAL HB   1 1 
        1  1026 1 1  66 VAL HG11 H   4.638  -3.336   7.324 1.00 . A A .  66 VAL HG11 1 1 
        1  1027 1 1  66 VAL HG12 H   5.873  -3.361   8.586 1.00 . A A .  66 VAL HG12 1 1 
        1  1028 1 1  66 VAL HG13 H   4.539  -4.515   8.636 1.00 . A A .  66 VAL HG13 1 1 
        1  1029 1 1  66 VAL HG21 H   4.461  -6.457   7.000 1.00 . A A .  66 VAL HG21 1 1 
        1  1030 1 1  66 VAL HG22 H   5.736  -6.646   5.791 1.00 . A A .  66 VAL HG22 1 1 
        1  1031 1 1  66 VAL HG23 H   4.544  -5.354   5.623 1.00 . A A .  66 VAL HG23 1 1 
        1  1032 1 1  66 VAL N    N   7.878  -5.212   5.439 1.00 . A A .  66 VAL N    1 1 
        1  1033 1 1  66 VAL O    O   7.754  -2.074   7.000 1.00 . A A .  66 VAL O    1 1 
        1  1034 1 1  67 ASN C    C  10.795  -2.232   7.516 1.00 . A A .  67 ASN C    1 1 
        1  1035 1 1  67 ASN CA   C   9.975  -3.135   8.438 1.00 . A A .  67 ASN CA   1 1 
        1  1036 1 1  67 ASN CB   C  10.907  -4.096   9.226 1.00 . A A .  67 ASN CB   1 1 
        1  1037 1 1  67 ASN CG   C  10.174  -4.936  10.276 1.00 . A A .  67 ASN CG   1 1 
        1  1038 1 1  67 ASN H    H   9.062  -4.852   7.592 1.00 . A A .  67 ASN H    1 1 
        1  1039 1 1  67 ASN HA   H   9.432  -2.513   9.147 1.00 . A A .  67 ASN HA   1 1 
        1  1040 1 1  67 ASN HB2  H  11.387  -4.774   8.526 1.00 . A A .  67 ASN HB2  1 1 
        1  1041 1 1  67 ASN HB3  H  11.675  -3.523   9.734 1.00 . A A .  67 ASN HB3  1 1 
        1  1042 1 1  67 ASN HD21 H  11.459  -6.422   9.993 1.00 . A A .  67 ASN HD21 1 1 
        1  1043 1 1  67 ASN HD22 H  10.212  -6.719  11.150 1.00 . A A .  67 ASN HD22 1 1 
        1  1044 1 1  67 ASN N    N   8.975  -3.880   7.650 1.00 . A A .  67 ASN N    1 1 
        1  1045 1 1  67 ASN ND2  N  10.666  -6.145  10.500 1.00 . A A .  67 ASN ND2  1 1 
        1  1046 1 1  67 ASN O    O  11.036  -1.080   7.855 1.00 . A A .  67 ASN O    1 1 
        1  1047 1 1  67 ASN OD1  O   9.181  -4.509  10.875 1.00 . A A .  67 ASN OD1  1 1 
        1  1048 1 1  68 GLU C    C  11.098  -0.779   4.860 1.00 . A A .  68 GLU C    1 1 
        1  1049 1 1  68 GLU CA   C  11.915  -1.998   5.309 1.00 . A A .  68 GLU CA   1 1 
        1  1050 1 1  68 GLU CB   C  12.268  -2.875   4.079 1.00 . A A .  68 GLU CB   1 1 
        1  1051 1 1  68 GLU CD   C  14.467  -3.805   5.071 1.00 . A A .  68 GLU CD   1 1 
        1  1052 1 1  68 GLU CG   C  13.126  -4.114   4.392 1.00 . A A .  68 GLU CG   1 1 
        1  1053 1 1  68 GLU H    H  10.945  -3.692   6.134 1.00 . A A .  68 GLU H    1 1 
        1  1054 1 1  68 GLU HA   H  12.839  -1.657   5.774 1.00 . A A .  68 GLU HA   1 1 
        1  1055 1 1  68 GLU HB2  H  11.343  -3.216   3.618 1.00 . A A .  68 GLU HB2  1 1 
        1  1056 1 1  68 GLU HB3  H  12.805  -2.265   3.354 1.00 . A A .  68 GLU HB3  1 1 
        1  1057 1 1  68 GLU HG2  H  12.552  -4.766   5.035 1.00 . A A .  68 GLU HG2  1 1 
        1  1058 1 1  68 GLU HG3  H  13.323  -4.640   3.465 1.00 . A A .  68 GLU HG3  1 1 
        1  1059 1 1  68 GLU N    N  11.175  -2.763   6.328 1.00 . A A .  68 GLU N    1 1 
        1  1060 1 1  68 GLU O    O  11.642   0.294   4.735 1.00 . A A .  68 GLU O    1 1 
        1  1061 1 1  68 GLU OE1  O  15.387  -3.299   4.392 1.00 . A A .  68 GLU OE1  1 1 
        1  1062 1 1  68 GLU OE2  O  14.625  -4.075   6.278 1.00 . A A .  68 GLU OE2  1 1 
        1  1063 1 1  69 PHE C    C   8.868   1.252   5.256 1.00 . A A .  69 PHE C    1 1 
        1  1064 1 1  69 PHE CA   C   8.851   0.103   4.249 1.00 . A A .  69 PHE CA   1 1 
        1  1065 1 1  69 PHE CB   C   7.414  -0.464   4.091 1.00 . A A .  69 PHE CB   1 1 
        1  1066 1 1  69 PHE CD1  C   5.643   1.345   4.436 1.00 . A A .  69 PHE CD1  1 1 
        1  1067 1 1  69 PHE CD2  C   6.153   0.667   2.196 1.00 . A A .  69 PHE CD2  1 1 
        1  1068 1 1  69 PHE CE1  C   4.709   2.231   3.950 1.00 . A A .  69 PHE CE1  1 1 
        1  1069 1 1  69 PHE CE2  C   5.220   1.558   1.715 1.00 . A A .  69 PHE CE2  1 1 
        1  1070 1 1  69 PHE CG   C   6.387   0.539   3.566 1.00 . A A .  69 PHE CG   1 1 
        1  1071 1 1  69 PHE CZ   C   4.499   2.333   2.593 1.00 . A A .  69 PHE CZ   1 1 
        1  1072 1 1  69 PHE H    H   9.408  -1.863   4.825 1.00 . A A .  69 PHE H    1 1 
        1  1073 1 1  69 PHE HA   H   9.195   0.469   3.287 1.00 . A A .  69 PHE HA   1 1 
        1  1074 1 1  69 PHE HB2  H   7.442  -1.304   3.403 1.00 . A A .  69 PHE HB2  1 1 
        1  1075 1 1  69 PHE HB3  H   7.069  -0.828   5.052 1.00 . A A .  69 PHE HB3  1 1 
        1  1076 1 1  69 PHE HD1  H   5.802   1.268   5.505 1.00 . A A .  69 PHE HD1  1 1 
        1  1077 1 1  69 PHE HD2  H   6.716   0.060   1.499 1.00 . A A .  69 PHE HD2  1 1 
        1  1078 1 1  69 PHE HE1  H   4.138   2.850   4.636 1.00 . A A .  69 PHE HE1  1 1 
        1  1079 1 1  69 PHE HE2  H   5.047   1.644   0.647 1.00 . A A .  69 PHE HE2  1 1 
        1  1080 1 1  69 PHE HZ   H   3.762   3.024   2.214 1.00 . A A .  69 PHE HZ   1 1 
        1  1081 1 1  69 PHE N    N   9.775  -0.970   4.670 1.00 . A A .  69 PHE N    1 1 
        1  1082 1 1  69 PHE O    O   9.061   2.418   4.887 1.00 . A A .  69 PHE O    1 1 
        1  1083 1 1  70 GLN C    C   9.936   2.605   7.759 1.00 . A A .  70 GLN C    1 1 
        1  1084 1 1  70 GLN CA   C   8.621   1.815   7.648 1.00 . A A .  70 GLN CA   1 1 
        1  1085 1 1  70 GLN CB   C   8.301   1.047   8.957 1.00 . A A .  70 GLN CB   1 1 
        1  1086 1 1  70 GLN CD   C   6.690  -0.551  10.165 1.00 . A A .  70 GLN CD   1 1 
        1  1087 1 1  70 GLN CG   C   6.924   0.345   8.948 1.00 . A A .  70 GLN CG   1 1 
        1  1088 1 1  70 GLN H    H   8.576  -0.079   6.719 1.00 . A A .  70 GLN H    1 1 
        1  1089 1 1  70 GLN HA   H   7.808   2.511   7.445 1.00 . A A .  70 GLN HA   1 1 
        1  1090 1 1  70 GLN HB2  H   9.067   0.295   9.116 1.00 . A A .  70 GLN HB2  1 1 
        1  1091 1 1  70 GLN HB3  H   8.319   1.743   9.792 1.00 . A A .  70 GLN HB3  1 1 
        1  1092 1 1  70 GLN HE21 H   7.534  -2.097   9.249 1.00 . A A .  70 GLN HE21 1 1 
        1  1093 1 1  70 GLN HE22 H   6.944  -2.400  10.841 1.00 . A A .  70 GLN HE22 1 1 
        1  1094 1 1  70 GLN HG2  H   6.149   1.102   8.925 1.00 . A A .  70 GLN HG2  1 1 
        1  1095 1 1  70 GLN HG3  H   6.847  -0.261   8.050 1.00 . A A .  70 GLN HG3  1 1 
        1  1096 1 1  70 GLN N    N   8.677   0.879   6.529 1.00 . A A .  70 GLN N    1 1 
        1  1097 1 1  70 GLN NE2  N   7.100  -1.809  10.076 1.00 . A A .  70 GLN NE2  1 1 
        1  1098 1 1  70 GLN O    O   9.903   3.828   7.773 1.00 . A A .  70 GLN O    1 1 
        1  1099 1 1  70 GLN OE1  O   6.169  -0.109  11.188 1.00 . A A .  70 GLN OE1  1 1 
        1  1100 1 1  71 ASN C    C  12.771   3.397   6.744 1.00 . A A .  71 ASN C    1 1 
        1  1101 1 1  71 ASN CA   C  12.433   2.433   7.895 1.00 . A A .  71 ASN CA   1 1 
        1  1102 1 1  71 ASN CB   C  13.505   1.302   7.971 1.00 . A A .  71 ASN CB   1 1 
        1  1103 1 1  71 ASN CG   C  13.354   0.375   9.181 1.00 . A A .  71 ASN CG   1 1 
        1  1104 1 1  71 ASN H    H  10.992   0.908   7.591 1.00 . A A .  71 ASN H    1 1 
        1  1105 1 1  71 ASN HA   H  12.448   2.989   8.831 1.00 . A A .  71 ASN HA   1 1 
        1  1106 1 1  71 ASN HB2  H  13.440   0.694   7.075 1.00 . A A .  71 ASN HB2  1 1 
        1  1107 1 1  71 ASN HB3  H  14.496   1.745   8.016 1.00 . A A .  71 ASN HB3  1 1 
        1  1108 1 1  71 ASN HD21 H  14.228  -1.108   8.183 1.00 . A A .  71 ASN HD21 1 1 
        1  1109 1 1  71 ASN HD22 H  13.728  -1.477   9.795 1.00 . A A .  71 ASN HD22 1 1 
        1  1110 1 1  71 ASN N    N  11.074   1.870   7.736 1.00 . A A .  71 ASN N    1 1 
        1  1111 1 1  71 ASN ND2  N  13.818  -0.860   9.040 1.00 . A A .  71 ASN ND2  1 1 
        1  1112 1 1  71 ASN O    O  13.156   4.543   6.991 1.00 . A A .  71 ASN O    1 1 
        1  1113 1 1  71 ASN OD1  O  12.836   0.764  10.230 1.00 . A A .  71 ASN OD1  1 1 
        1  1114 1 1  72 GLU C    C  12.062   4.953   4.129 1.00 . A A .  72 GLU C    1 1 
        1  1115 1 1  72 GLU CA   C  12.918   3.684   4.269 1.00 . A A .  72 GLU CA   1 1 
        1  1116 1 1  72 GLU CB   C  12.771   2.812   2.987 1.00 . A A .  72 GLU CB   1 1 
        1  1117 1 1  72 GLU CD   C  15.204   1.939   2.928 1.00 . A A .  72 GLU CD   1 1 
        1  1118 1 1  72 GLU CG   C  13.709   1.589   2.903 1.00 . A A .  72 GLU CG   1 1 
        1  1119 1 1  72 GLU H    H  12.190   2.037   5.392 1.00 . A A .  72 GLU H    1 1 
        1  1120 1 1  72 GLU HA   H  13.959   3.982   4.360 1.00 . A A .  72 GLU HA   1 1 
        1  1121 1 1  72 GLU HB2  H  11.747   2.450   2.933 1.00 . A A .  72 GLU HB2  1 1 
        1  1122 1 1  72 GLU HB3  H  12.956   3.438   2.117 1.00 . A A .  72 GLU HB3  1 1 
        1  1123 1 1  72 GLU HG2  H  13.489   0.932   3.741 1.00 . A A .  72 GLU HG2  1 1 
        1  1124 1 1  72 GLU HG3  H  13.491   1.050   1.984 1.00 . A A .  72 GLU HG3  1 1 
        1  1125 1 1  72 GLU N    N  12.579   2.923   5.493 1.00 . A A .  72 GLU N    1 1 
        1  1126 1 1  72 GLU O    O  12.502   5.929   3.527 1.00 . A A .  72 GLU O    1 1 
        1  1127 1 1  72 GLU OE1  O  15.769   2.275   1.867 1.00 . A A .  72 GLU OE1  1 1 
        1  1128 1 1  72 GLU OE2  O  15.832   1.876   4.003 1.00 . A A .  72 GLU OE2  1 1 
        1  1129 1 1  73 ALA C    C  10.317   7.119   5.716 1.00 . A A .  73 ALA C    1 1 
        1  1130 1 1  73 ALA CA   C   9.924   6.077   4.640 1.00 . A A .  73 ALA CA   1 1 
        1  1131 1 1  73 ALA CB   C   8.470   5.613   4.806 1.00 . A A .  73 ALA CB   1 1 
        1  1132 1 1  73 ALA H    H  10.513   4.083   5.077 1.00 . A A .  73 ALA H    1 1 
        1  1133 1 1  73 ALA HA   H  10.008   6.542   3.660 1.00 . A A .  73 ALA HA   1 1 
        1  1134 1 1  73 ALA HB1  H   7.800   6.462   4.719 1.00 . A A .  73 ALA HB1  1 1 
        1  1135 1 1  73 ALA HB2  H   8.338   5.148   5.776 1.00 . A A .  73 ALA HB2  1 1 
        1  1136 1 1  73 ALA HB3  H   8.224   4.892   4.034 1.00 . A A .  73 ALA HB3  1 1 
        1  1137 1 1  73 ALA N    N  10.830   4.919   4.665 1.00 . A A .  73 ALA N    1 1 
        1  1138 1 1  73 ALA O    O  10.539   8.293   5.394 1.00 . A A .  73 ALA O    1 1 
        1  1139 1 1  74 LYS C    C  12.023   8.255   8.163 1.00 . A A .  74 LYS C    1 1 
        1  1140 1 1  74 LYS CA   C  10.637   7.580   8.156 1.00 . A A .  74 LYS CA   1 1 
        1  1141 1 1  74 LYS CB   C  10.330   6.849   9.512 1.00 . A A .  74 LYS CB   1 1 
        1  1142 1 1  74 LYS CD   C  12.566   5.868  10.498 1.00 . A A .  74 LYS CD   1 1 
        1  1143 1 1  74 LYS CE   C  12.477   6.600  11.846 1.00 . A A .  74 LYS CE   1 1 
        1  1144 1 1  74 LYS CG   C  11.178   5.586   9.864 1.00 . A A .  74 LYS CG   1 1 
        1  1145 1 1  74 LYS H    H  10.434   5.705   7.149 1.00 . A A .  74 LYS H    1 1 
        1  1146 1 1  74 LYS HA   H   9.900   8.373   8.038 1.00 . A A .  74 LYS HA   1 1 
        1  1147 1 1  74 LYS HB2  H  10.444   7.560  10.321 1.00 . A A .  74 LYS HB2  1 1 
        1  1148 1 1  74 LYS HB3  H   9.284   6.547   9.490 1.00 . A A .  74 LYS HB3  1 1 
        1  1149 1 1  74 LYS HD2  H  13.076   4.925  10.648 1.00 . A A .  74 LYS HD2  1 1 
        1  1150 1 1  74 LYS HD3  H  13.144   6.473   9.805 1.00 . A A .  74 LYS HD3  1 1 
        1  1151 1 1  74 LYS HE2  H  12.006   7.564  11.702 1.00 . A A .  74 LYS HE2  1 1 
        1  1152 1 1  74 LYS HE3  H  11.881   6.011  12.533 1.00 . A A .  74 LYS HE3  1 1 
        1  1153 1 1  74 LYS HG2  H  10.610   4.973  10.556 1.00 . A A .  74 LYS HG2  1 1 
        1  1154 1 1  74 LYS HG3  H  11.324   5.017   8.951 1.00 . A A .  74 LYS HG3  1 1 
        1  1155 1 1  74 LYS HZ1  H  14.277   5.899  12.637 1.00 . A A .  74 LYS HZ1  1 1 
        1  1156 1 1  74 LYS HZ2  H  13.738   7.336  13.341 1.00 . A A .  74 LYS HZ2  1 1 
        1  1157 1 1  74 LYS HZ3  H  14.425   7.358  11.797 1.00 . A A .  74 LYS HZ3  1 1 
        1  1158 1 1  74 LYS N    N  10.452   6.670   6.991 1.00 . A A .  74 LYS N    1 1 
        1  1159 1 1  74 LYS NZ   N  13.821   6.812  12.445 1.00 . A A .  74 LYS NZ   1 1 
        1  1160 1 1  74 LYS O    O  12.151   9.387   8.647 1.00 . A A .  74 LYS O    1 1 
        1  1161 1 1  75 LYS C    C  14.472   9.309   6.545 1.00 . A A .  75 LYS C    1 1 
        1  1162 1 1  75 LYS CA   C  14.425   8.117   7.531 1.00 . A A .  75 LYS CA   1 1 
        1  1163 1 1  75 LYS CB   C  15.443   7.021   7.109 1.00 . A A .  75 LYS CB   1 1 
        1  1164 1 1  75 LYS CD   C  16.368   5.562   5.193 1.00 . A A .  75 LYS CD   1 1 
        1  1165 1 1  75 LYS CE   C  16.347   5.384   3.674 1.00 . A A .  75 LYS CE   1 1 
        1  1166 1 1  75 LYS CG   C  15.287   6.560   5.652 1.00 . A A .  75 LYS CG   1 1 
        1  1167 1 1  75 LYS H    H  12.885   6.655   7.281 1.00 . A A .  75 LYS H    1 1 
        1  1168 1 1  75 LYS HA   H  14.701   8.475   8.511 1.00 . A A .  75 LYS HA   1 1 
        1  1169 1 1  75 LYS HB2  H  16.450   7.404   7.243 1.00 . A A .  75 LYS HB2  1 1 
        1  1170 1 1  75 LYS HB3  H  15.315   6.159   7.756 1.00 . A A .  75 LYS HB3  1 1 
        1  1171 1 1  75 LYS HD2  H  17.345   5.930   5.486 1.00 . A A .  75 LYS HD2  1 1 
        1  1172 1 1  75 LYS HD3  H  16.190   4.600   5.664 1.00 . A A .  75 LYS HD3  1 1 
        1  1173 1 1  75 LYS HE2  H  15.361   5.050   3.378 1.00 . A A .  75 LYS HE2  1 1 
        1  1174 1 1  75 LYS HE3  H  16.549   6.343   3.211 1.00 . A A .  75 LYS HE3  1 1 
        1  1175 1 1  75 LYS HG2  H  14.315   6.092   5.541 1.00 . A A .  75 LYS HG2  1 1 
        1  1176 1 1  75 LYS HG3  H  15.326   7.439   5.013 1.00 . A A .  75 LYS HG3  1 1 
        1  1177 1 1  75 LYS HZ1  H  17.303   4.308   2.169 1.00 . A A .  75 LYS HZ1  1 1 
        1  1178 1 1  75 LYS HZ2  H  17.154   3.462   3.621 1.00 . A A .  75 LYS HZ2  1 1 
        1  1179 1 1  75 LYS HZ3  H  18.302   4.692   3.472 1.00 . A A .  75 LYS HZ3  1 1 
        1  1180 1 1  75 LYS N    N  13.052   7.564   7.623 1.00 . A A .  75 LYS N    1 1 
        1  1181 1 1  75 LYS NZ   N  17.348   4.396   3.202 1.00 . A A .  75 LYS NZ   1 1 
        1  1182 1 1  75 LYS O    O  15.284  10.226   6.691 1.00 . A A .  75 LYS O    1 1 
        1  1183 1 1  76 GLU C    C  12.452  11.374   4.881 1.00 . A A .  76 GLU C    1 1 
        1  1184 1 1  76 GLU CA   C  13.475  10.290   4.489 1.00 . A A .  76 GLU CA   1 1 
        1  1185 1 1  76 GLU CB   C  13.067   9.613   3.158 1.00 . A A .  76 GLU CB   1 1 
        1  1186 1 1  76 GLU CD   C  15.470   8.994   2.401 1.00 . A A .  76 GLU CD   1 1 
        1  1187 1 1  76 GLU CG   C  14.034   8.505   2.677 1.00 . A A .  76 GLU CG   1 1 
        1  1188 1 1  76 GLU H    H  12.963   8.502   5.502 1.00 . A A .  76 GLU H    1 1 
        1  1189 1 1  76 GLU HA   H  14.451  10.757   4.362 1.00 . A A .  76 GLU HA   1 1 
        1  1190 1 1  76 GLU HB2  H  12.083   9.169   3.281 1.00 . A A .  76 GLU HB2  1 1 
        1  1191 1 1  76 GLU HB3  H  13.008  10.370   2.381 1.00 . A A .  76 GLU HB3  1 1 
        1  1192 1 1  76 GLU HG2  H  14.068   7.728   3.436 1.00 . A A .  76 GLU HG2  1 1 
        1  1193 1 1  76 GLU HG3  H  13.631   8.070   1.765 1.00 . A A .  76 GLU HG3  1 1 
        1  1194 1 1  76 GLU N    N  13.581   9.264   5.539 1.00 . A A .  76 GLU N    1 1 
        1  1195 1 1  76 GLU O    O  12.443  12.466   4.304 1.00 . A A .  76 GLU O    1 1 
        1  1196 1 1  76 GLU OE1  O  15.739   9.467   1.282 1.00 . A A .  76 GLU OE1  1 1 
        1  1197 1 1  76 GLU OE2  O  16.333   8.903   3.299 1.00 . A A .  76 GLU OE2  1 1 
        1  1198 1 1  77 GLY C    C   9.202  11.754   5.634 1.00 . A A .  77 GLY C    1 1 
        1  1199 1 1  77 GLY CA   C  10.537  11.949   6.348 1.00 . A A .  77 GLY CA   1 1 
        1  1200 1 1  77 GLY H    H  11.675  10.163   6.282 1.00 . A A .  77 GLY H    1 1 
        1  1201 1 1  77 GLY HA2  H  10.389  11.756   7.398 1.00 . A A .  77 GLY HA2  1 1 
        1  1202 1 1  77 GLY HA3  H  10.851  12.982   6.229 1.00 . A A .  77 GLY HA3  1 1 
        1  1203 1 1  77 GLY N    N  11.592  11.045   5.868 1.00 . A A .  77 GLY N    1 1 
        1  1204 1 1  77 GLY O    O   8.247  12.499   5.896 1.00 . A A .  77 GLY O    1 1 
        1  1205 1 1  78 VAL C    C   6.789   9.992   4.935 1.00 . A A .  78 VAL C    1 1 
        1  1206 1 1  78 VAL CA   C   7.933  10.389   3.982 1.00 . A A .  78 VAL CA   1 1 
        1  1207 1 1  78 VAL CB   C   8.237   9.217   2.966 1.00 . A A .  78 VAL CB   1 1 
        1  1208 1 1  78 VAL CG1  C   6.956   8.680   2.287 1.00 . A A .  78 VAL CG1  1 1 
        1  1209 1 1  78 VAL CG2  C   9.261   9.666   1.898 1.00 . A A .  78 VAL CG2  1 1 
        1  1210 1 1  78 VAL H    H   9.945  10.207   4.607 1.00 . A A .  78 VAL H    1 1 
        1  1211 1 1  78 VAL HA   H   7.633  11.269   3.409 1.00 . A A .  78 VAL HA   1 1 
        1  1212 1 1  78 VAL HB   H   8.680   8.399   3.528 1.00 . A A .  78 VAL HB   1 1 
        1  1213 1 1  78 VAL HG11 H   6.479   9.476   1.728 1.00 . A A .  78 VAL HG11 1 1 
        1  1214 1 1  78 VAL HG12 H   6.267   8.308   3.035 1.00 . A A .  78 VAL HG12 1 1 
        1  1215 1 1  78 VAL HG13 H   7.212   7.874   1.609 1.00 . A A .  78 VAL HG13 1 1 
        1  1216 1 1  78 VAL HG21 H  10.184   9.969   2.377 1.00 . A A .  78 VAL HG21 1 1 
        1  1217 1 1  78 VAL HG22 H   8.860  10.499   1.333 1.00 . A A .  78 VAL HG22 1 1 
        1  1218 1 1  78 VAL HG23 H   9.468   8.845   1.217 1.00 . A A .  78 VAL HG23 1 1 
        1  1219 1 1  78 VAL N    N   9.142  10.745   4.745 1.00 . A A .  78 VAL N    1 1 
        1  1220 1 1  78 VAL O    O   6.970   9.141   5.812 1.00 . A A .  78 VAL O    1 1 
        1  1221 1 1  79 SER C    C   3.744   9.112   5.033 1.00 . A A .  79 SER C    1 1 
        1  1222 1 1  79 SER CA   C   4.416  10.392   5.536 1.00 . A A .  79 SER CA   1 1 
        1  1223 1 1  79 SER CB   C   3.462  11.599   5.417 1.00 . A A .  79 SER CB   1 1 
        1  1224 1 1  79 SER H    H   5.585  11.321   4.051 1.00 . A A .  79 SER H    1 1 
        1  1225 1 1  79 SER HA   H   4.701  10.269   6.582 1.00 . A A .  79 SER HA   1 1 
        1  1226 1 1  79 SER HB2  H   3.234  11.786   4.374 1.00 . A A .  79 SER HB2  1 1 
        1  1227 1 1  79 SER HB3  H   2.542  11.397   5.955 1.00 . A A .  79 SER HB3  1 1 
        1  1228 1 1  79 SER HG   H   5.018  12.664   5.949 1.00 . A A .  79 SER HG   1 1 
        1  1229 1 1  79 SER N    N   5.629  10.648   4.756 1.00 . A A .  79 SER N    1 1 
        1  1230 1 1  79 SER O    O   3.489   8.968   3.831 1.00 . A A .  79 SER O    1 1 
        1  1231 1 1  79 SER OG   O   4.060  12.761   5.965 1.00 . A A .  79 SER OG   1 1 
        1  1232 1 1  80 TYR C    C   1.893   6.450   6.712 1.00 . A A .  80 TYR C    1 1 
        1  1233 1 1  80 TYR CA   C   2.883   6.881   5.628 1.00 . A A .  80 TYR CA   1 1 
        1  1234 1 1  80 TYR CB   C   3.988   5.801   5.417 1.00 . A A .  80 TYR CB   1 1 
        1  1235 1 1  80 TYR CD1  C   5.823   6.453   7.080 1.00 . A A .  80 TYR CD1  1 1 
        1  1236 1 1  80 TYR CD2  C   4.852   4.279   7.296 1.00 . A A .  80 TYR CD2  1 1 
        1  1237 1 1  80 TYR CE1  C   6.661   6.189   8.137 1.00 . A A .  80 TYR CE1  1 1 
        1  1238 1 1  80 TYR CE2  C   5.697   4.012   8.352 1.00 . A A .  80 TYR CE2  1 1 
        1  1239 1 1  80 TYR CG   C   4.899   5.507   6.627 1.00 . A A .  80 TYR CG   1 1 
        1  1240 1 1  80 TYR CZ   C   6.595   4.971   8.772 1.00 . A A .  80 TYR CZ   1 1 
        1  1241 1 1  80 TYR H    H   3.699   8.370   6.893 1.00 . A A .  80 TYR H    1 1 
        1  1242 1 1  80 TYR HA   H   2.332   6.989   4.685 1.00 . A A .  80 TYR HA   1 1 
        1  1243 1 1  80 TYR HB2  H   3.514   4.870   5.121 1.00 . A A .  80 TYR HB2  1 1 
        1  1244 1 1  80 TYR HB3  H   4.627   6.120   4.599 1.00 . A A .  80 TYR HB3  1 1 
        1  1245 1 1  80 TYR HD1  H   5.873   7.416   6.583 1.00 . A A .  80 TYR HD1  1 1 
        1  1246 1 1  80 TYR HD2  H   4.144   3.525   6.969 1.00 . A A .  80 TYR HD2  1 1 
        1  1247 1 1  80 TYR HE1  H   7.369   6.942   8.467 1.00 . A A .  80 TYR HE1  1 1 
        1  1248 1 1  80 TYR HE2  H   5.645   3.054   8.857 1.00 . A A .  80 TYR HE2  1 1 
        1  1249 1 1  80 TYR HH   H   7.903   3.882   9.674 1.00 . A A .  80 TYR HH   1 1 
        1  1250 1 1  80 TYR N    N   3.478   8.180   5.954 1.00 . A A .  80 TYR N    1 1 
        1  1251 1 1  80 TYR O    O   1.997   6.853   7.881 1.00 . A A .  80 TYR O    1 1 
        1  1252 1 1  80 TYR OH   O   7.440   4.708   9.827 1.00 . A A .  80 TYR OH   1 1 
        1  1253 1 1  81 ASP C    C   0.110   3.464   6.933 1.00 . A A .  81 ASP C    1 1 
        1  1254 1 1  81 ASP CA   C  -0.037   4.970   7.160 1.00 . A A .  81 ASP CA   1 1 
        1  1255 1 1  81 ASP CB   C  -1.486   5.456   6.858 1.00 . A A .  81 ASP CB   1 1 
        1  1256 1 1  81 ASP CG   C  -2.591   4.789   7.716 1.00 . A A .  81 ASP CG   1 1 
        1  1257 1 1  81 ASP H    H   0.858   5.480   5.318 1.00 . A A .  81 ASP H    1 1 
        1  1258 1 1  81 ASP HA   H   0.207   5.196   8.197 1.00 . A A .  81 ASP HA   1 1 
        1  1259 1 1  81 ASP HB2  H  -1.533   6.525   7.033 1.00 . A A .  81 ASP HB2  1 1 
        1  1260 1 1  81 ASP HB3  H  -1.703   5.273   5.808 1.00 . A A .  81 ASP HB3  1 1 
        1  1261 1 1  81 ASP N    N   0.923   5.647   6.286 1.00 . A A .  81 ASP N    1 1 
        1  1262 1 1  81 ASP O    O   0.457   3.043   5.830 1.00 . A A .  81 ASP O    1 1 
        1  1263 1 1  81 ASP OD1  O  -2.324   4.386   8.869 1.00 . A A .  81 ASP OD1  1 1 
        1  1264 1 1  81 ASP OD2  O  -3.750   4.722   7.257 1.00 . A A .  81 ASP OD2  1 1 
        1  1265 1 1  82 VAL C    C  -1.357   0.567   8.321 1.00 . A A .  82 VAL C    1 1 
        1  1266 1 1  82 VAL CA   C  -0.008   1.190   7.917 1.00 . A A .  82 VAL CA   1 1 
        1  1267 1 1  82 VAL CB   C   1.157   0.652   8.835 1.00 . A A .  82 VAL CB   1 1 
        1  1268 1 1  82 VAL CG1  C   1.258  -0.892   8.798 1.00 . A A .  82 VAL CG1  1 1 
        1  1269 1 1  82 VAL CG2  C   2.518   1.289   8.452 1.00 . A A .  82 VAL CG2  1 1 
        1  1270 1 1  82 VAL H    H  -0.405   3.064   8.830 1.00 . A A .  82 VAL H    1 1 
        1  1271 1 1  82 VAL HA   H   0.211   0.906   6.884 1.00 . A A .  82 VAL HA   1 1 
        1  1272 1 1  82 VAL HB   H   0.932   0.945   9.857 1.00 . A A .  82 VAL HB   1 1 
        1  1273 1 1  82 VAL HG11 H   2.063  -1.224   9.445 1.00 . A A .  82 VAL HG11 1 1 
        1  1274 1 1  82 VAL HG12 H   1.457  -1.222   7.788 1.00 . A A .  82 VAL HG12 1 1 
        1  1275 1 1  82 VAL HG13 H   0.325  -1.336   9.139 1.00 . A A .  82 VAL HG13 1 1 
        1  1276 1 1  82 VAL HG21 H   3.298   0.918   9.108 1.00 . A A .  82 VAL HG21 1 1 
        1  1277 1 1  82 VAL HG22 H   2.460   2.369   8.546 1.00 . A A .  82 VAL HG22 1 1 
        1  1278 1 1  82 VAL HG23 H   2.764   1.036   7.429 1.00 . A A .  82 VAL HG23 1 1 
        1  1279 1 1  82 VAL N    N  -0.121   2.659   7.985 1.00 . A A .  82 VAL N    1 1 
        1  1280 1 1  82 VAL O    O  -1.993   1.007   9.282 1.00 . A A .  82 VAL O    1 1 
        1  1281 1 1  83 LEU C    C  -2.805  -2.671   7.647 1.00 . A A .  83 LEU C    1 1 
        1  1282 1 1  83 LEU CA   C  -3.054  -1.154   7.734 1.00 . A A .  83 LEU CA   1 1 
        1  1283 1 1  83 LEU CB   C  -4.016  -0.699   6.602 1.00 . A A .  83 LEU CB   1 1 
        1  1284 1 1  83 LEU CD1  C  -6.296  -0.989   7.764 1.00 . A A .  83 LEU CD1  1 1 
        1  1285 1 1  83 LEU CD2  C  -6.127  -1.076   5.211 1.00 . A A .  83 LEU CD2  1 1 
        1  1286 1 1  83 LEU CG   C  -5.423  -1.383   6.550 1.00 . A A .  83 LEU CG   1 1 
        1  1287 1 1  83 LEU H    H  -1.181  -0.763   6.852 1.00 . A A .  83 LEU H    1 1 
        1  1288 1 1  83 LEU HA   H  -3.482  -0.903   8.705 1.00 . A A .  83 LEU HA   1 1 
        1  1289 1 1  83 LEU HB2  H  -4.163   0.374   6.705 1.00 . A A .  83 LEU HB2  1 1 
        1  1290 1 1  83 LEU HB3  H  -3.515  -0.873   5.652 1.00 . A A .  83 LEU HB3  1 1 
        1  1291 1 1  83 LEU HD11 H  -6.470   0.081   7.764 1.00 . A A .  83 LEU HD11 1 1 
        1  1292 1 1  83 LEU HD12 H  -5.791  -1.269   8.679 1.00 . A A .  83 LEU HD12 1 1 
        1  1293 1 1  83 LEU HD13 H  -7.245  -1.506   7.712 1.00 . A A .  83 LEU HD13 1 1 
        1  1294 1 1  83 LEU HD21 H  -6.272  -0.008   5.105 1.00 . A A .  83 LEU HD21 1 1 
        1  1295 1 1  83 LEU HD22 H  -7.090  -1.572   5.183 1.00 . A A .  83 LEU HD22 1 1 
        1  1296 1 1  83 LEU HD23 H  -5.521  -1.439   4.392 1.00 . A A .  83 LEU HD23 1 1 
        1  1297 1 1  83 LEU HG   H  -5.291  -2.458   6.601 1.00 . A A .  83 LEU HG   1 1 
        1  1298 1 1  83 LEU N    N  -1.770  -0.455   7.568 1.00 . A A .  83 LEU N    1 1 
        1  1299 1 1  83 LEU O    O  -2.133  -3.127   6.733 1.00 . A A .  83 LEU O    1 1 
        1  1300 1 1  84 LYS C    C  -4.731  -5.432   8.718 1.00 . A A .  84 LYS C    1 1 
        1  1301 1 1  84 LYS CA   C  -3.287  -4.918   8.612 1.00 . A A .  84 LYS CA   1 1 
        1  1302 1 1  84 LYS CB   C  -2.403  -5.503   9.767 1.00 . A A .  84 LYS CB   1 1 
        1  1303 1 1  84 LYS CD   C  -0.207  -4.099   9.684 1.00 . A A .  84 LYS CD   1 1 
        1  1304 1 1  84 LYS CE   C   0.075  -3.699  11.145 1.00 . A A .  84 LYS CE   1 1 
        1  1305 1 1  84 LYS CG   C  -0.872  -5.491   9.513 1.00 . A A .  84 LYS CG   1 1 
        1  1306 1 1  84 LYS H    H  -3.742  -2.991   9.386 1.00 . A A .  84 LYS H    1 1 
        1  1307 1 1  84 LYS HA   H  -2.873  -5.245   7.654 1.00 . A A .  84 LYS HA   1 1 
        1  1308 1 1  84 LYS HB2  H  -2.596  -4.935  10.671 1.00 . A A .  84 LYS HB2  1 1 
        1  1309 1 1  84 LYS HB3  H  -2.700  -6.533   9.948 1.00 . A A .  84 LYS HB3  1 1 
        1  1310 1 1  84 LYS HD2  H   0.739  -4.104   9.151 1.00 . A A .  84 LYS HD2  1 1 
        1  1311 1 1  84 LYS HD3  H  -0.846  -3.346   9.233 1.00 . A A .  84 LYS HD3  1 1 
        1  1312 1 1  84 LYS HE2  H   0.763  -4.413  11.574 1.00 . A A .  84 LYS HE2  1 1 
        1  1313 1 1  84 LYS HE3  H   0.548  -2.721  11.143 1.00 . A A .  84 LYS HE3  1 1 
        1  1314 1 1  84 LYS HG2  H  -0.397  -6.186  10.197 1.00 . A A .  84 LYS HG2  1 1 
        1  1315 1 1  84 LYS HG3  H  -0.699  -5.837   8.496 1.00 . A A .  84 LYS HG3  1 1 
        1  1316 1 1  84 LYS HZ1  H  -0.899  -3.248  12.945 1.00 . A A .  84 LYS HZ1  1 1 
        1  1317 1 1  84 LYS HZ2  H  -1.543  -4.587  12.137 1.00 . A A .  84 LYS HZ2  1 1 
        1  1318 1 1  84 LYS HZ3  H  -1.858  -3.032  11.574 1.00 . A A .  84 LYS HZ3  1 1 
        1  1319 1 1  84 LYS N    N  -3.315  -3.435   8.627 1.00 . A A .  84 LYS N    1 1 
        1  1320 1 1  84 LYS NZ   N  -1.142  -3.637  12.007 1.00 . A A .  84 LYS NZ   1 1 
        1  1321 1 1  84 LYS O    O  -5.321  -5.411   9.804 1.00 . A A .  84 LYS O    1 1 
        1  1322 1 1  85 SER C    C  -6.788  -7.299   6.257 1.00 . A A .  85 SER C    1 1 
        1  1323 1 1  85 SER CA   C  -6.681  -6.368   7.477 1.00 . A A .  85 SER CA   1 1 
        1  1324 1 1  85 SER CB   C  -7.703  -5.201   7.361 1.00 . A A .  85 SER CB   1 1 
        1  1325 1 1  85 SER H    H  -4.757  -5.825   6.754 1.00 . A A .  85 SER H    1 1 
        1  1326 1 1  85 SER HA   H  -6.894  -6.942   8.378 1.00 . A A .  85 SER HA   1 1 
        1  1327 1 1  85 SER HB2  H  -7.456  -4.579   6.507 1.00 . A A .  85 SER HB2  1 1 
        1  1328 1 1  85 SER HB3  H  -8.705  -5.595   7.235 1.00 . A A .  85 SER HB3  1 1 
        1  1329 1 1  85 SER HG   H  -7.379  -4.899   9.268 1.00 . A A .  85 SER HG   1 1 
        1  1330 1 1  85 SER N    N  -5.300  -5.852   7.574 1.00 . A A .  85 SER N    1 1 
        1  1331 1 1  85 SER O    O  -6.221  -7.005   5.207 1.00 . A A .  85 SER O    1 1 
        1  1332 1 1  85 SER OG   O  -7.696  -4.382   8.517 1.00 . A A .  85 SER OG   1 1 
        1  1333 1 1  86 THR C    C  -9.199  -9.365   4.866 1.00 . A A .  86 THR C    1 1 
        1  1334 1 1  86 THR CA   C  -7.727  -9.399   5.318 1.00 . A A .  86 THR CA   1 1 
        1  1335 1 1  86 THR CB   C  -7.331 -10.841   5.781 1.00 . A A .  86 THR CB   1 1 
        1  1336 1 1  86 THR CG2  C  -5.874 -10.903   6.284 1.00 . A A .  86 THR CG2  1 1 
        1  1337 1 1  86 THR H    H  -7.879  -8.629   7.293 1.00 . A A .  86 THR H    1 1 
        1  1338 1 1  86 THR HA   H  -7.104  -9.126   4.469 1.00 . A A .  86 THR HA   1 1 
        1  1339 1 1  86 THR HB   H  -7.435 -11.521   4.940 1.00 . A A .  86 THR HB   1 1 
        1  1340 1 1  86 THR HG1  H  -8.990 -11.688   6.456 1.00 . A A .  86 THR HG1  1 1 
        1  1341 1 1  86 THR HG21 H  -5.751 -10.231   7.124 1.00 . A A .  86 THR HG21 1 1 
        1  1342 1 1  86 THR HG22 H  -5.197 -10.610   5.490 1.00 . A A .  86 THR HG22 1 1 
        1  1343 1 1  86 THR HG23 H  -5.638 -11.911   6.597 1.00 . A A .  86 THR HG23 1 1 
        1  1344 1 1  86 THR N    N  -7.498  -8.429   6.414 1.00 . A A .  86 THR N    1 1 
        1  1345 1 1  86 THR O    O  -9.633 -10.204   4.067 1.00 . A A .  86 THR O    1 1 
        1  1346 1 1  86 THR OG1  O  -8.205 -11.272   6.839 1.00 . A A .  86 THR OG1  1 1 
        1  1347 1 1  87 ASP C    C -11.505  -7.396   3.766 1.00 . A A .  87 ASP C    1 1 
        1  1348 1 1  87 ASP CA   C -11.386  -8.190   5.079 1.00 . A A .  87 ASP CA   1 1 
        1  1349 1 1  87 ASP CB   C -12.091  -7.425   6.235 1.00 . A A .  87 ASP CB   1 1 
        1  1350 1 1  87 ASP CG   C -11.901  -8.093   7.607 1.00 . A A .  87 ASP CG   1 1 
        1  1351 1 1  87 ASP H    H  -9.543  -7.762   6.028 1.00 . A A .  87 ASP H    1 1 
        1  1352 1 1  87 ASP HA   H -11.850  -9.165   4.964 1.00 . A A .  87 ASP HA   1 1 
        1  1353 1 1  87 ASP HB2  H -11.689  -6.419   6.295 1.00 . A A .  87 ASP HB2  1 1 
        1  1354 1 1  87 ASP HB3  H -13.156  -7.356   6.021 1.00 . A A .  87 ASP HB3  1 1 
        1  1355 1 1  87 ASP N    N  -9.960  -8.385   5.392 1.00 . A A .  87 ASP N    1 1 
        1  1356 1 1  87 ASP O    O -11.018  -6.252   3.710 1.00 . A A .  87 ASP O    1 1 
        1  1357 1 1  87 ASP OD1  O -10.795  -7.965   8.193 1.00 . A A .  87 ASP OD1  1 1 
        1  1358 1 1  87 ASP OD2  O -12.845  -8.747   8.112 1.00 . A A .  87 ASP OD2  1 1 
        1  1359 1 1  88 PRO C    C -12.976  -5.937   1.478 1.00 . A A .  88 PRO C    1 1 
        1  1360 1 1  88 PRO CA   C -12.253  -7.291   1.369 1.00 . A A .  88 PRO CA   1 1 
        1  1361 1 1  88 PRO CB   C -13.024  -8.308   0.472 1.00 . A A .  88 PRO CB   1 1 
        1  1362 1 1  88 PRO CD   C -12.676  -9.355   2.615 1.00 . A A .  88 PRO CD   1 1 
        1  1363 1 1  88 PRO CG   C -13.616  -9.307   1.428 1.00 . A A .  88 PRO CG   1 1 
        1  1364 1 1  88 PRO HA   H -11.268  -7.111   0.942 1.00 . A A .  88 PRO HA   1 1 
        1  1365 1 1  88 PRO HB2  H -13.800  -7.807  -0.111 1.00 . A A .  88 PRO HB2  1 1 
        1  1366 1 1  88 PRO HB3  H -12.334  -8.804  -0.202 1.00 . A A .  88 PRO HB3  1 1 
        1  1367 1 1  88 PRO HD2  H -13.218  -9.590   3.525 1.00 . A A .  88 PRO HD2  1 1 
        1  1368 1 1  88 PRO HD3  H -11.881 -10.081   2.456 1.00 . A A .  88 PRO HD3  1 1 
        1  1369 1 1  88 PRO HG2  H -14.609  -8.977   1.735 1.00 . A A .  88 PRO HG2  1 1 
        1  1370 1 1  88 PRO HG3  H -13.679 -10.282   0.963 1.00 . A A .  88 PRO HG3  1 1 
        1  1371 1 1  88 PRO N    N -12.119  -7.978   2.675 1.00 . A A .  88 PRO N    1 1 
        1  1372 1 1  88 PRO O    O -12.502  -4.943   0.912 1.00 . A A .  88 PRO O    1 1 
        1  1373 1 1  89 GLU C    C -14.045  -3.553   3.113 1.00 . A A .  89 GLU C    1 1 
        1  1374 1 1  89 GLU CA   C -14.879  -4.664   2.427 1.00 . A A .  89 GLU CA   1 1 
        1  1375 1 1  89 GLU CB   C -16.180  -4.951   3.227 1.00 . A A .  89 GLU CB   1 1 
        1  1376 1 1  89 GLU CD   C -17.259  -5.683   5.446 1.00 . A A .  89 GLU CD   1 1 
        1  1377 1 1  89 GLU CG   C -15.958  -5.376   4.695 1.00 . A A .  89 GLU CG   1 1 
        1  1378 1 1  89 GLU H    H -14.359  -6.710   2.729 1.00 . A A .  89 GLU H    1 1 
        1  1379 1 1  89 GLU HA   H -15.154  -4.320   1.428 1.00 . A A .  89 GLU HA   1 1 
        1  1380 1 1  89 GLU HB2  H -16.798  -4.058   3.218 1.00 . A A .  89 GLU HB2  1 1 
        1  1381 1 1  89 GLU HB3  H -16.725  -5.745   2.721 1.00 . A A .  89 GLU HB3  1 1 
        1  1382 1 1  89 GLU HG2  H -15.322  -6.255   4.706 1.00 . A A .  89 GLU HG2  1 1 
        1  1383 1 1  89 GLU HG3  H -15.442  -4.572   5.214 1.00 . A A .  89 GLU HG3  1 1 
        1  1384 1 1  89 GLU N    N -14.080  -5.893   2.256 1.00 . A A .  89 GLU N    1 1 
        1  1385 1 1  89 GLU O    O -14.131  -2.380   2.721 1.00 . A A .  89 GLU O    1 1 
        1  1386 1 1  89 GLU OE1  O -18.036  -4.745   5.718 1.00 . A A .  89 GLU OE1  1 1 
        1  1387 1 1  89 GLU OE2  O -17.528  -6.865   5.750 1.00 . A A .  89 GLU OE2  1 1 
        1  1388 1 1  90 GLU C    C -11.390  -2.344   3.900 1.00 . A A .  90 GLU C    1 1 
        1  1389 1 1  90 GLU CA   C -12.351  -3.036   4.860 1.00 . A A .  90 GLU CA   1 1 
        1  1390 1 1  90 GLU CB   C -11.562  -3.798   5.960 1.00 . A A .  90 GLU CB   1 1 
        1  1391 1 1  90 GLU CD   C -11.552  -2.113   7.927 1.00 . A A .  90 GLU CD   1 1 
        1  1392 1 1  90 GLU CG   C -10.712  -2.908   6.907 1.00 . A A .  90 GLU CG   1 1 
        1  1393 1 1  90 GLU H    H -13.150  -4.916   4.304 1.00 . A A .  90 GLU H    1 1 
        1  1394 1 1  90 GLU HA   H -12.992  -2.294   5.330 1.00 . A A .  90 GLU HA   1 1 
        1  1395 1 1  90 GLU HB2  H -12.267  -4.358   6.566 1.00 . A A .  90 GLU HB2  1 1 
        1  1396 1 1  90 GLU HB3  H -10.898  -4.507   5.475 1.00 . A A .  90 GLU HB3  1 1 
        1  1397 1 1  90 GLU HG2  H -10.013  -3.544   7.446 1.00 . A A .  90 GLU HG2  1 1 
        1  1398 1 1  90 GLU HG3  H -10.137  -2.207   6.305 1.00 . A A .  90 GLU HG3  1 1 
        1  1399 1 1  90 GLU N    N -13.203  -3.959   4.100 1.00 . A A .  90 GLU N    1 1 
        1  1400 1 1  90 GLU O    O -11.435  -1.128   3.753 1.00 . A A .  90 GLU O    1 1 
        1  1401 1 1  90 GLU OE1  O -12.062  -1.030   7.593 1.00 . A A .  90 GLU OE1  1 1 
        1  1402 1 1  90 GLU OE2  O -11.712  -2.572   9.078 1.00 . A A .  90 GLU OE2  1 1 
        1  1403 1 1  91 LEU C    C -10.115  -1.780   1.150 1.00 . A A .  91 LEU C    1 1 
        1  1404 1 1  91 LEU CA   C  -9.543  -2.684   2.272 1.00 . A A .  91 LEU CA   1 1 
        1  1405 1 1  91 LEU CB   C  -8.764  -3.887   1.665 1.00 . A A .  91 LEU CB   1 1 
        1  1406 1 1  91 LEU CD1  C  -7.377  -6.031   1.953 1.00 . A A .  91 LEU CD1  1 1 
        1  1407 1 1  91 LEU CD2  C  -7.351  -4.236   3.775 1.00 . A A .  91 LEU CD2  1 1 
        1  1408 1 1  91 LEU CG   C  -8.186  -4.927   2.677 1.00 . A A .  91 LEU CG   1 1 
        1  1409 1 1  91 LEU H    H -10.749  -4.132   3.252 1.00 . A A .  91 LEU H    1 1 
        1  1410 1 1  91 LEU HA   H  -8.858  -2.094   2.873 1.00 . A A .  91 LEU HA   1 1 
        1  1411 1 1  91 LEU HB2  H  -9.428  -4.413   0.981 1.00 . A A .  91 LEU HB2  1 1 
        1  1412 1 1  91 LEU HB3  H  -7.936  -3.489   1.083 1.00 . A A .  91 LEU HB3  1 1 
        1  1413 1 1  91 LEU HD11 H  -6.533  -5.589   1.436 1.00 . A A .  91 LEU HD11 1 1 
        1  1414 1 1  91 LEU HD12 H  -8.013  -6.532   1.236 1.00 . A A .  91 LEU HD12 1 1 
        1  1415 1 1  91 LEU HD13 H  -7.020  -6.754   2.674 1.00 . A A .  91 LEU HD13 1 1 
        1  1416 1 1  91 LEU HD21 H  -7.978  -3.552   4.331 1.00 . A A .  91 LEU HD21 1 1 
        1  1417 1 1  91 LEU HD22 H  -6.533  -3.685   3.326 1.00 . A A .  91 LEU HD22 1 1 
        1  1418 1 1  91 LEU HD23 H  -6.952  -4.977   4.452 1.00 . A A .  91 LEU HD23 1 1 
        1  1419 1 1  91 LEU HG   H  -9.018  -5.421   3.171 1.00 . A A .  91 LEU HG   1 1 
        1  1420 1 1  91 LEU N    N -10.605  -3.162   3.174 1.00 . A A .  91 LEU N    1 1 
        1  1421 1 1  91 LEU O    O  -9.506  -0.764   0.811 1.00 . A A .  91 LEU O    1 1 
        1  1422 1 1  92 THR C    C -12.354   0.015  -0.023 1.00 . A A .  92 THR C    1 1 
        1  1423 1 1  92 THR CA   C -12.002  -1.420  -0.460 1.00 . A A .  92 THR CA   1 1 
        1  1424 1 1  92 THR CB   C -13.300  -2.186  -0.924 1.00 . A A .  92 THR CB   1 1 
        1  1425 1 1  92 THR CG2  C -14.078  -1.438  -2.027 1.00 . A A .  92 THR CG2  1 1 
        1  1426 1 1  92 THR H    H -11.731  -2.964   0.973 1.00 . A A .  92 THR H    1 1 
        1  1427 1 1  92 THR HA   H -11.324  -1.369  -1.309 1.00 . A A .  92 THR HA   1 1 
        1  1428 1 1  92 THR HB   H -13.952  -2.311  -0.065 1.00 . A A .  92 THR HB   1 1 
        1  1429 1 1  92 THR HG1  H -12.223  -3.856  -0.907 1.00 . A A .  92 THR HG1  1 1 
        1  1430 1 1  92 THR HG21 H -13.444  -1.303  -2.891 1.00 . A A .  92 THR HG21 1 1 
        1  1431 1 1  92 THR HG22 H -14.393  -0.468  -1.660 1.00 . A A .  92 THR HG22 1 1 
        1  1432 1 1  92 THR HG23 H -14.953  -2.012  -2.312 1.00 . A A .  92 THR HG23 1 1 
        1  1433 1 1  92 THR N    N -11.305  -2.158   0.619 1.00 . A A .  92 THR N    1 1 
        1  1434 1 1  92 THR O    O -12.064   0.983  -0.746 1.00 . A A .  92 THR O    1 1 
        1  1435 1 1  92 THR OG1  O -12.954  -3.496  -1.418 1.00 . A A .  92 THR OG1  1 1 
        1  1436 1 1  93 GLN C    C -12.150   2.252   2.223 1.00 . A A .  93 GLN C    1 1 
        1  1437 1 1  93 GLN CA   C -13.365   1.461   1.687 1.00 . A A .  93 GLN CA   1 1 
        1  1438 1 1  93 GLN CB   C -14.519   1.320   2.729 1.00 . A A .  93 GLN CB   1 1 
        1  1439 1 1  93 GLN CD   C -13.486   1.577   5.105 1.00 . A A .  93 GLN CD   1 1 
        1  1440 1 1  93 GLN CG   C -14.172   0.652   4.088 1.00 . A A .  93 GLN CG   1 1 
        1  1441 1 1  93 GLN H    H -13.119  -0.653   1.726 1.00 . A A .  93 GLN H    1 1 
        1  1442 1 1  93 GLN HA   H -13.757   2.017   0.834 1.00 . A A .  93 GLN HA   1 1 
        1  1443 1 1  93 GLN HB2  H -14.915   2.309   2.935 1.00 . A A .  93 GLN HB2  1 1 
        1  1444 1 1  93 GLN HB3  H -15.311   0.737   2.269 1.00 . A A .  93 GLN HB3  1 1 
        1  1445 1 1  93 GLN HE21 H -14.538   3.149   4.488 1.00 . A A .  93 GLN HE21 1 1 
        1  1446 1 1  93 GLN HE22 H -13.410   3.447   5.757 1.00 . A A .  93 GLN HE22 1 1 
        1  1447 1 1  93 GLN HG2  H -15.088   0.281   4.535 1.00 . A A .  93 GLN HG2  1 1 
        1  1448 1 1  93 GLN HG3  H -13.514  -0.189   3.900 1.00 . A A .  93 GLN HG3  1 1 
        1  1449 1 1  93 GLN N    N -12.952   0.149   1.176 1.00 . A A .  93 GLN N    1 1 
        1  1450 1 1  93 GLN NE2  N -13.849   2.851   5.120 1.00 . A A .  93 GLN NE2  1 1 
        1  1451 1 1  93 GLN O    O -12.190   3.476   2.261 1.00 . A A .  93 GLN O    1 1 
        1  1452 1 1  93 GLN OE1  O -12.671   1.138   5.911 1.00 . A A .  93 GLN OE1  1 1 
        1  1453 1 1  94 ARG C    C  -9.101   2.922   1.925 1.00 . A A .  94 ARG C    1 1 
        1  1454 1 1  94 ARG CA   C  -9.821   2.203   3.081 1.00 . A A .  94 ARG CA   1 1 
        1  1455 1 1  94 ARG CB   C  -8.861   1.195   3.771 1.00 . A A .  94 ARG CB   1 1 
        1  1456 1 1  94 ARG CD   C  -9.419   1.716   6.239 1.00 . A A .  94 ARG CD   1 1 
        1  1457 1 1  94 ARG CG   C  -9.353   0.651   5.132 1.00 . A A .  94 ARG CG   1 1 
        1  1458 1 1  94 ARG CZ   C  -9.478   1.351   8.714 1.00 . A A .  94 ARG CZ   1 1 
        1  1459 1 1  94 ARG H    H -11.105   0.568   2.601 1.00 . A A .  94 ARG H    1 1 
        1  1460 1 1  94 ARG HA   H -10.114   2.955   3.811 1.00 . A A .  94 ARG HA   1 1 
        1  1461 1 1  94 ARG HB2  H  -8.706   0.350   3.106 1.00 . A A .  94 ARG HB2  1 1 
        1  1462 1 1  94 ARG HB3  H  -7.897   1.678   3.932 1.00 . A A .  94 ARG HB3  1 1 
        1  1463 1 1  94 ARG HD2  H  -8.421   2.095   6.423 1.00 . A A .  94 ARG HD2  1 1 
        1  1464 1 1  94 ARG HD3  H -10.058   2.532   5.920 1.00 . A A .  94 ARG HD3  1 1 
        1  1465 1 1  94 ARG HE   H -10.760   0.580   7.391 1.00 . A A .  94 ARG HE   1 1 
        1  1466 1 1  94 ARG HG2  H -10.342   0.230   5.003 1.00 . A A .  94 ARG HG2  1 1 
        1  1467 1 1  94 ARG HG3  H  -8.681  -0.140   5.454 1.00 . A A .  94 ARG HG3  1 1 
        1  1468 1 1  94 ARG HH11 H  -7.953   2.568   8.145 1.00 . A A .  94 ARG HH11 1 1 
        1  1469 1 1  94 ARG HH12 H  -8.055   2.268   9.851 1.00 . A A .  94 ARG HH12 1 1 
        1  1470 1 1  94 ARG HH21 H -10.865   0.166   9.583 1.00 . A A .  94 ARG HH21 1 1 
        1  1471 1 1  94 ARG HH22 H  -9.724   0.891  10.669 1.00 . A A .  94 ARG HH22 1 1 
        1  1472 1 1  94 ARG N    N -11.064   1.548   2.617 1.00 . A A .  94 ARG N    1 1 
        1  1473 1 1  94 ARG NE   N  -9.965   1.149   7.483 1.00 . A A .  94 ARG NE   1 1 
        1  1474 1 1  94 ARG NH1  N  -8.411   2.125   8.919 1.00 . A A .  94 ARG NH1  1 1 
        1  1475 1 1  94 ARG NH2  N -10.067   0.756   9.734 1.00 . A A .  94 ARG NH2  1 1 
        1  1476 1 1  94 ARG O    O  -8.436   3.928   2.162 1.00 . A A .  94 ARG O    1 1 
        1  1477 1 1  95 VAL C    C  -9.296   4.444  -0.702 1.00 . A A .  95 VAL C    1 1 
        1  1478 1 1  95 VAL CA   C  -8.674   3.042  -0.522 1.00 . A A .  95 VAL CA   1 1 
        1  1479 1 1  95 VAL CB   C  -8.896   2.183  -1.831 1.00 . A A .  95 VAL CB   1 1 
        1  1480 1 1  95 VAL CG1  C  -8.356   2.909  -3.094 1.00 . A A .  95 VAL CG1  1 1 
        1  1481 1 1  95 VAL CG2  C  -8.254   0.779  -1.701 1.00 . A A .  95 VAL CG2  1 1 
        1  1482 1 1  95 VAL H    H  -9.705   1.538   0.577 1.00 . A A .  95 VAL H    1 1 
        1  1483 1 1  95 VAL HA   H  -7.600   3.152  -0.368 1.00 . A A .  95 VAL HA   1 1 
        1  1484 1 1  95 VAL HB   H  -9.967   2.046  -1.959 1.00 . A A .  95 VAL HB   1 1 
        1  1485 1 1  95 VAL HG11 H  -7.294   3.091  -2.986 1.00 . A A .  95 VAL HG11 1 1 
        1  1486 1 1  95 VAL HG12 H  -8.869   3.855  -3.219 1.00 . A A .  95 VAL HG12 1 1 
        1  1487 1 1  95 VAL HG13 H  -8.527   2.296  -3.972 1.00 . A A .  95 VAL HG13 1 1 
        1  1488 1 1  95 VAL HG21 H  -8.688   0.255  -0.861 1.00 . A A .  95 VAL HG21 1 1 
        1  1489 1 1  95 VAL HG22 H  -7.186   0.874  -1.549 1.00 . A A .  95 VAL HG22 1 1 
        1  1490 1 1  95 VAL HG23 H  -8.435   0.205  -2.605 1.00 . A A .  95 VAL HG23 1 1 
        1  1491 1 1  95 VAL N    N  -9.232   2.392   0.682 1.00 . A A .  95 VAL N    1 1 
        1  1492 1 1  95 VAL O    O  -8.578   5.438  -0.691 1.00 . A A .  95 VAL O    1 1 
        1  1493 1 1  96 ARG C    C -11.225   6.772   0.098 1.00 . A A .  96 ARG C    1 1 
        1  1494 1 1  96 ARG CA   C -11.374   5.767  -1.057 1.00 . A A .  96 ARG CA   1 1 
        1  1495 1 1  96 ARG CB   C -12.874   5.504  -1.335 1.00 . A A .  96 ARG CB   1 1 
        1  1496 1 1  96 ARG CD   C -15.143   4.670  -0.446 1.00 . A A .  96 ARG CD   1 1 
        1  1497 1 1  96 ARG CG   C -13.634   4.786  -0.199 1.00 . A A .  96 ARG CG   1 1 
        1  1498 1 1  96 ARG CZ   C -16.669   3.798  -2.225 1.00 . A A .  96 ARG CZ   1 1 
        1  1499 1 1  96 ARG H    H -11.159   3.672  -0.705 1.00 . A A .  96 ARG H    1 1 
        1  1500 1 1  96 ARG HA   H -10.936   6.207  -1.947 1.00 . A A .  96 ARG HA   1 1 
        1  1501 1 1  96 ARG HB2  H -13.366   6.451  -1.536 1.00 . A A .  96 ARG HB2  1 1 
        1  1502 1 1  96 ARG HB3  H -12.949   4.889  -2.227 1.00 . A A .  96 ARG HB3  1 1 
        1  1503 1 1  96 ARG HD2  H -15.598   4.174   0.407 1.00 . A A .  96 ARG HD2  1 1 
        1  1504 1 1  96 ARG HD3  H -15.561   5.665  -0.541 1.00 . A A .  96 ARG HD3  1 1 
        1  1505 1 1  96 ARG HE   H -14.703   3.437  -2.102 1.00 . A A .  96 ARG HE   1 1 
        1  1506 1 1  96 ARG HG2  H -13.226   3.786  -0.093 1.00 . A A .  96 ARG HG2  1 1 
        1  1507 1 1  96 ARG HG3  H -13.471   5.329   0.729 1.00 . A A .  96 ARG HG3  1 1 
        1  1508 1 1  96 ARG HH11 H -17.638   4.963  -0.871 1.00 . A A .  96 ARG HH11 1 1 
        1  1509 1 1  96 ARG HH12 H -18.634   4.319  -2.135 1.00 . A A .  96 ARG HH12 1 1 
        1  1510 1 1  96 ARG HH21 H -16.014   2.628  -3.737 1.00 . A A .  96 ARG HH21 1 1 
        1  1511 1 1  96 ARG HH22 H -17.708   2.994  -3.765 1.00 . A A .  96 ARG HH22 1 1 
        1  1512 1 1  96 ARG N    N -10.643   4.502  -0.802 1.00 . A A .  96 ARG N    1 1 
        1  1513 1 1  96 ARG NE   N -15.453   3.900  -1.663 1.00 . A A .  96 ARG NE   1 1 
        1  1514 1 1  96 ARG NH1  N -17.733   4.410  -1.699 1.00 . A A .  96 ARG NH1  1 1 
        1  1515 1 1  96 ARG NH2  N -16.808   3.085  -3.329 1.00 . A A .  96 ARG NH2  1 1 
        1  1516 1 1  96 ARG O    O -11.105   7.975  -0.151 1.00 . A A .  96 ARG O    1 1 
        1  1517 1 1  97 GLU C    C  -9.673   7.758   2.555 1.00 . A A .  97 GLU C    1 1 
        1  1518 1 1  97 GLU CA   C -11.061   7.110   2.550 1.00 . A A .  97 GLU CA   1 1 
        1  1519 1 1  97 GLU CB   C -11.279   6.286   3.847 1.00 . A A .  97 GLU CB   1 1 
        1  1520 1 1  97 GLU CD   C -13.677   7.143   4.205 1.00 . A A .  97 GLU CD   1 1 
        1  1521 1 1  97 GLU CG   C -12.748   5.917   4.132 1.00 . A A .  97 GLU CG   1 1 
        1  1522 1 1  97 GLU H    H -11.359   5.301   1.475 1.00 . A A .  97 GLU H    1 1 
        1  1523 1 1  97 GLU HA   H -11.813   7.894   2.503 1.00 . A A .  97 GLU HA   1 1 
        1  1524 1 1  97 GLU HB2  H -10.709   5.362   3.775 1.00 . A A .  97 GLU HB2  1 1 
        1  1525 1 1  97 GLU HB3  H -10.902   6.851   4.696 1.00 . A A .  97 GLU HB3  1 1 
        1  1526 1 1  97 GLU HG2  H -13.094   5.251   3.347 1.00 . A A .  97 GLU HG2  1 1 
        1  1527 1 1  97 GLU HG3  H -12.797   5.388   5.080 1.00 . A A .  97 GLU HG3  1 1 
        1  1528 1 1  97 GLU N    N -11.234   6.269   1.355 1.00 . A A .  97 GLU N    1 1 
        1  1529 1 1  97 GLU O    O  -9.534   8.947   2.889 1.00 . A A .  97 GLU O    1 1 
        1  1530 1 1  97 GLU OE1  O -13.566   7.934   5.172 1.00 . A A .  97 GLU OE1  1 1 
        1  1531 1 1  97 GLU OE2  O -14.524   7.330   3.303 1.00 . A A .  97 GLU OE2  1 1 
        1  1532 1 1  98 PHE C    C  -7.163   8.511   0.969 1.00 . A A .  98 PHE C    1 1 
        1  1533 1 1  98 PHE CA   C  -7.284   7.417   2.043 1.00 . A A .  98 PHE CA   1 1 
        1  1534 1 1  98 PHE CB   C  -6.309   6.245   1.730 1.00 . A A .  98 PHE CB   1 1 
        1  1535 1 1  98 PHE CD1  C  -4.130   7.195   2.591 1.00 . A A .  98 PHE CD1  1 1 
        1  1536 1 1  98 PHE CD2  C  -4.325   6.801   0.233 1.00 . A A .  98 PHE CD2  1 1 
        1  1537 1 1  98 PHE CE1  C  -2.875   7.713   2.392 1.00 . A A .  98 PHE CE1  1 1 
        1  1538 1 1  98 PHE CE2  C  -3.065   7.309   0.048 1.00 . A A .  98 PHE CE2  1 1 
        1  1539 1 1  98 PHE CG   C  -4.885   6.733   1.513 1.00 . A A .  98 PHE CG   1 1 
        1  1540 1 1  98 PHE CZ   C  -2.347   7.768   1.123 1.00 . A A .  98 PHE CZ   1 1 
        1  1541 1 1  98 PHE H    H  -8.866   6.025   1.928 1.00 . A A .  98 PHE H    1 1 
        1  1542 1 1  98 PHE HA   H  -7.012   7.845   3.008 1.00 . A A .  98 PHE HA   1 1 
        1  1543 1 1  98 PHE HB2  H  -6.311   5.545   2.560 1.00 . A A .  98 PHE HB2  1 1 
        1  1544 1 1  98 PHE HB3  H  -6.639   5.730   0.836 1.00 . A A .  98 PHE HB3  1 1 
        1  1545 1 1  98 PHE HD1  H  -4.539   7.151   3.595 1.00 . A A .  98 PHE HD1  1 1 
        1  1546 1 1  98 PHE HD2  H  -4.885   6.438  -0.621 1.00 . A A .  98 PHE HD2  1 1 
        1  1547 1 1  98 PHE HE1  H  -2.295   8.069   3.238 1.00 . A A .  98 PHE HE1  1 1 
        1  1548 1 1  98 PHE HE2  H  -2.637   7.357  -0.948 1.00 . A A .  98 PHE HE2  1 1 
        1  1549 1 1  98 PHE HZ   H  -1.360   8.179   0.971 1.00 . A A .  98 PHE HZ   1 1 
        1  1550 1 1  98 PHE N    N  -8.664   6.957   2.156 1.00 . A A .  98 PHE N    1 1 
        1  1551 1 1  98 PHE O    O  -6.585   9.561   1.230 1.00 . A A .  98 PHE O    1 1 
        1  1552 1 1  99 LEU C    C  -8.294  10.499  -1.083 1.00 . A A .  99 LEU C    1 1 
        1  1553 1 1  99 LEU CA   C  -7.605   9.159  -1.386 1.00 . A A .  99 LEU CA   1 1 
        1  1554 1 1  99 LEU CB   C  -8.211   8.519  -2.668 1.00 . A A .  99 LEU CB   1 1 
        1  1555 1 1  99 LEU CD1  C  -8.210   6.675  -4.458 1.00 . A A .  99 LEU CD1  1 1 
        1  1556 1 1  99 LEU CD2  C  -6.054   7.220  -3.187 1.00 . A A .  99 LEU CD2  1 1 
        1  1557 1 1  99 LEU CG   C  -7.596   7.155  -3.121 1.00 . A A .  99 LEU CG   1 1 
        1  1558 1 1  99 LEU H    H  -8.209   7.404  -0.343 1.00 . A A .  99 LEU H    1 1 
        1  1559 1 1  99 LEU HA   H  -6.546   9.344  -1.553 1.00 . A A .  99 LEU HA   1 1 
        1  1560 1 1  99 LEU HB2  H  -9.274   8.371  -2.504 1.00 . A A .  99 LEU HB2  1 1 
        1  1561 1 1  99 LEU HB3  H  -8.093   9.226  -3.486 1.00 . A A .  99 LEU HB3  1 1 
        1  1562 1 1  99 LEU HD11 H  -9.282   6.579  -4.351 1.00 . A A .  99 LEU HD11 1 1 
        1  1563 1 1  99 LEU HD12 H  -7.794   5.714  -4.725 1.00 . A A .  99 LEU HD12 1 1 
        1  1564 1 1  99 LEU HD13 H  -7.991   7.392  -5.242 1.00 . A A .  99 LEU HD13 1 1 
        1  1565 1 1  99 LEU HD21 H  -5.663   6.267  -3.515 1.00 . A A .  99 LEU HD21 1 1 
        1  1566 1 1  99 LEU HD22 H  -5.659   7.447  -2.206 1.00 . A A .  99 LEU HD22 1 1 
        1  1567 1 1  99 LEU HD23 H  -5.746   7.991  -3.883 1.00 . A A .  99 LEU HD23 1 1 
        1  1568 1 1  99 LEU HG   H  -7.850   6.405  -2.382 1.00 . A A .  99 LEU HG   1 1 
        1  1569 1 1  99 LEU N    N  -7.712   8.242  -0.233 1.00 . A A .  99 LEU N    1 1 
        1  1570 1 1  99 LEU O    O  -7.822  11.555  -1.494 1.00 . A A .  99 LEU O    1 1 
        1  1571 1 1 100 LYS C    C  -9.405  12.495   1.062 1.00 . A A . 100 LYS C    1 1 
        1  1572 1 1 100 LYS CA   C -10.183  11.610   0.061 1.00 . A A . 100 LYS CA   1 1 
        1  1573 1 1 100 LYS CB   C -11.538  11.156   0.651 1.00 . A A . 100 LYS CB   1 1 
        1  1574 1 1 100 LYS CD   C -13.774  11.777   1.773 1.00 . A A . 100 LYS CD   1 1 
        1  1575 1 1 100 LYS CE   C -13.557  10.711   2.866 1.00 . A A . 100 LYS CE   1 1 
        1  1576 1 1 100 LYS CG   C -12.445  12.296   1.172 1.00 . A A . 100 LYS CG   1 1 
        1  1577 1 1 100 LYS H    H  -9.692   9.552  -0.013 1.00 . A A . 100 LYS H    1 1 
        1  1578 1 1 100 LYS HA   H -10.376  12.187  -0.843 1.00 . A A . 100 LYS HA   1 1 
        1  1579 1 1 100 LYS HB2  H -12.085  10.617  -0.116 1.00 . A A . 100 LYS HB2  1 1 
        1  1580 1 1 100 LYS HB3  H -11.342  10.475   1.472 1.00 . A A . 100 LYS HB3  1 1 
        1  1581 1 1 100 LYS HD2  H -14.312  12.613   2.208 1.00 . A A . 100 LYS HD2  1 1 
        1  1582 1 1 100 LYS HD3  H -14.373  11.347   0.978 1.00 . A A . 100 LYS HD3  1 1 
        1  1583 1 1 100 LYS HE2  H -13.019   9.871   2.447 1.00 . A A . 100 LYS HE2  1 1 
        1  1584 1 1 100 LYS HE3  H -12.973  11.141   3.672 1.00 . A A . 100 LYS HE3  1 1 
        1  1585 1 1 100 LYS HG2  H -11.912  12.851   1.937 1.00 . A A . 100 LYS HG2  1 1 
        1  1586 1 1 100 LYS HG3  H -12.673  12.967   0.349 1.00 . A A . 100 LYS HG3  1 1 
        1  1587 1 1 100 LYS HZ1  H -15.464   9.893   2.659 1.00 . A A . 100 LYS HZ1  1 1 
        1  1588 1 1 100 LYS HZ2  H -15.317  10.965   3.957 1.00 . A A . 100 LYS HZ2  1 1 
        1  1589 1 1 100 LYS HZ3  H -14.664   9.409   4.064 1.00 . A A . 100 LYS HZ3  1 1 
        1  1590 1 1 100 LYS N    N  -9.397  10.432  -0.327 1.00 . A A . 100 LYS N    1 1 
        1  1591 1 1 100 LYS NZ   N -14.838  10.213   3.425 1.00 . A A . 100 LYS NZ   1 1 
        1  1592 1 1 100 LYS O    O  -9.386  13.720   0.914 1.00 . A A . 100 LYS O    1 1 
        1  1593 1 1 101 THR C    C  -6.619  13.096   2.544 1.00 . A A . 101 THR C    1 1 
        1  1594 1 1 101 THR CA   C  -7.981  12.628   3.093 1.00 . A A . 101 THR CA   1 1 
        1  1595 1 1 101 THR CB   C  -7.791  11.812   4.424 1.00 . A A . 101 THR CB   1 1 
        1  1596 1 1 101 THR CG2  C  -6.907  10.572   4.234 1.00 . A A . 101 THR CG2  1 1 
        1  1597 1 1 101 THR H    H  -8.790  10.887   2.132 1.00 . A A . 101 THR H    1 1 
        1  1598 1 1 101 THR HA   H  -8.559  13.515   3.338 1.00 . A A . 101 THR HA   1 1 
        1  1599 1 1 101 THR HB   H  -8.771  11.486   4.761 1.00 . A A . 101 THR HB   1 1 
        1  1600 1 1 101 THR HG1  H  -7.575  13.540   5.390 1.00 . A A . 101 THR HG1  1 1 
        1  1601 1 1 101 THR HG21 H  -6.822  10.038   5.173 1.00 . A A . 101 THR HG21 1 1 
        1  1602 1 1 101 THR HG22 H  -5.921  10.872   3.902 1.00 . A A . 101 THR HG22 1 1 
        1  1603 1 1 101 THR HG23 H  -7.349   9.919   3.494 1.00 . A A . 101 THR HG23 1 1 
        1  1604 1 1 101 THR N    N  -8.752  11.872   2.072 1.00 . A A . 101 THR N    1 1 
        1  1605 1 1 101 THR O    O  -6.065  14.100   3.005 1.00 . A A . 101 THR O    1 1 
        1  1606 1 1 101 THR OG1  O  -7.215  12.644   5.452 1.00 . A A . 101 THR OG1  1 1 
        1  1607 1 1 102 ALA C    C  -5.045  13.726  -0.225 1.00 . A A . 102 ALA C    1 1 
        1  1608 1 1 102 ALA CA   C  -4.829  12.684   0.886 1.00 . A A . 102 ALA CA   1 1 
        1  1609 1 1 102 ALA CB   C  -4.203  11.407   0.319 1.00 . A A . 102 ALA CB   1 1 
        1  1610 1 1 102 ALA H    H  -6.575  11.557   1.265 1.00 . A A . 102 ALA H    1 1 
        1  1611 1 1 102 ALA HA   H  -4.142  13.095   1.624 1.00 . A A . 102 ALA HA   1 1 
        1  1612 1 1 102 ALA HB1  H  -4.036  10.700   1.121 1.00 . A A . 102 ALA HB1  1 1 
        1  1613 1 1 102 ALA HB2  H  -3.256  11.639  -0.154 1.00 . A A . 102 ALA HB2  1 1 
        1  1614 1 1 102 ALA HB3  H  -4.869  10.964  -0.413 1.00 . A A . 102 ALA HB3  1 1 
        1  1615 1 1 102 ALA N    N  -6.091  12.356   1.559 1.00 . A A . 102 ALA N    1 1 
        1  1616 1 1 102 ALA O    O  -4.108  14.432  -0.610 1.00 . A A . 102 ALA O    1 1 
        1  1617 1 1 103 GLY C    C  -7.090  16.058  -1.244 1.00 . A A . 103 GLY C    1 1 
        1  1618 1 1 103 GLY CA   C  -6.662  14.712  -1.799 1.00 . A A . 103 GLY CA   1 1 
        1  1619 1 1 103 GLY H    H  -6.965  13.174  -0.388 1.00 . A A . 103 GLY H    1 1 
        1  1620 1 1 103 GLY HA2  H  -5.833  14.844  -2.487 1.00 . A A . 103 GLY HA2  1 1 
        1  1621 1 1 103 GLY HA3  H  -7.492  14.281  -2.346 1.00 . A A . 103 GLY HA3  1 1 
        1  1622 1 1 103 GLY N    N  -6.285  13.784  -0.742 1.00 . A A . 103 GLY N    1 1 
        1  1623 1 1 103 GLY O    O  -6.447  17.074  -1.526 1.00 . A A . 103 GLY O    1 1 
        1  1624 1 1 104 SER C    C  -9.662  16.980   1.353 1.00 . A A . 104 SER C    1 1 
        1  1625 1 1 104 SER CA   C  -8.734  17.283   0.150 1.00 . A A . 104 SER CA   1 1 
        1  1626 1 1 104 SER CB   C  -9.486  18.091  -0.948 1.00 . A A . 104 SER CB   1 1 
        1  1627 1 1 104 SER H    H  -8.594  15.198  -0.220 1.00 . A A . 104 SER H    1 1 
        1  1628 1 1 104 SER HA   H  -7.903  17.885   0.514 1.00 . A A . 104 SER HA   1 1 
        1  1629 1 1 104 SER HB2  H  -9.958  18.962  -0.507 1.00 . A A . 104 SER HB2  1 1 
        1  1630 1 1 104 SER HB3  H  -8.780  18.418  -1.703 1.00 . A A . 104 SER HB3  1 1 
        1  1631 1 1 104 SER HG   H -11.304  17.350  -1.061 1.00 . A A . 104 SER HG   1 1 
        1  1632 1 1 104 SER N    N  -8.167  16.055  -0.431 1.00 . A A . 104 SER N    1 1 
        1  1633 1 1 104 SER O    O -10.856  16.708   1.185 1.00 . A A . 104 SER O    1 1 
        1  1634 1 1 104 SER OG   O -10.493  17.307  -1.581 1.00 . A A . 104 SER OG   1 1 
        1  1635 1 1 105 LEU C    C  -9.053  17.959   4.822 1.00 . A A . 105 LEU C    1 1 
        1  1636 1 1 105 LEU CA   C  -9.810  17.023   3.855 1.00 . A A . 105 LEU CA   1 1 
        1  1637 1 1 105 LEU CB   C -10.011  15.608   4.496 1.00 . A A . 105 LEU CB   1 1 
        1  1638 1 1 105 LEU CD1  C -11.307  13.393   4.698 1.00 . A A . 105 LEU CD1  1 1 
        1  1639 1 1 105 LEU CD2  C -12.500  15.468   3.838 1.00 . A A . 105 LEU CD2  1 1 
        1  1640 1 1 105 LEU CG   C -11.154  14.712   3.903 1.00 . A A . 105 LEU CG   1 1 
        1  1641 1 1 105 LEU H    H  -8.092  16.926   2.597 1.00 . A A . 105 LEU H    1 1 
        1  1642 1 1 105 LEU HA   H -10.782  17.476   3.667 1.00 . A A . 105 LEU HA   1 1 
        1  1643 1 1 105 LEU HB2  H  -9.075  15.065   4.405 1.00 . A A . 105 LEU HB2  1 1 
        1  1644 1 1 105 LEU HB3  H -10.212  15.743   5.555 1.00 . A A . 105 LEU HB3  1 1 
        1  1645 1 1 105 LEU HD11 H -11.535  13.608   5.736 1.00 . A A . 105 LEU HD11 1 1 
        1  1646 1 1 105 LEU HD12 H -10.388  12.829   4.645 1.00 . A A . 105 LEU HD12 1 1 
        1  1647 1 1 105 LEU HD13 H -12.105  12.802   4.271 1.00 . A A . 105 LEU HD13 1 1 
        1  1648 1 1 105 LEU HD21 H -12.788  15.798   4.830 1.00 . A A . 105 LEU HD21 1 1 
        1  1649 1 1 105 LEU HD22 H -13.266  14.815   3.441 1.00 . A A . 105 LEU HD22 1 1 
        1  1650 1 1 105 LEU HD23 H -12.401  16.328   3.191 1.00 . A A . 105 LEU HD23 1 1 
        1  1651 1 1 105 LEU HG   H -10.889  14.439   2.885 1.00 . A A . 105 LEU HG   1 1 
        1  1652 1 1 105 LEU N    N  -9.074  16.968   2.563 1.00 . A A . 105 LEU N    1 1 
        1  1653 1 1 105 LEU O    O  -7.942  18.419   4.510 1.00 . A A . 105 LEU O    1 1 
        1  1654 1 1 106 GLU C    C  -7.982  18.593   7.798 1.00 . A A . 106 GLU C    1 1 
        1  1655 1 1 106 GLU CA   C  -9.119  19.201   6.964 1.00 . A A . 106 GLU CA   1 1 
        1  1656 1 1 106 GLU CB   C -10.253  19.731   7.877 1.00 . A A . 106 GLU CB   1 1 
        1  1657 1 1 106 GLU CD   C -10.987  21.538   6.180 1.00 . A A . 106 GLU CD   1 1 
        1  1658 1 1 106 GLU CG   C -11.424  20.393   7.117 1.00 . A A . 106 GLU CG   1 1 
        1  1659 1 1 106 GLU H    H -10.490  17.759   6.214 1.00 . A A . 106 GLU H    1 1 
        1  1660 1 1 106 GLU HA   H  -8.714  20.038   6.398 1.00 . A A . 106 GLU HA   1 1 
        1  1661 1 1 106 GLU HB2  H -10.650  18.900   8.455 1.00 . A A . 106 GLU HB2  1 1 
        1  1662 1 1 106 GLU HB3  H  -9.835  20.459   8.565 1.00 . A A . 106 GLU HB3  1 1 
        1  1663 1 1 106 GLU HG2  H -11.926  19.629   6.531 1.00 . A A . 106 GLU HG2  1 1 
        1  1664 1 1 106 GLU HG3  H -12.130  20.788   7.841 1.00 . A A . 106 GLU HG3  1 1 
        1  1665 1 1 106 GLU N    N  -9.657  18.229   5.994 1.00 . A A . 106 GLU N    1 1 
        1  1666 1 1 106 GLU O    O  -6.924  19.219   7.964 1.00 . A A . 106 GLU O    1 1 
        1  1667 1 1 106 GLU OE1  O -10.590  22.605   6.678 1.00 . A A . 106 GLU OE1  1 1 
        1  1668 1 1 106 GLU OE2  O -11.021  21.377   4.944 1.00 . A A . 106 GLU OE2  1 1 
        1  1669 1 1 107 HIS C    C  -6.117  16.092   8.158 1.00 . A A . 107 HIS C    1 1 
        1  1670 1 1 107 HIS CA   C  -7.178  16.655   9.107 1.00 . A A . 107 HIS CA   1 1 
        1  1671 1 1 107 HIS CB   C  -7.798  15.511   9.958 1.00 . A A . 107 HIS CB   1 1 
        1  1672 1 1 107 HIS CD2  C  -6.068  13.654  10.642 1.00 . A A . 107 HIS CD2  1 1 
        1  1673 1 1 107 HIS CE1  C  -5.616  14.365  12.656 1.00 . A A . 107 HIS CE1  1 1 
        1  1674 1 1 107 HIS CG   C  -6.811  14.776  10.847 1.00 . A A . 107 HIS CG   1 1 
        1  1675 1 1 107 HIS H    H  -9.061  16.928   8.158 1.00 . A A . 107 HIS H    1 1 
        1  1676 1 1 107 HIS HA   H  -6.715  17.377   9.781 1.00 . A A . 107 HIS HA   1 1 
        1  1677 1 1 107 HIS HB2  H  -8.569  15.923  10.600 1.00 . A A . 107 HIS HB2  1 1 
        1  1678 1 1 107 HIS HB3  H  -8.258  14.784   9.296 1.00 . A A . 107 HIS HB3  1 1 
        1  1679 1 1 107 HIS HD1  H  -6.866  15.977  12.578 1.00 . A A . 107 HIS HD1  1 1 
        1  1680 1 1 107 HIS HD2  H  -6.054  13.053   9.746 1.00 . A A . 107 HIS HD2  1 1 
        1  1681 1 1 107 HIS HE1  H  -5.197  14.443  13.649 1.00 . A A . 107 HIS HE1  1 1 
        1  1682 1 1 107 HIS HE2  H  -4.890  12.580  11.992 1.00 . A A . 107 HIS HE2  1 1 
        1  1683 1 1 107 HIS N    N  -8.200  17.368   8.321 1.00 . A A . 107 HIS N    1 1 
        1  1684 1 1 107 HIS ND1  N  -6.496  15.191  12.125 1.00 . A A . 107 HIS ND1  1 1 
        1  1685 1 1 107 HIS NE2  N  -5.340  13.424  11.776 1.00 . A A . 107 HIS NE2  1 1 
        1  1686 1 1 107 HIS O    O  -6.427  15.237   7.311 1.00 . A A . 107 HIS O    1 1 
        1  1687 1 1 108 HIS C    C  -3.416  14.690   8.231 1.00 . A A . 108 HIS C    1 1 
        1  1688 1 1 108 HIS CA   C  -3.716  16.056   7.607 1.00 . A A . 108 HIS CA   1 1 
        1  1689 1 1 108 HIS CB   C  -2.494  17.010   7.720 1.00 . A A . 108 HIS CB   1 1 
        1  1690 1 1 108 HIS CD2  C  -0.224  15.729   7.477 1.00 . A A . 108 HIS CD2  1 1 
        1  1691 1 1 108 HIS CE1  C   0.202  16.235   5.400 1.00 . A A . 108 HIS CE1  1 1 
        1  1692 1 1 108 HIS CG   C  -1.245  16.505   7.031 1.00 . A A . 108 HIS CG   1 1 
        1  1693 1 1 108 HIS H    H  -4.758  17.367   8.883 1.00 . A A . 108 HIS H    1 1 
        1  1694 1 1 108 HIS HA   H  -3.969  15.928   6.555 1.00 . A A . 108 HIS HA   1 1 
        1  1695 1 1 108 HIS HB2  H  -2.747  17.969   7.280 1.00 . A A . 108 HIS HB2  1 1 
        1  1696 1 1 108 HIS HB3  H  -2.258  17.164   8.767 1.00 . A A . 108 HIS HB3  1 1 
        1  1697 1 1 108 HIS HD1  H  -1.475  17.359   5.117 1.00 . A A . 108 HIS HD1  1 1 
        1  1698 1 1 108 HIS HD2  H  -0.127  15.307   8.463 1.00 . A A . 108 HIS HD2  1 1 
        1  1699 1 1 108 HIS HE1  H   0.693  16.310   4.439 1.00 . A A . 108 HIS HE1  1 1 
        1  1700 1 1 108 HIS HE2  H   1.587  15.271   6.548 1.00 . A A . 108 HIS HE2  1 1 
        1  1701 1 1 108 HIS N    N  -4.882  16.604   8.289 1.00 . A A . 108 HIS N    1 1 
        1  1702 1 1 108 HIS ND1  N  -0.937  16.803   5.722 1.00 . A A . 108 HIS ND1  1 1 
        1  1703 1 1 108 HIS NE2  N   0.658  15.577   6.447 1.00 . A A . 108 HIS NE2  1 1 
        1  1704 1 1 108 HIS O    O  -2.864  14.607   9.338 1.00 . A A . 108 HIS O    1 1 
        1  1705 1 1 109 HIS C    C  -2.164  11.945   7.999 1.00 . A A . 109 HIS C    1 1 
        1  1706 1 1 109 HIS CA   C  -3.672  12.246   7.948 1.00 . A A . 109 HIS CA   1 1 
        1  1707 1 1 109 HIS CB   C  -4.408  11.313   6.951 1.00 . A A . 109 HIS CB   1 1 
        1  1708 1 1 109 HIS CD2  C  -3.851   8.766   6.875 1.00 . A A . 109 HIS CD2  1 1 
        1  1709 1 1 109 HIS CE1  C  -5.114   8.132   8.540 1.00 . A A . 109 HIS CE1  1 1 
        1  1710 1 1 109 HIS CG   C  -4.467   9.870   7.365 1.00 . A A . 109 HIS CG   1 1 
        1  1711 1 1 109 HIS H    H  -4.374  13.811   6.717 1.00 . A A . 109 HIS H    1 1 
        1  1712 1 1 109 HIS HA   H  -4.106  12.123   8.940 1.00 . A A . 109 HIS HA   1 1 
        1  1713 1 1 109 HIS HB2  H  -5.434  11.653   6.833 1.00 . A A . 109 HIS HB2  1 1 
        1  1714 1 1 109 HIS HB3  H  -3.919  11.368   5.983 1.00 . A A . 109 HIS HB3  1 1 
        1  1715 1 1 109 HIS HD1  H  -5.840   9.994   8.959 1.00 . A A . 109 HIS HD1  1 1 
        1  1716 1 1 109 HIS HD2  H  -3.163   8.730   6.041 1.00 . A A . 109 HIS HD2  1 1 
        1  1717 1 1 109 HIS HE1  H  -5.621   7.519   9.268 1.00 . A A . 109 HIS HE1  1 1 
        1  1718 1 1 109 HIS HE2  H  -4.191   6.764   7.354 1.00 . A A . 109 HIS HE2  1 1 
        1  1719 1 1 109 HIS N    N  -3.870  13.637   7.541 1.00 . A A . 109 HIS N    1 1 
        1  1720 1 1 109 HIS ND1  N  -5.251   9.432   8.406 1.00 . A A . 109 HIS ND1  1 1 
        1  1721 1 1 109 HIS NE2  N  -4.272   7.701   7.624 1.00 . A A . 109 HIS NE2  1 1 
        1  1722 1 1 109 HIS O    O  -1.479  12.036   6.981 1.00 . A A . 109 HIS O    1 1 
        1  1723 1 1 110 HIS C    C  -0.082  10.413  10.583 1.00 . A A . 110 HIS C    1 1 
        1  1724 1 1 110 HIS CA   C  -0.227  11.389   9.414 1.00 . A A . 110 HIS CA   1 1 
        1  1725 1 1 110 HIS CB   C   0.530  12.725   9.671 1.00 . A A . 110 HIS CB   1 1 
        1  1726 1 1 110 HIS CD2  C   2.892  11.926   8.937 1.00 . A A . 110 HIS CD2  1 1 
        1  1727 1 1 110 HIS CE1  C   4.078  12.967  10.439 1.00 . A A . 110 HIS CE1  1 1 
        1  1728 1 1 110 HIS CG   C   2.031  12.597   9.735 1.00 . A A . 110 HIS CG   1 1 
        1  1729 1 1 110 HIS H    H  -2.255  11.627   9.967 1.00 . A A . 110 HIS H    1 1 
        1  1730 1 1 110 HIS HA   H   0.181  10.920   8.517 1.00 . A A . 110 HIS HA   1 1 
        1  1731 1 1 110 HIS HB2  H   0.300  13.419   8.872 1.00 . A A . 110 HIS HB2  1 1 
        1  1732 1 1 110 HIS HB3  H   0.188  13.154  10.607 1.00 . A A . 110 HIS HB3  1 1 
        1  1733 1 1 110 HIS HD1  H   2.482  13.819  11.389 1.00 . A A . 110 HIS HD1  1 1 
        1  1734 1 1 110 HIS HD2  H   2.630  11.312   8.089 1.00 . A A . 110 HIS HD2  1 1 
        1  1735 1 1 110 HIS HE1  H   4.915  13.339  11.011 1.00 . A A . 110 HIS HE1  1 1 
        1  1736 1 1 110 HIS HE2  H   4.924  11.581   9.221 1.00 . A A . 110 HIS HE2  1 1 
        1  1737 1 1 110 HIS N    N  -1.653  11.651   9.195 1.00 . A A . 110 HIS N    1 1 
        1  1738 1 1 110 HIS ND1  N   2.810  13.242  10.665 1.00 . A A . 110 HIS ND1  1 1 
        1  1739 1 1 110 HIS NE2  N   4.158  12.169   9.393 1.00 . A A . 110 HIS NE2  1 1 
        1  1740 1 1 110 HIS O    O   0.018  10.822  11.745 1.00 . A A . 110 HIS O    1 1 
        1  1741 1 1 111 HIS C    C   1.321   7.965  11.873 1.00 . A A . 111 HIS C    1 1 
        1  1742 1 1 111 HIS CA   C  -0.071   8.015  11.229 1.00 . A A . 111 HIS CA   1 1 
        1  1743 1 1 111 HIS CB   C  -0.411   6.674  10.536 1.00 . A A . 111 HIS CB   1 1 
        1  1744 1 1 111 HIS CD2  C  -1.307   5.147  12.455 1.00 . A A . 111 HIS CD2  1 1 
        1  1745 1 1 111 HIS CE1  C   0.151   3.526  12.287 1.00 . A A . 111 HIS CE1  1 1 
        1  1746 1 1 111 HIS CG   C  -0.450   5.474  11.455 1.00 . A A . 111 HIS CG   1 1 
        1  1747 1 1 111 HIS H    H  -0.229   8.878   9.307 1.00 . A A . 111 HIS H    1 1 
        1  1748 1 1 111 HIS HA   H  -0.813   8.208  12.002 1.00 . A A . 111 HIS HA   1 1 
        1  1749 1 1 111 HIS HB2  H  -1.387   6.758  10.075 1.00 . A A . 111 HIS HB2  1 1 
        1  1750 1 1 111 HIS HB3  H   0.320   6.477   9.758 1.00 . A A . 111 HIS HB3  1 1 
        1  1751 1 1 111 HIS HD1  H   1.206   4.372  10.756 1.00 . A A . 111 HIS HD1  1 1 
        1  1752 1 1 111 HIS HD2  H  -2.150   5.730  12.798 1.00 . A A . 111 HIS HD2  1 1 
        1  1753 1 1 111 HIS HE1  H   0.686   2.603  12.457 1.00 . A A . 111 HIS HE1  1 1 
        1  1754 1 1 111 HIS HE2  H  -1.266   3.509  13.761 1.00 . A A . 111 HIS HE2  1 1 
        1  1755 1 1 111 HIS N    N  -0.140   9.111  10.251 1.00 . A A . 111 HIS N    1 1 
        1  1756 1 1 111 HIS ND1  N   0.452   4.435  11.380 1.00 . A A . 111 HIS ND1  1 1 
        1  1757 1 1 111 HIS NE2  N  -0.908   3.935  12.951 1.00 . A A . 111 HIS NE2  1 1 
        1  1758 1 1 111 HIS O    O   1.446   7.834  13.094 1.00 . A A . 111 HIS O    1 1 
        1  1759 1 1 112 HIS C    C   4.560   9.062  10.515 1.00 . A A . 112 HIS C    1 1 
        1  1760 1 1 112 HIS CA   C   3.761   8.142  11.468 1.00 . A A . 112 HIS CA   1 1 
        1  1761 1 1 112 HIS CB   C   4.387   6.730  11.503 1.00 . A A . 112 HIS CB   1 1 
        1  1762 1 1 112 HIS CD2  C   6.177   6.376  13.367 1.00 . A A . 112 HIS CD2  1 1 
        1  1763 1 1 112 HIS CE1  C   7.950   6.915  12.217 1.00 . A A . 112 HIS CE1  1 1 
        1  1764 1 1 112 HIS CG   C   5.766   6.696  12.118 1.00 . A A . 112 HIS CG   1 1 
        1  1765 1 1 112 HIS H    H   2.179   8.122  10.069 1.00 . A A . 112 HIS H    1 1 
        1  1766 1 1 112 HIS HA   H   3.780   8.568  12.474 1.00 . A A . 112 HIS HA   1 1 
        1  1767 1 1 112 HIS HB2  H   3.745   6.072  12.079 1.00 . A A . 112 HIS HB2  1 1 
        1  1768 1 1 112 HIS HB3  H   4.459   6.344  10.491 1.00 . A A . 112 HIS HB3  1 1 
        1  1769 1 1 112 HIS HD1  H   6.947   7.304  10.485 1.00 . A A . 112 HIS HD1  1 1 
        1  1770 1 1 112 HIS HD2  H   5.547   6.070  14.192 1.00 . A A . 112 HIS HD2  1 1 
        1  1771 1 1 112 HIS HE1  H   8.976   7.110  11.943 1.00 . A A . 112 HIS HE1  1 1 
        1  1772 1 1 112 HIS HE2  H   8.117   6.236  14.132 1.00 . A A . 112 HIS HE2  1 1 
        1  1773 1 1 112 HIS N    N   2.358   8.080  11.028 1.00 . A A . 112 HIS N    1 1 
        1  1774 1 1 112 HIS ND1  N   6.909   7.028  11.424 1.00 . A A . 112 HIS ND1  1 1 
        1  1775 1 1 112 HIS NE2  N   7.536   6.519  13.398 1.00 . A A . 112 HIS NE2  1 1 
        1  1776 1 1 112 HIS O    O   4.453   8.888   9.279 1.00 . A A . 112 HIS O    1 1 
        1  1777 1 1 112 HIS OXT  O   5.304   9.943  11.000 1.00 . A A . 112 HIS OXT  1 1 
        2  1778 1 1   1 MET C    C   0.328  14.219   1.025 1.00 . A A .   1 MET C    1 1 
        2  1779 1 1   1 MET CA   C  -0.874  14.698   0.188 1.00 . A A .   1 MET CA   1 1 
        2  1780 1 1   1 MET CB   C  -0.434  15.290  -1.187 1.00 . A A .   1 MET CB   1 1 
        2  1781 1 1   1 MET CE   C  -3.960  15.246  -3.472 1.00 . A A .   1 MET CE   1 1 
        2  1782 1 1   1 MET CG   C  -1.594  15.781  -2.065 1.00 . A A .   1 MET CG   1 1 
        2  1783 1 1   1 MET H1   H  -1.052  16.540   1.160 1.00 . A A .   1 MET H1   1 1 
        2  1784 1 1   1 MET H2   H  -1.983  15.311   1.845 1.00 . A A .   1 MET H2   1 1 
        2  1785 1 1   1 MET H3   H  -2.473  16.027   0.396 1.00 . A A .   1 MET H3   1 1 
        2  1786 1 1   1 MET HA   H  -1.527  13.851   0.023 1.00 . A A .   1 MET HA   1 1 
        2  1787 1 1   1 MET HB2  H   0.238  16.122  -1.011 1.00 . A A .   1 MET HB2  1 1 
        2  1788 1 1   1 MET HB3  H   0.107  14.524  -1.738 1.00 . A A .   1 MET HB3  1 1 
        2  1789 1 1   1 MET HE1  H  -4.305  16.227  -3.175 1.00 . A A .   1 MET HE1  1 1 
        2  1790 1 1   1 MET HE2  H  -4.811  14.601  -3.627 1.00 . A A .   1 MET HE2  1 1 
        2  1791 1 1   1 MET HE3  H  -3.398  15.327  -4.393 1.00 . A A .   1 MET HE3  1 1 
        2  1792 1 1   1 MET HG2  H  -2.003  16.686  -1.636 1.00 . A A .   1 MET HG2  1 1 
        2  1793 1 1   1 MET HG3  H  -1.222  15.997  -3.061 1.00 . A A .   1 MET HG3  1 1 
        2  1794 1 1   1 MET N    N  -1.647  15.715   0.949 1.00 . A A .   1 MET N    1 1 
        2  1795 1 1   1 MET O    O   0.283  14.282   2.262 1.00 . A A .   1 MET O    1 1 
        2  1796 1 1   1 MET SD   S  -2.916  14.557  -2.189 1.00 . A A .   1 MET SD   1 1 
        2  1797 1 1   2 GLY C    C   2.703  12.019   1.692 1.00 . A A .   2 GLY C    1 1 
        2  1798 1 1   2 GLY CA   C   2.652  13.368   1.000 1.00 . A A .   2 GLY CA   1 1 
        2  1799 1 1   2 GLY H    H   1.267  13.481  -0.599 1.00 . A A .   2 GLY H    1 1 
        2  1800 1 1   2 GLY HA2  H   3.416  13.381   0.238 1.00 . A A .   2 GLY HA2  1 1 
        2  1801 1 1   2 GLY HA3  H   2.883  14.141   1.724 1.00 . A A .   2 GLY HA3  1 1 
        2  1802 1 1   2 GLY N    N   1.371  13.678   0.354 1.00 . A A .   2 GLY N    1 1 
        2  1803 1 1   2 GLY O    O   3.634  11.769   2.466 1.00 . A A .   2 GLY O    1 1 
        2  1804 1 1   3 LYS C    C   1.175   8.693   1.127 1.00 . A A .   3 LYS C    1 1 
        2  1805 1 1   3 LYS CA   C   1.652   9.810   2.061 1.00 . A A .   3 LYS CA   1 1 
        2  1806 1 1   3 LYS CB   C   0.789   9.835   3.351 1.00 . A A .   3 LYS CB   1 1 
        2  1807 1 1   3 LYS CD   C  -1.569   9.940   4.371 1.00 . A A .   3 LYS CD   1 1 
        2  1808 1 1   3 LYS CE   C  -0.954  10.070   5.776 1.00 . A A .   3 LYS CE   1 1 
        2  1809 1 1   3 LYS CG   C  -0.636  10.422   3.222 1.00 . A A .   3 LYS CG   1 1 
        2  1810 1 1   3 LYS H    H   1.052  11.361   0.731 1.00 . A A .   3 LYS H    1 1 
        2  1811 1 1   3 LYS HA   H   2.667   9.551   2.350 1.00 . A A .   3 LYS HA   1 1 
        2  1812 1 1   3 LYS HB2  H   0.698   8.815   3.714 1.00 . A A .   3 LYS HB2  1 1 
        2  1813 1 1   3 LYS HB3  H   1.321  10.409   4.102 1.00 . A A .   3 LYS HB3  1 1 
        2  1814 1 1   3 LYS HD2  H  -2.487  10.515   4.344 1.00 . A A .   3 LYS HD2  1 1 
        2  1815 1 1   3 LYS HD3  H  -1.809   8.897   4.197 1.00 . A A .   3 LYS HD3  1 1 
        2  1816 1 1   3 LYS HE2  H   0.002   9.560   5.799 1.00 . A A .   3 LYS HE2  1 1 
        2  1817 1 1   3 LYS HE3  H  -0.805  11.118   6.005 1.00 . A A .   3 LYS HE3  1 1 
        2  1818 1 1   3 LYS HG2  H  -0.575  11.506   3.245 1.00 . A A .   3 LYS HG2  1 1 
        2  1819 1 1   3 LYS HG3  H  -1.060  10.114   2.271 1.00 . A A .   3 LYS HG3  1 1 
        2  1820 1 1   3 LYS HZ1  H  -2.811   9.803   6.699 1.00 . A A .   3 LYS HZ1  1 1 
        2  1821 1 1   3 LYS HZ2  H  -1.507   9.730   7.767 1.00 . A A .   3 LYS HZ2  1 1 
        2  1822 1 1   3 LYS HZ3  H  -1.835   8.430   6.745 1.00 . A A .   3 LYS HZ3  1 1 
        2  1823 1 1   3 LYS N    N   1.723  11.131   1.409 1.00 . A A .   3 LYS N    1 1 
        2  1824 1 1   3 LYS NZ   N  -1.836   9.470   6.816 1.00 . A A .   3 LYS NZ   1 1 
        2  1825 1 1   3 LYS O    O   0.757   8.925  -0.008 1.00 . A A .   3 LYS O    1 1 
        2  1826 1 1   4 VAL C    C   0.182   5.255   1.893 1.00 . A A .   4 VAL C    1 1 
        2  1827 1 1   4 VAL CA   C   0.931   6.223   0.955 1.00 . A A .   4 VAL CA   1 1 
        2  1828 1 1   4 VAL CB   C   2.250   5.570   0.417 1.00 . A A .   4 VAL CB   1 1 
        2  1829 1 1   4 VAL CG1  C   3.262   5.321   1.543 1.00 . A A .   4 VAL CG1  1 1 
        2  1830 1 1   4 VAL CG2  C   1.969   4.281  -0.371 1.00 . A A .   4 VAL CG2  1 1 
        2  1831 1 1   4 VAL H    H   1.520   7.391   2.605 1.00 . A A .   4 VAL H    1 1 
        2  1832 1 1   4 VAL HA   H   0.291   6.464   0.105 1.00 . A A .   4 VAL HA   1 1 
        2  1833 1 1   4 VAL HB   H   2.700   6.278  -0.260 1.00 . A A .   4 VAL HB   1 1 
        2  1834 1 1   4 VAL HG11 H   3.480   6.251   2.053 1.00 . A A .   4 VAL HG11 1 1 
        2  1835 1 1   4 VAL HG12 H   4.176   4.917   1.130 1.00 . A A .   4 VAL HG12 1 1 
        2  1836 1 1   4 VAL HG13 H   2.847   4.612   2.252 1.00 . A A .   4 VAL HG13 1 1 
        2  1837 1 1   4 VAL HG21 H   2.897   3.889  -0.778 1.00 . A A .   4 VAL HG21 1 1 
        2  1838 1 1   4 VAL HG22 H   1.289   4.490  -1.186 1.00 . A A .   4 VAL HG22 1 1 
        2  1839 1 1   4 VAL HG23 H   1.525   3.538   0.280 1.00 . A A .   4 VAL HG23 1 1 
        2  1840 1 1   4 VAL N    N   1.240   7.466   1.667 1.00 . A A .   4 VAL N    1 1 
        2  1841 1 1   4 VAL O    O   0.424   5.242   3.096 1.00 . A A .   4 VAL O    1 1 
        2  1842 1 1   5 LEU C    C  -0.940   2.096   1.895 1.00 . A A .   5 LEU C    1 1 
        2  1843 1 1   5 LEU CA   C  -1.544   3.491   2.082 1.00 . A A .   5 LEU CA   1 1 
        2  1844 1 1   5 LEU CB   C  -3.021   3.514   1.606 1.00 . A A .   5 LEU CB   1 1 
        2  1845 1 1   5 LEU CD1  C  -4.086   3.078   3.898 1.00 . A A .   5 LEU CD1  1 1 
        2  1846 1 1   5 LEU CD2  C  -5.423   2.630   1.772 1.00 . A A .   5 LEU CD2  1 1 
        2  1847 1 1   5 LEU CG   C  -4.021   2.634   2.424 1.00 . A A .   5 LEU CG   1 1 
        2  1848 1 1   5 LEU H    H  -0.885   4.527   0.369 1.00 . A A .   5 LEU H    1 1 
        2  1849 1 1   5 LEU HA   H  -1.510   3.759   3.142 1.00 . A A .   5 LEU HA   1 1 
        2  1850 1 1   5 LEU HB2  H  -3.367   4.543   1.640 1.00 . A A .   5 LEU HB2  1 1 
        2  1851 1 1   5 LEU HB3  H  -3.051   3.190   0.569 1.00 . A A .   5 LEU HB3  1 1 
        2  1852 1 1   5 LEU HD11 H  -4.794   2.458   4.432 1.00 . A A .   5 LEU HD11 1 1 
        2  1853 1 1   5 LEU HD12 H  -4.396   4.111   3.963 1.00 . A A .   5 LEU HD12 1 1 
        2  1854 1 1   5 LEU HD13 H  -3.107   2.967   4.352 1.00 . A A .   5 LEU HD13 1 1 
        2  1855 1 1   5 LEU HD21 H  -6.086   1.986   2.334 1.00 . A A .   5 LEU HD21 1 1 
        2  1856 1 1   5 LEU HD22 H  -5.348   2.260   0.756 1.00 . A A .   5 LEU HD22 1 1 
        2  1857 1 1   5 LEU HD23 H  -5.827   3.632   1.755 1.00 . A A .   5 LEU HD23 1 1 
        2  1858 1 1   5 LEU HG   H  -3.665   1.610   2.420 1.00 . A A .   5 LEU HG   1 1 
        2  1859 1 1   5 LEU N    N  -0.746   4.465   1.330 1.00 . A A .   5 LEU N    1 1 
        2  1860 1 1   5 LEU O    O  -1.139   1.458   0.855 1.00 . A A .   5 LEU O    1 1 
        2  1861 1 1   6 LEU C    C  -0.678  -0.689   3.306 1.00 . A A .   6 LEU C    1 1 
        2  1862 1 1   6 LEU CA   C   0.427   0.327   2.917 1.00 . A A .   6 LEU CA   1 1 
        2  1863 1 1   6 LEU CB   C   1.612   0.326   3.935 1.00 . A A .   6 LEU CB   1 1 
        2  1864 1 1   6 LEU CD1  C   3.107  -1.314   2.660 1.00 . A A .   6 LEU CD1  1 1 
        2  1865 1 1   6 LEU CD2  C   3.537  -0.864   5.137 1.00 . A A .   6 LEU CD2  1 1 
        2  1866 1 1   6 LEU CG   C   2.469  -0.974   4.018 1.00 . A A .   6 LEU CG   1 1 
        2  1867 1 1   6 LEU H    H   0.049   2.281   3.608 1.00 . A A .   6 LEU H    1 1 
        2  1868 1 1   6 LEU HA   H   0.808   0.086   1.924 1.00 . A A .   6 LEU HA   1 1 
        2  1869 1 1   6 LEU HB2  H   2.273   1.147   3.679 1.00 . A A .   6 LEU HB2  1 1 
        2  1870 1 1   6 LEU HB3  H   1.203   0.526   4.924 1.00 . A A .   6 LEU HB3  1 1 
        2  1871 1 1   6 LEU HD11 H   3.703  -2.212   2.753 1.00 . A A .   6 LEU HD11 1 1 
        2  1872 1 1   6 LEU HD12 H   3.737  -0.498   2.331 1.00 . A A .   6 LEU HD12 1 1 
        2  1873 1 1   6 LEU HD13 H   2.328  -1.481   1.926 1.00 . A A .   6 LEU HD13 1 1 
        2  1874 1 1   6 LEU HD21 H   4.106  -1.784   5.191 1.00 . A A .   6 LEU HD21 1 1 
        2  1875 1 1   6 LEU HD22 H   3.048  -0.696   6.088 1.00 . A A .   6 LEU HD22 1 1 
        2  1876 1 1   6 LEU HD23 H   4.210  -0.041   4.931 1.00 . A A .   6 LEU HD23 1 1 
        2  1877 1 1   6 LEU HG   H   1.821  -1.803   4.273 1.00 . A A .   6 LEU HG   1 1 
        2  1878 1 1   6 LEU N    N  -0.151   1.668   2.878 1.00 . A A .   6 LEU N    1 1 
        2  1879 1 1   6 LEU O    O  -0.937  -0.923   4.492 1.00 . A A .   6 LEU O    1 1 
        2  1880 1 1   7 VAL C    C  -1.783  -3.629   2.581 1.00 . A A .   7 VAL C    1 1 
        2  1881 1 1   7 VAL CA   C  -2.418  -2.244   2.424 1.00 . A A .   7 VAL CA   1 1 
        2  1882 1 1   7 VAL CB   C  -3.410  -2.263   1.195 1.00 . A A .   7 VAL CB   1 1 
        2  1883 1 1   7 VAL CG1  C  -4.592  -3.244   1.428 1.00 . A A .   7 VAL CG1  1 1 
        2  1884 1 1   7 VAL CG2  C  -3.908  -0.843   0.863 1.00 . A A .   7 VAL CG2  1 1 
        2  1885 1 1   7 VAL H    H  -1.134  -0.931   1.375 1.00 . A A .   7 VAL H    1 1 
        2  1886 1 1   7 VAL HA   H  -2.992  -2.004   3.322 1.00 . A A .   7 VAL HA   1 1 
        2  1887 1 1   7 VAL HB   H  -2.858  -2.624   0.327 1.00 . A A .   7 VAL HB   1 1 
        2  1888 1 1   7 VAL HG11 H  -5.244  -3.243   0.563 1.00 . A A .   7 VAL HG11 1 1 
        2  1889 1 1   7 VAL HG12 H  -5.159  -2.939   2.299 1.00 . A A .   7 VAL HG12 1 1 
        2  1890 1 1   7 VAL HG13 H  -4.211  -4.246   1.585 1.00 . A A .   7 VAL HG13 1 1 
        2  1891 1 1   7 VAL HG21 H  -4.443  -0.434   1.711 1.00 . A A .   7 VAL HG21 1 1 
        2  1892 1 1   7 VAL HG22 H  -4.568  -0.875   0.005 1.00 . A A .   7 VAL HG22 1 1 
        2  1893 1 1   7 VAL HG23 H  -3.062  -0.204   0.636 1.00 . A A .   7 VAL HG23 1 1 
        2  1894 1 1   7 VAL N    N  -1.354  -1.232   2.274 1.00 . A A .   7 VAL N    1 1 
        2  1895 1 1   7 VAL O    O  -1.239  -4.194   1.619 1.00 . A A .   7 VAL O    1 1 
        2  1896 1 1   8 ILE C    C  -2.331  -6.439   4.509 1.00 . A A .   8 ILE C    1 1 
        2  1897 1 1   8 ILE CA   C  -1.235  -5.419   4.186 1.00 . A A .   8 ILE CA   1 1 
        2  1898 1 1   8 ILE CB   C  -0.309  -5.257   5.446 1.00 . A A .   8 ILE CB   1 1 
        2  1899 1 1   8 ILE CD1  C   1.479  -3.724   6.506 1.00 . A A .   8 ILE CD1  1 1 
        2  1900 1 1   8 ILE CG1  C   0.633  -4.027   5.292 1.00 . A A .   8 ILE CG1  1 1 
        2  1901 1 1   8 ILE CG2  C   0.501  -6.557   5.701 1.00 . A A .   8 ILE CG2  1 1 
        2  1902 1 1   8 ILE H    H  -2.332  -3.665   4.482 1.00 . A A .   8 ILE H    1 1 
        2  1903 1 1   8 ILE HA   H  -0.627  -5.782   3.355 1.00 . A A .   8 ILE HA   1 1 
        2  1904 1 1   8 ILE HB   H  -0.944  -5.095   6.314 1.00 . A A .   8 ILE HB   1 1 
        2  1905 1 1   8 ILE HD11 H   2.112  -2.878   6.295 1.00 . A A .   8 ILE HD11 1 1 
        2  1906 1 1   8 ILE HD12 H   2.095  -4.580   6.746 1.00 . A A .   8 ILE HD12 1 1 
        2  1907 1 1   8 ILE HD13 H   0.839  -3.491   7.346 1.00 . A A .   8 ILE HD13 1 1 
        2  1908 1 1   8 ILE HG12 H   1.301  -4.183   4.458 1.00 . A A .   8 ILE HG12 1 1 
        2  1909 1 1   8 ILE HG13 H   0.032  -3.145   5.092 1.00 . A A .   8 ILE HG13 1 1 
        2  1910 1 1   8 ILE HG21 H  -0.176  -7.392   5.844 1.00 . A A .   8 ILE HG21 1 1 
        2  1911 1 1   8 ILE HG22 H   1.109  -6.442   6.589 1.00 . A A .   8 ILE HG22 1 1 
        2  1912 1 1   8 ILE HG23 H   1.145  -6.762   4.854 1.00 . A A .   8 ILE HG23 1 1 
        2  1913 1 1   8 ILE N    N  -1.846  -4.152   3.805 1.00 . A A .   8 ILE N    1 1 
        2  1914 1 1   8 ILE O    O  -3.189  -6.198   5.371 1.00 . A A .   8 ILE O    1 1 
        2  1915 1 1   9 SER C    C  -2.148  -9.953   3.918 1.00 . A A .   9 SER C    1 1 
        2  1916 1 1   9 SER CA   C  -3.074  -8.749   4.093 1.00 . A A .   9 SER CA   1 1 
        2  1917 1 1   9 SER CB   C  -4.304  -8.842   3.157 1.00 . A A .   9 SER CB   1 1 
        2  1918 1 1   9 SER H    H  -1.682  -7.594   3.034 1.00 . A A .   9 SER H    1 1 
        2  1919 1 1   9 SER HA   H  -3.408  -8.705   5.128 1.00 . A A .   9 SER HA   1 1 
        2  1920 1 1   9 SER HB2  H  -4.969  -8.011   3.356 1.00 . A A .   9 SER HB2  1 1 
        2  1921 1 1   9 SER HB3  H  -3.976  -8.789   2.131 1.00 . A A .   9 SER HB3  1 1 
        2  1922 1 1   9 SER HG   H  -5.324 -10.377   2.482 1.00 . A A .   9 SER HG   1 1 
        2  1923 1 1   9 SER N    N  -2.288  -7.560   3.801 1.00 . A A .   9 SER N    1 1 
        2  1924 1 1   9 SER O    O  -1.272  -9.955   3.037 1.00 . A A .   9 SER O    1 1 
        2  1925 1 1   9 SER OG   O  -5.031 -10.050   3.339 1.00 . A A .   9 SER OG   1 1 
        2  1926 1 1  10 THR C    C  -2.234 -13.140   3.666 1.00 . A A .  10 THR C    1 1 
        2  1927 1 1  10 THR CA   C  -1.572 -12.210   4.702 1.00 . A A .  10 THR CA   1 1 
        2  1928 1 1  10 THR CB   C  -1.514 -12.888   6.103 1.00 . A A .  10 THR CB   1 1 
        2  1929 1 1  10 THR CG2  C  -0.668 -12.063   7.101 1.00 . A A .  10 THR CG2  1 1 
        2  1930 1 1  10 THR H    H  -2.957 -10.835   5.512 1.00 . A A .  10 THR H    1 1 
        2  1931 1 1  10 THR HA   H  -0.556 -11.996   4.376 1.00 . A A .  10 THR HA   1 1 
        2  1932 1 1  10 THR HB   H  -1.069 -13.873   6.003 1.00 . A A .  10 THR HB   1 1 
        2  1933 1 1  10 THR HG1  H  -3.195 -13.897   6.383 1.00 . A A .  10 THR HG1  1 1 
        2  1934 1 1  10 THR HG21 H  -0.642 -12.570   8.059 1.00 . A A .  10 THR HG21 1 1 
        2  1935 1 1  10 THR HG22 H  -1.103 -11.081   7.230 1.00 . A A .  10 THR HG22 1 1 
        2  1936 1 1  10 THR HG23 H   0.342 -11.961   6.727 1.00 . A A .  10 THR HG23 1 1 
        2  1937 1 1  10 THR N    N  -2.311 -10.947   4.786 1.00 . A A .  10 THR N    1 1 
        2  1938 1 1  10 THR O    O  -1.605 -14.074   3.157 1.00 . A A .  10 THR O    1 1 
        2  1939 1 1  10 THR OG1  O  -2.850 -13.029   6.619 1.00 . A A .  10 THR OG1  1 1 
        2  1940 1 1  11 ASP C    C  -4.219 -12.904   1.011 1.00 . A A .  11 ASP C    1 1 
        2  1941 1 1  11 ASP CA   C  -4.308 -13.605   2.383 1.00 . A A .  11 ASP CA   1 1 
        2  1942 1 1  11 ASP CB   C  -5.783 -13.727   2.848 1.00 . A A .  11 ASP CB   1 1 
        2  1943 1 1  11 ASP CG   C  -6.582 -14.724   1.991 1.00 . A A .  11 ASP CG   1 1 
        2  1944 1 1  11 ASP H    H  -3.936 -12.094   3.810 1.00 . A A .  11 ASP H    1 1 
        2  1945 1 1  11 ASP HA   H  -3.882 -14.606   2.300 1.00 . A A .  11 ASP HA   1 1 
        2  1946 1 1  11 ASP HB2  H  -5.804 -14.059   3.885 1.00 . A A .  11 ASP HB2  1 1 
        2  1947 1 1  11 ASP HB3  H  -6.260 -12.752   2.793 1.00 . A A .  11 ASP HB3  1 1 
        2  1948 1 1  11 ASP N    N  -3.517 -12.853   3.362 1.00 . A A .  11 ASP N    1 1 
        2  1949 1 1  11 ASP O    O  -4.680 -11.767   0.860 1.00 . A A .  11 ASP O    1 1 
        2  1950 1 1  11 ASP OD1  O  -7.067 -14.352   0.909 1.00 . A A .  11 ASP OD1  1 1 
        2  1951 1 1  11 ASP OD2  O  -6.684 -15.906   2.374 1.00 . A A .  11 ASP OD2  1 1 
        2  1952 1 1  12 THR C    C  -4.642 -12.883  -2.165 1.00 . A A .  12 THR C    1 1 
        2  1953 1 1  12 THR CA   C  -3.362 -13.075  -1.325 1.00 . A A .  12 THR CA   1 1 
        2  1954 1 1  12 THR CB   C  -2.375 -14.018  -2.085 1.00 . A A .  12 THR CB   1 1 
        2  1955 1 1  12 THR CG2  C  -0.983 -14.037  -1.426 1.00 . A A .  12 THR CG2  1 1 
        2  1956 1 1  12 THR H    H  -3.379 -14.535   0.216 1.00 . A A .  12 THR H    1 1 
        2  1957 1 1  12 THR HA   H  -2.879 -12.108  -1.205 1.00 . A A .  12 THR HA   1 1 
        2  1958 1 1  12 THR HB   H  -2.265 -13.662  -3.108 1.00 . A A .  12 THR HB   1 1 
        2  1959 1 1  12 THR HG1  H  -3.510 -15.444  -2.870 1.00 . A A .  12 THR HG1  1 1 
        2  1960 1 1  12 THR HG21 H  -0.330 -14.706  -1.971 1.00 . A A .  12 THR HG21 1 1 
        2  1961 1 1  12 THR HG22 H  -1.065 -14.378  -0.403 1.00 . A A .  12 THR HG22 1 1 
        2  1962 1 1  12 THR HG23 H  -0.558 -13.036  -1.440 1.00 . A A .  12 THR HG23 1 1 
        2  1963 1 1  12 THR N    N  -3.639 -13.610   0.025 1.00 . A A .  12 THR N    1 1 
        2  1964 1 1  12 THR O    O  -4.680 -12.028  -3.061 1.00 . A A .  12 THR O    1 1 
        2  1965 1 1  12 THR OG1  O  -2.909 -15.354  -2.120 1.00 . A A .  12 THR OG1  1 1 
        2  1966 1 1  13 ASN C    C  -7.717 -12.351  -2.274 1.00 . A A .  13 ASN C    1 1 
        2  1967 1 1  13 ASN CA   C  -6.968 -13.658  -2.581 1.00 . A A .  13 ASN CA   1 1 
        2  1968 1 1  13 ASN CB   C  -7.835 -14.895  -2.188 1.00 . A A .  13 ASN CB   1 1 
        2  1969 1 1  13 ASN CG   C  -7.198 -16.253  -2.527 1.00 . A A .  13 ASN CG   1 1 
        2  1970 1 1  13 ASN H    H  -5.586 -14.293  -1.098 1.00 . A A .  13 ASN H    1 1 
        2  1971 1 1  13 ASN HA   H  -6.751 -13.699  -3.647 1.00 . A A .  13 ASN HA   1 1 
        2  1972 1 1  13 ASN HB2  H  -8.014 -14.878  -1.120 1.00 . A A .  13 ASN HB2  1 1 
        2  1973 1 1  13 ASN HB3  H  -8.790 -14.835  -2.700 1.00 . A A .  13 ASN HB3  1 1 
        2  1974 1 1  13 ASN HD21 H  -8.972 -17.138  -2.427 1.00 . A A .  13 ASN HD21 1 1 
        2  1975 1 1  13 ASN HD22 H  -7.638 -18.167  -2.810 1.00 . A A .  13 ASN HD22 1 1 
        2  1976 1 1  13 ASN N    N  -5.681 -13.680  -1.855 1.00 . A A .  13 ASN N    1 1 
        2  1977 1 1  13 ASN ND2  N  -8.017 -17.289  -2.596 1.00 . A A .  13 ASN ND2  1 1 
        2  1978 1 1  13 ASN O    O  -8.313 -11.747  -3.170 1.00 . A A .  13 ASN O    1 1 
        2  1979 1 1  13 ASN OD1  O  -5.981 -16.382  -2.674 1.00 . A A .  13 ASN OD1  1 1 
        2  1980 1 1  14 ILE C    C  -7.557  -9.447  -1.218 1.00 . A A .  14 ILE C    1 1 
        2  1981 1 1  14 ILE CA   C  -8.257 -10.639  -0.547 1.00 . A A .  14 ILE CA   1 1 
        2  1982 1 1  14 ILE CB   C  -8.211 -10.465   1.018 1.00 . A A .  14 ILE CB   1 1 
        2  1983 1 1  14 ILE CD1  C -10.268 -12.053   1.363 1.00 . A A .  14 ILE CD1  1 1 
        2  1984 1 1  14 ILE CG1  C  -8.834 -11.696   1.747 1.00 . A A .  14 ILE CG1  1 1 
        2  1985 1 1  14 ILE CG2  C  -8.909  -9.154   1.456 1.00 . A A .  14 ILE CG2  1 1 
        2  1986 1 1  14 ILE H    H  -7.157 -12.455  -0.337 1.00 . A A .  14 ILE H    1 1 
        2  1987 1 1  14 ILE HA   H  -9.301 -10.659  -0.857 1.00 . A A .  14 ILE HA   1 1 
        2  1988 1 1  14 ILE HB   H  -7.164 -10.387   1.311 1.00 . A A .  14 ILE HB   1 1 
        2  1989 1 1  14 ILE HD11 H -10.925 -11.228   1.597 1.00 . A A .  14 ILE HD11 1 1 
        2  1990 1 1  14 ILE HD12 H -10.577 -12.922   1.924 1.00 . A A .  14 ILE HD12 1 1 
        2  1991 1 1  14 ILE HD13 H -10.326 -12.273   0.307 1.00 . A A .  14 ILE HD13 1 1 
        2  1992 1 1  14 ILE HG12 H  -8.228 -12.564   1.540 1.00 . A A .  14 ILE HG12 1 1 
        2  1993 1 1  14 ILE HG13 H  -8.820 -11.520   2.819 1.00 . A A .  14 ILE HG13 1 1 
        2  1994 1 1  14 ILE HG21 H  -9.953  -9.180   1.169 1.00 . A A .  14 ILE HG21 1 1 
        2  1995 1 1  14 ILE HG22 H  -8.433  -8.302   0.980 1.00 . A A .  14 ILE HG22 1 1 
        2  1996 1 1  14 ILE HG23 H  -8.839  -9.041   2.531 1.00 . A A .  14 ILE HG23 1 1 
        2  1997 1 1  14 ILE N    N  -7.640 -11.906  -0.995 1.00 . A A .  14 ILE N    1 1 
        2  1998 1 1  14 ILE O    O  -8.222  -8.538  -1.715 1.00 . A A .  14 ILE O    1 1 
        2  1999 1 1  15 ILE C    C  -5.779  -8.347  -3.396 1.00 . A A .  15 ILE C    1 1 
        2  2000 1 1  15 ILE CA   C  -5.368  -8.472  -1.920 1.00 . A A .  15 ILE CA   1 1 
        2  2001 1 1  15 ILE CB   C  -3.834  -8.829  -1.828 1.00 . A A .  15 ILE CB   1 1 
        2  2002 1 1  15 ILE CD1  C  -2.040  -9.600  -0.128 1.00 . A A .  15 ILE CD1  1 1 
        2  2003 1 1  15 ILE CG1  C  -3.402  -8.971  -0.342 1.00 . A A .  15 ILE CG1  1 1 
        2  2004 1 1  15 ILE CG2  C  -2.954  -7.781  -2.565 1.00 . A A .  15 ILE CG2  1 1 
        2  2005 1 1  15 ILE H    H  -5.757 -10.238  -0.793 1.00 . A A .  15 ILE H    1 1 
        2  2006 1 1  15 ILE HA   H  -5.536  -7.523  -1.417 1.00 . A A .  15 ILE HA   1 1 
        2  2007 1 1  15 ILE HB   H  -3.687  -9.787  -2.323 1.00 . A A .  15 ILE HB   1 1 
        2  2008 1 1  15 ILE HD11 H  -2.023 -10.588  -0.566 1.00 . A A .  15 ILE HD11 1 1 
        2  2009 1 1  15 ILE HD12 H  -1.842  -9.674   0.930 1.00 . A A .  15 ILE HD12 1 1 
        2  2010 1 1  15 ILE HD13 H  -1.280  -8.987  -0.591 1.00 . A A .  15 ILE HD13 1 1 
        2  2011 1 1  15 ILE HG12 H  -3.383  -7.996   0.124 1.00 . A A .  15 ILE HG12 1 1 
        2  2012 1 1  15 ILE HG13 H  -4.125  -9.586   0.182 1.00 . A A .  15 ILE HG13 1 1 
        2  2013 1 1  15 ILE HG21 H  -1.909  -8.065  -2.494 1.00 . A A .  15 ILE HG21 1 1 
        2  2014 1 1  15 ILE HG22 H  -3.087  -6.807  -2.115 1.00 . A A .  15 ILE HG22 1 1 
        2  2015 1 1  15 ILE HG23 H  -3.240  -7.731  -3.609 1.00 . A A .  15 ILE HG23 1 1 
        2  2016 1 1  15 ILE N    N  -6.204  -9.492  -1.244 1.00 . A A .  15 ILE N    1 1 
        2  2017 1 1  15 ILE O    O  -6.013  -7.251  -3.878 1.00 . A A .  15 ILE O    1 1 
        2  2018 1 1  16 SER C    C  -7.699  -9.010  -5.742 1.00 . A A .  16 SER C    1 1 
        2  2019 1 1  16 SER CA   C  -6.291  -9.591  -5.486 1.00 . A A .  16 SER CA   1 1 
        2  2020 1 1  16 SER CB   C  -6.209 -11.066  -5.948 1.00 . A A .  16 SER CB   1 1 
        2  2021 1 1  16 SER H    H  -5.795 -10.350  -3.567 1.00 . A A .  16 SER H    1 1 
        2  2022 1 1  16 SER HA   H  -5.563  -9.007  -6.045 1.00 . A A .  16 SER HA   1 1 
        2  2023 1 1  16 SER HB2  H  -5.228 -11.457  -5.722 1.00 . A A .  16 SER HB2  1 1 
        2  2024 1 1  16 SER HB3  H  -6.954 -11.652  -5.421 1.00 . A A .  16 SER HB3  1 1 
        2  2025 1 1  16 SER HG   H  -5.653 -11.583  -7.760 1.00 . A A .  16 SER HG   1 1 
        2  2026 1 1  16 SER N    N  -5.928  -9.509  -4.061 1.00 . A A .  16 SER N    1 1 
        2  2027 1 1  16 SER O    O  -7.926  -8.339  -6.758 1.00 . A A .  16 SER O    1 1 
        2  2028 1 1  16 SER OG   O  -6.433 -11.198  -7.342 1.00 . A A .  16 SER OG   1 1 
        2  2029 1 1  17 SER C    C -10.005  -7.207  -4.827 1.00 . A A .  17 SER C    1 1 
        2  2030 1 1  17 SER CA   C -10.008  -8.745  -4.870 1.00 . A A .  17 SER CA   1 1 
        2  2031 1 1  17 SER CB   C -10.870  -9.316  -3.719 1.00 . A A .  17 SER CB   1 1 
        2  2032 1 1  17 SER H    H  -8.380  -9.808  -4.019 1.00 . A A .  17 SER H    1 1 
        2  2033 1 1  17 SER HA   H -10.430  -9.071  -5.815 1.00 . A A .  17 SER HA   1 1 
        2  2034 1 1  17 SER HB2  H -10.441  -9.024  -2.770 1.00 . A A .  17 SER HB2  1 1 
        2  2035 1 1  17 SER HB3  H -11.876  -8.924  -3.791 1.00 . A A .  17 SER HB3  1 1 
        2  2036 1 1  17 SER HG   H -10.081 -11.077  -4.055 1.00 . A A .  17 SER HG   1 1 
        2  2037 1 1  17 SER N    N  -8.634  -9.262  -4.794 1.00 . A A .  17 SER N    1 1 
        2  2038 1 1  17 SER O    O -10.414  -6.550  -5.784 1.00 . A A .  17 SER O    1 1 
        2  2039 1 1  17 SER OG   O -10.933 -10.733  -3.770 1.00 . A A .  17 SER OG   1 1 
        2  2040 1 1  18 VAL C    C  -8.665  -4.407  -4.443 1.00 . A A .  18 VAL C    1 1 
        2  2041 1 1  18 VAL CA   C  -9.492  -5.220  -3.436 1.00 . A A .  18 VAL CA   1 1 
        2  2042 1 1  18 VAL CB   C  -8.967  -4.926  -1.985 1.00 . A A .  18 VAL CB   1 1 
        2  2043 1 1  18 VAL CG1  C  -9.107  -3.427  -1.623 1.00 . A A .  18 VAL CG1  1 1 
        2  2044 1 1  18 VAL CG2  C  -9.682  -5.822  -0.957 1.00 . A A .  18 VAL CG2  1 1 
        2  2045 1 1  18 VAL H    H  -8.992  -7.252  -3.109 1.00 . A A .  18 VAL H    1 1 
        2  2046 1 1  18 VAL HA   H -10.532  -4.904  -3.495 1.00 . A A .  18 VAL HA   1 1 
        2  2047 1 1  18 VAL HB   H  -7.907  -5.174  -1.952 1.00 . A A .  18 VAL HB   1 1 
        2  2048 1 1  18 VAL HG11 H -10.152  -3.139  -1.642 1.00 . A A .  18 VAL HG11 1 1 
        2  2049 1 1  18 VAL HG12 H  -8.560  -2.822  -2.336 1.00 . A A .  18 VAL HG12 1 1 
        2  2050 1 1  18 VAL HG13 H  -8.708  -3.250  -0.633 1.00 . A A .  18 VAL HG13 1 1 
        2  2051 1 1  18 VAL HG21 H -10.741  -5.593  -0.942 1.00 . A A .  18 VAL HG21 1 1 
        2  2052 1 1  18 VAL HG22 H  -9.266  -5.655   0.029 1.00 . A A .  18 VAL HG22 1 1 
        2  2053 1 1  18 VAL HG23 H  -9.551  -6.862  -1.224 1.00 . A A .  18 VAL HG23 1 1 
        2  2054 1 1  18 VAL N    N  -9.451  -6.661  -3.735 1.00 . A A .  18 VAL N    1 1 
        2  2055 1 1  18 VAL O    O  -9.078  -3.323  -4.842 1.00 . A A .  18 VAL O    1 1 
        2  2056 1 1  19 GLN C    C  -7.154  -4.003  -7.109 1.00 . A A .  19 GLN C    1 1 
        2  2057 1 1  19 GLN CA   C  -6.542  -4.283  -5.734 1.00 . A A .  19 GLN CA   1 1 
        2  2058 1 1  19 GLN CB   C  -5.260  -5.143  -5.864 1.00 . A A .  19 GLN CB   1 1 
        2  2059 1 1  19 GLN CD   C  -2.828  -5.367  -6.672 1.00 . A A .  19 GLN CD   1 1 
        2  2060 1 1  19 GLN CG   C  -4.107  -4.516  -6.662 1.00 . A A .  19 GLN CG   1 1 
        2  2061 1 1  19 GLN H    H  -7.307  -5.872  -4.551 1.00 . A A .  19 GLN H    1 1 
        2  2062 1 1  19 GLN HA   H  -6.280  -3.336  -5.265 1.00 . A A .  19 GLN HA   1 1 
        2  2063 1 1  19 GLN HB2  H  -4.891  -5.356  -4.862 1.00 . A A .  19 GLN HB2  1 1 
        2  2064 1 1  19 GLN HB3  H  -5.522  -6.090  -6.329 1.00 . A A .  19 GLN HB3  1 1 
        2  2065 1 1  19 GLN HE21 H  -3.159  -6.055  -4.820 1.00 . A A .  19 GLN HE21 1 1 
        2  2066 1 1  19 GLN HE22 H  -1.719  -6.616  -5.589 1.00 . A A .  19 GLN HE22 1 1 
        2  2067 1 1  19 GLN HG2  H  -4.434  -4.374  -7.684 1.00 . A A .  19 GLN HG2  1 1 
        2  2068 1 1  19 GLN HG3  H  -3.870  -3.549  -6.231 1.00 . A A .  19 GLN HG3  1 1 
        2  2069 1 1  19 GLN N    N  -7.512  -4.964  -4.854 1.00 . A A .  19 GLN N    1 1 
        2  2070 1 1  19 GLN NE2  N  -2.544  -6.089  -5.585 1.00 . A A .  19 GLN NE2  1 1 
        2  2071 1 1  19 GLN O    O  -7.202  -2.850  -7.540 1.00 . A A .  19 GLN O    1 1 
        2  2072 1 1  19 GLN OE1  O  -2.076  -5.361  -7.641 1.00 . A A .  19 GLN OE1  1 1 
        2  2073 1 1  20 GLU C    C  -9.549  -4.152  -9.104 1.00 . A A .  20 GLU C    1 1 
        2  2074 1 1  20 GLU CA   C  -8.243  -4.963  -9.105 1.00 . A A .  20 GLU CA   1 1 
        2  2075 1 1  20 GLU CB   C  -8.458  -6.375  -9.694 1.00 . A A .  20 GLU CB   1 1 
        2  2076 1 1  20 GLU CD   C  -6.053  -6.514 -10.607 1.00 . A A .  20 GLU CD   1 1 
        2  2077 1 1  20 GLU CG   C  -7.168  -7.215  -9.804 1.00 . A A .  20 GLU CG   1 1 
        2  2078 1 1  20 GLU H    H  -7.659  -5.935  -7.304 1.00 . A A .  20 GLU H    1 1 
        2  2079 1 1  20 GLU HA   H  -7.519  -4.443  -9.726 1.00 . A A .  20 GLU HA   1 1 
        2  2080 1 1  20 GLU HB2  H  -9.161  -6.914  -9.062 1.00 . A A .  20 GLU HB2  1 1 
        2  2081 1 1  20 GLU HB3  H  -8.888  -6.286 -10.684 1.00 . A A .  20 GLU HB3  1 1 
        2  2082 1 1  20 GLU HG2  H  -6.807  -7.423  -8.801 1.00 . A A .  20 GLU HG2  1 1 
        2  2083 1 1  20 GLU HG3  H  -7.408  -8.159 -10.285 1.00 . A A .  20 GLU HG3  1 1 
        2  2084 1 1  20 GLU N    N  -7.667  -5.059  -7.755 1.00 . A A .  20 GLU N    1 1 
        2  2085 1 1  20 GLU O    O  -9.828  -3.408 -10.054 1.00 . A A .  20 GLU O    1 1 
        2  2086 1 1  20 GLU OE1  O  -6.066  -6.578 -11.855 1.00 . A A .  20 GLU OE1  1 1 
        2  2087 1 1  20 GLU OE2  O  -5.158  -5.893  -9.996 1.00 . A A .  20 GLU OE2  1 1 
        2  2088 1 1  21 ARG C    C -11.207  -2.012  -7.586 1.00 . A A .  21 ARG C    1 1 
        2  2089 1 1  21 ARG CA   C -11.556  -3.489  -7.829 1.00 . A A .  21 ARG CA   1 1 
        2  2090 1 1  21 ARG CB   C -12.410  -4.028  -6.653 1.00 . A A .  21 ARG CB   1 1 
        2  2091 1 1  21 ARG CD   C -13.913  -5.860  -5.713 1.00 . A A .  21 ARG CD   1 1 
        2  2092 1 1  21 ARG CG   C -13.050  -5.414  -6.899 1.00 . A A .  21 ARG CG   1 1 
        2  2093 1 1  21 ARG CZ   C -15.424  -7.756  -5.129 1.00 . A A .  21 ARG CZ   1 1 
        2  2094 1 1  21 ARG H    H -10.075  -4.932  -7.325 1.00 . A A .  21 ARG H    1 1 
        2  2095 1 1  21 ARG HA   H -12.139  -3.562  -8.747 1.00 . A A .  21 ARG HA   1 1 
        2  2096 1 1  21 ARG HB2  H -11.777  -4.102  -5.773 1.00 . A A .  21 ARG HB2  1 1 
        2  2097 1 1  21 ARG HB3  H -13.208  -3.324  -6.444 1.00 . A A .  21 ARG HB3  1 1 
        2  2098 1 1  21 ARG HD2  H -13.317  -5.823  -4.808 1.00 . A A .  21 ARG HD2  1 1 
        2  2099 1 1  21 ARG HD3  H -14.750  -5.174  -5.617 1.00 . A A .  21 ARG HD3  1 1 
        2  2100 1 1  21 ARG HE   H -14.028  -7.785  -6.568 1.00 . A A .  21 ARG HE   1 1 
        2  2101 1 1  21 ARG HG2  H -13.671  -5.364  -7.787 1.00 . A A .  21 ARG HG2  1 1 
        2  2102 1 1  21 ARG HG3  H -12.264  -6.142  -7.058 1.00 . A A .  21 ARG HG3  1 1 
        2  2103 1 1  21 ARG HH11 H -15.722  -6.097  -3.995 1.00 . A A .  21 ARG HH11 1 1 
        2  2104 1 1  21 ARG HH12 H -16.752  -7.441  -3.618 1.00 . A A .  21 ARG HH12 1 1 
        2  2105 1 1  21 ARG HH21 H -15.373  -9.552  -6.068 1.00 . A A .  21 ARG HH21 1 1 
        2  2106 1 1  21 ARG HH22 H -16.549  -9.407  -4.798 1.00 . A A .  21 ARG HH22 1 1 
        2  2107 1 1  21 ARG N    N -10.333  -4.284  -8.017 1.00 . A A .  21 ARG N    1 1 
        2  2108 1 1  21 ARG NE   N -14.436  -7.228  -5.867 1.00 . A A .  21 ARG NE   1 1 
        2  2109 1 1  21 ARG NH1  N -16.011  -7.040  -4.169 1.00 . A A .  21 ARG NH1  1 1 
        2  2110 1 1  21 ARG NH2  N -15.811  -9.003  -5.347 1.00 . A A .  21 ARG NH2  1 1 
        2  2111 1 1  21 ARG O    O -11.918  -1.144  -8.039 1.00 . A A .  21 ARG O    1 1 
        2  2112 1 1  22 ALA C    C  -9.254   0.366  -7.884 1.00 . A A .  22 ALA C    1 1 
        2  2113 1 1  22 ALA CA   C  -9.662  -0.364  -6.590 1.00 . A A .  22 ALA CA   1 1 
        2  2114 1 1  22 ALA CB   C  -8.520  -0.353  -5.555 1.00 . A A .  22 ALA CB   1 1 
        2  2115 1 1  22 ALA H    H  -9.526  -2.490  -6.595 1.00 . A A .  22 ALA H    1 1 
        2  2116 1 1  22 ALA HA   H -10.513   0.150  -6.149 1.00 . A A .  22 ALA HA   1 1 
        2  2117 1 1  22 ALA HB1  H  -8.836  -0.871  -4.657 1.00 . A A .  22 ALA HB1  1 1 
        2  2118 1 1  22 ALA HB2  H  -8.262   0.668  -5.303 1.00 . A A .  22 ALA HB2  1 1 
        2  2119 1 1  22 ALA HB3  H  -7.649  -0.852  -5.964 1.00 . A A .  22 ALA HB3  1 1 
        2  2120 1 1  22 ALA N    N -10.088  -1.742  -6.895 1.00 . A A .  22 ALA N    1 1 
        2  2121 1 1  22 ALA O    O  -9.722   1.474  -8.169 1.00 . A A .  22 ALA O    1 1 
        2  2122 1 1  23 LYS C    C  -9.015   0.474 -10.984 1.00 . A A .  23 LYS C    1 1 
        2  2123 1 1  23 LYS CA   C  -7.894   0.166  -9.958 1.00 . A A .  23 LYS CA   1 1 
        2  2124 1 1  23 LYS CB   C  -6.908  -0.902 -10.514 1.00 . A A .  23 LYS CB   1 1 
        2  2125 1 1  23 LYS CD   C  -4.879  -2.430 -10.003 1.00 . A A .  23 LYS CD   1 1 
        2  2126 1 1  23 LYS CE   C  -4.422  -2.511 -11.467 1.00 . A A .  23 LYS CE   1 1 
        2  2127 1 1  23 LYS CG   C  -5.620  -1.109  -9.658 1.00 . A A .  23 LYS CG   1 1 
        2  2128 1 1  23 LYS H    H  -8.176  -1.228  -8.393 1.00 . A A .  23 LYS H    1 1 
        2  2129 1 1  23 LYS HA   H  -7.341   1.076  -9.759 1.00 . A A .  23 LYS HA   1 1 
        2  2130 1 1  23 LYS HB2  H  -7.431  -1.854 -10.572 1.00 . A A .  23 LYS HB2  1 1 
        2  2131 1 1  23 LYS HB3  H  -6.604  -0.619 -11.515 1.00 . A A .  23 LYS HB3  1 1 
        2  2132 1 1  23 LYS HD2  H  -4.007  -2.523  -9.365 1.00 . A A .  23 LYS HD2  1 1 
        2  2133 1 1  23 LYS HD3  H  -5.548  -3.265  -9.799 1.00 . A A .  23 LYS HD3  1 1 
        2  2134 1 1  23 LYS HE2  H  -5.250  -2.254 -12.114 1.00 . A A .  23 LYS HE2  1 1 
        2  2135 1 1  23 LYS HE3  H  -3.617  -1.804 -11.625 1.00 . A A .  23 LYS HE3  1 1 
        2  2136 1 1  23 LYS HG2  H  -4.945  -0.275  -9.827 1.00 . A A .  23 LYS HG2  1 1 
        2  2137 1 1  23 LYS HG3  H  -5.896  -1.128  -8.605 1.00 . A A .  23 LYS HG3  1 1 
        2  2138 1 1  23 LYS HZ1  H  -3.056  -4.085 -11.324 1.00 . A A .  23 LYS HZ1  1 1 
        2  2139 1 1  23 LYS HZ2  H  -3.757  -3.926 -12.852 1.00 . A A .  23 LYS HZ2  1 1 
        2  2140 1 1  23 LYS HZ3  H  -4.652  -4.593 -11.578 1.00 . A A .  23 LYS HZ3  1 1 
        2  2141 1 1  23 LYS N    N  -8.433  -0.327  -8.681 1.00 . A A .  23 LYS N    1 1 
        2  2142 1 1  23 LYS NZ   N  -3.938  -3.874 -11.832 1.00 . A A .  23 LYS NZ   1 1 
        2  2143 1 1  23 LYS O    O  -8.920   1.449 -11.742 1.00 . A A .  23 LYS O    1 1 
        2  2144 1 1  24 HIS C    C -12.299   0.710 -11.441 1.00 . A A .  24 HIS C    1 1 
        2  2145 1 1  24 HIS CA   C -11.192  -0.241 -11.953 1.00 . A A .  24 HIS CA   1 1 
        2  2146 1 1  24 HIS CB   C -11.793  -1.633 -12.275 1.00 . A A .  24 HIS CB   1 1 
        2  2147 1 1  24 HIS CD2  C -14.280  -1.872 -13.051 1.00 . A A .  24 HIS CD2  1 1 
        2  2148 1 1  24 HIS CE1  C -14.028  -1.139 -15.099 1.00 . A A .  24 HIS CE1  1 1 
        2  2149 1 1  24 HIS CG   C -12.967  -1.575 -13.222 1.00 . A A .  24 HIS CG   1 1 
        2  2150 1 1  24 HIS H    H -10.101  -1.088 -10.334 1.00 . A A .  24 HIS H    1 1 
        2  2151 1 1  24 HIS HA   H -10.785   0.171 -12.876 1.00 . A A .  24 HIS HA   1 1 
        2  2152 1 1  24 HIS HB2  H -11.033  -2.254 -12.736 1.00 . A A .  24 HIS HB2  1 1 
        2  2153 1 1  24 HIS HB3  H -12.122  -2.104 -11.355 1.00 . A A .  24 HIS HB3  1 1 
        2  2154 1 1  24 HIS HD1  H -12.018  -0.810 -14.944 1.00 . A A .  24 HIS HD1  1 1 
        2  2155 1 1  24 HIS HD2  H -14.744  -2.255 -12.149 1.00 . A A .  24 HIS HD2  1 1 
        2  2156 1 1  24 HIS HE1  H -14.235  -0.830 -16.117 1.00 . A A .  24 HIS HE1  1 1 
        2  2157 1 1  24 HIS HE2  H -15.886  -1.527 -14.353 1.00 . A A .  24 HIS HE2  1 1 
        2  2158 1 1  24 HIS N    N -10.075  -0.366 -10.994 1.00 . A A .  24 HIS N    1 1 
        2  2159 1 1  24 HIS ND1  N -12.849  -1.118 -14.517 1.00 . A A .  24 HIS ND1  1 1 
        2  2160 1 1  24 HIS NE2  N -14.915  -1.588 -14.235 1.00 . A A .  24 HIS NE2  1 1 
        2  2161 1 1  24 HIS O    O -12.691   1.646 -12.147 1.00 . A A .  24 HIS O    1 1 
        2  2162 1 1  25 ASN C    C -13.592   2.657  -9.451 1.00 . A A .  25 ASN C    1 1 
        2  2163 1 1  25 ASN CA   C -13.943   1.172  -9.611 1.00 . A A .  25 ASN CA   1 1 
        2  2164 1 1  25 ASN CB   C -14.313   0.556  -8.229 1.00 . A A .  25 ASN CB   1 1 
        2  2165 1 1  25 ASN CG   C -15.487   1.232  -7.523 1.00 . A A .  25 ASN CG   1 1 
        2  2166 1 1  25 ASN H    H -12.423  -0.315  -9.727 1.00 . A A .  25 ASN H    1 1 
        2  2167 1 1  25 ASN HA   H -14.800   1.082 -10.271 1.00 . A A .  25 ASN HA   1 1 
        2  2168 1 1  25 ASN HB2  H -14.569  -0.487  -8.371 1.00 . A A .  25 ASN HB2  1 1 
        2  2169 1 1  25 ASN HB3  H -13.443   0.603  -7.575 1.00 . A A .  25 ASN HB3  1 1 
        2  2170 1 1  25 ASN HD21 H -14.271   2.504  -6.609 1.00 . A A .  25 ASN HD21 1 1 
        2  2171 1 1  25 ASN HD22 H -15.949   2.674  -6.248 1.00 . A A .  25 ASN HD22 1 1 
        2  2172 1 1  25 ASN N    N -12.816   0.423 -10.228 1.00 . A A .  25 ASN N    1 1 
        2  2173 1 1  25 ASN ND2  N -15.205   2.238  -6.714 1.00 . A A .  25 ASN ND2  1 1 
        2  2174 1 1  25 ASN O    O -14.390   3.530  -9.803 1.00 . A A .  25 ASN O    1 1 
        2  2175 1 1  25 ASN OD1  O -16.641   0.848  -7.702 1.00 . A A .  25 ASN OD1  1 1 
        2  2176 1 1  26 TYR C    C -11.117   4.727  -9.974 1.00 . A A .  26 TYR C    1 1 
        2  2177 1 1  26 TYR CA   C -11.899   4.288  -8.711 1.00 . A A .  26 TYR CA   1 1 
        2  2178 1 1  26 TYR CB   C -11.020   4.338  -7.438 1.00 . A A .  26 TYR CB   1 1 
        2  2179 1 1  26 TYR CD1  C -12.571   4.644  -5.444 1.00 . A A .  26 TYR CD1  1 1 
        2  2180 1 1  26 TYR CD2  C -11.558   2.516  -5.745 1.00 . A A .  26 TYR CD2  1 1 
        2  2181 1 1  26 TYR CE1  C -13.223   4.162  -4.328 1.00 . A A .  26 TYR CE1  1 1 
        2  2182 1 1  26 TYR CE2  C -12.198   2.031  -4.630 1.00 . A A .  26 TYR CE2  1 1 
        2  2183 1 1  26 TYR CG   C -11.725   3.828  -6.178 1.00 . A A .  26 TYR CG   1 1 
        2  2184 1 1  26 TYR CZ   C -13.033   2.853  -3.923 1.00 . A A .  26 TYR CZ   1 1 
        2  2185 1 1  26 TYR H    H -11.801   2.179  -8.678 1.00 . A A .  26 TYR H    1 1 
        2  2186 1 1  26 TYR HA   H -12.759   4.942  -8.573 1.00 . A A .  26 TYR HA   1 1 
        2  2187 1 1  26 TYR HB2  H -10.130   3.739  -7.597 1.00 . A A .  26 TYR HB2  1 1 
        2  2188 1 1  26 TYR HB3  H -10.716   5.364  -7.257 1.00 . A A .  26 TYR HB3  1 1 
        2  2189 1 1  26 TYR HD1  H -12.717   5.673  -5.754 1.00 . A A .  26 TYR HD1  1 1 
        2  2190 1 1  26 TYR HD2  H -10.897   1.868  -6.302 1.00 . A A .  26 TYR HD2  1 1 
        2  2191 1 1  26 TYR HE1  H -13.880   4.816  -3.765 1.00 . A A .  26 TYR HE1  1 1 
        2  2192 1 1  26 TYR HE2  H -12.044   1.004  -4.318 1.00 . A A .  26 TYR HE2  1 1 
        2  2193 1 1  26 TYR HH   H -13.072   1.860  -2.268 1.00 . A A .  26 TYR HH   1 1 
        2  2194 1 1  26 TYR N    N -12.391   2.924  -8.919 1.00 . A A .  26 TYR N    1 1 
        2  2195 1 1  26 TYR O    O -10.215   4.003 -10.410 1.00 . A A .  26 TYR O    1 1 
        2  2196 1 1  26 TYR OH   O -13.685   2.378  -2.802 1.00 . A A .  26 TYR OH   1 1 
        2  2197 1 1  27 PRO C    C  -9.464   6.563 -12.041 1.00 . A A .  27 PRO C    1 1 
        2  2198 1 1  27 PRO CA   C -10.988   6.309 -11.929 1.00 . A A .  27 PRO CA   1 1 
        2  2199 1 1  27 PRO CB   C -11.829   7.579 -12.231 1.00 . A A .  27 PRO CB   1 1 
        2  2200 1 1  27 PRO CD   C -12.275   6.992  -9.946 1.00 . A A .  27 PRO CD   1 1 
        2  2201 1 1  27 PRO CG   C -12.127   8.170 -10.884 1.00 . A A .  27 PRO CG   1 1 
        2  2202 1 1  27 PRO HA   H -11.253   5.539 -12.644 1.00 . A A .  27 PRO HA   1 1 
        2  2203 1 1  27 PRO HB2  H -11.271   8.275 -12.858 1.00 . A A .  27 PRO HB2  1 1 
        2  2204 1 1  27 PRO HB3  H -12.754   7.306 -12.728 1.00 . A A .  27 PRO HB3  1 1 
        2  2205 1 1  27 PRO HD2  H -11.905   7.241  -8.957 1.00 . A A .  27 PRO HD2  1 1 
        2  2206 1 1  27 PRO HD3  H -13.313   6.675  -9.886 1.00 . A A .  27 PRO HD3  1 1 
        2  2207 1 1  27 PRO HG2  H -11.311   8.816 -10.573 1.00 . A A .  27 PRO HG2  1 1 
        2  2208 1 1  27 PRO HG3  H -13.052   8.733 -10.915 1.00 . A A .  27 PRO HG3  1 1 
        2  2209 1 1  27 PRO N    N -11.441   5.923 -10.567 1.00 . A A .  27 PRO N    1 1 
        2  2210 1 1  27 PRO O    O  -8.987   7.689 -11.816 1.00 . A A .  27 PRO O    1 1 
        2  2211 1 1  28 GLY C    C  -6.477   6.181 -11.524 1.00 . A A .  28 GLY C    1 1 
        2  2212 1 1  28 GLY CA   C  -7.282   5.523 -12.628 1.00 . A A .  28 GLY CA   1 1 
        2  2213 1 1  28 GLY H    H  -9.174   4.602 -12.368 1.00 . A A .  28 GLY H    1 1 
        2  2214 1 1  28 GLY HA2  H  -6.917   4.512 -12.756 1.00 . A A .  28 GLY HA2  1 1 
        2  2215 1 1  28 GLY HA3  H  -7.129   6.065 -13.555 1.00 . A A .  28 GLY HA3  1 1 
        2  2216 1 1  28 GLY N    N  -8.722   5.472 -12.348 1.00 . A A .  28 GLY N    1 1 
        2  2217 1 1  28 GLY O    O  -5.683   7.087 -11.779 1.00 . A A .  28 GLY O    1 1 
        2  2218 1 1  29 ARG C    C  -4.624   5.966  -8.944 1.00 . A A .  29 ARG C    1 1 
        2  2219 1 1  29 ARG CA   C  -6.101   6.343  -9.093 1.00 . A A .  29 ARG CA   1 1 
        2  2220 1 1  29 ARG CB   C  -6.895   5.959  -7.827 1.00 . A A .  29 ARG CB   1 1 
        2  2221 1 1  29 ARG CD   C  -8.555   7.959  -7.759 1.00 . A A .  29 ARG CD   1 1 
        2  2222 1 1  29 ARG CG   C  -8.367   6.433  -7.801 1.00 . A A .  29 ARG CG   1 1 
        2  2223 1 1  29 ARG CZ   C  -7.699   9.852  -9.148 1.00 . A A .  29 ARG CZ   1 1 
        2  2224 1 1  29 ARG H    H  -7.310   4.964 -10.173 1.00 . A A .  29 ARG H    1 1 
        2  2225 1 1  29 ARG HA   H  -6.163   7.421  -9.217 1.00 . A A .  29 ARG HA   1 1 
        2  2226 1 1  29 ARG HB2  H  -6.893   4.879  -7.735 1.00 . A A .  29 ARG HB2  1 1 
        2  2227 1 1  29 ARG HB3  H  -6.396   6.377  -6.955 1.00 . A A .  29 ARG HB3  1 1 
        2  2228 1 1  29 ARG HD2  H  -9.600   8.172  -7.556 1.00 . A A .  29 ARG HD2  1 1 
        2  2229 1 1  29 ARG HD3  H  -7.951   8.365  -6.953 1.00 . A A .  29 ARG HD3  1 1 
        2  2230 1 1  29 ARG HE   H  -8.333   8.088  -9.846 1.00 . A A .  29 ARG HE   1 1 
        2  2231 1 1  29 ARG HG2  H  -8.867   6.053  -8.686 1.00 . A A .  29 ARG HG2  1 1 
        2  2232 1 1  29 ARG HG3  H  -8.844   6.002  -6.926 1.00 . A A .  29 ARG HG3  1 1 
        2  2233 1 1  29 ARG HH11 H  -7.716  10.300  -7.159 1.00 . A A .  29 ARG HH11 1 1 
        2  2234 1 1  29 ARG HH12 H  -7.120  11.558  -8.197 1.00 . A A .  29 ARG HH12 1 1 
        2  2235 1 1  29 ARG HH21 H  -7.512   9.721 -11.161 1.00 . A A .  29 ARG HH21 1 1 
        2  2236 1 1  29 ARG HH22 H  -7.003  11.227 -10.460 1.00 . A A .  29 ARG HH22 1 1 
        2  2237 1 1  29 ARG N    N  -6.710   5.733 -10.286 1.00 . A A .  29 ARG N    1 1 
        2  2238 1 1  29 ARG NE   N  -8.192   8.613  -9.023 1.00 . A A .  29 ARG NE   1 1 
        2  2239 1 1  29 ARG NH1  N  -7.495  10.629  -8.081 1.00 . A A .  29 ARG NH1  1 1 
        2  2240 1 1  29 ARG NH2  N  -7.383  10.302 -10.350 1.00 . A A .  29 ARG NH2  1 1 
        2  2241 1 1  29 ARG O    O  -4.131   5.031  -9.591 1.00 . A A .  29 ARG O    1 1 
        2  2242 1 1  30 GLU C    C  -2.326   5.327  -6.865 1.00 . A A .  30 GLU C    1 1 
        2  2243 1 1  30 GLU CA   C  -2.515   6.537  -7.788 1.00 . A A .  30 GLU CA   1 1 
        2  2244 1 1  30 GLU CB   C  -1.929   7.844  -7.180 1.00 . A A .  30 GLU CB   1 1 
        2  2245 1 1  30 GLU CD   C  -1.943   9.045  -9.460 1.00 . A A .  30 GLU CD   1 1 
        2  2246 1 1  30 GLU CG   C  -2.284   9.127  -7.958 1.00 . A A .  30 GLU CG   1 1 
        2  2247 1 1  30 GLU H    H  -4.419   7.396  -7.565 1.00 . A A .  30 GLU H    1 1 
        2  2248 1 1  30 GLU HA   H  -2.012   6.340  -8.732 1.00 . A A .  30 GLU HA   1 1 
        2  2249 1 1  30 GLU HB2  H  -2.292   7.950  -6.165 1.00 . A A .  30 GLU HB2  1 1 
        2  2250 1 1  30 GLU HB3  H  -0.847   7.758  -7.145 1.00 . A A .  30 GLU HB3  1 1 
        2  2251 1 1  30 GLU HG2  H  -3.346   9.318  -7.842 1.00 . A A .  30 GLU HG2  1 1 
        2  2252 1 1  30 GLU HG3  H  -1.734   9.960  -7.525 1.00 . A A .  30 GLU HG3  1 1 
        2  2253 1 1  30 GLU N    N  -3.938   6.709  -8.060 1.00 . A A .  30 GLU N    1 1 
        2  2254 1 1  30 GLU O    O  -2.327   5.447  -5.640 1.00 . A A .  30 GLU O    1 1 
        2  2255 1 1  30 GLU OE1  O  -0.765   8.811  -9.801 1.00 . A A .  30 GLU OE1  1 1 
        2  2256 1 1  30 GLU OE2  O  -2.847   9.214 -10.308 1.00 . A A .  30 GLU OE2  1 1 
        2  2257 1 1  31 ILE C    C  -0.901   2.109  -7.241 1.00 . A A .  31 ILE C    1 1 
        2  2258 1 1  31 ILE CA   C  -2.162   2.854  -6.781 1.00 . A A .  31 ILE CA   1 1 
        2  2259 1 1  31 ILE CB   C  -3.443   1.976  -7.048 1.00 . A A .  31 ILE CB   1 1 
        2  2260 1 1  31 ILE CD1  C  -6.029   2.002  -6.811 1.00 . A A .  31 ILE CD1  1 1 
        2  2261 1 1  31 ILE CG1  C  -4.723   2.712  -6.532 1.00 . A A .  31 ILE CG1  1 1 
        2  2262 1 1  31 ILE CG2  C  -3.304   0.570  -6.411 1.00 . A A .  31 ILE CG2  1 1 
        2  2263 1 1  31 ILE H    H  -2.268   4.131  -8.465 1.00 . A A .  31 ILE H    1 1 
        2  2264 1 1  31 ILE HA   H  -2.094   3.041  -5.706 1.00 . A A .  31 ILE HA   1 1 
        2  2265 1 1  31 ILE HB   H  -3.537   1.838  -8.122 1.00 . A A .  31 ILE HB   1 1 
        2  2266 1 1  31 ILE HD11 H  -6.846   2.612  -6.456 1.00 . A A .  31 ILE HD11 1 1 
        2  2267 1 1  31 ILE HD12 H  -6.044   1.047  -6.298 1.00 . A A .  31 ILE HD12 1 1 
        2  2268 1 1  31 ILE HD13 H  -6.138   1.842  -7.874 1.00 . A A .  31 ILE HD13 1 1 
        2  2269 1 1  31 ILE HG12 H  -4.649   2.849  -5.461 1.00 . A A .  31 ILE HG12 1 1 
        2  2270 1 1  31 ILE HG13 H  -4.780   3.690  -7.000 1.00 . A A .  31 ILE HG13 1 1 
        2  2271 1 1  31 ILE HG21 H  -4.183  -0.022  -6.621 1.00 . A A .  31 ILE HG21 1 1 
        2  2272 1 1  31 ILE HG22 H  -3.186   0.668  -5.338 1.00 . A A .  31 ILE HG22 1 1 
        2  2273 1 1  31 ILE HG23 H  -2.428   0.073  -6.814 1.00 . A A .  31 ILE HG23 1 1 
        2  2274 1 1  31 ILE N    N  -2.253   4.142  -7.483 1.00 . A A .  31 ILE N    1 1 
        2  2275 1 1  31 ILE O    O  -0.636   2.006  -8.441 1.00 . A A .  31 ILE O    1 1 
        2  2276 1 1  32 ARG C    C   0.855  -0.623  -6.011 1.00 . A A .  32 ARG C    1 1 
        2  2277 1 1  32 ARG CA   C   1.082   0.815  -6.505 1.00 . A A .  32 ARG CA   1 1 
        2  2278 1 1  32 ARG CB   C   2.281   1.449  -5.758 1.00 . A A .  32 ARG CB   1 1 
        2  2279 1 1  32 ARG CD   C   3.029   3.041  -7.651 1.00 . A A .  32 ARG CD   1 1 
        2  2280 1 1  32 ARG CG   C   2.613   2.897  -6.174 1.00 . A A .  32 ARG CG   1 1 
        2  2281 1 1  32 ARG CZ   C   4.349   4.899  -8.716 1.00 . A A .  32 ARG CZ   1 1 
        2  2282 1 1  32 ARG H    H  -0.389   1.781  -5.342 1.00 . A A .  32 ARG H    1 1 
        2  2283 1 1  32 ARG HA   H   1.296   0.790  -7.572 1.00 . A A .  32 ARG HA   1 1 
        2  2284 1 1  32 ARG HB2  H   2.066   1.451  -4.693 1.00 . A A .  32 ARG HB2  1 1 
        2  2285 1 1  32 ARG HB3  H   3.164   0.842  -5.922 1.00 . A A .  32 ARG HB3  1 1 
        2  2286 1 1  32 ARG HD2  H   3.918   2.446  -7.831 1.00 . A A .  32 ARG HD2  1 1 
        2  2287 1 1  32 ARG HD3  H   2.227   2.678  -8.285 1.00 . A A .  32 ARG HD3  1 1 
        2  2288 1 1  32 ARG HE   H   2.643   5.113  -7.704 1.00 . A A .  32 ARG HE   1 1 
        2  2289 1 1  32 ARG HG2  H   1.737   3.509  -6.002 1.00 . A A .  32 ARG HG2  1 1 
        2  2290 1 1  32 ARG HG3  H   3.420   3.262  -5.548 1.00 . A A .  32 ARG HG3  1 1 
        2  2291 1 1  32 ARG HH11 H   5.194   3.076  -9.012 1.00 . A A .  32 ARG HH11 1 1 
        2  2292 1 1  32 ARG HH12 H   6.039   4.414  -9.709 1.00 . A A .  32 ARG HH12 1 1 
        2  2293 1 1  32 ARG HH21 H   3.783   6.844  -8.625 1.00 . A A .  32 ARG HH21 1 1 
        2  2294 1 1  32 ARG HH22 H   5.250   6.528  -9.492 1.00 . A A .  32 ARG HH22 1 1 
        2  2295 1 1  32 ARG N    N  -0.126   1.617  -6.269 1.00 . A A .  32 ARG N    1 1 
        2  2296 1 1  32 ARG NE   N   3.300   4.453  -8.006 1.00 . A A .  32 ARG NE   1 1 
        2  2297 1 1  32 ARG NH1  N   5.263   4.063  -9.185 1.00 . A A .  32 ARG NH1  1 1 
        2  2298 1 1  32 ARG NH2  N   4.472   6.193  -8.965 1.00 . A A .  32 ARG NH2  1 1 
        2  2299 1 1  32 ARG O    O  -0.180  -0.936  -5.398 1.00 . A A .  32 ARG O    1 1 
        2  2300 1 1  33 THR C    C   3.249  -3.341  -5.556 1.00 . A A .  33 THR C    1 1 
        2  2301 1 1  33 THR CA   C   1.810  -2.896  -5.880 1.00 . A A .  33 THR CA   1 1 
        2  2302 1 1  33 THR CB   C   1.209  -3.776  -7.030 1.00 . A A .  33 THR CB   1 1 
        2  2303 1 1  33 THR CG2  C   1.007  -5.232  -6.595 1.00 . A A .  33 THR CG2  1 1 
        2  2304 1 1  33 THR H    H   2.622  -1.161  -6.772 1.00 . A A .  33 THR H    1 1 
        2  2305 1 1  33 THR HA   H   1.187  -2.998  -4.988 1.00 . A A .  33 THR HA   1 1 
        2  2306 1 1  33 THR HB   H   1.888  -3.760  -7.877 1.00 . A A .  33 THR HB   1 1 
        2  2307 1 1  33 THR HG1  H  -0.570  -2.958  -6.698 1.00 . A A .  33 THR HG1  1 1 
        2  2308 1 1  33 THR HG21 H   0.318  -5.273  -5.759 1.00 . A A .  33 THR HG21 1 1 
        2  2309 1 1  33 THR HG22 H   1.956  -5.665  -6.296 1.00 . A A .  33 THR HG22 1 1 
        2  2310 1 1  33 THR HG23 H   0.600  -5.805  -7.418 1.00 . A A .  33 THR HG23 1 1 
        2  2311 1 1  33 THR N    N   1.838  -1.486  -6.280 1.00 . A A .  33 THR N    1 1 
        2  2312 1 1  33 THR O    O   4.186  -2.970  -6.269 1.00 . A A .  33 THR O    1 1 
        2  2313 1 1  33 THR OG1  O  -0.057  -3.234  -7.463 1.00 . A A .  33 THR OG1  1 1 
        2  2314 1 1  34 ALA C    C   4.678  -6.077  -3.678 1.00 . A A .  34 ALA C    1 1 
        2  2315 1 1  34 ALA CA   C   4.737  -4.591  -4.031 1.00 . A A .  34 ALA CA   1 1 
        2  2316 1 1  34 ALA CB   C   5.211  -3.764  -2.824 1.00 . A A .  34 ALA CB   1 1 
        2  2317 1 1  34 ALA H    H   2.632  -4.389  -3.961 1.00 . A A .  34 ALA H    1 1 
        2  2318 1 1  34 ALA HA   H   5.457  -4.448  -4.839 1.00 . A A .  34 ALA HA   1 1 
        2  2319 1 1  34 ALA HB1  H   5.268  -2.720  -3.100 1.00 . A A .  34 ALA HB1  1 1 
        2  2320 1 1  34 ALA HB2  H   6.190  -4.100  -2.508 1.00 . A A .  34 ALA HB2  1 1 
        2  2321 1 1  34 ALA HB3  H   4.512  -3.875  -2.002 1.00 . A A .  34 ALA HB3  1 1 
        2  2322 1 1  34 ALA N    N   3.421  -4.118  -4.477 1.00 . A A .  34 ALA N    1 1 
        2  2323 1 1  34 ALA O    O   3.828  -6.492  -2.893 1.00 . A A .  34 ALA O    1 1 
        2  2324 1 1  35 THR C    C   6.757  -8.452  -2.805 1.00 . A A .  35 THR C    1 1 
        2  2325 1 1  35 THR CA   C   5.720  -8.299  -3.935 1.00 . A A .  35 THR CA   1 1 
        2  2326 1 1  35 THR CB   C   6.175  -9.137  -5.178 1.00 . A A .  35 THR CB   1 1 
        2  2327 1 1  35 THR CG2  C   6.191 -10.653  -4.895 1.00 . A A .  35 THR CG2  1 1 
        2  2328 1 1  35 THR H    H   6.145  -6.497  -4.975 1.00 . A A .  35 THR H    1 1 
        2  2329 1 1  35 THR HA   H   4.754  -8.677  -3.593 1.00 . A A .  35 THR HA   1 1 
        2  2330 1 1  35 THR HB   H   7.175  -8.827  -5.458 1.00 . A A .  35 THR HB   1 1 
        2  2331 1 1  35 THR HG1  H   5.781  -9.058  -7.108 1.00 . A A .  35 THR HG1  1 1 
        2  2332 1 1  35 THR HG21 H   6.881 -10.870  -4.089 1.00 . A A .  35 THR HG21 1 1 
        2  2333 1 1  35 THR HG22 H   6.507 -11.185  -5.784 1.00 . A A .  35 THR HG22 1 1 
        2  2334 1 1  35 THR HG23 H   5.201 -10.991  -4.617 1.00 . A A .  35 THR HG23 1 1 
        2  2335 1 1  35 THR N    N   5.572  -6.875  -4.277 1.00 . A A .  35 THR N    1 1 
        2  2336 1 1  35 THR O    O   6.532  -9.171  -1.820 1.00 . A A .  35 THR O    1 1 
        2  2337 1 1  35 THR OG1  O   5.307  -8.878  -6.286 1.00 . A A .  35 THR OG1  1 1 
        2  2338 1 1  36 SER C    C   9.815  -6.546  -1.918 1.00 . A A .  36 SER C    1 1 
        2  2339 1 1  36 SER CA   C   9.052  -7.885  -2.071 1.00 . A A .  36 SER CA   1 1 
        2  2340 1 1  36 SER CB   C   9.960  -9.024  -2.619 1.00 . A A .  36 SER CB   1 1 
        2  2341 1 1  36 SER H    H   7.945  -7.092  -3.694 1.00 . A A .  36 SER H    1 1 
        2  2342 1 1  36 SER HA   H   8.694  -8.170  -1.084 1.00 . A A .  36 SER HA   1 1 
        2  2343 1 1  36 SER HB2  H   9.351  -9.899  -2.818 1.00 . A A .  36 SER HB2  1 1 
        2  2344 1 1  36 SER HB3  H  10.429  -8.704  -3.542 1.00 . A A .  36 SER HB3  1 1 
        2  2345 1 1  36 SER HG   H  10.567  -9.606  -0.843 1.00 . A A .  36 SER HG   1 1 
        2  2346 1 1  36 SER N    N   7.890  -7.737  -2.956 1.00 . A A .  36 SER N    1 1 
        2  2347 1 1  36 SER O    O   9.365  -5.508  -2.421 1.00 . A A .  36 SER O    1 1 
        2  2348 1 1  36 SER OG   O  10.973  -9.392  -1.693 1.00 . A A .  36 SER OG   1 1 
        2  2349 1 1  37 SER C    C  12.284  -4.596  -1.981 1.00 . A A .  37 SER C    1 1 
        2  2350 1 1  37 SER CA   C  11.774  -5.436  -0.799 1.00 . A A .  37 SER CA   1 1 
        2  2351 1 1  37 SER CB   C  12.947  -5.933   0.058 1.00 . A A .  37 SER CB   1 1 
        2  2352 1 1  37 SER H    H  11.291  -7.483  -0.934 1.00 . A A .  37 SER H    1 1 
        2  2353 1 1  37 SER HA   H  11.143  -4.809  -0.182 1.00 . A A .  37 SER HA   1 1 
        2  2354 1 1  37 SER HB2  H  13.601  -5.106   0.318 1.00 . A A .  37 SER HB2  1 1 
        2  2355 1 1  37 SER HB3  H  12.564  -6.377   0.971 1.00 . A A .  37 SER HB3  1 1 
        2  2356 1 1  37 SER HG   H  14.101  -7.519   0.010 1.00 . A A .  37 SER HG   1 1 
        2  2357 1 1  37 SER N    N  10.966  -6.601  -1.211 1.00 . A A .  37 SER N    1 1 
        2  2358 1 1  37 SER O    O  12.503  -3.396  -1.829 1.00 . A A .  37 SER O    1 1 
        2  2359 1 1  37 SER OG   O  13.707  -6.917  -0.630 1.00 . A A .  37 SER OG   1 1 
        2  2360 1 1  38 GLN C    C  11.770  -3.489  -4.765 1.00 . A A .  38 GLN C    1 1 
        2  2361 1 1  38 GLN CA   C  12.824  -4.559  -4.408 1.00 . A A .  38 GLN CA   1 1 
        2  2362 1 1  38 GLN CB   C  12.961  -5.608  -5.547 1.00 . A A .  38 GLN CB   1 1 
        2  2363 1 1  38 GLN CD   C  14.507  -4.193  -7.071 1.00 . A A .  38 GLN CD   1 1 
        2  2364 1 1  38 GLN CG   C  13.238  -5.047  -6.961 1.00 . A A .  38 GLN CG   1 1 
        2  2365 1 1  38 GLN H    H  12.368  -6.216  -3.160 1.00 . A A .  38 GLN H    1 1 
        2  2366 1 1  38 GLN HA   H  13.784  -4.072  -4.257 1.00 . A A .  38 GLN HA   1 1 
        2  2367 1 1  38 GLN HB2  H  13.775  -6.278  -5.296 1.00 . A A .  38 GLN HB2  1 1 
        2  2368 1 1  38 GLN HB3  H  12.043  -6.191  -5.587 1.00 . A A .  38 GLN HB3  1 1 
        2  2369 1 1  38 GLN HE21 H  13.458  -2.515  -6.852 1.00 . A A .  38 GLN HE21 1 1 
        2  2370 1 1  38 GLN HE22 H  15.165  -2.319  -7.077 1.00 . A A .  38 GLN HE22 1 1 
        2  2371 1 1  38 GLN HG2  H  13.332  -5.876  -7.653 1.00 . A A .  38 GLN HG2  1 1 
        2  2372 1 1  38 GLN HG3  H  12.386  -4.444  -7.263 1.00 . A A .  38 GLN HG3  1 1 
        2  2373 1 1  38 GLN N    N  12.467  -5.241  -3.148 1.00 . A A .  38 GLN N    1 1 
        2  2374 1 1  38 GLN NE2  N  14.362  -2.877  -6.986 1.00 . A A .  38 GLN NE2  1 1 
        2  2375 1 1  38 GLN O    O  12.106  -2.326  -5.029 1.00 . A A .  38 GLN O    1 1 
        2  2376 1 1  38 GLN OE1  O  15.606  -4.712  -7.270 1.00 . A A .  38 GLN OE1  1 1 
        2  2377 1 1  39 ASP C    C   9.180  -1.971  -3.942 1.00 . A A .  39 ASP C    1 1 
        2  2378 1 1  39 ASP CA   C   9.343  -3.050  -5.025 1.00 . A A .  39 ASP CA   1 1 
        2  2379 1 1  39 ASP CB   C   8.057  -3.897  -5.108 1.00 . A A .  39 ASP CB   1 1 
        2  2380 1 1  39 ASP CG   C   8.161  -5.098  -6.060 1.00 . A A .  39 ASP CG   1 1 
        2  2381 1 1  39 ASP H    H  10.324  -4.841  -4.459 1.00 . A A .  39 ASP H    1 1 
        2  2382 1 1  39 ASP HA   H   9.526  -2.572  -5.985 1.00 . A A .  39 ASP HA   1 1 
        2  2383 1 1  39 ASP HB2  H   7.813  -4.263  -4.111 1.00 . A A .  39 ASP HB2  1 1 
        2  2384 1 1  39 ASP HB3  H   7.240  -3.264  -5.443 1.00 . A A .  39 ASP HB3  1 1 
        2  2385 1 1  39 ASP N    N  10.497  -3.909  -4.716 1.00 . A A .  39 ASP N    1 1 
        2  2386 1 1  39 ASP O    O   8.995  -0.800  -4.254 1.00 . A A .  39 ASP O    1 1 
        2  2387 1 1  39 ASP OD1  O   7.901  -4.934  -7.267 1.00 . A A .  39 ASP OD1  1 1 
        2  2388 1 1  39 ASP OD2  O   8.509  -6.208  -5.594 1.00 . A A .  39 ASP OD2  1 1 
        2  2389 1 1  40 ILE C    C  10.157  -0.325  -1.621 1.00 . A A .  40 ILE C    1 1 
        2  2390 1 1  40 ILE CA   C   9.231  -1.558  -1.463 1.00 . A A .  40 ILE CA   1 1 
        2  2391 1 1  40 ILE CB   C   9.667  -2.408  -0.198 1.00 . A A .  40 ILE CB   1 1 
        2  2392 1 1  40 ILE CD1  C   7.242  -3.028   0.586 1.00 . A A .  40 ILE CD1  1 1 
        2  2393 1 1  40 ILE CG1  C   8.616  -3.521   0.158 1.00 . A A .  40 ILE CG1  1 1 
        2  2394 1 1  40 ILE CG2  C   9.991  -1.526   1.022 1.00 . A A .  40 ILE CG2  1 1 
        2  2395 1 1  40 ILE H    H   9.384  -3.381  -2.535 1.00 . A A .  40 ILE H    1 1 
        2  2396 1 1  40 ILE HA   H   8.206  -1.227  -1.324 1.00 . A A .  40 ILE HA   1 1 
        2  2397 1 1  40 ILE HB   H  10.599  -2.908  -0.468 1.00 . A A .  40 ILE HB   1 1 
        2  2398 1 1  40 ILE HD11 H   6.608  -3.880   0.787 1.00 . A A .  40 ILE HD11 1 1 
        2  2399 1 1  40 ILE HD12 H   6.802  -2.435  -0.204 1.00 . A A .  40 ILE HD12 1 1 
        2  2400 1 1  40 ILE HD13 H   7.331  -2.431   1.482 1.00 . A A .  40 ILE HD13 1 1 
        2  2401 1 1  40 ILE HG12 H   8.471  -4.159  -0.704 1.00 . A A .  40 ILE HG12 1 1 
        2  2402 1 1  40 ILE HG13 H   9.008  -4.130   0.968 1.00 . A A .  40 ILE HG13 1 1 
        2  2403 1 1  40 ILE HG21 H   9.122  -0.937   1.286 1.00 . A A .  40 ILE HG21 1 1 
        2  2404 1 1  40 ILE HG22 H  10.812  -0.859   0.788 1.00 . A A .  40 ILE HG22 1 1 
        2  2405 1 1  40 ILE HG23 H  10.269  -2.147   1.863 1.00 . A A .  40 ILE HG23 1 1 
        2  2406 1 1  40 ILE N    N   9.274  -2.416  -2.669 1.00 . A A .  40 ILE N    1 1 
        2  2407 1 1  40 ILE O    O   9.706   0.823  -1.526 1.00 . A A .  40 ILE O    1 1 
        2  2408 1 1  41 ARG C    C  12.205   1.314  -3.316 1.00 . A A .  41 ARG C    1 1 
        2  2409 1 1  41 ARG CA   C  12.483   0.409  -2.102 1.00 . A A .  41 ARG CA   1 1 
        2  2410 1 1  41 ARG CB   C  13.840  -0.322  -2.280 1.00 . A A .  41 ARG CB   1 1 
        2  2411 1 1  41 ARG CD   C  15.037   0.052  -0.052 1.00 . A A .  41 ARG CD   1 1 
        2  2412 1 1  41 ARG CG   C  14.388  -0.971  -0.989 1.00 . A A .  41 ARG CG   1 1 
        2  2413 1 1  41 ARG CZ   C  16.952   1.664  -0.182 1.00 . A A .  41 ARG CZ   1 1 
        2  2414 1 1  41 ARG H    H  11.675  -1.547  -2.063 1.00 . A A .  41 ARG H    1 1 
        2  2415 1 1  41 ARG HA   H  12.518   1.015  -1.201 1.00 . A A .  41 ARG HA   1 1 
        2  2416 1 1  41 ARG HB2  H  13.716  -1.104  -3.026 1.00 . A A .  41 ARG HB2  1 1 
        2  2417 1 1  41 ARG HB3  H  14.582   0.379  -2.650 1.00 . A A .  41 ARG HB3  1 1 
        2  2418 1 1  41 ARG HD2  H  14.309   0.816   0.212 1.00 . A A .  41 ARG HD2  1 1 
        2  2419 1 1  41 ARG HD3  H  15.365  -0.458   0.845 1.00 . A A .  41 ARG HD3  1 1 
        2  2420 1 1  41 ARG HE   H  16.450   0.340  -1.591 1.00 . A A .  41 ARG HE   1 1 
        2  2421 1 1  41 ARG HG2  H  13.574  -1.461  -0.467 1.00 . A A .  41 ARG HG2  1 1 
        2  2422 1 1  41 ARG HG3  H  15.129  -1.714  -1.260 1.00 . A A .  41 ARG HG3  1 1 
        2  2423 1 1  41 ARG HH11 H  15.910   1.821   1.543 1.00 . A A .  41 ARG HH11 1 1 
        2  2424 1 1  41 ARG HH12 H  17.247   2.908   1.386 1.00 . A A .  41 ARG HH12 1 1 
        2  2425 1 1  41 ARG HH21 H  18.208   1.749  -1.768 1.00 . A A .  41 ARG HH21 1 1 
        2  2426 1 1  41 ARG HH22 H  18.550   2.868  -0.488 1.00 . A A .  41 ARG HH22 1 1 
        2  2427 1 1  41 ARG N    N  11.432  -0.606  -1.928 1.00 . A A .  41 ARG N    1 1 
        2  2428 1 1  41 ARG NE   N  16.204   0.684  -0.701 1.00 . A A .  41 ARG NE   1 1 
        2  2429 1 1  41 ARG NH1  N  16.679   2.171   1.007 1.00 . A A .  41 ARG NH1  1 1 
        2  2430 1 1  41 ARG NH2  N  17.985   2.133  -0.868 1.00 . A A .  41 ARG NH2  1 1 
        2  2431 1 1  41 ARG O    O  12.386   2.532  -3.246 1.00 . A A .  41 ARG O    1 1 
        2  2432 1 1  42 ASP C    C  10.353   2.379  -5.627 1.00 . A A .  42 ASP C    1 1 
        2  2433 1 1  42 ASP CA   C  11.506   1.351  -5.704 1.00 . A A .  42 ASP CA   1 1 
        2  2434 1 1  42 ASP CB   C  11.198   0.286  -6.790 1.00 . A A .  42 ASP CB   1 1 
        2  2435 1 1  42 ASP CG   C  11.170   0.872  -8.214 1.00 . A A .  42 ASP CG   1 1 
        2  2436 1 1  42 ASP H    H  11.568  -0.279  -4.351 1.00 . A A .  42 ASP H    1 1 
        2  2437 1 1  42 ASP HA   H  12.422   1.871  -5.975 1.00 . A A .  42 ASP HA   1 1 
        2  2438 1 1  42 ASP HB2  H  11.957  -0.497  -6.750 1.00 . A A .  42 ASP HB2  1 1 
        2  2439 1 1  42 ASP HB3  H  10.235  -0.174  -6.578 1.00 . A A .  42 ASP HB3  1 1 
        2  2440 1 1  42 ASP N    N  11.744   0.683  -4.412 1.00 . A A .  42 ASP N    1 1 
        2  2441 1 1  42 ASP O    O  10.421   3.445  -6.254 1.00 . A A .  42 ASP O    1 1 
        2  2442 1 1  42 ASP OD1  O  12.226   0.902  -8.870 1.00 . A A .  42 ASP OD1  1 1 
        2  2443 1 1  42 ASP OD2  O  10.101   1.297  -8.691 1.00 . A A .  42 ASP OD2  1 1 
        2  2444 1 1  43 ILE C    C   8.432   4.098  -3.790 1.00 . A A .  43 ILE C    1 1 
        2  2445 1 1  43 ILE CA   C   8.107   2.875  -4.673 1.00 . A A .  43 ILE CA   1 1 
        2  2446 1 1  43 ILE CB   C   6.913   2.040  -4.064 1.00 . A A .  43 ILE CB   1 1 
        2  2447 1 1  43 ILE CD1  C   5.527  -0.132  -4.458 1.00 . A A .  43 ILE CD1  1 1 
        2  2448 1 1  43 ILE CG1  C   6.493   0.889  -5.043 1.00 . A A .  43 ILE CG1  1 1 
        2  2449 1 1  43 ILE CG2  C   5.702   2.952  -3.721 1.00 . A A .  43 ILE CG2  1 1 
        2  2450 1 1  43 ILE H    H   9.351   1.181  -4.373 1.00 . A A .  43 ILE H    1 1 
        2  2451 1 1  43 ILE HA   H   7.804   3.231  -5.659 1.00 . A A .  43 ILE HA   1 1 
        2  2452 1 1  43 ILE HB   H   7.260   1.595  -3.132 1.00 . A A .  43 ILE HB   1 1 
        2  2453 1 1  43 ILE HD11 H   5.978  -0.604  -3.595 1.00 . A A .  43 ILE HD11 1 1 
        2  2454 1 1  43 ILE HD12 H   5.310  -0.885  -5.202 1.00 . A A .  43 ILE HD12 1 1 
        2  2455 1 1  43 ILE HD13 H   4.609   0.357  -4.164 1.00 . A A .  43 ILE HD13 1 1 
        2  2456 1 1  43 ILE HG12 H   6.023   1.312  -5.919 1.00 . A A .  43 ILE HG12 1 1 
        2  2457 1 1  43 ILE HG13 H   7.379   0.347  -5.355 1.00 . A A .  43 ILE HG13 1 1 
        2  2458 1 1  43 ILE HG21 H   5.357   3.453  -4.616 1.00 . A A .  43 ILE HG21 1 1 
        2  2459 1 1  43 ILE HG22 H   5.996   3.696  -2.988 1.00 . A A .  43 ILE HG22 1 1 
        2  2460 1 1  43 ILE HG23 H   4.899   2.356  -3.316 1.00 . A A .  43 ILE HG23 1 1 
        2  2461 1 1  43 ILE N    N   9.308   2.035  -4.851 1.00 . A A .  43 ILE N    1 1 
        2  2462 1 1  43 ILE O    O   8.027   5.214  -4.115 1.00 . A A .  43 ILE O    1 1 
        2  2463 1 1  44 ILE C    C  10.605   5.914  -2.618 1.00 . A A .  44 ILE C    1 1 
        2  2464 1 1  44 ILE CA   C   9.680   4.969  -1.815 1.00 . A A .  44 ILE CA   1 1 
        2  2465 1 1  44 ILE CB   C  10.434   4.398  -0.551 1.00 . A A .  44 ILE CB   1 1 
        2  2466 1 1  44 ILE CD1  C  10.121   2.798   1.458 1.00 . A A .  44 ILE CD1  1 1 
        2  2467 1 1  44 ILE CG1  C   9.464   3.514   0.298 1.00 . A A .  44 ILE CG1  1 1 
        2  2468 1 1  44 ILE CG2  C  11.060   5.531   0.319 1.00 . A A .  44 ILE CG2  1 1 
        2  2469 1 1  44 ILE H    H   9.415   2.953  -2.458 1.00 . A A .  44 ILE H    1 1 
        2  2470 1 1  44 ILE HA   H   8.814   5.537  -1.471 1.00 . A A .  44 ILE HA   1 1 
        2  2471 1 1  44 ILE HB   H  11.247   3.774  -0.905 1.00 . A A .  44 ILE HB   1 1 
        2  2472 1 1  44 ILE HD11 H  10.894   2.139   1.085 1.00 . A A .  44 ILE HD11 1 1 
        2  2473 1 1  44 ILE HD12 H   9.380   2.217   1.978 1.00 . A A .  44 ILE HD12 1 1 
        2  2474 1 1  44 ILE HD13 H  10.554   3.517   2.138 1.00 . A A .  44 ILE HD13 1 1 
        2  2475 1 1  44 ILE HG12 H   8.673   4.130   0.706 1.00 . A A .  44 ILE HG12 1 1 
        2  2476 1 1  44 ILE HG13 H   9.021   2.758  -0.340 1.00 . A A .  44 ILE HG13 1 1 
        2  2477 1 1  44 ILE HG21 H  11.763   6.103  -0.279 1.00 . A A .  44 ILE HG21 1 1 
        2  2478 1 1  44 ILE HG22 H  11.586   5.101   1.162 1.00 . A A .  44 ILE HG22 1 1 
        2  2479 1 1  44 ILE HG23 H  10.282   6.188   0.680 1.00 . A A .  44 ILE HG23 1 1 
        2  2480 1 1  44 ILE N    N   9.185   3.876  -2.689 1.00 . A A .  44 ILE N    1 1 
        2  2481 1 1  44 ILE O    O  10.554   7.133  -2.455 1.00 . A A .  44 ILE O    1 1 
        2  2482 1 1  45 LYS C    C  11.493   6.879  -5.450 1.00 . A A .  45 LYS C    1 1 
        2  2483 1 1  45 LYS CA   C  12.321   6.052  -4.433 1.00 . A A .  45 LYS CA   1 1 
        2  2484 1 1  45 LYS CB   C  13.292   5.035  -5.131 1.00 . A A .  45 LYS CB   1 1 
        2  2485 1 1  45 LYS CD   C  14.452   6.368  -7.073 1.00 . A A .  45 LYS CD   1 1 
        2  2486 1 1  45 LYS CE   C  13.892   5.487  -8.198 1.00 . A A .  45 LYS CE   1 1 
        2  2487 1 1  45 LYS CG   C  14.614   5.609  -5.733 1.00 . A A .  45 LYS CG   1 1 
        2  2488 1 1  45 LYS H    H  11.375   4.338  -3.600 1.00 . A A .  45 LYS H    1 1 
        2  2489 1 1  45 LYS HA   H  12.905   6.734  -3.817 1.00 . A A .  45 LYS HA   1 1 
        2  2490 1 1  45 LYS HB2  H  13.575   4.289  -4.397 1.00 . A A .  45 LYS HB2  1 1 
        2  2491 1 1  45 LYS HB3  H  12.751   4.525  -5.922 1.00 . A A .  45 LYS HB3  1 1 
        2  2492 1 1  45 LYS HD2  H  13.786   7.209  -6.923 1.00 . A A .  45 LYS HD2  1 1 
        2  2493 1 1  45 LYS HD3  H  15.424   6.744  -7.378 1.00 . A A .  45 LYS HD3  1 1 
        2  2494 1 1  45 LYS HE2  H  14.577   4.665  -8.381 1.00 . A A .  45 LYS HE2  1 1 
        2  2495 1 1  45 LYS HE3  H  12.931   5.088  -7.894 1.00 . A A .  45 LYS HE3  1 1 
        2  2496 1 1  45 LYS HG2  H  15.050   6.288  -5.011 1.00 . A A .  45 LYS HG2  1 1 
        2  2497 1 1  45 LYS HG3  H  15.305   4.786  -5.889 1.00 . A A .  45 LYS HG3  1 1 
        2  2498 1 1  45 LYS HZ1  H  13.350   5.633 -10.211 1.00 . A A .  45 LYS HZ1  1 1 
        2  2499 1 1  45 LYS HZ2  H  14.629   6.648  -9.774 1.00 . A A .  45 LYS HZ2  1 1 
        2  2500 1 1  45 LYS HZ3  H  13.047   7.036  -9.322 1.00 . A A .  45 LYS HZ3  1 1 
        2  2501 1 1  45 LYS N    N  11.407   5.317  -3.530 1.00 . A A .  45 LYS N    1 1 
        2  2502 1 1  45 LYS NZ   N  13.718   6.255  -9.461 1.00 . A A .  45 LYS NZ   1 1 
        2  2503 1 1  45 LYS O    O  11.887   7.983  -5.829 1.00 . A A .  45 LYS O    1 1 
        2  2504 1 1  46 SER C    C   8.723   8.241  -5.997 1.00 . A A .  46 SER C    1 1 
        2  2505 1 1  46 SER CA   C   9.376   7.052  -6.750 1.00 . A A .  46 SER CA   1 1 
        2  2506 1 1  46 SER CB   C   8.298   6.069  -7.290 1.00 . A A .  46 SER CB   1 1 
        2  2507 1 1  46 SER H    H  10.103   5.430  -5.571 1.00 . A A .  46 SER H    1 1 
        2  2508 1 1  46 SER HA   H   9.939   7.443  -7.590 1.00 . A A .  46 SER HA   1 1 
        2  2509 1 1  46 SER HB2  H   8.786   5.235  -7.777 1.00 . A A .  46 SER HB2  1 1 
        2  2510 1 1  46 SER HB3  H   7.696   5.693  -6.465 1.00 . A A .  46 SER HB3  1 1 
        2  2511 1 1  46 SER HG   H   7.851   6.670  -9.110 1.00 . A A .  46 SER HG   1 1 
        2  2512 1 1  46 SER N    N  10.330   6.339  -5.866 1.00 . A A .  46 SER N    1 1 
        2  2513 1 1  46 SER O    O   8.475   9.305  -6.578 1.00 . A A .  46 SER O    1 1 
        2  2514 1 1  46 SER OG   O   7.436   6.690  -8.237 1.00 . A A .  46 SER OG   1 1 
        2  2515 1 1  47 MET C    C   9.005  10.118  -3.389 1.00 . A A .  47 MET C    1 1 
        2  2516 1 1  47 MET CA   C   7.935   9.079  -3.778 1.00 . A A .  47 MET CA   1 1 
        2  2517 1 1  47 MET CB   C   7.305   8.437  -2.509 1.00 . A A .  47 MET CB   1 1 
        2  2518 1 1  47 MET CE   C   4.364   8.606  -1.024 1.00 . A A .  47 MET CE   1 1 
        2  2519 1 1  47 MET CG   C   6.169   7.443  -2.793 1.00 . A A .  47 MET CG   1 1 
        2  2520 1 1  47 MET H    H   8.716   7.174  -4.295 1.00 . A A .  47 MET H    1 1 
        2  2521 1 1  47 MET HA   H   7.150   9.597  -4.322 1.00 . A A .  47 MET HA   1 1 
        2  2522 1 1  47 MET HB2  H   8.080   7.913  -1.958 1.00 . A A .  47 MET HB2  1 1 
        2  2523 1 1  47 MET HB3  H   6.910   9.223  -1.875 1.00 . A A .  47 MET HB3  1 1 
        2  2524 1 1  47 MET HE1  H   3.726   8.510  -0.158 1.00 . A A .  47 MET HE1  1 1 
        2  2525 1 1  47 MET HE2  H   3.769   8.877  -1.883 1.00 . A A .  47 MET HE2  1 1 
        2  2526 1 1  47 MET HE3  H   5.106   9.375  -0.840 1.00 . A A .  47 MET HE3  1 1 
        2  2527 1 1  47 MET HG2  H   5.506   7.862  -3.539 1.00 . A A .  47 MET HG2  1 1 
        2  2528 1 1  47 MET HG3  H   6.593   6.524  -3.179 1.00 . A A .  47 MET HG3  1 1 
        2  2529 1 1  47 MET N    N   8.494   8.046  -4.678 1.00 . A A .  47 MET N    1 1 
        2  2530 1 1  47 MET O    O   8.673  11.208  -2.909 1.00 . A A .  47 MET O    1 1 
        2  2531 1 1  47 MET SD   S   5.190   7.041  -1.329 1.00 . A A .  47 MET SD   1 1 
        2  2532 1 1  48 LYS C    C  11.365  11.791  -4.493 1.00 . A A .  48 LYS C    1 1 
        2  2533 1 1  48 LYS CA   C  11.418  10.701  -3.413 1.00 . A A .  48 LYS CA   1 1 
        2  2534 1 1  48 LYS CB   C  12.781   9.952  -3.466 1.00 . A A .  48 LYS CB   1 1 
        2  2535 1 1  48 LYS CD   C  13.845   9.813  -1.095 1.00 . A A .  48 LYS CD   1 1 
        2  2536 1 1  48 LYS CE   C  13.028  10.921  -0.413 1.00 . A A .  48 LYS CE   1 1 
        2  2537 1 1  48 LYS CG   C  13.100   9.067  -2.227 1.00 . A A .  48 LYS CG   1 1 
        2  2538 1 1  48 LYS H    H  10.491   8.829  -3.807 1.00 . A A .  48 LYS H    1 1 
        2  2539 1 1  48 LYS HA   H  11.314  11.174  -2.446 1.00 . A A .  48 LYS HA   1 1 
        2  2540 1 1  48 LYS HB2  H  12.783   9.316  -4.342 1.00 . A A .  48 LYS HB2  1 1 
        2  2541 1 1  48 LYS HB3  H  13.583  10.677  -3.578 1.00 . A A .  48 LYS HB3  1 1 
        2  2542 1 1  48 LYS HD2  H  14.129   9.092  -0.338 1.00 . A A .  48 LYS HD2  1 1 
        2  2543 1 1  48 LYS HD3  H  14.750  10.252  -1.507 1.00 . A A .  48 LYS HD3  1 1 
        2  2544 1 1  48 LYS HE2  H  12.754  11.664  -1.148 1.00 . A A .  48 LYS HE2  1 1 
        2  2545 1 1  48 LYS HE3  H  12.128  10.484   0.006 1.00 . A A .  48 LYS HE3  1 1 
        2  2546 1 1  48 LYS HG2  H  12.166   8.678  -1.825 1.00 . A A .  48 LYS HG2  1 1 
        2  2547 1 1  48 LYS HG3  H  13.710   8.229  -2.551 1.00 . A A .  48 LYS HG3  1 1 
        2  2548 1 1  48 LYS HZ1  H  14.579  12.137   0.283 1.00 . A A .  48 LYS HZ1  1 1 
        2  2549 1 1  48 LYS HZ2  H  14.186  10.864   1.325 1.00 . A A .  48 LYS HZ2  1 1 
        2  2550 1 1  48 LYS HZ3  H  13.176  12.215   1.222 1.00 . A A .  48 LYS HZ3  1 1 
        2  2551 1 1  48 LYS N    N  10.294   9.759  -3.570 1.00 . A A .  48 LYS N    1 1 
        2  2552 1 1  48 LYS NZ   N  13.794  11.581   0.680 1.00 . A A .  48 LYS NZ   1 1 
        2  2553 1 1  48 LYS O    O  11.727  12.945  -4.237 1.00 . A A .  48 LYS O    1 1 
        2  2554 1 1  49 ASP C    C   9.407  13.167  -6.499 1.00 . A A .  49 ASP C    1 1 
        2  2555 1 1  49 ASP CA   C  10.674  12.354  -6.795 1.00 . A A .  49 ASP CA   1 1 
        2  2556 1 1  49 ASP CB   C  10.545  11.609  -8.149 1.00 . A A .  49 ASP CB   1 1 
        2  2557 1 1  49 ASP CG   C  10.266  12.550  -9.337 1.00 . A A .  49 ASP CG   1 1 
        2  2558 1 1  49 ASP H    H  10.729  10.460  -5.850 1.00 . A A .  49 ASP H    1 1 
        2  2559 1 1  49 ASP HA   H  11.526  13.033  -6.847 1.00 . A A .  49 ASP HA   1 1 
        2  2560 1 1  49 ASP HB2  H  11.472  11.077  -8.344 1.00 . A A .  49 ASP HB2  1 1 
        2  2561 1 1  49 ASP HB3  H   9.745  10.876  -8.082 1.00 . A A .  49 ASP HB3  1 1 
        2  2562 1 1  49 ASP N    N  10.915  11.409  -5.698 1.00 . A A .  49 ASP N    1 1 
        2  2563 1 1  49 ASP O    O   9.446  14.398  -6.472 1.00 . A A .  49 ASP O    1 1 
        2  2564 1 1  49 ASP OD1  O  11.211  13.181  -9.842 1.00 . A A .  49 ASP OD1  1 1 
        2  2565 1 1  49 ASP OD2  O   9.108  12.652  -9.783 1.00 . A A .  49 ASP OD2  1 1 
        2  2566 1 1  50 ASN C    C   6.221  12.289  -4.888 1.00 . A A .  50 ASN C    1 1 
        2  2567 1 1  50 ASN CA   C   6.983  13.073  -5.977 1.00 . A A .  50 ASN CA   1 1 
        2  2568 1 1  50 ASN CB   C   6.165  13.145  -7.301 1.00 . A A .  50 ASN CB   1 1 
        2  2569 1 1  50 ASN CG   C   4.806  13.856  -7.174 1.00 . A A .  50 ASN CG   1 1 
        2  2570 1 1  50 ASN H    H   8.369  11.473  -6.181 1.00 . A A .  50 ASN H    1 1 
        2  2571 1 1  50 ASN HA   H   7.151  14.086  -5.617 1.00 . A A .  50 ASN HA   1 1 
        2  2572 1 1  50 ASN HB2  H   6.745  13.679  -8.043 1.00 . A A .  50 ASN HB2  1 1 
        2  2573 1 1  50 ASN HB3  H   5.994  12.137  -7.662 1.00 . A A .  50 ASN HB3  1 1 
        2  2574 1 1  50 ASN HD21 H   5.528  15.204  -5.888 1.00 . A A .  50 ASN HD21 1 1 
        2  2575 1 1  50 ASN HD22 H   3.853  15.347  -6.277 1.00 . A A .  50 ASN HD22 1 1 
        2  2576 1 1  50 ASN N    N   8.298  12.453  -6.227 1.00 . A A .  50 ASN N    1 1 
        2  2577 1 1  50 ASN ND2  N   4.725  14.910  -6.368 1.00 . A A .  50 ASN ND2  1 1 
        2  2578 1 1  50 ASN O    O   5.692  11.199  -5.153 1.00 . A A .  50 ASN O    1 1 
        2  2579 1 1  50 ASN OD1  O   3.835  13.485  -7.836 1.00 . A A .  50 ASN OD1  1 1 
        2  2580 1 1  51 GLY C    C   3.983  12.571  -2.639 1.00 . A A .  51 GLY C    1 1 
        2  2581 1 1  51 GLY CA   C   5.472  12.277  -2.520 1.00 . A A .  51 GLY CA   1 1 
        2  2582 1 1  51 GLY H    H   6.724  13.665  -3.515 1.00 . A A .  51 GLY H    1 1 
        2  2583 1 1  51 GLY HA2  H   5.629  11.201  -2.479 1.00 . A A .  51 GLY HA2  1 1 
        2  2584 1 1  51 GLY HA3  H   5.847  12.713  -1.603 1.00 . A A .  51 GLY HA3  1 1 
        2  2585 1 1  51 GLY N    N   6.216  12.843  -3.653 1.00 . A A .  51 GLY N    1 1 
        2  2586 1 1  51 GLY O    O   3.481  13.551  -2.079 1.00 . A A .  51 GLY O    1 1 
        2  2587 1 1  52 LYS C    C   1.005  10.786  -3.118 1.00 . A A .  52 LYS C    1 1 
        2  2588 1 1  52 LYS CA   C   1.865  11.913  -3.764 1.00 . A A .  52 LYS CA   1 1 
        2  2589 1 1  52 LYS CB   C   1.746  11.944  -5.317 1.00 . A A .  52 LYS CB   1 1 
        2  2590 1 1  52 LYS CD   C   1.979  10.752  -7.586 1.00 . A A .  52 LYS CD   1 1 
        2  2591 1 1  52 LYS CE   C   0.689  11.438  -8.076 1.00 . A A .  52 LYS CE   1 1 
        2  2592 1 1  52 LYS CG   C   2.041  10.609  -6.044 1.00 . A A .  52 LYS CG   1 1 
        2  2593 1 1  52 LYS H    H   3.757  10.946  -3.777 1.00 . A A .  52 LYS H    1 1 
        2  2594 1 1  52 LYS HA   H   1.526  12.868  -3.366 1.00 . A A .  52 LYS HA   1 1 
        2  2595 1 1  52 LYS HB2  H   0.738  12.249  -5.575 1.00 . A A .  52 LYS HB2  1 1 
        2  2596 1 1  52 LYS HB3  H   2.432  12.694  -5.698 1.00 . A A .  52 LYS HB3  1 1 
        2  2597 1 1  52 LYS HD2  H   2.827  11.337  -7.918 1.00 . A A .  52 LYS HD2  1 1 
        2  2598 1 1  52 LYS HD3  H   2.039   9.765  -8.032 1.00 . A A .  52 LYS HD3  1 1 
        2  2599 1 1  52 LYS HE2  H  -0.169  10.925  -7.659 1.00 . A A .  52 LYS HE2  1 1 
        2  2600 1 1  52 LYS HE3  H   0.685  12.467  -7.736 1.00 . A A .  52 LYS HE3  1 1 
        2  2601 1 1  52 LYS HG2  H   3.031  10.265  -5.762 1.00 . A A .  52 LYS HG2  1 1 
        2  2602 1 1  52 LYS HG3  H   1.311   9.870  -5.728 1.00 . A A .  52 LYS HG3  1 1 
        2  2603 1 1  52 LYS HZ1  H   1.399  11.882  -9.991 1.00 . A A .  52 LYS HZ1  1 1 
        2  2604 1 1  52 LYS HZ2  H  -0.284  11.939  -9.857 1.00 . A A .  52 LYS HZ2  1 1 
        2  2605 1 1  52 LYS HZ3  H   0.507  10.451  -9.907 1.00 . A A .  52 LYS HZ3  1 1 
        2  2606 1 1  52 LYS N    N   3.290  11.732  -3.414 1.00 . A A .  52 LYS N    1 1 
        2  2607 1 1  52 LYS NZ   N   0.571  11.427  -9.559 1.00 . A A .  52 LYS NZ   1 1 
        2  2608 1 1  52 LYS O    O   1.572   9.775  -2.688 1.00 . A A .  52 LYS O    1 1 
        2  2609 1 1  53 PRO C    C  -1.296   8.583  -3.076 1.00 . A A .  53 PRO C    1 1 
        2  2610 1 1  53 PRO CA   C  -1.249   9.941  -2.337 1.00 . A A .  53 PRO CA   1 1 
        2  2611 1 1  53 PRO CB   C  -2.636  10.635  -2.322 1.00 . A A .  53 PRO CB   1 1 
        2  2612 1 1  53 PRO CD   C  -1.193  12.053  -3.589 1.00 . A A .  53 PRO CD   1 1 
        2  2613 1 1  53 PRO CG   C  -2.612  11.527  -3.522 1.00 . A A .  53 PRO CG   1 1 
        2  2614 1 1  53 PRO HA   H  -0.916   9.774  -1.315 1.00 . A A .  53 PRO HA   1 1 
        2  2615 1 1  53 PRO HB2  H  -3.439   9.899  -2.387 1.00 . A A .  53 PRO HB2  1 1 
        2  2616 1 1  53 PRO HB3  H  -2.756  11.225  -1.420 1.00 . A A .  53 PRO HB3  1 1 
        2  2617 1 1  53 PRO HD2  H  -0.911  12.262  -4.617 1.00 . A A .  53 PRO HD2  1 1 
        2  2618 1 1  53 PRO HD3  H  -1.083  12.949  -2.987 1.00 . A A .  53 PRO HD3  1 1 
        2  2619 1 1  53 PRO HG2  H  -2.854  10.956  -4.418 1.00 . A A .  53 PRO HG2  1 1 
        2  2620 1 1  53 PRO HG3  H  -3.310  12.347  -3.402 1.00 . A A .  53 PRO HG3  1 1 
        2  2621 1 1  53 PRO N    N  -0.375  10.934  -3.025 1.00 . A A .  53 PRO N    1 1 
        2  2622 1 1  53 PRO O    O  -2.093   8.380  -3.998 1.00 . A A .  53 PRO O    1 1 
        2  2623 1 1  54 LEU C    C  -1.017   5.292  -2.395 1.00 . A A .  54 LEU C    1 1 
        2  2624 1 1  54 LEU CA   C  -0.315   6.323  -3.279 1.00 . A A .  54 LEU CA   1 1 
        2  2625 1 1  54 LEU CB   C   1.177   5.945  -3.527 1.00 . A A .  54 LEU CB   1 1 
        2  2626 1 1  54 LEU CD1  C   3.357   6.336  -4.834 1.00 . A A .  54 LEU CD1  1 1 
        2  2627 1 1  54 LEU CD2  C   1.125   6.276  -6.050 1.00 . A A .  54 LEU CD2  1 1 
        2  2628 1 1  54 LEU CG   C   1.851   6.653  -4.744 1.00 . A A .  54 LEU CG   1 1 
        2  2629 1 1  54 LEU H    H   0.204   7.898  -1.935 1.00 . A A .  54 LEU H    1 1 
        2  2630 1 1  54 LEU HA   H  -0.830   6.345  -4.241 1.00 . A A .  54 LEU HA   1 1 
        2  2631 1 1  54 LEU HB2  H   1.738   6.193  -2.633 1.00 . A A .  54 LEU HB2  1 1 
        2  2632 1 1  54 LEU HB3  H   1.248   4.870  -3.679 1.00 . A A .  54 LEU HB3  1 1 
        2  2633 1 1  54 LEU HD11 H   3.843   6.641  -3.919 1.00 . A A .  54 LEU HD11 1 1 
        2  2634 1 1  54 LEU HD12 H   3.793   6.874  -5.663 1.00 . A A .  54 LEU HD12 1 1 
        2  2635 1 1  54 LEU HD13 H   3.507   5.271  -4.980 1.00 . A A .  54 LEU HD13 1 1 
        2  2636 1 1  54 LEU HD21 H   0.098   6.608  -5.998 1.00 . A A .  54 LEU HD21 1 1 
        2  2637 1 1  54 LEU HD22 H   1.142   5.198  -6.191 1.00 . A A .  54 LEU HD22 1 1 
        2  2638 1 1  54 LEU HD23 H   1.607   6.756  -6.888 1.00 . A A .  54 LEU HD23 1 1 
        2  2639 1 1  54 LEU HG   H   1.758   7.724  -4.619 1.00 . A A .  54 LEU HG   1 1 
        2  2640 1 1  54 LEU N    N  -0.405   7.669  -2.678 1.00 . A A .  54 LEU N    1 1 
        2  2641 1 1  54 LEU O    O  -1.296   5.563  -1.236 1.00 . A A .  54 LEU O    1 1 
        2  2642 1 1  55 VAL C    C  -1.135   1.706  -2.647 1.00 . A A .  55 VAL C    1 1 
        2  2643 1 1  55 VAL CA   C  -1.911   2.975  -2.239 1.00 . A A .  55 VAL CA   1 1 
        2  2644 1 1  55 VAL CB   C  -3.461   2.799  -2.555 1.00 . A A .  55 VAL CB   1 1 
        2  2645 1 1  55 VAL CG1  C  -4.059   1.599  -1.791 1.00 . A A .  55 VAL CG1  1 1 
        2  2646 1 1  55 VAL CG2  C  -4.263   4.092  -2.261 1.00 . A A .  55 VAL CG2  1 1 
        2  2647 1 1  55 VAL H    H  -1.184   4.022  -3.939 1.00 . A A .  55 VAL H    1 1 
        2  2648 1 1  55 VAL HA   H  -1.788   3.141  -1.166 1.00 . A A .  55 VAL HA   1 1 
        2  2649 1 1  55 VAL HB   H  -3.561   2.588  -3.622 1.00 . A A .  55 VAL HB   1 1 
        2  2650 1 1  55 VAL HG11 H  -5.110   1.499  -2.028 1.00 . A A .  55 VAL HG11 1 1 
        2  2651 1 1  55 VAL HG12 H  -3.949   1.751  -0.723 1.00 . A A .  55 VAL HG12 1 1 
        2  2652 1 1  55 VAL HG13 H  -3.542   0.689  -2.074 1.00 . A A .  55 VAL HG13 1 1 
        2  2653 1 1  55 VAL HG21 H  -4.173   4.348  -1.213 1.00 . A A .  55 VAL HG21 1 1 
        2  2654 1 1  55 VAL HG22 H  -5.307   3.943  -2.505 1.00 . A A .  55 VAL HG22 1 1 
        2  2655 1 1  55 VAL HG23 H  -3.873   4.908  -2.859 1.00 . A A .  55 VAL HG23 1 1 
        2  2656 1 1  55 VAL N    N  -1.334   4.120  -2.974 1.00 . A A .  55 VAL N    1 1 
        2  2657 1 1  55 VAL O    O  -1.366   1.167  -3.726 1.00 . A A .  55 VAL O    1 1 
        2  2658 1 1  56 VAL C    C  -0.038  -1.207  -1.495 1.00 . A A .  56 VAL C    1 1 
        2  2659 1 1  56 VAL CA   C   0.633   0.054  -2.067 1.00 . A A .  56 VAL CA   1 1 
        2  2660 1 1  56 VAL CB   C   2.087   0.187  -1.462 1.00 . A A .  56 VAL CB   1 1 
        2  2661 1 1  56 VAL CG1  C   2.911  -1.113  -1.638 1.00 . A A .  56 VAL CG1  1 1 
        2  2662 1 1  56 VAL CG2  C   2.832   1.378  -2.086 1.00 . A A .  56 VAL CG2  1 1 
        2  2663 1 1  56 VAL H    H  -0.024   1.757  -0.962 1.00 . A A .  56 VAL H    1 1 
        2  2664 1 1  56 VAL HA   H   0.730  -0.056  -3.149 1.00 . A A .  56 VAL HA   1 1 
        2  2665 1 1  56 VAL HB   H   1.993   0.380  -0.396 1.00 . A A .  56 VAL HB   1 1 
        2  2666 1 1  56 VAL HG11 H   3.009  -1.348  -2.691 1.00 . A A .  56 VAL HG11 1 1 
        2  2667 1 1  56 VAL HG12 H   2.413  -1.935  -1.136 1.00 . A A .  56 VAL HG12 1 1 
        2  2668 1 1  56 VAL HG13 H   3.896  -0.985  -1.208 1.00 . A A .  56 VAL HG13 1 1 
        2  2669 1 1  56 VAL HG21 H   2.243   2.278  -1.971 1.00 . A A .  56 VAL HG21 1 1 
        2  2670 1 1  56 VAL HG22 H   3.000   1.197  -3.139 1.00 . A A .  56 VAL HG22 1 1 
        2  2671 1 1  56 VAL HG23 H   3.787   1.516  -1.594 1.00 . A A .  56 VAL HG23 1 1 
        2  2672 1 1  56 VAL N    N  -0.184   1.260  -1.796 1.00 . A A .  56 VAL N    1 1 
        2  2673 1 1  56 VAL O    O  -0.113  -1.372  -0.277 1.00 . A A .  56 VAL O    1 1 
        2  2674 1 1  57 PHE C    C   0.258  -4.364  -1.965 1.00 . A A .  57 PHE C    1 1 
        2  2675 1 1  57 PHE CA   C  -0.964  -3.436  -2.005 1.00 . A A .  57 PHE CA   1 1 
        2  2676 1 1  57 PHE CB   C  -2.009  -3.969  -3.017 1.00 . A A .  57 PHE CB   1 1 
        2  2677 1 1  57 PHE CD1  C  -3.535  -2.050  -3.701 1.00 . A A .  57 PHE CD1  1 1 
        2  2678 1 1  57 PHE CD2  C  -4.406  -3.724  -2.229 1.00 . A A .  57 PHE CD2  1 1 
        2  2679 1 1  57 PHE CE1  C  -4.747  -1.384  -3.659 1.00 . A A .  57 PHE CE1  1 1 
        2  2680 1 1  57 PHE CE2  C  -5.611  -3.056  -2.189 1.00 . A A .  57 PHE CE2  1 1 
        2  2681 1 1  57 PHE CG   C  -3.344  -3.233  -2.984 1.00 . A A .  57 PHE CG   1 1 
        2  2682 1 1  57 PHE CZ   C  -5.783  -1.887  -2.902 1.00 . A A .  57 PHE CZ   1 1 
        2  2683 1 1  57 PHE H    H  -0.606  -1.812  -3.324 1.00 . A A .  57 PHE H    1 1 
        2  2684 1 1  57 PHE HA   H  -1.417  -3.393  -1.015 1.00 . A A .  57 PHE HA   1 1 
        2  2685 1 1  57 PHE HB2  H  -1.608  -3.886  -4.019 1.00 . A A .  57 PHE HB2  1 1 
        2  2686 1 1  57 PHE HB3  H  -2.200  -5.020  -2.812 1.00 . A A .  57 PHE HB3  1 1 
        2  2687 1 1  57 PHE HD1  H  -2.724  -1.649  -4.297 1.00 . A A .  57 PHE HD1  1 1 
        2  2688 1 1  57 PHE HD2  H  -4.282  -4.646  -1.665 1.00 . A A .  57 PHE HD2  1 1 
        2  2689 1 1  57 PHE HE1  H  -4.883  -0.466  -4.219 1.00 . A A .  57 PHE HE1  1 1 
        2  2690 1 1  57 PHE HE2  H  -6.425  -3.450  -1.595 1.00 . A A .  57 PHE HE2  1 1 
        2  2691 1 1  57 PHE HZ   H  -6.733  -1.365  -2.867 1.00 . A A .  57 PHE HZ   1 1 
        2  2692 1 1  57 PHE N    N  -0.527  -2.085  -2.383 1.00 . A A .  57 PHE N    1 1 
        2  2693 1 1  57 PHE O    O   0.826  -4.694  -3.017 1.00 . A A .  57 PHE O    1 1 
        2  2694 1 1  58 VAL C    C   1.218  -7.161  -0.640 1.00 . A A .  58 VAL C    1 1 
        2  2695 1 1  58 VAL CA   C   1.777  -5.728  -0.583 1.00 . A A .  58 VAL CA   1 1 
        2  2696 1 1  58 VAL CB   C   2.635  -5.482   0.724 1.00 . A A .  58 VAL CB   1 1 
        2  2697 1 1  58 VAL CG1  C   3.470  -4.190   0.595 1.00 . A A .  58 VAL CG1  1 1 
        2  2698 1 1  58 VAL CG2  C   1.777  -5.445   2.005 1.00 . A A .  58 VAL CG2  1 1 
        2  2699 1 1  58 VAL H    H   0.235  -4.407   0.044 1.00 . A A .  58 VAL H    1 1 
        2  2700 1 1  58 VAL HA   H   2.452  -5.600  -1.436 1.00 . A A .  58 VAL HA   1 1 
        2  2701 1 1  58 VAL HB   H   3.336  -6.309   0.818 1.00 . A A .  58 VAL HB   1 1 
        2  2702 1 1  58 VAL HG11 H   4.126  -4.267  -0.262 1.00 . A A .  58 VAL HG11 1 1 
        2  2703 1 1  58 VAL HG12 H   4.069  -4.046   1.486 1.00 . A A .  58 VAL HG12 1 1 
        2  2704 1 1  58 VAL HG13 H   2.812  -3.339   0.464 1.00 . A A .  58 VAL HG13 1 1 
        2  2705 1 1  58 VAL HG21 H   2.412  -5.290   2.870 1.00 . A A .  58 VAL HG21 1 1 
        2  2706 1 1  58 VAL HG22 H   1.252  -6.385   2.116 1.00 . A A .  58 VAL HG22 1 1 
        2  2707 1 1  58 VAL HG23 H   1.055  -4.641   1.943 1.00 . A A .  58 VAL HG23 1 1 
        2  2708 1 1  58 VAL N    N   0.680  -4.765  -0.752 1.00 . A A .  58 VAL N    1 1 
        2  2709 1 1  58 VAL O    O   0.484  -7.600   0.255 1.00 . A A .  58 VAL O    1 1 
        2  2710 1 1  59 ASN C    C   1.937 -10.196  -1.060 1.00 . A A .  59 ASN C    1 1 
        2  2711 1 1  59 ASN CA   C   1.137  -9.261  -1.971 1.00 . A A .  59 ASN CA   1 1 
        2  2712 1 1  59 ASN CB   C   1.296  -9.647  -3.469 1.00 . A A .  59 ASN CB   1 1 
        2  2713 1 1  59 ASN CG   C   0.288  -8.929  -4.367 1.00 . A A .  59 ASN CG   1 1 
        2  2714 1 1  59 ASN H    H   2.042  -7.409  -2.449 1.00 . A A .  59 ASN H    1 1 
        2  2715 1 1  59 ASN HA   H   0.090  -9.350  -1.705 1.00 . A A .  59 ASN HA   1 1 
        2  2716 1 1  59 ASN HB2  H   2.295  -9.385  -3.798 1.00 . A A .  59 ASN HB2  1 1 
        2  2717 1 1  59 ASN HB3  H   1.161 -10.718  -3.582 1.00 . A A .  59 ASN HB3  1 1 
        2  2718 1 1  59 ASN HD21 H  -1.023 -10.401  -4.130 1.00 . A A .  59 ASN HD21 1 1 
        2  2719 1 1  59 ASN HD22 H  -1.533  -9.102  -5.139 1.00 . A A .  59 ASN HD22 1 1 
        2  2720 1 1  59 ASN N    N   1.531  -7.861  -1.747 1.00 . A A .  59 ASN N    1 1 
        2  2721 1 1  59 ASN ND2  N  -0.873  -9.535  -4.566 1.00 . A A .  59 ASN ND2  1 1 
        2  2722 1 1  59 ASN O    O   2.974 -10.747  -1.462 1.00 . A A .  59 ASN O    1 1 
        2  2723 1 1  59 ASN OD1  O   0.545  -7.840  -4.871 1.00 . A A .  59 ASN OD1  1 1 
        2  2724 1 1  60 GLY C    C   3.529 -10.913   1.439 1.00 . A A .  60 GLY C    1 1 
        2  2725 1 1  60 GLY CA   C   2.044 -11.168   1.221 1.00 . A A .  60 GLY CA   1 1 
        2  2726 1 1  60 GLY H    H   0.666  -9.775   0.437 1.00 . A A .  60 GLY H    1 1 
        2  2727 1 1  60 GLY HA2  H   1.528 -10.991   2.156 1.00 . A A .  60 GLY HA2  1 1 
        2  2728 1 1  60 GLY HA3  H   1.895 -12.202   0.935 1.00 . A A .  60 GLY HA3  1 1 
        2  2729 1 1  60 GLY N    N   1.451 -10.306   0.199 1.00 . A A .  60 GLY N    1 1 
        2  2730 1 1  60 GLY O    O   4.305 -11.861   1.622 1.00 . A A .  60 GLY O    1 1 
        2  2731 1 1  61 ALA C    C   5.759  -9.511   3.003 1.00 . A A .  61 ALA C    1 1 
        2  2732 1 1  61 ALA CA   C   5.323  -9.209   1.567 1.00 . A A .  61 ALA CA   1 1 
        2  2733 1 1  61 ALA CB   C   5.517  -7.722   1.231 1.00 . A A .  61 ALA CB   1 1 
        2  2734 1 1  61 ALA H    H   3.253  -8.935   1.189 1.00 . A A .  61 ALA H    1 1 
        2  2735 1 1  61 ALA HA   H   5.932  -9.791   0.876 1.00 . A A .  61 ALA HA   1 1 
        2  2736 1 1  61 ALA HB1  H   5.216  -7.539   0.208 1.00 . A A .  61 ALA HB1  1 1 
        2  2737 1 1  61 ALA HB2  H   6.559  -7.450   1.351 1.00 . A A .  61 ALA HB2  1 1 
        2  2738 1 1  61 ALA HB3  H   4.910  -7.114   1.891 1.00 . A A .  61 ALA HB3  1 1 
        2  2739 1 1  61 ALA N    N   3.925  -9.623   1.373 1.00 . A A .  61 ALA N    1 1 
        2  2740 1 1  61 ALA O    O   4.998  -9.253   3.948 1.00 . A A .  61 ALA O    1 1 
        2  2741 1 1  62 SER C    C   7.646  -9.341   5.421 1.00 . A A .  62 SER C    1 1 
        2  2742 1 1  62 SER CA   C   7.519 -10.521   4.433 1.00 . A A .  62 SER CA   1 1 
        2  2743 1 1  62 SER CB   C   8.889 -11.198   4.196 1.00 . A A .  62 SER CB   1 1 
        2  2744 1 1  62 SER H    H   7.524 -10.183   2.344 1.00 . A A .  62 SER H    1 1 
        2  2745 1 1  62 SER HA   H   6.829 -11.251   4.844 1.00 . A A .  62 SER HA   1 1 
        2  2746 1 1  62 SER HB2  H   8.806 -11.913   3.388 1.00 . A A .  62 SER HB2  1 1 
        2  2747 1 1  62 SER HB3  H   9.621 -10.449   3.926 1.00 . A A .  62 SER HB3  1 1 
        2  2748 1 1  62 SER HG   H  10.284 -12.090   5.235 1.00 . A A .  62 SER HG   1 1 
        2  2749 1 1  62 SER N    N   6.972 -10.071   3.144 1.00 . A A .  62 SER N    1 1 
        2  2750 1 1  62 SER O    O   7.752  -8.182   4.996 1.00 . A A .  62 SER O    1 1 
        2  2751 1 1  62 SER OG   O   9.350 -11.882   5.345 1.00 . A A .  62 SER OG   1 1 
        2  2752 1 1  63 GLN C    C   8.832  -7.678   7.711 1.00 . A A .  63 GLN C    1 1 
        2  2753 1 1  63 GLN CA   C   7.644  -8.660   7.818 1.00 . A A .  63 GLN CA   1 1 
        2  2754 1 1  63 GLN CB   C   7.644  -9.376   9.199 1.00 . A A .  63 GLN CB   1 1 
        2  2755 1 1  63 GLN CD   C   6.463  -7.496  10.526 1.00 . A A .  63 GLN CD   1 1 
        2  2756 1 1  63 GLN CG   C   7.667  -8.439  10.427 1.00 . A A .  63 GLN CG   1 1 
        2  2757 1 1  63 GLN H    H   7.694 -10.610   6.970 1.00 . A A .  63 GLN H    1 1 
        2  2758 1 1  63 GLN HA   H   6.717  -8.101   7.721 1.00 . A A .  63 GLN HA   1 1 
        2  2759 1 1  63 GLN HB2  H   6.756  -9.998   9.268 1.00 . A A .  63 GLN HB2  1 1 
        2  2760 1 1  63 GLN HB3  H   8.513 -10.025   9.251 1.00 . A A .  63 GLN HB3  1 1 
        2  2761 1 1  63 GLN HE21 H   7.586  -6.134  11.419 1.00 . A A .  63 GLN HE21 1 1 
        2  2762 1 1  63 GLN HE22 H   5.936  -5.707  11.178 1.00 . A A .  63 GLN HE22 1 1 
        2  2763 1 1  63 GLN HG2  H   7.697  -9.041  11.327 1.00 . A A .  63 GLN HG2  1 1 
        2  2764 1 1  63 GLN HG3  H   8.570  -7.838  10.379 1.00 . A A .  63 GLN HG3  1 1 
        2  2765 1 1  63 GLN N    N   7.658  -9.661   6.730 1.00 . A A .  63 GLN N    1 1 
        2  2766 1 1  63 GLN NE2  N   6.682  -6.331  11.098 1.00 . A A .  63 GLN NE2  1 1 
        2  2767 1 1  63 GLN O    O   8.671  -6.487   7.968 1.00 . A A .  63 GLN O    1 1 
        2  2768 1 1  63 GLN OE1  O   5.347  -7.810  10.102 1.00 . A A .  63 GLN OE1  1 1 
        2  2769 1 1  64 ASN C    C  10.965  -6.317   5.999 1.00 . A A .  64 ASN C    1 1 
        2  2770 1 1  64 ASN CA   C  11.226  -7.410   7.051 1.00 . A A .  64 ASN CA   1 1 
        2  2771 1 1  64 ASN CB   C  12.385  -8.325   6.563 1.00 . A A .  64 ASN CB   1 1 
        2  2772 1 1  64 ASN CG   C  13.701  -7.564   6.335 1.00 . A A .  64 ASN CG   1 1 
        2  2773 1 1  64 ASN H    H  10.037  -9.175   7.125 1.00 . A A .  64 ASN H    1 1 
        2  2774 1 1  64 ASN HA   H  11.510  -6.945   7.990 1.00 . A A .  64 ASN HA   1 1 
        2  2775 1 1  64 ASN HB2  H  12.571  -9.093   7.307 1.00 . A A .  64 ASN HB2  1 1 
        2  2776 1 1  64 ASN HB3  H  12.090  -8.808   5.631 1.00 . A A .  64 ASN HB3  1 1 
        2  2777 1 1  64 ASN HD21 H  14.153  -8.722   4.789 1.00 . A A .  64 ASN HD21 1 1 
        2  2778 1 1  64 ASN HD22 H  15.288  -7.478   5.166 1.00 . A A .  64 ASN HD22 1 1 
        2  2779 1 1  64 ASN N    N  10.003  -8.206   7.288 1.00 . A A .  64 ASN N    1 1 
        2  2780 1 1  64 ASN ND2  N  14.459  -7.963   5.333 1.00 . A A .  64 ASN ND2  1 1 
        2  2781 1 1  64 ASN O    O  11.291  -5.155   6.210 1.00 . A A .  64 ASN O    1 1 
        2  2782 1 1  64 ASN OD1  O  14.023  -6.614   7.053 1.00 . A A .  64 ASN OD1  1 1 
        2  2783 1 1  65 ASP C    C   9.071  -4.771   4.051 1.00 . A A .  65 ASP C    1 1 
        2  2784 1 1  65 ASP CA   C  10.061  -5.895   3.707 1.00 . A A .  65 ASP CA   1 1 
        2  2785 1 1  65 ASP CB   C   9.474  -6.767   2.557 1.00 . A A .  65 ASP CB   1 1 
        2  2786 1 1  65 ASP CG   C  10.323  -8.009   2.200 1.00 . A A .  65 ASP CG   1 1 
        2  2787 1 1  65 ASP H    H  10.019  -7.671   4.874 1.00 . A A .  65 ASP H    1 1 
        2  2788 1 1  65 ASP HA   H  11.004  -5.459   3.389 1.00 . A A .  65 ASP HA   1 1 
        2  2789 1 1  65 ASP HB2  H   8.485  -7.113   2.843 1.00 . A A .  65 ASP HB2  1 1 
        2  2790 1 1  65 ASP HB3  H   9.375  -6.144   1.672 1.00 . A A .  65 ASP HB3  1 1 
        2  2791 1 1  65 ASP N    N  10.328  -6.734   4.897 1.00 . A A .  65 ASP N    1 1 
        2  2792 1 1  65 ASP O    O   9.216  -3.628   3.605 1.00 . A A .  65 ASP O    1 1 
        2  2793 1 1  65 ASP OD1  O  10.767  -8.729   3.113 1.00 . A A .  65 ASP OD1  1 1 
        2  2794 1 1  65 ASP OD2  O  10.540  -8.289   1.014 1.00 . A A .  65 ASP OD2  1 1 
        2  2795 1 1  66 VAL C    C   7.759  -3.170   6.320 1.00 . A A .  66 VAL C    1 1 
        2  2796 1 1  66 VAL CA   C   7.067  -4.203   5.407 1.00 . A A .  66 VAL CA   1 1 
        2  2797 1 1  66 VAL CB   C   5.943  -4.978   6.203 1.00 . A A .  66 VAL CB   1 1 
        2  2798 1 1  66 VAL CG1  C   4.985  -4.014   6.941 1.00 . A A .  66 VAL CG1  1 1 
        2  2799 1 1  66 VAL CG2  C   5.158  -5.923   5.258 1.00 . A A .  66 VAL CG2  1 1 
        2  2800 1 1  66 VAL H    H   7.977  -6.088   5.088 1.00 . A A .  66 VAL H    1 1 
        2  2801 1 1  66 VAL HA   H   6.598  -3.689   4.570 1.00 . A A .  66 VAL HA   1 1 
        2  2802 1 1  66 VAL HB   H   6.434  -5.593   6.954 1.00 . A A .  66 VAL HB   1 1 
        2  2803 1 1  66 VAL HG11 H   5.543  -3.409   7.648 1.00 . A A .  66 VAL HG11 1 1 
        2  2804 1 1  66 VAL HG12 H   4.234  -4.579   7.476 1.00 . A A .  66 VAL HG12 1 1 
        2  2805 1 1  66 VAL HG13 H   4.497  -3.363   6.226 1.00 . A A .  66 VAL HG13 1 1 
        2  2806 1 1  66 VAL HG21 H   4.420  -6.483   5.822 1.00 . A A .  66 VAL HG21 1 1 
        2  2807 1 1  66 VAL HG22 H   5.844  -6.618   4.786 1.00 . A A .  66 VAL HG22 1 1 
        2  2808 1 1  66 VAL HG23 H   4.659  -5.343   4.494 1.00 . A A .  66 VAL HG23 1 1 
        2  2809 1 1  66 VAL N    N   8.059  -5.138   4.856 1.00 . A A .  66 VAL N    1 1 
        2  2810 1 1  66 VAL O    O   7.486  -1.971   6.231 1.00 . A A .  66 VAL O    1 1 
        2  2811 1 1  67 ASN C    C  10.451  -1.891   7.284 1.00 . A A .  67 ASN C    1 1 
        2  2812 1 1  67 ASN CA   C   9.492  -2.797   8.074 1.00 . A A .  67 ASN CA   1 1 
        2  2813 1 1  67 ASN CB   C  10.295  -3.640   9.108 1.00 . A A .  67 ASN CB   1 1 
        2  2814 1 1  67 ASN CG   C   9.408  -4.401  10.096 1.00 . A A .  67 ASN CG   1 1 
        2  2815 1 1  67 ASN H    H   8.855  -4.625   7.169 1.00 . A A .  67 ASN H    1 1 
        2  2816 1 1  67 ASN HA   H   8.789  -2.166   8.614 1.00 . A A .  67 ASN HA   1 1 
        2  2817 1 1  67 ASN HB2  H  10.919  -4.359   8.579 1.00 . A A .  67 ASN HB2  1 1 
        2  2818 1 1  67 ASN HB3  H  10.942  -2.984   9.683 1.00 . A A .  67 ASN HB3  1 1 
        2  2819 1 1  67 ASN HD21 H  10.783  -5.816  10.284 1.00 . A A .  67 ASN HD21 1 1 
        2  2820 1 1  67 ASN HD22 H   9.348  -6.035  11.211 1.00 . A A .  67 ASN HD22 1 1 
        2  2821 1 1  67 ASN N    N   8.696  -3.656   7.163 1.00 . A A .  67 ASN N    1 1 
        2  2822 1 1  67 ASN ND2  N   9.892  -5.529  10.580 1.00 . A A .  67 ASN ND2  1 1 
        2  2823 1 1  67 ASN O    O  10.757  -0.789   7.720 1.00 . A A .  67 ASN O    1 1 
        2  2824 1 1  67 ASN OD1  O   8.299  -3.972  10.427 1.00 . A A .  67 ASN OD1  1 1 
        2  2825 1 1  68 GLU C    C  10.930  -0.427   4.598 1.00 . A A .  68 GLU C    1 1 
        2  2826 1 1  68 GLU CA   C  11.745  -1.578   5.193 1.00 . A A .  68 GLU CA   1 1 
        2  2827 1 1  68 GLU CB   C  12.340  -2.464   4.060 1.00 . A A .  68 GLU CB   1 1 
        2  2828 1 1  68 GLU CD   C  14.006  -4.321   3.413 1.00 . A A .  68 GLU CD   1 1 
        2  2829 1 1  68 GLU CG   C  13.392  -3.479   4.544 1.00 . A A .  68 GLU CG   1 1 
        2  2830 1 1  68 GLU H    H  10.650  -3.283   5.846 1.00 . A A .  68 GLU H    1 1 
        2  2831 1 1  68 GLU HA   H  12.562  -1.155   5.776 1.00 . A A .  68 GLU HA   1 1 
        2  2832 1 1  68 GLU HB2  H  11.532  -3.013   3.586 1.00 . A A .  68 GLU HB2  1 1 
        2  2833 1 1  68 GLU HB3  H  12.806  -1.825   3.317 1.00 . A A .  68 GLU HB3  1 1 
        2  2834 1 1  68 GLU HG2  H  14.189  -2.937   5.038 1.00 . A A .  68 GLU HG2  1 1 
        2  2835 1 1  68 GLU HG3  H  12.929  -4.139   5.266 1.00 . A A .  68 GLU HG3  1 1 
        2  2836 1 1  68 GLU N    N  10.904  -2.371   6.110 1.00 . A A .  68 GLU N    1 1 
        2  2837 1 1  68 GLU O    O  11.450   0.663   4.396 1.00 . A A .  68 GLU O    1 1 
        2  2838 1 1  68 GLU OE1  O  14.738  -3.748   2.569 1.00 . A A .  68 GLU OE1  1 1 
        2  2839 1 1  68 GLU OE2  O  13.794  -5.554   3.373 1.00 . A A .  68 GLU OE2  1 1 
        2  2840 1 1  69 PHE C    C   8.486   1.432   4.837 1.00 . A A .  69 PHE C    1 1 
        2  2841 1 1  69 PHE CA   C   8.711   0.318   3.801 1.00 . A A .  69 PHE CA   1 1 
        2  2842 1 1  69 PHE CB   C   7.361  -0.324   3.381 1.00 . A A .  69 PHE CB   1 1 
        2  2843 1 1  69 PHE CD1  C   6.684   0.563   1.094 1.00 . A A .  69 PHE CD1  1 1 
        2  2844 1 1  69 PHE CD2  C   5.543   1.426   3.016 1.00 . A A .  69 PHE CD2  1 1 
        2  2845 1 1  69 PHE CE1  C   5.924   1.371   0.276 1.00 . A A .  69 PHE CE1  1 1 
        2  2846 1 1  69 PHE CE2  C   4.786   2.233   2.194 1.00 . A A .  69 PHE CE2  1 1 
        2  2847 1 1  69 PHE CG   C   6.509   0.571   2.482 1.00 . A A .  69 PHE CG   1 1 
        2  2848 1 1  69 PHE CZ   C   4.976   2.205   0.826 1.00 . A A .  69 PHE CZ   1 1 
        2  2849 1 1  69 PHE H    H   9.299  -1.603   4.494 1.00 . A A .  69 PHE H    1 1 
        2  2850 1 1  69 PHE HA   H   9.185   0.747   2.923 1.00 . A A .  69 PHE HA   1 1 
        2  2851 1 1  69 PHE HB2  H   7.562  -1.244   2.841 1.00 . A A .  69 PHE HB2  1 1 
        2  2852 1 1  69 PHE HB3  H   6.784  -0.568   4.267 1.00 . A A .  69 PHE HB3  1 1 
        2  2853 1 1  69 PHE HD1  H   7.427  -0.093   0.656 1.00 . A A .  69 PHE HD1  1 1 
        2  2854 1 1  69 PHE HD2  H   5.385   1.455   4.084 1.00 . A A .  69 PHE HD2  1 1 
        2  2855 1 1  69 PHE HE1  H   6.070   1.353  -0.801 1.00 . A A .  69 PHE HE1  1 1 
        2  2856 1 1  69 PHE HE2  H   4.037   2.893   2.622 1.00 . A A .  69 PHE HE2  1 1 
        2  2857 1 1  69 PHE HZ   H   4.378   2.845   0.183 1.00 . A A .  69 PHE HZ   1 1 
        2  2858 1 1  69 PHE N    N   9.635  -0.694   4.333 1.00 . A A .  69 PHE N    1 1 
        2  2859 1 1  69 PHE O    O   8.640   2.615   4.530 1.00 . A A .  69 PHE O    1 1 
        2  2860 1 1  70 GLN C    C   9.057   2.769   7.582 1.00 . A A .  70 GLN C    1 1 
        2  2861 1 1  70 GLN CA   C   7.837   1.915   7.180 1.00 . A A .  70 GLN CA   1 1 
        2  2862 1 1  70 GLN CB   C   7.320   1.081   8.386 1.00 . A A .  70 GLN CB   1 1 
        2  2863 1 1  70 GLN CD   C   5.690  -0.714   9.189 1.00 . A A .  70 GLN CD   1 1 
        2  2864 1 1  70 GLN CG   C   6.069   0.240   8.064 1.00 . A A .  70 GLN CG   1 1 
        2  2865 1 1  70 GLN H    H   8.152   0.046   6.240 1.00 . A A .  70 GLN H    1 1 
        2  2866 1 1  70 GLN HA   H   7.039   2.576   6.846 1.00 . A A .  70 GLN HA   1 1 
        2  2867 1 1  70 GLN HB2  H   8.111   0.409   8.708 1.00 . A A .  70 GLN HB2  1 1 
        2  2868 1 1  70 GLN HB3  H   7.079   1.751   9.205 1.00 . A A .  70 GLN HB3  1 1 
        2  2869 1 1  70 GLN HE21 H   4.433   0.603   9.984 1.00 . A A .  70 GLN HE21 1 1 
        2  2870 1 1  70 GLN HE22 H   4.552  -0.912  10.801 1.00 . A A .  70 GLN HE22 1 1 
        2  2871 1 1  70 GLN HG2  H   5.233   0.908   7.872 1.00 . A A .  70 GLN HG2  1 1 
        2  2872 1 1  70 GLN HG3  H   6.261  -0.342   7.170 1.00 . A A .  70 GLN HG3  1 1 
        2  2873 1 1  70 GLN N    N   8.164   1.011   6.070 1.00 . A A .  70 GLN N    1 1 
        2  2874 1 1  70 GLN NE2  N   4.806  -0.300  10.081 1.00 . A A .  70 GLN NE2  1 1 
        2  2875 1 1  70 GLN O    O   8.998   4.007   7.561 1.00 . A A .  70 GLN O    1 1 
        2  2876 1 1  70 GLN OE1  O   6.202  -1.829   9.256 1.00 . A A .  70 GLN OE1  1 1 
        2  2877 1 1  71 ASN C    C  12.040   3.644   7.325 1.00 . A A .  71 ASN C    1 1 
        2  2878 1 1  71 ASN CA   C  11.406   2.726   8.383 1.00 . A A .  71 ASN CA   1 1 
        2  2879 1 1  71 ASN CB   C  12.416   1.659   8.904 1.00 . A A .  71 ASN CB   1 1 
        2  2880 1 1  71 ASN CG   C  12.068   1.155  10.314 1.00 . A A .  71 ASN CG   1 1 
        2  2881 1 1  71 ASN H    H  10.172   1.119   7.759 1.00 . A A .  71 ASN H    1 1 
        2  2882 1 1  71 ASN HA   H  11.112   3.350   9.229 1.00 . A A .  71 ASN HA   1 1 
        2  2883 1 1  71 ASN HB2  H  12.423   0.810   8.229 1.00 . A A .  71 ASN HB2  1 1 
        2  2884 1 1  71 ASN HB3  H  13.415   2.081   8.932 1.00 . A A .  71 ASN HB3  1 1 
        2  2885 1 1  71 ASN HD21 H  10.864  -0.247   9.602 1.00 . A A .  71 ASN HD21 1 1 
        2  2886 1 1  71 ASN HD22 H  10.998  -0.194  11.310 1.00 . A A .  71 ASN HD22 1 1 
        2  2887 1 1  71 ASN N    N  10.175   2.086   7.885 1.00 . A A .  71 ASN N    1 1 
        2  2888 1 1  71 ASN ND2  N  11.224   0.136  10.417 1.00 . A A .  71 ASN ND2  1 1 
        2  2889 1 1  71 ASN O    O  12.372   4.789   7.644 1.00 . A A .  71 ASN O    1 1 
        2  2890 1 1  71 ASN OD1  O  12.542   1.700  11.313 1.00 . A A .  71 ASN OD1  1 1 
        2  2891 1 1  72 GLU C    C  11.893   5.230   4.685 1.00 . A A .  72 GLU C    1 1 
        2  2892 1 1  72 GLU CA   C  12.765   4.013   4.994 1.00 . A A .  72 GLU CA   1 1 
        2  2893 1 1  72 GLU CB   C  13.062   3.214   3.699 1.00 . A A .  72 GLU CB   1 1 
        2  2894 1 1  72 GLU CD   C  15.580   2.982   4.162 1.00 . A A .  72 GLU CD   1 1 
        2  2895 1 1  72 GLU CG   C  14.262   2.258   3.814 1.00 . A A .  72 GLU CG   1 1 
        2  2896 1 1  72 GLU H    H  11.865   2.264   5.851 1.00 . A A .  72 GLU H    1 1 
        2  2897 1 1  72 GLU HA   H  13.716   4.383   5.384 1.00 . A A .  72 GLU HA   1 1 
        2  2898 1 1  72 GLU HB2  H  12.185   2.629   3.433 1.00 . A A .  72 GLU HB2  1 1 
        2  2899 1 1  72 GLU HB3  H  13.266   3.906   2.890 1.00 . A A .  72 GLU HB3  1 1 
        2  2900 1 1  72 GLU HG2  H  14.040   1.525   4.582 1.00 . A A .  72 GLU HG2  1 1 
        2  2901 1 1  72 GLU HG3  H  14.387   1.740   2.867 1.00 . A A .  72 GLU HG3  1 1 
        2  2902 1 1  72 GLU N    N  12.173   3.175   6.064 1.00 . A A .  72 GLU N    1 1 
        2  2903 1 1  72 GLU O    O  12.428   6.322   4.532 1.00 . A A .  72 GLU O    1 1 
        2  2904 1 1  72 GLU OE1  O  16.175   3.621   3.275 1.00 . A A .  72 GLU OE1  1 1 
        2  2905 1 1  72 GLU OE2  O  16.037   2.905   5.321 1.00 . A A .  72 GLU OE2  1 1 
        2  2906 1 1  73 ALA C    C   9.800   7.305   5.369 1.00 . A A .  73 ALA C    1 1 
        2  2907 1 1  73 ALA CA   C   9.622   6.153   4.353 1.00 . A A .  73 ALA CA   1 1 
        2  2908 1 1  73 ALA CB   C   8.168   5.655   4.334 1.00 . A A .  73 ALA CB   1 1 
        2  2909 1 1  73 ALA H    H  10.188   4.148   4.804 1.00 . A A .  73 ALA H    1 1 
        2  2910 1 1  73 ALA HA   H   9.852   6.527   3.357 1.00 . A A .  73 ALA HA   1 1 
        2  2911 1 1  73 ALA HB1  H   7.501   6.471   4.076 1.00 . A A .  73 ALA HB1  1 1 
        2  2912 1 1  73 ALA HB2  H   7.902   5.266   5.313 1.00 . A A .  73 ALA HB2  1 1 
        2  2913 1 1  73 ALA HB3  H   8.058   4.868   3.602 1.00 . A A .  73 ALA HB3  1 1 
        2  2914 1 1  73 ALA N    N  10.554   5.048   4.640 1.00 . A A .  73 ALA N    1 1 
        2  2915 1 1  73 ALA O    O  10.117   8.435   4.973 1.00 . A A .  73 ALA O    1 1 
        2  2916 1 1  74 LYS C    C  11.194   8.629   7.805 1.00 . A A .  74 LYS C    1 1 
        2  2917 1 1  74 LYS CA   C   9.773   8.003   7.763 1.00 . A A .  74 LYS CA   1 1 
        2  2918 1 1  74 LYS CB   C   9.345   7.395   9.148 1.00 . A A .  74 LYS CB   1 1 
        2  2919 1 1  74 LYS CD   C  11.454   6.753  10.541 1.00 . A A .  74 LYS CD   1 1 
        2  2920 1 1  74 LYS CE   C  12.526   5.675  10.762 1.00 . A A .  74 LYS CE   1 1 
        2  2921 1 1  74 LYS CG   C  10.238   6.249   9.713 1.00 . A A .  74 LYS CG   1 1 
        2  2922 1 1  74 LYS H    H   9.473   6.053   6.923 1.00 . A A .  74 LYS H    1 1 
        2  2923 1 1  74 LYS HA   H   9.075   8.796   7.515 1.00 . A A .  74 LYS HA   1 1 
        2  2924 1 1  74 LYS HB2  H   9.314   8.191   9.884 1.00 . A A .  74 LYS HB2  1 1 
        2  2925 1 1  74 LYS HB3  H   8.334   7.005   9.040 1.00 . A A .  74 LYS HB3  1 1 
        2  2926 1 1  74 LYS HD2  H  11.912   7.590  10.023 1.00 . A A .  74 LYS HD2  1 1 
        2  2927 1 1  74 LYS HD3  H  11.098   7.098  11.507 1.00 . A A .  74 LYS HD3  1 1 
        2  2928 1 1  74 LYS HE2  H  12.858   5.310   9.802 1.00 . A A .  74 LYS HE2  1 1 
        2  2929 1 1  74 LYS HE3  H  13.366   6.123  11.276 1.00 . A A .  74 LYS HE3  1 1 
        2  2930 1 1  74 LYS HG2  H   9.633   5.612  10.347 1.00 . A A .  74 LYS HG2  1 1 
        2  2931 1 1  74 LYS HG3  H  10.602   5.660   8.875 1.00 . A A .  74 LYS HG3  1 1 
        2  2932 1 1  74 LYS HZ1  H  11.814   4.834  12.528 1.00 . A A .  74 LYS HZ1  1 1 
        2  2933 1 1  74 LYS HZ2  H  12.774   3.789  11.614 1.00 . A A .  74 LYS HZ2  1 1 
        2  2934 1 1  74 LYS HZ3  H  11.185   4.119  11.133 1.00 . A A .  74 LYS HZ3  1 1 
        2  2935 1 1  74 LYS N    N   9.660   6.990   6.681 1.00 . A A .  74 LYS N    1 1 
        2  2936 1 1  74 LYS NZ   N  12.037   4.524  11.563 1.00 . A A .  74 LYS NZ   1 1 
        2  2937 1 1  74 LYS O    O  11.355   9.802   8.149 1.00 . A A .  74 LYS O    1 1 
        2  2938 1 1  75 LYS C    C  13.853   9.213   6.162 1.00 . A A .  75 LYS C    1 1 
        2  2939 1 1  75 LYS CA   C  13.616   8.271   7.364 1.00 . A A .  75 LYS CA   1 1 
        2  2940 1 1  75 LYS CB   C  14.543   6.996   7.353 1.00 . A A .  75 LYS CB   1 1 
        2  2941 1 1  75 LYS CD   C  16.848   6.008   6.738 1.00 . A A .  75 LYS CD   1 1 
        2  2942 1 1  75 LYS CE   C  18.049   6.106   5.797 1.00 . A A .  75 LYS CE   1 1 
        2  2943 1 1  75 LYS CG   C  15.739   7.030   6.388 1.00 . A A .  75 LYS CG   1 1 
        2  2944 1 1  75 LYS H    H  12.019   6.913   7.139 1.00 . A A .  75 LYS H    1 1 
        2  2945 1 1  75 LYS HA   H  13.825   8.839   8.273 1.00 . A A .  75 LYS HA   1 1 
        2  2946 1 1  75 LYS HB2  H  14.924   6.846   8.359 1.00 . A A .  75 LYS HB2  1 1 
        2  2947 1 1  75 LYS HB3  H  13.939   6.126   7.100 1.00 . A A .  75 LYS HB3  1 1 
        2  2948 1 1  75 LYS HD2  H  17.185   6.187   7.756 1.00 . A A .  75 LYS HD2  1 1 
        2  2949 1 1  75 LYS HD3  H  16.434   5.005   6.675 1.00 . A A .  75 LYS HD3  1 1 
        2  2950 1 1  75 LYS HE2  H  18.409   7.130   5.789 1.00 . A A .  75 LYS HE2  1 1 
        2  2951 1 1  75 LYS HE3  H  18.837   5.457   6.153 1.00 . A A .  75 LYS HE3  1 1 
        2  2952 1 1  75 LYS HG2  H  15.372   6.820   5.387 1.00 . A A .  75 LYS HG2  1 1 
        2  2953 1 1  75 LYS HG3  H  16.156   8.026   6.401 1.00 . A A .  75 LYS HG3  1 1 
        2  2954 1 1  75 LYS HZ1  H  17.373   4.728   4.391 1.00 . A A .  75 LYS HZ1  1 1 
        2  2955 1 1  75 LYS HZ2  H  18.530   5.802   3.790 1.00 . A A .  75 LYS HZ2  1 1 
        2  2956 1 1  75 LYS HZ3  H  16.936   6.311   4.051 1.00 . A A .  75 LYS HZ3  1 1 
        2  2957 1 1  75 LYS N    N  12.213   7.833   7.417 1.00 . A A .  75 LYS N    1 1 
        2  2958 1 1  75 LYS NZ   N  17.701   5.712   4.412 1.00 . A A .  75 LYS NZ   1 1 
        2  2959 1 1  75 LYS O    O  14.723  10.089   6.207 1.00 . A A .  75 LYS O    1 1 
        2  2960 1 1  76 GLU C    C  12.117  11.037   3.914 1.00 . A A .  76 GLU C    1 1 
        2  2961 1 1  76 GLU CA   C  13.124   9.868   3.890 1.00 . A A .  76 GLU CA   1 1 
        2  2962 1 1  76 GLU CB   C  12.895   8.963   2.650 1.00 . A A .  76 GLU CB   1 1 
        2  2963 1 1  76 GLU CD   C  15.434   8.473   2.402 1.00 . A A .  76 GLU CD   1 1 
        2  2964 1 1  76 GLU CG   C  14.002   7.904   2.400 1.00 . A A .  76 GLU CG   1 1 
        2  2965 1 1  76 GLU H    H  12.359   8.345   5.152 1.00 . A A .  76 GLU H    1 1 
        2  2966 1 1  76 GLU HA   H  14.125  10.292   3.827 1.00 . A A .  76 GLU HA   1 1 
        2  2967 1 1  76 GLU HB2  H  11.949   8.438   2.770 1.00 . A A .  76 GLU HB2  1 1 
        2  2968 1 1  76 GLU HB3  H  12.828   9.587   1.775 1.00 . A A .  76 GLU HB3  1 1 
        2  2969 1 1  76 GLU HG2  H  13.925   7.143   3.168 1.00 . A A .  76 GLU HG2  1 1 
        2  2970 1 1  76 GLU HG3  H  13.822   7.441   1.437 1.00 . A A .  76 GLU HG3  1 1 
        2  2971 1 1  76 GLU N    N  13.043   9.049   5.111 1.00 . A A .  76 GLU N    1 1 
        2  2972 1 1  76 GLU O    O  11.972  11.758   2.912 1.00 . A A .  76 GLU O    1 1 
        2  2973 1 1  76 GLU OE1  O  15.692   9.473   1.709 1.00 . A A .  76 GLU OE1  1 1 
        2  2974 1 1  76 GLU OE2  O  16.312   7.906   3.071 1.00 . A A .  76 GLU OE2  1 1 
        2  2975 1 1  77 GLY C    C   9.072  11.972   4.623 1.00 . A A .  77 GLY C    1 1 
        2  2976 1 1  77 GLY CA   C  10.436  12.293   5.240 1.00 . A A .  77 GLY CA   1 1 
        2  2977 1 1  77 GLY H    H  11.579  10.598   5.802 1.00 . A A .  77 GLY H    1 1 
        2  2978 1 1  77 GLY HA2  H  10.302  12.460   6.299 1.00 . A A .  77 GLY HA2  1 1 
        2  2979 1 1  77 GLY HA3  H  10.815  13.207   4.794 1.00 . A A .  77 GLY HA3  1 1 
        2  2980 1 1  77 GLY N    N  11.424  11.217   5.061 1.00 . A A .  77 GLY N    1 1 
        2  2981 1 1  77 GLY O    O   8.120  12.749   4.763 1.00 . A A .  77 GLY O    1 1 
        2  2982 1 1  78 VAL C    C   6.830   9.760   4.351 1.00 . A A .  78 VAL C    1 1 
        2  2983 1 1  78 VAL CA   C   7.785  10.324   3.283 1.00 . A A .  78 VAL CA   1 1 
        2  2984 1 1  78 VAL CB   C   8.151   9.205   2.220 1.00 . A A .  78 VAL CB   1 1 
        2  2985 1 1  78 VAL CG1  C   6.896   8.626   1.534 1.00 . A A .  78 VAL CG1  1 1 
        2  2986 1 1  78 VAL CG2  C   9.159   9.742   1.169 1.00 . A A .  78 VAL CG2  1 1 
        2  2987 1 1  78 VAL H    H   9.791  10.264   3.890 1.00 . A A .  78 VAL H    1 1 
        2  2988 1 1  78 VAL HA   H   7.309  11.155   2.761 1.00 . A A .  78 VAL HA   1 1 
        2  2989 1 1  78 VAL HB   H   8.640   8.386   2.749 1.00 . A A .  78 VAL HB   1 1 
        2  2990 1 1  78 VAL HG11 H   7.183   7.848   0.839 1.00 . A A .  78 VAL HG11 1 1 
        2  2991 1 1  78 VAL HG12 H   6.378   9.409   0.994 1.00 . A A .  78 VAL HG12 1 1 
        2  2992 1 1  78 VAL HG13 H   6.227   8.208   2.279 1.00 . A A .  78 VAL HG13 1 1 
        2  2993 1 1  78 VAL HG21 H   9.431   8.946   0.484 1.00 . A A .  78 VAL HG21 1 1 
        2  2994 1 1  78 VAL HG22 H  10.049  10.102   1.668 1.00 . A A .  78 VAL HG22 1 1 
        2  2995 1 1  78 VAL HG23 H   8.708  10.552   0.612 1.00 . A A .  78 VAL HG23 1 1 
        2  2996 1 1  78 VAL N    N   8.996  10.822   3.938 1.00 . A A .  78 VAL N    1 1 
        2  2997 1 1  78 VAL O    O   7.173   8.811   5.061 1.00 . A A .  78 VAL O    1 1 
        2  2998 1 1  79 SER C    C   3.987   8.599   4.805 1.00 . A A .  79 SER C    1 1 
        2  2999 1 1  79 SER CA   C   4.619   9.872   5.406 1.00 . A A .  79 SER CA   1 1 
        2  3000 1 1  79 SER CB   C   3.558  10.969   5.664 1.00 . A A .  79 SER CB   1 1 
        2  3001 1 1  79 SER H    H   5.450  11.153   3.943 1.00 . A A .  79 SER H    1 1 
        2  3002 1 1  79 SER HA   H   5.098   9.614   6.348 1.00 . A A .  79 SER HA   1 1 
        2  3003 1 1  79 SER HB2  H   3.052  11.219   4.737 1.00 . A A .  79 SER HB2  1 1 
        2  3004 1 1  79 SER HB3  H   2.830  10.614   6.382 1.00 . A A .  79 SER HB3  1 1 
        2  3005 1 1  79 SER HG   H   4.693  12.564   5.492 1.00 . A A .  79 SER HG   1 1 
        2  3006 1 1  79 SER N    N   5.647  10.370   4.491 1.00 . A A .  79 SER N    1 1 
        2  3007 1 1  79 SER O    O   4.027   8.390   3.585 1.00 . A A .  79 SER O    1 1 
        2  3008 1 1  79 SER OG   O   4.158  12.152   6.178 1.00 . A A .  79 SER OG   1 1 
        2  3009 1 1  80 TYR C    C   1.556   6.265   6.177 1.00 . A A .  80 TYR C    1 1 
        2  3010 1 1  80 TYR CA   C   2.732   6.529   5.237 1.00 . A A .  80 TYR CA   1 1 
        2  3011 1 1  80 TYR CB   C   3.694   5.303   5.164 1.00 . A A .  80 TYR CB   1 1 
        2  3012 1 1  80 TYR CD1  C   5.614   5.585   6.819 1.00 . A A .  80 TYR CD1  1 1 
        2  3013 1 1  80 TYR CD2  C   3.887   4.030   7.374 1.00 . A A .  80 TYR CD2  1 1 
        2  3014 1 1  80 TYR CE1  C   6.258   5.291   7.997 1.00 . A A .  80 TYR CE1  1 1 
        2  3015 1 1  80 TYR CE2  C   4.530   3.742   8.557 1.00 . A A .  80 TYR CE2  1 1 
        2  3016 1 1  80 TYR CG   C   4.412   4.964   6.477 1.00 . A A .  80 TYR CG   1 1 
        2  3017 1 1  80 TYR CZ   C   5.713   4.374   8.864 1.00 . A A .  80 TYR CZ   1 1 
        2  3018 1 1  80 TYR H    H   3.520   7.921   6.622 1.00 . A A .  80 TYR H    1 1 
        2  3019 1 1  80 TYR HA   H   2.324   6.711   4.241 1.00 . A A .  80 TYR HA   1 1 
        2  3020 1 1  80 TYR HB2  H   3.132   4.429   4.851 1.00 . A A .  80 TYR HB2  1 1 
        2  3021 1 1  80 TYR HB3  H   4.452   5.502   4.412 1.00 . A A .  80 TYR HB3  1 1 
        2  3022 1 1  80 TYR HD1  H   6.047   6.310   6.139 1.00 . A A .  80 TYR HD1  1 1 
        2  3023 1 1  80 TYR HD2  H   2.953   3.532   7.134 1.00 . A A .  80 TYR HD2  1 1 
        2  3024 1 1  80 TYR HE1  H   7.188   5.785   8.241 1.00 . A A .  80 TYR HE1  1 1 
        2  3025 1 1  80 TYR HE2  H   4.106   3.011   9.239 1.00 . A A .  80 TYR HE2  1 1 
        2  3026 1 1  80 TYR HH   H   6.209   3.171  10.285 1.00 . A A .  80 TYR HH   1 1 
        2  3027 1 1  80 TYR N    N   3.441   7.742   5.663 1.00 . A A .  80 TYR N    1 1 
        2  3028 1 1  80 TYR O    O   1.395   6.944   7.205 1.00 . A A .  80 TYR O    1 1 
        2  3029 1 1  80 TYR OH   O   6.352   4.095  10.054 1.00 . A A .  80 TYR OH   1 1 
        2  3030 1 1  81 ASP C    C  -0.612   3.383   6.450 1.00 . A A .  81 ASP C    1 1 
        2  3031 1 1  81 ASP CA   C  -0.467   4.905   6.539 1.00 . A A .  81 ASP CA   1 1 
        2  3032 1 1  81 ASP CB   C  -1.686   5.624   5.886 1.00 . A A .  81 ASP CB   1 1 
        2  3033 1 1  81 ASP CG   C  -2.873   5.833   6.830 1.00 . A A .  81 ASP CG   1 1 
        2  3034 1 1  81 ASP H    H   0.978   4.766   4.999 1.00 . A A .  81 ASP H    1 1 
        2  3035 1 1  81 ASP HA   H  -0.364   5.210   7.580 1.00 . A A .  81 ASP HA   1 1 
        2  3036 1 1  81 ASP HB2  H  -1.365   6.587   5.522 1.00 . A A .  81 ASP HB2  1 1 
        2  3037 1 1  81 ASP HB3  H  -2.030   5.039   5.035 1.00 . A A .  81 ASP HB3  1 1 
        2  3038 1 1  81 ASP N    N   0.751   5.274   5.812 1.00 . A A .  81 ASP N    1 1 
        2  3039 1 1  81 ASP O    O  -0.686   2.834   5.357 1.00 . A A .  81 ASP O    1 1 
        2  3040 1 1  81 ASP OD1  O  -3.335   4.859   7.447 1.00 . A A .  81 ASP OD1  1 1 
        2  3041 1 1  81 ASP OD2  O  -3.372   6.981   6.934 1.00 . A A .  81 ASP OD2  1 1 
        2  3042 1 1  82 VAL C    C  -2.120   0.723   7.796 1.00 . A A .  82 VAL C    1 1 
        2  3043 1 1  82 VAL CA   C  -0.673   1.236   7.675 1.00 . A A .  82 VAL CA   1 1 
        2  3044 1 1  82 VAL CB   C   0.195   0.692   8.879 1.00 . A A .  82 VAL CB   1 1 
        2  3045 1 1  82 VAL CG1  C   0.160  -0.862   8.954 1.00 . A A .  82 VAL CG1  1 1 
        2  3046 1 1  82 VAL CG2  C   1.651   1.217   8.797 1.00 . A A .  82 VAL CG2  1 1 
        2  3047 1 1  82 VAL H    H  -0.687   3.229   8.426 1.00 . A A .  82 VAL H    1 1 
        2  3048 1 1  82 VAL HA   H  -0.240   0.846   6.750 1.00 . A A .  82 VAL HA   1 1 
        2  3049 1 1  82 VAL HB   H  -0.240   1.073   9.803 1.00 . A A .  82 VAL HB   1 1 
        2  3050 1 1  82 VAL HG11 H   0.743  -1.199   9.800 1.00 . A A .  82 VAL HG11 1 1 
        2  3051 1 1  82 VAL HG12 H   0.568  -1.287   8.047 1.00 . A A .  82 VAL HG12 1 1 
        2  3052 1 1  82 VAL HG13 H  -0.864  -1.204   9.072 1.00 . A A .  82 VAL HG13 1 1 
        2  3053 1 1  82 VAL HG21 H   2.217   0.862   9.650 1.00 . A A .  82 VAL HG21 1 1 
        2  3054 1 1  82 VAL HG22 H   1.650   2.302   8.799 1.00 . A A .  82 VAL HG22 1 1 
        2  3055 1 1  82 VAL HG23 H   2.120   0.865   7.887 1.00 . A A .  82 VAL HG23 1 1 
        2  3056 1 1  82 VAL N    N  -0.650   2.715   7.601 1.00 . A A .  82 VAL N    1 1 
        2  3057 1 1  82 VAL O    O  -2.790   0.932   8.817 1.00 . A A .  82 VAL O    1 1 
        2  3058 1 1  83 LEU C    C  -3.663  -2.116   6.829 1.00 . A A .  83 LEU C    1 1 
        2  3059 1 1  83 LEU CA   C  -3.891  -0.601   6.692 1.00 . A A .  83 LEU CA   1 1 
        2  3060 1 1  83 LEU CB   C  -4.602  -0.243   5.358 1.00 . A A .  83 LEU CB   1 1 
        2  3061 1 1  83 LEU CD1  C  -6.962  -0.851   6.183 1.00 . A A .  83 LEU CD1  1 1 
        2  3062 1 1  83 LEU CD2  C  -6.519  -0.515   3.688 1.00 . A A .  83 LEU CD2  1 1 
        2  3063 1 1  83 LEU CG   C  -5.936  -0.988   5.040 1.00 . A A .  83 LEU CG   1 1 
        2  3064 1 1  83 LEU H    H  -2.020   0.019   5.942 1.00 . A A .  83 LEU H    1 1 
        2  3065 1 1  83 LEU HA   H  -4.502  -0.249   7.528 1.00 . A A .  83 LEU HA   1 1 
        2  3066 1 1  83 LEU HB2  H  -4.806   0.823   5.367 1.00 . A A .  83 LEU HB2  1 1 
        2  3067 1 1  83 LEU HB3  H  -3.906  -0.440   4.544 1.00 . A A .  83 LEU HB3  1 1 
        2  3068 1 1  83 LEU HD11 H  -7.879  -1.357   5.915 1.00 . A A .  83 LEU HD11 1 1 
        2  3069 1 1  83 LEU HD12 H  -7.169   0.194   6.374 1.00 . A A .  83 LEU HD12 1 1 
        2  3070 1 1  83 LEU HD13 H  -6.561  -1.303   7.084 1.00 . A A .  83 LEU HD13 1 1 
        2  3071 1 1  83 LEU HD21 H  -5.809  -0.716   2.898 1.00 . A A .  83 LEU HD21 1 1 
        2  3072 1 1  83 LEU HD22 H  -6.723   0.550   3.722 1.00 . A A .  83 LEU HD22 1 1 
        2  3073 1 1  83 LEU HD23 H  -7.438  -1.048   3.478 1.00 . A A .  83 LEU HD23 1 1 
        2  3074 1 1  83 LEU HG   H  -5.720  -2.045   4.944 1.00 . A A .  83 LEU HG   1 1 
        2  3075 1 1  83 LEU N    N  -2.587   0.066   6.737 1.00 . A A .  83 LEU N    1 1 
        2  3076 1 1  83 LEU O    O  -3.195  -2.759   5.901 1.00 . A A .  83 LEU O    1 1 
        2  3077 1 1  84 LYS C    C  -5.093  -4.799   8.478 1.00 . A A .  84 LYS C    1 1 
        2  3078 1 1  84 LYS CA   C  -3.732  -4.087   8.330 1.00 . A A .  84 LYS CA   1 1 
        2  3079 1 1  84 LYS CB   C  -2.921  -4.203   9.652 1.00 . A A .  84 LYS CB   1 1 
        2  3080 1 1  84 LYS CD   C  -1.265  -6.105   9.133 1.00 . A A .  84 LYS CD   1 1 
        2  3081 1 1  84 LYS CE   C   0.018  -5.309   9.413 1.00 . A A .  84 LYS CE   1 1 
        2  3082 1 1  84 LYS CG   C  -2.452  -5.637   9.997 1.00 . A A .  84 LYS CG   1 1 
        2  3083 1 1  84 LYS H    H  -4.323  -2.089   8.713 1.00 . A A .  84 LYS H    1 1 
        2  3084 1 1  84 LYS HA   H  -3.168  -4.549   7.524 1.00 . A A .  84 LYS HA   1 1 
        2  3085 1 1  84 LYS HB2  H  -2.044  -3.563   9.584 1.00 . A A .  84 LYS HB2  1 1 
        2  3086 1 1  84 LYS HB3  H  -3.537  -3.842  10.470 1.00 . A A .  84 LYS HB3  1 1 
        2  3087 1 1  84 LYS HD2  H  -1.074  -7.149   9.334 1.00 . A A .  84 LYS HD2  1 1 
        2  3088 1 1  84 LYS HD3  H  -1.529  -5.983   8.085 1.00 . A A .  84 LYS HD3  1 1 
        2  3089 1 1  84 LYS HE2  H   0.824  -5.722   8.820 1.00 . A A .  84 LYS HE2  1 1 
        2  3090 1 1  84 LYS HE3  H  -0.135  -4.275   9.126 1.00 . A A .  84 LYS HE3  1 1 
        2  3091 1 1  84 LYS HG2  H  -2.153  -5.672  11.039 1.00 . A A .  84 LYS HG2  1 1 
        2  3092 1 1  84 LYS HG3  H  -3.284  -6.318   9.847 1.00 . A A .  84 LYS HG3  1 1 
        2  3093 1 1  84 LYS HZ1  H   0.566  -6.337  11.143 1.00 . A A .  84 LYS HZ1  1 1 
        2  3094 1 1  84 LYS HZ2  H  -0.316  -4.930  11.436 1.00 . A A .  84 LYS HZ2  1 1 
        2  3095 1 1  84 LYS HZ3  H   1.306  -4.827  10.984 1.00 . A A .  84 LYS HZ3  1 1 
        2  3096 1 1  84 LYS N    N  -3.951  -2.663   8.016 1.00 . A A .  84 LYS N    1 1 
        2  3097 1 1  84 LYS NZ   N   0.419  -5.355  10.841 1.00 . A A .  84 LYS NZ   1 1 
        2  3098 1 1  84 LYS O    O  -5.784  -4.582   9.485 1.00 . A A .  84 LYS O    1 1 
        2  3099 1 1  85 SER C    C  -6.818  -7.379   6.323 1.00 . A A .  85 SER C    1 1 
        2  3100 1 1  85 SER CA   C  -6.748  -6.387   7.498 1.00 . A A .  85 SER CA   1 1 
        2  3101 1 1  85 SER CB   C  -7.989  -5.451   7.467 1.00 . A A .  85 SER CB   1 1 
        2  3102 1 1  85 SER H    H  -4.891  -5.709   6.688 1.00 . A A .  85 SER H    1 1 
        2  3103 1 1  85 SER HA   H  -6.759  -6.954   8.425 1.00 . A A .  85 SER HA   1 1 
        2  3104 1 1  85 SER HB2  H  -7.966  -4.797   8.330 1.00 . A A .  85 SER HB2  1 1 
        2  3105 1 1  85 SER HB3  H  -7.968  -4.848   6.570 1.00 . A A .  85 SER HB3  1 1 
        2  3106 1 1  85 SER HG   H  -9.928  -5.599   7.744 1.00 . A A .  85 SER HG   1 1 
        2  3107 1 1  85 SER N    N  -5.480  -5.615   7.473 1.00 . A A .  85 SER N    1 1 
        2  3108 1 1  85 SER O    O  -6.141  -7.210   5.307 1.00 . A A .  85 SER O    1 1 
        2  3109 1 1  85 SER OG   O  -9.204  -6.185   7.495 1.00 . A A .  85 SER OG   1 1 
        2  3110 1 1  86 THR C    C  -9.465  -9.399   5.083 1.00 . A A .  86 THR C    1 1 
        2  3111 1 1  86 THR CA   C  -7.962  -9.446   5.486 1.00 . A A .  86 THR CA   1 1 
        2  3112 1 1  86 THR CB   C  -7.592 -10.865   6.053 1.00 . A A .  86 THR CB   1 1 
        2  3113 1 1  86 THR CG2  C  -6.081 -11.009   6.353 1.00 . A A .  86 THR CG2  1 1 
        2  3114 1 1  86 THR H    H  -8.134  -8.468   7.351 1.00 . A A .  86 THR H    1 1 
        2  3115 1 1  86 THR HA   H  -7.365  -9.255   4.594 1.00 . A A .  86 THR HA   1 1 
        2  3116 1 1  86 THR HB   H  -7.868 -11.617   5.320 1.00 . A A .  86 THR HB   1 1 
        2  3117 1 1  86 THR HG1  H  -9.003 -11.781   7.101 1.00 . A A .  86 THR HG1  1 1 
        2  3118 1 1  86 THR HG21 H  -5.506 -10.829   5.451 1.00 . A A .  86 THR HG21 1 1 
        2  3119 1 1  86 THR HG22 H  -5.875 -12.007   6.718 1.00 . A A .  86 THR HG22 1 1 
        2  3120 1 1  86 THR HG23 H  -5.792 -10.289   7.106 1.00 . A A .  86 THR HG23 1 1 
        2  3121 1 1  86 THR N    N  -7.670  -8.407   6.495 1.00 . A A .  86 THR N    1 1 
        2  3122 1 1  86 THR O    O -10.006 -10.376   4.550 1.00 . A A .  86 THR O    1 1 
        2  3123 1 1  86 THR OG1  O  -8.332 -11.112   7.266 1.00 . A A .  86 THR OG1  1 1 
        2  3124 1 1  87 ASP C    C -11.604  -7.293   3.588 1.00 . A A .  87 ASP C    1 1 
        2  3125 1 1  87 ASP CA   C -11.540  -8.005   4.959 1.00 . A A .  87 ASP CA   1 1 
        2  3126 1 1  87 ASP CB   C -12.250  -7.136   6.029 1.00 . A A .  87 ASP CB   1 1 
        2  3127 1 1  87 ASP CG   C -12.425  -7.849   7.373 1.00 . A A .  87 ASP CG   1 1 
        2  3128 1 1  87 ASP H    H  -9.634  -7.521   5.781 1.00 . A A .  87 ASP H    1 1 
        2  3129 1 1  87 ASP HA   H -12.049  -8.965   4.893 1.00 . A A .  87 ASP HA   1 1 
        2  3130 1 1  87 ASP HB2  H -11.678  -6.223   6.184 1.00 . A A .  87 ASP HB2  1 1 
        2  3131 1 1  87 ASP HB3  H -13.237  -6.856   5.662 1.00 . A A .  87 ASP HB3  1 1 
        2  3132 1 1  87 ASP N    N -10.122  -8.246   5.334 1.00 . A A .  87 ASP N    1 1 
        2  3133 1 1  87 ASP O    O -11.116  -6.174   3.485 1.00 . A A .  87 ASP O    1 1 
        2  3134 1 1  87 ASP OD1  O -13.279  -8.751   7.453 1.00 . A A .  87 ASP OD1  1 1 
        2  3135 1 1  87 ASP OD2  O -11.721  -7.522   8.348 1.00 . A A .  87 ASP OD2  1 1 
        2  3136 1 1  88 PRO C    C -12.916  -5.917   1.112 1.00 . A A .  88 PRO C    1 1 
        2  3137 1 1  88 PRO CA   C -12.266  -7.316   1.153 1.00 . A A .  88 PRO CA   1 1 
        2  3138 1 1  88 PRO CB   C -13.078  -8.346   0.311 1.00 . A A .  88 PRO CB   1 1 
        2  3139 1 1  88 PRO CD   C -12.981  -9.188   2.578 1.00 . A A .  88 PRO CD   1 1 
        2  3140 1 1  88 PRO CG   C -13.081  -9.609   1.122 1.00 . A A .  88 PRO CG   1 1 
        2  3141 1 1  88 PRO HA   H -11.256  -7.242   0.756 1.00 . A A .  88 PRO HA   1 1 
        2  3142 1 1  88 PRO HB2  H -14.095  -7.986   0.142 1.00 . A A .  88 PRO HB2  1 1 
        2  3143 1 1  88 PRO HB3  H -12.595  -8.516  -0.646 1.00 . A A .  88 PRO HB3  1 1 
        2  3144 1 1  88 PRO HD2  H -13.969  -9.039   3.005 1.00 . A A .  88 PRO HD2  1 1 
        2  3145 1 1  88 PRO HD3  H -12.435  -9.929   3.152 1.00 . A A .  88 PRO HD3  1 1 
        2  3146 1 1  88 PRO HG2  H -13.995 -10.165   0.944 1.00 . A A .  88 PRO HG2  1 1 
        2  3147 1 1  88 PRO HG3  H -12.225 -10.218   0.857 1.00 . A A .  88 PRO HG3  1 1 
        2  3148 1 1  88 PRO N    N -12.239  -7.904   2.525 1.00 . A A .  88 PRO N    1 1 
        2  3149 1 1  88 PRO O    O -12.287  -4.929   0.703 1.00 . A A .  88 PRO O    1 1 
        2  3150 1 1  89 GLU C    C -14.407  -3.510   2.458 1.00 . A A .  89 GLU C    1 1 
        2  3151 1 1  89 GLU CA   C -14.977  -4.625   1.550 1.00 . A A .  89 GLU CA   1 1 
        2  3152 1 1  89 GLU CB   C -16.441  -4.958   1.918 1.00 . A A .  89 GLU CB   1 1 
        2  3153 1 1  89 GLU CD   C -18.087  -6.000   3.586 1.00 . A A .  89 GLU CD   1 1 
        2  3154 1 1  89 GLU CG   C -16.642  -5.534   3.334 1.00 . A A .  89 GLU CG   1 1 
        2  3155 1 1  89 GLU H    H -14.561  -6.661   1.982 1.00 . A A .  89 GLU H    1 1 
        2  3156 1 1  89 GLU HA   H -14.960  -4.267   0.523 1.00 . A A .  89 GLU HA   1 1 
        2  3157 1 1  89 GLU HB2  H -17.037  -4.058   1.825 1.00 . A A .  89 GLU HB2  1 1 
        2  3158 1 1  89 GLU HB3  H -16.811  -5.687   1.202 1.00 . A A .  89 GLU HB3  1 1 
        2  3159 1 1  89 GLU HG2  H -15.970  -6.377   3.467 1.00 . A A .  89 GLU HG2  1 1 
        2  3160 1 1  89 GLU HG3  H -16.384  -4.772   4.064 1.00 . A A .  89 GLU HG3  1 1 
        2  3161 1 1  89 GLU N    N -14.165  -5.849   1.592 1.00 . A A .  89 GLU N    1 1 
        2  3162 1 1  89 GLU O    O -14.540  -2.324   2.135 1.00 . A A .  89 GLU O    1 1 
        2  3163 1 1  89 GLU OE1  O -18.942  -5.160   3.922 1.00 . A A .  89 GLU OE1  1 1 
        2  3164 1 1  89 GLU OE2  O -18.371  -7.208   3.440 1.00 . A A .  89 GLU OE2  1 1 
        2  3165 1 1  90 GLU C    C -11.906  -2.270   3.892 1.00 . A A .  90 GLU C    1 1 
        2  3166 1 1  90 GLU CA   C -13.145  -2.932   4.514 1.00 . A A .  90 GLU CA   1 1 
        2  3167 1 1  90 GLU CB   C -12.774  -3.595   5.864 1.00 . A A .  90 GLU CB   1 1 
        2  3168 1 1  90 GLU CD   C -11.842  -3.236   8.241 1.00 . A A .  90 GLU CD   1 1 
        2  3169 1 1  90 GLU CG   C -12.267  -2.588   6.920 1.00 . A A .  90 GLU CG   1 1 
        2  3170 1 1  90 GLU H    H -13.640  -4.855   3.752 1.00 . A A .  90 GLU H    1 1 
        2  3171 1 1  90 GLU HA   H -13.892  -2.162   4.705 1.00 . A A .  90 GLU HA   1 1 
        2  3172 1 1  90 GLU HB2  H -13.652  -4.097   6.259 1.00 . A A .  90 GLU HB2  1 1 
        2  3173 1 1  90 GLU HB3  H -11.998  -4.337   5.693 1.00 . A A .  90 GLU HB3  1 1 
        2  3174 1 1  90 GLU HG2  H -11.419  -2.053   6.505 1.00 . A A .  90 GLU HG2  1 1 
        2  3175 1 1  90 GLU HG3  H -13.057  -1.869   7.116 1.00 . A A .  90 GLU HG3  1 1 
        2  3176 1 1  90 GLU N    N -13.738  -3.899   3.570 1.00 . A A .  90 GLU N    1 1 
        2  3177 1 1  90 GLU O    O -11.767  -1.046   3.930 1.00 . A A .  90 GLU O    1 1 
        2  3178 1 1  90 GLU OE1  O -10.700  -3.715   8.322 1.00 . A A .  90 GLU OE1  1 1 
        2  3179 1 1  90 GLU OE2  O -12.641  -3.264   9.201 1.00 . A A .  90 GLU OE2  1 1 
        2  3180 1 1  91 LEU C    C -10.229  -1.646   1.439 1.00 . A A .  91 LEU C    1 1 
        2  3181 1 1  91 LEU CA   C  -9.827  -2.613   2.582 1.00 . A A .  91 LEU CA   1 1 
        2  3182 1 1  91 LEU CB   C  -8.979  -3.796   2.019 1.00 . A A .  91 LEU CB   1 1 
        2  3183 1 1  91 LEU CD1  C  -7.531  -5.898   2.321 1.00 . A A .  91 LEU CD1  1 1 
        2  3184 1 1  91 LEU CD2  C  -7.463  -4.067   4.071 1.00 . A A .  91 LEU CD2  1 1 
        2  3185 1 1  91 LEU CG   C  -8.338  -4.794   3.044 1.00 . A A .  91 LEU CG   1 1 
        2  3186 1 1  91 LEU H    H -11.193  -4.065   3.325 1.00 . A A .  91 LEU H    1 1 
        2  3187 1 1  91 LEU HA   H  -9.224  -2.067   3.305 1.00 . A A .  91 LEU HA   1 1 
        2  3188 1 1  91 LEU HB2  H  -9.621  -4.372   1.358 1.00 . A A .  91 LEU HB2  1 1 
        2  3189 1 1  91 LEU HB3  H  -8.178  -3.380   1.416 1.00 . A A .  91 LEU HB3  1 1 
        2  3190 1 1  91 LEU HD11 H  -8.178  -6.433   1.639 1.00 . A A .  91 LEU HD11 1 1 
        2  3191 1 1  91 LEU HD12 H  -7.131  -6.596   3.045 1.00 . A A .  91 LEU HD12 1 1 
        2  3192 1 1  91 LEU HD13 H  -6.712  -5.457   1.761 1.00 . A A .  91 LEU HD13 1 1 
        2  3193 1 1  91 LEU HD21 H  -7.057  -4.784   4.774 1.00 . A A .  91 LEU HD21 1 1 
        2  3194 1 1  91 LEU HD22 H  -8.061  -3.345   4.612 1.00 . A A .  91 LEU HD22 1 1 
        2  3195 1 1  91 LEU HD23 H  -6.650  -3.555   3.573 1.00 . A A .  91 LEU HD23 1 1 
        2  3196 1 1  91 LEU HG   H  -9.132  -5.289   3.591 1.00 . A A .  91 LEU HG   1 1 
        2  3197 1 1  91 LEU N    N -11.027  -3.100   3.289 1.00 . A A .  91 LEU N    1 1 
        2  3198 1 1  91 LEU O    O  -9.594  -0.609   1.256 1.00 . A A .  91 LEU O    1 1 
        2  3199 1 1  92 THR C    C -12.327   0.196   0.007 1.00 . A A .  92 THR C    1 1 
        2  3200 1 1  92 THR CA   C -11.845  -1.207  -0.428 1.00 . A A .  92 THR CA   1 1 
        2  3201 1 1  92 THR CB   C -13.019  -1.963  -1.156 1.00 . A A .  92 THR CB   1 1 
        2  3202 1 1  92 THR CG2  C -13.584  -1.165  -2.355 1.00 . A A .  92 THR CG2  1 1 
        2  3203 1 1  92 THR H    H -11.811  -2.806   0.977 1.00 . A A .  92 THR H    1 1 
        2  3204 1 1  92 THR HA   H -11.027  -1.097  -1.134 1.00 . A A .  92 THR HA   1 1 
        2  3205 1 1  92 THR HB   H -13.819  -2.125  -0.440 1.00 . A A .  92 THR HB   1 1 
        2  3206 1 1  92 THR HG1  H -11.896  -3.591  -1.026 1.00 . A A .  92 THR HG1  1 1 
        2  3207 1 1  92 THR HG21 H -14.393  -1.719  -2.814 1.00 . A A .  92 THR HG21 1 1 
        2  3208 1 1  92 THR HG22 H -12.803  -1.004  -3.086 1.00 . A A .  92 THR HG22 1 1 
        2  3209 1 1  92 THR HG23 H -13.957  -0.204  -2.014 1.00 . A A .  92 THR HG23 1 1 
        2  3210 1 1  92 THR N    N -11.330  -1.992   0.720 1.00 . A A .  92 THR N    1 1 
        2  3211 1 1  92 THR O    O -11.943   1.212  -0.599 1.00 . A A .  92 THR O    1 1 
        2  3212 1 1  92 THR OG1  O -12.566  -3.248  -1.621 1.00 . A A .  92 THR OG1  1 1 
        2  3213 1 1  93 GLN C    C -12.609   2.352   2.253 1.00 . A A .  93 GLN C    1 1 
        2  3214 1 1  93 GLN CA   C -13.707   1.517   1.581 1.00 . A A .  93 GLN CA   1 1 
        2  3215 1 1  93 GLN CB   C -14.931   1.287   2.529 1.00 . A A .  93 GLN CB   1 1 
        2  3216 1 1  93 GLN CD   C -13.989   1.265   4.982 1.00 . A A .  93 GLN CD   1 1 
        2  3217 1 1  93 GLN CG   C -14.677   0.491   3.841 1.00 . A A .  93 GLN CG   1 1 
        2  3218 1 1  93 GLN H    H -13.391  -0.587   1.530 1.00 . A A .  93 GLN H    1 1 
        2  3219 1 1  93 GLN HA   H -14.056   2.077   0.710 1.00 . A A .  93 GLN HA   1 1 
        2  3220 1 1  93 GLN HB2  H -15.340   2.252   2.804 1.00 . A A .  93 GLN HB2  1 1 
        2  3221 1 1  93 GLN HB3  H -15.694   0.754   1.966 1.00 . A A .  93 GLN HB3  1 1 
        2  3222 1 1  93 GLN HE21 H -14.874   2.973   4.465 1.00 . A A .  93 GLN HE21 1 1 
        2  3223 1 1  93 GLN HE22 H -13.807   3.058   5.816 1.00 . A A .  93 GLN HE22 1 1 
        2  3224 1 1  93 GLN HG2  H -15.625   0.128   4.213 1.00 . A A .  93 GLN HG2  1 1 
        2  3225 1 1  93 GLN HG3  H -14.054  -0.364   3.598 1.00 . A A .  93 GLN HG3  1 1 
        2  3226 1 1  93 GLN N    N -13.156   0.247   1.074 1.00 . A A .  93 GLN N    1 1 
        2  3227 1 1  93 GLN NE2  N -14.255   2.561   5.099 1.00 . A A .  93 GLN NE2  1 1 
        2  3228 1 1  93 GLN O    O -12.726   3.563   2.359 1.00 . A A .  93 GLN O    1 1 
        2  3229 1 1  93 GLN OE1  O -13.254   0.685   5.783 1.00 . A A .  93 GLN OE1  1 1 
        2  3230 1 1  94 ARG C    C  -9.478   2.977   2.281 1.00 . A A .  94 ARG C    1 1 
        2  3231 1 1  94 ARG CA   C -10.408   2.364   3.356 1.00 . A A .  94 ARG CA   1 1 
        2  3232 1 1  94 ARG CB   C  -9.665   1.360   4.294 1.00 . A A .  94 ARG CB   1 1 
        2  3233 1 1  94 ARG CD   C  -8.135   3.019   5.549 1.00 . A A .  94 ARG CD   1 1 
        2  3234 1 1  94 ARG CG   C  -9.225   1.938   5.657 1.00 . A A .  94 ARG CG   1 1 
        2  3235 1 1  94 ARG CZ   C  -6.538   4.201   7.051 1.00 . A A .  94 ARG CZ   1 1 
        2  3236 1 1  94 ARG H    H -11.530   0.712   2.656 1.00 . A A .  94 ARG H    1 1 
        2  3237 1 1  94 ARG HA   H -10.810   3.178   3.959 1.00 . A A .  94 ARG HA   1 1 
        2  3238 1 1  94 ARG HB2  H -10.320   0.519   4.497 1.00 . A A .  94 ARG HB2  1 1 
        2  3239 1 1  94 ARG HB3  H  -8.783   0.978   3.791 1.00 . A A .  94 ARG HB3  1 1 
        2  3240 1 1  94 ARG HD2  H  -7.339   2.655   4.909 1.00 . A A .  94 ARG HD2  1 1 
        2  3241 1 1  94 ARG HD3  H  -8.565   3.913   5.104 1.00 . A A .  94 ARG HD3  1 1 
        2  3242 1 1  94 ARG HE   H  -7.991   2.955   7.645 1.00 . A A .  94 ARG HE   1 1 
        2  3243 1 1  94 ARG HG2  H -10.096   2.364   6.143 1.00 . A A .  94 ARG HG2  1 1 
        2  3244 1 1  94 ARG HG3  H  -8.851   1.126   6.271 1.00 . A A .  94 ARG HG3  1 1 
        2  3245 1 1  94 ARG HH11 H  -6.246   4.665   5.094 1.00 . A A .  94 ARG HH11 1 1 
        2  3246 1 1  94 ARG HH12 H  -5.163   5.434   6.210 1.00 . A A .  94 ARG HH12 1 1 
        2  3247 1 1  94 ARG HH21 H  -6.509   3.916   9.053 1.00 . A A .  94 ARG HH21 1 1 
        2  3248 1 1  94 ARG HH22 H  -5.312   5.010   8.437 1.00 . A A .  94 ARG HH22 1 1 
        2  3249 1 1  94 ARG N    N -11.544   1.690   2.718 1.00 . A A .  94 ARG N    1 1 
        2  3250 1 1  94 ARG NE   N  -7.567   3.367   6.856 1.00 . A A .  94 ARG NE   1 1 
        2  3251 1 1  94 ARG NH1  N  -5.934   4.816   6.033 1.00 . A A .  94 ARG NH1  1 1 
        2  3252 1 1  94 ARG NH2  N  -6.085   4.390   8.278 1.00 . A A .  94 ARG NH2  1 1 
        2  3253 1 1  94 ARG O    O  -8.772   3.947   2.561 1.00 . A A .  94 ARG O    1 1 
        2  3254 1 1  95 VAL C    C  -9.442   4.364  -0.457 1.00 . A A .  95 VAL C    1 1 
        2  3255 1 1  95 VAL CA   C  -8.793   3.007  -0.110 1.00 . A A .  95 VAL CA   1 1 
        2  3256 1 1  95 VAL CB   C  -8.772   2.049  -1.376 1.00 . A A .  95 VAL CB   1 1 
        2  3257 1 1  95 VAL CG1  C  -8.216   2.753  -2.648 1.00 . A A .  95 VAL CG1  1 1 
        2  3258 1 1  95 VAL CG2  C  -7.971   0.756  -1.088 1.00 . A A .  95 VAL CG2  1 1 
        2  3259 1 1  95 VAL H    H  -9.968   1.559   0.926 1.00 . A A .  95 VAL H    1 1 
        2  3260 1 1  95 VAL HA   H  -7.761   3.184   0.194 1.00 . A A .  95 VAL HA   1 1 
        2  3261 1 1  95 VAL HB   H  -9.797   1.760  -1.586 1.00 . A A .  95 VAL HB   1 1 
        2  3262 1 1  95 VAL HG11 H  -8.216   2.059  -3.480 1.00 . A A .  95 VAL HG11 1 1 
        2  3263 1 1  95 VAL HG12 H  -7.206   3.094  -2.469 1.00 . A A .  95 VAL HG12 1 1 
        2  3264 1 1  95 VAL HG13 H  -8.841   3.603  -2.895 1.00 . A A .  95 VAL HG13 1 1 
        2  3265 1 1  95 VAL HG21 H  -8.407   0.236  -0.248 1.00 . A A .  95 VAL HG21 1 1 
        2  3266 1 1  95 VAL HG22 H  -6.943   1.002  -0.860 1.00 . A A .  95 VAL HG22 1 1 
        2  3267 1 1  95 VAL HG23 H  -7.996   0.103  -1.956 1.00 . A A .  95 VAL HG23 1 1 
        2  3268 1 1  95 VAL N    N  -9.489   2.407   1.050 1.00 . A A .  95 VAL N    1 1 
        2  3269 1 1  95 VAL O    O  -8.732   5.358  -0.603 1.00 . A A .  95 VAL O    1 1 
        2  3270 1 1  96 ARG C    C -11.369   6.719   0.234 1.00 . A A .  96 ARG C    1 1 
        2  3271 1 1  96 ARG CA   C -11.514   5.667  -0.874 1.00 . A A .  96 ARG CA   1 1 
        2  3272 1 1  96 ARG CB   C -13.023   5.445  -1.196 1.00 . A A .  96 ARG CB   1 1 
        2  3273 1 1  96 ARG CD   C -15.403   4.948  -0.368 1.00 . A A .  96 ARG CD   1 1 
        2  3274 1 1  96 ARG CG   C -13.911   4.986  -0.027 1.00 . A A .  96 ARG CG   1 1 
        2  3275 1 1  96 ARG CZ   C -16.830   3.308  -1.599 1.00 . A A .  96 ARG CZ   1 1 
        2  3276 1 1  96 ARG H    H -11.318   3.596  -0.341 1.00 . A A .  96 ARG H    1 1 
        2  3277 1 1  96 ARG HA   H -11.035   6.056  -1.770 1.00 . A A .  96 ARG HA   1 1 
        2  3278 1 1  96 ARG HB2  H -13.431   6.372  -1.587 1.00 . A A .  96 ARG HB2  1 1 
        2  3279 1 1  96 ARG HB3  H -13.087   4.697  -1.972 1.00 . A A .  96 ARG HB3  1 1 
        2  3280 1 1  96 ARG HD2  H -15.951   4.634   0.515 1.00 . A A .  96 ARG HD2  1 1 
        2  3281 1 1  96 ARG HD3  H -15.729   5.943  -0.646 1.00 . A A .  96 ARG HD3  1 1 
        2  3282 1 1  96 ARG HE   H -15.024   3.943  -2.181 1.00 . A A .  96 ARG HE   1 1 
        2  3283 1 1  96 ARG HG2  H -13.604   3.986   0.265 1.00 . A A .  96 ARG HG2  1 1 
        2  3284 1 1  96 ARG HG3  H -13.760   5.659   0.813 1.00 . A A .  96 ARG HG3  1 1 
        2  3285 1 1  96 ARG HH11 H -17.689   3.974   0.117 1.00 . A A .  96 ARG HH11 1 1 
        2  3286 1 1  96 ARG HH12 H -18.632   2.834  -0.787 1.00 . A A .  96 ARG HH12 1 1 
        2  3287 1 1  96 ARG HH21 H -16.263   2.454  -3.343 1.00 . A A .  96 ARG HH21 1 1 
        2  3288 1 1  96 ARG HH22 H -17.822   1.974  -2.750 1.00 . A A .  96 ARG HH22 1 1 
        2  3289 1 1  96 ARG N    N -10.799   4.413  -0.527 1.00 . A A .  96 ARG N    1 1 
        2  3290 1 1  96 ARG NE   N -15.705   4.026  -1.477 1.00 . A A .  96 ARG NE   1 1 
        2  3291 1 1  96 ARG NH1  N -17.792   3.378  -0.683 1.00 . A A .  96 ARG NH1  1 1 
        2  3292 1 1  96 ARG NH2  N -16.987   2.516  -2.648 1.00 . A A .  96 ARG NH2  1 1 
        2  3293 1 1  96 ARG O    O -11.170   7.892  -0.063 1.00 . A A .  96 ARG O    1 1 
        2  3294 1 1  97 GLU C    C  -9.913   7.745   2.774 1.00 . A A .  97 GLU C    1 1 
        2  3295 1 1  97 GLU CA   C -11.329   7.166   2.680 1.00 . A A .  97 GLU CA   1 1 
        2  3296 1 1  97 GLU CB   C -11.711   6.428   3.989 1.00 . A A .  97 GLU CB   1 1 
        2  3297 1 1  97 GLU CD   C -14.107   7.363   4.038 1.00 . A A .  97 GLU CD   1 1 
        2  3298 1 1  97 GLU CG   C -13.215   6.111   4.130 1.00 . A A .  97 GLU CG   1 1 
        2  3299 1 1  97 GLU H    H -11.622   5.320   1.666 1.00 . A A .  97 GLU H    1 1 
        2  3300 1 1  97 GLU HA   H -12.026   7.990   2.530 1.00 . A A .  97 GLU HA   1 1 
        2  3301 1 1  97 GLU HB2  H -11.161   5.490   4.036 1.00 . A A .  97 GLU HB2  1 1 
        2  3302 1 1  97 GLU HB3  H -11.416   7.034   4.837 1.00 . A A .  97 GLU HB3  1 1 
        2  3303 1 1  97 GLU HG2  H -13.496   5.413   3.351 1.00 . A A .  97 GLU HG2  1 1 
        2  3304 1 1  97 GLU HG3  H -13.382   5.639   5.093 1.00 . A A .  97 GLU HG3  1 1 
        2  3305 1 1  97 GLU N    N -11.457   6.276   1.510 1.00 . A A .  97 GLU N    1 1 
        2  3306 1 1  97 GLU O    O  -9.741   8.894   3.202 1.00 . A A .  97 GLU O    1 1 
        2  3307 1 1  97 GLU OE1  O -14.098   8.183   4.986 1.00 . A A .  97 GLU OE1  1 1 
        2  3308 1 1  97 GLU OE2  O -14.813   7.538   3.024 1.00 . A A .  97 GLU OE2  1 1 
        2  3309 1 1  98 PHE C    C  -7.388   8.514   1.233 1.00 . A A .  98 PHE C    1 1 
        2  3310 1 1  98 PHE CA   C  -7.513   7.388   2.269 1.00 . A A .  98 PHE CA   1 1 
        2  3311 1 1  98 PHE CB   C  -6.566   6.214   1.897 1.00 . A A .  98 PHE CB   1 1 
        2  3312 1 1  98 PHE CD1  C  -4.271   6.784   2.822 1.00 . A A .  98 PHE CD1  1 1 
        2  3313 1 1  98 PHE CD2  C  -4.585   6.938   0.449 1.00 . A A .  98 PHE CD2  1 1 
        2  3314 1 1  98 PHE CE1  C  -2.970   7.208   2.667 1.00 . A A .  98 PHE CE1  1 1 
        2  3315 1 1  98 PHE CE2  C  -3.280   7.359   0.303 1.00 . A A .  98 PHE CE2  1 1 
        2  3316 1 1  98 PHE CG   C  -5.108   6.639   1.717 1.00 . A A .  98 PHE CG   1 1 
        2  3317 1 1  98 PHE CZ   C  -2.477   7.498   1.411 1.00 . A A .  98 PHE CZ   1 1 
        2  3318 1 1  98 PHE H    H  -9.129   6.024   2.092 1.00 . A A .  98 PHE H    1 1 
        2  3319 1 1  98 PHE HA   H  -7.229   7.771   3.249 1.00 . A A .  98 PHE HA   1 1 
        2  3320 1 1  98 PHE HB2  H  -6.601   5.463   2.680 1.00 . A A .  98 PHE HB2  1 1 
        2  3321 1 1  98 PHE HB3  H  -6.906   5.761   0.970 1.00 . A A .  98 PHE HB3  1 1 
        2  3322 1 1  98 PHE HD1  H  -4.647   6.556   3.810 1.00 . A A .  98 PHE HD1  1 1 
        2  3323 1 1  98 PHE HD2  H  -5.212   6.830  -0.426 1.00 . A A .  98 PHE HD2  1 1 
        2  3324 1 1  98 PHE HE1  H  -2.326   7.313   3.536 1.00 . A A .  98 PHE HE1  1 1 
        2  3325 1 1  98 PHE HE2  H  -2.887   7.587  -0.684 1.00 . A A .  98 PHE HE2  1 1 
        2  3326 1 1  98 PHE HZ   H  -1.448   7.832   1.296 1.00 . A A .  98 PHE HZ   1 1 
        2  3327 1 1  98 PHE N    N  -8.911   6.943   2.355 1.00 . A A .  98 PHE N    1 1 
        2  3328 1 1  98 PHE O    O  -6.996   9.618   1.576 1.00 . A A .  98 PHE O    1 1 
        2  3329 1 1  99 LEU C    C  -8.453  10.441  -0.929 1.00 . A A .  99 LEU C    1 1 
        2  3330 1 1  99 LEU CA   C  -7.671   9.127  -1.183 1.00 . A A .  99 LEU CA   1 1 
        2  3331 1 1  99 LEU CB   C  -8.227   8.423  -2.458 1.00 . A A .  99 LEU CB   1 1 
        2  3332 1 1  99 LEU CD1  C  -8.289   6.378  -4.019 1.00 . A A .  99 LEU CD1  1 1 
        2  3333 1 1  99 LEU CD2  C  -6.049   7.410  -3.374 1.00 . A A .  99 LEU CD2  1 1 
        2  3334 1 1  99 LEU CG   C  -7.493   7.116  -2.914 1.00 . A A .  99 LEU CG   1 1 
        2  3335 1 1  99 LEU H    H  -8.125   7.297  -0.191 1.00 . A A .  99 LEU H    1 1 
        2  3336 1 1  99 LEU HA   H  -6.621   9.359  -1.332 1.00 . A A .  99 LEU HA   1 1 
        2  3337 1 1  99 LEU HB2  H  -9.269   8.176  -2.272 1.00 . A A .  99 LEU HB2  1 1 
        2  3338 1 1  99 LEU HB3  H  -8.195   9.129  -3.279 1.00 . A A .  99 LEU HB3  1 1 
        2  3339 1 1  99 LEU HD11 H  -7.779   5.462  -4.289 1.00 . A A .  99 LEU HD11 1 1 
        2  3340 1 1  99 LEU HD12 H  -8.381   7.006  -4.897 1.00 . A A .  99 LEU HD12 1 1 
        2  3341 1 1  99 LEU HD13 H  -9.279   6.136  -3.651 1.00 . A A .  99 LEU HD13 1 1 
        2  3342 1 1  99 LEU HD21 H  -5.492   7.849  -2.558 1.00 . A A .  99 LEU HD21 1 1 
        2  3343 1 1  99 LEU HD22 H  -6.062   8.096  -4.212 1.00 . A A .  99 LEU HD22 1 1 
        2  3344 1 1  99 LEU HD23 H  -5.568   6.488  -3.673 1.00 . A A .  99 LEU HD23 1 1 
        2  3345 1 1  99 LEU HG   H  -7.430   6.442  -2.068 1.00 . A A .  99 LEU HG   1 1 
        2  3346 1 1  99 LEU N    N  -7.765   8.199  -0.029 1.00 . A A .  99 LEU N    1 1 
        2  3347 1 1  99 LEU O    O  -8.085  11.516  -1.428 1.00 . A A .  99 LEU O    1 1 
        2  3348 1 1 100 LYS C    C  -9.717  12.373   1.205 1.00 . A A . 100 LYS C    1 1 
        2  3349 1 1 100 LYS CA   C -10.429  11.401   0.246 1.00 . A A . 100 LYS CA   1 1 
        2  3350 1 1 100 LYS CB   C -11.695  10.793   0.923 1.00 . A A . 100 LYS CB   1 1 
        2  3351 1 1 100 LYS CD   C -13.470  12.308  -0.156 1.00 . A A . 100 LYS CD   1 1 
        2  3352 1 1 100 LYS CE   C -14.856  12.938   0.051 1.00 . A A . 100 LYS CE   1 1 
        2  3353 1 1 100 LYS CG   C -12.866  11.764   1.164 1.00 . A A . 100 LYS CG   1 1 
        2  3354 1 1 100 LYS H    H  -9.719   9.417   0.224 1.00 . A A . 100 LYS H    1 1 
        2  3355 1 1 100 LYS HA   H -10.726  11.932  -0.653 1.00 . A A . 100 LYS HA   1 1 
        2  3356 1 1 100 LYS HB2  H -12.065   9.985   0.297 1.00 . A A . 100 LYS HB2  1 1 
        2  3357 1 1 100 LYS HB3  H -11.405  10.365   1.882 1.00 . A A . 100 LYS HB3  1 1 
        2  3358 1 1 100 LYS HD2  H -12.805  13.057  -0.569 1.00 . A A . 100 LYS HD2  1 1 
        2  3359 1 1 100 LYS HD3  H -13.567  11.490  -0.867 1.00 . A A . 100 LYS HD3  1 1 
        2  3360 1 1 100 LYS HE2  H -14.785  13.742   0.776 1.00 . A A . 100 LYS HE2  1 1 
        2  3361 1 1 100 LYS HE3  H -15.204  13.337  -0.892 1.00 . A A . 100 LYS HE3  1 1 
        2  3362 1 1 100 LYS HG2  H -13.642  11.244   1.719 1.00 . A A . 100 LYS HG2  1 1 
        2  3363 1 1 100 LYS HG3  H -12.509  12.600   1.759 1.00 . A A . 100 LYS HG3  1 1 
        2  3364 1 1 100 LYS HZ1  H -15.853  11.103  -0.086 1.00 . A A . 100 LYS HZ1  1 1 
        2  3365 1 1 100 LYS HZ2  H -16.790  12.349   0.566 1.00 . A A . 100 LYS HZ2  1 1 
        2  3366 1 1 100 LYS HZ3  H -15.584  11.623   1.500 1.00 . A A . 100 LYS HZ3  1 1 
        2  3367 1 1 100 LYS N    N  -9.527  10.308  -0.134 1.00 . A A . 100 LYS N    1 1 
        2  3368 1 1 100 LYS NZ   N -15.840  11.935   0.541 1.00 . A A . 100 LYS NZ   1 1 
        2  3369 1 1 100 LYS O    O  -9.641  13.578   0.948 1.00 . A A . 100 LYS O    1 1 
        2  3370 1 1 101 THR C    C  -7.090  13.021   3.007 1.00 . A A . 101 THR C    1 1 
        2  3371 1 1 101 THR CA   C  -8.537  12.608   3.359 1.00 . A A . 101 THR CA   1 1 
        2  3372 1 1 101 THR CB   C  -8.584  11.839   4.716 1.00 . A A . 101 THR CB   1 1 
        2  3373 1 1 101 THR CG2  C  -7.617  10.633   4.754 1.00 . A A . 101 THR CG2  1 1 
        2  3374 1 1 101 THR H    H  -9.168  10.834   2.371 1.00 . A A . 101 THR H    1 1 
        2  3375 1 1 101 THR HA   H  -9.124  13.515   3.477 1.00 . A A . 101 THR HA   1 1 
        2  3376 1 1 101 THR HB   H  -9.592  11.471   4.865 1.00 . A A . 101 THR HB   1 1 
        2  3377 1 1 101 THR HG1  H  -7.446  12.503   6.194 1.00 . A A . 101 THR HG1  1 1 
        2  3378 1 1 101 THR HG21 H  -7.723  10.112   5.696 1.00 . A A . 101 THR HG21 1 1 
        2  3379 1 1 101 THR HG22 H  -6.596  10.979   4.645 1.00 . A A . 101 THR HG22 1 1 
        2  3380 1 1 101 THR HG23 H  -7.846   9.952   3.944 1.00 . A A . 101 THR HG23 1 1 
        2  3381 1 1 101 THR N    N  -9.159  11.817   2.289 1.00 . A A . 101 THR N    1 1 
        2  3382 1 1 101 THR O    O  -6.533  13.948   3.612 1.00 . A A . 101 THR O    1 1 
        2  3383 1 1 101 THR OG1  O  -8.283  12.748   5.787 1.00 . A A . 101 THR OG1  1 1 
        2  3384 1 1 102 ALA C    C  -5.102  13.906   0.721 1.00 . A A . 102 ALA C    1 1 
        2  3385 1 1 102 ALA CA   C  -5.134  12.595   1.518 1.00 . A A . 102 ALA CA   1 1 
        2  3386 1 1 102 ALA CB   C  -4.622  11.428   0.668 1.00 . A A . 102 ALA CB   1 1 
        2  3387 1 1 102 ALA H    H  -6.993  11.583   1.611 1.00 . A A . 102 ALA H    1 1 
        2  3388 1 1 102 ALA HA   H  -4.475  12.698   2.379 1.00 . A A . 102 ALA HA   1 1 
        2  3389 1 1 102 ALA HB1  H  -4.637  10.518   1.256 1.00 . A A . 102 ALA HB1  1 1 
        2  3390 1 1 102 ALA HB2  H  -3.605  11.621   0.344 1.00 . A A . 102 ALA HB2  1 1 
        2  3391 1 1 102 ALA HB3  H  -5.256  11.298  -0.200 1.00 . A A . 102 ALA HB3  1 1 
        2  3392 1 1 102 ALA N    N  -6.491  12.315   2.022 1.00 . A A . 102 ALA N    1 1 
        2  3393 1 1 102 ALA O    O  -4.033  14.474   0.506 1.00 . A A . 102 ALA O    1 1 
        2  3394 1 1 103 GLY C    C  -6.205  16.861   0.700 1.00 . A A . 103 GLY C    1 1 
        2  3395 1 1 103 GLY CA   C  -6.449  15.716  -0.299 1.00 . A A . 103 GLY CA   1 1 
        2  3396 1 1 103 GLY H    H  -7.083  13.803   0.380 1.00 . A A . 103 GLY H    1 1 
        2  3397 1 1 103 GLY HA2  H  -5.751  15.820  -1.121 1.00 . A A . 103 GLY HA2  1 1 
        2  3398 1 1 103 GLY HA3  H  -7.453  15.803  -0.690 1.00 . A A . 103 GLY HA3  1 1 
        2  3399 1 1 103 GLY N    N  -6.295  14.379   0.294 1.00 . A A . 103 GLY N    1 1 
        2  3400 1 1 103 GLY O    O  -6.242  18.036   0.320 1.00 . A A . 103 GLY O    1 1 
        2  3401 1 1 104 SER C    C  -4.193  17.042   3.614 1.00 . A A . 104 SER C    1 1 
        2  3402 1 1 104 SER CA   C  -5.578  17.440   3.052 1.00 . A A . 104 SER CA   1 1 
        2  3403 1 1 104 SER CB   C  -6.659  17.398   4.164 1.00 . A A . 104 SER CB   1 1 
        2  3404 1 1 104 SER H    H  -6.093  15.568   2.219 1.00 . A A . 104 SER H    1 1 
        2  3405 1 1 104 SER HA   H  -5.514  18.447   2.647 1.00 . A A . 104 SER HA   1 1 
        2  3406 1 1 104 SER HB2  H  -7.634  17.534   3.718 1.00 . A A . 104 SER HB2  1 1 
        2  3407 1 1 104 SER HB3  H  -6.633  16.433   4.664 1.00 . A A . 104 SER HB3  1 1 
        2  3408 1 1 104 SER HG   H  -6.857  19.242   4.819 1.00 . A A . 104 SER HG   1 1 
        2  3409 1 1 104 SER N    N  -5.973  16.508   1.977 1.00 . A A . 104 SER N    1 1 
        2  3410 1 1 104 SER O    O  -3.545  16.107   3.107 1.00 . A A . 104 SER O    1 1 
        2  3411 1 1 104 SER OG   O  -6.466  18.420   5.137 1.00 . A A . 104 SER OG   1 1 
        2  3412 1 1 105 LEU C    C  -2.925  16.316   6.465 1.00 . A A . 105 LEU C    1 1 
        2  3413 1 1 105 LEU CA   C  -2.537  17.390   5.428 1.00 . A A . 105 LEU CA   1 1 
        2  3414 1 1 105 LEU CB   C  -1.900  18.638   6.112 1.00 . A A . 105 LEU CB   1 1 
        2  3415 1 1 105 LEU CD1  C  -0.749  20.927   5.965 1.00 . A A . 105 LEU CD1  1 1 
        2  3416 1 1 105 LEU CD2  C  -0.236  19.138   4.206 1.00 . A A . 105 LEU CD2  1 1 
        2  3417 1 1 105 LEU CG   C  -1.307  19.729   5.162 1.00 . A A . 105 LEU CG   1 1 
        2  3418 1 1 105 LEU H    H  -4.237  18.561   4.939 1.00 . A A . 105 LEU H    1 1 
        2  3419 1 1 105 LEU HA   H  -1.813  16.958   4.740 1.00 . A A . 105 LEU HA   1 1 
        2  3420 1 1 105 LEU HB2  H  -2.670  19.106   6.722 1.00 . A A . 105 LEU HB2  1 1 
        2  3421 1 1 105 LEU HB3  H  -1.111  18.300   6.779 1.00 . A A . 105 LEU HB3  1 1 
        2  3422 1 1 105 LEU HD11 H  -1.533  21.343   6.586 1.00 . A A . 105 LEU HD11 1 1 
        2  3423 1 1 105 LEU HD12 H  -0.405  21.691   5.281 1.00 . A A . 105 LEU HD12 1 1 
        2  3424 1 1 105 LEU HD13 H   0.075  20.610   6.593 1.00 . A A . 105 LEU HD13 1 1 
        2  3425 1 1 105 LEU HD21 H  -0.679  18.353   3.606 1.00 . A A . 105 LEU HD21 1 1 
        2  3426 1 1 105 LEU HD22 H   0.591  18.731   4.773 1.00 . A A . 105 LEU HD22 1 1 
        2  3427 1 1 105 LEU HD23 H   0.130  19.914   3.546 1.00 . A A . 105 LEU HD23 1 1 
        2  3428 1 1 105 LEU HG   H  -2.110  20.114   4.545 1.00 . A A . 105 LEU HG   1 1 
        2  3429 1 1 105 LEU N    N  -3.737  17.763   4.662 1.00 . A A . 105 LEU N    1 1 
        2  3430 1 1 105 LEU O    O  -3.081  16.609   7.656 1.00 . A A . 105 LEU O    1 1 
        2  3431 1 1 106 GLU C    C  -2.246  13.460   7.585 1.00 . A A . 106 GLU C    1 1 
        2  3432 1 1 106 GLU CA   C  -3.499  13.947   6.830 1.00 . A A . 106 GLU CA   1 1 
        2  3433 1 1 106 GLU CB   C  -4.151  12.804   5.998 1.00 . A A . 106 GLU CB   1 1 
        2  3434 1 1 106 GLU CD   C  -5.457  11.712   7.969 1.00 . A A . 106 GLU CD   1 1 
        2  3435 1 1 106 GLU CG   C  -4.485  11.509   6.785 1.00 . A A . 106 GLU CG   1 1 
        2  3436 1 1 106 GLU H    H  -3.082  14.943   5.008 1.00 . A A . 106 GLU H    1 1 
        2  3437 1 1 106 GLU HA   H  -4.230  14.299   7.560 1.00 . A A . 106 GLU HA   1 1 
        2  3438 1 1 106 GLU HB2  H  -5.074  13.175   5.568 1.00 . A A . 106 GLU HB2  1 1 
        2  3439 1 1 106 GLU HB3  H  -3.478  12.543   5.187 1.00 . A A . 106 GLU HB3  1 1 
        2  3440 1 1 106 GLU HG2  H  -4.925  10.794   6.095 1.00 . A A . 106 GLU HG2  1 1 
        2  3441 1 1 106 GLU HG3  H  -3.558  11.087   7.161 1.00 . A A . 106 GLU HG3  1 1 
        2  3442 1 1 106 GLU N    N  -3.150  15.084   5.975 1.00 . A A . 106 GLU N    1 1 
        2  3443 1 1 106 GLU O    O  -1.237  13.098   6.972 1.00 . A A . 106 GLU O    1 1 
        2  3444 1 1 106 GLU OE1  O  -5.012  12.084   9.062 1.00 . A A . 106 GLU OE1  1 1 
        2  3445 1 1 106 GLU OE2  O  -6.657  11.488   7.820 1.00 . A A . 106 GLU OE2  1 1 
        2  3446 1 1 107 HIS C    C  -1.495  11.771  10.536 1.00 . A A . 107 HIS C    1 1 
        2  3447 1 1 107 HIS CA   C  -1.219  13.113   9.829 1.00 . A A . 107 HIS CA   1 1 
        2  3448 1 1 107 HIS CB   C  -1.008  14.254  10.862 1.00 . A A . 107 HIS CB   1 1 
        2  3449 1 1 107 HIS CD2  C   0.533  15.908   9.577 1.00 . A A . 107 HIS CD2  1 1 
        2  3450 1 1 107 HIS CE1  C  -0.752  17.675   9.631 1.00 . A A . 107 HIS CE1  1 1 
        2  3451 1 1 107 HIS CG   C  -0.596  15.564  10.240 1.00 . A A . 107 HIS CG   1 1 
        2  3452 1 1 107 HIS H    H  -3.184  13.743   9.325 1.00 . A A . 107 HIS H    1 1 
        2  3453 1 1 107 HIS HA   H  -0.310  12.999   9.242 1.00 . A A . 107 HIS HA   1 1 
        2  3454 1 1 107 HIS HB2  H  -1.934  14.422  11.400 1.00 . A A . 107 HIS HB2  1 1 
        2  3455 1 1 107 HIS HB3  H  -0.239  13.967  11.571 1.00 . A A . 107 HIS HB3  1 1 
        2  3456 1 1 107 HIS HD1  H  -2.266  16.776  10.667 1.00 . A A . 107 HIS HD1  1 1 
        2  3457 1 1 107 HIS HD2  H   1.375  15.267   9.372 1.00 . A A . 107 HIS HD2  1 1 
        2  3458 1 1 107 HIS HE1  H  -1.127  18.678   9.481 1.00 . A A . 107 HIS HE1  1 1 
        2  3459 1 1 107 HIS HE2  H   1.127  17.768   8.843 1.00 . A A . 107 HIS HE2  1 1 
        2  3460 1 1 107 HIS N    N  -2.329  13.477   8.924 1.00 . A A . 107 HIS N    1 1 
        2  3461 1 1 107 HIS ND1  N  -1.380  16.698  10.258 1.00 . A A . 107 HIS ND1  1 1 
        2  3462 1 1 107 HIS NE2  N   0.407  17.217   9.210 1.00 . A A . 107 HIS NE2  1 1 
        2  3463 1 1 107 HIS O    O  -0.910  11.491  11.590 1.00 . A A . 107 HIS O    1 1 
        2  3464 1 1 108 HIS C    C  -1.396   8.706  10.156 1.00 . A A . 108 HIS C    1 1 
        2  3465 1 1 108 HIS CA   C  -2.659   9.568  10.405 1.00 . A A . 108 HIS CA   1 1 
        2  3466 1 1 108 HIS CB   C  -3.901   8.980   9.664 1.00 . A A . 108 HIS CB   1 1 
        2  3467 1 1 108 HIS CD2  C  -3.872   6.441  10.276 1.00 . A A . 108 HIS CD2  1 1 
        2  3468 1 1 108 HIS CE1  C  -5.882   6.292  11.102 1.00 . A A . 108 HIS CE1  1 1 
        2  3469 1 1 108 HIS CG   C  -4.429   7.674  10.207 1.00 . A A . 108 HIS CG   1 1 
        2  3470 1 1 108 HIS H    H  -2.899  11.289   9.181 1.00 . A A . 108 HIS H    1 1 
        2  3471 1 1 108 HIS HA   H  -2.866   9.606  11.475 1.00 . A A . 108 HIS HA   1 1 
        2  3472 1 1 108 HIS HB2  H  -4.710   9.699   9.709 1.00 . A A . 108 HIS HB2  1 1 
        2  3473 1 1 108 HIS HB3  H  -3.646   8.821   8.621 1.00 . A A . 108 HIS HB3  1 1 
        2  3474 1 1 108 HIS HD1  H  -6.361   8.253  10.819 1.00 . A A . 108 HIS HD1  1 1 
        2  3475 1 1 108 HIS HD2  H  -2.884   6.163   9.933 1.00 . A A . 108 HIS HD2  1 1 
        2  3476 1 1 108 HIS HE1  H  -6.779   5.896  11.554 1.00 . A A . 108 HIS HE1  1 1 
        2  3477 1 1 108 HIS HE2  H  -4.686   4.642  10.967 1.00 . A A . 108 HIS HE2  1 1 
        2  3478 1 1 108 HIS N    N  -2.390  10.948   9.942 1.00 . A A . 108 HIS N    1 1 
        2  3479 1 1 108 HIS ND1  N  -5.693   7.538  10.734 1.00 . A A . 108 HIS ND1  1 1 
        2  3480 1 1 108 HIS NE2  N  -4.794   5.609  10.835 1.00 . A A . 108 HIS NE2  1 1 
        2  3481 1 1 108 HIS O    O  -1.234   8.106   9.084 1.00 . A A . 108 HIS O    1 1 
        2  3482 1 1 109 HIS C    C   1.461   8.083  12.461 1.00 . A A . 109 HIS C    1 1 
        2  3483 1 1 109 HIS CA   C   0.832   8.114  11.058 1.00 . A A . 109 HIS CA   1 1 
        2  3484 1 1 109 HIS CB   C   1.739   8.923  10.072 1.00 . A A . 109 HIS CB   1 1 
        2  3485 1 1 109 HIS CD2  C   3.751   7.336   9.655 1.00 . A A . 109 HIS CD2  1 1 
        2  3486 1 1 109 HIS CE1  C   5.345   8.606  10.436 1.00 . A A . 109 HIS CE1  1 1 
        2  3487 1 1 109 HIS CG   C   3.182   8.488  10.056 1.00 . A A . 109 HIS CG   1 1 
        2  3488 1 1 109 HIS H    H  -0.743   9.161  11.982 1.00 . A A . 109 HIS H    1 1 
        2  3489 1 1 109 HIS HA   H   0.723   7.093  10.692 1.00 . A A . 109 HIS HA   1 1 
        2  3490 1 1 109 HIS HB2  H   1.354   8.808   9.067 1.00 . A A . 109 HIS HB2  1 1 
        2  3491 1 1 109 HIS HB3  H   1.713   9.975  10.334 1.00 . A A . 109 HIS HB3  1 1 
        2  3492 1 1 109 HIS HD1  H   4.130  10.182  10.881 1.00 . A A . 109 HIS HD1  1 1 
        2  3493 1 1 109 HIS HD2  H   3.243   6.489   9.217 1.00 . A A . 109 HIS HD2  1 1 
        2  3494 1 1 109 HIS HE1  H   6.318   8.964  10.753 1.00 . A A . 109 HIS HE1  1 1 
        2  3495 1 1 109 HIS HE2  H   5.684   6.654  10.030 1.00 . A A . 109 HIS HE2  1 1 
        2  3496 1 1 109 HIS N    N  -0.500   8.716  11.143 1.00 . A A . 109 HIS N    1 1 
        2  3497 1 1 109 HIS ND1  N   4.215   9.265  10.535 1.00 . A A . 109 HIS ND1  1 1 
        2  3498 1 1 109 HIS NE2  N   5.096   7.431   9.907 1.00 . A A . 109 HIS NE2  1 1 
        2  3499 1 1 109 HIS O    O   1.321   9.039  13.233 1.00 . A A . 109 HIS O    1 1 
        2  3500 1 1 110 HIS C    C   4.366   6.372  13.649 1.00 . A A . 110 HIS C    1 1 
        2  3501 1 1 110 HIS CA   C   2.938   6.816  14.000 1.00 . A A . 110 HIS CA   1 1 
        2  3502 1 1 110 HIS CB   C   2.235   5.824  14.965 1.00 . A A . 110 HIS CB   1 1 
        2  3503 1 1 110 HIS CD2  C   1.078   7.390  16.685 1.00 . A A . 110 HIS CD2  1 1 
        2  3504 1 1 110 HIS CE1  C  -0.992   6.797  16.342 1.00 . A A . 110 HIS CE1  1 1 
        2  3505 1 1 110 HIS CG   C   1.085   6.435  15.723 1.00 . A A . 110 HIS CG   1 1 
        2  3506 1 1 110 HIS H    H   2.108   6.224  12.148 1.00 . A A . 110 HIS H    1 1 
        2  3507 1 1 110 HIS HA   H   3.016   7.789  14.489 1.00 . A A . 110 HIS HA   1 1 
        2  3508 1 1 110 HIS HB2  H   1.854   4.976  14.404 1.00 . A A . 110 HIS HB2  1 1 
        2  3509 1 1 110 HIS HB3  H   2.952   5.461  15.696 1.00 . A A . 110 HIS HB3  1 1 
        2  3510 1 1 110 HIS HD1  H  -0.561   5.403  14.906 1.00 . A A . 110 HIS HD1  1 1 
        2  3511 1 1 110 HIS HD2  H   1.940   7.897  17.093 1.00 . A A . 110 HIS HD2  1 1 
        2  3512 1 1 110 HIS HE1  H  -2.069   6.735  16.410 1.00 . A A . 110 HIS HE1  1 1 
        2  3513 1 1 110 HIS HE2  H  -0.545   8.340  17.600 1.00 . A A . 110 HIS HE2  1 1 
        2  3514 1 1 110 HIS N    N   2.143   6.978  12.772 1.00 . A A . 110 HIS N    1 1 
        2  3515 1 1 110 HIS ND1  N  -0.231   6.083  15.535 1.00 . A A . 110 HIS ND1  1 1 
        2  3516 1 1 110 HIS NE2  N  -0.223   7.596  17.049 1.00 . A A . 110 HIS NE2  1 1 
        2  3517 1 1 110 HIS O    O   4.692   6.174  12.472 1.00 . A A . 110 HIS O    1 1 
        2  3518 1 1 111 HIS C    C   6.966   4.630  13.817 1.00 . A A . 111 HIS C    1 1 
        2  3519 1 1 111 HIS CA   C   6.669   5.960  14.551 1.00 . A A . 111 HIS CA   1 1 
        2  3520 1 1 111 HIS CB   C   7.354   5.971  15.953 1.00 . A A . 111 HIS CB   1 1 
        2  3521 1 1 111 HIS CD2  C   6.427   8.309  16.685 1.00 . A A . 111 HIS CD2  1 1 
        2  3522 1 1 111 HIS CE1  C   8.057   8.889  18.019 1.00 . A A . 111 HIS CE1  1 1 
        2  3523 1 1 111 HIS CG   C   7.341   7.305  16.666 1.00 . A A . 111 HIS CG   1 1 
        2  3524 1 1 111 HIS H    H   4.830   6.249  15.595 1.00 . A A . 111 HIS H    1 1 
        2  3525 1 1 111 HIS HA   H   7.079   6.773  13.958 1.00 . A A . 111 HIS HA   1 1 
        2  3526 1 1 111 HIS HB2  H   6.858   5.259  16.601 1.00 . A A . 111 HIS HB2  1 1 
        2  3527 1 1 111 HIS HB3  H   8.392   5.671  15.842 1.00 . A A . 111 HIS HB3  1 1 
        2  3528 1 1 111 HIS HD1  H   9.165   7.196  17.718 1.00 . A A . 111 HIS HD1  1 1 
        2  3529 1 1 111 HIS HD2  H   5.502   8.347  16.126 1.00 . A A . 111 HIS HD2  1 1 
        2  3530 1 1 111 HIS HE1  H   8.674   9.451  18.709 1.00 . A A . 111 HIS HE1  1 1 
        2  3531 1 1 111 HIS HE2  H   6.367  10.025  17.886 1.00 . A A . 111 HIS HE2  1 1 
        2  3532 1 1 111 HIS N    N   5.207   6.210  14.690 1.00 . A A . 111 HIS N    1 1 
        2  3533 1 1 111 HIS ND1  N   8.349   7.708  17.514 1.00 . A A . 111 HIS ND1  1 1 
        2  3534 1 1 111 HIS NE2  N   6.897   9.276  17.533 1.00 . A A . 111 HIS NE2  1 1 
        2  3535 1 1 111 HIS O    O   8.064   4.441  13.278 1.00 . A A . 111 HIS O    1 1 
        2  3536 1 1 112 HIS C    C   4.588   2.115  12.614 1.00 . A A . 112 HIS C    1 1 
        2  3537 1 1 112 HIS CA   C   6.022   2.447  13.094 1.00 . A A . 112 HIS CA   1 1 
        2  3538 1 1 112 HIS CB   C   6.601   1.310  13.985 1.00 . A A . 112 HIS CB   1 1 
        2  3539 1 1 112 HIS CD2  C   7.687  -0.326  12.278 1.00 . A A . 112 HIS CD2  1 1 
        2  3540 1 1 112 HIS CE1  C   6.526  -2.120  12.747 1.00 . A A . 112 HIS CE1  1 1 
        2  3541 1 1 112 HIS CG   C   6.810   0.005  13.255 1.00 . A A . 112 HIS CG   1 1 
        2  3542 1 1 112 HIS H    H   5.186   3.912  14.359 1.00 . A A . 112 HIS H    1 1 
        2  3543 1 1 112 HIS HA   H   6.671   2.579  12.224 1.00 . A A . 112 HIS HA   1 1 
        2  3544 1 1 112 HIS HB2  H   7.559   1.622  14.376 1.00 . A A . 112 HIS HB2  1 1 
        2  3545 1 1 112 HIS HB3  H   5.928   1.126  14.816 1.00 . A A . 112 HIS HB3  1 1 
        2  3546 1 1 112 HIS HD1  H   5.383  -1.240  14.196 1.00 . A A . 112 HIS HD1  1 1 
        2  3547 1 1 112 HIS HD2  H   8.408   0.332  11.811 1.00 . A A . 112 HIS HD2  1 1 
        2  3548 1 1 112 HIS HE1  H   6.147  -3.133  12.730 1.00 . A A . 112 HIS HE1  1 1 
        2  3549 1 1 112 HIS HE2  H   8.082  -2.197  11.431 1.00 . A A . 112 HIS HE2  1 1 
        2  3550 1 1 112 HIS N    N   5.983   3.719  13.831 1.00 . A A . 112 HIS N    1 1 
        2  3551 1 1 112 HIS ND1  N   6.095  -1.147  13.525 1.00 . A A . 112 HIS ND1  1 1 
        2  3552 1 1 112 HIS NE2  N   7.488  -1.647  11.984 1.00 . A A . 112 HIS NE2  1 1 
        2  3553 1 1 112 HIS O    O   4.313   2.200  11.407 1.00 . A A . 112 HIS O    1 1 
        2  3554 1 1 112 HIS OXT  O   3.728   1.810  13.467 1.00 . A A . 112 HIS OXT  1 1 
        3  3555 1 1   1 MET C    C   2.815  14.117   0.418 1.00 . A A .   1 MET C    1 1 
        3  3556 1 1   1 MET CA   C   1.810  15.129  -0.156 1.00 . A A .   1 MET CA   1 1 
        3  3557 1 1   1 MET CB   C   2.097  16.558   0.379 1.00 . A A .   1 MET CB   1 1 
        3  3558 1 1   1 MET CE   C   1.327  19.074   2.231 1.00 . A A .   1 MET CE   1 1 
        3  3559 1 1   1 MET CG   C   1.193  17.660  -0.190 1.00 . A A .   1 MET CG   1 1 
        3  3560 1 1   1 MET H1   H   0.296  14.728   1.218 1.00 . A A .   1 MET H1   1 1 
        3  3561 1 1   1 MET H2   H   0.242  13.753  -0.159 1.00 . A A .   1 MET H2   1 1 
        3  3562 1 1   1 MET H3   H  -0.258  15.360  -0.246 1.00 . A A .   1 MET H3   1 1 
        3  3563 1 1   1 MET HA   H   1.897  15.129  -1.239 1.00 . A A .   1 MET HA   1 1 
        3  3564 1 1   1 MET HB2  H   1.981  16.556   1.454 1.00 . A A .   1 MET HB2  1 1 
        3  3565 1 1   1 MET HB3  H   3.126  16.820   0.146 1.00 . A A .   1 MET HB3  1 1 
        3  3566 1 1   1 MET HE1  H   0.308  18.772   2.419 1.00 . A A .   1 MET HE1  1 1 
        3  3567 1 1   1 MET HE2  H   1.526  20.004   2.741 1.00 . A A .   1 MET HE2  1 1 
        3  3568 1 1   1 MET HE3  H   2.000  18.310   2.596 1.00 . A A .   1 MET HE3  1 1 
        3  3569 1 1   1 MET HG2  H   1.305  17.690  -1.265 1.00 . A A .   1 MET HG2  1 1 
        3  3570 1 1   1 MET HG3  H   0.161  17.426   0.048 1.00 . A A .   1 MET HG3  1 1 
        3  3571 1 1   1 MET N    N   0.429  14.713   0.186 1.00 . A A .   1 MET N    1 1 
        3  3572 1 1   1 MET O    O   3.105  14.154   1.628 1.00 . A A .   1 MET O    1 1 
        3  3573 1 1   1 MET SD   S   1.578  19.305   0.471 1.00 . A A .   1 MET SD   1 1 
        3  3574 1 1   2 GLY C    C   3.742  11.274   1.076 1.00 . A A .   2 GLY C    1 1 
        3  3575 1 1   2 GLY CA   C   4.276  12.173  -0.039 1.00 . A A .   2 GLY CA   1 1 
        3  3576 1 1   2 GLY H    H   3.009  13.226  -1.376 1.00 . A A .   2 GLY H    1 1 
        3  3577 1 1   2 GLY HA2  H   4.516  11.562  -0.900 1.00 . A A .   2 GLY HA2  1 1 
        3  3578 1 1   2 GLY HA3  H   5.181  12.665   0.297 1.00 . A A .   2 GLY HA3  1 1 
        3  3579 1 1   2 GLY N    N   3.307  13.198  -0.445 1.00 . A A .   2 GLY N    1 1 
        3  3580 1 1   2 GLY O    O   4.414  11.048   2.082 1.00 . A A .   2 GLY O    1 1 
        3  3581 1 1   3 LYS C    C   1.295   8.689   1.269 1.00 . A A .   3 LYS C    1 1 
        3  3582 1 1   3 LYS CA   C   1.785   9.996   1.897 1.00 . A A .   3 LYS CA   1 1 
        3  3583 1 1   3 LYS CB   C   0.606  10.843   2.455 1.00 . A A .   3 LYS CB   1 1 
        3  3584 1 1   3 LYS CD   C  -1.122  11.144   4.353 1.00 . A A .   3 LYS CD   1 1 
        3  3585 1 1   3 LYS CE   C  -1.834  10.491   5.549 1.00 . A A .   3 LYS CE   1 1 
        3  3586 1 1   3 LYS CG   C  -0.168  10.176   3.620 1.00 . A A .   3 LYS CG   1 1 
        3  3587 1 1   3 LYS H    H   2.094  10.902   0.007 1.00 . A A .   3 LYS H    1 1 
        3  3588 1 1   3 LYS HA   H   2.471   9.755   2.717 1.00 . A A .   3 LYS HA   1 1 
        3  3589 1 1   3 LYS HB2  H   0.999  11.794   2.807 1.00 . A A .   3 LYS HB2  1 1 
        3  3590 1 1   3 LYS HB3  H  -0.098  11.044   1.652 1.00 . A A .   3 LYS HB3  1 1 
        3  3591 1 1   3 LYS HD2  H  -0.548  11.990   4.715 1.00 . A A .   3 LYS HD2  1 1 
        3  3592 1 1   3 LYS HD3  H  -1.867  11.496   3.648 1.00 . A A .   3 LYS HD3  1 1 
        3  3593 1 1   3 LYS HE2  H  -2.366  11.251   6.101 1.00 . A A .   3 LYS HE2  1 1 
        3  3594 1 1   3 LYS HE3  H  -2.542   9.750   5.186 1.00 . A A .   3 LYS HE3  1 1 
        3  3595 1 1   3 LYS HG2  H  -0.749   9.352   3.217 1.00 . A A .   3 LYS HG2  1 1 
        3  3596 1 1   3 LYS HG3  H   0.550   9.776   4.334 1.00 . A A .   3 LYS HG3  1 1 
        3  3597 1 1   3 LYS HZ1  H  -0.417   9.014   5.985 1.00 . A A .   3 LYS HZ1  1 1 
        3  3598 1 1   3 LYS HZ2  H  -1.361   9.457   7.310 1.00 . A A .   3 LYS HZ2  1 1 
        3  3599 1 1   3 LYS HZ3  H  -0.127  10.483   6.772 1.00 . A A .   3 LYS HZ3  1 1 
        3  3600 1 1   3 LYS N    N   2.518  10.774   0.881 1.00 . A A .   3 LYS N    1 1 
        3  3601 1 1   3 LYS NZ   N  -0.867   9.822   6.469 1.00 . A A .   3 LYS NZ   1 1 
        3  3602 1 1   3 LYS O    O   0.867   8.676   0.110 1.00 . A A .   3 LYS O    1 1 
        3  3603 1 1   4 VAL C    C   0.286   5.404   2.482 1.00 . A A .   4 VAL C    1 1 
        3  3604 1 1   4 VAL CA   C   1.084   6.248   1.482 1.00 . A A .   4 VAL CA   1 1 
        3  3605 1 1   4 VAL CB   C   2.421   5.530   1.078 1.00 . A A .   4 VAL CB   1 1 
        3  3606 1 1   4 VAL CG1  C   3.300   5.189   2.286 1.00 . A A .   4 VAL CG1  1 1 
        3  3607 1 1   4 VAL CG2  C   2.160   4.299   0.199 1.00 . A A .   4 VAL CG2  1 1 
        3  3608 1 1   4 VAL H    H   1.570   7.671   2.970 1.00 . A A .   4 VAL H    1 1 
        3  3609 1 1   4 VAL HA   H   0.480   6.361   0.578 1.00 . A A .   4 VAL HA   1 1 
        3  3610 1 1   4 VAL HB   H   2.990   6.230   0.487 1.00 . A A .   4 VAL HB   1 1 
        3  3611 1 1   4 VAL HG11 H   4.235   4.755   1.948 1.00 . A A .   4 VAL HG11 1 1 
        3  3612 1 1   4 VAL HG12 H   2.789   4.472   2.920 1.00 . A A .   4 VAL HG12 1 1 
        3  3613 1 1   4 VAL HG13 H   3.505   6.087   2.853 1.00 . A A .   4 VAL HG13 1 1 
        3  3614 1 1   4 VAL HG21 H   3.101   3.854  -0.103 1.00 . A A .   4 VAL HG21 1 1 
        3  3615 1 1   4 VAL HG22 H   1.610   4.594  -0.685 1.00 . A A .   4 VAL HG22 1 1 
        3  3616 1 1   4 VAL HG23 H   1.581   3.563   0.749 1.00 . A A .   4 VAL HG23 1 1 
        3  3617 1 1   4 VAL N    N   1.353   7.586   2.021 1.00 . A A .   4 VAL N    1 1 
        3  3618 1 1   4 VAL O    O   0.446   5.549   3.695 1.00 . A A .   4 VAL O    1 1 
        3  3619 1 1   5 LEU C    C  -0.777   2.186   2.567 1.00 . A A .   5 LEU C    1 1 
        3  3620 1 1   5 LEU CA   C  -1.375   3.587   2.762 1.00 . A A .   5 LEU CA   1 1 
        3  3621 1 1   5 LEU CB   C  -2.877   3.615   2.354 1.00 . A A .   5 LEU CB   1 1 
        3  3622 1 1   5 LEU CD1  C  -3.794   2.919   4.659 1.00 . A A .   5 LEU CD1  1 1 
        3  3623 1 1   5 LEU CD2  C  -5.276   2.706   2.592 1.00 . A A .   5 LEU CD2  1 1 
        3  3624 1 1   5 LEU CG   C  -3.827   2.647   3.140 1.00 . A A .   5 LEU CG   1 1 
        3  3625 1 1   5 LEU H    H  -0.741   4.546   0.986 1.00 . A A .   5 LEU H    1 1 
        3  3626 1 1   5 LEU HA   H  -1.290   3.867   3.816 1.00 . A A .   5 LEU HA   1 1 
        3  3627 1 1   5 LEU HB2  H  -3.243   4.630   2.482 1.00 . A A .   5 LEU HB2  1 1 
        3  3628 1 1   5 LEU HB3  H  -2.944   3.367   1.299 1.00 . A A .   5 LEU HB3  1 1 
        3  3629 1 1   5 LEU HD11 H  -4.474   2.242   5.160 1.00 . A A .   5 LEU HD11 1 1 
        3  3630 1 1   5 LEU HD12 H  -4.091   3.939   4.860 1.00 . A A .   5 LEU HD12 1 1 
        3  3631 1 1   5 LEU HD13 H  -2.791   2.754   5.037 1.00 . A A .   5 LEU HD13 1 1 
        3  3632 1 1   5 LEU HD21 H  -5.900   2.011   3.139 1.00 . A A .   5 LEU HD21 1 1 
        3  3633 1 1   5 LEU HD22 H  -5.279   2.432   1.544 1.00 . A A .   5 LEU HD22 1 1 
        3  3634 1 1   5 LEU HD23 H  -5.676   3.706   2.698 1.00 . A A .   5 LEU HD23 1 1 
        3  3635 1 1   5 LEU HG   H  -3.471   1.634   2.999 1.00 . A A .   5 LEU HG   1 1 
        3  3636 1 1   5 LEU N    N  -0.603   4.542   1.959 1.00 . A A .   5 LEU N    1 1 
        3  3637 1 1   5 LEU O    O  -0.962   1.562   1.517 1.00 . A A .   5 LEU O    1 1 
        3  3638 1 1   6 LEU C    C  -0.563  -0.633   3.963 1.00 . A A .   6 LEU C    1 1 
        3  3639 1 1   6 LEU CA   C   0.554   0.377   3.611 1.00 . A A .   6 LEU CA   1 1 
        3  3640 1 1   6 LEU CB   C   1.719   0.337   4.658 1.00 . A A .   6 LEU CB   1 1 
        3  3641 1 1   6 LEU CD1  C   3.006  -1.676   3.697 1.00 . A A .   6 LEU CD1  1 1 
        3  3642 1 1   6 LEU CD2  C   3.420  -0.937   6.099 1.00 . A A .   6 LEU CD2  1 1 
        3  3643 1 1   6 LEU CG   C   2.379  -1.051   4.954 1.00 . A A .   6 LEU CG   1 1 
        3  3644 1 1   6 LEU H    H   0.170   2.337   4.313 1.00 . A A .   6 LEU H    1 1 
        3  3645 1 1   6 LEU HA   H   0.954   0.142   2.625 1.00 . A A .   6 LEU HA   1 1 
        3  3646 1 1   6 LEU HB2  H   2.500   1.007   4.315 1.00 . A A .   6 LEU HB2  1 1 
        3  3647 1 1   6 LEU HB3  H   1.337   0.731   5.596 1.00 . A A .   6 LEU HB3  1 1 
        3  3648 1 1   6 LEU HD11 H   3.779  -1.026   3.308 1.00 . A A .   6 LEU HD11 1 1 
        3  3649 1 1   6 LEU HD12 H   2.246  -1.821   2.944 1.00 . A A .   6 LEU HD12 1 1 
        3  3650 1 1   6 LEU HD13 H   3.439  -2.636   3.951 1.00 . A A .   6 LEU HD13 1 1 
        3  3651 1 1   6 LEU HD21 H   3.844  -1.911   6.309 1.00 . A A .   6 LEU HD21 1 1 
        3  3652 1 1   6 LEU HD22 H   2.936  -0.563   6.992 1.00 . A A .   6 LEU HD22 1 1 
        3  3653 1 1   6 LEU HD23 H   4.213  -0.256   5.812 1.00 . A A .   6 LEU HD23 1 1 
        3  3654 1 1   6 LEU HG   H   1.608  -1.734   5.290 1.00 . A A .   6 LEU HG   1 1 
        3  3655 1 1   6 LEU N    N  -0.013   1.734   3.567 1.00 . A A .   6 LEU N    1 1 
        3  3656 1 1   6 LEU O    O  -0.884  -0.836   5.136 1.00 . A A .   6 LEU O    1 1 
        3  3657 1 1   7 VAL C    C  -1.487  -3.635   3.210 1.00 . A A .   7 VAL C    1 1 
        3  3658 1 1   7 VAL CA   C  -2.191  -2.274   3.063 1.00 . A A .   7 VAL CA   1 1 
        3  3659 1 1   7 VAL CB   C  -3.185  -2.303   1.833 1.00 . A A .   7 VAL CB   1 1 
        3  3660 1 1   7 VAL CG1  C  -4.159  -3.503   1.907 1.00 . A A .   7 VAL CG1  1 1 
        3  3661 1 1   7 VAL CG2  C  -3.952  -0.972   1.723 1.00 . A A .   7 VAL CG2  1 1 
        3  3662 1 1   7 VAL H    H  -0.962  -0.894   2.026 1.00 . A A .   7 VAL H    1 1 
        3  3663 1 1   7 VAL HA   H  -2.777  -2.076   3.964 1.00 . A A .   7 VAL HA   1 1 
        3  3664 1 1   7 VAL HB   H  -2.598  -2.421   0.921 1.00 . A A .   7 VAL HB   1 1 
        3  3665 1 1   7 VAL HG11 H  -4.735  -3.453   2.822 1.00 . A A .   7 VAL HG11 1 1 
        3  3666 1 1   7 VAL HG12 H  -3.601  -4.427   1.886 1.00 . A A .   7 VAL HG12 1 1 
        3  3667 1 1   7 VAL HG13 H  -4.835  -3.481   1.058 1.00 . A A .   7 VAL HG13 1 1 
        3  3668 1 1   7 VAL HG21 H  -4.620  -0.999   0.870 1.00 . A A .   7 VAL HG21 1 1 
        3  3669 1 1   7 VAL HG22 H  -3.247  -0.160   1.596 1.00 . A A .   7 VAL HG22 1 1 
        3  3670 1 1   7 VAL HG23 H  -4.530  -0.804   2.624 1.00 . A A .   7 VAL HG23 1 1 
        3  3671 1 1   7 VAL N    N  -1.184  -1.207   2.925 1.00 . A A .   7 VAL N    1 1 
        3  3672 1 1   7 VAL O    O  -0.914  -4.160   2.247 1.00 . A A .   7 VAL O    1 1 
        3  3673 1 1   8 ILE C    C  -2.192  -6.470   4.949 1.00 . A A .   8 ILE C    1 1 
        3  3674 1 1   8 ILE CA   C  -1.003  -5.515   4.760 1.00 . A A .   8 ILE CA   1 1 
        3  3675 1 1   8 ILE CB   C  -0.124  -5.504   6.073 1.00 . A A .   8 ILE CB   1 1 
        3  3676 1 1   8 ILE CD1  C   1.875  -4.308   7.203 1.00 . A A .   8 ILE CD1  1 1 
        3  3677 1 1   8 ILE CG1  C   1.005  -4.438   5.970 1.00 . A A .   8 ILE CG1  1 1 
        3  3678 1 1   8 ILE CG2  C   0.467  -6.910   6.380 1.00 . A A .   8 ILE CG2  1 1 
        3  3679 1 1   8 ILE H    H  -1.912  -3.650   5.153 1.00 . A A .   8 ILE H    1 1 
        3  3680 1 1   8 ILE HA   H  -0.382  -5.865   3.931 1.00 . A A .   8 ILE HA   1 1 
        3  3681 1 1   8 ILE HB   H  -0.774  -5.236   6.908 1.00 . A A .   8 ILE HB   1 1 
        3  3682 1 1   8 ILE HD11 H   1.269  -3.993   8.043 1.00 . A A .   8 ILE HD11 1 1 
        3  3683 1 1   8 ILE HD12 H   2.638  -3.569   7.019 1.00 . A A .   8 ILE HD12 1 1 
        3  3684 1 1   8 ILE HD13 H   2.339  -5.257   7.427 1.00 . A A .   8 ILE HD13 1 1 
        3  3685 1 1   8 ILE HG12 H   1.655  -4.680   5.144 1.00 . A A .   8 ILE HG12 1 1 
        3  3686 1 1   8 ILE HG13 H   0.559  -3.466   5.787 1.00 . A A .   8 ILE HG13 1 1 
        3  3687 1 1   8 ILE HG21 H   1.117  -7.220   5.570 1.00 . A A .   8 ILE HG21 1 1 
        3  3688 1 1   8 ILE HG22 H  -0.334  -7.631   6.485 1.00 . A A .   8 ILE HG22 1 1 
        3  3689 1 1   8 ILE HG23 H   1.036  -6.880   7.302 1.00 . A A .   8 ILE HG23 1 1 
        3  3690 1 1   8 ILE N    N  -1.516  -4.177   4.434 1.00 . A A .   8 ILE N    1 1 
        3  3691 1 1   8 ILE O    O  -3.183  -6.109   5.604 1.00 . A A .   8 ILE O    1 1 
        3  3692 1 1   9 SER C    C  -2.374 -10.083   4.217 1.00 . A A .   9 SER C    1 1 
        3  3693 1 1   9 SER CA   C  -3.054  -8.751   4.553 1.00 . A A .   9 SER CA   1 1 
        3  3694 1 1   9 SER CB   C  -4.307  -8.535   3.665 1.00 . A A .   9 SER CB   1 1 
        3  3695 1 1   9 SER H    H  -1.324  -7.829   3.766 1.00 . A A .   9 SER H    1 1 
        3  3696 1 1   9 SER HA   H  -3.352  -8.765   5.602 1.00 . A A .   9 SER HA   1 1 
        3  3697 1 1   9 SER HB2  H  -4.770  -7.591   3.924 1.00 . A A .   9 SER HB2  1 1 
        3  3698 1 1   9 SER HB3  H  -4.012  -8.508   2.628 1.00 . A A .   9 SER HB3  1 1 
        3  3699 1 1   9 SER HG   H  -6.148  -9.171   3.888 1.00 . A A .   9 SER HG   1 1 
        3  3700 1 1   9 SER N    N  -2.088  -7.666   4.363 1.00 . A A .   9 SER N    1 1 
        3  3701 1 1   9 SER O    O  -1.385 -10.115   3.464 1.00 . A A .   9 SER O    1 1 
        3  3702 1 1   9 SER OG   O  -5.271  -9.565   3.836 1.00 . A A .   9 SER OG   1 1 
        3  3703 1 1  10 THR C    C  -2.911 -13.064   3.213 1.00 . A A .  10 THR C    1 1 
        3  3704 1 1  10 THR CA   C  -2.399 -12.520   4.552 1.00 . A A .  10 THR CA   1 1 
        3  3705 1 1  10 THR CB   C  -2.827 -13.459   5.729 1.00 . A A .  10 THR CB   1 1 
        3  3706 1 1  10 THR CG2  C  -2.094 -13.108   7.026 1.00 . A A .  10 THR CG2  1 1 
        3  3707 1 1  10 THR H    H  -3.685 -11.053   5.372 1.00 . A A .  10 THR H    1 1 
        3  3708 1 1  10 THR HA   H  -1.311 -12.480   4.524 1.00 . A A .  10 THR HA   1 1 
        3  3709 1 1  10 THR HB   H  -2.588 -14.487   5.466 1.00 . A A .  10 THR HB   1 1 
        3  3710 1 1  10 THR HG1  H  -4.713 -13.820   5.250 1.00 . A A .  10 THR HG1  1 1 
        3  3711 1 1  10 THR HG21 H  -2.401 -13.786   7.813 1.00 . A A .  10 THR HG21 1 1 
        3  3712 1 1  10 THR HG22 H  -2.335 -12.092   7.319 1.00 . A A .  10 THR HG22 1 1 
        3  3713 1 1  10 THR HG23 H  -1.026 -13.194   6.881 1.00 . A A .  10 THR HG23 1 1 
        3  3714 1 1  10 THR N    N  -2.905 -11.165   4.783 1.00 . A A .  10 THR N    1 1 
        3  3715 1 1  10 THR O    O  -2.160 -13.680   2.447 1.00 . A A .  10 THR O    1 1 
        3  3716 1 1  10 THR OG1  O  -4.243 -13.360   5.951 1.00 . A A .  10 THR OG1  1 1 
        3  3717 1 1  11 ASP C    C  -4.537 -12.417   0.537 1.00 . A A .  11 ASP C    1 1 
        3  3718 1 1  11 ASP CA   C  -4.890 -13.291   1.746 1.00 . A A .  11 ASP CA   1 1 
        3  3719 1 1  11 ASP CB   C  -6.418 -13.277   1.971 1.00 . A A .  11 ASP CB   1 1 
        3  3720 1 1  11 ASP CG   C  -6.831 -14.042   3.225 1.00 . A A .  11 ASP CG   1 1 
        3  3721 1 1  11 ASP H    H  -4.696 -12.232   3.566 1.00 . A A .  11 ASP H    1 1 
        3  3722 1 1  11 ASP HA   H  -4.570 -14.316   1.558 1.00 . A A .  11 ASP HA   1 1 
        3  3723 1 1  11 ASP HB2  H  -6.754 -12.244   2.062 1.00 . A A .  11 ASP HB2  1 1 
        3  3724 1 1  11 ASP HB3  H  -6.910 -13.719   1.109 1.00 . A A .  11 ASP HB3  1 1 
        3  3725 1 1  11 ASP N    N  -4.192 -12.797   2.937 1.00 . A A .  11 ASP N    1 1 
        3  3726 1 1  11 ASP O    O  -5.106 -11.331   0.369 1.00 . A A .  11 ASP O    1 1 
        3  3727 1 1  11 ASP OD1  O  -6.816 -13.443   4.320 1.00 . A A .  11 ASP OD1  1 1 
        3  3728 1 1  11 ASP OD2  O  -7.150 -15.248   3.134 1.00 . A A .  11 ASP OD2  1 1 
        3  3729 1 1  12 THR C    C  -4.360 -12.184  -2.545 1.00 . A A .  12 THR C    1 1 
        3  3730 1 1  12 THR CA   C  -3.182 -12.253  -1.553 1.00 . A A .  12 THR CA   1 1 
        3  3731 1 1  12 THR CB   C  -1.977 -13.026  -2.186 1.00 . A A .  12 THR CB   1 1 
        3  3732 1 1  12 THR CG2  C  -0.753 -13.036  -1.246 1.00 . A A .  12 THR CG2  1 1 
        3  3733 1 1  12 THR H    H  -3.137 -13.724  -0.021 1.00 . A A .  12 THR H    1 1 
        3  3734 1 1  12 THR HA   H  -2.860 -11.241  -1.327 1.00 . A A .  12 THR HA   1 1 
        3  3735 1 1  12 THR HB   H  -1.694 -12.545  -3.118 1.00 . A A .  12 THR HB   1 1 
        3  3736 1 1  12 THR HG1  H  -2.674 -14.461  -3.369 1.00 . A A .  12 THR HG1  1 1 
        3  3737 1 1  12 THR HG21 H   0.061 -13.579  -1.709 1.00 . A A .  12 THR HG21 1 1 
        3  3738 1 1  12 THR HG22 H  -1.013 -13.516  -0.309 1.00 . A A .  12 THR HG22 1 1 
        3  3739 1 1  12 THR HG23 H  -0.433 -12.021  -1.047 1.00 . A A .  12 THR HG23 1 1 
        3  3740 1 1  12 THR N    N  -3.591 -12.898  -0.284 1.00 . A A .  12 THR N    1 1 
        3  3741 1 1  12 THR O    O  -4.405 -11.315  -3.422 1.00 . A A .  12 THR O    1 1 
        3  3742 1 1  12 THR OG1  O  -2.359 -14.389  -2.463 1.00 . A A .  12 THR OG1  1 1 
        3  3743 1 1  13 ASN C    C  -7.417 -11.918  -2.876 1.00 . A A .  13 ASN C    1 1 
        3  3744 1 1  13 ASN CA   C  -6.575 -13.183  -3.113 1.00 . A A .  13 ASN CA   1 1 
        3  3745 1 1  13 ASN CB   C  -7.385 -14.435  -2.677 1.00 . A A .  13 ASN CB   1 1 
        3  3746 1 1  13 ASN CG   C  -6.558 -15.722  -2.737 1.00 . A A .  13 ASN CG   1 1 
        3  3747 1 1  13 ASN H    H  -5.124 -13.810  -1.698 1.00 . A A .  13 ASN H    1 1 
        3  3748 1 1  13 ASN HA   H  -6.335 -13.265  -4.167 1.00 . A A .  13 ASN HA   1 1 
        3  3749 1 1  13 ASN HB2  H  -7.739 -14.304  -1.656 1.00 . A A .  13 ASN HB2  1 1 
        3  3750 1 1  13 ASN HB3  H  -8.245 -14.544  -3.328 1.00 . A A .  13 ASN HB3  1 1 
        3  3751 1 1  13 ASN HD21 H  -7.121 -16.081  -4.614 1.00 . A A .  13 ASN HD21 1 1 
        3  3752 1 1  13 ASN HD22 H  -6.074 -17.259  -3.903 1.00 . A A .  13 ASN HD22 1 1 
        3  3753 1 1  13 ASN N    N  -5.303 -13.116  -2.364 1.00 . A A .  13 ASN N    1 1 
        3  3754 1 1  13 ASN ND2  N  -6.583 -16.422  -3.866 1.00 . A A .  13 ASN ND2  1 1 
        3  3755 1 1  13 ASN O    O  -7.868 -11.275  -3.826 1.00 . A A .  13 ASN O    1 1 
        3  3756 1 1  13 ASN OD1  O  -5.882 -16.071  -1.768 1.00 . A A .  13 ASN OD1  1 1 
        3  3757 1 1  14 ILE C    C  -7.668  -9.091  -1.572 1.00 . A A .  14 ILE C    1 1 
        3  3758 1 1  14 ILE CA   C  -8.373 -10.393  -1.146 1.00 . A A .  14 ILE CA   1 1 
        3  3759 1 1  14 ILE CB   C  -8.595 -10.422   0.420 1.00 . A A .  14 ILE CB   1 1 
        3  3760 1 1  14 ILE CD1  C -10.887 -11.670   0.233 1.00 . A A .  14 ILE CD1  1 1 
        3  3761 1 1  14 ILE CG1  C  -9.485 -11.639   0.841 1.00 . A A .  14 ILE CG1  1 1 
        3  3762 1 1  14 ILE CG2  C  -9.182  -9.097   0.957 1.00 . A A .  14 ILE CG2  1 1 
        3  3763 1 1  14 ILE H    H  -7.176 -12.132  -0.897 1.00 . A A .  14 ILE H    1 1 
        3  3764 1 1  14 ILE HA   H  -9.347 -10.441  -1.632 1.00 . A A .  14 ILE HA   1 1 
        3  3765 1 1  14 ILE HB   H  -7.616 -10.543   0.884 1.00 . A A .  14 ILE HB   1 1 
        3  3766 1 1  14 ILE HD11 H -11.438 -10.785   0.531 1.00 . A A .  14 ILE HD11 1 1 
        3  3767 1 1  14 ILE HD12 H -11.408 -12.548   0.588 1.00 . A A .  14 ILE HD12 1 1 
        3  3768 1 1  14 ILE HD13 H -10.821 -11.706  -0.844 1.00 . A A .  14 ILE HD13 1 1 
        3  3769 1 1  14 ILE HG12 H  -8.988 -12.552   0.545 1.00 . A A .  14 ILE HG12 1 1 
        3  3770 1 1  14 ILE HG13 H  -9.594 -11.642   1.920 1.00 . A A .  14 ILE HG13 1 1 
        3  3771 1 1  14 ILE HG21 H -10.147  -8.912   0.503 1.00 . A A .  14 ILE HG21 1 1 
        3  3772 1 1  14 ILE HG22 H  -8.515  -8.280   0.721 1.00 . A A .  14 ILE HG22 1 1 
        3  3773 1 1  14 ILE HG23 H  -9.301  -9.158   2.031 1.00 . A A .  14 ILE HG23 1 1 
        3  3774 1 1  14 ILE N    N  -7.593 -11.572  -1.584 1.00 . A A .  14 ILE N    1 1 
        3  3775 1 1  14 ILE O    O  -8.306  -8.180  -2.104 1.00 . A A .  14 ILE O    1 1 
        3  3776 1 1  15 ILE C    C  -5.652  -7.564  -3.226 1.00 . A A .  15 ILE C    1 1 
        3  3777 1 1  15 ILE CA   C  -5.450  -7.941  -1.737 1.00 . A A .  15 ILE CA   1 1 
        3  3778 1 1  15 ILE CB   C  -3.955  -8.377  -1.465 1.00 . A A .  15 ILE CB   1 1 
        3  3779 1 1  15 ILE CD1  C  -2.313  -8.968   0.443 1.00 . A A .  15 ILE CD1  1 1 
        3  3780 1 1  15 ILE CG1  C  -3.684  -8.448   0.068 1.00 . A A .  15 ILE CG1  1 1 
        3  3781 1 1  15 ILE CG2  C  -2.932  -7.470  -2.171 1.00 . A A .  15 ILE CG2  1 1 
        3  3782 1 1  15 ILE H    H  -5.953  -9.805  -0.858 1.00 . A A .  15 ILE H    1 1 
        3  3783 1 1  15 ILE HA   H  -5.676  -7.077  -1.116 1.00 . A A .  15 ILE HA   1 1 
        3  3784 1 1  15 ILE HB   H  -3.829  -9.377  -1.875 1.00 . A A .  15 ILE HB   1 1 
        3  3785 1 1  15 ILE HD11 H  -2.175  -9.959   0.033 1.00 . A A .  15 ILE HD11 1 1 
        3  3786 1 1  15 ILE HD12 H  -2.232  -9.013   1.519 1.00 . A A .  15 ILE HD12 1 1 
        3  3787 1 1  15 ILE HD13 H  -1.550  -8.306   0.056 1.00 . A A .  15 ILE HD13 1 1 
        3  3788 1 1  15 ILE HG12 H  -3.785  -7.459   0.498 1.00 . A A .  15 ILE HG12 1 1 
        3  3789 1 1  15 ILE HG13 H  -4.415  -9.101   0.529 1.00 . A A .  15 ILE HG13 1 1 
        3  3790 1 1  15 ILE HG21 H  -3.098  -7.486  -3.239 1.00 . A A .  15 ILE HG21 1 1 
        3  3791 1 1  15 ILE HG22 H  -1.924  -7.813  -1.965 1.00 . A A .  15 ILE HG22 1 1 
        3  3792 1 1  15 ILE HG23 H  -3.041  -6.459  -1.808 1.00 . A A .  15 ILE HG23 1 1 
        3  3793 1 1  15 ILE N    N  -6.348  -9.047  -1.333 1.00 . A A .  15 ILE N    1 1 
        3  3794 1 1  15 ILE O    O  -5.957  -6.405  -3.560 1.00 . A A .  15 ILE O    1 1 
        3  3795 1 1  16 SER C    C  -7.059  -8.016  -5.957 1.00 . A A .  16 SER C    1 1 
        3  3796 1 1  16 SER CA   C  -5.645  -8.459  -5.544 1.00 . A A .  16 SER CA   1 1 
        3  3797 1 1  16 SER CB   C  -5.275  -9.809  -6.208 1.00 . A A .  16 SER CB   1 1 
        3  3798 1 1  16 SER H    H  -5.386  -9.483  -3.717 1.00 . A A .  16 SER H    1 1 
        3  3799 1 1  16 SER HA   H  -4.939  -7.702  -5.865 1.00 . A A .  16 SER HA   1 1 
        3  3800 1 1  16 SER HB2  H  -4.282 -10.097  -5.897 1.00 . A A .  16 SER HB2  1 1 
        3  3801 1 1  16 SER HB3  H  -5.979 -10.577  -5.900 1.00 . A A .  16 SER HB3  1 1 
        3  3802 1 1  16 SER HG   H  -5.342  -8.788  -7.869 1.00 . A A .  16 SER HG   1 1 
        3  3803 1 1  16 SER N    N  -5.537  -8.589  -4.086 1.00 . A A .  16 SER N    1 1 
        3  3804 1 1  16 SER O    O  -7.220  -7.089  -6.755 1.00 . A A .  16 SER O    1 1 
        3  3805 1 1  16 SER OG   O  -5.293  -9.718  -7.618 1.00 . A A .  16 SER OG   1 1 
        3  3806 1 1  17 SER C    C  -9.869  -6.948  -5.419 1.00 . A A .  17 SER C    1 1 
        3  3807 1 1  17 SER CA   C  -9.485  -8.424  -5.653 1.00 . A A .  17 SER CA   1 1 
        3  3808 1 1  17 SER CB   C -10.354  -9.364  -4.792 1.00 . A A .  17 SER CB   1 1 
        3  3809 1 1  17 SER H    H  -7.839  -9.336  -4.678 1.00 . A A .  17 SER H    1 1 
        3  3810 1 1  17 SER HA   H  -9.640  -8.668  -6.699 1.00 . A A .  17 SER HA   1 1 
        3  3811 1 1  17 SER HB2  H -10.066 -10.388  -4.980 1.00 . A A .  17 SER HB2  1 1 
        3  3812 1 1  17 SER HB3  H -10.205  -9.138  -3.743 1.00 . A A .  17 SER HB3  1 1 
        3  3813 1 1  17 SER HG   H -12.249  -9.281  -4.279 1.00 . A A .  17 SER HG   1 1 
        3  3814 1 1  17 SER N    N  -8.064  -8.664  -5.355 1.00 . A A .  17 SER N    1 1 
        3  3815 1 1  17 SER O    O -10.301  -6.259  -6.347 1.00 . A A .  17 SER O    1 1 
        3  3816 1 1  17 SER OG   O -11.730  -9.223  -5.094 1.00 . A A .  17 SER OG   1 1 
        3  3817 1 1  18 VAL C    C  -9.208  -4.067  -4.651 1.00 . A A .  18 VAL C    1 1 
        3  3818 1 1  18 VAL CA   C  -9.912  -5.087  -3.749 1.00 . A A .  18 VAL CA   1 1 
        3  3819 1 1  18 VAL CB   C  -9.442  -4.873  -2.259 1.00 . A A .  18 VAL CB   1 1 
        3  3820 1 1  18 VAL CG1  C  -9.517  -3.389  -1.835 1.00 . A A .  18 VAL CG1  1 1 
        3  3821 1 1  18 VAL CG2  C -10.260  -5.765  -1.306 1.00 . A A .  18 VAL CG2  1 1 
        3  3822 1 1  18 VAL H    H  -9.246  -7.084  -3.527 1.00 . A A .  18 VAL H    1 1 
        3  3823 1 1  18 VAL HA   H -10.984  -4.925  -3.800 1.00 . A A .  18 VAL HA   1 1 
        3  3824 1 1  18 VAL HB   H  -8.397  -5.181  -2.183 1.00 . A A .  18 VAL HB   1 1 
        3  3825 1 1  18 VAL HG11 H -10.538  -3.033  -1.918 1.00 . A A .  18 VAL HG11 1 1 
        3  3826 1 1  18 VAL HG12 H  -8.880  -2.792  -2.476 1.00 . A A .  18 VAL HG12 1 1 
        3  3827 1 1  18 VAL HG13 H  -9.186  -3.281  -0.812 1.00 . A A .  18 VAL HG13 1 1 
        3  3828 1 1  18 VAL HG21 H -10.158  -6.801  -1.602 1.00 . A A .  18 VAL HG21 1 1 
        3  3829 1 1  18 VAL HG22 H -11.308  -5.484  -1.346 1.00 . A A .  18 VAL HG22 1 1 
        3  3830 1 1  18 VAL HG23 H  -9.900  -5.650  -0.293 1.00 . A A .  18 VAL HG23 1 1 
        3  3831 1 1  18 VAL N    N  -9.636  -6.474  -4.180 1.00 . A A .  18 VAL N    1 1 
        3  3832 1 1  18 VAL O    O  -9.828  -3.095  -5.100 1.00 . A A .  18 VAL O    1 1 
        3  3833 1 1  19 GLN C    C  -7.600  -3.144  -7.085 1.00 . A A .  19 GLN C    1 1 
        3  3834 1 1  19 GLN CA   C  -7.052  -3.423  -5.673 1.00 . A A .  19 GLN CA   1 1 
        3  3835 1 1  19 GLN CB   C  -5.641  -4.029  -5.752 1.00 . A A .  19 GLN CB   1 1 
        3  3836 1 1  19 GLN CD   C  -3.213  -3.755  -6.534 1.00 . A A .  19 GLN CD   1 1 
        3  3837 1 1  19 GLN CG   C  -4.599  -3.126  -6.419 1.00 . A A .  19 GLN CG   1 1 
        3  3838 1 1  19 GLN H    H  -7.533  -5.167  -4.569 1.00 . A A .  19 GLN H    1 1 
        3  3839 1 1  19 GLN HA   H  -7.003  -2.487  -5.130 1.00 . A A .  19 GLN HA   1 1 
        3  3840 1 1  19 GLN HB2  H  -5.301  -4.245  -4.744 1.00 . A A .  19 GLN HB2  1 1 
        3  3841 1 1  19 GLN HB3  H  -5.685  -4.963  -6.306 1.00 . A A .  19 GLN HB3  1 1 
        3  3842 1 1  19 GLN HE21 H  -3.453  -4.798  -4.841 1.00 . A A .  19 GLN HE21 1 1 
        3  3843 1 1  19 GLN HE22 H  -1.937  -5.001  -5.642 1.00 . A A .  19 GLN HE22 1 1 
        3  3844 1 1  19 GLN HG2  H  -4.946  -2.878  -7.415 1.00 . A A .  19 GLN HG2  1 1 
        3  3845 1 1  19 GLN HG3  H  -4.509  -2.209  -5.844 1.00 . A A .  19 GLN HG3  1 1 
        3  3846 1 1  19 GLN N    N  -7.921  -4.327  -4.911 1.00 . A A .  19 GLN N    1 1 
        3  3847 1 1  19 GLN NE2  N  -2.832  -4.606  -5.577 1.00 . A A .  19 GLN NE2  1 1 
        3  3848 1 1  19 GLN O    O  -7.689  -1.986  -7.504 1.00 . A A .  19 GLN O    1 1 
        3  3849 1 1  19 GLN OE1  O  -2.478  -3.463  -7.477 1.00 . A A .  19 GLN OE1  1 1 
        3  3850 1 1  20 GLU C    C  -9.856  -3.398  -9.223 1.00 . A A .  20 GLU C    1 1 
        3  3851 1 1  20 GLU CA   C  -8.500  -4.116  -9.169 1.00 . A A .  20 GLU CA   1 1 
        3  3852 1 1  20 GLU CB   C  -8.591  -5.521  -9.809 1.00 . A A .  20 GLU CB   1 1 
        3  3853 1 1  20 GLU CD   C  -6.106  -5.480 -10.470 1.00 . A A .  20 GLU CD   1 1 
        3  3854 1 1  20 GLU CG   C  -7.257  -6.289  -9.846 1.00 . A A .  20 GLU CG   1 1 
        3  3855 1 1  20 GLU H    H  -7.956  -5.096  -7.361 1.00 . A A .  20 GLU H    1 1 
        3  3856 1 1  20 GLU HA   H  -7.781  -3.528  -9.736 1.00 . A A .  20 GLU HA   1 1 
        3  3857 1 1  20 GLU HB2  H  -9.310  -6.114  -9.250 1.00 . A A .  20 GLU HB2  1 1 
        3  3858 1 1  20 GLU HB3  H  -8.950  -5.419 -10.826 1.00 . A A .  20 GLU HB3  1 1 
        3  3859 1 1  20 GLU HG2  H  -6.989  -6.563  -8.830 1.00 . A A .  20 GLU HG2  1 1 
        3  3860 1 1  20 GLU HG3  H  -7.396  -7.199 -10.421 1.00 . A A .  20 GLU HG3  1 1 
        3  3861 1 1  20 GLU N    N  -7.997  -4.213  -7.787 1.00 . A A .  20 GLU N    1 1 
        3  3862 1 1  20 GLU O    O -10.100  -2.592 -10.124 1.00 . A A .  20 GLU O    1 1 
        3  3863 1 1  20 GLU OE1  O  -6.051  -5.372 -11.710 1.00 . A A .  20 GLU OE1  1 1 
        3  3864 1 1  20 GLU OE2  O  -5.253  -4.942  -9.723 1.00 . A A .  20 GLU OE2  1 1 
        3  3865 1 1  21 ARG C    C -11.852  -1.511  -7.827 1.00 . A A .  21 ARG C    1 1 
        3  3866 1 1  21 ARG CA   C -12.029  -3.015  -8.092 1.00 . A A .  21 ARG CA   1 1 
        3  3867 1 1  21 ARG CB   C -12.837  -3.678  -6.945 1.00 . A A .  21 ARG CB   1 1 
        3  3868 1 1  21 ARG CD   C -13.729  -5.891  -5.939 1.00 . A A .  21 ARG CD   1 1 
        3  3869 1 1  21 ARG CG   C -13.070  -5.189  -7.148 1.00 . A A .  21 ARG CG   1 1 
        3  3870 1 1  21 ARG CZ   C -14.657  -8.243  -5.886 1.00 . A A .  21 ARG CZ   1 1 
        3  3871 1 1  21 ARG H    H -10.449  -4.342  -7.563 1.00 . A A .  21 ARG H    1 1 
        3  3872 1 1  21 ARG HA   H -12.567  -3.142  -9.028 1.00 . A A .  21 ARG HA   1 1 
        3  3873 1 1  21 ARG HB2  H -12.292  -3.538  -6.015 1.00 . A A .  21 ARG HB2  1 1 
        3  3874 1 1  21 ARG HB3  H -13.803  -3.186  -6.858 1.00 . A A .  21 ARG HB3  1 1 
        3  3875 1 1  21 ARG HD2  H -13.214  -5.595  -5.034 1.00 . A A .  21 ARG HD2  1 1 
        3  3876 1 1  21 ARG HD3  H -14.768  -5.586  -5.876 1.00 . A A .  21 ARG HD3  1 1 
        3  3877 1 1  21 ARG HE   H -12.766  -7.725  -6.295 1.00 . A A .  21 ARG HE   1 1 
        3  3878 1 1  21 ARG HG2  H -13.697  -5.334  -8.020 1.00 . A A .  21 ARG HG2  1 1 
        3  3879 1 1  21 ARG HG3  H -12.108  -5.653  -7.333 1.00 . A A .  21 ARG HG3  1 1 
        3  3880 1 1  21 ARG HH11 H -16.071  -6.855  -5.451 1.00 . A A .  21 ARG HH11 1 1 
        3  3881 1 1  21 ARG HH12 H -16.630  -8.497  -5.434 1.00 . A A .  21 ARG HH12 1 1 
        3  3882 1 1  21 ARG HH21 H -13.488  -9.862  -6.270 1.00 . A A .  21 ARG HH21 1 1 
        3  3883 1 1  21 ARG HH22 H -15.153 -10.211  -5.899 1.00 . A A .  21 ARG HH22 1 1 
        3  3884 1 1  21 ARG N    N -10.713  -3.677  -8.232 1.00 . A A .  21 ARG N    1 1 
        3  3885 1 1  21 ARG NE   N -13.651  -7.364  -6.069 1.00 . A A .  21 ARG NE   1 1 
        3  3886 1 1  21 ARG NH1  N -15.882  -7.832  -5.563 1.00 . A A .  21 ARG NH1  1 1 
        3  3887 1 1  21 ARG NH2  N -14.413  -9.542  -6.028 1.00 . A A .  21 ARG NH2  1 1 
        3  3888 1 1  21 ARG O    O -12.637  -0.693  -8.303 1.00 . A A .  21 ARG O    1 1 
        3  3889 1 1  22 ALA C    C  -9.817   0.941  -7.988 1.00 . A A .  22 ALA C    1 1 
        3  3890 1 1  22 ALA CA   C -10.427   0.220  -6.764 1.00 . A A .  22 ALA CA   1 1 
        3  3891 1 1  22 ALA CB   C  -9.465   0.253  -5.566 1.00 . A A .  22 ALA CB   1 1 
        3  3892 1 1  22 ALA H    H -10.202  -1.886  -6.756 1.00 . A A .  22 ALA H    1 1 
        3  3893 1 1  22 ALA HA   H -11.341   0.740  -6.473 1.00 . A A .  22 ALA HA   1 1 
        3  3894 1 1  22 ALA HB1  H  -8.544  -0.258  -5.822 1.00 . A A .  22 ALA HB1  1 1 
        3  3895 1 1  22 ALA HB2  H  -9.921  -0.244  -4.718 1.00 . A A .  22 ALA HB2  1 1 
        3  3896 1 1  22 ALA HB3  H  -9.242   1.278  -5.298 1.00 . A A .  22 ALA HB3  1 1 
        3  3897 1 1  22 ALA N    N -10.781  -1.170  -7.089 1.00 . A A .  22 ALA N    1 1 
        3  3898 1 1  22 ALA O    O  -9.948   2.149  -8.124 1.00 . A A .  22 ALA O    1 1 
        3  3899 1 1  23 LYS C    C  -9.716   1.018 -11.143 1.00 . A A .  23 LYS C    1 1 
        3  3900 1 1  23 LYS CA   C  -8.589   0.716 -10.135 1.00 . A A .  23 LYS CA   1 1 
        3  3901 1 1  23 LYS CB   C  -7.569  -0.284 -10.749 1.00 . A A .  23 LYS CB   1 1 
        3  3902 1 1  23 LYS CD   C  -5.331  -1.528 -10.517 1.00 . A A .  23 LYS CD   1 1 
        3  3903 1 1  23 LYS CE   C  -3.993  -1.628  -9.767 1.00 . A A .  23 LYS CE   1 1 
        3  3904 1 1  23 LYS CG   C  -6.268  -0.447  -9.934 1.00 . A A .  23 LYS CG   1 1 
        3  3905 1 1  23 LYS H    H  -8.996  -0.764  -8.653 1.00 . A A .  23 LYS H    1 1 
        3  3906 1 1  23 LYS HA   H  -8.074   1.647  -9.904 1.00 . A A .  23 LYS HA   1 1 
        3  3907 1 1  23 LYS HB2  H  -8.048  -1.259 -10.831 1.00 . A A .  23 LYS HB2  1 1 
        3  3908 1 1  23 LYS HB3  H  -7.304   0.050 -11.749 1.00 . A A .  23 LYS HB3  1 1 
        3  3909 1 1  23 LYS HD2  H  -5.831  -2.491 -10.464 1.00 . A A .  23 LYS HD2  1 1 
        3  3910 1 1  23 LYS HD3  H  -5.130  -1.296 -11.559 1.00 . A A .  23 LYS HD3  1 1 
        3  3911 1 1  23 LYS HE2  H  -3.407  -0.738  -9.966 1.00 . A A .  23 LYS HE2  1 1 
        3  3912 1 1  23 LYS HE3  H  -4.185  -1.692  -8.699 1.00 . A A .  23 LYS HE3  1 1 
        3  3913 1 1  23 LYS HG2  H  -5.743   0.503  -9.922 1.00 . A A .  23 LYS HG2  1 1 
        3  3914 1 1  23 LYS HG3  H  -6.525  -0.718  -8.915 1.00 . A A .  23 LYS HG3  1 1 
        3  3915 1 1  23 LYS HZ1  H  -2.325  -2.895  -9.639 1.00 . A A .  23 LYS HZ1  1 1 
        3  3916 1 1  23 LYS HZ2  H  -2.972  -2.770 -11.200 1.00 . A A .  23 LYS HZ2  1 1 
        3  3917 1 1  23 LYS HZ3  H  -3.762  -3.692 -10.025 1.00 . A A .  23 LYS HZ3  1 1 
        3  3918 1 1  23 LYS N    N  -9.142   0.182  -8.867 1.00 . A A .  23 LYS N    1 1 
        3  3919 1 1  23 LYS NZ   N  -3.207  -2.828 -10.186 1.00 . A A .  23 LYS NZ   1 1 
        3  3920 1 1  23 LYS O    O  -9.719   2.071 -11.793 1.00 . A A .  23 LYS O    1 1 
        3  3921 1 1  24 HIS C    C -12.882   1.156 -11.696 1.00 . A A .  24 HIS C    1 1 
        3  3922 1 1  24 HIS CA   C -11.798   0.204 -12.216 1.00 . A A .  24 HIS CA   1 1 
        3  3923 1 1  24 HIS CB   C -12.399  -1.191 -12.547 1.00 . A A .  24 HIS CB   1 1 
        3  3924 1 1  24 HIS CD2  C -10.763  -3.181 -12.995 1.00 . A A .  24 HIS CD2  1 1 
        3  3925 1 1  24 HIS CE1  C -10.339  -2.777 -15.102 1.00 . A A .  24 HIS CE1  1 1 
        3  3926 1 1  24 HIS CG   C -11.475  -2.083 -13.345 1.00 . A A .  24 HIS CG   1 1 
        3  3927 1 1  24 HIS H    H -10.625  -0.704 -10.684 1.00 . A A .  24 HIS H    1 1 
        3  3928 1 1  24 HIS HA   H -11.403   0.630 -13.135 1.00 . A A .  24 HIS HA   1 1 
        3  3929 1 1  24 HIS HB2  H -12.651  -1.703 -11.627 1.00 . A A .  24 HIS HB2  1 1 
        3  3930 1 1  24 HIS HB3  H -13.305  -1.063 -13.130 1.00 . A A .  24 HIS HB3  1 1 
        3  3931 1 1  24 HIS HD1  H -11.557  -1.146 -15.233 1.00 . A A .  24 HIS HD1  1 1 
        3  3932 1 1  24 HIS HD2  H -10.745  -3.652 -12.015 1.00 . A A .  24 HIS HD2  1 1 
        3  3933 1 1  24 HIS HE1  H  -9.936  -2.852 -16.103 1.00 . A A .  24 HIS HE1  1 1 
        3  3934 1 1  24 HIS HE2  H  -9.582  -4.429 -14.188 1.00 . A A .  24 HIS HE2  1 1 
        3  3935 1 1  24 HIS N    N -10.675   0.085 -11.262 1.00 . A A .  24 HIS N    1 1 
        3  3936 1 1  24 HIS ND1  N -11.182  -1.861 -14.677 1.00 . A A .  24 HIS ND1  1 1 
        3  3937 1 1  24 HIS NE2  N -10.069  -3.588 -14.105 1.00 . A A .  24 HIS NE2  1 1 
        3  3938 1 1  24 HIS O    O -13.685   1.651 -12.484 1.00 . A A .  24 HIS O    1 1 
        3  3939 1 1  25 ASN C    C -13.221   3.783  -9.780 1.00 . A A .  25 ASN C    1 1 
        3  3940 1 1  25 ASN CA   C -13.845   2.374  -9.767 1.00 . A A .  25 ASN CA   1 1 
        3  3941 1 1  25 ASN CB   C -14.246   1.954  -8.320 1.00 . A A .  25 ASN CB   1 1 
        3  3942 1 1  25 ASN CG   C -15.390   2.786  -7.720 1.00 . A A .  25 ASN CG   1 1 
        3  3943 1 1  25 ASN H    H -12.317   0.882  -9.790 1.00 . A A .  25 ASN H    1 1 
        3  3944 1 1  25 ASN HA   H -14.746   2.401 -10.381 1.00 . A A .  25 ASN HA   1 1 
        3  3945 1 1  25 ASN HB2  H -14.567   0.921  -8.334 1.00 . A A .  25 ASN HB2  1 1 
        3  3946 1 1  25 ASN HB3  H -13.377   2.036  -7.669 1.00 . A A .  25 ASN HB3  1 1 
        3  3947 1 1  25 ASN HD21 H -14.794   2.358  -5.877 1.00 . A A .  25 ASN HD21 1 1 
        3  3948 1 1  25 ASN HD22 H -16.188   3.373  -6.010 1.00 . A A .  25 ASN HD22 1 1 
        3  3949 1 1  25 ASN N    N -12.918   1.391 -10.373 1.00 . A A .  25 ASN N    1 1 
        3  3950 1 1  25 ASN ND2  N -15.464   2.843  -6.406 1.00 . A A .  25 ASN ND2  1 1 
        3  3951 1 1  25 ASN O    O -13.920   4.770 -10.010 1.00 . A A .  25 ASN O    1 1 
        3  3952 1 1  25 ASN OD1  O -16.225   3.337  -8.433 1.00 . A A .  25 ASN OD1  1 1 
        3  3953 1 1  26 TYR C    C -10.131   5.191 -10.650 1.00 . A A .  26 TYR C    1 1 
        3  3954 1 1  26 TYR CA   C -11.158   5.156  -9.487 1.00 . A A .  26 TYR CA   1 1 
        3  3955 1 1  26 TYR CB   C -10.483   5.353  -8.091 1.00 . A A .  26 TYR CB   1 1 
        3  3956 1 1  26 TYR CD1  C -12.499   6.025  -6.687 1.00 . A A .  26 TYR CD1  1 1 
        3  3957 1 1  26 TYR CD2  C -11.410   3.970  -6.145 1.00 . A A .  26 TYR CD2  1 1 
        3  3958 1 1  26 TYR CE1  C -13.442   5.778  -5.714 1.00 . A A .  26 TYR CE1  1 1 
        3  3959 1 1  26 TYR CE2  C -12.339   3.731  -5.159 1.00 . A A .  26 TYR CE2  1 1 
        3  3960 1 1  26 TYR CG   C -11.465   5.124  -6.933 1.00 . A A .  26 TYR CG   1 1 
        3  3961 1 1  26 TYR CZ   C -13.356   4.638  -4.954 1.00 . A A .  26 TYR CZ   1 1 
        3  3962 1 1  26 TYR H    H -11.412   3.043  -9.340 1.00 . A A .  26 TYR H    1 1 
        3  3963 1 1  26 TYR HA   H -11.871   5.967  -9.641 1.00 . A A .  26 TYR HA   1 1 
        3  3964 1 1  26 TYR HB2  H  -9.655   4.656  -7.985 1.00 . A A .  26 TYR HB2  1 1 
        3  3965 1 1  26 TYR HB3  H -10.101   6.363  -8.014 1.00 . A A .  26 TYR HB3  1 1 
        3  3966 1 1  26 TYR HD1  H -12.567   6.929  -7.282 1.00 . A A .  26 TYR HD1  1 1 
        3  3967 1 1  26 TYR HD2  H -10.609   3.261  -6.310 1.00 . A A .  26 TYR HD2  1 1 
        3  3968 1 1  26 TYR HE1  H -14.237   6.493  -5.542 1.00 . A A .  26 TYR HE1  1 1 
        3  3969 1 1  26 TYR HE2  H -12.269   2.834  -4.554 1.00 . A A .  26 TYR HE2  1 1 
        3  3970 1 1  26 TYR HH   H -15.191   4.557  -4.374 1.00 . A A .  26 TYR HH   1 1 
        3  3971 1 1  26 TYR N    N -11.902   3.867  -9.521 1.00 . A A .  26 TYR N    1 1 
        3  3972 1 1  26 TYR O    O  -8.987   4.742 -10.490 1.00 . A A .  26 TYR O    1 1 
        3  3973 1 1  26 TYR OH   O -14.317   4.373  -4.009 1.00 . A A .  26 TYR OH   1 1 
        3  3974 1 1  27 PRO C    C  -8.366   6.431 -12.909 1.00 . A A .  27 PRO C    1 1 
        3  3975 1 1  27 PRO CA   C  -9.706   5.692 -13.087 1.00 . A A .  27 PRO CA   1 1 
        3  3976 1 1  27 PRO CB   C -10.589   6.410 -14.146 1.00 . A A .  27 PRO CB   1 1 
        3  3977 1 1  27 PRO CD   C -11.885   6.317 -12.142 1.00 . A A .  27 PRO CD   1 1 
        3  3978 1 1  27 PRO CG   C -11.993   6.263 -13.645 1.00 . A A .  27 PRO CG   1 1 
        3  3979 1 1  27 PRO HA   H  -9.511   4.671 -13.412 1.00 . A A .  27 PRO HA   1 1 
        3  3980 1 1  27 PRO HB2  H -10.314   7.465 -14.221 1.00 . A A .  27 PRO HB2  1 1 
        3  3981 1 1  27 PRO HB3  H -10.480   5.936 -15.114 1.00 . A A .  27 PRO HB3  1 1 
        3  3982 1 1  27 PRO HD2  H -11.913   7.342 -11.789 1.00 . A A .  27 PRO HD2  1 1 
        3  3983 1 1  27 PRO HD3  H -12.679   5.740 -11.685 1.00 . A A .  27 PRO HD3  1 1 
        3  3984 1 1  27 PRO HG2  H -12.606   7.077 -14.014 1.00 . A A .  27 PRO HG2  1 1 
        3  3985 1 1  27 PRO HG3  H -12.414   5.309 -13.956 1.00 . A A .  27 PRO HG3  1 1 
        3  3986 1 1  27 PRO N    N -10.551   5.700 -11.863 1.00 . A A .  27 PRO N    1 1 
        3  3987 1 1  27 PRO O    O  -7.309   5.925 -13.289 1.00 . A A .  27 PRO O    1 1 
        3  3988 1 1  28 GLY C    C  -6.656   8.350 -10.765 1.00 . A A .  28 GLY C    1 1 
        3  3989 1 1  28 GLY CA   C  -7.294   8.505 -12.131 1.00 . A A .  28 GLY CA   1 1 
        3  3990 1 1  28 GLY H    H  -9.311   7.912 -11.973 1.00 . A A .  28 GLY H    1 1 
        3  3991 1 1  28 GLY HA2  H  -6.544   8.301 -12.891 1.00 . A A .  28 GLY HA2  1 1 
        3  3992 1 1  28 GLY HA3  H  -7.630   9.526 -12.248 1.00 . A A .  28 GLY HA3  1 1 
        3  3993 1 1  28 GLY N    N  -8.445   7.624 -12.314 1.00 . A A .  28 GLY N    1 1 
        3  3994 1 1  28 GLY O    O  -6.445   9.345 -10.058 1.00 . A A .  28 GLY O    1 1 
        3  3995 1 1  29 ARG C    C  -4.583   5.708  -9.447 1.00 . A A .  29 ARG C    1 1 
        3  3996 1 1  29 ARG CA   C  -5.633   6.770  -9.146 1.00 . A A .  29 ARG CA   1 1 
        3  3997 1 1  29 ARG CB   C  -6.580   6.279  -8.007 1.00 . A A .  29 ARG CB   1 1 
        3  3998 1 1  29 ARG CD   C  -6.532   8.495  -6.716 1.00 . A A .  29 ARG CD   1 1 
        3  3999 1 1  29 ARG CG   C  -7.413   7.391  -7.339 1.00 . A A .  29 ARG CG   1 1 
        3  4000 1 1  29 ARG CZ   C  -8.043  10.463  -6.564 1.00 . A A .  29 ARG CZ   1 1 
        3  4001 1 1  29 ARG H    H  -6.684   6.347 -10.933 1.00 . A A .  29 ARG H    1 1 
        3  4002 1 1  29 ARG HA   H  -5.120   7.674  -8.808 1.00 . A A .  29 ARG HA   1 1 
        3  4003 1 1  29 ARG HB2  H  -7.266   5.546  -8.417 1.00 . A A .  29 ARG HB2  1 1 
        3  4004 1 1  29 ARG HB3  H  -5.990   5.793  -7.232 1.00 . A A .  29 ARG HB3  1 1 
        3  4005 1 1  29 ARG HD2  H  -5.837   8.042  -6.016 1.00 . A A .  29 ARG HD2  1 1 
        3  4006 1 1  29 ARG HD3  H  -5.976   8.994  -7.499 1.00 . A A .  29 ARG HD3  1 1 
        3  4007 1 1  29 ARG HE   H  -7.345   9.416  -5.010 1.00 . A A .  29 ARG HE   1 1 
        3  4008 1 1  29 ARG HG2  H  -8.066   7.839  -8.077 1.00 . A A .  29 ARG HG2  1 1 
        3  4009 1 1  29 ARG HG3  H  -8.022   6.948  -6.553 1.00 . A A .  29 ARG HG3  1 1 
        3  4010 1 1  29 ARG HH11 H  -7.505  10.028  -8.475 1.00 . A A .  29 ARG HH11 1 1 
        3  4011 1 1  29 ARG HH12 H  -8.576  11.380  -8.299 1.00 . A A .  29 ARG HH12 1 1 
        3  4012 1 1  29 ARG HH21 H  -8.800  11.114  -4.812 1.00 . A A .  29 ARG HH21 1 1 
        3  4013 1 1  29 ARG HH22 H  -9.301  11.985  -6.217 1.00 . A A .  29 ARG HH22 1 1 
        3  4014 1 1  29 ARG N    N  -6.375   7.094 -10.375 1.00 . A A .  29 ARG N    1 1 
        3  4015 1 1  29 ARG NE   N  -7.339   9.483  -5.991 1.00 . A A .  29 ARG NE   1 1 
        3  4016 1 1  29 ARG NH1  N  -8.038  10.638  -7.887 1.00 . A A .  29 ARG NH1  1 1 
        3  4017 1 1  29 ARG NH2  N  -8.770  11.252  -5.807 1.00 . A A .  29 ARG NH2  1 1 
        3  4018 1 1  29 ARG O    O  -4.906   4.638  -9.968 1.00 . A A .  29 ARG O    1 1 
        3  4019 1 1  30 GLU C    C  -2.117   4.316  -7.914 1.00 . A A .  30 GLU C    1 1 
        3  4020 1 1  30 GLU CA   C  -2.192   5.125  -9.219 1.00 . A A .  30 GLU CA   1 1 
        3  4021 1 1  30 GLU CB   C  -0.881   5.934  -9.474 1.00 . A A .  30 GLU CB   1 1 
        3  4022 1 1  30 GLU CD   C  -1.868   7.866 -10.951 1.00 . A A .  30 GLU CD   1 1 
        3  4023 1 1  30 GLU CG   C  -0.833   6.723 -10.814 1.00 . A A .  30 GLU CG   1 1 
        3  4024 1 1  30 GLU H    H  -3.157   6.950  -8.809 1.00 . A A .  30 GLU H    1 1 
        3  4025 1 1  30 GLU HA   H  -2.356   4.447 -10.057 1.00 . A A .  30 GLU HA   1 1 
        3  4026 1 1  30 GLU HB2  H  -0.740   6.644  -8.665 1.00 . A A .  30 GLU HB2  1 1 
        3  4027 1 1  30 GLU HB3  H  -0.042   5.243  -9.467 1.00 . A A .  30 GLU HB3  1 1 
        3  4028 1 1  30 GLU HG2  H   0.157   7.157 -10.919 1.00 . A A .  30 GLU HG2  1 1 
        3  4029 1 1  30 GLU HG3  H  -0.983   6.015 -11.623 1.00 . A A .  30 GLU HG3  1 1 
        3  4030 1 1  30 GLU N    N  -3.329   6.035  -9.127 1.00 . A A .  30 GLU N    1 1 
        3  4031 1 1  30 GLU O    O  -2.113   4.901  -6.823 1.00 . A A .  30 GLU O    1 1 
        3  4032 1 1  30 GLU OE1  O  -1.959   8.706 -10.027 1.00 . A A .  30 GLU OE1  1 1 
        3  4033 1 1  30 GLU OE2  O  -2.595   7.933 -11.972 1.00 . A A .  30 GLU OE2  1 1 
        3  4034 1 1  31 ILE C    C  -0.799   1.194  -7.028 1.00 . A A .  31 ILE C    1 1 
        3  4035 1 1  31 ILE CA   C  -2.044   2.081  -6.866 1.00 . A A .  31 ILE CA   1 1 
        3  4036 1 1  31 ILE CB   C  -3.341   1.193  -6.724 1.00 . A A .  31 ILE CB   1 1 
        3  4037 1 1  31 ILE CD1  C  -5.927   1.322  -6.480 1.00 . A A .  31 ILE CD1  1 1 
        3  4038 1 1  31 ILE CG1  C  -4.622   2.090  -6.615 1.00 . A A .  31 ILE CG1  1 1 
        3  4039 1 1  31 ILE CG2  C  -3.218   0.255  -5.508 1.00 . A A .  31 ILE CG2  1 1 
        3  4040 1 1  31 ILE H    H  -2.196   2.589  -8.919 1.00 . A A .  31 ILE H    1 1 
        3  4041 1 1  31 ILE HA   H  -1.936   2.684  -5.961 1.00 . A A .  31 ILE HA   1 1 
        3  4042 1 1  31 ILE HB   H  -3.427   0.572  -7.618 1.00 . A A .  31 ILE HB   1 1 
        3  4043 1 1  31 ILE HD11 H  -6.750   2.019  -6.458 1.00 . A A .  31 ILE HD11 1 1 
        3  4044 1 1  31 ILE HD12 H  -5.918   0.744  -5.568 1.00 . A A .  31 ILE HD12 1 1 
        3  4045 1 1  31 ILE HD13 H  -6.047   0.656  -7.326 1.00 . A A .  31 ILE HD13 1 1 
        3  4046 1 1  31 ILE HG12 H  -4.539   2.735  -5.752 1.00 . A A .  31 ILE HG12 1 1 
        3  4047 1 1  31 ILE HG13 H  -4.701   2.706  -7.503 1.00 . A A .  31 ILE HG13 1 1 
        3  4048 1 1  31 ILE HG21 H  -4.102  -0.360  -5.421 1.00 . A A .  31 ILE HG21 1 1 
        3  4049 1 1  31 ILE HG22 H  -3.102   0.844  -4.603 1.00 . A A .  31 ILE HG22 1 1 
        3  4050 1 1  31 ILE HG23 H  -2.349  -0.381  -5.625 1.00 . A A .  31 ILE HG23 1 1 
        3  4051 1 1  31 ILE N    N  -2.130   2.985  -8.024 1.00 . A A .  31 ILE N    1 1 
        3  4052 1 1  31 ILE O    O  -0.514   0.726  -8.134 1.00 . A A .  31 ILE O    1 1 
        3  4053 1 1  32 ARG C    C   0.922  -1.221  -5.315 1.00 . A A .  32 ARG C    1 1 
        3  4054 1 1  32 ARG CA   C   1.171   0.166  -5.924 1.00 . A A .  32 ARG CA   1 1 
        3  4055 1 1  32 ARG CB   C   2.288   0.893  -5.129 1.00 . A A .  32 ARG CB   1 1 
        3  4056 1 1  32 ARG CD   C   3.466   1.919  -7.164 1.00 . A A .  32 ARG CD   1 1 
        3  4057 1 1  32 ARG CG   C   2.814   2.177  -5.793 1.00 . A A .  32 ARG CG   1 1 
        3  4058 1 1  32 ARG CZ   C   4.820   3.213  -8.819 1.00 . A A .  32 ARG CZ   1 1 
        3  4059 1 1  32 ARG H    H  -0.363   1.370  -5.085 1.00 . A A .  32 ARG H    1 1 
        3  4060 1 1  32 ARG HA   H   1.495   0.033  -6.953 1.00 . A A .  32 ARG HA   1 1 
        3  4061 1 1  32 ARG HB2  H   1.900   1.155  -4.149 1.00 . A A .  32 ARG HB2  1 1 
        3  4062 1 1  32 ARG HB3  H   3.128   0.216  -4.991 1.00 . A A .  32 ARG HB3  1 1 
        3  4063 1 1  32 ARG HD2  H   4.313   1.250  -7.031 1.00 . A A .  32 ARG HD2  1 1 
        3  4064 1 1  32 ARG HD3  H   2.741   1.446  -7.814 1.00 . A A .  32 ARG HD3  1 1 
        3  4065 1 1  32 ARG HE   H   3.550   4.000  -7.473 1.00 . A A .  32 ARG HE   1 1 
        3  4066 1 1  32 ARG HG2  H   1.985   2.863  -5.925 1.00 . A A .  32 ARG HG2  1 1 
        3  4067 1 1  32 ARG HG3  H   3.546   2.637  -5.135 1.00 . A A .  32 ARG HG3  1 1 
        3  4068 1 1  32 ARG HH11 H   5.122   1.201  -8.934 1.00 . A A .  32 ARG HH11 1 1 
        3  4069 1 1  32 ARG HH12 H   6.030   2.152 -10.067 1.00 . A A .  32 ARG HH12 1 1 
        3  4070 1 1  32 ARG HH21 H   4.726   5.227  -8.995 1.00 . A A .  32 ARG HH21 1 1 
        3  4071 1 1  32 ARG HH22 H   5.804   4.434 -10.101 1.00 . A A .  32 ARG HH22 1 1 
        3  4072 1 1  32 ARG N    N  -0.062   0.977  -5.929 1.00 . A A .  32 ARG N    1 1 
        3  4073 1 1  32 ARG NE   N   3.930   3.160  -7.810 1.00 . A A .  32 ARG NE   1 1 
        3  4074 1 1  32 ARG NH1  N   5.367   2.098  -9.312 1.00 . A A .  32 ARG NH1  1 1 
        3  4075 1 1  32 ARG NH2  N   5.137   4.384  -9.350 1.00 . A A .  32 ARG NH2  1 1 
        3  4076 1 1  32 ARG O    O  -0.037  -1.432  -4.565 1.00 . A A .  32 ARG O    1 1 
        3  4077 1 1  33 THR C    C   3.336  -3.890  -4.905 1.00 . A A .  33 THR C    1 1 
        3  4078 1 1  33 THR CA   C   1.864  -3.513  -5.119 1.00 . A A .  33 THR CA   1 1 
        3  4079 1 1  33 THR CB   C   1.216  -4.546  -6.101 1.00 . A A .  33 THR CB   1 1 
        3  4080 1 1  33 THR CG2  C   1.263  -5.982  -5.557 1.00 . A A .  33 THR CG2  1 1 
        3  4081 1 1  33 THR H    H   2.488  -1.913  -6.342 1.00 . A A .  33 THR H    1 1 
        3  4082 1 1  33 THR HA   H   1.332  -3.535  -4.166 1.00 . A A .  33 THR HA   1 1 
        3  4083 1 1  33 THR HB   H   1.754  -4.518  -7.044 1.00 . A A .  33 THR HB   1 1 
        3  4084 1 1  33 THR HG1  H  -0.192  -3.256  -6.560 1.00 . A A .  33 THR HG1  1 1 
        3  4085 1 1  33 THR HG21 H   2.291  -6.280  -5.399 1.00 . A A .  33 THR HG21 1 1 
        3  4086 1 1  33 THR HG22 H   0.805  -6.658  -6.266 1.00 . A A .  33 THR HG22 1 1 
        3  4087 1 1  33 THR HG23 H   0.727  -6.039  -4.614 1.00 . A A .  33 THR HG23 1 1 
        3  4088 1 1  33 THR N    N   1.815  -2.154  -5.668 1.00 . A A .  33 THR N    1 1 
        3  4089 1 1  33 THR O    O   4.117  -3.810  -5.852 1.00 . A A .  33 THR O    1 1 
        3  4090 1 1  33 THR OG1  O  -0.135  -4.187  -6.350 1.00 . A A .  33 THR OG1  1 1 
        3  4091 1 1  34 ALA C    C   5.361  -6.113  -3.981 1.00 . A A .  34 ALA C    1 1 
        3  4092 1 1  34 ALA CA   C   5.078  -4.725  -3.395 1.00 . A A .  34 ALA CA   1 1 
        3  4093 1 1  34 ALA CB   C   5.309  -4.721  -1.889 1.00 . A A .  34 ALA CB   1 1 
        3  4094 1 1  34 ALA H    H   3.022  -4.401  -2.991 1.00 . A A .  34 ALA H    1 1 
        3  4095 1 1  34 ALA HA   H   5.754  -3.989  -3.846 1.00 . A A .  34 ALA HA   1 1 
        3  4096 1 1  34 ALA HB1  H   6.336  -4.986  -1.673 1.00 . A A .  34 ALA HB1  1 1 
        3  4097 1 1  34 ALA HB2  H   4.647  -5.434  -1.415 1.00 . A A .  34 ALA HB2  1 1 
        3  4098 1 1  34 ALA HB3  H   5.107  -3.732  -1.496 1.00 . A A .  34 ALA HB3  1 1 
        3  4099 1 1  34 ALA N    N   3.699  -4.330  -3.693 1.00 . A A .  34 ALA N    1 1 
        3  4100 1 1  34 ALA O    O   4.869  -7.126  -3.476 1.00 . A A .  34 ALA O    1 1 
        3  4101 1 1  35 THR C    C   7.644  -8.050  -4.818 1.00 . A A .  35 THR C    1 1 
        3  4102 1 1  35 THR CA   C   6.616  -7.347  -5.730 1.00 . A A .  35 THR CA   1 1 
        3  4103 1 1  35 THR CB   C   7.272  -6.990  -7.113 1.00 . A A .  35 THR CB   1 1 
        3  4104 1 1  35 THR CG2  C   7.517  -8.230  -7.998 1.00 . A A .  35 THR CG2  1 1 
        3  4105 1 1  35 THR H    H   6.366  -5.259  -5.478 1.00 . A A .  35 THR H    1 1 
        3  4106 1 1  35 THR HA   H   5.766  -8.004  -5.901 1.00 . A A .  35 THR HA   1 1 
        3  4107 1 1  35 THR HB   H   8.229  -6.499  -6.929 1.00 . A A .  35 THR HB   1 1 
        3  4108 1 1  35 THR HG1  H   6.939  -5.308  -8.111 1.00 . A A .  35 THR HG1  1 1 
        3  4109 1 1  35 THR HG21 H   8.174  -8.926  -7.490 1.00 . A A .  35 THR HG21 1 1 
        3  4110 1 1  35 THR HG22 H   7.974  -7.929  -8.931 1.00 . A A .  35 THR HG22 1 1 
        3  4111 1 1  35 THR HG23 H   6.574  -8.724  -8.208 1.00 . A A .  35 THR HG23 1 1 
        3  4112 1 1  35 THR N    N   6.129  -6.122  -5.077 1.00 . A A .  35 THR N    1 1 
        3  4113 1 1  35 THR O    O   7.638  -9.274  -4.661 1.00 . A A .  35 THR O    1 1 
        3  4114 1 1  35 THR OG1  O   6.424  -6.067  -7.815 1.00 . A A .  35 THR OG1  1 1 
        3  4115 1 1  36 SER C    C  10.135  -6.441  -2.538 1.00 . A A .  36 SER C    1 1 
        3  4116 1 1  36 SER CA   C   9.609  -7.643  -3.352 1.00 . A A .  36 SER CA   1 1 
        3  4117 1 1  36 SER CB   C  10.736  -8.235  -4.253 1.00 . A A .  36 SER CB   1 1 
        3  4118 1 1  36 SER H    H   8.326  -6.251  -4.293 1.00 . A A .  36 SER H    1 1 
        3  4119 1 1  36 SER HA   H   9.255  -8.403  -2.667 1.00 . A A .  36 SER HA   1 1 
        3  4120 1 1  36 SER HB2  H  10.340  -9.069  -4.817 1.00 . A A .  36 SER HB2  1 1 
        3  4121 1 1  36 SER HB3  H  11.082  -7.476  -4.947 1.00 . A A .  36 SER HB3  1 1 
        3  4122 1 1  36 SER HG   H  12.236  -9.472  -3.929 1.00 . A A .  36 SER HG   1 1 
        3  4123 1 1  36 SER N    N   8.484  -7.214  -4.192 1.00 . A A .  36 SER N    1 1 
        3  4124 1 1  36 SER O    O   9.590  -5.331  -2.629 1.00 . A A .  36 SER O    1 1 
        3  4125 1 1  36 SER OG   O  11.852  -8.695  -3.499 1.00 . A A .  36 SER OG   1 1 
        3  4126 1 1  37 SER C    C  12.578  -4.627  -2.003 1.00 . A A .  37 SER C    1 1 
        3  4127 1 1  37 SER CA   C  11.962  -5.660  -1.027 1.00 . A A .  37 SER CA   1 1 
        3  4128 1 1  37 SER CB   C  13.067  -6.365  -0.221 1.00 . A A .  37 SER CB   1 1 
        3  4129 1 1  37 SER H    H  11.473  -7.623  -1.647 1.00 . A A .  37 SER H    1 1 
        3  4130 1 1  37 SER HA   H  11.292  -5.149  -0.343 1.00 . A A .  37 SER HA   1 1 
        3  4131 1 1  37 SER HB2  H  13.748  -5.632   0.198 1.00 . A A .  37 SER HB2  1 1 
        3  4132 1 1  37 SER HB3  H  12.623  -6.937   0.581 1.00 . A A .  37 SER HB3  1 1 
        3  4133 1 1  37 SER HG   H  13.268  -8.030  -1.242 1.00 . A A .  37 SER HG   1 1 
        3  4134 1 1  37 SER N    N  11.193  -6.688  -1.751 1.00 . A A .  37 SER N    1 1 
        3  4135 1 1  37 SER O    O  12.684  -3.434  -1.687 1.00 . A A .  37 SER O    1 1 
        3  4136 1 1  37 SER OG   O  13.807  -7.253  -1.048 1.00 . A A .  37 SER OG   1 1 
        3  4137 1 1  38 GLN C    C  12.396  -3.290  -4.766 1.00 . A A .  38 GLN C    1 1 
        3  4138 1 1  38 GLN CA   C  13.482  -4.282  -4.294 1.00 . A A .  38 GLN CA   1 1 
        3  4139 1 1  38 GLN CB   C  13.949  -5.186  -5.470 1.00 . A A .  38 GLN CB   1 1 
        3  4140 1 1  38 GLN CD   C  15.796  -3.650  -6.404 1.00 . A A .  38 GLN CD   1 1 
        3  4141 1 1  38 GLN CG   C  14.513  -4.436  -6.698 1.00 . A A .  38 GLN CG   1 1 
        3  4142 1 1  38 GLN H    H  12.934  -6.093  -3.329 1.00 . A A .  38 GLN H    1 1 
        3  4143 1 1  38 GLN HA   H  14.337  -3.721  -3.922 1.00 . A A .  38 GLN HA   1 1 
        3  4144 1 1  38 GLN HB2  H  14.723  -5.854  -5.104 1.00 . A A .  38 GLN HB2  1 1 
        3  4145 1 1  38 GLN HB3  H  13.109  -5.792  -5.799 1.00 . A A .  38 GLN HB3  1 1 
        3  4146 1 1  38 GLN HE21 H  14.747  -2.047  -5.869 1.00 . A A .  38 GLN HE21 1 1 
        3  4147 1 1  38 GLN HE22 H  16.468  -1.886  -5.799 1.00 . A A .  38 GLN HE22 1 1 
        3  4148 1 1  38 GLN HG2  H  14.729  -5.161  -7.477 1.00 . A A .  38 GLN HG2  1 1 
        3  4149 1 1  38 GLN HG3  H  13.758  -3.750  -7.065 1.00 . A A .  38 GLN HG3  1 1 
        3  4150 1 1  38 GLN N    N  12.977  -5.121  -3.193 1.00 . A A .  38 GLN N    1 1 
        3  4151 1 1  38 GLN NE2  N  15.659  -2.406  -5.977 1.00 . A A .  38 GLN NE2  1 1 
        3  4152 1 1  38 GLN O    O  12.671  -2.101  -5.000 1.00 . A A .  38 GLN O    1 1 
        3  4153 1 1  38 GLN OE1  O  16.906  -4.166  -6.551 1.00 . A A .  38 GLN OE1  1 1 
        3  4154 1 1  39 ASP C    C   9.595  -1.982  -4.215 1.00 . A A .  39 ASP C    1 1 
        3  4155 1 1  39 ASP CA   C   9.997  -3.006  -5.296 1.00 . A A .  39 ASP CA   1 1 
        3  4156 1 1  39 ASP CB   C   8.816  -3.939  -5.640 1.00 . A A .  39 ASP CB   1 1 
        3  4157 1 1  39 ASP CG   C   7.678  -3.234  -6.406 1.00 . A A .  39 ASP CG   1 1 
        3  4158 1 1  39 ASP H    H  11.018  -4.737  -4.621 1.00 . A A .  39 ASP H    1 1 
        3  4159 1 1  39 ASP HA   H  10.293  -2.463  -6.193 1.00 . A A .  39 ASP HA   1 1 
        3  4160 1 1  39 ASP HB2  H   9.184  -4.759  -6.246 1.00 . A A .  39 ASP HB2  1 1 
        3  4161 1 1  39 ASP HB3  H   8.415  -4.355  -4.720 1.00 . A A .  39 ASP HB3  1 1 
        3  4162 1 1  39 ASP N    N  11.156  -3.797  -4.855 1.00 . A A .  39 ASP N    1 1 
        3  4163 1 1  39 ASP O    O   9.163  -0.897  -4.548 1.00 . A A .  39 ASP O    1 1 
        3  4164 1 1  39 ASP OD1  O   7.721  -3.201  -7.658 1.00 . A A .  39 ASP OD1  1 1 
        3  4165 1 1  39 ASP OD2  O   6.740  -2.732  -5.771 1.00 . A A .  39 ASP OD2  1 1 
        3  4166 1 1  40 ILE C    C  10.411  -0.146  -1.936 1.00 . A A .  40 ILE C    1 1 
        3  4167 1 1  40 ILE CA   C   9.567  -1.434  -1.764 1.00 . A A .  40 ILE CA   1 1 
        3  4168 1 1  40 ILE CB   C   9.944  -2.158  -0.404 1.00 . A A .  40 ILE CB   1 1 
        3  4169 1 1  40 ILE CD1  C   7.496  -2.808   0.263 1.00 . A A .  40 ILE CD1  1 1 
        3  4170 1 1  40 ILE CG1  C   8.915  -3.281  -0.040 1.00 . A A .  40 ILE CG1  1 1 
        3  4171 1 1  40 ILE CG2  C  10.122  -1.168   0.772 1.00 . A A .  40 ILE CG2  1 1 
        3  4172 1 1  40 ILE H    H  10.047  -3.270  -2.738 1.00 . A A .  40 ILE H    1 1 
        3  4173 1 1  40 ILE HA   H   8.512  -1.160  -1.735 1.00 . A A .  40 ILE HA   1 1 
        3  4174 1 1  40 ILE HB   H  10.914  -2.634  -0.557 1.00 . A A .  40 ILE HB   1 1 
        3  4175 1 1  40 ILE HD11 H   6.879  -3.662   0.500 1.00 . A A .  40 ILE HD11 1 1 
        3  4176 1 1  40 ILE HD12 H   7.086  -2.301  -0.600 1.00 . A A .  40 ILE HD12 1 1 
        3  4177 1 1  40 ILE HD13 H   7.502  -2.129   1.107 1.00 . A A .  40 ILE HD13 1 1 
        3  4178 1 1  40 ILE HG12 H   8.850  -3.978  -0.863 1.00 . A A .  40 ILE HG12 1 1 
        3  4179 1 1  40 ILE HG13 H   9.272  -3.818   0.834 1.00 . A A .  40 ILE HG13 1 1 
        3  4180 1 1  40 ILE HG21 H  10.927  -0.477   0.550 1.00 . A A .  40 ILE HG21 1 1 
        3  4181 1 1  40 ILE HG22 H  10.365  -1.711   1.676 1.00 . A A .  40 ILE HG22 1 1 
        3  4182 1 1  40 ILE HG23 H   9.205  -0.610   0.928 1.00 . A A .  40 ILE HG23 1 1 
        3  4183 1 1  40 ILE N    N   9.771  -2.350  -2.920 1.00 . A A .  40 ILE N    1 1 
        3  4184 1 1  40 ILE O    O   9.903   0.975  -1.778 1.00 . A A .  40 ILE O    1 1 
        3  4185 1 1  41 ARG C    C  12.159   1.638  -3.749 1.00 . A A .  41 ARG C    1 1 
        3  4186 1 1  41 ARG CA   C  12.637   0.775  -2.560 1.00 . A A .  41 ARG CA   1 1 
        3  4187 1 1  41 ARG CB   C  14.047   0.209  -2.859 1.00 . A A .  41 ARG CB   1 1 
        3  4188 1 1  41 ARG CD   C  15.053   0.305  -0.486 1.00 . A A .  41 ARG CD   1 1 
        3  4189 1 1  41 ARG CG   C  14.696  -0.572  -1.701 1.00 . A A .  41 ARG CG   1 1 
        3  4190 1 1  41 ARG CZ   C  16.830  -0.123   1.245 1.00 . A A .  41 ARG CZ   1 1 
        3  4191 1 1  41 ARG H    H  12.023  -1.261  -2.386 1.00 . A A .  41 ARG H    1 1 
        3  4192 1 1  41 ARG HA   H  12.681   1.394  -1.668 1.00 . A A .  41 ARG HA   1 1 
        3  4193 1 1  41 ARG HB2  H  13.971  -0.459  -3.709 1.00 . A A .  41 ARG HB2  1 1 
        3  4194 1 1  41 ARG HB3  H  14.708   1.027  -3.129 1.00 . A A .  41 ARG HB3  1 1 
        3  4195 1 1  41 ARG HD2  H  15.706   1.111  -0.804 1.00 . A A .  41 ARG HD2  1 1 
        3  4196 1 1  41 ARG HD3  H  14.143   0.727  -0.074 1.00 . A A .  41 ARG HD3  1 1 
        3  4197 1 1  41 ARG HE   H  15.298  -1.336   0.803 1.00 . A A .  41 ARG HE   1 1 
        3  4198 1 1  41 ARG HG2  H  14.007  -1.345  -1.377 1.00 . A A .  41 ARG HG2  1 1 
        3  4199 1 1  41 ARG HG3  H  15.603  -1.046  -2.066 1.00 . A A .  41 ARG HG3  1 1 
        3  4200 1 1  41 ARG HH11 H  17.095   1.662   0.307 1.00 . A A .  41 ARG HH11 1 1 
        3  4201 1 1  41 ARG HH12 H  18.273   1.281   1.524 1.00 . A A .  41 ARG HH12 1 1 
        3  4202 1 1  41 ARG HH21 H  16.813  -1.772   2.416 1.00 . A A .  41 ARG HH21 1 1 
        3  4203 1 1  41 ARG HH22 H  18.109  -0.655   2.707 1.00 . A A .  41 ARG HH22 1 1 
        3  4204 1 1  41 ARG N    N  11.696  -0.336  -2.296 1.00 . A A .  41 ARG N    1 1 
        3  4205 1 1  41 ARG NE   N  15.716  -0.478   0.578 1.00 . A A .  41 ARG NE   1 1 
        3  4206 1 1  41 ARG NH1  N  17.448   1.032   1.005 1.00 . A A .  41 ARG NH1  1 1 
        3  4207 1 1  41 ARG NH2  N  17.287  -0.912   2.196 1.00 . A A .  41 ARG NH2  1 1 
        3  4208 1 1  41 ARG O    O  12.175   2.876  -3.684 1.00 . A A .  41 ARG O    1 1 
        3  4209 1 1  42 ASP C    C   9.960   2.475  -5.749 1.00 . A A .  42 ASP C    1 1 
        3  4210 1 1  42 ASP CA   C  11.196   1.588  -6.051 1.00 . A A .  42 ASP CA   1 1 
        3  4211 1 1  42 ASP CB   C  10.855   0.506  -7.115 1.00 . A A .  42 ASP CB   1 1 
        3  4212 1 1  42 ASP CG   C  10.106   1.077  -8.336 1.00 . A A .  42 ASP CG   1 1 
        3  4213 1 1  42 ASP H    H  11.799  -0.030  -4.805 1.00 . A A .  42 ASP H    1 1 
        3  4214 1 1  42 ASP HA   H  11.982   2.223  -6.451 1.00 . A A .  42 ASP HA   1 1 
        3  4215 1 1  42 ASP HB2  H  11.778   0.050  -7.460 1.00 . A A .  42 ASP HB2  1 1 
        3  4216 1 1  42 ASP HB3  H  10.244  -0.268  -6.653 1.00 . A A .  42 ASP HB3  1 1 
        3  4217 1 1  42 ASP N    N  11.734   0.952  -4.828 1.00 . A A .  42 ASP N    1 1 
        3  4218 1 1  42 ASP O    O   9.870   3.610  -6.250 1.00 . A A .  42 ASP O    1 1 
        3  4219 1 1  42 ASP OD1  O  10.726   1.810  -9.143 1.00 . A A .  42 ASP OD1  1 1 
        3  4220 1 1  42 ASP OD2  O   8.890   0.832  -8.471 1.00 . A A .  42 ASP OD2  1 1 
        3  4221 1 1  43 ILE C    C   8.105   3.959  -3.799 1.00 . A A .  43 ILE C    1 1 
        3  4222 1 1  43 ILE CA   C   7.797   2.641  -4.524 1.00 . A A .  43 ILE CA   1 1 
        3  4223 1 1  43 ILE CB   C   6.887   1.750  -3.588 1.00 . A A .  43 ILE CB   1 1 
        3  4224 1 1  43 ILE CD1  C   5.680  -0.533  -3.431 1.00 . A A .  43 ILE CD1  1 1 
        3  4225 1 1  43 ILE CG1  C   6.393   0.468  -4.321 1.00 . A A .  43 ILE CG1  1 1 
        3  4226 1 1  43 ILE CG2  C   5.683   2.558  -3.049 1.00 . A A .  43 ILE CG2  1 1 
        3  4227 1 1  43 ILE H    H   9.219   1.070  -4.534 1.00 . A A .  43 ILE H    1 1 
        3  4228 1 1  43 ILE HA   H   7.244   2.860  -5.435 1.00 . A A .  43 ILE HA   1 1 
        3  4229 1 1  43 ILE HB   H   7.487   1.448  -2.728 1.00 . A A .  43 ILE HB   1 1 
        3  4230 1 1  43 ILE HD11 H   5.438  -1.414  -4.005 1.00 . A A .  43 ILE HD11 1 1 
        3  4231 1 1  43 ILE HD12 H   4.768  -0.094  -3.047 1.00 . A A .  43 ILE HD12 1 1 
        3  4232 1 1  43 ILE HD13 H   6.322  -0.807  -2.606 1.00 . A A .  43 ILE HD13 1 1 
        3  4233 1 1  43 ILE HG12 H   5.706   0.742  -5.111 1.00 . A A .  43 ILE HG12 1 1 
        3  4234 1 1  43 ILE HG13 H   7.239  -0.041  -4.759 1.00 . A A .  43 ILE HG13 1 1 
        3  4235 1 1  43 ILE HG21 H   6.032   3.426  -2.505 1.00 . A A .  43 ILE HG21 1 1 
        3  4236 1 1  43 ILE HG22 H   5.102   1.940  -2.384 1.00 . A A .  43 ILE HG22 1 1 
        3  4237 1 1  43 ILE HG23 H   5.057   2.881  -3.873 1.00 . A A .  43 ILE HG23 1 1 
        3  4238 1 1  43 ILE N    N   9.044   1.951  -4.911 1.00 . A A .  43 ILE N    1 1 
        3  4239 1 1  43 ILE O    O   7.621   5.010  -4.195 1.00 . A A .  43 ILE O    1 1 
        3  4240 1 1  44 ILE C    C  10.068   6.080  -2.592 1.00 . A A .  44 ILE C    1 1 
        3  4241 1 1  44 ILE CA   C   9.236   5.004  -1.849 1.00 . A A .  44 ILE CA   1 1 
        3  4242 1 1  44 ILE CB   C   9.925   4.480  -0.532 1.00 . A A .  44 ILE CB   1 1 
        3  4243 1 1  44 ILE CD1  C   9.501   2.830   1.433 1.00 . A A .  44 ILE CD1  1 1 
        3  4244 1 1  44 ILE CG1  C   8.942   3.499   0.199 1.00 . A A .  44 ILE CG1  1 1 
        3  4245 1 1  44 ILE CG2  C  10.351   5.639   0.409 1.00 . A A .  44 ILE CG2  1 1 
        3  4246 1 1  44 ILE H    H   9.346   3.005  -2.551 1.00 . A A .  44 ILE H    1 1 
        3  4247 1 1  44 ILE HA   H   8.285   5.459  -1.564 1.00 . A A .  44 ILE HA   1 1 
        3  4248 1 1  44 ILE HB   H  10.821   3.929  -0.813 1.00 . A A .  44 ILE HB   1 1 
        3  4249 1 1  44 ILE HD11 H   9.758   3.575   2.172 1.00 . A A .  44 ILE HD11 1 1 
        3  4250 1 1  44 ILE HD12 H  10.387   2.265   1.169 1.00 . A A .  44 ILE HD12 1 1 
        3  4251 1 1  44 ILE HD13 H   8.762   2.158   1.843 1.00 . A A .  44 ILE HD13 1 1 
        3  4252 1 1  44 ILE HG12 H   8.056   4.042   0.501 1.00 . A A .  44 ILE HG12 1 1 
        3  4253 1 1  44 ILE HG13 H   8.647   2.715  -0.491 1.00 . A A .  44 ILE HG13 1 1 
        3  4254 1 1  44 ILE HG21 H  11.060   6.280  -0.099 1.00 . A A .  44 ILE HG21 1 1 
        3  4255 1 1  44 ILE HG22 H  10.816   5.238   1.301 1.00 . A A .  44 ILE HG22 1 1 
        3  4256 1 1  44 ILE HG23 H   9.481   6.218   0.690 1.00 . A A .  44 ILE HG23 1 1 
        3  4257 1 1  44 ILE N    N   8.926   3.870  -2.738 1.00 . A A .  44 ILE N    1 1 
        3  4258 1 1  44 ILE O    O   9.903   7.286  -2.349 1.00 . A A .  44 ILE O    1 1 
        3  4259 1 1  45 LYS C    C  10.590   7.298  -5.371 1.00 . A A .  45 LYS C    1 1 
        3  4260 1 1  45 LYS CA   C  11.603   6.524  -4.496 1.00 . A A .  45 LYS CA   1 1 
        3  4261 1 1  45 LYS CB   C  12.590   5.677  -5.358 1.00 . A A .  45 LYS CB   1 1 
        3  4262 1 1  45 LYS CD   C  12.850   6.553  -7.821 1.00 . A A .  45 LYS CD   1 1 
        3  4263 1 1  45 LYS CE   C  12.952   5.246  -8.647 1.00 . A A .  45 LYS CE   1 1 
        3  4264 1 1  45 LYS CG   C  13.459   6.454  -6.392 1.00 . A A .  45 LYS CG   1 1 
        3  4265 1 1  45 LYS H    H  11.022   4.663  -3.642 1.00 . A A .  45 LYS H    1 1 
        3  4266 1 1  45 LYS HA   H  12.176   7.240  -3.913 1.00 . A A .  45 LYS HA   1 1 
        3  4267 1 1  45 LYS HB2  H  13.266   5.172  -4.680 1.00 . A A .  45 LYS HB2  1 1 
        3  4268 1 1  45 LYS HB3  H  12.021   4.921  -5.889 1.00 . A A .  45 LYS HB3  1 1 
        3  4269 1 1  45 LYS HD2  H  11.802   6.825  -7.737 1.00 . A A .  45 LYS HD2  1 1 
        3  4270 1 1  45 LYS HD3  H  13.369   7.340  -8.355 1.00 . A A .  45 LYS HD3  1 1 
        3  4271 1 1  45 LYS HE2  H  12.648   5.457  -9.663 1.00 . A A .  45 LYS HE2  1 1 
        3  4272 1 1  45 LYS HE3  H  13.985   4.913  -8.656 1.00 . A A .  45 LYS HE3  1 1 
        3  4273 1 1  45 LYS HG2  H  13.612   7.462  -6.024 1.00 . A A .  45 LYS HG2  1 1 
        3  4274 1 1  45 LYS HG3  H  14.427   5.970  -6.469 1.00 . A A .  45 LYS HG3  1 1 
        3  4275 1 1  45 LYS HZ1  H  12.447   3.815  -7.205 1.00 . A A .  45 LYS HZ1  1 1 
        3  4276 1 1  45 LYS HZ2  H  12.122   3.328  -8.791 1.00 . A A .  45 LYS HZ2  1 1 
        3  4277 1 1  45 LYS HZ3  H  11.116   4.452  -8.031 1.00 . A A .  45 LYS HZ3  1 1 
        3  4278 1 1  45 LYS N    N  10.891   5.633  -3.555 1.00 . A A .  45 LYS N    1 1 
        3  4279 1 1  45 LYS NZ   N  12.100   4.138  -8.131 1.00 . A A .  45 LYS NZ   1 1 
        3  4280 1 1  45 LYS O    O  10.734   8.507  -5.593 1.00 . A A .  45 LYS O    1 1 
        3  4281 1 1  46 SER C    C   7.550   8.057  -5.769 1.00 . A A .  46 SER C    1 1 
        3  4282 1 1  46 SER CA   C   8.458   7.162  -6.645 1.00 . A A .  46 SER CA   1 1 
        3  4283 1 1  46 SER CB   C   7.636   6.025  -7.303 1.00 . A A .  46 SER CB   1 1 
        3  4284 1 1  46 SER H    H   9.517   5.623  -5.633 1.00 . A A .  46 SER H    1 1 
        3  4285 1 1  46 SER HA   H   8.902   7.775  -7.424 1.00 . A A .  46 SER HA   1 1 
        3  4286 1 1  46 SER HB2  H   8.297   5.408  -7.897 1.00 . A A .  46 SER HB2  1 1 
        3  4287 1 1  46 SER HB3  H   7.178   5.413  -6.534 1.00 . A A .  46 SER HB3  1 1 
        3  4288 1 1  46 SER HG   H   6.933   6.538  -9.061 1.00 . A A .  46 SER HG   1 1 
        3  4289 1 1  46 SER N    N   9.554   6.580  -5.841 1.00 . A A .  46 SER N    1 1 
        3  4290 1 1  46 SER O    O   6.982   9.040  -6.247 1.00 . A A .  46 SER O    1 1 
        3  4291 1 1  46 SER OG   O   6.615   6.529  -8.154 1.00 . A A .  46 SER OG   1 1 
        3  4292 1 1  47 MET C    C   7.167   9.881  -3.315 1.00 . A A .  47 MET C    1 1 
        3  4293 1 1  47 MET CA   C   6.647   8.457  -3.485 1.00 . A A .  47 MET CA   1 1 
        3  4294 1 1  47 MET CB   C   6.648   7.739  -2.100 1.00 . A A .  47 MET CB   1 1 
        3  4295 1 1  47 MET CE   C   3.779   8.362  -1.199 1.00 . A A .  47 MET CE   1 1 
        3  4296 1 1  47 MET CG   C   5.716   6.530  -1.992 1.00 . A A .  47 MET CG   1 1 
        3  4297 1 1  47 MET H    H   7.974   6.943  -4.163 1.00 . A A .  47 MET H    1 1 
        3  4298 1 1  47 MET HA   H   5.627   8.496  -3.864 1.00 . A A .  47 MET HA   1 1 
        3  4299 1 1  47 MET HB2  H   7.658   7.407  -1.877 1.00 . A A .  47 MET HB2  1 1 
        3  4300 1 1  47 MET HB3  H   6.354   8.449  -1.331 1.00 . A A .  47 MET HB3  1 1 
        3  4301 1 1  47 MET HE1  H   2.767   8.730  -1.278 1.00 . A A .  47 MET HE1  1 1 
        3  4302 1 1  47 MET HE2  H   4.468   9.150  -1.481 1.00 . A A .  47 MET HE2  1 1 
        3  4303 1 1  47 MET HE3  H   3.975   8.064  -0.181 1.00 . A A .  47 MET HE3  1 1 
        3  4304 1 1  47 MET HG2  H   6.014   5.784  -2.720 1.00 . A A .  47 MET HG2  1 1 
        3  4305 1 1  47 MET HG3  H   5.800   6.108  -0.997 1.00 . A A .  47 MET HG3  1 1 
        3  4306 1 1  47 MET N    N   7.461   7.716  -4.470 1.00 . A A .  47 MET N    1 1 
        3  4307 1 1  47 MET O    O   6.386  10.837  -3.262 1.00 . A A .  47 MET O    1 1 
        3  4308 1 1  47 MET SD   S   3.992   6.961  -2.286 1.00 . A A .  47 MET SD   1 1 
        3  4309 1 1  48 LYS C    C   9.123  12.087  -4.385 1.00 . A A .  48 LYS C    1 1 
        3  4310 1 1  48 LYS CA   C   9.182  11.287  -3.074 1.00 . A A .  48 LYS CA   1 1 
        3  4311 1 1  48 LYS CB   C  10.656  11.088  -2.676 1.00 . A A .  48 LYS CB   1 1 
        3  4312 1 1  48 LYS CD   C  12.372  10.266  -0.981 1.00 . A A .  48 LYS CD   1 1 
        3  4313 1 1  48 LYS CE   C  12.805  11.662  -0.504 1.00 . A A .  48 LYS CE   1 1 
        3  4314 1 1  48 LYS CG   C  10.889  10.238  -1.416 1.00 . A A .  48 LYS CG   1 1 
        3  4315 1 1  48 LYS H    H   9.037   9.168  -3.207 1.00 . A A .  48 LYS H    1 1 
        3  4316 1 1  48 LYS HA   H   8.678  11.851  -2.288 1.00 . A A .  48 LYS HA   1 1 
        3  4317 1 1  48 LYS HB2  H  11.180  10.613  -3.503 1.00 . A A .  48 LYS HB2  1 1 
        3  4318 1 1  48 LYS HB3  H  11.102  12.067  -2.512 1.00 . A A .  48 LYS HB3  1 1 
        3  4319 1 1  48 LYS HD2  H  12.519   9.562  -0.171 1.00 . A A .  48 LYS HD2  1 1 
        3  4320 1 1  48 LYS HD3  H  12.996   9.974  -1.818 1.00 . A A .  48 LYS HD3  1 1 
        3  4321 1 1  48 LYS HE2  H  12.593  12.379  -1.287 1.00 . A A .  48 LYS HE2  1 1 
        3  4322 1 1  48 LYS HE3  H  12.234  11.923   0.380 1.00 . A A .  48 LYS HE3  1 1 
        3  4323 1 1  48 LYS HG2  H  10.267  10.614  -0.604 1.00 . A A .  48 LYS HG2  1 1 
        3  4324 1 1  48 LYS HG3  H  10.605   9.214  -1.630 1.00 . A A .  48 LYS HG3  1 1 
        3  4325 1 1  48 LYS HZ1  H  14.494  11.046   0.571 1.00 . A A .  48 LYS HZ1  1 1 
        3  4326 1 1  48 LYS HZ2  H  14.514  12.680   0.151 1.00 . A A .  48 LYS HZ2  1 1 
        3  4327 1 1  48 LYS HZ3  H  14.830  11.503  -1.017 1.00 . A A .  48 LYS HZ3  1 1 
        3  4328 1 1  48 LYS N    N   8.497   9.994  -3.210 1.00 . A A .  48 LYS N    1 1 
        3  4329 1 1  48 LYS NZ   N  14.260  11.727  -0.178 1.00 . A A .  48 LYS NZ   1 1 
        3  4330 1 1  48 LYS O    O   8.841  13.286  -4.362 1.00 . A A .  48 LYS O    1 1 
        3  4331 1 1  49 ASP C    C   8.164  12.670  -7.233 1.00 . A A .  49 ASP C    1 1 
        3  4332 1 1  49 ASP CA   C   9.491  11.994  -6.860 1.00 . A A .  49 ASP CA   1 1 
        3  4333 1 1  49 ASP CB   C   9.831  10.894  -7.910 1.00 . A A .  49 ASP CB   1 1 
        3  4334 1 1  49 ASP CG   C   9.904  11.430  -9.355 1.00 . A A .  49 ASP CG   1 1 
        3  4335 1 1  49 ASP H    H   9.554  10.429  -5.419 1.00 . A A .  49 ASP H    1 1 
        3  4336 1 1  49 ASP HA   H  10.285  12.741  -6.851 1.00 . A A .  49 ASP HA   1 1 
        3  4337 1 1  49 ASP HB2  H  10.787  10.446  -7.657 1.00 . A A .  49 ASP HB2  1 1 
        3  4338 1 1  49 ASP HB3  H   9.073  10.115  -7.865 1.00 . A A .  49 ASP HB3  1 1 
        3  4339 1 1  49 ASP N    N   9.407  11.393  -5.507 1.00 . A A .  49 ASP N    1 1 
        3  4340 1 1  49 ASP O    O   8.117  13.846  -7.620 1.00 . A A .  49 ASP O    1 1 
        3  4341 1 1  49 ASP OD1  O  10.991  11.874  -9.782 1.00 . A A .  49 ASP OD1  1 1 
        3  4342 1 1  49 ASP OD2  O   8.868  11.421 -10.061 1.00 . A A .  49 ASP OD2  1 1 
        3  4343 1 1  50 ASN C    C   5.170  13.243  -6.402 1.00 . A A .  50 ASN C    1 1 
        3  4344 1 1  50 ASN CA   C   5.735  12.286  -7.459 1.00 . A A .  50 ASN CA   1 1 
        3  4345 1 1  50 ASN CB   C   4.822  11.033  -7.591 1.00 . A A .  50 ASN CB   1 1 
        3  4346 1 1  50 ASN CG   C   5.189  10.045  -8.725 1.00 . A A .  50 ASN CG   1 1 
        3  4347 1 1  50 ASN H    H   7.224  11.003  -6.689 1.00 . A A .  50 ASN H    1 1 
        3  4348 1 1  50 ASN HA   H   5.773  12.803  -8.415 1.00 . A A .  50 ASN HA   1 1 
        3  4349 1 1  50 ASN HB2  H   4.859  10.476  -6.663 1.00 . A A .  50 ASN HB2  1 1 
        3  4350 1 1  50 ASN HB3  H   3.801  11.368  -7.744 1.00 . A A .  50 ASN HB3  1 1 
        3  4351 1 1  50 ASN HD21 H   7.146  10.399  -8.557 1.00 . A A .  50 ASN HD21 1 1 
        3  4352 1 1  50 ASN HD22 H   6.689   9.250  -9.754 1.00 . A A .  50 ASN HD22 1 1 
        3  4353 1 1  50 ASN N    N   7.095  11.888  -7.087 1.00 . A A .  50 ASN N    1 1 
        3  4354 1 1  50 ASN ND2  N   6.470   9.885  -9.043 1.00 . A A .  50 ASN ND2  1 1 
        3  4355 1 1  50 ASN O    O   4.536  14.250  -6.733 1.00 . A A .  50 ASN O    1 1 
        3  4356 1 1  50 ASN OD1  O   4.312   9.426  -9.321 1.00 . A A .  50 ASN OD1  1 1 
        3  4357 1 1  51 GLY C    C   3.357  13.490  -3.853 1.00 . A A .  51 GLY C    1 1 
        3  4358 1 1  51 GLY CA   C   4.865  13.665  -3.996 1.00 . A A .  51 GLY CA   1 1 
        3  4359 1 1  51 GLY H    H   5.990  12.134  -4.940 1.00 . A A .  51 GLY H    1 1 
        3  4360 1 1  51 GLY HA2  H   5.338  13.321  -3.089 1.00 . A A .  51 GLY HA2  1 1 
        3  4361 1 1  51 GLY HA3  H   5.090  14.716  -4.126 1.00 . A A .  51 GLY HA3  1 1 
        3  4362 1 1  51 GLY N    N   5.417  12.909  -5.122 1.00 . A A .  51 GLY N    1 1 
        3  4363 1 1  51 GLY O    O   2.694  14.296  -3.199 1.00 . A A .  51 GLY O    1 1 
        3  4364 1 1  52 LYS C    C   0.999  11.118  -3.383 1.00 . A A .  52 LYS C    1 1 
        3  4365 1 1  52 LYS CA   C   1.374  12.127  -4.490 1.00 . A A .  52 LYS CA   1 1 
        3  4366 1 1  52 LYS CB   C   0.977  11.576  -5.891 1.00 . A A .  52 LYS CB   1 1 
        3  4367 1 1  52 LYS CD   C   0.872   9.559  -7.495 1.00 . A A .  52 LYS CD   1 1 
        3  4368 1 1  52 LYS CE   C   1.242  10.370  -8.737 1.00 . A A .  52 LYS CE   1 1 
        3  4369 1 1  52 LYS CG   C   1.471  10.141  -6.191 1.00 . A A .  52 LYS CG   1 1 
        3  4370 1 1  52 LYS H    H   3.433  11.755  -4.848 1.00 . A A .  52 LYS H    1 1 
        3  4371 1 1  52 LYS HA   H   0.836  13.058  -4.318 1.00 . A A .  52 LYS HA   1 1 
        3  4372 1 1  52 LYS HB2  H  -0.106  11.587  -5.966 1.00 . A A .  52 LYS HB2  1 1 
        3  4373 1 1  52 LYS HB3  H   1.376  12.241  -6.649 1.00 . A A .  52 LYS HB3  1 1 
        3  4374 1 1  52 LYS HD2  H   1.234   8.546  -7.626 1.00 . A A .  52 LYS HD2  1 1 
        3  4375 1 1  52 LYS HD3  H  -0.211   9.534  -7.403 1.00 . A A .  52 LYS HD3  1 1 
        3  4376 1 1  52 LYS HE2  H   0.804  11.358  -8.656 1.00 . A A .  52 LYS HE2  1 1 
        3  4377 1 1  52 LYS HE3  H   2.320  10.468  -8.783 1.00 . A A .  52 LYS HE3  1 1 
        3  4378 1 1  52 LYS HG2  H   2.555  10.152  -6.278 1.00 . A A .  52 LYS HG2  1 1 
        3  4379 1 1  52 LYS HG3  H   1.195   9.497  -5.362 1.00 . A A .  52 LYS HG3  1 1 
        3  4380 1 1  52 LYS HZ1  H  -0.278   9.661  -9.995 1.00 . A A .  52 LYS HZ1  1 1 
        3  4381 1 1  52 LYS HZ2  H   1.151   8.761 -10.079 1.00 . A A .  52 LYS HZ2  1 1 
        3  4382 1 1  52 LYS HZ3  H   1.058  10.274 -10.823 1.00 . A A .  52 LYS HZ3  1 1 
        3  4383 1 1  52 LYS N    N   2.823  12.407  -4.443 1.00 . A A .  52 LYS N    1 1 
        3  4384 1 1  52 LYS NZ   N   0.762   9.724  -9.994 1.00 . A A .  52 LYS NZ   1 1 
        3  4385 1 1  52 LYS O    O   1.894  10.534  -2.748 1.00 . A A .  52 LYS O    1 1 
        3  4386 1 1  53 PRO C    C  -0.910   8.485  -3.021 1.00 . A A .  53 PRO C    1 1 
        3  4387 1 1  53 PRO CA   C  -0.789   9.816  -2.235 1.00 . A A .  53 PRO CA   1 1 
        3  4388 1 1  53 PRO CB   C  -2.168  10.318  -1.709 1.00 . A A .  53 PRO CB   1 1 
        3  4389 1 1  53 PRO CD   C  -1.466  11.801  -3.458 1.00 . A A .  53 PRO CD   1 1 
        3  4390 1 1  53 PRO CG   C  -2.307  11.733  -2.218 1.00 . A A .  53 PRO CG   1 1 
        3  4391 1 1  53 PRO HA   H  -0.113   9.672  -1.395 1.00 . A A .  53 PRO HA   1 1 
        3  4392 1 1  53 PRO HB2  H  -2.974   9.689  -2.093 1.00 . A A .  53 PRO HB2  1 1 
        3  4393 1 1  53 PRO HB3  H  -2.185  10.304  -0.626 1.00 . A A .  53 PRO HB3  1 1 
        3  4394 1 1  53 PRO HD2  H  -2.001  11.404  -4.316 1.00 . A A .  53 PRO HD2  1 1 
        3  4395 1 1  53 PRO HD3  H  -1.144  12.819  -3.645 1.00 . A A .  53 PRO HD3  1 1 
        3  4396 1 1  53 PRO HG2  H  -3.348  11.944  -2.449 1.00 . A A .  53 PRO HG2  1 1 
        3  4397 1 1  53 PRO HG3  H  -1.945  12.442  -1.477 1.00 . A A .  53 PRO HG3  1 1 
        3  4398 1 1  53 PRO N    N  -0.321  10.928  -3.086 1.00 . A A .  53 PRO N    1 1 
        3  4399 1 1  53 PRO O    O  -1.673   8.402  -3.998 1.00 . A A .  53 PRO O    1 1 
        3  4400 1 1  54 LEU C    C  -0.747   5.093  -2.136 1.00 . A A .  54 LEU C    1 1 
        3  4401 1 1  54 LEU CA   C  -0.214   6.089  -3.180 1.00 . A A .  54 LEU CA   1 1 
        3  4402 1 1  54 LEU CB   C   1.193   5.638  -3.695 1.00 . A A .  54 LEU CB   1 1 
        3  4403 1 1  54 LEU CD1  C   3.168   5.937  -5.339 1.00 . A A .  54 LEU CD1  1 1 
        3  4404 1 1  54 LEU CD2  C   0.776   6.006  -6.188 1.00 . A A .  54 LEU CD2  1 1 
        3  4405 1 1  54 LEU CG   C   1.706   6.328  -5.005 1.00 . A A .  54 LEU CG   1 1 
        3  4406 1 1  54 LEU H    H   0.468   7.612  -1.841 1.00 . A A .  54 LEU H    1 1 
        3  4407 1 1  54 LEU HA   H  -0.912   6.105  -4.020 1.00 . A A .  54 LEU HA   1 1 
        3  4408 1 1  54 LEU HB2  H   1.914   5.827  -2.906 1.00 . A A .  54 LEU HB2  1 1 
        3  4409 1 1  54 LEU HB3  H   1.170   4.564  -3.871 1.00 . A A .  54 LEU HB3  1 1 
        3  4410 1 1  54 LEU HD11 H   3.242   4.869  -5.508 1.00 . A A .  54 LEU HD11 1 1 
        3  4411 1 1  54 LEU HD12 H   3.811   6.210  -4.512 1.00 . A A .  54 LEU HD12 1 1 
        3  4412 1 1  54 LEU HD13 H   3.494   6.466  -6.224 1.00 . A A .  54 LEU HD13 1 1 
        3  4413 1 1  54 LEU HD21 H   0.718   4.934  -6.336 1.00 . A A .  54 LEU HD21 1 1 
        3  4414 1 1  54 LEU HD22 H   1.154   6.475  -7.088 1.00 . A A .  54 LEU HD22 1 1 
        3  4415 1 1  54 LEU HD23 H  -0.214   6.391  -5.983 1.00 . A A .  54 LEU HD23 1 1 
        3  4416 1 1  54 LEU HG   H   1.683   7.401  -4.865 1.00 . A A .  54 LEU HG   1 1 
        3  4417 1 1  54 LEU N    N  -0.153   7.456  -2.596 1.00 . A A .  54 LEU N    1 1 
        3  4418 1 1  54 LEU O    O  -0.763   5.382  -0.946 1.00 . A A .  54 LEU O    1 1 
        3  4419 1 1  55 VAL C    C  -0.857   1.540  -2.077 1.00 . A A .  55 VAL C    1 1 
        3  4420 1 1  55 VAL CA   C  -1.651   2.811  -1.729 1.00 . A A .  55 VAL CA   1 1 
        3  4421 1 1  55 VAL CB   C  -3.205   2.542  -1.889 1.00 . A A .  55 VAL CB   1 1 
        3  4422 1 1  55 VAL CG1  C  -3.671   1.387  -0.982 1.00 . A A .  55 VAL CG1  1 1 
        3  4423 1 1  55 VAL CG2  C  -4.031   3.816  -1.606 1.00 . A A .  55 VAL CG2  1 1 
        3  4424 1 1  55 VAL H    H  -1.206   3.775  -3.569 1.00 . A A .  55 VAL H    1 1 
        3  4425 1 1  55 VAL HA   H  -1.452   3.076  -0.687 1.00 . A A .  55 VAL HA   1 1 
        3  4426 1 1  55 VAL HB   H  -3.398   2.248  -2.922 1.00 . A A .  55 VAL HB   1 1 
        3  4427 1 1  55 VAL HG11 H  -4.734   1.226  -1.113 1.00 . A A .  55 VAL HG11 1 1 
        3  4428 1 1  55 VAL HG12 H  -3.472   1.627   0.055 1.00 . A A .  55 VAL HG12 1 1 
        3  4429 1 1  55 VAL HG13 H  -3.141   0.481  -1.247 1.00 . A A .  55 VAL HG13 1 1 
        3  4430 1 1  55 VAL HG21 H  -3.866   4.144  -0.587 1.00 . A A .  55 VAL HG21 1 1 
        3  4431 1 1  55 VAL HG22 H  -5.086   3.613  -1.752 1.00 . A A .  55 VAL HG22 1 1 
        3  4432 1 1  55 VAL HG23 H  -3.727   4.602  -2.286 1.00 . A A .  55 VAL HG23 1 1 
        3  4433 1 1  55 VAL N    N  -1.188   3.914  -2.601 1.00 . A A .  55 VAL N    1 1 
        3  4434 1 1  55 VAL O    O  -0.989   1.025  -3.185 1.00 . A A .  55 VAL O    1 1 
        3  4435 1 1  56 VAL C    C   0.163  -1.380  -0.770 1.00 . A A .  56 VAL C    1 1 
        3  4436 1 1  56 VAL CA   C   0.829  -0.133  -1.355 1.00 . A A .  56 VAL CA   1 1 
        3  4437 1 1  56 VAL CB   C   2.257   0.049  -0.722 1.00 . A A .  56 VAL CB   1 1 
        3  4438 1 1  56 VAL CG1  C   3.131  -1.224  -0.856 1.00 . A A .  56 VAL CG1  1 1 
        3  4439 1 1  56 VAL CG2  C   2.948   1.255  -1.358 1.00 . A A .  56 VAL CG2  1 1 
        3  4440 1 1  56 VAL H    H   0.063   1.544  -0.288 1.00 . A A .  56 VAL H    1 1 
        3  4441 1 1  56 VAL HA   H   0.961  -0.275  -2.431 1.00 . A A .  56 VAL HA   1 1 
        3  4442 1 1  56 VAL HB   H   2.140   0.260   0.341 1.00 . A A .  56 VAL HB   1 1 
        3  4443 1 1  56 VAL HG11 H   3.257  -1.478  -1.901 1.00 . A A .  56 VAL HG11 1 1 
        3  4444 1 1  56 VAL HG12 H   2.652  -2.047  -0.343 1.00 . A A .  56 VAL HG12 1 1 
        3  4445 1 1  56 VAL HG13 H   4.103  -1.048  -0.410 1.00 . A A .  56 VAL HG13 1 1 
        3  4446 1 1  56 VAL HG21 H   2.334   2.136  -1.232 1.00 . A A .  56 VAL HG21 1 1 
        3  4447 1 1  56 VAL HG22 H   3.103   1.076  -2.415 1.00 . A A .  56 VAL HG22 1 1 
        3  4448 1 1  56 VAL HG23 H   3.906   1.423  -0.883 1.00 . A A .  56 VAL HG23 1 1 
        3  4449 1 1  56 VAL N    N  -0.009   1.066  -1.147 1.00 . A A .  56 VAL N    1 1 
        3  4450 1 1  56 VAL O    O   0.116  -1.557   0.448 1.00 . A A .  56 VAL O    1 1 
        3  4451 1 1  57 PHE C    C   0.445  -4.502  -1.267 1.00 . A A .  57 PHE C    1 1 
        3  4452 1 1  57 PHE CA   C  -0.787  -3.575  -1.311 1.00 . A A .  57 PHE CA   1 1 
        3  4453 1 1  57 PHE CB   C  -1.806  -4.071  -2.365 1.00 . A A .  57 PHE CB   1 1 
        3  4454 1 1  57 PHE CD1  C  -3.429  -2.157  -2.803 1.00 . A A .  57 PHE CD1  1 1 
        3  4455 1 1  57 PHE CD2  C  -4.270  -4.113  -1.714 1.00 . A A .  57 PHE CD2  1 1 
        3  4456 1 1  57 PHE CE1  C  -4.690  -1.591  -2.743 1.00 . A A .  57 PHE CE1  1 1 
        3  4457 1 1  57 PHE CE2  C  -5.527  -3.547  -1.655 1.00 . A A .  57 PHE CE2  1 1 
        3  4458 1 1  57 PHE CG   C  -3.195  -3.430  -2.289 1.00 . A A .  57 PHE CG   1 1 
        3  4459 1 1  57 PHE CZ   C  -5.735  -2.286  -2.170 1.00 . A A .  57 PHE CZ   1 1 
        3  4460 1 1  57 PHE H    H  -0.468  -1.924  -2.584 1.00 . A A .  57 PHE H    1 1 
        3  4461 1 1  57 PHE HA   H  -1.263  -3.554  -0.330 1.00 . A A .  57 PHE HA   1 1 
        3  4462 1 1  57 PHE HB2  H  -1.411  -3.877  -3.356 1.00 . A A .  57 PHE HB2  1 1 
        3  4463 1 1  57 PHE HB3  H  -1.923  -5.138  -2.256 1.00 . A A .  57 PHE HB3  1 1 
        3  4464 1 1  57 PHE HD1  H  -2.614  -1.608  -3.255 1.00 . A A .  57 PHE HD1  1 1 
        3  4465 1 1  57 PHE HD2  H  -4.111  -5.105  -1.308 1.00 . A A .  57 PHE HD2  1 1 
        3  4466 1 1  57 PHE HE1  H  -4.856  -0.600  -3.147 1.00 . A A .  57 PHE HE1  1 1 
        3  4467 1 1  57 PHE HE2  H  -6.345  -4.095  -1.207 1.00 . A A .  57 PHE HE2  1 1 
        3  4468 1 1  57 PHE HZ   H  -6.721  -1.840  -2.122 1.00 . A A .  57 PHE HZ   1 1 
        3  4469 1 1  57 PHE N    N  -0.357  -2.225  -1.656 1.00 . A A .  57 PHE N    1 1 
        3  4470 1 1  57 PHE O    O   1.039  -4.801  -2.307 1.00 . A A .  57 PHE O    1 1 
        3  4471 1 1  58 VAL C    C   1.333  -7.328   0.108 1.00 . A A .  58 VAL C    1 1 
        3  4472 1 1  58 VAL CA   C   1.938  -5.907   0.096 1.00 . A A .  58 VAL CA   1 1 
        3  4473 1 1  58 VAL CB   C   2.829  -5.629   1.375 1.00 . A A .  58 VAL CB   1 1 
        3  4474 1 1  58 VAL CG1  C   3.566  -4.282   1.254 1.00 . A A .  58 VAL CG1  1 1 
        3  4475 1 1  58 VAL CG2  C   2.032  -5.676   2.688 1.00 . A A .  58 VAL CG2  1 1 
        3  4476 1 1  58 VAL H    H   0.408  -4.569   0.733 1.00 . A A .  58 VAL H    1 1 
        3  4477 1 1  58 VAL HA   H   2.592  -5.826  -0.778 1.00 . A A .  58 VAL HA   1 1 
        3  4478 1 1  58 VAL HB   H   3.588  -6.407   1.421 1.00 . A A .  58 VAL HB   1 1 
        3  4479 1 1  58 VAL HG11 H   4.190  -4.290   0.373 1.00 . A A .  58 VAL HG11 1 1 
        3  4480 1 1  58 VAL HG12 H   4.188  -4.118   2.125 1.00 . A A .  58 VAL HG12 1 1 
        3  4481 1 1  58 VAL HG13 H   2.845  -3.475   1.172 1.00 . A A .  58 VAL HG13 1 1 
        3  4482 1 1  58 VAL HG21 H   2.690  -5.485   3.530 1.00 . A A .  58 VAL HG21 1 1 
        3  4483 1 1  58 VAL HG22 H   1.583  -6.653   2.805 1.00 . A A .  58 VAL HG22 1 1 
        3  4484 1 1  58 VAL HG23 H   1.251  -4.926   2.671 1.00 . A A .  58 VAL HG23 1 1 
        3  4485 1 1  58 VAL N    N   0.854  -4.925  -0.065 1.00 . A A .  58 VAL N    1 1 
        3  4486 1 1  58 VAL O    O   0.609  -7.706   1.040 1.00 . A A .  58 VAL O    1 1 
        3  4487 1 1  59 ASN C    C   1.706 -10.471  -0.242 1.00 . A A .  59 ASN C    1 1 
        3  4488 1 1  59 ASN CA   C   1.020  -9.447  -1.150 1.00 . A A .  59 ASN CA   1 1 
        3  4489 1 1  59 ASN CB   C   1.053  -9.887  -2.640 1.00 . A A .  59 ASN CB   1 1 
        3  4490 1 1  59 ASN CG   C   0.137  -9.063  -3.547 1.00 . A A .  59 ASN CG   1 1 
        3  4491 1 1  59 ASN H    H   2.202  -7.751  -1.654 1.00 . A A .  59 ASN H    1 1 
        3  4492 1 1  59 ASN HA   H  -0.022  -9.388  -0.843 1.00 . A A .  59 ASN HA   1 1 
        3  4493 1 1  59 ASN HB2  H   2.061  -9.792  -3.015 1.00 . A A .  59 ASN HB2  1 1 
        3  4494 1 1  59 ASN HB3  H   0.757 -10.932  -2.703 1.00 . A A .  59 ASN HB3  1 1 
        3  4495 1 1  59 ASN HD21 H  -0.321 -10.674  -4.612 1.00 . A A .  59 ASN HD21 1 1 
        3  4496 1 1  59 ASN HD22 H  -1.080  -9.202  -5.103 1.00 . A A .  59 ASN HD22 1 1 
        3  4497 1 1  59 ASN N    N   1.601  -8.100  -0.963 1.00 . A A .  59 ASN N    1 1 
        3  4498 1 1  59 ASN ND2  N  -0.483  -9.712  -4.518 1.00 . A A .  59 ASN ND2  1 1 
        3  4499 1 1  59 ASN O    O   2.616 -11.198  -0.670 1.00 . A A .  59 ASN O    1 1 
        3  4500 1 1  59 ASN OD1  O  -0.045  -7.864  -3.347 1.00 . A A .  59 ASN OD1  1 1 
        3  4501 1 1  60 GLY C    C   3.308 -11.157   2.274 1.00 . A A .  60 GLY C    1 1 
        3  4502 1 1  60 GLY CA   C   1.813 -11.359   2.060 1.00 . A A .  60 GLY CA   1 1 
        3  4503 1 1  60 GLY H    H   0.524  -9.879   1.272 1.00 . A A .  60 GLY H    1 1 
        3  4504 1 1  60 GLY HA2  H   1.305 -11.159   2.990 1.00 . A A .  60 GLY HA2  1 1 
        3  4505 1 1  60 GLY HA3  H   1.629 -12.388   1.777 1.00 . A A .  60 GLY HA3  1 1 
        3  4506 1 1  60 GLY N    N   1.258 -10.487   1.032 1.00 . A A .  60 GLY N    1 1 
        3  4507 1 1  60 GLY O    O   4.033 -12.116   2.564 1.00 . A A .  60 GLY O    1 1 
        3  4508 1 1  61 ALA C    C   5.661  -9.796   3.668 1.00 . A A .  61 ALA C    1 1 
        3  4509 1 1  61 ALA CA   C   5.199  -9.560   2.222 1.00 . A A .  61 ALA CA   1 1 
        3  4510 1 1  61 ALA CB   C   5.470  -8.115   1.783 1.00 . A A .  61 ALA CB   1 1 
        3  4511 1 1  61 ALA H    H   3.137  -9.199   1.850 1.00 . A A .  61 ALA H    1 1 
        3  4512 1 1  61 ALA HA   H   5.758 -10.218   1.559 1.00 . A A .  61 ALA HA   1 1 
        3  4513 1 1  61 ALA HB1  H   4.943  -7.429   2.436 1.00 . A A .  61 ALA HB1  1 1 
        3  4514 1 1  61 ALA HB2  H   5.128  -7.972   0.766 1.00 . A A .  61 ALA HB2  1 1 
        3  4515 1 1  61 ALA HB3  H   6.531  -7.912   1.832 1.00 . A A .  61 ALA HB3  1 1 
        3  4516 1 1  61 ALA N    N   3.773  -9.904   2.083 1.00 . A A .  61 ALA N    1 1 
        3  4517 1 1  61 ALA O    O   4.909  -9.503   4.610 1.00 . A A .  61 ALA O    1 1 
        3  4518 1 1  62 SER C    C   7.671  -9.542   6.027 1.00 . A A .  62 SER C    1 1 
        3  4519 1 1  62 SER CA   C   7.420 -10.760   5.115 1.00 . A A .  62 SER CA   1 1 
        3  4520 1 1  62 SER CB   C   8.719 -11.567   4.889 1.00 . A A .  62 SER CB   1 1 
        3  4521 1 1  62 SER H    H   7.449 -10.427   3.021 1.00 . A A .  62 SER H    1 1 
        3  4522 1 1  62 SER HA   H   6.683 -11.401   5.589 1.00 . A A .  62 SER HA   1 1 
        3  4523 1 1  62 SER HB2  H   8.545 -12.331   4.147 1.00 . A A .  62 SER HB2  1 1 
        3  4524 1 1  62 SER HB3  H   9.502 -10.905   4.536 1.00 . A A .  62 SER HB3  1 1 
        3  4525 1 1  62 SER HG   H   8.783 -13.084   6.126 1.00 . A A .  62 SER HG   1 1 
        3  4526 1 1  62 SER N    N   6.878 -10.335   3.819 1.00 . A A .  62 SER N    1 1 
        3  4527 1 1  62 SER O    O   7.730  -8.403   5.543 1.00 . A A .  62 SER O    1 1 
        3  4528 1 1  62 SER OG   O   9.159 -12.195   6.080 1.00 . A A .  62 SER OG   1 1 
        3  4529 1 1  63 GLN C    C   9.202  -7.843   8.054 1.00 . A A .  63 GLN C    1 1 
        3  4530 1 1  63 GLN CA   C   7.987  -8.752   8.358 1.00 . A A .  63 GLN CA   1 1 
        3  4531 1 1  63 GLN CB   C   8.096  -9.396   9.772 1.00 . A A .  63 GLN CB   1 1 
        3  4532 1 1  63 GLN CD   C   7.220  -7.337  11.097 1.00 . A A .  63 GLN CD   1 1 
        3  4533 1 1  63 GLN CG   C   8.309  -8.407  10.947 1.00 . A A .  63 GLN CG   1 1 
        3  4534 1 1  63 GLN H    H   7.822 -10.736   7.625 1.00 . A A .  63 GLN H    1 1 
        3  4535 1 1  63 GLN HA   H   7.087  -8.140   8.329 1.00 . A A .  63 GLN HA   1 1 
        3  4536 1 1  63 GLN HB2  H   7.186  -9.955   9.968 1.00 . A A .  63 GLN HB2  1 1 
        3  4537 1 1  63 GLN HB3  H   8.927 -10.099   9.769 1.00 . A A .  63 GLN HB3  1 1 
        3  4538 1 1  63 GLN HE21 H   8.538  -6.073  11.860 1.00 . A A .  63 GLN HE21 1 1 
        3  4539 1 1  63 GLN HE22 H   6.919  -5.490  11.715 1.00 . A A .  63 GLN HE22 1 1 
        3  4540 1 1  63 GLN HG2  H   8.350  -8.967  11.870 1.00 . A A .  63 GLN HG2  1 1 
        3  4541 1 1  63 GLN HG3  H   9.265  -7.907  10.801 1.00 . A A .  63 GLN HG3  1 1 
        3  4542 1 1  63 GLN N    N   7.822  -9.801   7.337 1.00 . A A .  63 GLN N    1 1 
        3  4543 1 1  63 GLN NE2  N   7.595  -6.184  11.609 1.00 . A A .  63 GLN NE2  1 1 
        3  4544 1 1  63 GLN O    O   9.131  -6.645   8.279 1.00 . A A .  63 GLN O    1 1 
        3  4545 1 1  63 GLN OE1  O   6.054  -7.547  10.759 1.00 . A A .  63 GLN OE1  1 1 
        3  4546 1 1  64 ASN C    C  11.142  -6.661   5.947 1.00 . A A .  64 ASN C    1 1 
        3  4547 1 1  64 ASN CA   C  11.491  -7.665   7.066 1.00 . A A .  64 ASN CA   1 1 
        3  4548 1 1  64 ASN CB   C  12.638  -8.610   6.601 1.00 . A A .  64 ASN CB   1 1 
        3  4549 1 1  64 ASN CG   C  13.308  -9.376   7.753 1.00 . A A .  64 ASN CG   1 1 
        3  4550 1 1  64 ASN H    H  10.293  -9.406   7.409 1.00 . A A .  64 ASN H    1 1 
        3  4551 1 1  64 ASN HA   H  11.845  -7.100   7.930 1.00 . A A .  64 ASN HA   1 1 
        3  4552 1 1  64 ASN HB2  H  12.246  -9.333   5.893 1.00 . A A .  64 ASN HB2  1 1 
        3  4553 1 1  64 ASN HB3  H  13.404  -8.020   6.106 1.00 . A A .  64 ASN HB3  1 1 
        3  4554 1 1  64 ASN HD21 H  15.009  -9.506   6.730 1.00 . A A .  64 ASN HD21 1 1 
        3  4555 1 1  64 ASN HD22 H  15.018 -10.244   8.293 1.00 . A A .  64 ASN HD22 1 1 
        3  4556 1 1  64 ASN N    N  10.292  -8.429   7.506 1.00 . A A .  64 ASN N    1 1 
        3  4557 1 1  64 ASN ND2  N  14.574  -9.742   7.575 1.00 . A A .  64 ASN ND2  1 1 
        3  4558 1 1  64 ASN O    O  11.621  -5.531   5.979 1.00 . A A .  64 ASN O    1 1 
        3  4559 1 1  64 ASN OD1  O  12.695  -9.647   8.787 1.00 . A A .  64 ASN OD1  1 1 
        3  4560 1 1  65 ASP C    C   8.997  -5.030   4.400 1.00 . A A .  65 ASP C    1 1 
        3  4561 1 1  65 ASP CA   C   9.831  -6.209   3.868 1.00 . A A .  65 ASP CA   1 1 
        3  4562 1 1  65 ASP CB   C   8.991  -7.007   2.832 1.00 . A A .  65 ASP CB   1 1 
        3  4563 1 1  65 ASP CG   C   9.742  -8.199   2.224 1.00 . A A .  65 ASP CG   1 1 
        3  4564 1 1  65 ASP H    H   9.947  -8.001   5.037 1.00 . A A .  65 ASP H    1 1 
        3  4565 1 1  65 ASP HA   H  10.716  -5.815   3.374 1.00 . A A .  65 ASP HA   1 1 
        3  4566 1 1  65 ASP HB2  H   8.085  -7.366   3.321 1.00 . A A .  65 ASP HB2  1 1 
        3  4567 1 1  65 ASP HB3  H   8.697  -6.341   2.022 1.00 . A A .  65 ASP HB3  1 1 
        3  4568 1 1  65 ASP N    N  10.285  -7.083   4.988 1.00 . A A .  65 ASP N    1 1 
        3  4569 1 1  65 ASP O    O   9.114  -3.889   3.917 1.00 . A A .  65 ASP O    1 1 
        3  4570 1 1  65 ASP OD1  O  10.823  -7.985   1.651 1.00 . A A .  65 ASP OD1  1 1 
        3  4571 1 1  65 ASP OD2  O   9.259  -9.352   2.313 1.00 . A A .  65 ASP OD2  1 1 
        3  4572 1 1  66 VAL C    C   8.220  -3.344   6.870 1.00 . A A .  66 VAL C    1 1 
        3  4573 1 1  66 VAL CA   C   7.331  -4.344   6.103 1.00 . A A .  66 VAL CA   1 1 
        3  4574 1 1  66 VAL CB   C   6.319  -5.034   7.092 1.00 . A A .  66 VAL CB   1 1 
        3  4575 1 1  66 VAL CG1  C   5.475  -3.984   7.845 1.00 . A A .  66 VAL CG1  1 1 
        3  4576 1 1  66 VAL CG2  C   5.421  -6.045   6.340 1.00 . A A .  66 VAL CG2  1 1 
        3  4577 1 1  66 VAL H    H   8.111  -6.269   5.689 1.00 . A A .  66 VAL H    1 1 
        3  4578 1 1  66 VAL HA   H   6.759  -3.800   5.351 1.00 . A A .  66 VAL HA   1 1 
        3  4579 1 1  66 VAL HB   H   6.893  -5.590   7.834 1.00 . A A .  66 VAL HB   1 1 
        3  4580 1 1  66 VAL HG11 H   4.910  -3.390   7.137 1.00 . A A .  66 VAL HG11 1 1 
        3  4581 1 1  66 VAL HG12 H   6.126  -3.333   8.414 1.00 . A A .  66 VAL HG12 1 1 
        3  4582 1 1  66 VAL HG13 H   4.789  -4.477   8.523 1.00 . A A .  66 VAL HG13 1 1 
        3  4583 1 1  66 VAL HG21 H   4.751  -6.534   7.037 1.00 . A A .  66 VAL HG21 1 1 
        3  4584 1 1  66 VAL HG22 H   6.041  -6.792   5.860 1.00 . A A .  66 VAL HG22 1 1 
        3  4585 1 1  66 VAL HG23 H   4.839  -5.529   5.587 1.00 . A A .  66 VAL HG23 1 1 
        3  4586 1 1  66 VAL N    N   8.164  -5.335   5.407 1.00 . A A .  66 VAL N    1 1 
        3  4587 1 1  66 VAL O    O   7.986  -2.135   6.821 1.00 . A A .  66 VAL O    1 1 
        3  4588 1 1  67 ASN C    C  10.945  -2.091   7.398 1.00 . A A .  67 ASN C    1 1 
        3  4589 1 1  67 ASN CA   C  10.232  -3.077   8.324 1.00 . A A .  67 ASN CA   1 1 
        3  4590 1 1  67 ASN CB   C  11.278  -3.984   9.052 1.00 . A A .  67 ASN CB   1 1 
        3  4591 1 1  67 ASN CG   C  10.684  -4.831  10.176 1.00 . A A .  67 ASN CG   1 1 
        3  4592 1 1  67 ASN H    H   9.364  -4.848   7.530 1.00 . A A .  67 ASN H    1 1 
        3  4593 1 1  67 ASN HA   H   9.675  -2.512   9.066 1.00 . A A .  67 ASN HA   1 1 
        3  4594 1 1  67 ASN HB2  H  11.732  -4.656   8.328 1.00 . A A .  67 ASN HB2  1 1 
        3  4595 1 1  67 ASN HB3  H  12.060  -3.365   9.481 1.00 . A A .  67 ASN HB3  1 1 
        3  4596 1 1  67 ASN HD21 H  12.039  -6.241   9.846 1.00 . A A .  67 ASN HD21 1 1 
        3  4597 1 1  67 ASN HD22 H  10.909  -6.569  11.108 1.00 . A A .  67 ASN HD22 1 1 
        3  4598 1 1  67 ASN N    N   9.253  -3.881   7.553 1.00 . A A .  67 ASN N    1 1 
        3  4599 1 1  67 ASN ND2  N  11.270  -5.997  10.402 1.00 . A A .  67 ASN ND2  1 1 
        3  4600 1 1  67 ASN O    O  11.020  -0.903   7.692 1.00 . A A .  67 ASN O    1 1 
        3  4601 1 1  67 ASN OD1  O   9.714  -4.443  10.828 1.00 . A A .  67 ASN OD1  1 1 
        3  4602 1 1  68 GLU C    C  11.207  -0.705   4.649 1.00 . A A .  68 GLU C    1 1 
        3  4603 1 1  68 GLU CA   C  12.089  -1.818   5.212 1.00 . A A .  68 GLU CA   1 1 
        3  4604 1 1  68 GLU CB   C  12.563  -2.751   4.069 1.00 . A A .  68 GLU CB   1 1 
        3  4605 1 1  68 GLU CD   C  14.999  -2.959   4.842 1.00 . A A .  68 GLU CD   1 1 
        3  4606 1 1  68 GLU CG   C  13.707  -3.699   4.464 1.00 . A A .  68 GLU CG   1 1 
        3  4607 1 1  68 GLU H    H  11.255  -3.561   6.087 1.00 . A A .  68 GLU H    1 1 
        3  4608 1 1  68 GLU HA   H  12.961  -1.365   5.677 1.00 . A A .  68 GLU HA   1 1 
        3  4609 1 1  68 GLU HB2  H  11.719  -3.356   3.738 1.00 . A A .  68 GLU HB2  1 1 
        3  4610 1 1  68 GLU HB3  H  12.898  -2.149   3.231 1.00 . A A .  68 GLU HB3  1 1 
        3  4611 1 1  68 GLU HG2  H  13.383  -4.304   5.307 1.00 . A A .  68 GLU HG2  1 1 
        3  4612 1 1  68 GLU HG3  H  13.912  -4.360   3.628 1.00 . A A .  68 GLU HG3  1 1 
        3  4613 1 1  68 GLU N    N  11.399  -2.606   6.249 1.00 . A A .  68 GLU N    1 1 
        3  4614 1 1  68 GLU O    O  11.695   0.389   4.355 1.00 . A A .  68 GLU O    1 1 
        3  4615 1 1  68 GLU OE1  O  15.768  -2.593   3.925 1.00 . A A .  68 GLU OE1  1 1 
        3  4616 1 1  68 GLU OE2  O  15.255  -2.742   6.055 1.00 . A A .  68 GLU OE2  1 1 
        3  4617 1 1  69 PHE C    C   8.807   1.147   5.016 1.00 . A A .  69 PHE C    1 1 
        3  4618 1 1  69 PHE CA   C   8.927  -0.016   4.023 1.00 . A A .  69 PHE CA   1 1 
        3  4619 1 1  69 PHE CB   C   7.539  -0.669   3.790 1.00 . A A .  69 PHE CB   1 1 
        3  4620 1 1  69 PHE CD1  C   6.532   0.386   1.715 1.00 . A A .  69 PHE CD1  1 1 
        3  4621 1 1  69 PHE CD2  C   5.643   1.038   3.837 1.00 . A A .  69 PHE CD2  1 1 
        3  4622 1 1  69 PHE CE1  C   5.654   1.236   1.086 1.00 . A A .  69 PHE CE1  1 1 
        3  4623 1 1  69 PHE CE2  C   4.765   1.890   3.208 1.00 . A A .  69 PHE CE2  1 1 
        3  4624 1 1  69 PHE CG   C   6.543   0.266   3.101 1.00 . A A .  69 PHE CG   1 1 
        3  4625 1 1  69 PHE CZ   C   4.770   1.987   1.832 1.00 . A A .  69 PHE CZ   1 1 
        3  4626 1 1  69 PHE H    H   9.599  -1.903   4.736 1.00 . A A .  69 PHE H    1 1 
        3  4627 1 1  69 PHE HA   H   9.297   0.368   3.076 1.00 . A A .  69 PHE HA   1 1 
        3  4628 1 1  69 PHE HB2  H   7.660  -1.548   3.168 1.00 . A A .  69 PHE HB2  1 1 
        3  4629 1 1  69 PHE HB3  H   7.116  -0.978   4.742 1.00 . A A .  69 PHE HB3  1 1 
        3  4630 1 1  69 PHE HD1  H   7.226  -0.201   1.128 1.00 . A A .  69 PHE HD1  1 1 
        3  4631 1 1  69 PHE HD2  H   5.637   0.958   4.918 1.00 . A A .  69 PHE HD2  1 1 
        3  4632 1 1  69 PHE HE1  H   5.656   1.313   0.008 1.00 . A A .  69 PHE HE1  1 1 
        3  4633 1 1  69 PHE HE2  H   4.070   2.482   3.792 1.00 . A A .  69 PHE HE2  1 1 
        3  4634 1 1  69 PHE HZ   H   4.080   2.656   1.334 1.00 . A A .  69 PHE HZ   1 1 
        3  4635 1 1  69 PHE N    N   9.905  -0.999   4.509 1.00 . A A .  69 PHE N    1 1 
        3  4636 1 1  69 PHE O    O   8.843   2.315   4.629 1.00 . A A .  69 PHE O    1 1 
        3  4637 1 1  70 GLN C    C   9.789   2.583   7.631 1.00 . A A .  70 GLN C    1 1 
        3  4638 1 1  70 GLN CA   C   8.509   1.756   7.397 1.00 . A A .  70 GLN CA   1 1 
        3  4639 1 1  70 GLN CB   C   8.091   1.015   8.691 1.00 . A A .  70 GLN CB   1 1 
        3  4640 1 1  70 GLN CD   C   6.449  -0.565   9.824 1.00 . A A .  70 GLN CD   1 1 
        3  4641 1 1  70 GLN CG   C   6.783   0.216   8.558 1.00 . A A .  70 GLN CG   1 1 
        3  4642 1 1  70 GLN H    H   8.746  -0.161   6.521 1.00 . A A .  70 GLN H    1 1 
        3  4643 1 1  70 GLN HA   H   7.708   2.433   7.108 1.00 . A A .  70 GLN HA   1 1 
        3  4644 1 1  70 GLN HB2  H   8.882   0.328   8.976 1.00 . A A .  70 GLN HB2  1 1 
        3  4645 1 1  70 GLN HB3  H   7.963   1.744   9.488 1.00 . A A .  70 GLN HB3  1 1 
        3  4646 1 1  70 GLN HE21 H   7.537  -2.111   9.202 1.00 . A A .  70 GLN HE21 1 1 
        3  4647 1 1  70 GLN HE22 H   6.771  -2.297  10.738 1.00 . A A .  70 GLN HE22 1 1 
        3  4648 1 1  70 GLN HG2  H   5.968   0.905   8.346 1.00 . A A .  70 GLN HG2  1 1 
        3  4649 1 1  70 GLN HG3  H   6.881  -0.476   7.731 1.00 . A A .  70 GLN HG3  1 1 
        3  4650 1 1  70 GLN N    N   8.694   0.792   6.301 1.00 . A A .  70 GLN N    1 1 
        3  4651 1 1  70 GLN NE2  N   6.968  -1.781   9.934 1.00 . A A .  70 GLN NE2  1 1 
        3  4652 1 1  70 GLN O    O   9.699   3.775   7.923 1.00 . A A .  70 GLN O    1 1 
        3  4653 1 1  70 GLN OE1  O   5.757  -0.062  10.706 1.00 . A A .  70 GLN OE1  1 1 
        3  4654 1 1  71 ASN C    C  12.543   3.618   6.590 1.00 . A A .  71 ASN C    1 1 
        3  4655 1 1  71 ASN CA   C  12.295   2.571   7.675 1.00 . A A .  71 ASN CA   1 1 
        3  4656 1 1  71 ASN CB   C  13.446   1.512   7.665 1.00 . A A .  71 ASN CB   1 1 
        3  4657 1 1  71 ASN CG   C  13.419   0.554   8.855 1.00 . A A .  71 ASN CG   1 1 
        3  4658 1 1  71 ASN H    H  10.947   0.999   7.190 1.00 . A A .  71 ASN H    1 1 
        3  4659 1 1  71 ASN HA   H  12.281   3.068   8.642 1.00 . A A .  71 ASN HA   1 1 
        3  4660 1 1  71 ASN HB2  H  13.379   0.924   6.755 1.00 . A A .  71 ASN HB2  1 1 
        3  4661 1 1  71 ASN HB3  H  14.409   2.019   7.672 1.00 . A A .  71 ASN HB3  1 1 
        3  4662 1 1  71 ASN HD21 H  14.187  -0.893   7.733 1.00 . A A .  71 ASN HD21 1 1 
        3  4663 1 1  71 ASN HD22 H  13.874  -1.308   9.381 1.00 . A A .  71 ASN HD22 1 1 
        3  4664 1 1  71 ASN N    N  10.969   1.933   7.475 1.00 . A A .  71 ASN N    1 1 
        3  4665 1 1  71 ASN ND2  N  13.868  -0.674   8.636 1.00 . A A .  71 ASN ND2  1 1 
        3  4666 1 1  71 ASN O    O  12.751   4.801   6.889 1.00 . A A .  71 ASN O    1 1 
        3  4667 1 1  71 ASN OD1  O  12.988   0.905   9.952 1.00 . A A .  71 ASN OD1  1 1 
        3  4668 1 1  72 GLU C    C  11.665   5.138   4.060 1.00 . A A .  72 GLU C    1 1 
        3  4669 1 1  72 GLU CA   C  12.702   4.015   4.149 1.00 . A A .  72 GLU CA   1 1 
        3  4670 1 1  72 GLU CB   C  12.695   3.184   2.846 1.00 . A A .  72 GLU CB   1 1 
        3  4671 1 1  72 GLU CD   C  15.229   2.865   2.546 1.00 . A A .  72 GLU CD   1 1 
        3  4672 1 1  72 GLU CG   C  13.853   2.188   2.700 1.00 . A A .  72 GLU CG   1 1 
        3  4673 1 1  72 GLU H    H  12.269   2.216   5.178 1.00 . A A .  72 GLU H    1 1 
        3  4674 1 1  72 GLU HA   H  13.682   4.468   4.262 1.00 . A A .  72 GLU HA   1 1 
        3  4675 1 1  72 GLU HB2  H  11.766   2.624   2.801 1.00 . A A .  72 GLU HB2  1 1 
        3  4676 1 1  72 GLU HB3  H  12.723   3.861   1.997 1.00 . A A .  72 GLU HB3  1 1 
        3  4677 1 1  72 GLU HG2  H  13.861   1.554   3.580 1.00 . A A .  72 GLU HG2  1 1 
        3  4678 1 1  72 GLU HG3  H  13.669   1.567   1.827 1.00 . A A .  72 GLU HG3  1 1 
        3  4679 1 1  72 GLU N    N  12.480   3.162   5.326 1.00 . A A .  72 GLU N    1 1 
        3  4680 1 1  72 GLU O    O  11.976   6.220   3.592 1.00 . A A .  72 GLU O    1 1 
        3  4681 1 1  72 GLU OE1  O  15.505   3.397   1.448 1.00 . A A .  72 GLU OE1  1 1 
        3  4682 1 1  72 GLU OE2  O  16.044   2.849   3.505 1.00 . A A .  72 GLU OE2  1 1 
        3  4683 1 1  73 ALA C    C   9.688   7.006   5.551 1.00 . A A .  73 ALA C    1 1 
        3  4684 1 1  73 ALA CA   C   9.389   5.909   4.514 1.00 . A A .  73 ALA CA   1 1 
        3  4685 1 1  73 ALA CB   C   8.010   5.283   4.739 1.00 . A A .  73 ALA CB   1 1 
        3  4686 1 1  73 ALA H    H  10.223   3.982   4.845 1.00 . A A .  73 ALA H    1 1 
        3  4687 1 1  73 ALA HA   H   9.381   6.363   3.523 1.00 . A A .  73 ALA HA   1 1 
        3  4688 1 1  73 ALA HB1  H   7.824   4.534   3.984 1.00 . A A .  73 ALA HB1  1 1 
        3  4689 1 1  73 ALA HB2  H   7.244   6.048   4.681 1.00 . A A .  73 ALA HB2  1 1 
        3  4690 1 1  73 ALA HB3  H   7.975   4.818   5.719 1.00 . A A .  73 ALA HB3  1 1 
        3  4691 1 1  73 ALA N    N  10.433   4.882   4.514 1.00 . A A .  73 ALA N    1 1 
        3  4692 1 1  73 ALA O    O   9.770   8.191   5.204 1.00 . A A .  73 ALA O    1 1 
        3  4693 1 1  74 LYS C    C  11.312   8.440   7.825 1.00 . A A .  74 LYS C    1 1 
        3  4694 1 1  74 LYS CA   C  10.059   7.547   7.954 1.00 . A A .  74 LYS CA   1 1 
        3  4695 1 1  74 LYS CB   C  10.050   6.800   9.324 1.00 . A A .  74 LYS CB   1 1 
        3  4696 1 1  74 LYS CD   C  11.205   5.097  10.937 1.00 . A A .  74 LYS CD   1 1 
        3  4697 1 1  74 LYS CE   C  11.256   5.950  12.221 1.00 . A A .  74 LYS CE   1 1 
        3  4698 1 1  74 LYS CG   C  11.289   5.921   9.622 1.00 . A A .  74 LYS CG   1 1 
        3  4699 1 1  74 LYS H    H  10.023   5.634   6.987 1.00 . A A .  74 LYS H    1 1 
        3  4700 1 1  74 LYS HA   H   9.188   8.196   7.919 1.00 . A A .  74 LYS HA   1 1 
        3  4701 1 1  74 LYS HB2  H   9.966   7.536  10.117 1.00 . A A .  74 LYS HB2  1 1 
        3  4702 1 1  74 LYS HB3  H   9.173   6.165   9.362 1.00 . A A .  74 LYS HB3  1 1 
        3  4703 1 1  74 LYS HD2  H  10.283   4.526  10.942 1.00 . A A .  74 LYS HD2  1 1 
        3  4704 1 1  74 LYS HD3  H  12.041   4.401  10.954 1.00 . A A .  74 LYS HD3  1 1 
        3  4705 1 1  74 LYS HE2  H  11.442   5.293  13.062 1.00 . A A .  74 LYS HE2  1 1 
        3  4706 1 1  74 LYS HE3  H  12.078   6.654  12.140 1.00 . A A .  74 LYS HE3  1 1 
        3  4707 1 1  74 LYS HG2  H  11.417   5.229   8.798 1.00 . A A .  74 LYS HG2  1 1 
        3  4708 1 1  74 LYS HG3  H  12.163   6.563   9.670 1.00 . A A .  74 LYS HG3  1 1 
        3  4709 1 1  74 LYS HZ1  H  10.079   7.239  13.375 1.00 . A A .  74 LYS HZ1  1 1 
        3  4710 1 1  74 LYS HZ2  H   9.192   6.053  12.570 1.00 . A A .  74 LYS HZ2  1 1 
        3  4711 1 1  74 LYS HZ3  H   9.802   7.380  11.722 1.00 . A A .  74 LYS HZ3  1 1 
        3  4712 1 1  74 LYS N    N   9.927   6.597   6.815 1.00 . A A .  74 LYS N    1 1 
        3  4713 1 1  74 LYS NZ   N   9.996   6.708  12.489 1.00 . A A .  74 LYS NZ   1 1 
        3  4714 1 1  74 LYS O    O  11.272   9.627   8.177 1.00 . A A .  74 LYS O    1 1 
        3  4715 1 1  75 LYS C    C  13.639   9.638   6.023 1.00 . A A .  75 LYS C    1 1 
        3  4716 1 1  75 LYS CA   C  13.705   8.585   7.151 1.00 . A A .  75 LYS CA   1 1 
        3  4717 1 1  75 LYS CB   C  14.866   7.580   6.898 1.00 . A A .  75 LYS CB   1 1 
        3  4718 1 1  75 LYS CD   C  15.908   5.797   5.333 1.00 . A A .  75 LYS CD   1 1 
        3  4719 1 1  75 LYS CE   C  17.321   6.400   5.302 1.00 . A A .  75 LYS CE   1 1 
        3  4720 1 1  75 LYS CG   C  14.791   6.839   5.552 1.00 . A A .  75 LYS CG   1 1 
        3  4721 1 1  75 LYS H    H  12.346   6.940   6.983 1.00 . A A .  75 LYS H    1 1 
        3  4722 1 1  75 LYS HA   H  13.898   9.101   8.088 1.00 . A A .  75 LYS HA   1 1 
        3  4723 1 1  75 LYS HB2  H  15.810   8.115   6.940 1.00 . A A .  75 LYS HB2  1 1 
        3  4724 1 1  75 LYS HB3  H  14.860   6.840   7.692 1.00 . A A .  75 LYS HB3  1 1 
        3  4725 1 1  75 LYS HD2  H  15.868   5.064   6.128 1.00 . A A .  75 LYS HD2  1 1 
        3  4726 1 1  75 LYS HD3  H  15.728   5.296   4.387 1.00 . A A .  75 LYS HD3  1 1 
        3  4727 1 1  75 LYS HE2  H  17.351   7.209   4.578 1.00 . A A .  75 LYS HE2  1 1 
        3  4728 1 1  75 LYS HE3  H  17.559   6.794   6.284 1.00 . A A .  75 LYS HE3  1 1 
        3  4729 1 1  75 LYS HG2  H  13.833   6.333   5.495 1.00 . A A .  75 LYS HG2  1 1 
        3  4730 1 1  75 LYS HG3  H  14.839   7.576   4.756 1.00 . A A .  75 LYS HG3  1 1 
        3  4731 1 1  75 LYS HZ1  H  18.335   4.592   5.613 1.00 . A A .  75 LYS HZ1  1 1 
        3  4732 1 1  75 LYS HZ2  H  19.297   5.798   4.920 1.00 . A A .  75 LYS HZ2  1 1 
        3  4733 1 1  75 LYS HZ3  H  18.146   4.990   3.985 1.00 . A A .  75 LYS HZ3  1 1 
        3  4734 1 1  75 LYS N    N  12.411   7.871   7.293 1.00 . A A .  75 LYS N    1 1 
        3  4735 1 1  75 LYS NZ   N  18.346   5.376   4.932 1.00 . A A .  75 LYS NZ   1 1 
        3  4736 1 1  75 LYS O    O  14.190  10.733   6.156 1.00 . A A .  75 LYS O    1 1 
        3  4737 1 1  76 GLU C    C  11.664  11.194   3.925 1.00 . A A .  76 GLU C    1 1 
        3  4738 1 1  76 GLU CA   C  12.796  10.167   3.744 1.00 . A A .  76 GLU CA   1 1 
        3  4739 1 1  76 GLU CB   C  12.540   9.302   2.483 1.00 . A A .  76 GLU CB   1 1 
        3  4740 1 1  76 GLU CD   C  15.033   8.837   1.947 1.00 . A A .  76 GLU CD   1 1 
        3  4741 1 1  76 GLU CG   C  13.632   8.252   2.162 1.00 . A A .  76 GLU CG   1 1 
        3  4742 1 1  76 GLU H    H  12.497   8.419   4.914 1.00 . A A .  76 GLU H    1 1 
        3  4743 1 1  76 GLU HA   H  13.729  10.711   3.606 1.00 . A A .  76 GLU HA   1 1 
        3  4744 1 1  76 GLU HB2  H  11.594   8.780   2.606 1.00 . A A .  76 GLU HB2  1 1 
        3  4745 1 1  76 GLU HB3  H  12.450   9.960   1.629 1.00 . A A .  76 GLU HB3  1 1 
        3  4746 1 1  76 GLU HG2  H  13.671   7.542   2.984 1.00 . A A .  76 GLU HG2  1 1 
        3  4747 1 1  76 GLU HG3  H  13.334   7.714   1.266 1.00 . A A .  76 GLU HG3  1 1 
        3  4748 1 1  76 GLU N    N  12.938   9.295   4.928 1.00 . A A .  76 GLU N    1 1 
        3  4749 1 1  76 GLU O    O  11.527  12.120   3.109 1.00 . A A .  76 GLU O    1 1 
        3  4750 1 1  76 GLU OE1  O  15.341   9.271   0.816 1.00 . A A .  76 GLU OE1  1 1 
        3  4751 1 1  76 GLU OE2  O  15.844   8.858   2.899 1.00 . A A .  76 GLU OE2  1 1 
        3  4752 1 1  77 GLY C    C   8.432  11.548   4.681 1.00 . A A .  77 GLY C    1 1 
        3  4753 1 1  77 GLY CA   C   9.765  11.926   5.325 1.00 . A A .  77 GLY CA   1 1 
        3  4754 1 1  77 GLY H    H  10.997  10.215   5.545 1.00 . A A .  77 GLY H    1 1 
        3  4755 1 1  77 GLY HA2  H   9.635  11.907   6.398 1.00 . A A .  77 GLY HA2  1 1 
        3  4756 1 1  77 GLY HA3  H  10.033  12.936   5.032 1.00 . A A .  77 GLY HA3  1 1 
        3  4757 1 1  77 GLY N    N  10.857  11.007   4.985 1.00 . A A .  77 GLY N    1 1 
        3  4758 1 1  77 GLY O    O   7.483  12.339   4.710 1.00 . A A .  77 GLY O    1 1 
        3  4759 1 1  78 VAL C    C   6.176   9.357   4.636 1.00 . A A .  78 VAL C    1 1 
        3  4760 1 1  78 VAL CA   C   7.137   9.798   3.500 1.00 . A A .  78 VAL CA   1 1 
        3  4761 1 1  78 VAL CB   C   7.457   8.594   2.531 1.00 . A A .  78 VAL CB   1 1 
        3  4762 1 1  78 VAL CG1  C   6.174   8.023   1.889 1.00 . A A .  78 VAL CG1  1 1 
        3  4763 1 1  78 VAL CG2  C   8.491   9.014   1.460 1.00 . A A .  78 VAL CG2  1 1 
        3  4764 1 1  78 VAL H    H   9.182   9.809   4.040 1.00 . A A .  78 VAL H    1 1 
        3  4765 1 1  78 VAL HA   H   6.661  10.588   2.910 1.00 . A A .  78 VAL HA   1 1 
        3  4766 1 1  78 VAL HB   H   7.906   7.796   3.121 1.00 . A A .  78 VAL HB   1 1 
        3  4767 1 1  78 VAL HG11 H   6.425   7.190   1.243 1.00 . A A .  78 VAL HG11 1 1 
        3  4768 1 1  78 VAL HG12 H   5.683   8.791   1.304 1.00 . A A .  78 VAL HG12 1 1 
        3  4769 1 1  78 VAL HG13 H   5.503   7.681   2.666 1.00 . A A .  78 VAL HG13 1 1 
        3  4770 1 1  78 VAL HG21 H   9.401   9.344   1.951 1.00 . A A .  78 VAL HG21 1 1 
        3  4771 1 1  78 VAL HG22 H   8.096   9.826   0.863 1.00 . A A .  78 VAL HG22 1 1 
        3  4772 1 1  78 VAL HG23 H   8.723   8.175   0.817 1.00 . A A .  78 VAL HG23 1 1 
        3  4773 1 1  78 VAL N    N   8.369  10.347   4.087 1.00 . A A .  78 VAL N    1 1 
        3  4774 1 1  78 VAL O    O   6.489   8.435   5.399 1.00 . A A .  78 VAL O    1 1 
        3  4775 1 1  79 SER C    C   3.262   8.466   5.436 1.00 . A A .  79 SER C    1 1 
        3  4776 1 1  79 SER CA   C   3.990   9.787   5.749 1.00 . A A .  79 SER CA   1 1 
        3  4777 1 1  79 SER CB   C   3.004  10.976   5.787 1.00 . A A .  79 SER CB   1 1 
        3  4778 1 1  79 SER H    H   4.871  10.782   4.104 1.00 . A A .  79 SER H    1 1 
        3  4779 1 1  79 SER HA   H   4.476   9.703   6.718 1.00 . A A .  79 SER HA   1 1 
        3  4780 1 1  79 SER HB2  H   3.530  11.866   6.097 1.00 . A A .  79 SER HB2  1 1 
        3  4781 1 1  79 SER HB3  H   2.596  11.134   4.798 1.00 . A A .  79 SER HB3  1 1 
        3  4782 1 1  79 SER HG   H   2.277  10.459   7.540 1.00 . A A .  79 SER HG   1 1 
        3  4783 1 1  79 SER N    N   5.027  10.052   4.743 1.00 . A A .  79 SER N    1 1 
        3  4784 1 1  79 SER O    O   2.318   8.435   4.652 1.00 . A A .  79 SER O    1 1 
        3  4785 1 1  79 SER OG   O   1.928  10.760   6.690 1.00 . A A .  79 SER OG   1 1 
        3  4786 1 1  80 TYR C    C   2.097   5.740   6.869 1.00 . A A .  80 TYR C    1 1 
        3  4787 1 1  80 TYR CA   C   3.172   6.037   5.810 1.00 . A A .  80 TYR CA   1 1 
        3  4788 1 1  80 TYR CB   C   4.294   4.963   5.815 1.00 . A A .  80 TYR CB   1 1 
        3  4789 1 1  80 TYR CD1  C   6.001   5.673   7.593 1.00 . A A .  80 TYR CD1  1 1 
        3  4790 1 1  80 TYR CD2  C   4.706   3.712   8.011 1.00 . A A .  80 TYR CD2  1 1 
        3  4791 1 1  80 TYR CE1  C   6.642   5.509   8.799 1.00 . A A .  80 TYR CE1  1 1 
        3  4792 1 1  80 TYR CE2  C   5.353   3.550   9.222 1.00 . A A .  80 TYR CE2  1 1 
        3  4793 1 1  80 TYR CG   C   5.014   4.777   7.163 1.00 . A A .  80 TYR CG   1 1 
        3  4794 1 1  80 TYR CZ   C   6.316   4.453   9.610 1.00 . A A .  80 TYR CZ   1 1 
        3  4795 1 1  80 TYR H    H   4.500   7.471   6.643 1.00 . A A .  80 TYR H    1 1 
        3  4796 1 1  80 TYR HA   H   2.695   6.031   4.827 1.00 . A A .  80 TYR HA   1 1 
        3  4797 1 1  80 TYR HB2  H   3.871   4.010   5.516 1.00 . A A .  80 TYR HB2  1 1 
        3  4798 1 1  80 TYR HB3  H   5.044   5.240   5.079 1.00 . A A .  80 TYR HB3  1 1 
        3  4799 1 1  80 TYR HD1  H   6.264   6.509   6.962 1.00 . A A .  80 TYR HD1  1 1 
        3  4800 1 1  80 TYR HD2  H   3.944   3.001   7.711 1.00 . A A .  80 TYR HD2  1 1 
        3  4801 1 1  80 TYR HE1  H   7.400   6.217   9.109 1.00 . A A .  80 TYR HE1  1 1 
        3  4802 1 1  80 TYR HE2  H   5.098   2.713   9.860 1.00 . A A .  80 TYR HE2  1 1 
        3  4803 1 1  80 TYR HH   H   7.233   3.378  10.917 1.00 . A A .  80 TYR HH   1 1 
        3  4804 1 1  80 TYR N    N   3.740   7.374   6.026 1.00 . A A .  80 TYR N    1 1 
        3  4805 1 1  80 TYR O    O   2.227   6.153   8.024 1.00 . A A .  80 TYR O    1 1 
        3  4806 1 1  80 TYR OH   O   6.963   4.296  10.816 1.00 . A A .  80 TYR OH   1 1 
        3  4807 1 1  81 ASP C    C  -0.055   3.057   7.331 1.00 . A A .  81 ASP C    1 1 
        3  4808 1 1  81 ASP CA   C  -0.042   4.583   7.366 1.00 . A A .  81 ASP CA   1 1 
        3  4809 1 1  81 ASP CB   C  -1.432   5.118   6.914 1.00 . A A .  81 ASP CB   1 1 
        3  4810 1 1  81 ASP CG   C  -1.487   6.646   6.777 1.00 . A A .  81 ASP CG   1 1 
        3  4811 1 1  81 ASP H    H   0.952   4.833   5.508 1.00 . A A .  81 ASP H    1 1 
        3  4812 1 1  81 ASP HA   H   0.170   4.923   8.381 1.00 . A A .  81 ASP HA   1 1 
        3  4813 1 1  81 ASP HB2  H  -1.689   4.669   5.953 1.00 . A A .  81 ASP HB2  1 1 
        3  4814 1 1  81 ASP HB3  H  -2.178   4.813   7.640 1.00 . A A .  81 ASP HB3  1 1 
        3  4815 1 1  81 ASP N    N   1.030   5.043   6.459 1.00 . A A .  81 ASP N    1 1 
        3  4816 1 1  81 ASP O    O  -0.252   2.477   6.265 1.00 . A A .  81 ASP O    1 1 
        3  4817 1 1  81 ASP OD1  O  -1.455   7.356   7.810 1.00 . A A .  81 ASP OD1  1 1 
        3  4818 1 1  81 ASP OD2  O  -1.562   7.151   5.635 1.00 . A A .  81 ASP OD2  1 1 
        3  4819 1 1  82 VAL C    C  -1.219   0.369   8.812 1.00 . A A .  82 VAL C    1 1 
        3  4820 1 1  82 VAL CA   C   0.191   0.932   8.555 1.00 . A A .  82 VAL CA   1 1 
        3  4821 1 1  82 VAL CB   C   1.215   0.405   9.641 1.00 . A A .  82 VAL CB   1 1 
        3  4822 1 1  82 VAL CG1  C   1.303  -1.138   9.594 1.00 . A A .  82 VAL CG1  1 1 
        3  4823 1 1  82 VAL CG2  C   2.608   1.050   9.437 1.00 . A A .  82 VAL CG2  1 1 
        3  4824 1 1  82 VAL H    H   0.221   2.928   9.311 1.00 . A A .  82 VAL H    1 1 
        3  4825 1 1  82 VAL HA   H   0.533   0.575   7.580 1.00 . A A .  82 VAL HA   1 1 
        3  4826 1 1  82 VAL HB   H   0.853   0.692  10.634 1.00 . A A .  82 VAL HB   1 1 
        3  4827 1 1  82 VAL HG11 H   1.973  -1.499  10.365 1.00 . A A .  82 VAL HG11 1 1 
        3  4828 1 1  82 VAL HG12 H   1.675  -1.453   8.626 1.00 . A A .  82 VAL HG12 1 1 
        3  4829 1 1  82 VAL HG13 H   0.318  -1.569   9.751 1.00 . A A .  82 VAL HG13 1 1 
        3  4830 1 1  82 VAL HG21 H   2.995   0.780   8.462 1.00 . A A .  82 VAL HG21 1 1 
        3  4831 1 1  82 VAL HG22 H   3.296   0.709  10.203 1.00 . A A .  82 VAL HG22 1 1 
        3  4832 1 1  82 VAL HG23 H   2.522   2.128   9.495 1.00 . A A .  82 VAL HG23 1 1 
        3  4833 1 1  82 VAL N    N   0.133   2.408   8.488 1.00 . A A .  82 VAL N    1 1 
        3  4834 1 1  82 VAL O    O  -1.853   0.689   9.818 1.00 . A A .  82 VAL O    1 1 
        3  4835 1 1  83 LEU C    C  -2.886  -2.587   7.836 1.00 . A A .  83 LEU C    1 1 
        3  4836 1 1  83 LEU CA   C  -3.034  -1.063   7.910 1.00 . A A .  83 LEU CA   1 1 
        3  4837 1 1  83 LEU CB   C  -3.871  -0.540   6.703 1.00 . A A .  83 LEU CB   1 1 
        3  4838 1 1  83 LEU CD1  C  -6.226  -0.633   7.733 1.00 . A A .  83 LEU CD1  1 1 
        3  4839 1 1  83 LEU CD2  C  -5.929  -0.715   5.195 1.00 . A A .  83 LEU CD2  1 1 
        3  4840 1 1  83 LEU CG   C  -5.324  -1.092   6.568 1.00 . A A .  83 LEU CG   1 1 
        3  4841 1 1  83 LEU H    H  -1.112  -0.687   7.121 1.00 . A A .  83 LEU H    1 1 
        3  4842 1 1  83 LEU HA   H  -3.529  -0.790   8.844 1.00 . A A .  83 LEU HA   1 1 
        3  4843 1 1  83 LEU HB2  H  -3.930   0.543   6.772 1.00 . A A .  83 LEU HB2  1 1 
        3  4844 1 1  83 LEU HB3  H  -3.334  -0.782   5.791 1.00 . A A .  83 LEU HB3  1 1 
        3  4845 1 1  83 LEU HD11 H  -5.812  -0.972   8.673 1.00 . A A .  83 LEU HD11 1 1 
        3  4846 1 1  83 LEU HD12 H  -7.213  -1.058   7.609 1.00 . A A .  83 LEU HD12 1 1 
        3  4847 1 1  83 LEU HD13 H  -6.302   0.447   7.739 1.00 . A A .  83 LEU HD13 1 1 
        3  4848 1 1  83 LEU HD21 H  -5.313  -1.116   4.400 1.00 . A A .  83 LEU HD21 1 1 
        3  4849 1 1  83 LEU HD22 H  -5.986   0.363   5.095 1.00 . A A .  83 LEU HD22 1 1 
        3  4850 1 1  83 LEU HD23 H  -6.924  -1.133   5.110 1.00 . A A .  83 LEU HD23 1 1 
        3  4851 1 1  83 LEU HG   H  -5.282  -2.173   6.614 1.00 . A A .  83 LEU HG   1 1 
        3  4852 1 1  83 LEU N    N  -1.695  -0.460   7.876 1.00 . A A .  83 LEU N    1 1 
        3  4853 1 1  83 LEU O    O  -2.119  -3.087   7.021 1.00 . A A .  83 LEU O    1 1 
        3  4854 1 1  84 LYS C    C  -5.133  -5.177   8.699 1.00 . A A .  84 LYS C    1 1 
        3  4855 1 1  84 LYS CA   C  -3.654  -4.782   8.701 1.00 . A A .  84 LYS CA   1 1 
        3  4856 1 1  84 LYS CB   C  -2.912  -5.427   9.921 1.00 . A A .  84 LYS CB   1 1 
        3  4857 1 1  84 LYS CD   C  -0.623  -4.176  10.060 1.00 . A A .  84 LYS CD   1 1 
        3  4858 1 1  84 LYS CE   C  -0.506  -3.783  11.548 1.00 . A A .  84 LYS CE   1 1 
        3  4859 1 1  84 LYS CG   C  -1.370  -5.503   9.808 1.00 . A A .  84 LYS CG   1 1 
        3  4860 1 1  84 LYS H    H  -4.084  -2.830   9.415 1.00 . A A .  84 LYS H    1 1 
        3  4861 1 1  84 LYS HA   H  -3.196  -5.141   7.776 1.00 . A A .  84 LYS HA   1 1 
        3  4862 1 1  84 LYS HB2  H  -3.151  -4.857  10.814 1.00 . A A .  84 LYS HB2  1 1 
        3  4863 1 1  84 LYS HB3  H  -3.283  -6.438  10.054 1.00 . A A .  84 LYS HB3  1 1 
        3  4864 1 1  84 LYS HD2  H   0.381  -4.270   9.659 1.00 . A A .  84 LYS HD2  1 1 
        3  4865 1 1  84 LYS HD3  H  -1.131  -3.379   9.527 1.00 . A A .  84 LYS HD3  1 1 
        3  4866 1 1  84 LYS HE2  H  -0.017  -4.584  12.087 1.00 . A A .  84 LYS HE2  1 1 
        3  4867 1 1  84 LYS HE3  H   0.108  -2.893  11.614 1.00 . A A .  84 LYS HE3  1 1 
        3  4868 1 1  84 LYS HG2  H  -1.007  -6.232  10.523 1.00 . A A .  84 LYS HG2  1 1 
        3  4869 1 1  84 LYS HG3  H  -1.122  -5.855   8.808 1.00 . A A .  84 LYS HG3  1 1 
        3  4870 1 1  84 LYS HZ1  H  -2.367  -4.375  12.305 1.00 . A A .  84 LYS HZ1  1 1 
        3  4871 1 1  84 LYS HZ2  H  -2.357  -2.822  11.633 1.00 . A A .  84 LYS HZ2  1 1 
        3  4872 1 1  84 LYS HZ3  H  -1.658  -3.091  13.143 1.00 . A A .  84 LYS HZ3  1 1 
        3  4873 1 1  84 LYS N    N  -3.579  -3.308   8.722 1.00 . A A .  84 LYS N    1 1 
        3  4874 1 1  84 LYS NZ   N  -1.811  -3.502  12.199 1.00 . A A .  84 LYS NZ   1 1 
        3  4875 1 1  84 LYS O    O  -5.812  -4.997   9.718 1.00 . A A .  84 LYS O    1 1 
        3  4876 1 1  85 SER C    C  -7.198  -7.135   6.311 1.00 . A A .  85 SER C    1 1 
        3  4877 1 1  85 SER CA   C  -7.055  -6.041   7.383 1.00 . A A .  85 SER CA   1 1 
        3  4878 1 1  85 SER CB   C  -7.877  -4.793   6.961 1.00 . A A .  85 SER CB   1 1 
        3  4879 1 1  85 SER H    H  -5.015  -5.830   6.806 1.00 . A A .  85 SER H    1 1 
        3  4880 1 1  85 SER HA   H  -7.436  -6.421   8.329 1.00 . A A .  85 SER HA   1 1 
        3  4881 1 1  85 SER HB2  H  -7.498  -4.417   6.027 1.00 . A A .  85 SER HB2  1 1 
        3  4882 1 1  85 SER HB3  H  -8.924  -5.059   6.838 1.00 . A A .  85 SER HB3  1 1 
        3  4883 1 1  85 SER HG   H  -8.576  -3.760   8.467 1.00 . A A .  85 SER HG   1 1 
        3  4884 1 1  85 SER N    N  -5.632  -5.685   7.559 1.00 . A A .  85 SER N    1 1 
        3  4885 1 1  85 SER O    O  -6.611  -7.019   5.233 1.00 . A A .  85 SER O    1 1 
        3  4886 1 1  85 SER OG   O  -7.788  -3.750   7.911 1.00 . A A .  85 SER OG   1 1 
        3  4887 1 1  86 THR C    C  -9.673  -9.214   5.086 1.00 . A A .  86 THR C    1 1 
        3  4888 1 1  86 THR CA   C  -8.250  -9.293   5.675 1.00 . A A .  86 THR CA   1 1 
        3  4889 1 1  86 THR CB   C  -8.021 -10.671   6.378 1.00 . A A .  86 THR CB   1 1 
        3  4890 1 1  86 THR CG2  C  -6.531 -10.941   6.658 1.00 . A A .  86 THR CG2  1 1 
        3  4891 1 1  86 THR H    H  -8.391  -8.229   7.502 1.00 . A A .  86 THR H    1 1 
        3  4892 1 1  86 THR HA   H  -7.547  -9.221   4.846 1.00 . A A .  86 THR HA   1 1 
        3  4893 1 1  86 THR HB   H  -8.393 -11.460   5.734 1.00 . A A .  86 THR HB   1 1 
        3  4894 1 1  86 THR HG1  H  -9.420 -11.400   7.565 1.00 . A A .  86 THR HG1  1 1 
        3  4895 1 1  86 THR HG21 H  -6.131 -10.167   7.302 1.00 . A A .  86 THR HG21 1 1 
        3  4896 1 1  86 THR HG22 H  -5.978 -10.954   5.728 1.00 . A A .  86 THR HG22 1 1 
        3  4897 1 1  86 THR HG23 H  -6.424 -11.899   7.148 1.00 . A A .  86 THR HG23 1 1 
        3  4898 1 1  86 THR N    N  -7.981  -8.187   6.614 1.00 . A A .  86 THR N    1 1 
        3  4899 1 1  86 THR O    O  -9.986  -9.954   4.145 1.00 . A A .  86 THR O    1 1 
        3  4900 1 1  86 THR OG1  O  -8.746 -10.715   7.614 1.00 . A A .  86 THR OG1  1 1 
        3  4901 1 1  87 ASP C    C -11.778  -7.293   3.761 1.00 . A A .  87 ASP C    1 1 
        3  4902 1 1  87 ASP CA   C -11.884  -8.053   5.101 1.00 . A A .  87 ASP CA   1 1 
        3  4903 1 1  87 ASP CB   C -12.750  -7.217   6.094 1.00 . A A .  87 ASP CB   1 1 
        3  4904 1 1  87 ASP CG   C -13.316  -8.047   7.256 1.00 . A A .  87 ASP CG   1 1 
        3  4905 1 1  87 ASP H    H -10.218  -7.803   6.401 1.00 . A A .  87 ASP H    1 1 
        3  4906 1 1  87 ASP HA   H -12.365  -9.019   4.939 1.00 . A A .  87 ASP HA   1 1 
        3  4907 1 1  87 ASP HB2  H -12.148  -6.410   6.503 1.00 . A A .  87 ASP HB2  1 1 
        3  4908 1 1  87 ASP HB3  H -13.586  -6.768   5.556 1.00 . A A .  87 ASP HB3  1 1 
        3  4909 1 1  87 ASP N    N -10.523  -8.316   5.632 1.00 . A A .  87 ASP N    1 1 
        3  4910 1 1  87 ASP O    O -11.197  -6.207   3.738 1.00 . A A .  87 ASP O    1 1 
        3  4911 1 1  87 ASP OD1  O -12.642  -8.186   8.293 1.00 . A A .  87 ASP OD1  1 1 
        3  4912 1 1  87 ASP OD2  O -14.444  -8.571   7.127 1.00 . A A .  87 ASP OD2  1 1 
        3  4913 1 1  88 PRO C    C -13.141  -5.858   1.343 1.00 . A A .  88 PRO C    1 1 
        3  4914 1 1  88 PRO CA   C -12.332  -7.162   1.318 1.00 . A A .  88 PRO CA   1 1 
        3  4915 1 1  88 PRO CB   C -12.944  -8.210   0.341 1.00 . A A .  88 PRO CB   1 1 
        3  4916 1 1  88 PRO CD   C -12.965  -9.183   2.531 1.00 . A A .  88 PRO CD   1 1 
        3  4917 1 1  88 PRO CG   C -13.724  -9.133   1.223 1.00 . A A .  88 PRO CG   1 1 
        3  4918 1 1  88 PRO HA   H -11.312  -6.936   1.014 1.00 . A A .  88 PRO HA   1 1 
        3  4919 1 1  88 PRO HB2  H -13.583  -7.732  -0.401 1.00 . A A .  88 PRO HB2  1 1 
        3  4920 1 1  88 PRO HB3  H -12.154  -8.762  -0.162 1.00 . A A .  88 PRO HB3  1 1 
        3  4921 1 1  88 PRO HD2  H -13.645  -9.357   3.355 1.00 . A A .  88 PRO HD2  1 1 
        3  4922 1 1  88 PRO HD3  H -12.206  -9.959   2.504 1.00 . A A .  88 PRO HD3  1 1 
        3  4923 1 1  88 PRO HG2  H -14.728  -8.742   1.374 1.00 . A A .  88 PRO HG2  1 1 
        3  4924 1 1  88 PRO HG3  H -13.777 -10.125   0.784 1.00 . A A .  88 PRO HG3  1 1 
        3  4925 1 1  88 PRO N    N -12.333  -7.843   2.630 1.00 . A A .  88 PRO N    1 1 
        3  4926 1 1  88 PRO O    O -12.683  -4.843   0.825 1.00 . A A .  88 PRO O    1 1 
        3  4927 1 1  89 GLU C    C -14.549  -3.559   2.840 1.00 . A A .  89 GLU C    1 1 
        3  4928 1 1  89 GLU CA   C -15.231  -4.730   2.096 1.00 . A A .  89 GLU CA   1 1 
        3  4929 1 1  89 GLU CB   C -16.559  -5.143   2.786 1.00 . A A .  89 GLU CB   1 1 
        3  4930 1 1  89 GLU CD   C -17.726  -6.082   4.885 1.00 . A A .  89 GLU CD   1 1 
        3  4931 1 1  89 GLU CG   C -16.407  -5.638   4.240 1.00 . A A .  89 GLU CG   1 1 
        3  4932 1 1  89 GLU H    H -14.604  -6.745   2.397 1.00 . A A .  89 GLU H    1 1 
        3  4933 1 1  89 GLU HA   H -15.454  -4.405   1.085 1.00 . A A .  89 GLU HA   1 1 
        3  4934 1 1  89 GLU HB2  H -17.238  -4.293   2.789 1.00 . A A .  89 GLU HB2  1 1 
        3  4935 1 1  89 GLU HB3  H -17.014  -5.939   2.204 1.00 . A A .  89 GLU HB3  1 1 
        3  4936 1 1  89 GLU HG2  H -15.704  -6.468   4.254 1.00 . A A .  89 GLU HG2  1 1 
        3  4937 1 1  89 GLU HG3  H -15.988  -4.829   4.831 1.00 . A A .  89 GLU HG3  1 1 
        3  4938 1 1  89 GLU N    N -14.326  -5.897   1.986 1.00 . A A .  89 GLU N    1 1 
        3  4939 1 1  89 GLU O    O -14.656  -2.382   2.425 1.00 . A A .  89 GLU O    1 1 
        3  4940 1 1  89 GLU OE1  O -18.600  -5.218   5.128 1.00 . A A .  89 GLU OE1  1 1 
        3  4941 1 1  89 GLU OE2  O -17.896  -7.288   5.158 1.00 . A A .  89 GLU OE2  1 1 
        3  4942 1 1  90 GLU C    C -11.940  -2.318   3.891 1.00 . A A .  90 GLU C    1 1 
        3  4943 1 1  90 GLU CA   C -13.062  -2.942   4.717 1.00 . A A .  90 GLU CA   1 1 
        3  4944 1 1  90 GLU CB   C -12.478  -3.585   5.998 1.00 . A A .  90 GLU CB   1 1 
        3  4945 1 1  90 GLU CD   C -11.057  -3.189   8.135 1.00 . A A .  90 GLU CD   1 1 
        3  4946 1 1  90 GLU CG   C -11.809  -2.569   6.949 1.00 . A A .  90 GLU CG   1 1 
        3  4947 1 1  90 GLU H    H -13.721  -4.860   4.129 1.00 . A A .  90 GLU H    1 1 
        3  4948 1 1  90 GLU HA   H -13.763  -2.163   5.002 1.00 . A A .  90 GLU HA   1 1 
        3  4949 1 1  90 GLU HB2  H -13.278  -4.085   6.539 1.00 . A A .  90 GLU HB2  1 1 
        3  4950 1 1  90 GLU HB3  H -11.739  -4.327   5.715 1.00 . A A .  90 GLU HB3  1 1 
        3  4951 1 1  90 GLU HG2  H -11.097  -1.983   6.370 1.00 . A A .  90 GLU HG2  1 1 
        3  4952 1 1  90 GLU HG3  H -12.571  -1.898   7.336 1.00 . A A .  90 GLU HG3  1 1 
        3  4953 1 1  90 GLU N    N -13.793  -3.911   3.901 1.00 . A A .  90 GLU N    1 1 
        3  4954 1 1  90 GLU O    O -11.848  -1.108   3.808 1.00 . A A .  90 GLU O    1 1 
        3  4955 1 1  90 GLU OE1  O -11.284  -4.368   8.473 1.00 . A A .  90 GLU OE1  1 1 
        3  4956 1 1  90 GLU OE2  O -10.237  -2.478   8.753 1.00 . A A .  90 GLU OE2  1 1 
        3  4957 1 1  91 LEU C    C -10.451  -1.757   1.300 1.00 . A A .  91 LEU C    1 1 
        3  4958 1 1  91 LEU CA   C  -9.983  -2.704   2.422 1.00 . A A .  91 LEU CA   1 1 
        3  4959 1 1  91 LEU CB   C  -9.191  -3.902   1.827 1.00 . A A .  91 LEU CB   1 1 
        3  4960 1 1  91 LEU CD1  C  -7.605  -5.895   2.095 1.00 . A A .  91 LEU CD1  1 1 
        3  4961 1 1  91 LEU CD2  C  -7.339  -3.847   3.582 1.00 . A A .  91 LEU CD2  1 1 
        3  4962 1 1  91 LEU CG   C  -8.338  -4.743   2.824 1.00 . A A .  91 LEU CG   1 1 
        3  4963 1 1  91 LEU H    H -11.278  -4.129   3.333 1.00 . A A .  91 LEU H    1 1 
        3  4964 1 1  91 LEU HA   H  -9.324  -2.144   3.080 1.00 . A A .  91 LEU HA   1 1 
        3  4965 1 1  91 LEU HB2  H  -9.902  -4.571   1.346 1.00 . A A .  91 LEU HB2  1 1 
        3  4966 1 1  91 LEU HB3  H  -8.522  -3.524   1.057 1.00 . A A .  91 LEU HB3  1 1 
        3  4967 1 1  91 LEU HD11 H  -8.331  -6.524   1.597 1.00 . A A .  91 LEU HD11 1 1 
        3  4968 1 1  91 LEU HD12 H  -7.055  -6.490   2.809 1.00 . A A .  91 LEU HD12 1 1 
        3  4969 1 1  91 LEU HD13 H  -6.918  -5.490   1.359 1.00 . A A .  91 LEU HD13 1 1 
        3  4970 1 1  91 LEU HD21 H  -6.745  -4.453   4.257 1.00 . A A .  91 LEU HD21 1 1 
        3  4971 1 1  91 LEU HD22 H  -7.879  -3.107   4.158 1.00 . A A .  91 LEU HD22 1 1 
        3  4972 1 1  91 LEU HD23 H  -6.684  -3.345   2.882 1.00 . A A .  91 LEU HD23 1 1 
        3  4973 1 1  91 LEU HG   H  -8.997  -5.193   3.561 1.00 . A A .  91 LEU HG   1 1 
        3  4974 1 1  91 LEU N    N -11.115  -3.165   3.248 1.00 . A A .  91 LEU N    1 1 
        3  4975 1 1  91 LEU O    O  -9.811  -0.740   1.042 1.00 . A A .  91 LEU O    1 1 
        3  4976 1 1  92 THR C    C -12.560   0.123   0.060 1.00 . A A .  92 THR C    1 1 
        3  4977 1 1  92 THR CA   C -12.184  -1.296  -0.414 1.00 . A A .  92 THR CA   1 1 
        3  4978 1 1  92 THR CB   C -13.425  -2.036  -1.026 1.00 . A A .  92 THR CB   1 1 
        3  4979 1 1  92 THR CG2  C -14.018  -1.298  -2.238 1.00 . A A .  92 THR CG2  1 1 
        3  4980 1 1  92 THR H    H -12.079  -2.877   0.997 1.00 . A A .  92 THR H    1 1 
        3  4981 1 1  92 THR HA   H -11.429  -1.209  -1.191 1.00 . A A .  92 THR HA   1 1 
        3  4982 1 1  92 THR HB   H -14.189  -2.124  -0.259 1.00 . A A .  92 THR HB   1 1 
        3  4983 1 1  92 THR HG1  H -12.346  -3.686  -0.880 1.00 . A A .  92 THR HG1  1 1 
        3  4984 1 1  92 THR HG21 H -14.347  -0.309  -1.943 1.00 . A A .  92 THR HG21 1 1 
        3  4985 1 1  92 THR HG22 H -14.868  -1.854  -2.620 1.00 . A A .  92 THR HG22 1 1 
        3  4986 1 1  92 THR HG23 H -13.273  -1.211  -3.016 1.00 . A A .  92 THR HG23 1 1 
        3  4987 1 1  92 THR N    N -11.601  -2.084   0.687 1.00 . A A .  92 THR N    1 1 
        3  4988 1 1  92 THR O    O -12.300   1.116  -0.647 1.00 . A A .  92 THR O    1 1 
        3  4989 1 1  92 THR OG1  O -13.047  -3.357  -1.446 1.00 . A A .  92 THR OG1  1 1 
        3  4990 1 1  93 GLN C    C -12.208   2.251   2.408 1.00 . A A .  93 GLN C    1 1 
        3  4991 1 1  93 GLN CA   C -13.470   1.528   1.863 1.00 . A A .  93 GLN CA   1 1 
        3  4992 1 1  93 GLN CB   C -14.634   1.432   2.900 1.00 . A A .  93 GLN CB   1 1 
        3  4993 1 1  93 GLN CD   C -13.520   1.360   5.267 1.00 . A A .  93 GLN CD   1 1 
        3  4994 1 1  93 GLN CG   C -14.390   0.657   4.215 1.00 . A A .  93 GLN CG   1 1 
        3  4995 1 1  93 GLN H    H -13.366  -0.602   1.776 1.00 . A A .  93 GLN H    1 1 
        3  4996 1 1  93 GLN HA   H -13.837   2.141   1.036 1.00 . A A .  93 GLN HA   1 1 
        3  4997 1 1  93 GLN HB2  H -14.934   2.436   3.165 1.00 . A A .  93 GLN HB2  1 1 
        3  4998 1 1  93 GLN HB3  H -15.473   0.960   2.396 1.00 . A A .  93 GLN HB3  1 1 
        3  4999 1 1  93 GLN HE21 H -14.180   3.158   4.725 1.00 . A A .  93 GLN HE21 1 1 
        3  5000 1 1  93 GLN HE22 H -12.995   3.130   5.981 1.00 . A A .  93 GLN HE22 1 1 
        3  5001 1 1  93 GLN HG2  H -15.346   0.468   4.676 1.00 . A A .  93 GLN HG2  1 1 
        3  5002 1 1  93 GLN HG3  H -13.932  -0.293   3.963 1.00 . A A .  93 GLN HG3  1 1 
        3  5003 1 1  93 GLN N    N -13.140   0.221   1.278 1.00 . A A .  93 GLN N    1 1 
        3  5004 1 1  93 GLN NE2  N -13.579   2.683   5.339 1.00 . A A .  93 GLN NE2  1 1 
        3  5005 1 1  93 GLN O    O -12.141   3.467   2.336 1.00 . A A .  93 GLN O    1 1 
        3  5006 1 1  93 GLN OE1  O -12.815   0.707   6.027 1.00 . A A .  93 GLN OE1  1 1 
        3  5007 1 1  94 ARG C    C  -9.179   2.858   2.366 1.00 . A A .  94 ARG C    1 1 
        3  5008 1 1  94 ARG CA   C  -9.940   2.093   3.464 1.00 . A A .  94 ARG CA   1 1 
        3  5009 1 1  94 ARG CB   C  -9.002   0.992   4.043 1.00 . A A .  94 ARG CB   1 1 
        3  5010 1 1  94 ARG CD   C  -9.563   1.163   6.552 1.00 . A A .  94 ARG CD   1 1 
        3  5011 1 1  94 ARG CG   C  -9.507   0.269   5.307 1.00 . A A .  94 ARG CG   1 1 
        3  5012 1 1  94 ARG CZ   C -10.038   0.914   8.995 1.00 . A A .  94 ARG CZ   1 1 
        3  5013 1 1  94 ARG H    H -11.300   0.530   2.926 1.00 . A A .  94 ARG H    1 1 
        3  5014 1 1  94 ARG HA   H -10.212   2.790   4.252 1.00 . A A .  94 ARG HA   1 1 
        3  5015 1 1  94 ARG HB2  H  -8.842   0.243   3.272 1.00 . A A .  94 ARG HB2  1 1 
        3  5016 1 1  94 ARG HB3  H  -8.037   1.439   4.276 1.00 . A A .  94 ARG HB3  1 1 
        3  5017 1 1  94 ARG HD2  H  -8.591   1.622   6.705 1.00 . A A .  94 ARG HD2  1 1 
        3  5018 1 1  94 ARG HD3  H -10.305   1.938   6.398 1.00 . A A .  94 ARG HD3  1 1 
        3  5019 1 1  94 ARG HE   H -10.092  -0.564   7.641 1.00 . A A .  94 ARG HE   1 1 
        3  5020 1 1  94 ARG HG2  H -10.502  -0.110   5.112 1.00 . A A .  94 ARG HG2  1 1 
        3  5021 1 1  94 ARG HG3  H  -8.849  -0.571   5.508 1.00 . A A .  94 ARG HG3  1 1 
        3  5022 1 1  94 ARG HH11 H  -9.570   2.826   8.462 1.00 . A A .  94 ARG HH11 1 1 
        3  5023 1 1  94 ARG HH12 H  -9.903   2.584  10.151 1.00 . A A .  94 ARG HH12 1 1 
        3  5024 1 1  94 ARG HH21 H -10.568  -0.858   9.836 1.00 . A A .  94 ARG HH21 1 1 
        3  5025 1 1  94 ARG HH22 H -10.473   0.493  10.933 1.00 . A A .  94 ARG HH22 1 1 
        3  5026 1 1  94 ARG N    N -11.201   1.501   2.919 1.00 . A A .  94 ARG N    1 1 
        3  5027 1 1  94 ARG NE   N  -9.924   0.399   7.760 1.00 . A A .  94 ARG NE   1 1 
        3  5028 1 1  94 ARG NH1  N  -9.821   2.211   9.221 1.00 . A A .  94 ARG NH1  1 1 
        3  5029 1 1  94 ARG NH2  N -10.381   0.120  10.003 1.00 . A A .  94 ARG NH2  1 1 
        3  5030 1 1  94 ARG O    O  -8.735   4.002   2.567 1.00 . A A .  94 ARG O    1 1 
        3  5031 1 1  95 VAL C    C  -9.021   3.992  -0.465 1.00 . A A .  95 VAL C    1 1 
        3  5032 1 1  95 VAL CA   C  -8.340   2.711   0.042 1.00 . A A .  95 VAL CA   1 1 
        3  5033 1 1  95 VAL CB   C  -8.259   1.611  -1.086 1.00 . A A .  95 VAL CB   1 1 
        3  5034 1 1  95 VAL CG1  C  -7.676   2.156  -2.407 1.00 . A A .  95 VAL CG1  1 1 
        3  5035 1 1  95 VAL CG2  C  -7.444   0.393  -0.593 1.00 . A A .  95 VAL CG2  1 1 
        3  5036 1 1  95 VAL H    H  -9.429   1.286   1.156 1.00 . A A .  95 VAL H    1 1 
        3  5037 1 1  95 VAL HA   H  -7.327   2.960   0.348 1.00 . A A .  95 VAL HA   1 1 
        3  5038 1 1  95 VAL HB   H  -9.271   1.268  -1.290 1.00 . A A .  95 VAL HB   1 1 
        3  5039 1 1  95 VAL HG11 H  -6.681   2.549  -2.240 1.00 . A A .  95 VAL HG11 1 1 
        3  5040 1 1  95 VAL HG12 H  -8.312   2.947  -2.785 1.00 . A A .  95 VAL HG12 1 1 
        3  5041 1 1  95 VAL HG13 H  -7.629   1.362  -3.144 1.00 . A A .  95 VAL HG13 1 1 
        3  5042 1 1  95 VAL HG21 H  -7.467  -0.389  -1.344 1.00 . A A .  95 VAL HG21 1 1 
        3  5043 1 1  95 VAL HG22 H  -7.876   0.011   0.324 1.00 . A A .  95 VAL HG22 1 1 
        3  5044 1 1  95 VAL HG23 H  -6.418   0.681  -0.410 1.00 . A A .  95 VAL HG23 1 1 
        3  5045 1 1  95 VAL N    N  -9.039   2.184   1.215 1.00 . A A .  95 VAL N    1 1 
        3  5046 1 1  95 VAL O    O  -8.352   5.004  -0.648 1.00 . A A .  95 VAL O    1 1 
        3  5047 1 1  96 ARG C    C -11.110   6.307  -0.193 1.00 . A A .  96 ARG C    1 1 
        3  5048 1 1  96 ARG CA   C -11.113   5.110  -1.163 1.00 . A A .  96 ARG CA   1 1 
        3  5049 1 1  96 ARG CB   C -12.567   4.735  -1.518 1.00 . A A .  96 ARG CB   1 1 
        3  5050 1 1  96 ARG CD   C -14.975   4.297  -0.727 1.00 . A A .  96 ARG CD   1 1 
        3  5051 1 1  96 ARG CG   C -13.510   4.485  -0.324 1.00 . A A .  96 ARG CG   1 1 
        3  5052 1 1  96 ARG CZ   C -16.071   2.099  -1.218 1.00 . A A .  96 ARG CZ   1 1 
        3  5053 1 1  96 ARG H    H -10.848   3.150  -0.361 1.00 . A A .  96 ARG H    1 1 
        3  5054 1 1  96 ARG HA   H -10.605   5.418  -2.076 1.00 . A A .  96 ARG HA   1 1 
        3  5055 1 1  96 ARG HB2  H -12.988   5.541  -2.112 1.00 . A A .  96 ARG HB2  1 1 
        3  5056 1 1  96 ARG HB3  H -12.545   3.840  -2.131 1.00 . A A .  96 ARG HB3  1 1 
        3  5057 1 1  96 ARG HD2  H -15.581   4.243   0.172 1.00 . A A .  96 ARG HD2  1 1 
        3  5058 1 1  96 ARG HD3  H -15.291   5.160  -1.305 1.00 . A A .  96 ARG HD3  1 1 
        3  5059 1 1  96 ARG HE   H -14.709   3.029  -2.384 1.00 . A A .  96 ARG HE   1 1 
        3  5060 1 1  96 ARG HG2  H -13.179   3.591   0.192 1.00 . A A .  96 ARG HG2  1 1 
        3  5061 1 1  96 ARG HG3  H -13.440   5.327   0.355 1.00 . A A .  96 ARG HG3  1 1 
        3  5062 1 1  96 ARG HH11 H -16.708   2.934   0.531 1.00 . A A .  96 ARG HH11 1 1 
        3  5063 1 1  96 ARG HH12 H -17.436   1.407   0.129 1.00 . A A .  96 ARG HH12 1 1 
        3  5064 1 1  96 ARG HH21 H -15.698   1.030  -2.899 1.00 . A A .  96 ARG HH21 1 1 
        3  5065 1 1  96 ARG HH22 H -16.861   0.330  -1.814 1.00 . A A .  96 ARG HH22 1 1 
        3  5066 1 1  96 ARG N    N -10.358   3.960  -0.620 1.00 . A A .  96 ARG N    1 1 
        3  5067 1 1  96 ARG NE   N -15.213   3.092  -1.542 1.00 . A A .  96 ARG NE   1 1 
        3  5068 1 1  96 ARG NH1  N -16.796   2.152  -0.096 1.00 . A A .  96 ARG NH1  1 1 
        3  5069 1 1  96 ARG NH2  N -16.218   1.071  -2.039 1.00 . A A .  96 ARG NH2  1 1 
        3  5070 1 1  96 ARG O    O -11.096   7.461  -0.641 1.00 . A A .  96 ARG O    1 1 
        3  5071 1 1  97 GLU C    C  -9.754   7.838   2.038 1.00 . A A .  97 GLU C    1 1 
        3  5072 1 1  97 GLU CA   C -11.069   7.074   2.163 1.00 . A A .  97 GLU CA   1 1 
        3  5073 1 1  97 GLU CB   C -11.237   6.492   3.603 1.00 . A A .  97 GLU CB   1 1 
        3  5074 1 1  97 GLU CD   C -13.740   7.103   3.842 1.00 . A A .  97 GLU CD   1 1 
        3  5075 1 1  97 GLU CG   C -12.662   6.009   3.949 1.00 . A A .  97 GLU CG   1 1 
        3  5076 1 1  97 GLU H    H -11.213   5.086   1.406 1.00 . A A .  97 GLU H    1 1 
        3  5077 1 1  97 GLU HA   H -11.889   7.768   1.975 1.00 . A A .  97 GLU HA   1 1 
        3  5078 1 1  97 GLU HB2  H -10.559   5.652   3.719 1.00 . A A .  97 GLU HB2  1 1 
        3  5079 1 1  97 GLU HB3  H -10.959   7.250   4.329 1.00 . A A .  97 GLU HB3  1 1 
        3  5080 1 1  97 GLU HG2  H -12.919   5.195   3.275 1.00 . A A .  97 GLU HG2  1 1 
        3  5081 1 1  97 GLU HG3  H -12.659   5.621   4.963 1.00 . A A .  97 GLU HG3  1 1 
        3  5082 1 1  97 GLU N    N -11.142   6.028   1.129 1.00 . A A .  97 GLU N    1 1 
        3  5083 1 1  97 GLU O    O  -9.745   9.069   2.011 1.00 . A A .  97 GLU O    1 1 
        3  5084 1 1  97 GLU OE1  O -13.872   7.914   4.780 1.00 . A A .  97 GLU OE1  1 1 
        3  5085 1 1  97 GLU OE2  O -14.448   7.166   2.809 1.00 . A A .  97 GLU OE2  1 1 
        3  5086 1 1  98 PHE C    C  -7.198   8.432   0.410 1.00 . A A .  98 PHE C    1 1 
        3  5087 1 1  98 PHE CA   C  -7.307   7.609   1.715 1.00 . A A .  98 PHE CA   1 1 
        3  5088 1 1  98 PHE CB   C  -6.275   6.448   1.712 1.00 . A A .  98 PHE CB   1 1 
        3  5089 1 1  98 PHE CD1  C  -4.132   7.386   2.689 1.00 . A A .  98 PHE CD1  1 1 
        3  5090 1 1  98 PHE CD2  C  -4.167   6.891   0.349 1.00 . A A .  98 PHE CD2  1 1 
        3  5091 1 1  98 PHE CE1  C  -2.836   7.829   2.571 1.00 . A A .  98 PHE CE1  1 1 
        3  5092 1 1  98 PHE CE2  C  -2.870   7.329   0.237 1.00 . A A .  98 PHE CE2  1 1 
        3  5093 1 1  98 PHE CG   C  -4.825   6.911   1.581 1.00 . A A .  98 PHE CG   1 1 
        3  5094 1 1  98 PHE CZ   C  -2.206   7.800   1.347 1.00 . A A .  98 PHE CZ   1 1 
        3  5095 1 1  98 PHE H    H  -8.783   6.098   1.902 1.00 . A A .  98 PHE H    1 1 
        3  5096 1 1  98 PHE HA   H  -7.101   8.261   2.560 1.00 . A A .  98 PHE HA   1 1 
        3  5097 1 1  98 PHE HB2  H  -6.363   5.890   2.638 1.00 . A A .  98 PHE HB2  1 1 
        3  5098 1 1  98 PHE HB3  H  -6.496   5.774   0.886 1.00 . A A .  98 PHE HB3  1 1 
        3  5099 1 1  98 PHE HD1  H  -4.623   7.408   3.651 1.00 . A A .  98 PHE HD1  1 1 
        3  5100 1 1  98 PHE HD2  H  -4.689   6.520  -0.526 1.00 . A A .  98 PHE HD2  1 1 
        3  5101 1 1  98 PHE HE1  H  -2.309   8.195   3.444 1.00 . A A .  98 PHE HE1  1 1 
        3  5102 1 1  98 PHE HE2  H  -2.370   7.308  -0.725 1.00 . A A .  98 PHE HE2  1 1 
        3  5103 1 1  98 PHE HZ   H  -1.186   8.150   1.258 1.00 . A A .  98 PHE HZ   1 1 
        3  5104 1 1  98 PHE N    N  -8.664   7.071   1.890 1.00 . A A .  98 PHE N    1 1 
        3  5105 1 1  98 PHE O    O  -6.726   9.573   0.416 1.00 . A A .  98 PHE O    1 1 
        3  5106 1 1  99 LEU C    C  -8.456   9.692  -2.180 1.00 . A A .  99 LEU C    1 1 
        3  5107 1 1  99 LEU CA   C  -7.583   8.429  -2.048 1.00 . A A .  99 LEU CA   1 1 
        3  5108 1 1  99 LEU CB   C  -7.992   7.381  -3.124 1.00 . A A .  99 LEU CB   1 1 
        3  5109 1 1  99 LEU CD1  C  -7.600   5.170  -4.355 1.00 . A A .  99 LEU CD1  1 1 
        3  5110 1 1  99 LEU CD2  C  -5.600   6.536  -3.550 1.00 . A A .  99 LEU CD2  1 1 
        3  5111 1 1  99 LEU CG   C  -7.065   6.133  -3.271 1.00 . A A .  99 LEU CG   1 1 
        3  5112 1 1  99 LEU H    H  -8.088   6.959  -0.605 1.00 . A A .  99 LEU H    1 1 
        3  5113 1 1  99 LEU HA   H  -6.548   8.716  -2.219 1.00 . A A .  99 LEU HA   1 1 
        3  5114 1 1  99 LEU HB2  H  -8.993   7.030  -2.881 1.00 . A A .  99 LEU HB2  1 1 
        3  5115 1 1  99 LEU HB3  H  -8.041   7.879  -4.089 1.00 . A A .  99 LEU HB3  1 1 
        3  5116 1 1  99 LEU HD11 H  -8.600   4.851  -4.096 1.00 . A A .  99 LEU HD11 1 1 
        3  5117 1 1  99 LEU HD12 H  -6.961   4.300  -4.421 1.00 . A A .  99 LEU HD12 1 1 
        3  5118 1 1  99 LEU HD13 H  -7.620   5.669  -5.315 1.00 . A A .  99 LEU HD13 1 1 
        3  5119 1 1  99 LEU HD21 H  -4.986   5.648  -3.631 1.00 . A A .  99 LEU HD21 1 1 
        3  5120 1 1  99 LEU HD22 H  -5.230   7.148  -2.736 1.00 . A A .  99 LEU HD22 1 1 
        3  5121 1 1  99 LEU HD23 H  -5.541   7.098  -4.472 1.00 . A A .  99 LEU HD23 1 1 
        3  5122 1 1  99 LEU HG   H  -7.072   5.586  -2.331 1.00 . A A .  99 LEU HG   1 1 
        3  5123 1 1  99 LEU N    N  -7.667   7.834  -0.698 1.00 . A A .  99 LEU N    1 1 
        3  5124 1 1  99 LEU O    O  -8.210  10.511  -3.058 1.00 . A A .  99 LEU O    1 1 
        3  5125 1 1 100 LYS C    C  -9.851  12.115  -0.407 1.00 . A A . 100 LYS C    1 1 
        3  5126 1 1 100 LYS CA   C -10.389  10.986  -1.316 1.00 . A A . 100 LYS CA   1 1 
        3  5127 1 1 100 LYS CB   C -11.810  10.546  -0.867 1.00 . A A . 100 LYS CB   1 1 
        3  5128 1 1 100 LYS CD   C -14.335  11.122  -0.594 1.00 . A A . 100 LYS CD   1 1 
        3  5129 1 1 100 LYS CE   C -14.566  10.582   0.836 1.00 . A A . 100 LYS CE   1 1 
        3  5130 1 1 100 LYS CG   C -12.895  11.657  -0.867 1.00 . A A . 100 LYS CG   1 1 
        3  5131 1 1 100 LYS H    H  -9.650   9.092  -0.689 1.00 . A A . 100 LYS H    1 1 
        3  5132 1 1 100 LYS HA   H -10.456  11.367  -2.335 1.00 . A A . 100 LYS HA   1 1 
        3  5133 1 1 100 LYS HB2  H -12.144   9.753  -1.527 1.00 . A A . 100 LYS HB2  1 1 
        3  5134 1 1 100 LYS HB3  H -11.744  10.141   0.139 1.00 . A A . 100 LYS HB3  1 1 
        3  5135 1 1 100 LYS HD2  H -15.036  11.930  -0.764 1.00 . A A . 100 LYS HD2  1 1 
        3  5136 1 1 100 LYS HD3  H -14.551  10.326  -1.303 1.00 . A A . 100 LYS HD3  1 1 
        3  5137 1 1 100 LYS HE2  H -14.247  11.331   1.548 1.00 . A A . 100 LYS HE2  1 1 
        3  5138 1 1 100 LYS HE3  H -15.625  10.403   0.970 1.00 . A A . 100 LYS HE3  1 1 
        3  5139 1 1 100 LYS HG2  H -12.647  12.390  -0.106 1.00 . A A . 100 LYS HG2  1 1 
        3  5140 1 1 100 LYS HG3  H -12.884  12.149  -1.837 1.00 . A A . 100 LYS HG3  1 1 
        3  5141 1 1 100 LYS HZ1  H -14.131   8.938   2.040 1.00 . A A . 100 LYS HZ1  1 1 
        3  5142 1 1 100 LYS HZ2  H -12.811   9.476   1.137 1.00 . A A . 100 LYS HZ2  1 1 
        3  5143 1 1 100 LYS HZ3  H -14.052   8.602   0.391 1.00 . A A . 100 LYS HZ3  1 1 
        3  5144 1 1 100 LYS N    N  -9.484   9.818  -1.327 1.00 . A A . 100 LYS N    1 1 
        3  5145 1 1 100 LYS NZ   N -13.835   9.312   1.119 1.00 . A A . 100 LYS NZ   1 1 
        3  5146 1 1 100 LYS O    O  -9.885  13.288  -0.791 1.00 . A A . 100 LYS O    1 1 
        3  5147 1 1 101 THR C    C  -7.546  13.347   1.436 1.00 . A A . 101 THR C    1 1 
        3  5148 1 1 101 THR CA   C  -8.920  12.759   1.808 1.00 . A A . 101 THR CA   1 1 
        3  5149 1 1 101 THR CB   C  -8.918  12.187   3.281 1.00 . A A . 101 THR CB   1 1 
        3  5150 1 1 101 THR CG2  C  -7.880  11.076   3.515 1.00 . A A . 101 THR CG2  1 1 
        3  5151 1 1 101 THR H    H  -9.256  10.805   1.006 1.00 . A A . 101 THR H    1 1 
        3  5152 1 1 101 THR HA   H  -9.648  13.571   1.779 1.00 . A A . 101 THR HA   1 1 
        3  5153 1 1 101 THR HB   H  -9.904  11.775   3.479 1.00 . A A . 101 THR HB   1 1 
        3  5154 1 1 101 THR HG1  H  -9.134  14.039   3.960 1.00 . A A . 101 THR HG1  1 1 
        3  5155 1 1 101 THR HG21 H  -6.882  11.460   3.337 1.00 . A A . 101 THR HG21 1 1 
        3  5156 1 1 101 THR HG22 H  -8.070  10.257   2.836 1.00 . A A . 101 THR HG22 1 1 
        3  5157 1 1 101 THR HG23 H  -7.946  10.715   4.534 1.00 . A A . 101 THR HG23 1 1 
        3  5158 1 1 101 THR N    N  -9.351  11.757   0.798 1.00 . A A . 101 THR N    1 1 
        3  5159 1 1 101 THR O    O  -7.356  14.568   1.456 1.00 . A A . 101 THR O    1 1 
        3  5160 1 1 101 THR OG1  O  -8.673  13.242   4.234 1.00 . A A . 101 THR OG1  1 1 
        3  5161 1 1 102 ALA C    C  -5.201  13.285  -0.763 1.00 . A A . 102 ALA C    1 1 
        3  5162 1 1 102 ALA CA   C  -5.243  12.845   0.706 1.00 . A A . 102 ALA CA   1 1 
        3  5163 1 1 102 ALA CB   C  -4.296  11.670   0.985 1.00 . A A . 102 ALA CB   1 1 
        3  5164 1 1 102 ALA H    H  -6.849  11.520   1.040 1.00 . A A . 102 ALA H    1 1 
        3  5165 1 1 102 ALA HA   H  -4.937  13.682   1.334 1.00 . A A . 102 ALA HA   1 1 
        3  5166 1 1 102 ALA HB1  H  -4.346  11.406   2.033 1.00 . A A . 102 ALA HB1  1 1 
        3  5167 1 1 102 ALA HB2  H  -3.280  11.950   0.739 1.00 . A A . 102 ALA HB2  1 1 
        3  5168 1 1 102 ALA HB3  H  -4.584  10.810   0.389 1.00 . A A . 102 ALA HB3  1 1 
        3  5169 1 1 102 ALA N    N  -6.607  12.466   1.073 1.00 . A A . 102 ALA N    1 1 
        3  5170 1 1 102 ALA O    O  -4.616  14.322  -1.099 1.00 . A A . 102 ALA O    1 1 
        3  5171 1 1 103 GLY C    C  -7.260  13.608  -3.289 1.00 . A A . 103 GLY C    1 1 
        3  5172 1 1 103 GLY CA   C  -5.979  12.828  -3.051 1.00 . A A . 103 GLY CA   1 1 
        3  5173 1 1 103 GLY H    H  -6.222  11.642  -1.309 1.00 . A A . 103 GLY H    1 1 
        3  5174 1 1 103 GLY HA2  H  -5.130  13.422  -3.380 1.00 . A A . 103 GLY HA2  1 1 
        3  5175 1 1 103 GLY HA3  H  -6.006  11.916  -3.631 1.00 . A A . 103 GLY HA3  1 1 
        3  5176 1 1 103 GLY N    N  -5.833  12.482  -1.636 1.00 . A A . 103 GLY N    1 1 
        3  5177 1 1 103 GLY O    O  -8.157  13.146  -4.003 1.00 . A A . 103 GLY O    1 1 
        3  5178 1 1 104 SER C    C  -8.847  16.119  -4.142 1.00 . A A . 104 SER C    1 1 
        3  5179 1 1 104 SER CA   C  -8.561  15.623  -2.703 1.00 . A A . 104 SER CA   1 1 
        3  5180 1 1 104 SER CB   C  -8.413  16.798  -1.717 1.00 . A A . 104 SER CB   1 1 
        3  5181 1 1 104 SER H    H  -6.572  15.122  -2.169 1.00 . A A . 104 SER H    1 1 
        3  5182 1 1 104 SER HA   H  -9.390  15.000  -2.378 1.00 . A A . 104 SER HA   1 1 
        3  5183 1 1 104 SER HB2  H  -8.132  16.419  -0.742 1.00 . A A . 104 SER HB2  1 1 
        3  5184 1 1 104 SER HB3  H  -7.642  17.468  -2.069 1.00 . A A . 104 SER HB3  1 1 
        3  5185 1 1 104 SER HG   H -10.089  17.228  -0.791 1.00 . A A . 104 SER HG   1 1 
        3  5186 1 1 104 SER N    N  -7.353  14.793  -2.668 1.00 . A A . 104 SER N    1 1 
        3  5187 1 1 104 SER O    O  -7.945  16.633  -4.823 1.00 . A A . 104 SER O    1 1 
        3  5188 1 1 104 SER OG   O  -9.622  17.525  -1.585 1.00 . A A . 104 SER OG   1 1 
        3  5189 1 1 105 LEU C    C -10.936  17.706  -6.109 1.00 . A A . 105 LEU C    1 1 
        3  5190 1 1 105 LEU CA   C -10.522  16.233  -5.976 1.00 . A A . 105 LEU CA   1 1 
        3  5191 1 1 105 LEU CB   C -11.648  15.253  -6.399 1.00 . A A . 105 LEU CB   1 1 
        3  5192 1 1 105 LEU CD1  C -12.392  12.825  -6.779 1.00 . A A . 105 LEU CD1  1 1 
        3  5193 1 1 105 LEU CD2  C -10.158  13.651  -7.712 1.00 . A A . 105 LEU CD2  1 1 
        3  5194 1 1 105 LEU CG   C -11.191  13.773  -6.565 1.00 . A A . 105 LEU CG   1 1 
        3  5195 1 1 105 LEU H    H -10.761  15.556  -3.977 1.00 . A A . 105 LEU H    1 1 
        3  5196 1 1 105 LEU HA   H  -9.669  16.073  -6.626 1.00 . A A . 105 LEU HA   1 1 
        3  5197 1 1 105 LEU HB2  H -12.431  15.293  -5.647 1.00 . A A . 105 LEU HB2  1 1 
        3  5198 1 1 105 LEU HB3  H -12.068  15.590  -7.342 1.00 . A A . 105 LEU HB3  1 1 
        3  5199 1 1 105 LEU HD11 H -13.071  12.905  -5.941 1.00 . A A . 105 LEU HD11 1 1 
        3  5200 1 1 105 LEU HD12 H -12.042  11.806  -6.851 1.00 . A A . 105 LEU HD12 1 1 
        3  5201 1 1 105 LEU HD13 H -12.917  13.088  -7.692 1.00 . A A . 105 LEU HD13 1 1 
        3  5202 1 1 105 LEU HD21 H -10.597  13.979  -8.645 1.00 . A A . 105 LEU HD21 1 1 
        3  5203 1 1 105 LEU HD22 H  -9.842  12.618  -7.807 1.00 . A A . 105 LEU HD22 1 1 
        3  5204 1 1 105 LEU HD23 H  -9.292  14.260  -7.489 1.00 . A A . 105 LEU HD23 1 1 
        3  5205 1 1 105 LEU HG   H -10.694  13.456  -5.652 1.00 . A A . 105 LEU HG   1 1 
        3  5206 1 1 105 LEU N    N -10.097  15.925  -4.597 1.00 . A A . 105 LEU N    1 1 
        3  5207 1 1 105 LEU O    O -12.126  18.048  -6.136 1.00 . A A . 105 LEU O    1 1 
        3  5208 1 1 106 GLU C    C -10.313  20.453  -7.699 1.00 . A A . 106 GLU C    1 1 
        3  5209 1 1 106 GLU CA   C -10.087  20.030  -6.238 1.00 . A A . 106 GLU CA   1 1 
        3  5210 1 1 106 GLU CB   C  -8.835  20.735  -5.622 1.00 . A A . 106 GLU CB   1 1 
        3  5211 1 1 106 GLU CD   C  -9.030  23.189  -6.502 1.00 . A A . 106 GLU CD   1 1 
        3  5212 1 1 106 GLU CG   C  -8.984  22.247  -5.283 1.00 . A A . 106 GLU CG   1 1 
        3  5213 1 1 106 GLU H    H  -9.003  18.218  -6.126 1.00 . A A . 106 GLU H    1 1 
        3  5214 1 1 106 GLU HA   H -10.965  20.301  -5.652 1.00 . A A . 106 GLU HA   1 1 
        3  5215 1 1 106 GLU HB2  H  -8.582  20.215  -4.701 1.00 . A A . 106 GLU HB2  1 1 
        3  5216 1 1 106 GLU HB3  H  -7.999  20.621  -6.304 1.00 . A A . 106 GLU HB3  1 1 
        3  5217 1 1 106 GLU HG2  H  -9.896  22.367  -4.709 1.00 . A A . 106 GLU HG2  1 1 
        3  5218 1 1 106 GLU HG3  H  -8.148  22.539  -4.665 1.00 . A A . 106 GLU HG3  1 1 
        3  5219 1 1 106 GLU N    N  -9.918  18.575  -6.149 1.00 . A A . 106 GLU N    1 1 
        3  5220 1 1 106 GLU O    O -11.221  21.238  -7.981 1.00 . A A . 106 GLU O    1 1 
        3  5221 1 1 106 GLU OE1  O  -8.012  23.270  -7.230 1.00 . A A . 106 GLU OE1  1 1 
        3  5222 1 1 106 GLU OE2  O -10.078  23.825  -6.764 1.00 . A A . 106 GLU OE2  1 1 
        3  5223 1 1 107 HIS C    C -10.815  19.958 -10.706 1.00 . A A . 107 HIS C    1 1 
        3  5224 1 1 107 HIS CA   C  -9.483  20.328 -10.034 1.00 . A A . 107 HIS CA   1 1 
        3  5225 1 1 107 HIS CB   C  -8.279  19.709 -10.778 1.00 . A A . 107 HIS CB   1 1 
        3  5226 1 1 107 HIS CD2  C  -6.125  19.815  -9.315 1.00 . A A . 107 HIS CD2  1 1 
        3  5227 1 1 107 HIS CE1  C  -5.228  21.614 -10.181 1.00 . A A . 107 HIS CE1  1 1 
        3  5228 1 1 107 HIS CG   C  -6.955  20.246 -10.293 1.00 . A A . 107 HIS CG   1 1 
        3  5229 1 1 107 HIS H    H  -8.860  19.227  -8.333 1.00 . A A . 107 HIS H    1 1 
        3  5230 1 1 107 HIS HA   H  -9.380  21.412 -10.053 1.00 . A A . 107 HIS HA   1 1 
        3  5231 1 1 107 HIS HB2  H  -8.285  18.635 -10.628 1.00 . A A . 107 HIS HB2  1 1 
        3  5232 1 1 107 HIS HB3  H  -8.358  19.917 -11.838 1.00 . A A . 107 HIS HB3  1 1 
        3  5233 1 1 107 HIS HD1  H  -6.716  21.928 -11.545 1.00 . A A . 107 HIS HD1  1 1 
        3  5234 1 1 107 HIS HD2  H  -6.268  18.942  -8.687 1.00 . A A . 107 HIS HD2  1 1 
        3  5235 1 1 107 HIS HE1  H  -4.552  22.434 -10.374 1.00 . A A . 107 HIS HE1  1 1 
        3  5236 1 1 107 HIS HE2  H  -4.321  20.641  -8.626 1.00 . A A . 107 HIS HE2  1 1 
        3  5237 1 1 107 HIS N    N  -9.481  19.924  -8.615 1.00 . A A . 107 HIS N    1 1 
        3  5238 1 1 107 HIS ND1  N  -6.357  21.376 -10.820 1.00 . A A . 107 HIS ND1  1 1 
        3  5239 1 1 107 HIS NE2  N  -5.062  20.681  -9.268 1.00 . A A . 107 HIS NE2  1 1 
        3  5240 1 1 107 HIS O    O -11.236  18.802 -10.689 1.00 . A A . 107 HIS O    1 1 
        3  5241 1 1 108 HIS C    C -13.023  20.250 -13.058 1.00 . A A . 108 HIS C    1 1 
        3  5242 1 1 108 HIS CA   C -12.849  20.966 -11.714 1.00 . A A . 108 HIS CA   1 1 
        3  5243 1 1 108 HIS CB   C -13.369  22.432 -11.794 1.00 . A A . 108 HIS CB   1 1 
        3  5244 1 1 108 HIS CD2  C -12.013  23.699  -9.945 1.00 . A A . 108 HIS CD2  1 1 
        3  5245 1 1 108 HIS CE1  C -13.678  24.270  -8.654 1.00 . A A . 108 HIS CE1  1 1 
        3  5246 1 1 108 HIS CG   C -13.151  23.222 -10.518 1.00 . A A . 108 HIS CG   1 1 
        3  5247 1 1 108 HIS H    H -10.910  21.773 -11.517 1.00 . A A . 108 HIS H    1 1 
        3  5248 1 1 108 HIS HA   H -13.420  20.436 -10.951 1.00 . A A . 108 HIS HA   1 1 
        3  5249 1 1 108 HIS HB2  H -12.861  22.956 -12.598 1.00 . A A . 108 HIS HB2  1 1 
        3  5250 1 1 108 HIS HB3  H -14.433  22.420 -12.004 1.00 . A A . 108 HIS HB3  1 1 
        3  5251 1 1 108 HIS HD1  H -15.128  23.404  -9.813 1.00 . A A . 108 HIS HD1  1 1 
        3  5252 1 1 108 HIS HD2  H -11.008  23.583 -10.330 1.00 . A A . 108 HIS HD2  1 1 
        3  5253 1 1 108 HIS HE1  H -14.252  24.684  -7.839 1.00 . A A . 108 HIS HE1  1 1 
        3  5254 1 1 108 HIS HE2  H -11.746  24.546  -8.052 1.00 . A A . 108 HIS HE2  1 1 
        3  5255 1 1 108 HIS N    N -11.438  20.972 -11.311 1.00 . A A . 108 HIS N    1 1 
        3  5256 1 1 108 HIS ND1  N -14.174  23.604  -9.678 1.00 . A A . 108 HIS ND1  1 1 
        3  5257 1 1 108 HIS NE2  N -12.366  24.342  -8.789 1.00 . A A . 108 HIS NE2  1 1 
        3  5258 1 1 108 HIS O    O -12.578  20.757 -14.096 1.00 . A A . 108 HIS O    1 1 
        3  5259 1 1 109 HIS C    C -15.096  18.793 -15.018 1.00 . A A . 109 HIS C    1 1 
        3  5260 1 1 109 HIS CA   C -13.877  18.244 -14.230 1.00 . A A . 109 HIS CA   1 1 
        3  5261 1 1 109 HIS CB   C -14.003  16.726 -13.862 1.00 . A A . 109 HIS CB   1 1 
        3  5262 1 1 109 HIS CD2  C -16.378  15.768 -13.342 1.00 . A A . 109 HIS CD2  1 1 
        3  5263 1 1 109 HIS CE1  C -16.347  15.976 -11.163 1.00 . A A . 109 HIS CE1  1 1 
        3  5264 1 1 109 HIS CG   C -15.181  16.319 -13.002 1.00 . A A . 109 HIS CG   1 1 
        3  5265 1 1 109 HIS H    H -13.990  18.737 -12.171 1.00 . A A . 109 HIS H    1 1 
        3  5266 1 1 109 HIS HA   H -12.995  18.358 -14.863 1.00 . A A . 109 HIS HA   1 1 
        3  5267 1 1 109 HIS HB2  H -14.066  16.153 -14.778 1.00 . A A . 109 HIS HB2  1 1 
        3  5268 1 1 109 HIS HB3  H -13.102  16.430 -13.338 1.00 . A A . 109 HIS HB3  1 1 
        3  5269 1 1 109 HIS HD1  H -14.468  16.769 -11.077 1.00 . A A . 109 HIS HD1  1 1 
        3  5270 1 1 109 HIS HD2  H -16.718  15.533 -14.347 1.00 . A A . 109 HIS HD2  1 1 
        3  5271 1 1 109 HIS HE1  H -16.638  15.931 -10.122 1.00 . A A . 109 HIS HE1  1 1 
        3  5272 1 1 109 HIS HE2  H -18.039  15.364 -12.132 1.00 . A A . 109 HIS HE2  1 1 
        3  5273 1 1 109 HIS N    N -13.653  19.061 -13.027 1.00 . A A . 109 HIS N    1 1 
        3  5274 1 1 109 HIS ND1  N -15.195  16.426 -11.629 1.00 . A A . 109 HIS ND1  1 1 
        3  5275 1 1 109 HIS NE2  N -17.079  15.571 -12.180 1.00 . A A . 109 HIS NE2  1 1 
        3  5276 1 1 109 HIS O    O -16.251  18.486 -14.721 1.00 . A A . 109 HIS O    1 1 
        3  5277 1 1 110 HIS C    C -16.570  19.453 -17.769 1.00 . A A . 110 HIS C    1 1 
        3  5278 1 1 110 HIS CA   C -15.842  20.391 -16.776 1.00 . A A . 110 HIS CA   1 1 
        3  5279 1 1 110 HIS CB   C -15.187  21.588 -17.523 1.00 . A A . 110 HIS CB   1 1 
        3  5280 1 1 110 HIS CD2  C -16.227  22.404 -19.775 1.00 . A A . 110 HIS CD2  1 1 
        3  5281 1 1 110 HIS CE1  C -17.797  23.695 -18.965 1.00 . A A . 110 HIS CE1  1 1 
        3  5282 1 1 110 HIS CG   C -16.125  22.365 -18.422 1.00 . A A . 110 HIS CG   1 1 
        3  5283 1 1 110 HIS H    H -13.866  19.835 -16.206 1.00 . A A . 110 HIS H    1 1 
        3  5284 1 1 110 HIS HA   H -16.578  20.780 -16.074 1.00 . A A . 110 HIS HA   1 1 
        3  5285 1 1 110 HIS HB2  H -14.786  22.282 -16.795 1.00 . A A . 110 HIS HB2  1 1 
        3  5286 1 1 110 HIS HB3  H -14.369  21.222 -18.135 1.00 . A A . 110 HIS HB3  1 1 
        3  5287 1 1 110 HIS HD1  H -17.314  23.385 -17.003 1.00 . A A . 110 HIS HD1  1 1 
        3  5288 1 1 110 HIS HD2  H -15.594  21.884 -20.481 1.00 . A A . 110 HIS HD2  1 1 
        3  5289 1 1 110 HIS HE1  H -18.633  24.378 -18.896 1.00 . A A . 110 HIS HE1  1 1 
        3  5290 1 1 110 HIS HE2  H -17.606  23.418 -20.984 1.00 . A A . 110 HIS HE2  1 1 
        3  5291 1 1 110 HIS N    N -14.811  19.668 -15.995 1.00 . A A . 110 HIS N    1 1 
        3  5292 1 1 110 HIS ND1  N -17.127  23.189 -17.947 1.00 . A A . 110 HIS ND1  1 1 
        3  5293 1 1 110 HIS NE2  N -17.269  23.236 -20.079 1.00 . A A . 110 HIS NE2  1 1 
        3  5294 1 1 110 HIS O    O -17.738  19.673 -18.094 1.00 . A A . 110 HIS O    1 1 
        3  5295 1 1 111 HIS C    C -16.017  16.031 -18.883 1.00 . A A . 111 HIS C    1 1 
        3  5296 1 1 111 HIS CA   C -16.390  17.478 -19.247 1.00 . A A . 111 HIS CA   1 1 
        3  5297 1 1 111 HIS CB   C -15.848  17.870 -20.657 1.00 . A A . 111 HIS CB   1 1 
        3  5298 1 1 111 HIS CD2  C -15.715  15.959 -22.439 1.00 . A A . 111 HIS CD2  1 1 
        3  5299 1 1 111 HIS CE1  C -17.732  16.151 -23.266 1.00 . A A . 111 HIS CE1  1 1 
        3  5300 1 1 111 HIS CG   C -16.329  16.976 -21.779 1.00 . A A . 111 HIS CG   1 1 
        3  5301 1 1 111 HIS H    H -14.975  18.254 -17.868 1.00 . A A . 111 HIS H    1 1 
        3  5302 1 1 111 HIS HA   H -17.475  17.557 -19.257 1.00 . A A . 111 HIS HA   1 1 
        3  5303 1 1 111 HIS HB2  H -16.163  18.882 -20.885 1.00 . A A . 111 HIS HB2  1 1 
        3  5304 1 1 111 HIS HB3  H -14.762  17.841 -20.645 1.00 . A A . 111 HIS HB3  1 1 
        3  5305 1 1 111 HIS HD1  H -18.288  17.707 -22.067 1.00 . A A . 111 HIS HD1  1 1 
        3  5306 1 1 111 HIS HD2  H -14.705  15.610 -22.279 1.00 . A A . 111 HIS HD2  1 1 
        3  5307 1 1 111 HIS HE1  H -18.616  15.994 -23.869 1.00 . A A . 111 HIS HE1  1 1 
        3  5308 1 1 111 HIS HE2  H -16.521  14.603 -23.820 1.00 . A A . 111 HIS HE2  1 1 
        3  5309 1 1 111 HIS N    N -15.870  18.410 -18.231 1.00 . A A . 111 HIS N    1 1 
        3  5310 1 1 111 HIS ND1  N -17.593  17.067 -22.328 1.00 . A A . 111 HIS ND1  1 1 
        3  5311 1 1 111 HIS NE2  N -16.610  15.464 -23.353 1.00 . A A . 111 HIS NE2  1 1 
        3  5312 1 1 111 HIS O    O -16.894  15.220 -18.568 1.00 . A A . 111 HIS O    1 1 
        3  5313 1 1 112 HIS C    C -14.392  13.943 -17.220 1.00 . A A . 112 HIS C    1 1 
        3  5314 1 1 112 HIS CA   C -14.168  14.366 -18.698 1.00 . A A . 112 HIS CA   1 1 
        3  5315 1 1 112 HIS CB   C -12.658  14.301 -19.095 1.00 . A A . 112 HIS CB   1 1 
        3  5316 1 1 112 HIS CD2  C -11.168  12.544 -17.834 1.00 . A A . 112 HIS CD2  1 1 
        3  5317 1 1 112 HIS CE1  C -11.430  10.848 -19.190 1.00 . A A . 112 HIS CE1  1 1 
        3  5318 1 1 112 HIS CG   C -11.985  12.960 -18.843 1.00 . A A . 112 HIS CG   1 1 
        3  5319 1 1 112 HIS H    H -14.075  16.441 -19.140 1.00 . A A . 112 HIS H    1 1 
        3  5320 1 1 112 HIS HA   H -14.717  13.688 -19.349 1.00 . A A . 112 HIS HA   1 1 
        3  5321 1 1 112 HIS HB2  H -12.565  14.518 -20.153 1.00 . A A . 112 HIS HB2  1 1 
        3  5322 1 1 112 HIS HB3  H -12.112  15.060 -18.543 1.00 . A A . 112 HIS HB3  1 1 
        3  5323 1 1 112 HIS HD1  H -12.633  11.841 -20.512 1.00 . A A . 112 HIS HD1  1 1 
        3  5324 1 1 112 HIS HD2  H -10.833  13.142 -16.995 1.00 . A A . 112 HIS HD2  1 1 
        3  5325 1 1 112 HIS HE1  H -11.335   9.871 -19.646 1.00 . A A . 112 HIS HE1  1 1 
        3  5326 1 1 112 HIS HE2  H -10.119  10.741 -17.632 1.00 . A A . 112 HIS HE2  1 1 
        3  5327 1 1 112 HIS N    N -14.705  15.725 -18.937 1.00 . A A . 112 HIS N    1 1 
        3  5328 1 1 112 HIS ND1  N -12.119  11.863 -19.677 1.00 . A A . 112 HIS ND1  1 1 
        3  5329 1 1 112 HIS NE2  N -10.844  11.232 -18.076 1.00 . A A . 112 HIS NE2  1 1 
        3  5330 1 1 112 HIS O    O -13.679  14.448 -16.333 1.00 . A A . 112 HIS O    1 1 
        3  5331 1 1 112 HIS OXT  O -15.288  13.117 -16.963 1.00 . A A . 112 HIS OXT  1 1 
        4  5332 1 1   1 MET C    C   4.635  14.118   1.132 1.00 . A A .   1 MET C    1 1 
        4  5333 1 1   1 MET CA   C   4.350  15.617   1.276 1.00 . A A .   1 MET CA   1 1 
        4  5334 1 1   1 MET CB   C   5.367  16.436   0.439 1.00 . A A .   1 MET CB   1 1 
        4  5335 1 1   1 MET CE   C   3.562  20.165  -0.351 1.00 . A A .   1 MET CE   1 1 
        4  5336 1 1   1 MET CG   C   5.112  17.951   0.397 1.00 . A A .   1 MET CG   1 1 
        4  5337 1 1   1 MET H1   H   4.229  17.016   2.815 1.00 . A A .   1 MET H1   1 1 
        4  5338 1 1   1 MET H2   H   5.352  15.781   3.088 1.00 . A A .   1 MET H2   1 1 
        4  5339 1 1   1 MET H3   H   3.702  15.467   3.249 1.00 . A A .   1 MET H3   1 1 
        4  5340 1 1   1 MET HA   H   3.345  15.821   0.927 1.00 . A A .   1 MET HA   1 1 
        4  5341 1 1   1 MET HB2  H   6.362  16.274   0.844 1.00 . A A .   1 MET HB2  1 1 
        4  5342 1 1   1 MET HB3  H   5.354  16.069  -0.585 1.00 . A A .   1 MET HB3  1 1 
        4  5343 1 1   1 MET HE1  H   2.646  20.547  -0.781 1.00 . A A .   1 MET HE1  1 1 
        4  5344 1 1   1 MET HE2  H   4.399  20.491  -0.950 1.00 . A A .   1 MET HE2  1 1 
        4  5345 1 1   1 MET HE3  H   3.669  20.543   0.655 1.00 . A A .   1 MET HE3  1 1 
        4  5346 1 1   1 MET HG2  H   5.147  18.339   1.407 1.00 . A A .   1 MET HG2  1 1 
        4  5347 1 1   1 MET HG3  H   5.891  18.423  -0.193 1.00 . A A .   1 MET HG3  1 1 
        4  5348 1 1   1 MET N    N   4.412  16.000   2.706 1.00 . A A .   1 MET N    1 1 
        4  5349 1 1   1 MET O    O   5.525  13.587   1.813 1.00 . A A .   1 MET O    1 1 
        4  5350 1 1   1 MET SD   S   3.507  18.369  -0.324 1.00 . A A .   1 MET SD   1 1 
        4  5351 1 1   2 GLY C    C   3.388  11.210   1.147 1.00 . A A .   2 GLY C    1 1 
        4  5352 1 1   2 GLY CA   C   4.005  12.016   0.018 1.00 . A A .   2 GLY CA   1 1 
        4  5353 1 1   2 GLY H    H   3.226  13.955  -0.299 1.00 . A A .   2 GLY H    1 1 
        4  5354 1 1   2 GLY HA2  H   3.510  11.764  -0.910 1.00 . A A .   2 GLY HA2  1 1 
        4  5355 1 1   2 GLY HA3  H   5.056  11.753  -0.077 1.00 . A A .   2 GLY HA3  1 1 
        4  5356 1 1   2 GLY N    N   3.880  13.455   0.233 1.00 . A A .   2 GLY N    1 1 
        4  5357 1 1   2 GLY O    O   4.076  10.865   2.099 1.00 . A A .   2 GLY O    1 1 
        4  5358 1 1   3 LYS C    C   0.885   8.838   1.340 1.00 . A A .   3 LYS C    1 1 
        4  5359 1 1   3 LYS CA   C   1.350  10.117   2.043 1.00 . A A .   3 LYS CA   1 1 
        4  5360 1 1   3 LYS CB   C   0.159  10.922   2.645 1.00 . A A .   3 LYS CB   1 1 
        4  5361 1 1   3 LYS CD   C  -1.505  11.264   4.597 1.00 . A A .   3 LYS CD   1 1 
        4  5362 1 1   3 LYS CE   C  -2.033  10.732   5.943 1.00 . A A .   3 LYS CE   1 1 
        4  5363 1 1   3 LYS CG   C  -0.457  10.319   3.937 1.00 . A A .   3 LYS CG   1 1 
        4  5364 1 1   3 LYS H    H   1.579  11.279   0.285 1.00 . A A .   3 LYS H    1 1 
        4  5365 1 1   3 LYS HA   H   2.038   9.844   2.845 1.00 . A A .   3 LYS HA   1 1 
        4  5366 1 1   3 LYS HB2  H   0.505  11.924   2.874 1.00 . A A .   3 LYS HB2  1 1 
        4  5367 1 1   3 LYS HB3  H  -0.630  10.999   1.899 1.00 . A A .   3 LYS HB3  1 1 
        4  5368 1 1   3 LYS HD2  H  -1.047  12.231   4.764 1.00 . A A .   3 LYS HD2  1 1 
        4  5369 1 1   3 LYS HD3  H  -2.344  11.383   3.919 1.00 . A A .   3 LYS HD3  1 1 
        4  5370 1 1   3 LYS HE2  H  -1.200  10.583   6.618 1.00 . A A .   3 LYS HE2  1 1 
        4  5371 1 1   3 LYS HE3  H  -2.706  11.466   6.368 1.00 . A A .   3 LYS HE3  1 1 
        4  5372 1 1   3 LYS HG2  H  -0.940   9.378   3.685 1.00 . A A .   3 LYS HG2  1 1 
        4  5373 1 1   3 LYS HG3  H   0.340  10.123   4.648 1.00 . A A .   3 LYS HG3  1 1 
        4  5374 1 1   3 LYS HZ1  H  -2.149   8.751   5.319 1.00 . A A .   3 LYS HZ1  1 1 
        4  5375 1 1   3 LYS HZ2  H  -3.618   9.579   5.231 1.00 . A A .   3 LYS HZ2  1 1 
        4  5376 1 1   3 LYS HZ3  H  -3.021   9.070   6.730 1.00 . A A .   3 LYS HZ3  1 1 
        4  5377 1 1   3 LYS N    N   2.077  10.937   1.057 1.00 . A A .   3 LYS N    1 1 
        4  5378 1 1   3 LYS NZ   N  -2.758   9.448   5.795 1.00 . A A .   3 LYS NZ   1 1 
        4  5379 1 1   3 LYS O    O   0.417   8.896   0.195 1.00 . A A .   3 LYS O    1 1 
        4  5380 1 1   4 VAL C    C   0.029   5.425   2.343 1.00 . A A .   4 VAL C    1 1 
        4  5381 1 1   4 VAL CA   C   0.735   6.379   1.373 1.00 . A A .   4 VAL CA   1 1 
        4  5382 1 1   4 VAL CB   C   2.050   5.734   0.821 1.00 . A A .   4 VAL CB   1 1 
        4  5383 1 1   4 VAL CG1  C   3.077   5.470   1.928 1.00 . A A .   4 VAL CG1  1 1 
        4  5384 1 1   4 VAL CG2  C   1.767   4.458   0.009 1.00 . A A .   4 VAL CG2  1 1 
        4  5385 1 1   4 VAL H    H   1.323   7.698   2.932 1.00 . A A .   4 VAL H    1 1 
        4  5386 1 1   4 VAL HA   H   0.068   6.552   0.524 1.00 . A A .   4 VAL HA   1 1 
        4  5387 1 1   4 VAL HB   H   2.498   6.455   0.154 1.00 . A A .   4 VAL HB   1 1 
        4  5388 1 1   4 VAL HG11 H   2.679   4.736   2.622 1.00 . A A .   4 VAL HG11 1 1 
        4  5389 1 1   4 VAL HG12 H   3.293   6.386   2.460 1.00 . A A .   4 VAL HG12 1 1 
        4  5390 1 1   4 VAL HG13 H   3.992   5.084   1.493 1.00 . A A .   4 VAL HG13 1 1 
        4  5391 1 1   4 VAL HG21 H   2.690   4.066  -0.398 1.00 . A A .   4 VAL HG21 1 1 
        4  5392 1 1   4 VAL HG22 H   1.092   4.690  -0.805 1.00 . A A .   4 VAL HG22 1 1 
        4  5393 1 1   4 VAL HG23 H   1.311   3.710   0.645 1.00 . A A .   4 VAL HG23 1 1 
        4  5394 1 1   4 VAL N    N   1.017   7.682   2.001 1.00 . A A .   4 VAL N    1 1 
        4  5395 1 1   4 VAL O    O   0.309   5.425   3.537 1.00 . A A .   4 VAL O    1 1 
        4  5396 1 1   5 LEU C    C  -0.999   2.218   2.272 1.00 . A A .   5 LEU C    1 1 
        4  5397 1 1   5 LEU CA   C  -1.619   3.593   2.566 1.00 . A A .   5 LEU CA   1 1 
        4  5398 1 1   5 LEU CB   C  -3.122   3.599   2.195 1.00 . A A .   5 LEU CB   1 1 
        4  5399 1 1   5 LEU CD1  C  -3.994   2.874   4.497 1.00 . A A .   5 LEU CD1  1 1 
        4  5400 1 1   5 LEU CD2  C  -5.460   2.574   2.424 1.00 . A A .   5 LEU CD2  1 1 
        4  5401 1 1   5 LEU CG   C  -4.019   2.590   2.980 1.00 . A A .   5 LEU CG   1 1 
        4  5402 1 1   5 LEU H    H  -1.114   4.733   0.856 1.00 . A A .   5 LEU H    1 1 
        4  5403 1 1   5 LEU HA   H  -1.520   3.810   3.633 1.00 . A A .   5 LEU HA   1 1 
        4  5404 1 1   5 LEU HB2  H  -3.506   4.603   2.360 1.00 . A A .   5 LEU HB2  1 1 
        4  5405 1 1   5 LEU HB3  H  -3.208   3.378   1.133 1.00 . A A .   5 LEU HB3  1 1 
        4  5406 1 1   5 LEU HD11 H  -4.319   3.887   4.690 1.00 . A A .   5 LEU HD11 1 1 
        4  5407 1 1   5 LEU HD12 H  -2.987   2.738   4.875 1.00 . A A .   5 LEU HD12 1 1 
        4  5408 1 1   5 LEU HD13 H  -4.653   2.182   5.007 1.00 . A A .   5 LEU HD13 1 1 
        4  5409 1 1   5 LEU HD21 H  -6.050   1.842   2.962 1.00 . A A .   5 LEU HD21 1 1 
        4  5410 1 1   5 LEU HD22 H  -5.441   2.309   1.375 1.00 . A A .   5 LEU HD22 1 1 
        4  5411 1 1   5 LEU HD23 H  -5.914   3.549   2.536 1.00 . A A .   5 LEU HD23 1 1 
        4  5412 1 1   5 LEU HG   H  -3.611   1.594   2.844 1.00 . A A .   5 LEU HG   1 1 
        4  5413 1 1   5 LEU N    N  -0.902   4.622   1.810 1.00 . A A .   5 LEU N    1 1 
        4  5414 1 1   5 LEU O    O  -1.217   1.642   1.200 1.00 . A A .   5 LEU O    1 1 
        4  5415 1 1   6 LEU C    C  -0.674  -0.667   3.513 1.00 . A A .   6 LEU C    1 1 
        4  5416 1 1   6 LEU CA   C   0.399   0.391   3.166 1.00 . A A .   6 LEU CA   1 1 
        4  5417 1 1   6 LEU CB   C   1.594   0.317   4.162 1.00 . A A .   6 LEU CB   1 1 
        4  5418 1 1   6 LEU CD1  C   3.016  -1.384   2.887 1.00 . A A .   6 LEU CD1  1 1 
        4  5419 1 1   6 LEU CD2  C   3.378  -1.041   5.394 1.00 . A A .   6 LEU CD2  1 1 
        4  5420 1 1   6 LEU CG   C   2.356  -1.040   4.232 1.00 . A A .   6 LEU CG   1 1 
        4  5421 1 1   6 LEU H    H   0.006   2.301   3.985 1.00 . A A .   6 LEU H    1 1 
        4  5422 1 1   6 LEU HA   H   0.767   0.213   2.155 1.00 . A A .   6 LEU HA   1 1 
        4  5423 1 1   6 LEU HB2  H   2.306   1.091   3.892 1.00 . A A .   6 LEU HB2  1 1 
        4  5424 1 1   6 LEU HB3  H   1.216   0.548   5.157 1.00 . A A .   6 LEU HB3  1 1 
        4  5425 1 1   6 LEU HD11 H   3.721  -0.609   2.613 1.00 . A A .   6 LEU HD11 1 1 
        4  5426 1 1   6 LEU HD12 H   2.258  -1.466   2.121 1.00 . A A .   6 LEU HD12 1 1 
        4  5427 1 1   6 LEU HD13 H   3.538  -2.329   2.968 1.00 . A A .   6 LEU HD13 1 1 
        4  5428 1 1   6 LEU HD21 H   2.859  -0.880   6.331 1.00 . A A .   6 LEU HD21 1 1 
        4  5429 1 1   6 LEU HD22 H   4.106  -0.255   5.249 1.00 . A A .   6 LEU HD22 1 1 
        4  5430 1 1   6 LEU HD23 H   3.887  -1.997   5.436 1.00 . A A .   6 LEU HD23 1 1 
        4  5431 1 1   6 LEU HG   H   1.638  -1.827   4.435 1.00 . A A .   6 LEU HG   1 1 
        4  5432 1 1   6 LEU N    N  -0.194   1.731   3.215 1.00 . A A .   6 LEU N    1 1 
        4  5433 1 1   6 LEU O    O  -0.908  -0.965   4.687 1.00 . A A .   6 LEU O    1 1 
        4  5434 1 1   7 VAL C    C  -1.622  -3.619   2.752 1.00 . A A .   7 VAL C    1 1 
        4  5435 1 1   7 VAL CA   C  -2.333  -2.264   2.600 1.00 . A A .   7 VAL CA   1 1 
        4  5436 1 1   7 VAL CB   C  -3.280  -2.301   1.344 1.00 . A A .   7 VAL CB   1 1 
        4  5437 1 1   7 VAL CG1  C  -4.272  -3.485   1.413 1.00 . A A .   7 VAL CG1  1 1 
        4  5438 1 1   7 VAL CG2  C  -4.023  -0.960   1.173 1.00 . A A .   7 VAL CG2  1 1 
        4  5439 1 1   7 VAL H    H  -1.149  -0.832   1.588 1.00 . A A .   7 VAL H    1 1 
        4  5440 1 1   7 VAL HA   H  -2.942  -2.073   3.487 1.00 . A A .   7 VAL HA   1 1 
        4  5441 1 1   7 VAL HB   H  -2.661  -2.449   0.457 1.00 . A A .   7 VAL HB   1 1 
        4  5442 1 1   7 VAL HG11 H  -4.865  -3.414   2.312 1.00 . A A .   7 VAL HG11 1 1 
        4  5443 1 1   7 VAL HG12 H  -3.725  -4.420   1.419 1.00 . A A .   7 VAL HG12 1 1 
        4  5444 1 1   7 VAL HG13 H  -4.926  -3.468   0.550 1.00 . A A .   7 VAL HG13 1 1 
        4  5445 1 1   7 VAL HG21 H  -4.644  -0.994   0.285 1.00 . A A .   7 VAL HG21 1 1 
        4  5446 1 1   7 VAL HG22 H  -3.303  -0.156   1.069 1.00 . A A .   7 VAL HG22 1 1 
        4  5447 1 1   7 VAL HG23 H  -4.645  -0.768   2.035 1.00 . A A .   7 VAL HG23 1 1 
        4  5448 1 1   7 VAL N    N  -1.333  -1.191   2.480 1.00 . A A .   7 VAL N    1 1 
        4  5449 1 1   7 VAL O    O  -1.008  -4.113   1.797 1.00 . A A .   7 VAL O    1 1 
        4  5450 1 1   8 ILE C    C  -2.213  -6.533   4.513 1.00 . A A .   8 ILE C    1 1 
        4  5451 1 1   8 ILE CA   C  -1.105  -5.507   4.271 1.00 . A A .   8 ILE CA   1 1 
        4  5452 1 1   8 ILE CB   C  -0.187  -5.449   5.547 1.00 . A A .   8 ILE CB   1 1 
        4  5453 1 1   8 ILE CD1  C   1.650  -4.060   6.700 1.00 . A A .   8 ILE CD1  1 1 
        4  5454 1 1   8 ILE CG1  C   0.798  -4.248   5.467 1.00 . A A .   8 ILE CG1  1 1 
        4  5455 1 1   8 ILE CG2  C   0.582  -6.790   5.730 1.00 . A A .   8 ILE CG2  1 1 
        4  5456 1 1   8 ILE H    H  -2.199  -3.749   4.666 1.00 . A A .   8 ILE H    1 1 
        4  5457 1 1   8 ILE HA   H  -0.493  -5.823   3.423 1.00 . A A .   8 ILE HA   1 1 
        4  5458 1 1   8 ILE HB   H  -0.827  -5.315   6.422 1.00 . A A .   8 ILE HB   1 1 
        4  5459 1 1   8 ILE HD11 H   2.306  -3.218   6.551 1.00 . A A .   8 ILE HD11 1 1 
        4  5460 1 1   8 ILE HD12 H   2.241  -4.948   6.875 1.00 . A A .   8 ILE HD12 1 1 
        4  5461 1 1   8 ILE HD13 H   1.015  -3.872   7.557 1.00 . A A .   8 ILE HD13 1 1 
        4  5462 1 1   8 ILE HG12 H   1.466  -4.381   4.629 1.00 . A A .   8 ILE HG12 1 1 
        4  5463 1 1   8 ILE HG13 H   0.233  -3.334   5.323 1.00 . A A .   8 ILE HG13 1 1 
        4  5464 1 1   8 ILE HG21 H  -0.122  -7.611   5.817 1.00 . A A .   8 ILE HG21 1 1 
        4  5465 1 1   8 ILE HG22 H   1.189  -6.754   6.625 1.00 . A A .   8 ILE HG22 1 1 
        4  5466 1 1   8 ILE HG23 H   1.224  -6.965   4.873 1.00 . A A .   8 ILE HG23 1 1 
        4  5467 1 1   8 ILE N    N  -1.706  -4.20