NMR Restraints Grid

Result table
 (Save to zip file containing files for each block)

image mrblock_id pdb_id bmrb_id cing stage program type subtype item_count
509357 2ytq 10222 cing 4-filtered-FRED STAR entry full 458


data_FRED_restraints_with_modified_coordinates_PDB_code_2ytq

# This FRED archive file contains, for PDB entry <2ytq>:
# 
# - Coordinates and sequence information from the PDB mmCIF file
# - NMR restraints from the PDB MR file
# 
# In this file, the coordinates and NMR restraints share the same atom names,
# and in this way can differ from the data deposited at the wwPDB. To achieve
# this aim, the NMR restraints were parsed from their original format files, and
# the coordinates and NMR restraints information were subsequently harmonized.
# 
# Due to the complexity of this harmonization process and the filtering process
# used in creating these files, the NMR restraints information in these files
# may differ significantly from that in the originally deposited file. Other 
# modifications could have occurred to the NMR restraints information, or data 
# could have been lost because of parsing or conversion errors. The PDB file 
# remains the authoritative reference for the atomic coordinates and the 
# originally deposited restraints files remain the primary reference for these 
# data.
# 
# This file is generated at the BioMagResBank (BMRB) in collaboration with the 
# PDBe (formerly MSD) group at the European Bioinformatics Institute (EBI) and 
# the CMBI/IMM group at the Radboud University of Nijmegen.
# 
# Several software packages were used to produce this file:
# 
# - Wattos (BMRB and CMBI/IMM).
# - FormatConverter and NMRStarExport (PDBe).
# - CCPN framework (http://www.ccpn.ac.uk/).
# 
# More information about this process can be found in the references below.
# Please cite the original reference for this PDB entry.
# 
# JF Doreleijers, A Nederveen, W Vranken, J Lin, AM Bonvin, R Kaptein, JL
# Markley, and EL Ulrich (2005). BioMagResBank databases DOCR and FRED
# containing converted and filtered sets of experimental NMR restraints and
# coordinates from over 500 protein PDB structures. J. Biomol. NMR 32, 1-12.
# 
# WF Vranken, W Boucher, TJ Stevens, RH Fogh, A Pajon, M Llinas, EL Ulrich, JL
# Markley, J Ionides, ED Laue (2005). The CCPN data model for NMR spectroscopy:
# development of a software pipeline. Proteins 59, 687-696. 
# 
# JF Doreleijers, WF Vranken, C Schulte, J Lin, JR Wedell, CJ Penkett, GW Vuister, 
# G Vriend, JL Markley, and EL Ulrich (2009). The NMR Restraints Grid at BMRB for 
# 5,266 Protein and Nucleic Acid PDB Entries. J Biomol. NMR 45, 389?396.




save_Conversion_project_for_entry_Name_1
    _Study_list.Sf_category  study_list
    _Study_list.Entry_ID     1
    _Study_list.ID           1

    loop_
       _Study.ID
       _Study.Name
       _Study.Type
       _Study.Details
       _Study.Entry_ID
       _Study.Study_list_ID

       1 "Conversion project for entry 1" NMR . 1 1 
    stop_

save_


save_originalConstraints_1
    _Entry.PDB_coordinate_file_version  .
    _Entry.Sf_category                  entry_information
    _Entry.ID                           1
    _Entry.Title                        "Data for entry 1"
    _Entry.NMR_STAR_version             3.1.0.8
    _Entry.Experimental_method          NMR
    _Entry.Details                      .

save_


save_assembly_2ytq
    _Assembly.Sf_category           assembly
    _Assembly.Entry_ID              1
    _Assembly.ID                    1
    _Assembly.Name                  2ytq
    _Assembly.Number_of_components  2
    _Assembly.Organic_ligands       .
    _Assembly.Metal_ions            .
    _Assembly.Paramagnetic          .
    _Assembly.Thiol_state           "all other bound"
    _Assembly.Molecular_mass        4639.37

    loop_
       _Entity_assembly.ID
       _Entity_assembly.Entity_assembly_name
       _Entity_assembly.Entity_ID
       _Entity_assembly.Entity_label
       _Entity_assembly.Asym_ID
       _Entity_assembly.Details
       _Entity_assembly.Entry_ID
       _Entity_assembly.Assembly_ID

       1 . 1 $Zinc_finger_protein_268 A . 1 1 
       2 . 2 $ZINC_ION                B . 1 1 
    stop_

    loop_
       _PDBX_nonpoly_scheme.Entity_assembly_ID
       _PDBX_nonpoly_scheme.Entity_ID
       _PDBX_nonpoly_scheme.Mon_ID
       _PDBX_nonpoly_scheme.Comp_index_ID
       _PDBX_nonpoly_scheme.Comp_ID
       _PDBX_nonpoly_scheme.Entry_ID
       _PDBX_nonpoly_scheme.Assembly_ID

       2 2 ZN 1 ZN 1 1 
    stop_

save_


save_Zinc_finger_protein_268
    _Entity.Sf_category                  entity
    _Entity.Entry_ID                     1
    _Entity.ID                           1
    _Entity.Name                         "Zinc finger protein 268"
    _Entity.Type                         polymer
    _Entity.Polymer_type                 polypeptide(L)
    _Entity.Polymer_seq_one_letter_code  GSSGSSGAGEKPYGCSECGKAFSSKSYLIIHMRTHSGEKPSGPSSG
    _Entity.Number_of_monomers           46

    loop_
       _Entity_comp_index.ID
       _Entity_comp_index.Comp_ID
       _Entity_comp_index.Comp_label
       _Entity_comp_index.Entry_ID
       _Entity_comp_index.Entity_ID

        1 GLY . 1 1 
        2 SER . 1 1 
        3 SER . 1 1 
        4 GLY . 1 1 
        5 SER . 1 1 
        6 SER . 1 1 
        7 GLY . 1 1 
        8 ALA . 1 1 
        9 GLY . 1 1 
       10 GLU . 1 1 
       11 LYS . 1 1 
       12 PRO . 1 1 
       13 TYR . 1 1 
       14 GLY . 1 1 
       15 CYS . 1 1 
       16 SER . 1 1 
       17 GLU . 1 1 
       18 CYS . 1 1 
       19 GLY . 1 1 
       20 LYS . 1 1 
       21 ALA . 1 1 
       22 PHE . 1 1 
       23 SER . 1 1 
       24 SER . 1 1 
       25 LYS . 1 1 
       26 SER . 1 1 
       27 TYR . 1 1 
       28 LEU . 1 1 
       29 ILE . 1 1 
       30 ILE . 1 1 
       31 HIS . 1 1 
       32 MET . 1 1 
       33 ARG . 1 1 
       34 THR . 1 1 
       35 HIS . 1 1 
       36 SER . 1 1 
       37 GLY . 1 1 
       38 GLU . 1 1 
       39 LYS . 1 1 
       40 PRO . 1 1 
       41 SER . 1 1 
       42 GLY . 1 1 
       43 PRO . 1 1 
       44 SER . 1 1 
       45 SER . 1 1 
       46 GLY . 1 1 
    stop_

    loop_
       _Entity_poly_seq.Mon_ID
       _Entity_poly_seq.Num
       _Entity_poly_seq.Comp_index_ID
       _Entity_poly_seq.Entry_ID
       _Entity_poly_seq.Entity_ID

       GLY  1  1 1 1 
       SER  2  2 1 1 
       SER  3  3 1 1 
       GLY  4  4 1 1 
       SER  5  5 1 1 
       SER  6  6 1 1 
       GLY  7  7 1 1 
       ALA  8  8 1 1 
       GLY  9  9 1 1 
       GLU 10 10 1 1 
       LYS 11 11 1 1 
       PRO 12 12 1 1 
       TYR 13 13 1 1 
       GLY 14 14 1 1 
       CYS 15 15 1 1 
       SER 16 16 1 1 
       GLU 17 17 1 1 
       CYS 18 18 1 1 
       GLY 19 19 1 1 
       LYS 20 20 1 1 
       ALA 21 21 1 1 
       PHE 22 22 1 1 
       SER 23 23 1 1 
       SER 24 24 1 1 
       LYS 25 25 1 1 
       SER 26 26 1 1 
       TYR 27 27 1 1 
       LEU 28 28 1 1 
       ILE 29 29 1 1 
       ILE 30 30 1 1 
       HIS 31 31 1 1 
       MET 32 32 1 1 
       ARG 33 33 1 1 
       THR 34 34 1 1 
       HIS 35 35 1 1 
       SER 36 36 1 1 
       GLY 37 37 1 1 
       GLU 38 38 1 1 
       LYS 39 39 1 1 
       PRO 40 40 1 1 
       SER 41 41 1 1 
       GLY 42 42 1 1 
       PRO 43 43 1 1 
       SER 44 44 1 1 
       SER 45 45 1 1 
       GLY 46 46 1 1 
    stop_

save_


save_ZINC_ION
    _Entity.Sf_category  entity
    _Entity.Entry_ID     1
    _Entity.ID           2
    _Entity.Name         "ZINC ION"
    _Entity.Type         non-polymer

    loop_
       _Entity_comp_index.ID
       _Entity_comp_index.Comp_ID
       _Entity_comp_index.Comp_label
       _Entity_comp_index.Entry_ID
       _Entity_comp_index.Entity_ID

       1 ZN $ZN 1 2 
    stop_

save_


save_ZN
    _Chem_comp.Sf_category  chem_comp
    _Chem_comp.Entry_ID     1
    _Chem_comp.ID           ZN
    _Chem_comp.Type         non-polymer

save_


save_DYANA/DIANA_distance_constraints_2_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  1
    _Distance_constraint_list.Constraint_type     "general distance"
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

        1 1 . . . 1 1 
        2 1 . . . 1 1 
        3 1 . . . 1 1 
        4 1 . . . 1 1 
        5 1 . . . 1 1 
        6 1 . . . 1 1 
        7 1 . . . 1 1 
        8 1 . . . 1 1 
        9 1 . . . 1 1 
       10 1 . . . 1 1 
       11 1 . . . 1 1 
       12 1 . . . 1 1 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

        1 1 1 1 1 15 CYS SG  .  15 CYSS SG  1 1 
        1 1 2 2 2  1 ZN  ZN  . 201 ZN   ZN  1 1 
        2 1 1 1 1 15 CYS CB  .  15 CYSS CB  1 1 
        2 1 2 2 2  1 ZN  ZN  . 201 ZN   ZN  1 1 
        3 1 1 1 1 18 CYS SG  .  18 CYSS SG  1 1 
        3 1 2 2 2  1 ZN  ZN  . 201 ZN   ZN  1 1 
        4 1 1 1 1 18 CYS CB  .  18 CYSS CB  1 1 
        4 1 2 2 2  1 ZN  ZN  . 201 ZN   ZN  1 1 
        5 1 1 1 1 31 HIS NE2 .  31 HIS  NE2 1 1 
        5 1 2 2 2  1 ZN  ZN  . 201 ZN   ZN  1 1 
        6 1 1 1 1 35 HIS NE2 .  35 HIS  NE2 1 1 
        6 1 2 2 2  1 ZN  ZN  . 201 ZN   ZN  1 1 
        7 1 1 1 1 15 CYS SG  .  15 CYSS SG  1 1 
        7 1 2 1 1 18 CYS SG  .  18 CYSS SG  1 1 
        8 1 1 1 1 15 CYS SG  .  15 CYSS SG  1 1 
        8 1 2 1 1 31 HIS NE2 .  31 HIS  NE2 1 1 
        9 1 1 1 1 15 CYS SG  .  15 CYSS SG  1 1 
        9 1 2 1 1 35 HIS NE2 .  35 HIS  NE2 1 1 
       10 1 1 1 1 18 CYS SG  .  18 CYSS SG  1 1 
       10 1 2 1 1 31 HIS NE2 .  31 HIS  NE2 1 1 
       11 1 1 1 1 18 CYS SG  .  18 CYSS SG  1 1 
       11 1 2 1 1 35 HIS NE2 .  35 HIS  NE2 1 1 
       12 1 1 1 1 31 HIS NE2 .  31 HIS  NE2 1 1 
       12 1 2 1 1 35 HIS NE2 .  35 HIS  NE2 1 1 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

        1 1 . . . . . . 2.19 2.39 1 1 
        2 1 . . . . . . 3.25 3.51 1 1 
        3 1 . . . . . . 2.19 2.39 1 1 
        4 1 . . . . . . 3.25 3.51 1 1 
        5 1 . . . . . .  1.9  2.1 1 1 
        6 1 . . . . . .  1.9  2.1 1 1 
        7 1 . . . . . . 3.56 3.96 1 1 
        8 1 . . . . . . 3.32 3.72 1 1 
        9 1 . . . . . . 3.32 3.72 1 1 
       10 1 . . . . . . 3.32 3.72 1 1 
       11 1 . . . . . . 3.32 3.72 1 1 
       12 1 . . . . . .  3.0  3.6 1 1 
    stop_

save_


save_DYANA/DIANA_distance_constraints_5_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  2
    _Distance_constraint_list.Constraint_type     NOE
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

         1 1 . . . 1 2 
         2 1 . . . 1 2 
         3 1 . . . 1 2 
         4 1 . . . 1 2 
         5 1 . . . 1 2 
         6 1 . . . 1 2 
         7 1 . . . 1 2 
         8 1 . . . 1 2 
         9 1 . . . 1 2 
        10 1 . . . 1 2 
        11 1 . . . 1 2 
        12 1 . . . 1 2 
        13 1 . . . 1 2 
        14 1 . . . 1 2 
        15 1 . . . 1 2 
        16 1 . . . 1 2 
        17 1 . . . 1 2 
        18 1 . . . 1 2 
        19 1 . . . 1 2 
        20 1 . . . 1 2 
        21 1 . . . 1 2 
        22 1 . . . 1 2 
        23 1 . . . 1 2 
        24 1 . . . 1 2 
        25 1 . . . 1 2 
        26 1 . . . 1 2 
        27 1 . . . 1 2 
        28 1 . . . 1 2 
        29 1 . . . 1 2 
        30 1 . . . 1 2 
        31 1 . . . 1 2 
        32 1 . . . 1 2 
        33 1 . . . 1 2 
        34 1 . . . 1 2 
        35 1 . . . 1 2 
        36 1 . . . 1 2 
        37 1 . . . 1 2 
        38 1 . . . 1 2 
        39 1 . . . 1 2 
        40 1 . . . 1 2 
        41 1 . . . 1 2 
        42 1 . . . 1 2 
        43 1 . . . 1 2 
        44 1 . . . 1 2 
        45 1 . . . 1 2 
        46 1 . . . 1 2 
        47 1 . . . 1 2 
        48 1 . . . 1 2 
        49 1 . . . 1 2 
        50 1 . . . 1 2 
        51 1 . . . 1 2 
        52 1 . . . 1 2 
        53 1 . . . 1 2 
        54 1 . . . 1 2 
        55 1 . . . 1 2 
        56 1 . . . 1 2 
        57 1 . . . 1 2 
        58 1 . . . 1 2 
        59 1 . . . 1 2 
        60 1 . . . 1 2 
        61 1 . . . 1 2 
        62 1 . . . 1 2 
        63 1 . . . 1 2 
        64 1 . . . 1 2 
        65 1 . . . 1 2 
        66 1 . . . 1 2 
        67 1 . . . 1 2 
        68 1 . . . 1 2 
        69 1 . . . 1 2 
        70 1 . . . 1 2 
        71 1 . . . 1 2 
        72 1 . . . 1 2 
        73 1 . . . 1 2 
        74 1 . . . 1 2 
        75 1 . . . 1 2 
        76 1 . . . 1 2 
        77 1 . . . 1 2 
        78 1 . . . 1 2 
        79 1 . . . 1 2 
        80 1 . . . 1 2 
        81 1 . . . 1 2 
        82 1 . . . 1 2 
        83 1 . . . 1 2 
        84 1 . . . 1 2 
        85 1 . . . 1 2 
        86 1 . . . 1 2 
        87 1 . . . 1 2 
        88 1 . . . 1 2 
        89 1 . . . 1 2 
        90 1 . . . 1 2 
        91 1 . . . 1 2 
        92 1 . . . 1 2 
        93 1 . . . 1 2 
        94 1 . . . 1 2 
        95 1 . . . 1 2 
        96 1 . . . 1 2 
        97 1 . . . 1 2 
        98 1 . . . 1 2 
        99 1 . . . 1 2 
       100 1 . . . 1 2 
       101 1 . . . 1 2 
       102 1 . . . 1 2 
       103 1 . . . 1 2 
       104 1 . . . 1 2 
       105 1 . . . 1 2 
       106 1 . . . 1 2 
       107 1 . . . 1 2 
       108 1 . . . 1 2 
       109 1 . . . 1 2 
       110 1 . . . 1 2 
       111 1 . . . 1 2 
       112 1 . . . 1 2 
       113 1 . . . 1 2 
       114 1 . . . 1 2 
       115 1 . . . 1 2 
       116 1 . . . 1 2 
       117 1 . . . 1 2 
       118 1 . . . 1 2 
       119 1 . . . 1 2 
       120 1 . . . 1 2 
       121 1 . . . 1 2 
       122 1 . . . 1 2 
       123 1 . . . 1 2 
       124 1 . . . 1 2 
       125 1 . . . 1 2 
       126 1 . . . 1 2 
       127 1 . . . 1 2 
       128 1 . . . 1 2 
       129 1 . . . 1 2 
       130 1 . . . 1 2 
       131 1 . . . 1 2 
       132 1 . . . 1 2 
       133 1 . . . 1 2 
       134 1 . . . 1 2 
       135 1 . . . 1 2 
       136 1 . . . 1 2 
       137 1 . . . 1 2 
       138 1 . . . 1 2 
       139 1 . . . 1 2 
       140 1 . . . 1 2 
       141 1 . . . 1 2 
       142 1 . . . 1 2 
       143 1 . . . 1 2 
       144 1 . . . 1 2 
       145 1 . . . 1 2 
       146 1 . . . 1 2 
       147 1 . . . 1 2 
       148 1 . . . 1 2 
       149 1 . . . 1 2 
       150 1 . . . 1 2 
       151 1 . . . 1 2 
       152 1 . . . 1 2 
       153 1 . . . 1 2 
       154 1 . . . 1 2 
       155 1 . . . 1 2 
       156 1 . . . 1 2 
       157 1 . . . 1 2 
       158 1 . . . 1 2 
       159 1 . . . 1 2 
       160 1 . . . 1 2 
       161 1 . . . 1 2 
       162 1 . . . 1 2 
       163 1 . . . 1 2 
       164 1 . . . 1 2 
       165 1 . . . 1 2 
       166 1 . . . 1 2 
       167 1 . . . 1 2 
       168 1 . . . 1 2 
       169 1 . . . 1 2 
       170 1 . . . 1 2 
       171 1 . . . 1 2 
       172 1 . . . 1 2 
       173 1 . . . 1 2 
       174 1 . . . 1 2 
       175 1 . . . 1 2 
       176 1 . . . 1 2 
       177 1 . . . 1 2 
       178 1 . . . 1 2 
       179 1 . . . 1 2 
       180 1 . . . 1 2 
       181 1 . . . 1 2 
       182 1 . . . 1 2 
       183 1 . . . 1 2 
       184 1 . . . 1 2 
       185 1 . . . 1 2 
       186 1 . . . 1 2 
       187 1 . . . 1 2 
       188 1 . . . 1 2 
       189 1 . . . 1 2 
       190 1 . . . 1 2 
       191 1 . . . 1 2 
       192 1 . . . 1 2 
       193 1 . . . 1 2 
       194 1 . . . 1 2 
       195 1 . . . 1 2 
       196 1 . . . 1 2 
       197 1 . . . 1 2 
       198 1 . . . 1 2 
       199 1 . . . 1 2 
       200 1 . . . 1 2 
       201 1 . . . 1 2 
       202 1 . . . 1 2 
       203 1 . . . 1 2 
       204 1 . . . 1 2 
       205 1 . . . 1 2 
       206 1 . . . 1 2 
       207 1 . . . 1 2 
       208 1 . . . 1 2 
       209 1 . . . 1 2 
       210 1 . . . 1 2 
       211 1 . . . 1 2 
       212 1 . . . 1 2 
       213 1 . . . 1 2 
       214 1 . . . 1 2 
       215 1 . . . 1 2 
       216 1 . . . 1 2 
       217 1 . . . 1 2 
       218 1 . . . 1 2 
       219 1 . . . 1 2 
       220 1 . . . 1 2 
       221 1 . . . 1 2 
       222 1 . . . 1 2 
       223 1 . . . 1 2 
       224 1 . . . 1 2 
       225 1 . . . 1 2 
       226 1 . . . 1 2 
       227 1 . . . 1 2 
       228 1 . . . 1 2 
       229 1 . . . 1 2 
       230 1 . . . 1 2 
       231 1 . . . 1 2 
       232 1 . . . 1 2 
       233 1 . . . 1 2 
       234 1 . . . 1 2 
       235 1 . . . 1 2 
       236 1 . . . 1 2 
       237 1 . . . 1 2 
       238 1 . . . 1 2 
       239 1 . . . 1 2 
       240 1 . . . 1 2 
       241 1 . . . 1 2 
       242 1 . . . 1 2 
       243 1 . . . 1 2 
       244 1 . . . 1 2 
       245 1 . . . 1 2 
       246 1 . . . 1 2 
       247 1 . . . 1 2 
       248 1 . . . 1 2 
       249 1 . . . 1 2 
       250 1 . . . 1 2 
       251 1 . . . 1 2 
       252 1 . . . 1 2 
       253 1 . . . 1 2 
       254 1 . . . 1 2 
       255 1 . . . 1 2 
       256 1 . . . 1 2 
       257 1 . . . 1 2 
       258 1 . . . 1 2 
       259 1 . . . 1 2 
       260 1 . . . 1 2 
       261 1 . . . 1 2 
       262 1 . . . 1 2 
       263 1 . . . 1 2 
       264 1 . . . 1 2 
       265 1 . . . 1 2 
       266 1 . . . 1 2 
       267 1 . . . 1 2 
       268 1 . . . 1 2 
       269 1 . . . 1 2 
       270 1 . . . 1 2 
       271 1 . . . 1 2 
       272 1 . . . 1 2 
       273 1 . . . 1 2 
       274 1 . . . 1 2 
       275 1 . . . 1 2 
       276 1 . . . 1 2 
       277 1 . . . 1 2 
       278 1 . . . 1 2 
       279 1 . . . 1 2 
       280 1 . . . 1 2 
       281 1 . . . 1 2 
       282 1 . . . 1 2 
       283 1 . . . 1 2 
       284 1 . . . 1 2 
       285 1 . . . 1 2 
       286 1 . . . 1 2 
       287 1 . . . 1 2 
       288 1 . . . 1 2 
       289 1 . . . 1 2 
       290 1 . . . 1 2 
       291 1 . . . 1 2 
       292 1 . . . 1 2 
       293 1 . . . 1 2 
       294 1 . . . 1 2 
       295 1 . . . 1 2 
       296 1 . . . 1 2 
       297 1 . . . 1 2 
       298 1 . . . 1 2 
       299 1 . . . 1 2 
       300 1 . . . 1 2 
       301 1 . . . 1 2 
       302 1 . . . 1 2 
       303 1 . . . 1 2 
       304 1 . . . 1 2 
       305 1 . . . 1 2 
       306 1 . . . 1 2 
       307 1 . . . 1 2 
       308 1 . . . 1 2 
       309 1 . . . 1 2 
       310 1 . . . 1 2 
       311 1 . . . 1 2 
       312 1 . . . 1 2 
       313 1 . . . 1 2 
       314 1 . . . 1 2 
       315 1 . . . 1 2 
       316 1 . . . 1 2 
       317 1 . . . 1 2 
       318 1 . . . 1 2 
       319 1 . . . 1 2 
       320 1 . . . 1 2 
       321 1 . . . 1 2 
       322 1 . . . 1 2 
       323 1 . . . 1 2 
       324 1 . . . 1 2 
       325 1 . . . 1 2 
       326 1 . . . 1 2 
       327 1 . . . 1 2 
       328 1 . . . 1 2 
       329 1 . . . 1 2 
       330 1 . . . 1 2 
       331 1 . . . 1 2 
       332 1 . . . 1 2 
       333 1 . . . 1 2 
       334 1 . . . 1 2 
       335 1 . . . 1 2 
       336 1 . . . 1 2 
       337 1 . . . 1 2 
       338 1 . . . 1 2 
       339 1 . . . 1 2 
       340 1 . . . 1 2 
       341 1 . . . 1 2 
       342 1 . . . 1 2 
       343 1 . . . 1 2 
       344 1 . . . 1 2 
       345 1 . . . 1 2 
       346 1 . . . 1 2 
       347 1 . . . 1 2 
       348 1 . . . 1 2 
       349 1 . . . 1 2 
       350 1 . . . 1 2 
       351 1 . . . 1 2 
       352 1 . . . 1 2 
       353 1 . . . 1 2 
       354 1 . . . 1 2 
       355 1 . . . 1 2 
       356 1 . . . 1 2 
       357 1 . . . 1 2 
       358 1 . . . 1 2 
       359 1 . . . 1 2 
       360 1 . . . 1 2 
       361 1 . . . 1 2 
       362 1 . . . 1 2 
       363 1 . . . 1 2 
       364 1 . . . 1 2 
       365 1 . . . 1 2 
       366 1 . . . 1 2 
       367 1 . . . 1 2 
       368 1 . . . 1 2 
       369 1 . . . 1 2 
       370 1 . . . 1 2 
       371 1 . . . 1 2 
       372 1 . . . 1 2 
       373 1 . . . 1 2 
       374 1 . . . 1 2 
       375 1 . . . 1 2 
       376 1 . . . 1 2 
       377 1 . . . 1 2 
       378 1 . . . 1 2 
       379 1 . . . 1 2 
       380 1 . . . 1 2 
       381 1 . . . 1 2 
       382 1 . . . 1 2 
       383 1 . . . 1 2 
       384 1 . . . 1 2 
       385 1 . . . 1 2 
       386 1 . . . 1 2 
       387 1 . . . 1 2 
       388 1 . . . 1 2 
       389 1 . . . 1 2 
       390 1 . . . 1 2 
       391 1 . . . 1 2 
       392 1 . . . 1 2 
       393 1 . . . 1 2 
       394 1 . . . 1 2 
       395 1 . . . 1 2 
       396 1 . . . 1 2 
       397 1 . . . 1 2 
       398 1 . . . 1 2 
       399 1 . . . 1 2 
       400 1 . . . 1 2 
       401 1 . . . 1 2 
       402 1 . . . 1 2 
       403 1 . . . 1 2 
       404 1 . . . 1 2 
       405 1 . . . 1 2 
       406 1 . . . 1 2 
       407 1 . . . 1 2 
       408 1 . . . 1 2 
       409 1 . . . 1 2 
       410 1 . . . 1 2 
       411 1 . . . 1 2 
       412 1 . . . 1 2 
       413 1 . . . 1 2 
       414 1 . . . 1 2 
       415 1 . . . 1 2 
       416 1 . . . 1 2 
       417 1 . . . 1 2 
       418 1 . . . 1 2 
       419 1 . . . 1 2 
       420 1 . . . 1 2 
       421 1 . . . 1 2 
       422 1 . . . 1 2 
       423 1 . . . 1 2 
       424 1 . . . 1 2 
       425 1 . . . 1 2 
       426 1 . . . 1 2 
       427 1 . . . 1 2 
       428 1 . . . 1 2 
       429 1 . . . 1 2 
       430 1 . . . 1 2 
       431 1 . . . 1 2 
       432 1 . . . 1 2 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

         1 1 1 1 1 13 TYR QD   . 13 TYR  QD   1 2 
         1 1 2 1 1 25 LYS H    . 25 LYS  HN   1 2 
         2 1 1 1 1 13 TYR QE   . 13 TYR  QE   1 2 
         2 1 2 1 1 25 LYS H    . 25 LYS  HN   1 2 
         3 1 1 1 1 24 SER HB2  . 24 SER  HB2  1 2 
         3 1 2 1 1 25 LYS H    . 25 LYS  HN   1 2 
         4 1 1 1 1 24 SER HB3  . 24 SER  HB3  1 2 
         4 1 2 1 1 25 LYS H    . 25 LYS  HN   1 2 
         5 1 1 1 1 25 LYS H    . 25 LYS  HN   1 2 
         5 1 2 1 1 25 LYS HB2  . 25 LYS  HB2  1 2 
         6 1 1 1 1 25 LYS H    . 25 LYS  HN   1 2 
         6 1 2 1 1 25 LYS HB3  . 25 LYS  HB3  1 2 
         7 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
         7 1 2 1 1 22 PHE QD   . 22 PHE  QD   1 2 
         8 1 1 1 1 35 HIS H    . 35 HIS  HN   1 2 
         8 1 2 1 1 36 SER H    . 36 SER  HN   1 2 
         9 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
         9 1 2 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
        10 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
        10 1 2 1 1 22 PHE QE   . 22 PHE  QE   1 2 
        11 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
        11 1 2 1 1 15 CYS HB3  . 15 CYSS HB3  1 2 
        12 1 1 1 1 14 GLY H    . 14 GLY  HN   1 2 
        12 1 2 1 1 15 CYS H    . 15 CYSS HN   1 2 
        13 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
        13 1 2 1 1 20 LYS H    . 20 LYS  HN   1 2 
        14 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
        14 1 2 1 1 21 ALA HA   . 21 ALA  HA   1 2 
        15 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
        15 1 2 1 1 15 CYS HB2  . 15 CYSS HB2  1 2 
        16 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
        16 1 2 1 1 21 ALA MB   . 21 ALA  QB   1 2 
        17 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
        17 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
        18 1 1 1 1 38 GLU HA   . 38 GLU  HA   1 2 
        18 1 2 1 1 39 LYS H    . 39 LYS  HN   1 2 
        19 1 1 1 1 39 LYS H    . 39 LYS  HN   1 2 
        19 1 2 1 1 39 LYS QG   . 39 LYS  QG   1 2 
        20 1 1 1 1 15 CYS HB3  . 15 CYSS HB3  1 2 
        20 1 2 1 1 17 GLU H    . 17 GLU  HN   1 2 
        21 1 1 1 1 17 GLU H    . 17 GLU  HN   1 2 
        21 1 2 1 1 17 GLU HB2  . 17 GLU  HB2  1 2 
        22 1 1 1 1 15 CYS HB2  . 15 CYSS HB2  1 2 
        22 1 2 1 1 17 GLU H    . 17 GLU  HN   1 2 
        23 1 1 1 1 17 GLU H    . 17 GLU  HN   1 2 
        23 1 2 1 1 17 GLU HB3  . 17 GLU  HB3  1 2 
        24 1 1 1 1 15 CYS HB3  . 15 CYSS HB3  1 2 
        24 1 2 1 1 20 LYS H    . 20 LYS  HN   1 2 
        25 1 1 1 1 15 CYS HB2  . 15 CYSS HB2  1 2 
        25 1 2 1 1 20 LYS H    . 20 LYS  HN   1 2 
        26 1 1 1 1 20 LYS H    . 20 LYS  HN   1 2 
        26 1 2 1 1 20 LYS HG2  . 20 LYS  HG2  1 2 
        27 1 1 1 1 20 LYS H    . 20 LYS  HN   1 2 
        27 1 2 1 1 20 LYS QD   . 20 LYS  QD   1 2 
        28 1 1 1 1 20 LYS H    . 20 LYS  HN   1 2 
        28 1 2 1 1 20 LYS HB2  . 20 LYS  HB2  1 2 
        29 1 1 1 1 20 LYS H    . 20 LYS  HN   1 2 
        29 1 2 1 1 20 LYS HB3  . 20 LYS  HB3  1 2 
        30 1 1 1 1 23 SER H    . 23 SER  HN   1 2 
        30 1 2 1 1 24 SER H    . 24 SER  HN   1 2 
        31 1 1 1 1 21 ALA H    . 21 ALA  HN   1 2 
        31 1 2 1 1 22 PHE H    . 22 PHE  HN   1 2 
        32 1 1 1 1 22 PHE HB3  . 22 PHE  HB3  1 2 
        32 1 2 1 1 24 SER H    . 24 SER  HN   1 2 
        33 1 1 1 1 24 SER H    . 24 SER  HN   1 2 
        33 1 2 1 1 27 TYR HB2  . 27 TYR  HB2  1 2 
        34 1 1 1 1 24 SER H    . 24 SER  HN   1 2 
        34 1 2 1 1 27 TYR HB3  . 27 TYR  HB3  1 2 
        35 1 1 1 1 22 PHE HB2  . 22 PHE  HB2  1 2 
        35 1 2 1 1 24 SER H    . 24 SER  HN   1 2 
        36 1 1 1 1 24 SER H    . 24 SER  HN   1 2 
        36 1 2 1 1 25 LYS H    . 25 LYS  HN   1 2 
        37 1 1 1 1 20 LYS H    . 20 LYS  HN   1 2 
        37 1 2 1 1 21 ALA H    . 21 ALA  HN   1 2 
        38 1 1 1 1 20 LYS HA   . 20 LYS  HA   1 2 
        38 1 2 1 1 21 ALA H    . 21 ALA  HN   1 2 
        39 1 1 1 1 20 LYS HG2  . 20 LYS  HG2  1 2 
        39 1 2 1 1 21 ALA H    . 21 ALA  HN   1 2 
        40 1 1 1 1 20 LYS QD   . 20 LYS  QD   1 2 
        40 1 2 1 1 21 ALA H    . 21 ALA  HN   1 2 
        41 1 1 1 1 21 ALA H    . 21 ALA  HN   1 2 
        41 1 2 1 1 21 ALA MB   . 21 ALA  QB   1 2 
        42 1 1 1 1 17 GLU H    . 17 GLU  HN   1 2 
        42 1 2 1 1 19 GLY H    . 19 GLY  HN   1 2 
        43 1 1 1 1 15 CYS HB3  . 15 CYSS HB3  1 2 
        43 1 2 1 1 19 GLY H    . 19 GLY  HN   1 2 
        44 1 1 1 1 26 SER QB   . 26 SER  QB   1 2 
        44 1 2 1 1 28 LEU H    . 28 LEU  HN   1 2 
        45 1 1 1 1 25 LYS HA   . 25 LYS  HA   1 2 
        45 1 2 1 1 28 LEU H    . 28 LEU  HN   1 2 
        46 1 1 1 1 28 LEU H    . 28 LEU  HN   1 2 
        46 1 2 1 1 28 LEU HB3  . 28 LEU  HB3  1 2 
        47 1 1 1 1 28 LEU H    . 28 LEU  HN   1 2 
        47 1 2 1 1 28 LEU HB2  . 28 LEU  HB2  1 2 
        48 1 1 1 1 28 LEU H    . 28 LEU  HN   1 2 
        48 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
        49 1 1 1 1 28 LEU H    . 28 LEU  HN   1 2 
        49 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
        50 1 1 1 1 28 LEU H    . 28 LEU  HN   1 2 
        50 1 2 1 1 29 ILE HB   . 29 ILE  HB   1 2 
        51 1 1 1 1 13 TYR HA   . 13 TYR  HA   1 2 
        51 1 2 1 1 14 GLY H    . 14 GLY  HN   1 2 
        52 1 1 1 1 13 TYR HB3  . 13 TYR  HB3  1 2 
        52 1 2 1 1 14 GLY H    . 14 GLY  HN   1 2 
        53 1 1 1 1 14 GLY H    . 14 GLY  HN   1 2 
        53 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
        54 1 1 1 1 11 LYS H    . 11 LYS  HN   1 2 
        54 1 2 1 1 12 PRO HD2  . 12 PRO  HD2  1 2 
        55 1 1 1 1 11 LYS H    . 11 LYS  HN   1 2 
        55 1 2 1 1 12 PRO HD3  . 12 PRO  HD3  1 2 
        56 1 1 1 1 37 GLY H    . 37 GLY  HN   1 2 
        56 1 2 1 1 38 GLU H    . 38 GLU  HN   1 2 
        57 1 1 1 1 38 GLU H    . 38 GLU  HN   1 2 
        57 1 2 1 1 39 LYS H    . 39 LYS  HN   1 2 
        58 1 1 1 1 38 GLU H    . 38 GLU  HN   1 2 
        58 1 2 1 1 38 GLU HG2  . 38 GLU  HG2  1 2 
        59 1 1 1 1 38 GLU H    . 38 GLU  HN   1 2 
        59 1 2 1 1 38 GLU HG3  . 38 GLU  HG3  1 2 
        60 1 1 1 1 28 LEU H    . 28 LEU  HN   1 2 
        60 1 2 1 1 29 ILE H    . 29 ILE  HN   1 2 
        61 1 1 1 1 29 ILE H    . 29 ILE  HN   1 2 
        61 1 2 1 1 30 ILE H    . 30 ILE  HN   1 2 
        62 1 1 1 1 26 SER HA   . 26 SER  HA   1 2 
        62 1 2 1 1 29 ILE H    . 29 ILE  HN   1 2 
        63 1 1 1 1 25 LYS HA   . 25 LYS  HA   1 2 
        63 1 2 1 1 29 ILE H    . 29 ILE  HN   1 2 
        64 1 1 1 1 10 GLU H    . 10 GLU  HN   1 2 
        64 1 2 1 1 10 GLU HG2  . 10 GLU  HG2  1 2 
        65 1 1 1 1 10 GLU H    . 10 GLU  HN   1 2 
        65 1 2 1 1 10 GLU HG3  . 10 GLU  HG3  1 2 
        66 1 1 1 1 28 LEU HB3  . 28 LEU  HB3  1 2 
        66 1 2 1 1 29 ILE H    . 29 ILE  HN   1 2 
        67 1 1 1 1 29 ILE H    . 29 ILE  HN   1 2 
        67 1 2 1 1 29 ILE HB   . 29 ILE  HB   1 2 
        68 1 1 1 1 28 LEU HG   . 28 LEU  HG   1 2 
        68 1 2 1 1 29 ILE H    . 29 ILE  HN   1 2 
        69 1 1 1 1 28 LEU HB2  . 28 LEU  HB2  1 2 
        69 1 2 1 1 29 ILE H    . 29 ILE  HN   1 2 
        70 1 1 1 1 29 ILE H    . 29 ILE  HN   1 2 
        70 1 2 1 1 29 ILE HG12 . 29 ILE  HG12 1 2 
        71 1 1 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
        71 1 2 1 1 29 ILE H    . 29 ILE  HN   1 2 
        72 1 1 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
        72 1 2 1 1 29 ILE H    . 29 ILE  HN   1 2 
        73 1 1 1 1 29 ILE H    . 29 ILE  HN   1 2 
        73 1 2 1 1 29 ILE MG   . 29 ILE  QG2  1 2 
        74 1 1 1 1 31 HIS H    . 31 HIS  HN   1 2 
        74 1 2 1 1 32 MET HB2  . 32 MET  HB2  1 2 
        75 1 1 1 1 31 HIS H    . 31 HIS  HN   1 2 
        75 1 2 1 1 32 MET H    . 32 MET  HN   1 2 
        76 1 1 1 1 30 ILE H    . 30 ILE  HN   1 2 
        76 1 2 1 1 31 HIS H    . 31 HIS  HN   1 2 
        77 1 1 1 1 31 HIS H    . 31 HIS  HN   1 2 
        77 1 2 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
        78 1 1 1 1 31 HIS H    . 31 HIS  HN   1 2 
        78 1 2 1 1 31 HIS HB3  . 31 HIS  HB3  1 2 
        79 1 1 1 1 31 HIS H    . 31 HIS  HN   1 2 
        79 1 2 1 1 31 HIS HB2  . 31 HIS  HB2  1 2 
        80 1 1 1 1 30 ILE HB   . 30 ILE  HB   1 2 
        80 1 2 1 1 31 HIS H    . 31 HIS  HN   1 2 
        81 1 1 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
        81 1 2 1 1 31 HIS H    . 31 HIS  HN   1 2 
        82 1 1 1 1 30 ILE MG   . 30 ILE  QG2  1 2 
        82 1 2 1 1 31 HIS H    . 31 HIS  HN   1 2 
        83 1 1 1 1 32 MET H    . 32 MET  HN   1 2 
        83 1 2 1 1 34 THR H    . 34 THR  HN   1 2 
        84 1 1 1 1 34 THR H    . 34 THR  HN   1 2 
        84 1 2 1 1 34 THR HB   . 34 THR  HB   1 2 
        85 1 1 1 1 34 THR H    . 34 THR  HN   1 2 
        85 1 2 1 1 35 HIS HB2  . 35 HIS  HB2  1 2 
        86 1 1 1 1 34 THR H    . 34 THR  HN   1 2 
        86 1 2 1 1 34 THR MG   . 34 THR  QG2  1 2 
        87 1 1 1 1 32 MET HB3  . 32 MET  HB3  1 2 
        87 1 2 1 1 34 THR H    . 34 THR  HN   1 2 
        88 1 1 1 1 30 ILE H    . 30 ILE  HN   1 2 
        88 1 2 1 1 32 MET H    . 32 MET  HN   1 2 
        89 1 1 1 1 32 MET H    . 32 MET  HN   1 2 
        89 1 2 1 1 33 ARG H    . 33 ARG  HN   1 2 
        90 1 1 1 1 27 TYR HA   . 27 TYR  HA   1 2 
        90 1 2 1 1 30 ILE H    . 30 ILE  HN   1 2 
        91 1 1 1 1 26 SER HA   . 26 SER  HA   1 2 
        91 1 2 1 1 30 ILE H    . 30 ILE  HN   1 2 
        92 1 1 1 1 29 ILE HA   . 29 ILE  HA   1 2 
        92 1 2 1 1 32 MET H    . 32 MET  HN   1 2 
        93 1 1 1 1 31 HIS HB3  . 31 HIS  HB3  1 2 
        93 1 2 1 1 32 MET H    . 32 MET  HN   1 2 
        94 1 1 1 1 32 MET H    . 32 MET  HN   1 2 
        94 1 2 1 1 32 MET HG2  . 32 MET  HG2  1 2 
        95 1 1 1 1 30 ILE H    . 30 ILE  HN   1 2 
        95 1 2 1 1 31 HIS HB3  . 31 HIS  HB3  1 2 
        96 1 1 1 1 32 MET H    . 32 MET  HN   1 2 
        96 1 2 1 1 32 MET HB2  . 32 MET  HB2  1 2 
        97 1 1 1 1 29 ILE HB   . 29 ILE  HB   1 2 
        97 1 2 1 1 32 MET H    . 32 MET  HN   1 2 
        98 1 1 1 1 30 ILE H    . 30 ILE  HN   1 2 
        98 1 2 1 1 30 ILE HG13 . 30 ILE  HG13 1 2 
        99 1 1 1 1 30 ILE H    . 30 ILE  HN   1 2 
        99 1 2 1 1 30 ILE HG12 . 30 ILE  HG12 1 2 
       100 1 1 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       100 1 2 1 1 32 MET H    . 32 MET  HN   1 2 
       101 1 1 1 1 29 ILE MG   . 29 ILE  QG2  1 2 
       101 1 2 1 1 32 MET H    . 32 MET  HN   1 2 
       102 1 1 1 1 30 ILE MG   . 30 ILE  QG2  1 2 
       102 1 2 1 1 32 MET H    . 32 MET  HN   1 2 
       103 1 1 1 1 29 ILE MG   . 29 ILE  QG2  1 2 
       103 1 2 1 1 30 ILE H    . 30 ILE  HN   1 2 
       104 1 1 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       104 1 2 1 1 32 MET H    . 32 MET  HN   1 2 
       105 1 1 1 1 29 ILE HB   . 29 ILE  HB   1 2 
       105 1 2 1 1 30 ILE H    . 30 ILE  HN   1 2 
       106 1 1 1 1 22 PHE HB3  . 22 PHE  HB3  1 2 
       106 1 2 1 1 27 TYR H    . 27 TYR  HN   1 2 
       107 1 1 1 1 27 TYR H    . 27 TYR  HN   1 2 
       107 1 2 1 1 30 ILE HG13 . 30 ILE  HG13 1 2 
       108 1 1 1 1 27 TYR H    . 27 TYR  HN   1 2 
       108 1 2 1 1 29 ILE H    . 29 ILE  HN   1 2 
       109 1 1 1 1 24 SER HB2  . 24 SER  HB2  1 2 
       109 1 2 1 1 27 TYR H    . 27 TYR  HN   1 2 
       110 1 1 1 1 26 SER QB   . 26 SER  QB   1 2 
       110 1 2 1 1 27 TYR H    . 27 TYR  HN   1 2 
       111 1 1 1 1 27 TYR H    . 27 TYR  HN   1 2 
       111 1 2 1 1 27 TYR HB2  . 27 TYR  HB2  1 2 
       112 1 1 1 1 27 TYR H    . 27 TYR  HN   1 2 
       112 1 2 1 1 27 TYR HB3  . 27 TYR  HB3  1 2 
       113 1 1 1 1 33 ARG H    . 33 ARG  HN   1 2 
       113 1 2 1 1 33 ARG HG3  . 33 ARG  HG3  1 2 
       114 1 1 1 1 33 ARG H    . 33 ARG  HN   1 2 
       114 1 2 1 1 34 THR H    . 34 THR  HN   1 2 
       115 1 1 1 1 34 THR H    . 34 THR  HN   1 2 
       115 1 2 1 1 35 HIS H    . 35 HIS  HN   1 2 
       116 1 1 1 1 32 MET HA   . 32 MET  HA   1 2 
       116 1 2 1 1 35 HIS H    . 35 HIS  HN   1 2 
       117 1 1 1 1 35 HIS H    . 35 HIS  HN   1 2 
       117 1 2 1 1 35 HIS HB3  . 35 HIS  HB3  1 2 
       118 1 1 1 1 33 ARG H    . 33 ARG  HN   1 2 
       118 1 2 1 1 33 ARG QD   . 33 ARG  QD   1 2 
       119 1 1 1 1 35 HIS H    . 35 HIS  HN   1 2 
       119 1 2 1 1 35 HIS HB2  . 35 HIS  HB2  1 2 
       120 1 1 1 1 32 MET HB3  . 32 MET  HB3  1 2 
       120 1 2 1 1 35 HIS H    . 35 HIS  HN   1 2 
       121 1 1 1 1 32 MET ME   . 32 MET  QE   1 2 
       121 1 2 1 1 35 HIS H    . 35 HIS  HN   1 2 
       122 1 1 1 1 32 MET HB2  . 32 MET  HB2  1 2 
       122 1 2 1 1 33 ARG H    . 33 ARG  HN   1 2 
       123 1 1 1 1 33 ARG H    . 33 ARG  HN   1 2 
       123 1 2 1 1 33 ARG HB2  . 33 ARG  HB2  1 2 
       124 1 1 1 1 34 THR MG   . 34 THR  QG2  1 2 
       124 1 2 1 1 35 HIS H    . 35 HIS  HN   1 2 
       125 1 1 1 1 35 HIS H    . 35 HIS  HN   1 2 
       125 1 2 1 1 35 HIS HD2  . 35 HIS  HD2  1 2 
       126 1 1 1 1 30 ILE HA   . 30 ILE  HA   1 2 
       126 1 2 1 1 33 ARG H    . 33 ARG  HN   1 2 
       127 1 1 1 1 13 TYR H    . 13 TYR  HN   1 2 
       127 1 2 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       128 1 1 1 1 13 TYR H    . 13 TYR  HN   1 2 
       128 1 2 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       129 1 1 1 1 11 LYS HA   . 11 LYS  HA   1 2 
       129 1 2 1 1 13 TYR H    . 13 TYR  HN   1 2 
       130 1 1 1 1 13 TYR H    . 13 TYR  HN   1 2 
       130 1 2 1 1 13 TYR HB3  . 13 TYR  HB3  1 2 
       131 1 1 1 1 12 PRO HB2  . 12 PRO  HB2  1 2 
       131 1 2 1 1 13 TYR H    . 13 TYR  HN   1 2 
       132 1 1 1 1 12 PRO HB3  . 12 PRO  HB3  1 2 
       132 1 2 1 1 13 TYR H    . 13 TYR  HN   1 2 
       133 1 1 1 1 22 PHE H    . 22 PHE  HN   1 2 
       133 1 2 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       134 1 1 1 1 22 PHE H    . 22 PHE  HN   1 2 
       134 1 2 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       135 1 1 1 1 21 ALA HA   . 21 ALA  HA   1 2 
       135 1 2 1 1 22 PHE H    . 22 PHE  HN   1 2 
       136 1 1 1 1 22 PHE H    . 22 PHE  HN   1 2 
       136 1 2 1 1 22 PHE HB3  . 22 PHE  HB3  1 2 
       137 1 1 1 1 22 PHE H    . 22 PHE  HN   1 2 
       137 1 2 1 1 22 PHE HB2  . 22 PHE  HB2  1 2 
       138 1 1 1 1 21 ALA MB   . 21 ALA  QB   1 2 
       138 1 2 1 1 22 PHE H    . 22 PHE  HN   1 2 
       139 1 1 1 1 17 GLU HG2  . 17 GLU  HG2  1 2 
       139 1 2 1 1 18 CYS H    . 18 CYSS HN   1 2 
       140 1 1 1 1 17 GLU HG3  . 17 GLU  HG3  1 2 
       140 1 2 1 1 18 CYS H    . 18 CYSS HN   1 2 
       141 1 1 1 1 17 GLU H    . 17 GLU  HN   1 2 
       141 1 2 1 1 18 CYS H    . 18 CYSS HN   1 2 
       142 1 1 1 1 18 CYS H    . 18 CYSS HN   1 2 
       142 1 2 1 1 19 GLY H    . 19 GLY  HN   1 2 
       143 1 1 1 1 18 CYS H    . 18 CYSS HN   1 2 
       143 1 2 1 1 19 GLY HA2  . 19 GLY  HA1  1 2 
       144 1 1 1 1 18 CYS H    . 18 CYSS HN   1 2 
       144 1 2 1 1 18 CYS HB3  . 18 CYSS HB3  1 2 
       145 1 1 1 1 18 CYS H    . 18 CYSS HN   1 2 
       145 1 2 1 1 18 CYS HB2  . 18 CYSS HB2  1 2 
       146 1 1 1 1 17 GLU HB2  . 17 GLU  HB2  1 2 
       146 1 2 1 1 18 CYS H    . 18 CYSS HN   1 2 
       147 1 1 1 1 17 GLU HB3  . 17 GLU  HB3  1 2 
       147 1 2 1 1 18 CYS H    . 18 CYSS HN   1 2 
       148 1 1 1 1 27 TYR H    . 27 TYR  HN   1 2 
       148 1 2 1 1 30 ILE MD   . 30 ILE  QD1  1 2 
       149 1 1 1 1 33 ARG H    . 33 ARG  HN   1 2 
       149 1 2 1 1 34 THR MG   . 34 THR  QG2  1 2 
       150 1 1 1 1 29 ILE MG   . 29 ILE  QG2  1 2 
       150 1 2 1 1 33 ARG H    . 33 ARG  HN   1 2 
       151 1 1 1 1 30 ILE MG   . 30 ILE  QG2  1 2 
       151 1 2 1 1 33 ARG H    . 33 ARG  HN   1 2 
       152 1 1 1 1 33 ARG H    . 33 ARG  HN   1 2 
       152 1 2 1 1 33 ARG HB3  . 33 ARG  HB3  1 2 
       153 1 1 1 1 13 TYR H    . 13 TYR  HN   1 2 
       153 1 2 1 1 13 TYR HB2  . 13 TYR  HB2  1 2 
       154 1 1 1 1 13 TYR HB2  . 13 TYR  HB2  1 2 
       154 1 2 1 1 14 GLY H    . 14 GLY  HN   1 2 
       155 1 1 1 1 25 LYS HG2  . 25 LYS  HG2  1 2 
       155 1 2 1 1 29 ILE MD   . 29 ILE  QD1  1 2 
       156 1 1 1 1 15 CYS HB3  . 15 CYSS HB3  1 2 
       156 1 2 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       157 1 1 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       157 1 2 1 1 31 HIS HB3  . 31 HIS  HB3  1 2 
       158 1 1 1 1 20 LYS QD   . 20 LYS  QD   1 2 
       158 1 2 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       159 1 1 1 1 20 LYS HB2  . 20 LYS  HB2  1 2 
       159 1 2 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       160 1 1 1 1 20 LYS HB3  . 20 LYS  HB3  1 2 
       160 1 2 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       161 1 1 1 1 25 LYS HG3  . 25 LYS  HG3  1 2 
       161 1 2 1 1 29 ILE MD   . 29 ILE  QD1  1 2 
       162 1 1 1 1 39 LYS HA   . 39 LYS  HA   1 2 
       162 1 2 1 1 40 PRO HD2  . 40 PRO  HD2  1 2 
       163 1 1 1 1 39 LYS HA   . 39 LYS  HA   1 2 
       163 1 2 1 1 40 PRO HD3  . 40 PRO  HD3  1 2 
       164 1 1 1 1 11 LYS HA   . 11 LYS  HA   1 2 
       164 1 2 1 1 12 PRO HD2  . 12 PRO  HD2  1 2 
       165 1 1 1 1 11 LYS HA   . 11 LYS  HA   1 2 
       165 1 2 1 1 12 PRO HD3  . 12 PRO  HD3  1 2 
       166 1 1 1 1 42 GLY HA2  . 42 GLY  HA1  1 2 
       166 1 2 1 1 43 PRO QD   . 43 PRO  QD   1 2 
       167 1 1 1 1 22 PHE HZ   . 22 PHE  HZ   1 2 
       167 1 2 1 1 31 HIS HE1  . 31 HIS  HE1  1 2 
       168 1 1 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       168 1 2 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       169 1 1 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       169 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       170 1 1 1 1 15 CYS HA   . 15 CYSS HA   1 2 
       170 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       171 1 1 1 1 28 LEU HA   . 28 LEU  HA   1 2 
       171 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       172 1 1 1 1 22 PHE HZ   . 22 PHE  HZ   1 2 
       172 1 2 1 1 31 HIS HB3  . 31 HIS  HB3  1 2 
       173 1 1 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       173 1 2 1 1 31 HIS HB3  . 31 HIS  HB3  1 2 
       174 1 1 1 1 15 CYS HB2  . 15 CYSS HB2  1 2 
       174 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       175 1 1 1 1 22 PHE HZ   . 22 PHE  HZ   1 2 
       175 1 2 1 1 31 HIS HB2  . 31 HIS  HB2  1 2 
       176 1 1 1 1 20 LYS QD   . 20 LYS  QD   1 2 
       176 1 2 1 1 22 PHE HZ   . 22 PHE  HZ   1 2 
       177 1 1 1 1 20 LYS HB3  . 20 LYS  HB3  1 2 
       177 1 2 1 1 22 PHE HZ   . 22 PHE  HZ   1 2 
       178 1 1 1 1 21 ALA MB   . 21 ALA  QB   1 2 
       178 1 2 1 1 22 PHE HB2  . 22 PHE  HB2  1 2 
       179 1 1 1 1 20 LYS HA   . 20 LYS  HA   1 2 
       179 1 2 1 1 21 ALA MB   . 21 ALA  QB   1 2 
       180 1 1 1 1 31 HIS HB3  . 31 HIS  HB3  1 2 
       180 1 2 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       181 1 1 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       181 1 2 1 1 32 MET ME   . 32 MET  QE   1 2 
       182 1 1 1 1 35 HIS HB2  . 35 HIS  HB2  1 2 
       182 1 2 1 1 35 HIS HD2  . 35 HIS  HD2  1 2 
       183 1 1 1 1 17 GLU HG2  . 17 GLU  HG2  1 2 
       183 1 2 1 1 35 HIS HD2  . 35 HIS  HD2  1 2 
       184 1 1 1 1 17 GLU HG3  . 17 GLU  HG3  1 2 
       184 1 2 1 1 35 HIS HD2  . 35 HIS  HD2  1 2 
       185 1 1 1 1 17 GLU HB2  . 17 GLU  HB2  1 2 
       185 1 2 1 1 35 HIS HD2  . 35 HIS  HD2  1 2 
       186 1 1 1 1 17 GLU HB3  . 17 GLU  HB3  1 2 
       186 1 2 1 1 35 HIS HD2  . 35 HIS  HD2  1 2 
       187 1 1 1 1 34 THR HA   . 34 THR  HA   1 2 
       187 1 2 1 1 34 THR MG   . 34 THR  QG2  1 2 
       188 1 1 1 1 18 CYS H    . 18 CYSS HN   1 2 
       188 1 2 1 1 19 GLY HA3  . 19 GLY  HA2  1 2 
       189 1 1 1 1 42 GLY HA3  . 42 GLY  HA2  1 2 
       189 1 2 1 1 43 PRO QD   . 43 PRO  QD   1 2 
       190 1 1 1 1 22 PHE HB3  . 22 PHE  HB3  1 2 
       190 1 2 1 1 28 LEU HB2  . 28 LEU  HB2  1 2 
       191 1 1 1 1 22 PHE HB3  . 22 PHE  HB3  1 2 
       191 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       192 1 1 1 1 22 PHE HB2  . 22 PHE  HB2  1 2 
       192 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       193 1 1 1 1 22 PHE HB2  . 22 PHE  HB2  1 2 
       193 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       194 1 1 1 1 22 PHE HB3  . 22 PHE  HB3  1 2 
       194 1 2 1 1 27 TYR HB2  . 27 TYR  HB2  1 2 
       195 1 1 1 1 27 TYR QD   . 27 TYR  QD   1 2 
       195 1 2 1 1 30 ILE MG   . 30 ILE  QG2  1 2 
       196 1 1 1 1 33 ARG HA   . 33 ARG  HA   1 2 
       196 1 2 1 1 33 ARG QD   . 33 ARG  QD   1 2 
       197 1 1 1 1 29 ILE MG   . 29 ILE  QG2  1 2 
       197 1 2 1 1 33 ARG QD   . 33 ARG  QD   1 2 
       198 1 1 1 1 30 ILE MG   . 30 ILE  QG2  1 2 
       198 1 2 1 1 33 ARG QD   . 33 ARG  QD   1 2 
       199 1 1 1 1 27 TYR HA   . 27 TYR  HA   1 2 
       199 1 2 1 1 30 ILE MG   . 30 ILE  QG2  1 2 
       200 1 1 1 1 26 SER HA   . 26 SER  HA   1 2 
       200 1 2 1 1 29 ILE MG   . 29 ILE  QG2  1 2 
       201 1 1 1 1 29 ILE MG   . 29 ILE  QG2  1 2 
       201 1 2 1 1 32 MET HB2  . 32 MET  HB2  1 2 
       202 1 1 1 1 17 GLU H    . 17 GLU  HN   1 2 
       202 1 2 1 1 32 MET ME   . 32 MET  QE   1 2 
       203 1 1 1 1 32 MET ME   . 32 MET  QE   1 2 
       203 1 2 1 1 35 HIS HD2  . 35 HIS  HD2  1 2 
       204 1 1 1 1 32 MET HA   . 32 MET  HA   1 2 
       204 1 2 1 1 32 MET ME   . 32 MET  QE   1 2 
       205 1 1 1 1 32 MET ME   . 32 MET  QE   1 2 
       205 1 2 1 1 35 HIS HB3  . 35 HIS  HB3  1 2 
       206 1 1 1 1 17 GLU HG2  . 17 GLU  HG2  1 2 
       206 1 2 1 1 32 MET ME   . 32 MET  QE   1 2 
       207 1 1 1 1 17 GLU HG3  . 17 GLU  HG3  1 2 
       207 1 2 1 1 32 MET ME   . 32 MET  QE   1 2 
       208 1 1 1 1 28 LEU HG   . 28 LEU  HG   1 2 
       208 1 2 1 1 32 MET ME   . 32 MET  QE   1 2 
       209 1 1 1 1 17 GLU HB2  . 17 GLU  HB2  1 2 
       209 1 2 1 1 32 MET ME   . 32 MET  QE   1 2 
       210 1 1 1 1 17 GLU HB3  . 17 GLU  HB3  1 2 
       210 1 2 1 1 32 MET ME   . 32 MET  QE   1 2 
       211 1 1 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       211 1 2 1 1 32 MET ME   . 32 MET  QE   1 2 
       212 1 1 1 1 13 TYR HB3  . 13 TYR  HB3  1 2 
       212 1 2 1 1 28 LEU HB3  . 28 LEU  HB3  1 2 
       213 1 1 1 1 22 PHE HB2  . 22 PHE  HB2  1 2 
       213 1 2 1 1 28 LEU HB3  . 28 LEU  HB3  1 2 
       214 1 1 1 1 22 PHE HB2  . 22 PHE  HB2  1 2 
       214 1 2 1 1 28 LEU HB2  . 28 LEU  HB2  1 2 
       215 1 1 1 1 28 LEU HB3  . 28 LEU  HB3  1 2 
       215 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       216 1 1 1 1 28 LEU HB2  . 28 LEU  HB2  1 2 
       216 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       217 1 1 1 1 24 SER HB3  . 24 SER  HB3  1 2 
       217 1 2 1 1 27 TYR H    . 27 TYR  HN   1 2 
       218 1 1 1 1 30 ILE MD   . 30 ILE  QD1  1 2 
       218 1 2 1 1 31 HIS H    . 31 HIS  HN   1 2 
       219 1 1 1 1 30 ILE H    . 30 ILE  HN   1 2 
       219 1 2 1 1 30 ILE MD   . 30 ILE  QD1  1 2 
       220 1 1 1 1 27 TYR HA   . 27 TYR  HA   1 2 
       220 1 2 1 1 30 ILE MD   . 30 ILE  QD1  1 2 
       221 1 1 1 1 29 ILE H    . 29 ILE  HN   1 2 
       221 1 2 1 1 29 ILE MD   . 29 ILE  QD1  1 2 
       222 1 1 1 1 26 SER HA   . 26 SER  HA   1 2 
       222 1 2 1 1 29 ILE MD   . 29 ILE  QD1  1 2 
       223 1 1 1 1 29 ILE HA   . 29 ILE  HA   1 2 
       223 1 2 1 1 29 ILE MD   . 29 ILE  QD1  1 2 
       224 1 1 1 1 30 ILE HA   . 30 ILE  HA   1 2 
       224 1 2 1 1 30 ILE MD   . 30 ILE  QD1  1 2 
       225 1 1 1 1 25 LYS QE   . 25 LYS  QE   1 2 
       225 1 2 1 1 29 ILE MD   . 29 ILE  QD1  1 2 
       226 1 1 1 1 29 ILE HB   . 29 ILE  HB   1 2 
       226 1 2 1 1 29 ILE MD   . 29 ILE  QD1  1 2 
       227 1 1 1 1 25 LYS QD   . 25 LYS  QD   1 2 
       227 1 2 1 1 29 ILE MD   . 29 ILE  QD1  1 2 
       228 1 1 1 1 27 TYR HA   . 27 TYR  HA   1 2 
       228 1 2 1 1 27 TYR QE   . 27 TYR  QE   1 2 
       229 1 1 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       229 1 2 1 1 25 LYS QE   . 25 LYS  QE   1 2 
       230 1 1 1 1 27 TYR QE   . 27 TYR  QE   1 2 
       230 1 2 1 1 30 ILE MD   . 30 ILE  QD1  1 2 
       231 1 1 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       231 1 2 1 1 24 SER HA   . 24 SER  HA   1 2 
       232 1 1 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       232 1 2 1 1 25 LYS HA   . 25 LYS  HA   1 2 
       233 1 1 1 1 29 ILE HA   . 29 ILE  HA   1 2 
       233 1 2 1 1 32 MET HG2  . 32 MET  HG2  1 2 
       234 1 1 1 1 29 ILE HA   . 29 ILE  HA   1 2 
       234 1 2 1 1 32 MET HG3  . 32 MET  HG3  1 2 
       235 1 1 1 1 29 ILE HA   . 29 ILE  HA   1 2 
       235 1 2 1 1 32 MET HB2  . 32 MET  HB2  1 2 
       236 1 1 1 1 28 LEU HG   . 28 LEU  HG   1 2 
       236 1 2 1 1 29 ILE HA   . 29 ILE  HA   1 2 
       237 1 1 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       237 1 2 1 1 25 LYS QD   . 25 LYS  QD   1 2 
       238 1 1 1 1 29 ILE HA   . 29 ILE  HA   1 2 
       238 1 2 1 1 29 ILE HG12 . 29 ILE  HG12 1 2 
       239 1 1 1 1 29 ILE HA   . 29 ILE  HA   1 2 
       239 1 2 1 1 29 ILE MG   . 29 ILE  QG2  1 2 
       240 1 1 1 1 30 ILE HA   . 30 ILE  HA   1 2 
       240 1 2 1 1 33 ARG QD   . 33 ARG  QD   1 2 
       241 1 1 1 1 30 ILE HA   . 30 ILE  HA   1 2 
       241 1 2 1 1 30 ILE HG12 . 30 ILE  HG12 1 2 
       242 1 1 1 1 30 ILE HA   . 30 ILE  HA   1 2 
       242 1 2 1 1 30 ILE MG   . 30 ILE  QG2  1 2 
       243 1 1 1 1 30 ILE H    . 30 ILE  HN   1 2 
       243 1 2 1 1 30 ILE HB   . 30 ILE  HB   1 2 
       244 1 1 1 1 13 TYR HB2  . 13 TYR  HB2  1 2 
       244 1 2 1 1 22 PHE H    . 22 PHE  HN   1 2 
       245 1 1 1 1 13 TYR HB2  . 13 TYR  HB2  1 2 
       245 1 2 1 1 28 LEU HB3  . 28 LEU  HB3  1 2 
       246 1 1 1 1 13 TYR HB3  . 13 TYR  HB3  1 2 
       246 1 2 1 1 28 LEU HG   . 28 LEU  HG   1 2 
       247 1 1 1 1 13 TYR HB3  . 13 TYR  HB3  1 2 
       247 1 2 1 1 28 LEU HB2  . 28 LEU  HB2  1 2 
       248 1 1 1 1 13 TYR HB2  . 13 TYR  HB2  1 2 
       248 1 2 1 1 28 LEU HB2  . 28 LEU  HB2  1 2 
       249 1 1 1 1 13 TYR HB2  . 13 TYR  HB2  1 2 
       249 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       250 1 1 1 1 22 PHE HB3  . 22 PHE  HB3  1 2 
       250 1 2 1 1 27 TYR HB3  . 27 TYR  HB3  1 2 
       251 1 1 1 1 17 GLU H    . 17 GLU  HN   1 2 
       251 1 2 1 1 17 GLU HG2  . 17 GLU  HG2  1 2 
       252 1 1 1 1 17 GLU H    . 17 GLU  HN   1 2 
       252 1 2 1 1 17 GLU HG3  . 17 GLU  HG3  1 2 
       253 1 1 1 1 26 SER QB   . 26 SER  QB   1 2 
       253 1 2 1 1 30 ILE MD   . 30 ILE  QD1  1 2 
       254 1 1 1 1 26 SER QB   . 26 SER  QB   1 2 
       254 1 2 1 1 29 ILE HB   . 29 ILE  HB   1 2 
       255 1 1 1 1 26 SER HA   . 26 SER  HA   1 2 
       255 1 2 1 1 29 ILE HB   . 29 ILE  HB   1 2 
       256 1 1 1 1 26 SER HA   . 26 SER  HA   1 2 
       256 1 2 1 1 29 ILE HG13 . 29 ILE  HG13 1 2 
       257 1 1 1 1 26 SER HA   . 26 SER  HA   1 2 
       257 1 2 1 1 29 ILE HG12 . 29 ILE  HG12 1 2 
       258 1 1 1 1 18 CYS HA   . 18 CYSS HA   1 2 
       258 1 2 1 1 35 HIS HE1  . 35 HIS  HE1  1 2 
       259 1 1 1 1 20 LYS HB2  . 20 LYS  HB2  1 2 
       259 1 2 1 1 21 ALA H    . 21 ALA  HN   1 2 
       260 1 1 1 1 20 LYS HB3  . 20 LYS  HB3  1 2 
       260 1 2 1 1 21 ALA H    . 21 ALA  HN   1 2 
       261 1 1 1 1 20 LYS HB2  . 20 LYS  HB2  1 2 
       261 1 2 1 1 22 PHE HZ   . 22 PHE  HZ   1 2 
       262 1 1 1 1 18 CYS HB3  . 18 CYSS HB3  1 2 
       262 1 2 1 1 35 HIS HE1  . 35 HIS  HE1  1 2 
       263 1 1 1 1 20 LYS QD   . 20 LYS  QD   1 2 
       263 1 2 1 1 31 HIS HE1  . 31 HIS  HE1  1 2 
       264 1 1 1 1 27 TYR HA   . 27 TYR  HA   1 2 
       264 1 2 1 1 30 ILE HB   . 30 ILE  HB   1 2 
       265 1 1 1 1 27 TYR HA   . 27 TYR  HA   1 2 
       265 1 2 1 1 30 ILE HG13 . 30 ILE  HG13 1 2 
       266 1 1 1 1 27 TYR HA   . 27 TYR  HA   1 2 
       266 1 2 1 1 30 ILE HG12 . 30 ILE  HG12 1 2 
       267 1 1 1 1 30 ILE MG   . 30 ILE  QG2  1 2 
       267 1 2 1 1 31 HIS HA   . 31 HIS  HA   1 2 
       268 1 1 1 1 18 CYS HB2  . 18 CYSS HB2  1 2 
       268 1 2 1 1 35 HIS HE1  . 35 HIS  HE1  1 2 
       269 1 1 1 1 33 ARG HA   . 33 ARG  HA   1 2 
       269 1 2 1 1 35 HIS H    . 35 HIS  HN   1 2 
       270 1 1 1 1 13 TYR HB3  . 13 TYR  HB3  1 2 
       270 1 2 1 1 25 LYS HA   . 25 LYS  HA   1 2 
       271 1 1 1 1 32 MET HB2  . 32 MET  HB2  1 2 
       271 1 2 1 1 33 ARG HA   . 33 ARG  HA   1 2 
       272 1 1 1 1 32 MET HB3  . 32 MET  HB3  1 2 
       272 1 2 1 1 33 ARG HA   . 33 ARG  HA   1 2 
       273 1 1 1 1 25 LYS HA   . 25 LYS  HA   1 2 
       273 1 2 1 1 28 LEU HB3  . 28 LEU  HB3  1 2 
       274 1 1 1 1 33 ARG HA   . 33 ARG  HA   1 2 
       274 1 2 1 1 33 ARG HG2  . 33 ARG  HG2  1 2 
       275 1 1 1 1 33 ARG HA   . 33 ARG  HA   1 2 
       275 1 2 1 1 33 ARG HG3  . 33 ARG  HG3  1 2 
       276 1 1 1 1 25 LYS HA   . 25 LYS  HA   1 2 
       276 1 2 1 1 28 LEU HB2  . 28 LEU  HB2  1 2 
       277 1 1 1 1 25 LYS HA   . 25 LYS  HA   1 2 
       277 1 2 1 1 25 LYS HG2  . 25 LYS  HG2  1 2 
       278 1 1 1 1 25 LYS HA   . 25 LYS  HA   1 2 
       278 1 2 1 1 25 LYS HG3  . 25 LYS  HG3  1 2 
       279 1 1 1 1 25 LYS HA   . 25 LYS  HA   1 2 
       279 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       280 1 1 1 1 32 MET H    . 32 MET  HN   1 2 
       280 1 2 1 1 32 MET HG3  . 32 MET  HG3  1 2 
       281 1 1 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       281 1 2 1 1 32 MET HA   . 32 MET  HA   1 2 
       282 1 1 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       282 1 2 1 1 32 MET HG2  . 32 MET  HG2  1 2 
       283 1 1 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       283 1 2 1 1 32 MET HG3  . 32 MET  HG3  1 2 
       284 1 1 1 1 32 MET HA   . 32 MET  HA   1 2 
       284 1 2 1 1 35 HIS HD2  . 35 HIS  HD2  1 2 
       285 1 1 1 1 32 MET HA   . 32 MET  HA   1 2 
       285 1 2 1 1 35 HIS HB2  . 35 HIS  HB2  1 2 
       286 1 1 1 1 28 LEU HG   . 28 LEU  HG   1 2 
       286 1 2 1 1 32 MET HG2  . 32 MET  HG2  1 2 
       287 1 1 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       287 1 2 1 1 32 MET HG2  . 32 MET  HG2  1 2 
       288 1 1 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       288 1 2 1 1 32 MET HG3  . 32 MET  HG3  1 2 
       289 1 1 1 1 28 LEU HA   . 28 LEU  HA   1 2 
       289 1 2 1 1 32 MET H    . 32 MET  HN   1 2 
       290 1 1 1 1 28 LEU HA   . 28 LEU  HA   1 2 
       290 1 2 1 1 31 HIS H    . 31 HIS  HN   1 2 
       291 1 1 1 1 28 LEU HA   . 28 LEU  HA   1 2 
       291 1 2 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       292 1 1 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       292 1 2 1 1 28 LEU HA   . 28 LEU  HA   1 2 
       293 1 1 1 1 28 LEU HA   . 28 LEU  HA   1 2 
       293 1 2 1 1 31 HIS HB3  . 31 HIS  HB3  1 2 
       294 1 1 1 1 28 LEU HA   . 28 LEU  HA   1 2 
       294 1 2 1 1 28 LEU HG   . 28 LEU  HG   1 2 
       295 1 1 1 1 20 LYS HA   . 20 LYS  HA   1 2 
       295 1 2 1 1 20 LYS HG2  . 20 LYS  HG2  1 2 
       296 1 1 1 1 20 LYS HA   . 20 LYS  HA   1 2 
       296 1 2 1 1 20 LYS QD   . 20 LYS  QD   1 2 
       297 1 1 1 1 20 LYS HA   . 20 LYS  HA   1 2 
       297 1 2 1 1 20 LYS HG3  . 20 LYS  HG3  1 2 
       298 1 1 1 1 32 MET H    . 32 MET  HN   1 2 
       298 1 2 1 1 32 MET HB3  . 32 MET  HB3  1 2 
       299 1 1 1 1 32 MET HB3  . 32 MET  HB3  1 2 
       299 1 2 1 1 33 ARG H    . 33 ARG  HN   1 2 
       300 1 1 1 1 29 ILE HA   . 29 ILE  HA   1 2 
       300 1 2 1 1 32 MET HB3  . 32 MET  HB3  1 2 
       301 1 1 1 1 15 CYS HB2  . 15 CYSS HB2  1 2 
       301 1 2 1 1 18 CYS H    . 18 CYSS HN   1 2 
       302 1 1 1 1 15 CYS HB3  . 15 CYSS HB3  1 2 
       302 1 2 1 1 18 CYS H    . 18 CYSS HN   1 2 
       303 1 1 1 1 15 CYS HB2  . 15 CYSS HB2  1 2 
       303 1 2 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       304 1 1 1 1 15 CYS HB3  . 15 CYSS HB3  1 2 
       304 1 2 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       305 1 1 1 1 15 CYS HB2  . 15 CYSS HB2  1 2 
       305 1 2 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       306 1 1 1 1 15 CYS HB2  . 15 CYSS HB2  1 2 
       306 1 2 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       307 1 1 1 1 15 CYS HB3  . 15 CYSS HB3  1 2 
       307 1 2 1 1 20 LYS HB2  . 20 LYS  HB2  1 2 
       308 1 1 1 1 15 CYS HB3  . 15 CYSS HB3  1 2 
       308 1 2 1 1 20 LYS HB3  . 20 LYS  HB3  1 2 
       309 1 1 1 1 15 CYS HB3  . 15 CYSS HB3  1 2 
       309 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       310 1 1 1 1 29 ILE H    . 29 ILE  HN   1 2 
       310 1 2 1 1 29 ILE HG13 . 29 ILE  HG13 1 2 
       311 1 1 1 1 29 ILE HA   . 29 ILE  HA   1 2 
       311 1 2 1 1 29 ILE HG13 . 29 ILE  HG13 1 2 
       312 1 1 1 1 30 ILE HA   . 30 ILE  HA   1 2 
       312 1 2 1 1 30 ILE HG13 . 30 ILE  HG13 1 2 
       313 1 1 1 1 17 GLU HG2  . 17 GLU  HG2  1 2 
       313 1 2 1 1 35 HIS HB3  . 35 HIS  HB3  1 2 
       314 1 1 1 1 17 GLU HG3  . 17 GLU  HG3  1 2 
       314 1 2 1 1 35 HIS HB3  . 35 HIS  HB3  1 2 
       315 1 1 1 1 17 GLU HG2  . 17 GLU  HG2  1 2 
       315 1 2 1 1 35 HIS HB2  . 35 HIS  HB2  1 2 
       316 1 1 1 1 17 GLU HG3  . 17 GLU  HG3  1 2 
       316 1 2 1 1 35 HIS HB2  . 35 HIS  HB2  1 2 
       317 1 1 1 1 32 MET HB3  . 32 MET  HB3  1 2 
       317 1 2 1 1 35 HIS HB2  . 35 HIS  HB2  1 2 
       318 1 1 1 1 32 MET ME   . 32 MET  QE   1 2 
       318 1 2 1 1 35 HIS HB2  . 35 HIS  HB2  1 2 
       319 1 1 1 1 31 HIS HB2  . 31 HIS  HB2  1 2 
       319 1 2 1 1 32 MET H    . 32 MET  HN   1 2 
       320 1 1 1 1 30 ILE H    . 30 ILE  HN   1 2 
       320 1 2 1 1 31 HIS HB2  . 31 HIS  HB2  1 2 
       321 1 1 1 1 31 HIS HB2  . 31 HIS  HB2  1 2 
       321 1 2 1 1 33 ARG H    . 33 ARG  HN   1 2 
       322 1 1 1 1 31 HIS HB3  . 31 HIS  HB3  1 2 
       322 1 2 1 1 33 ARG H    . 33 ARG  HN   1 2 
       323 1 1 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       323 1 2 1 1 31 HIS HB2  . 31 HIS  HB2  1 2 
       324 1 1 1 1 28 LEU HA   . 28 LEU  HA   1 2 
       324 1 2 1 1 31 HIS HB2  . 31 HIS  HB2  1 2 
       325 1 1 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       325 1 2 1 1 31 HIS HB2  . 31 HIS  HB2  1 2 
       326 1 1 1 1 33 ARG H    . 33 ARG  HN   1 2 
       326 1 2 1 1 33 ARG HG2  . 33 ARG  HG2  1 2 
       327 1 1 1 1 28 LEU H    . 28 LEU  HN   1 2 
       327 1 2 1 1 28 LEU HG   . 28 LEU  HG   1 2 
       328 1 1 1 1 28 LEU HG   . 28 LEU  HG   1 2 
       328 1 2 1 1 32 MET HG3  . 32 MET  HG3  1 2 
       329 1 1 1 1 13 TYR HA   . 13 TYR  HA   1 2 
       329 1 2 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       330 1 1 1 1 12 PRO HA   . 12 PRO  HA   1 2 
       330 1 2 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       331 1 1 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       331 1 2 1 1 25 LYS HA   . 25 LYS  HA   1 2 
       332 1 1 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       332 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       333 1 1 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       333 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       334 1 1 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       334 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       335 1 1 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       335 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       336 1 1 1 1 13 TYR HA   . 13 TYR  HA   1 2 
       336 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       337 1 1 1 1 28 LEU HA   . 28 LEU  HA   1 2 
       337 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       338 1 1 1 1 13 TYR HB3  . 13 TYR  HB3  1 2 
       338 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       339 1 1 1 1 20 LYS H    . 20 LYS  HN   1 2 
       339 1 2 1 1 20 LYS HG3  . 20 LYS  HG3  1 2 
       340 1 1 1 1 20 LYS HG3  . 20 LYS  HG3  1 2 
       340 1 2 1 1 21 ALA H    . 21 ALA  HN   1 2 
       341 1 1 1 1 21 ALA HA   . 21 ALA  HA   1 2 
       341 1 2 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       342 1 1 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       342 1 2 1 1 28 LEU HB2  . 28 LEU  HB2  1 2 
       343 1 1 1 1 21 ALA MB   . 21 ALA  QB   1 2 
       343 1 2 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       344 1 1 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       344 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       345 1 1 1 1 27 TYR HA   . 27 TYR  HA   1 2 
       345 1 2 1 1 27 TYR QD   . 27 TYR  QD   1 2 
       346 1 1 1 1 27 TYR QD   . 27 TYR  QD   1 2 
       346 1 2 1 1 30 ILE HB   . 30 ILE  HB   1 2 
       347 1 1 1 1 27 TYR QD   . 27 TYR  QD   1 2 
       347 1 2 1 1 30 ILE MD   . 30 ILE  QD1  1 2 
       348 1 1 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       348 1 2 1 1 22 PHE H    . 22 PHE  HN   1 2 
       349 1 1 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       349 1 2 1 1 28 LEU HB3  . 28 LEU  HB3  1 2 
       350 1 1 1 1 10 GLU H    . 10 GLU  HN   1 2 
       350 1 2 1 1 10 GLU QB   . 10 GLU  QB   1 2 
       351 1 1 1 1 10 GLU H    . 10 GLU  HN   1 2 
       351 1 2 1 1 10 GLU QG   . 10 GLU  QG   1 2 
       352 1 1 1 1 11 LYS H    . 11 LYS  HN   1 2 
       352 1 2 1 1 12 PRO QD   . 12 PRO  QD   1 2 
       353 1 1 1 1 11 LYS HA   . 11 LYS  HA   1 2 
       353 1 2 1 1 12 PRO QD   . 12 PRO  QD   1 2 
       354 1 1 1 1 11 LYS QB   . 11 LYS  QB   1 2 
       354 1 2 1 1 12 PRO QD   . 12 PRO  QD   1 2 
       355 1 1 1 1 11 LYS QB   . 11 LYS  QB   1 2 
       355 1 2 1 1 13 TYR H    . 13 TYR  HN   1 2 
       356 1 1 1 1 11 LYS QB   . 11 LYS  QB   1 2 
       356 1 2 1 1 13 TYR HB2  . 13 TYR  HB2  1 2 
       357 1 1 1 1 11 LYS QB   . 11 LYS  QB   1 2 
       357 1 2 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       358 1 1 1 1 12 PRO QB   . 12 PRO  QB   1 2 
       358 1 2 1 1 13 TYR H    . 13 TYR  HN   1 2 
       359 1 1 1 1 12 PRO QB   . 12 PRO  QB   1 2 
       359 1 2 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       360 1 1 1 1 12 PRO QG   . 12 PRO  QG   1 2 
       360 1 2 1 1 13 TYR H    . 13 TYR  HN   1 2 
       361 1 1 1 1 12 PRO QG   . 12 PRO  QG   1 2 
       361 1 2 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       362 1 1 1 1 12 PRO QG   . 12 PRO  QG   1 2 
       362 1 2 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       363 1 1 1 1 12 PRO QD   . 12 PRO  QD   1 2 
       363 1 2 1 1 13 TYR H    . 13 TYR  HN   1 2 
       364 1 1 1 1 12 PRO QD   . 12 PRO  QD   1 2 
       364 1 2 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       365 1 1 1 1 12 PRO QD   . 12 PRO  QD   1 2 
       365 1 2 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       366 1 1 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       366 1 2 1 1 25 LYS QB   . 25 LYS  QB   1 2 
       367 1 1 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       367 1 2 1 1 24 SER QB   . 24 SER  QB   1 2 
       368 1 1 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       368 1 2 1 1 25 LYS QB   . 25 LYS  QB   1 2 
       369 1 1 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       369 1 2 1 1 25 LYS QG   . 25 LYS  QG   1 2 
       370 1 1 1 1 14 GLY QA   . 14 GLY  QA   1 2 
       370 1 2 1 1 15 CYS H    . 15 CYSS HN   1 2 
       371 1 1 1 1 14 GLY QA   . 14 GLY  QA   1 2 
       371 1 2 1 1 21 ALA HA   . 21 ALA  HA   1 2 
       372 1 1 1 1 14 GLY QA   . 14 GLY  QA   1 2 
       372 1 2 1 1 21 ALA MB   . 21 ALA  QB   1 2 
       373 1 1 1 1 14 GLY QA   . 14 GLY  QA   1 2 
       373 1 2 1 1 22 PHE H    . 22 PHE  HN   1 2 
       374 1 1 1 1 16 SER QB   . 16 SER  QB   1 2 
       374 1 2 1 1 17 GLU H    . 17 GLU  HN   1 2 
       375 1 1 1 1 17 GLU H    . 17 GLU  HN   1 2 
       375 1 2 1 1 17 GLU QB   . 17 GLU  QB   1 2 
       376 1 1 1 1 17 GLU H    . 17 GLU  HN   1 2 
       376 1 2 1 1 17 GLU QG   . 17 GLU  QG   1 2 
       377 1 1 1 1 17 GLU HA   . 17 GLU  HA   1 2 
       377 1 2 1 1 17 GLU QG   . 17 GLU  QG   1 2 
       378 1 1 1 1 17 GLU QB   . 17 GLU  QB   1 2 
       378 1 2 1 1 18 CYS H    . 18 CYSS HN   1 2 
       379 1 1 1 1 17 GLU QB   . 17 GLU  QB   1 2 
       379 1 2 1 1 18 CYS QB   . 18 CYSS QB   1 2 
       380 1 1 1 1 17 GLU QB   . 17 GLU  QB   1 2 
       380 1 2 1 1 19 GLY H    . 19 GLY  HN   1 2 
       381 1 1 1 1 17 GLU QB   . 17 GLU  QB   1 2 
       381 1 2 1 1 32 MET ME   . 32 MET  QE   1 2 
       382 1 1 1 1 17 GLU QB   . 17 GLU  QB   1 2 
       382 1 2 1 1 35 HIS HD2  . 35 HIS  HD2  1 2 
       383 1 1 1 1 17 GLU QG   . 17 GLU  QG   1 2 
       383 1 2 1 1 18 CYS H    . 18 CYSS HN   1 2 
       384 1 1 1 1 17 GLU QG   . 17 GLU  QG   1 2 
       384 1 2 1 1 32 MET ME   . 32 MET  QE   1 2 
       385 1 1 1 1 17 GLU QG   . 17 GLU  QG   1 2 
       385 1 2 1 1 35 HIS HB3  . 35 HIS  HB3  1 2 
       386 1 1 1 1 18 CYS H    . 18 CYSS HN   1 2 
       386 1 2 1 1 18 CYS QB   . 18 CYSS QB   1 2 
       387 1 1 1 1 18 CYS H    . 18 CYSS HN   1 2 
       387 1 2 1 1 19 GLY QA   . 19 GLY  QA   1 2 
       388 1 1 1 1 18 CYS QB   . 18 CYSS QB   1 2 
       388 1 2 1 1 19 GLY H    . 19 GLY  HN   1 2 
       389 1 1 1 1 18 CYS QB   . 18 CYSS QB   1 2 
       389 1 2 1 1 35 HIS HE1  . 35 HIS  HE1  1 2 
       390 1 1 1 1 19 GLY H    . 19 GLY  HN   1 2 
       390 1 2 1 1 20 LYS QB   . 20 LYS  QB   1 2 
       391 1 1 1 1 20 LYS H    . 20 LYS  HN   1 2 
       391 1 2 1 1 20 LYS QB   . 20 LYS  QB   1 2 
       392 1 1 1 1 20 LYS H    . 20 LYS  HN   1 2 
       392 1 2 1 1 20 LYS QG   . 20 LYS  QG   1 2 
       393 1 1 1 1 20 LYS HA   . 20 LYS  HA   1 2 
       393 1 2 1 1 20 LYS QG   . 20 LYS  QG   1 2 
       394 1 1 1 1 20 LYS QB   . 20 LYS  QB   1 2 
       394 1 2 1 1 21 ALA H    . 21 ALA  HN   1 2 
       395 1 1 1 1 20 LYS QB   . 20 LYS  QB   1 2 
       395 1 2 1 1 22 PHE HZ   . 22 PHE  HZ   1 2 
       396 1 1 1 1 20 LYS QB   . 20 LYS  QB   1 2 
       396 1 2 1 1 31 HIS HE1  . 31 HIS  HE1  1 2 
       397 1 1 1 1 20 LYS QG   . 20 LYS  QG   1 2 
       397 1 2 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       398 1 1 1 1 20 LYS QG   . 20 LYS  QG   1 2 
       398 1 2 1 1 31 HIS HE1  . 31 HIS  HE1  1 2 
       399 1 1 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       399 1 2 1 1 27 TYR QB   . 27 TYR  QB   1 2 
       400 1 1 1 1 24 SER H    . 24 SER  HN   1 2 
       400 1 2 1 1 24 SER QB   . 24 SER  QB   1 2 
       401 1 1 1 1 24 SER H    . 24 SER  HN   1 2 
       401 1 2 1 1 27 TYR QB   . 27 TYR  QB   1 2 
       402 1 1 1 1 24 SER QB   . 24 SER  QB   1 2 
       402 1 2 1 1 25 LYS H    . 25 LYS  HN   1 2 
       403 1 1 1 1 24 SER QB   . 24 SER  QB   1 2 
       403 1 2 1 1 27 TYR QD   . 27 TYR  QD   1 2 
       404 1 1 1 1 25 LYS H    . 25 LYS  HN   1 2 
       404 1 2 1 1 25 LYS QB   . 25 LYS  QB   1 2 
       405 1 1 1 1 25 LYS QB   . 25 LYS  QB   1 2 
       405 1 2 1 1 29 ILE MD   . 29 ILE  QD1  1 2 
       406 1 1 1 1 27 TYR H    . 27 TYR  HN   1 2 
       406 1 2 1 1 27 TYR QB   . 27 TYR  QB   1 2 
       407 1 1 1 1 27 TYR QB   . 27 TYR  QB   1 2 
       407 1 2 1 1 28 LEU H    . 28 LEU  HN   1 2 
       408 1 1 1 1 27 TYR QB   . 27 TYR  QB   1 2 
       408 1 2 1 1 29 ILE H    . 29 ILE  HN   1 2 
       409 1 1 1 1 27 TYR QB   . 27 TYR  QB   1 2 
       409 1 2 1 1 30 ILE MD   . 30 ILE  QD1  1 2 
       410 1 1 1 1 28 LEU H    . 28 LEU  HN   1 2 
       410 1 2 1 1 29 ILE QG   . 29 ILE  QG1  1 2 
       411 1 1 1 1 28 LEU HG   . 28 LEU  HG   1 2 
       411 1 2 1 1 32 MET QG   . 32 MET  QG   1 2 
       412 1 1 1 1 29 ILE HA   . 29 ILE  HA   1 2 
       412 1 2 1 1 29 ILE QG   . 29 ILE  QG1  1 2 
       413 1 1 1 1 30 ILE HA   . 30 ILE  HA   1 2 
       413 1 2 1 1 33 ARG QB   . 33 ARG  QB   1 2 
       414 1 1 1 1 30 ILE HA   . 30 ILE  HA   1 2 
       414 1 2 1 1 33 ARG QG   . 33 ARG  QG   1 2 
       415 1 1 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       415 1 2 1 1 32 MET QG   . 32 MET  QG   1 2 
       416 1 1 1 1 32 MET H    . 32 MET  HN   1 2 
       416 1 2 1 1 32 MET QG   . 32 MET  QG   1 2 
       417 1 1 1 1 32 MET H    . 32 MET  HN   1 2 
       417 1 2 1 1 33 ARG QB   . 33 ARG  QB   1 2 
       418 1 1 1 1 32 MET H    . 32 MET  HN   1 2 
       418 1 2 1 1 33 ARG QG   . 33 ARG  QG   1 2 
       419 1 1 1 1 32 MET HA   . 32 MET  HA   1 2 
       419 1 2 1 1 32 MET QG   . 32 MET  QG   1 2 
       420 1 1 1 1 32 MET ME   . 32 MET  QE   1 2 
       420 1 2 1 1 32 MET QG   . 32 MET  QG   1 2 
       421 1 1 1 1 33 ARG H    . 33 ARG  HN   1 2 
       421 1 2 1 1 33 ARG QB   . 33 ARG  QB   1 2 
       422 1 1 1 1 33 ARG H    . 33 ARG  HN   1 2 
       422 1 2 1 1 33 ARG QG   . 33 ARG  QG   1 2 
       423 1 1 1 1 33 ARG QB   . 33 ARG  QB   1 2 
       423 1 2 1 1 34 THR H    . 34 THR  HN   1 2 
       424 1 1 1 1 33 ARG QB   . 33 ARG  QB   1 2 
       424 1 2 1 1 34 THR MG   . 34 THR  QG2  1 2 
       425 1 1 1 1 33 ARG QB   . 33 ARG  QB   1 2 
       425 1 2 1 1 35 HIS H    . 35 HIS  HN   1 2 
       426 1 1 1 1 33 ARG QG   . 33 ARG  QG   1 2 
       426 1 2 1 1 34 THR H    . 34 THR  HN   1 2 
       427 1 1 1 1 38 GLU H    . 38 GLU  HN   1 2 
       427 1 2 1 1 38 GLU QB   . 38 GLU  QB   1 2 
       428 1 1 1 1 38 GLU H    . 38 GLU  HN   1 2 
       428 1 2 1 1 38 GLU QG   . 38 GLU  QG   1 2 
       429 1 1 1 1 38 GLU QB   . 38 GLU  QB   1 2 
       429 1 2 1 1 39 LYS H    . 39 LYS  HN   1 2 
       430 1 1 1 1 39 LYS H    . 39 LYS  HN   1 2 
       430 1 2 1 1 39 LYS QB   . 39 LYS  QB   1 2 
       431 1 1 1 1 39 LYS HA   . 39 LYS  HA   1 2 
       431 1 2 1 1 40 PRO QD   . 40 PRO  QD   1 2 
       432 1 1 1 1 39 LYS QB   . 39 LYS  QB   1 2 
       432 1 2 1 1 40 PRO QD   . 40 PRO  QD   1 2 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

         1 1 . . . . . . . 4.94 1 2 
         2 1 . . . . . . . 4.43 1 2 
         3 1 . . . . . . . 4.51 1 2 
         4 1 . . . . . . . 4.51 1 2 
         5 1 . . . . . . . 3.72 1 2 
         6 1 . . . . . . . 3.72 1 2 
         7 1 . . . . . . . 4.76 1 2 
         8 1 . . . . . . . 4.17 1 2 
         9 1 . . . . . . . 5.25 1 2 
        10 1 . . . . . . . 4.49 1 2 
        11 1 . . . . . . . 3.18 1 2 
        12 1 . . . . . . . 4.49 1 2 
        13 1 . . . . . . . 4.48 1 2 
        14 1 . . . . . . . 3.81 1 2 
        15 1 . . . . . . . 3.31 1 2 
        16 1 . . . . . . .  4.4 1 2 
        17 1 . . . . . . . 4.07 1 2 
        18 1 . . . . . . . 3.32 1 2 
        19 1 . . . . . . . 4.67 1 2 
        20 1 . . . . . . . 5.21 1 2 
        21 1 . . . . . . .  3.7 1 2 
        22 1 . . . . . . . 5.24 1 2 
        23 1 . . . . . . .  3.7 1 2 
        24 1 . . . . . . . 3.62 1 2 
        25 1 . . . . . . .  4.1 1 2 
        26 1 . . . . . . . 5.19 1 2 
        27 1 . . . . . . . 5.49 1 2 
        28 1 . . . . . . . 3.78 1 2 
        29 1 . . . . . . . 3.78 1 2 
        30 1 . . . . . . . 4.92 1 2 
        31 1 . . . . . . . 4.96 1 2 
        32 1 . . . . . . . 3.54 1 2 
        33 1 . . . . . . . 4.32 1 2 
        34 1 . . . . . . . 4.32 1 2 
        35 1 . . . . . . . 3.78 1 2 
        36 1 . . . . . . . 4.82 1 2 
        37 1 . . . . . . .  4.8 1 2 
        38 1 . . . . . . . 2.84 1 2 
        39 1 . . . . . . . 5.12 1 2 
        40 1 . . . . . . .  5.5 1 2 
        41 1 . . . . . . . 3.14 1 2 
        42 1 . . . . . . . 4.18 1 2 
        43 1 . . . . . . . 3.65 1 2 
        44 1 . . . . . . . 4.85 1 2 
        45 1 . . . . . . . 4.03 1 2 
        46 1 . . . . . . . 3.26 1 2 
        47 1 . . . . . . . 3.45 1 2 
        48 1 . . . . . . . 4.54 1 2 
        49 1 . . . . . . . 4.84 1 2 
        50 1 . . . . . . . 5.25 1 2 
        51 1 . . . . . . .  2.8 1 2 
        52 1 . . . . . . . 4.28 1 2 
        53 1 . . . . . . . 4.21 1 2 
        54 1 . . . . . . .  5.5 1 2 
        55 1 . . . . . . .  5.5 1 2 
        56 1 . . . . . . . 5.03 1 2 
        57 1 . . . . . . . 5.37 1 2 
        58 1 . . . . . . . 5.42 1 2 
        59 1 . . . . . . . 5.42 1 2 
        60 1 . . . . . . . 3.33 1 2 
        61 1 . . . . . . . 3.63 1 2 
        62 1 . . . . . . .  4.2 1 2 
        63 1 . . . . . . . 4.58 1 2 
        64 1 . . . . . . . 5.39 1 2 
        65 1 . . . . . . . 5.39 1 2 
        66 1 . . . . . . . 3.55 1 2 
        67 1 . . . . . . . 3.12 1 2 
        68 1 . . . . . . . 3.98 1 2 
        69 1 . . . . . . . 4.18 1 2 
        70 1 . . . . . . .  3.7 1 2 
        71 1 . . . . . . .  4.6 1 2 
        72 1 . . . . . . . 4.83 1 2 
        73 1 . . . . . . . 3.95 1 2 
        74 1 . . . . . . . 4.94 1 2 
        75 1 . . . . . . . 3.56 1 2 
        76 1 . . . . . . . 3.39 1 2 
        77 1 . . . . . . . 4.98 1 2 
        78 1 . . . . . . . 3.12 1 2 
        79 1 . . . . . . . 3.29 1 2 
        80 1 . . . . . . . 3.41 1 2 
        81 1 . . . . . . . 4.89 1 2 
        82 1 . . . . . . . 3.96 1 2 
        83 1 . . . . . . .  5.0 1 2 
        84 1 . . . . . . . 3.73 1 2 
        85 1 . . . . . . . 4.82 1 2 
        86 1 . . . . . . .  3.3 1 2 
        87 1 . . . . . . .  5.3 1 2 
        88 1 . . . . . . . 4.98 1 2 
        89 1 . . . . . . . 3.47 1 2 
        90 1 . . . . . . . 3.98 1 2 
        91 1 . . . . . . . 4.85 1 2 
        92 1 . . . . . . . 4.05 1 2 
        93 1 . . . . . . . 3.38 1 2 
        94 1 . . . . . . . 4.07 1 2 
        95 1 . . . . . . . 5.02 1 2 
        96 1 . . . . . . .  3.2 1 2 
        97 1 . . . . . . .  5.5 1 2 
        98 1 . . . . . . . 2.96 1 2 
        99 1 . . . . . . .  3.7 1 2 
       100 1 . . . . . . . 4.38 1 2 
       101 1 . . . . . . . 5.14 1 2 
       102 1 . . . . . . .  5.5 1 2 
       103 1 . . . . . . . 3.53 1 2 
       104 1 . . . . . . . 4.41 1 2 
       105 1 . . . . . . . 3.54 1 2 
       106 1 . . . . . . . 5.04 1 2 
       107 1 . . . . . . . 5.41 1 2 
       108 1 . . . . . . .  4.8 1 2 
       109 1 . . . . . . . 4.68 1 2 
       110 1 . . . . . . . 3.67 1 2 
       111 1 . . . . . . . 3.77 1 2 
       112 1 . . . . . . . 3.77 1 2 
       113 1 . . . . . . . 3.88 1 2 
       114 1 . . . . . . . 3.43 1 2 
       115 1 . . . . . . . 3.23 1 2 
       116 1 . . . . . . . 3.91 1 2 
       117 1 . . . . . . . 3.76 1 2 
       118 1 . . . . . . . 4.33 1 2 
       119 1 . . . . . . . 3.33 1 2 
       120 1 . . . . . . . 5.32 1 2 
       121 1 . . . . . . .  5.5 1 2 
       122 1 . . . . . . . 3.91 1 2 
       123 1 . . . . . . . 3.72 1 2 
       124 1 . . . . . . . 4.34 1 2 
       125 1 . . . . . . . 4.25 1 2 
       126 1 . . . . . . .  4.4 1 2 
       127 1 . . . . . . . 3.57 1 2 
       128 1 . . . . . . . 4.75 1 2 
       129 1 . . . . . . . 4.62 1 2 
       130 1 . . . . . . . 3.75 1 2 
       131 1 . . . . . . . 4.54 1 2 
       132 1 . . . . . . . 4.54 1 2 
       133 1 . . . . . . . 3.35 1 2 
       134 1 . . . . . . . 5.22 1 2 
       135 1 . . . . . . . 3.03 1 2 
       136 1 . . . . . . .  4.0 1 2 
       137 1 . . . . . . . 3.42 1 2 
       138 1 . . . . . . .  3.5 1 2 
       139 1 . . . . . . .  5.5 1 2 
       140 1 . . . . . . .  5.5 1 2 
       141 1 . . . . . . .  3.2 1 2 
       142 1 . . . . . . . 2.98 1 2 
       143 1 . . . . . . . 5.03 1 2 
       144 1 . . . . . . . 3.85 1 2 
       145 1 . . . . . . . 3.85 1 2 
       146 1 . . . . . . . 3.72 1 2 
       147 1 . . . . . . . 3.72 1 2 
       148 1 . . . . . . . 4.76 1 2 
       149 1 . . . . . . . 4.57 1 2 
       150 1 . . . . . . . 5.08 1 2 
       151 1 . . . . . . .  5.5 1 2 
       152 1 . . . . . . . 3.72 1 2 
       153 1 . . . . . . . 3.33 1 2 
       154 1 . . . . . . . 4.53 1 2 
       155 1 . . . . . . . 4.37 1 2 
       156 1 . . . . . . . 4.18 1 2 
       157 1 . . . . . . . 4.49 1 2 
       158 1 . . . . . . . 5.25 1 2 
       159 1 . . . . . . . 4.34 1 2 
       160 1 . . . . . . . 4.34 1 2 
       161 1 . . . . . . . 4.37 1 2 
       162 1 . . . . . . . 3.77 1 2 
       163 1 . . . . . . . 3.77 1 2 
       164 1 . . . . . . . 3.99 1 2 
       165 1 . . . . . . . 3.99 1 2 
       166 1 . . . . . . . 3.87 1 2 
       167 1 . . . . . . . 4.94 1 2 
       168 1 . . . . . . .  3.7 1 2 
       169 1 . . . . . . .  3.9 1 2 
       170 1 . . . . . . . 4.12 1 2 
       171 1 . . . . . . . 3.27 1 2 
       172 1 . . . . . . . 4.62 1 2 
       173 1 . . . . . . . 3.94 1 2 
       174 1 . . . . . . . 3.47 1 2 
       175 1 . . . . . . . 4.35 1 2 
       176 1 . . . . . . .  4.1 1 2 
       177 1 . . . . . . . 4.85 1 2 
       178 1 . . . . . . . 5.09 1 2 
       179 1 . . . . . . . 4.23 1 2 
       180 1 . . . . . . . 3.95 1 2 
       181 1 . . . . . . . 4.92 1 2 
       182 1 . . . . . . . 3.65 1 2 
       183 1 . . . . . . .  5.5 1 2 
       184 1 . . . . . . .  5.5 1 2 
       185 1 . . . . . . . 5.04 1 2 
       186 1 . . . . . . . 5.04 1 2 
       187 1 . . . . . . . 3.21 1 2 
       188 1 . . . . . . . 5.03 1 2 
       189 1 . . . . . . . 3.87 1 2 
       190 1 . . . . . . . 4.63 1 2 
       191 1 . . . . . . . 5.37 1 2 
       192 1 . . . . . . .  4.7 1 2 
       193 1 . . . . . . .  5.2 1 2 
       194 1 . . . . . . . 4.17 1 2 
       195 1 . . . . . . . 4.79 1 2 
       196 1 . . . . . . . 4.27 1 2 
       197 1 . . . . . . . 4.64 1 2 
       198 1 . . . . . . . 4.87 1 2 
       199 1 . . . . . . . 4.55 1 2 
       200 1 . . . . . . . 4.34 1 2 
       201 1 . . . . . . .  4.8 1 2 
       202 1 . . . . . . . 4.55 1 2 
       203 1 . . . . . . . 3.83 1 2 
       204 1 . . . . . . . 3.77 1 2 
       205 1 . . . . . . . 4.76 1 2 
       206 1 . . . . . . . 5.37 1 2 
       207 1 . . . . . . . 5.37 1 2 
       208 1 . . . . . . . 4.77 1 2 
       209 1 . . . . . . . 4.56 1 2 
       210 1 . . . . . . . 4.56 1 2 
       211 1 . . . . . . . 3.75 1 2 
       212 1 . . . . . . . 4.37 1 2 
       213 1 . . . . . . . 4.83 1 2 
       214 1 . . . . . . . 4.12 1 2 
       215 1 . . . . . . .  3.4 1 2 
       216 1 . . . . . . . 3.57 1 2 
       217 1 . . . . . . . 4.68 1 2 
       218 1 . . . . . . . 4.89 1 2 
       219 1 . . . . . . . 3.81 1 2 
       220 1 . . . . . . .  3.7 1 2 
       221 1 . . . . . . . 4.12 1 2 
       222 1 . . . . . . . 4.52 1 2 
       223 1 . . . . . . . 4.22 1 2 
       224 1 . . . . . . . 4.74 1 2 
       225 1 . . . . . . . 4.07 1 2 
       226 1 . . . . . . .  3.5 1 2 
       227 1 . . . . . . . 3.23 1 2 
       228 1 . . . . . . . 4.66 1 2 
       229 1 . . . . . . . 5.31 1 2 
       230 1 . . . . . . . 4.45 1 2 
       231 1 . . . . . . . 4.18 1 2 
       232 1 . . . . . . .  4.9 1 2 
       233 1 . . . . . . . 4.34 1 2 
       234 1 . . . . . . . 4.34 1 2 
       235 1 . . . . . . . 3.64 1 2 
       236 1 . . . . . . . 3.78 1 2 
       237 1 . . . . . . . 4.79 1 2 
       238 1 . . . . . . . 3.87 1 2 
       239 1 . . . . . . . 3.29 1 2 
       240 1 . . . . . . . 4.01 1 2 
       241 1 . . . . . . . 3.55 1 2 
       242 1 . . . . . . . 3.36 1 2 
       243 1 . . . . . . . 3.46 1 2 
       244 1 . . . . . . . 4.78 1 2 
       245 1 . . . . . . . 4.86 1 2 
       246 1 . . . . . . . 4.79 1 2 
       247 1 . . . . . . . 4.29 1 2 
       248 1 . . . . . . . 4.43 1 2 
       249 1 . . . . . . .  3.8 1 2 
       250 1 . . . . . . . 4.17 1 2 
       251 1 . . . . . . . 4.77 1 2 
       252 1 . . . . . . . 4.77 1 2 
       253 1 . . . . . . . 4.41 1 2 
       254 1 . . . . . . . 4.74 1 2 
       255 1 . . . . . . . 3.72 1 2 
       256 1 . . . . . . . 4.55 1 2 
       257 1 . . . . . . . 4.55 1 2 
       258 1 . . . . . . . 4.81 1 2 
       259 1 . . . . . . . 4.64 1 2 
       260 1 . . . . . . . 4.64 1 2 
       261 1 . . . . . . . 4.85 1 2 
       262 1 . . . . . . . 3.82 1 2 
       263 1 . . . . . . . 3.72 1 2 
       264 1 . . . . . . . 3.69 1 2 
       265 1 . . . . . . . 4.11 1 2 
       266 1 . . . . . . . 5.02 1 2 
       267 1 . . . . . . . 4.34 1 2 
       268 1 . . . . . . . 3.82 1 2 
       269 1 . . . . . . . 4.91 1 2 
       270 1 . . . . . . . 4.37 1 2 
       271 1 . . . . . . . 5.13 1 2 
       272 1 . . . . . . . 5.42 1 2 
       273 1 . . . . . . . 3.54 1 2 
       274 1 . . . . . . . 3.83 1 2 
       275 1 . . . . . . . 3.83 1 2 
       276 1 . . . . . . . 4.09 1 2 
       277 1 . . . . . . .  4.0 1 2 
       278 1 . . . . . . .  4.0 1 2 
       279 1 . . . . . . . 4.25 1 2 
       280 1 . . . . . . . 4.07 1 2 
       281 1 . . . . . . . 4.15 1 2 
       282 1 . . . . . . .  5.0 1 2 
       283 1 . . . . . . .  5.0 1 2 
       284 1 . . . . . . . 3.46 1 2 
       285 1 . . . . . . . 4.23 1 2 
       286 1 . . . . . . . 4.46 1 2 
       287 1 . . . . . . . 4.06 1 2 
       288 1 . . . . . . . 4.06 1 2 
       289 1 . . . . . . . 4.85 1 2 
       290 1 . . . . . . . 4.28 1 2 
       291 1 . . . . . . . 4.94 1 2 
       292 1 . . . . . . . 4.69 1 2 
       293 1 . . . . . . .  3.5 1 2 
       294 1 . . . . . . . 4.05 1 2 
       295 1 . . . . . . . 3.91 1 2 
       296 1 . . . . . . . 4.44 1 2 
       297 1 . . . . . . . 3.91 1 2 
       298 1 . . . . . . . 3.99 1 2 
       299 1 . . . . . . . 4.81 1 2 
       300 1 . . . . . . . 4.45 1 2 
       301 1 . . . . . . . 5.09 1 2 
       302 1 . . . . . . . 4.35 1 2 
       303 1 . . . . . . . 4.92 1 2 
       304 1 . . . . . . . 4.17 1 2 
       305 1 . . . . . . .  3.6 1 2 
       306 1 . . . . . . . 3.93 1 2 
       307 1 . . . . . . . 4.79 1 2 
       308 1 . . . . . . . 4.79 1 2 
       309 1 . . . . . . . 4.14 1 2 
       310 1 . . . . . . .  3.7 1 2 
       311 1 . . . . . . . 3.87 1 2 
       312 1 . . . . . . . 3.81 1 2 
       313 1 . . . . . . . 5.45 1 2 
       314 1 . . . . . . . 5.45 1 2 
       315 1 . . . . . . .  5.5 1 2 
       316 1 . . . . . . .  5.5 1 2 
       317 1 . . . . . . . 4.92 1 2 
       318 1 . . . . . . . 5.23 1 2 
       319 1 . . . . . . . 4.37 1 2 
       320 1 . . . . . . .  5.5 1 2 
       321 1 . . . . . . .  5.5 1 2 
       322 1 . . . . . . .  5.5 1 2 
       323 1 . . . . . . . 4.41 1 2 
       324 1 . . . . . . . 3.99 1 2 
       325 1 . . . . . . . 4.53 1 2 
       326 1 . . . . . . . 3.88 1 2 
       327 1 . . . . . . .  4.6 1 2 
       328 1 . . . . . . . 4.46 1 2 
       329 1 . . . . . . . 3.84 1 2 
       330 1 . . . . . . .  5.5 1 2 
       331 1 . . . . . . . 4.47 1 2 
       332 1 . . . . . . . 3.76 1 2 
       333 1 . . . . . . . 4.65 1 2 
       334 1 . . . . . . .  5.5 1 2 
       335 1 . . . . . . .  5.5 1 2 
       336 1 . . . . . . . 4.66 1 2 
       337 1 . . . . . . . 4.44 1 2 
       338 1 . . . . . . . 3.44 1 2 
       339 1 . . . . . . . 5.19 1 2 
       340 1 . . . . . . . 5.12 1 2 
       341 1 . . . . . . . 4.24 1 2 
       342 1 . . . . . . . 4.16 1 2 
       343 1 . . . . . . . 4.79 1 2 
       344 1 . . . . . . . 3.48 1 2 
       345 1 . . . . . . . 3.68 1 2 
       346 1 . . . . . . . 4.67 1 2 
       347 1 . . . . . . .  4.0 1 2 
       348 1 . . . . . . .  5.5 1 2 
       349 1 . . . . . . .  5.0 1 2 
       350 1 . . . . . . . 3.66 1 2 
       351 1 . . . . . . . 4.56 1 2 
       352 1 . . . . . . . 4.82 1 2 
       353 1 . . . . . . . 3.41 1 2 
       354 1 . . . . . . . 3.74 1 2 
       355 1 . . . . . . . 4.37 1 2 
       356 1 . . . . . . . 4.92 1 2 
       357 1 . . . . . . .  4.0 1 2 
       358 1 . . . . . . . 3.74 1 2 
       359 1 . . . . . . . 5.18 1 2 
       360 1 . . . . . . . 4.54 1 2 
       361 1 . . . . . . . 4.35 1 2 
       362 1 . . . . . . . 4.15 1 2 
       363 1 . . . . . . . 3.63 1 2 
       364 1 . . . . . . . 3.82 1 2 
       365 1 . . . . . . . 4.23 1 2 
       366 1 . . . . . . . 5.34 1 2 
       367 1 . . . . . . . 5.34 1 2 
       368 1 . . . . . . .  3.7 1 2 
       369 1 . . . . . . . 4.18 1 2 
       370 1 . . . . . . . 3.08 1 2 
       371 1 . . . . . . . 4.13 1 2 
       372 1 . . . . . . . 4.21 1 2 
       373 1 . . . . . . . 4.52 1 2 
       374 1 . . . . . . . 4.48 1 2 
       375 1 . . . . . . . 3.15 1 2 
       376 1 . . . . . . . 4.15 1 2 
       377 1 . . . . . . . 3.73 1 2 
       378 1 . . . . . . . 3.26 1 2 
       379 1 . . . . . . . 5.18 1 2 
       380 1 . . . . . . . 4.65 1 2 
       381 1 . . . . . . . 3.93 1 2 
       382 1 . . . . . . . 4.22 1 2 
       383 1 . . . . . . . 4.72 1 2 
       384 1 . . . . . . .  4.6 1 2 
       385 1 . . . . . . . 4.76 1 2 
       386 1 . . . . . . . 3.35 1 2 
       387 1 . . . . . . . 4.17 1 2 
       388 1 . . . . . . . 4.02 1 2 
       389 1 . . . . . . . 3.27 1 2 
       390 1 . . . . . . . 4.73 1 2 
       391 1 . . . . . . . 3.19 1 2 
       392 1 . . . . . . . 4.54 1 2 
       393 1 . . . . . . . 3.21 1 2 
       394 1 . . . . . . . 3.89 1 2 
       395 1 . . . . . . . 4.01 1 2 
       396 1 . . . . . . . 4.55 1 2 
       397 1 . . . . . . . 4.94 1 2 
       398 1 . . . . . . . 4.54 1 2 
       399 1 . . . . . . . 3.69 1 2 
       400 1 . . . . . . . 3.71 1 2 
       401 1 . . . . . . . 3.59 1 2 
       402 1 . . . . . . . 3.74 1 2 
       403 1 . . . . . . .  4.5 1 2 
       404 1 . . . . . . . 3.26 1 2 
       405 1 . . . . . . . 4.76 1 2 
       406 1 . . . . . . . 3.13 1 2 
       407 1 . . . . . . . 3.75 1 2 
       408 1 . . . . . . . 5.34 1 2 
       409 1 . . . . . . . 4.62 1 2 
       410 1 . . . . . . . 5.04 1 2 
       411 1 . . . . . . . 3.89 1 2 
       412 1 . . . . . . . 3.27 1 2 
       413 1 . . . . . . . 4.55 1 2 
       414 1 . . . . . . . 3.48 1 2 
       415 1 . . . . . . . 4.28 1 2 
       416 1 . . . . . . . 3.49 1 2 
       417 1 . . . . . . . 5.34 1 2 
       418 1 . . . . . . . 4.59 1 2 
       419 1 . . . . . . .  3.7 1 2 
       420 1 . . . . . . . 3.56 1 2 
       421 1 . . . . . . . 2.93 1 2 
       422 1 . . . . . . . 3.35 1 2 
       423 1 . . . . . . . 4.03 1 2 
       424 1 . . . . . . . 4.65 1 2 
       425 1 . . . . . . . 5.34 1 2 
       426 1 . . . . . . . 4.78 1 2 
       427 1 . . . . . . . 3.58 1 2 
       428 1 . . . . . . . 4.57 1 2 
       429 1 . . . . . . . 4.42 1 2 
       430 1 . . . . . . . 3.65 1 2 
       431 1 . . . . . . .  3.3 1 2 
       432 1 . . . . . . .  4.0 1 2 
    stop_

save_


save_DYANA/DIANA_dihedral_4
    _Torsion_angle_constraint_list.Sf_category         torsion_angle_constraints
    _Torsion_angle_constraint_list.Entry_ID            1
    _Torsion_angle_constraint_list.ID                  1
    _Torsion_angle_constraint_list.Constraint_file_ID  .
    _Torsion_angle_constraint_list.Block_ID            .

    loop_
       _Torsion_angle_constraint.ID
       _Torsion_angle_constraint.Torsion_angle_name
       _Torsion_angle_constraint.Entity_assembly_ID_1
       _Torsion_angle_constraint.Entity_ID_1
       _Torsion_angle_constraint.Comp_index_ID_1
       _Torsion_angle_constraint.Comp_ID_1
       _Torsion_angle_constraint.Atom_ID_1
       _Torsion_angle_constraint.Entity_assembly_ID_2
       _Torsion_angle_constraint.Entity_ID_2
       _Torsion_angle_constraint.Comp_index_ID_2
       _Torsion_angle_constraint.Comp_ID_2
       _Torsion_angle_constraint.Atom_ID_2
       _Torsion_angle_constraint.Entity_assembly_ID_3
       _Torsion_angle_constraint.Entity_ID_3
       _Torsion_angle_constraint.Comp_index_ID_3
       _Torsion_angle_constraint.Comp_ID_3
       _Torsion_angle_constraint.Atom_ID_3
       _Torsion_angle_constraint.Entity_assembly_ID_4
       _Torsion_angle_constraint.Entity_ID_4
       _Torsion_angle_constraint.Comp_index_ID_4
       _Torsion_angle_constraint.Comp_ID_4
       _Torsion_angle_constraint.Atom_ID_4
       _Torsion_angle_constraint.Angle_lower_bound_val
       _Torsion_angle_constraint.Angle_upper_bound_val
       _Torsion_angle_constraint.Auth_asym_ID_1
       _Torsion_angle_constraint.Auth_seq_ID_1
       _Torsion_angle_constraint.Auth_comp_ID_1
       _Torsion_angle_constraint.Auth_atom_ID_1
       _Torsion_angle_constraint.Auth_asym_ID_2
       _Torsion_angle_constraint.Auth_seq_ID_2
       _Torsion_angle_constraint.Auth_comp_ID_2
       _Torsion_angle_constraint.Auth_atom_ID_2
       _Torsion_angle_constraint.Auth_asym_ID_3
       _Torsion_angle_constraint.Auth_seq_ID_3
       _Torsion_angle_constraint.Auth_comp_ID_3
       _Torsion_angle_constraint.Auth_atom_ID_3
       _Torsion_angle_constraint.Auth_asym_ID_4
       _Torsion_angle_constraint.Auth_seq_ID_4
       _Torsion_angle_constraint.Auth_comp_ID_4
       _Torsion_angle_constraint.Auth_atom_ID_4
       _Torsion_angle_constraint.Entry_ID
       _Torsion_angle_constraint.Torsion_angle_constraint_list_ID

        1 PHI 1 1 25 LYS C 1 1 26 SER N  1 1 26 SER CA 1 1 26 SER C     -97.4      -37.4 . 26 SER . . 26 SER . . 26 SER . . 26 SER . 1 1 
        2 PSI 1 1 26 SER N 1 1 26 SER CA 1 1 26 SER C  1 1 27 TYR N     -71.8      -11.8 . 26 SER . . 26 SER . . 26 SER . . 26 SER . 1 1 
        3 PHI 1 1 26 SER C 1 1 27 TYR N  1 1 27 TYR CA 1 1 27 TYR C     -96.8 -36.799995 . 27 TYR . . 27 TYR . . 27 TYR . . 27 TYR . 1 1 
        4 PSI 1 1 27 TYR N 1 1 27 TYR CA 1 1 27 TYR C  1 1 28 LEU N     -64.4       -4.4 . 27 TYR . . 27 TYR . . 27 TYR . . 27 TYR . 1 1 
        5 PHI 1 1 27 TYR C 1 1 28 LEU N  1 1 28 LEU CA 1 1 28 LEU C -98.19999      -38.2 . 28 LEU . . 28 LEU . . 28 LEU . . 28 LEU . 1 1 
        6 PSI 1 1 28 LEU N 1 1 28 LEU CA 1 1 28 LEU C  1 1 29 ILE N     -72.0 -11.999999 . 28 LEU . . 28 LEU . . 28 LEU . . 28 LEU . 1 1 
        7 PHI 1 1 28 LEU C 1 1 29 ILE N  1 1 29 ILE CA 1 1 29 ILE C     -96.4      -36.4 . 29 ILE . . 29 ILE . . 29 ILE . . 29 ILE . 1 1 
        8 PSI 1 1 29 ILE N 1 1 29 ILE CA 1 1 29 ILE C  1 1 30 ILE N     -67.3       -7.3 . 29 ILE . . 29 ILE . . 29 ILE . . 29 ILE . 1 1 
        9 PHI 1 1 29 ILE C 1 1 30 ILE N  1 1 30 ILE CA 1 1 30 ILE C     -97.7      -37.7 . 30 ILE . . 30 ILE . . 30 ILE . . 30 ILE . 1 1 
       10 PSI 1 1 30 ILE N 1 1 30 ILE CA 1 1 30 ILE C  1 1 31 HIS N     -67.8       -7.8 . 30 ILE . . 30 ILE . . 30 ILE . . 30 ILE . 1 1 
       11 PHI 1 1 30 ILE C 1 1 31 HIS N  1 1 31 HIS CA 1 1 31 HIS C -95.99999      -36.0 . 31 HIS . . 31 HIS . . 31 HIS . . 31 HIS . 1 1 
       12 PSI 1 1 31 HIS N 1 1 31 HIS CA 1 1 31 HIS C  1 1 32 MET N     -69.2  -9.199999 . 31 HIS . . 31 HIS . . 31 HIS . . 31 HIS . 1 1 
       13 PHI 1 1 31 HIS C 1 1 32 MET N  1 1 32 MET CA 1 1 32 MET C     -95.1      -35.1 . 32 MET . . 32 MET . . 32 MET . . 32 MET . 1 1 
       14 PSI 1 1 32 MET N 1 1 32 MET CA 1 1 32 MET C  1 1 33 ARG N     -68.4       -8.4 . 32 MET . . 32 MET . . 32 MET . . 32 MET . 1 1 
    stop_

save_


save_conformer_family_coord_set_1
    _Conformer_family_coord_set.Sf_category  conformer_family_coord_set
    _Conformer_family_coord_set.Entry_ID     1
    _Conformer_family_coord_set.ID           1

    loop_
       _Atom_site.Model_ID
       _Atom_site.ID
       _Atom_site.Label_entity_assembly_ID
       _Atom_site.Label_entity_ID
       _Atom_site.Label_comp_index_ID
       _Atom_site.Label_comp_ID
       _Atom_site.Label_atom_ID
       _Atom_site.Type_symbol
       _Atom_site.Cartn_x
       _Atom_site.Cartn_y
       _Atom_site.Cartn_z
       _Atom_site.Occupancy
       _Atom_site.Uncertainty
       _Atom_site.PDBX_label_asym_ID
       _Atom_site.PDB_strand_ID
       _Atom_site.PDB_ins_code
       _Atom_site.PDB_residue_no
       _Atom_site.PDB_residue_name
       _Atom_site.PDB_atom_name
       _Atom_site.Entry_ID
       _Atom_site.Conformer_family_coord_set_ID

        1     1 1 1  1 GLY C    C  -26.157   4.094  -5.227 1.00 . A A .   1 GLY C    1 1 
        1     2 1 1  1 GLY CA   C  -26.984   4.380  -6.464 1.00 . A A .   1 GLY CA   1 1 
        1     3 1 1  1 GLY H1   H  -28.436   5.317  -5.242 1.00 . A A .   1 GLY H1   1 1 
        1     4 1 1  1 GLY HA2  H  -27.290   3.443  -6.905 1.00 . A A .   1 GLY HA2  1 1 
        1     5 1 1  1 GLY HA3  H  -26.372   4.917  -7.175 1.00 . A A .   1 GLY HA3  1 1 
        1     6 1 1  1 GLY N    N  -28.165   5.171  -6.172 1.00 . A A .   1 GLY N    1 1 
        1     7 1 1  1 GLY O    O  -26.651   4.198  -4.104 1.00 . A A .   1 GLY O    1 1 
        1     8 1 1  2 SER C    C  -22.921   4.492  -4.181 1.00 . A A .   2 SER C    1 1 
        1     9 1 1  2 SER CA   C  -23.999   3.422  -4.323 1.00 . A A .   2 SER CA   1 1 
        1    10 1 1  2 SER CB   C  -23.349   2.052  -4.529 1.00 . A A .   2 SER CB   1 1 
        1    11 1 1  2 SER H    H  -24.559   3.665  -6.350 1.00 . A A .   2 SER H    1 1 
        1    12 1 1  2 SER HA   H  -24.587   3.399  -3.417 1.00 . A A .   2 SER HA   1 1 
        1    13 1 1  2 SER HB2  H  -24.042   1.402  -5.043 1.00 . A A .   2 SER HB2  1 1 
        1    14 1 1  2 SER HB3  H  -22.455   2.167  -5.124 1.00 . A A .   2 SER HB3  1 1 
        1    15 1 1  2 SER HG   H  -23.095   0.507  -3.353 1.00 . A A .   2 SER HG   1 1 
        1    16 1 1  2 SER N    N  -24.895   3.730  -5.431 1.00 . A A .   2 SER N    1 1 
        1    17 1 1  2 SER O    O  -22.375   4.974  -5.174 1.00 . A A .   2 SER O    1 1 
        1    18 1 1  2 SER OG   O  -23.001   1.460  -3.290 1.00 . A A .   2 SER OG   1 1 
        1    19 1 1  3 SER C    C  -20.906   5.601  -1.342 1.00 . A A .   3 SER C    1 1 
        1    20 1 1  3 SER CA   C  -21.610   5.877  -2.667 1.00 . A A .   3 SER CA   1 1 
        1    21 1 1  3 SER CB   C  -22.250   7.266  -2.639 1.00 . A A .   3 SER CB   1 1 
        1    22 1 1  3 SER H    H  -23.091   4.440  -2.190 1.00 . A A .   3 SER H    1 1 
        1    23 1 1  3 SER HA   H  -20.881   5.841  -3.463 1.00 . A A .   3 SER HA   1 1 
        1    24 1 1  3 SER HB2  H  -22.988   7.336  -3.423 1.00 . A A .   3 SER HB2  1 1 
        1    25 1 1  3 SER HB3  H  -22.725   7.421  -1.681 1.00 . A A .   3 SER HB3  1 1 
        1    26 1 1  3 SER HG   H  -21.591   9.101  -2.452 1.00 . A A .   3 SER HG   1 1 
        1    27 1 1  3 SER N    N  -22.620   4.860  -2.940 1.00 . A A .   3 SER N    1 1 
        1    28 1 1  3 SER O    O  -21.495   5.746  -0.272 1.00 . A A .   3 SER O    1 1 
        1    29 1 1  3 SER OG   O  -21.278   8.279  -2.836 1.00 . A A .   3 SER OG   1 1 
        1    30 1 1  4 GLY C    C  -18.406   3.472  -0.171 1.00 . A A .   4 GLY C    1 1 
        1    31 1 1  4 GLY CA   C  -18.876   4.912  -0.225 1.00 . A A .   4 GLY CA   1 1 
        1    32 1 1  4 GLY H    H  -19.223   5.104  -2.305 1.00 . A A .   4 GLY H    1 1 
        1    33 1 1  4 GLY HA2  H  -18.014   5.562  -0.195 1.00 . A A .   4 GLY HA2  1 1 
        1    34 1 1  4 GLY HA3  H  -19.494   5.109   0.639 1.00 . A A .   4 GLY HA3  1 1 
        1    35 1 1  4 GLY N    N  -19.641   5.202  -1.424 1.00 . A A .   4 GLY N    1 1 
        1    36 1 1  4 GLY O    O  -17.794   2.975  -1.117 1.00 . A A .   4 GLY O    1 1 
        1    37 1 1  5 SER C    C  -18.477   0.621  -0.178 1.00 . A A .   5 SER C    1 1 
        1    38 1 1  5 SER CA   C  -18.289   1.409   1.115 1.00 . A A .   5 SER CA   1 1 
        1    39 1 1  5 SER CB   C  -19.096   0.761   2.242 1.00 . A A .   5 SER CB   1 1 
        1    40 1 1  5 SER H    H  -19.182   3.250   1.658 1.00 . A A .   5 SER H    1 1 
        1    41 1 1  5 SER HA   H  -17.243   1.397   1.381 1.00 . A A .   5 SER HA   1 1 
        1    42 1 1  5 SER HB2  H  -20.083   1.197   2.271 1.00 . A A .   5 SER HB2  1 1 
        1    43 1 1  5 SER HB3  H  -19.177  -0.301   2.059 1.00 . A A .   5 SER HB3  1 1 
        1    44 1 1  5 SER HG   H  -18.980   0.523   4.183 1.00 . A A .   5 SER HG   1 1 
        1    45 1 1  5 SER N    N  -18.691   2.799   0.939 1.00 . A A .   5 SER N    1 1 
        1    46 1 1  5 SER O    O  -19.425   0.855  -0.928 1.00 . A A .   5 SER O    1 1 
        1    47 1 1  5 SER OG   O  -18.470   0.962   3.498 1.00 . A A .   5 SER OG   1 1 
        1    48 1 1  6 SER C    C  -18.814  -2.095  -1.578 1.00 . A A .   6 SER C    1 1 
        1    49 1 1  6 SER CA   C  -17.629  -1.135  -1.635 1.00 . A A .   6 SER CA   1 1 
        1    50 1 1  6 SER CB   C  -16.329  -1.921  -1.810 1.00 . A A .   6 SER CB   1 1 
        1    51 1 1  6 SER H    H  -16.835  -0.453   0.205 1.00 . A A .   6 SER H    1 1 
        1    52 1 1  6 SER HA   H  -17.757  -0.474  -2.480 1.00 . A A .   6 SER HA   1 1 
        1    53 1 1  6 SER HB2  H  -16.381  -2.502  -2.718 1.00 . A A .   6 SER HB2  1 1 
        1    54 1 1  6 SER HB3  H  -15.500  -1.231  -1.871 1.00 . A A .   6 SER HB3  1 1 
        1    55 1 1  6 SER HG   H  -15.171  -2.876  -0.550 1.00 . A A .   6 SER HG   1 1 
        1    56 1 1  6 SER N    N  -17.567  -0.314  -0.432 1.00 . A A .   6 SER N    1 1 
        1    57 1 1  6 SER O    O  -19.585  -2.205  -2.530 1.00 . A A .   6 SER O    1 1 
        1    58 1 1  6 SER OG   O  -16.113  -2.799  -0.718 1.00 . A A .   6 SER OG   1 1 
        1    59 1 1  7 GLY C    C  -19.586  -5.051   0.299 1.00 . A A .   7 GLY C    1 1 
        1    60 1 1  7 GLY CA   C  -20.043  -3.731  -0.290 1.00 . A A .   7 GLY CA   1 1 
        1    61 1 1  7 GLY H    H  -18.305  -2.660   0.274 1.00 . A A .   7 GLY H    1 1 
        1    62 1 1  7 GLY HA2  H  -20.786  -3.296   0.362 1.00 . A A .   7 GLY HA2  1 1 
        1    63 1 1  7 GLY HA3  H  -20.489  -3.917  -1.256 1.00 . A A .   7 GLY HA3  1 1 
        1    64 1 1  7 GLY N    N  -18.951  -2.789  -0.452 1.00 . A A .   7 GLY N    1 1 
        1    65 1 1  7 GLY O    O  -19.985  -5.416   1.405 1.00 . A A .   7 GLY O    1 1 
        1    66 1 1  8 ALA C    C  -16.971  -6.882   0.843 1.00 . A A .   8 ALA C    1 1 
        1    67 1 1  8 ALA CA   C  -18.238  -7.057   0.014 1.00 . A A .   8 ALA CA   1 1 
        1    68 1 1  8 ALA CB   C  -17.972  -7.969  -1.174 1.00 . A A .   8 ALA CB   1 1 
        1    69 1 1  8 ALA H    H  -18.468  -5.426  -1.315 1.00 . A A .   8 ALA H    1 1 
        1    70 1 1  8 ALA HA   H  -18.998  -7.519   0.628 1.00 . A A .   8 ALA HA   1 1 
        1    71 1 1  8 ALA HB1  H  -16.909  -8.132  -1.272 1.00 . A A .   8 ALA HB1  1 1 
        1    72 1 1  8 ALA HB2  H  -18.468  -8.916  -1.018 1.00 . A A .   8 ALA HB2  1 1 
        1    73 1 1  8 ALA HB3  H  -18.350  -7.508  -2.074 1.00 . A A .   8 ALA HB3  1 1 
        1    74 1 1  8 ALA N    N  -18.749  -5.770  -0.442 1.00 . A A .   8 ALA N    1 1 
        1    75 1 1  8 ALA O    O  -16.024  -7.657   0.719 1.00 . A A .   8 ALA O    1 1 
        1    76 1 1  9 GLY C    C  -14.637  -5.028   1.745 1.00 . A A .   9 GLY C    1 1 
        1    77 1 1  9 GLY CA   C  -15.803  -5.598   2.527 1.00 . A A .   9 GLY CA   1 1 
        1    78 1 1  9 GLY H    H  -17.744  -5.271   1.747 1.00 . A A .   9 GLY H    1 1 
        1    79 1 1  9 GLY HA2  H  -16.082  -4.898   3.301 1.00 . A A .   9 GLY HA2  1 1 
        1    80 1 1  9 GLY HA3  H  -15.493  -6.525   2.989 1.00 . A A .   9 GLY HA3  1 1 
        1    81 1 1  9 GLY N    N  -16.960  -5.857   1.690 1.00 . A A .   9 GLY N    1 1 
        1    82 1 1  9 GLY O    O  -14.150  -5.651   0.803 1.00 . A A .   9 GLY O    1 1 
        1    83 1 1 10 GLU C    C  -11.795  -4.000   1.607 1.00 . A A .  10 GLU C    1 1 
        1    84 1 1 10 GLU CA   C  -13.076  -3.183   1.461 1.00 . A A .  10 GLU CA   1 1 
        1    85 1 1 10 GLU CB   C  -12.864  -1.777   2.026 1.00 . A A .  10 GLU CB   1 1 
        1    86 1 1 10 GLU CD   C  -12.392   0.626   1.407 1.00 . A A .  10 GLU CD   1 1 
        1    87 1 1 10 GLU CG   C  -12.163  -0.833   1.064 1.00 . A A .  10 GLU CG   1 1 
        1    88 1 1 10 GLU H    H  -14.621  -3.391   2.894 1.00 . A A .  10 GLU H    1 1 
        1    89 1 1 10 GLU HA   H  -13.321  -3.106   0.413 1.00 . A A .  10 GLU HA   1 1 
        1    90 1 1 10 GLU HB2  H  -13.826  -1.354   2.277 1.00 . A A .  10 GLU HB2  1 1 
        1    91 1 1 10 GLU HB3  H  -12.268  -1.849   2.924 1.00 . A A .  10 GLU HB3  1 1 
        1    92 1 1 10 GLU HG2  H  -11.102  -1.031   1.094 1.00 . A A .  10 GLU HG2  1 1 
        1    93 1 1 10 GLU HG3  H  -12.535  -1.015   0.066 1.00 . A A .  10 GLU HG3  1 1 
        1    94 1 1 10 GLU N    N  -14.191  -3.838   2.135 1.00 . A A .  10 GLU N    1 1 
        1    95 1 1 10 GLU O    O  -11.696  -4.871   2.471 1.00 . A A .  10 GLU O    1 1 
        1    96 1 1 10 GLU OE1  O  -13.419   0.932   2.049 1.00 . A A .  10 GLU OE1  1 1 
        1    97 1 1 10 GLU OE2  O  -11.544   1.463   1.033 1.00 . A A .  10 GLU OE2  1 1 
        1    98 1 1 11 LYS C    C   -8.636  -3.854   1.880 1.00 . A A .  11 LYS C    1 1 
        1    99 1 1 11 LYS CA   C   -9.541  -4.417   0.790 1.00 . A A .  11 LYS CA   1 1 
        1   100 1 1 11 LYS CB   C   -8.843  -4.316  -0.569 1.00 . A A .  11 LYS CB   1 1 
        1   101 1 1 11 LYS CD   C   -8.657  -5.395  -2.830 1.00 . A A .  11 LYS CD   1 1 
        1   102 1 1 11 LYS CE   C   -9.427  -5.655  -4.116 1.00 . A A .  11 LYS CE   1 1 
        1   103 1 1 11 LYS CG   C   -9.588  -5.022  -1.689 1.00 . A A .  11 LYS CG   1 1 
        1   104 1 1 11 LYS H    H  -10.955  -3.006   0.090 1.00 . A A .  11 LYS H    1 1 
        1   105 1 1 11 LYS HA   H   -9.742  -5.456   1.005 1.00 . A A .  11 LYS HA   1 1 
        1   106 1 1 11 LYS HB2  H   -8.743  -3.274  -0.832 1.00 . A A .  11 LYS HB2  1 1 
        1   107 1 1 11 LYS HB3  H   -7.859  -4.754  -0.488 1.00 . A A .  11 LYS HB3  1 1 
        1   108 1 1 11 LYS HD2  H   -7.963  -4.584  -2.997 1.00 . A A .  11 LYS HD2  1 1 
        1   109 1 1 11 LYS HD3  H   -8.111  -6.288  -2.560 1.00 . A A .  11 LYS HD3  1 1 
        1   110 1 1 11 LYS HE2  H  -10.373  -6.110  -3.867 1.00 . A A .  11 LYS HE2  1 1 
        1   111 1 1 11 LYS HE3  H   -9.601  -4.712  -4.613 1.00 . A A .  11 LYS HE3  1 1 
        1   112 1 1 11 LYS HG2  H  -10.039  -5.922  -1.298 1.00 . A A .  11 LYS HG2  1 1 
        1   113 1 1 11 LYS HG3  H  -10.360  -4.365  -2.066 1.00 . A A .  11 LYS HG3  1 1 
        1   114 1 1 11 LYS HZ1  H   -8.768  -7.543  -4.719 1.00 . A A .  11 LYS HZ1  1 1 
        1   115 1 1 11 LYS HZ2  H   -7.674  -6.297  -5.052 1.00 . A A .  11 LYS HZ2  1 1 
        1   116 1 1 11 LYS HZ3  H   -9.062  -6.479  -6.000 1.00 . A A .  11 LYS HZ3  1 1 
        1   117 1 1 11 LYS N    N  -10.816  -3.711   0.756 1.00 . A A .  11 LYS N    1 1 
        1   118 1 1 11 LYS NZ   N   -8.681  -6.557  -5.036 1.00 . A A .  11 LYS NZ   1 1 
        1   119 1 1 11 LYS O    O   -8.621  -2.653   2.150 1.00 . A A .  11 LYS O    1 1 
        1   120 1 1 12 PRO C    C   -5.752  -3.547   3.074 1.00 . A A .  12 PRO C    1 1 
        1   121 1 1 12 PRO CA   C   -6.937  -4.354   3.594 1.00 . A A .  12 PRO CA   1 1 
        1   122 1 1 12 PRO CB   C   -6.464  -5.697   4.156 1.00 . A A .  12 PRO CB   1 1 
        1   123 1 1 12 PRO CD   C   -7.827  -6.188   2.255 1.00 . A A .  12 PRO CD   1 1 
        1   124 1 1 12 PRO CG   C   -6.627  -6.658   3.030 1.00 . A A .  12 PRO CG   1 1 
        1   125 1 1 12 PRO HA   H   -7.439  -3.794   4.369 1.00 . A A .  12 PRO HA   1 1 
        1   126 1 1 12 PRO HB2  H   -5.431  -5.617   4.463 1.00 . A A .  12 PRO HB2  1 1 
        1   127 1 1 12 PRO HB3  H   -7.076  -5.972   5.002 1.00 . A A .  12 PRO HB3  1 1 
        1   128 1 1 12 PRO HD2  H   -7.694  -6.381   1.200 1.00 . A A .  12 PRO HD2  1 1 
        1   129 1 1 12 PRO HD3  H   -8.723  -6.668   2.619 1.00 . A A .  12 PRO HD3  1 1 
        1   130 1 1 12 PRO HG2  H   -5.747  -6.643   2.405 1.00 . A A .  12 PRO HG2  1 1 
        1   131 1 1 12 PRO HG3  H   -6.797  -7.651   3.417 1.00 . A A .  12 PRO HG3  1 1 
        1   132 1 1 12 PRO N    N   -7.861  -4.740   2.524 1.00 . A A .  12 PRO N    1 1 
        1   133 1 1 12 PRO O    O   -5.078  -2.854   3.836 1.00 . A A .  12 PRO O    1 1 
        1   134 1 1 13 TYR C    C   -4.913  -1.783   0.276 1.00 . A A .  13 TYR C    1 1 
        1   135 1 1 13 TYR CA   C   -4.398  -2.923   1.151 1.00 . A A .  13 TYR CA   1 1 
        1   136 1 1 13 TYR CB   C   -3.546  -3.878   0.314 1.00 . A A .  13 TYR CB   1 1 
        1   137 1 1 13 TYR CD1  C   -2.671  -5.409   2.122 1.00 . A A .  13 TYR CD1  1 1 
        1   138 1 1 13 TYR CD2  C   -3.931  -6.374   0.344 1.00 . A A .  13 TYR CD2  1 1 
        1   139 1 1 13 TYR CE1  C   -2.516  -6.656   2.695 1.00 . A A .  13 TYR CE1  1 1 
        1   140 1 1 13 TYR CE2  C   -3.782  -7.625   0.911 1.00 . A A .  13 TYR CE2  1 1 
        1   141 1 1 13 TYR CG   C   -3.379  -5.245   0.938 1.00 . A A .  13 TYR CG   1 1 
        1   142 1 1 13 TYR CZ   C   -3.073  -7.761   2.086 1.00 . A A .  13 TYR CZ   1 1 
        1   143 1 1 13 TYR H    H   -6.076  -4.211   1.216 1.00 . A A .  13 TYR H    1 1 
        1   144 1 1 13 TYR HA   H   -3.787  -2.508   1.939 1.00 . A A .  13 TYR HA   1 1 
        1   145 1 1 13 TYR HB2  H   -4.009  -4.010  -0.652 1.00 . A A .  13 TYR HB2  1 1 
        1   146 1 1 13 TYR HB3  H   -2.563  -3.451   0.182 1.00 . A A .  13 TYR HB3  1 1 
        1   147 1 1 13 TYR HD1  H   -2.236  -4.541   2.597 1.00 . A A .  13 TYR HD1  1 1 
        1   148 1 1 13 TYR HD2  H   -4.486  -6.264  -0.577 1.00 . A A .  13 TYR HD2  1 1 
        1   149 1 1 13 TYR HE1  H   -1.961  -6.763   3.616 1.00 . A A .  13 TYR HE1  1 1 
        1   150 1 1 13 TYR HE2  H   -4.218  -8.490   0.434 1.00 . A A .  13 TYR HE2  1 1 
        1   151 1 1 13 TYR HH   H   -2.570  -9.614   2.001 1.00 . A A .  13 TYR HH   1 1 
        1   152 1 1 13 TYR N    N   -5.503  -3.642   1.772 1.00 . A A .  13 TYR N    1 1 
        1   153 1 1 13 TYR O    O   -4.973  -1.903  -0.947 1.00 . A A .  13 TYR O    1 1 
        1   154 1 1 13 TYR OH   O   -2.922  -9.005   2.654 1.00 . A A .  13 TYR OH   1 1 
        1   155 1 1 14 GLY C    C   -5.070   1.753   0.545 1.00 . A A .  14 GLY C    1 1 
        1   156 1 1 14 GLY CA   C   -5.788   0.469   0.180 1.00 . A A .  14 GLY CA   1 1 
        1   157 1 1 14 GLY H    H   -5.214  -0.639   1.891 1.00 . A A .  14 GLY H    1 1 
        1   158 1 1 14 GLY HA2  H   -5.665   0.288  -0.877 1.00 . A A .  14 GLY HA2  1 1 
        1   159 1 1 14 GLY HA3  H   -6.840   0.584   0.395 1.00 . A A .  14 GLY HA3  1 1 
        1   160 1 1 14 GLY N    N   -5.283  -0.677   0.914 1.00 . A A .  14 GLY N    1 1 
        1   161 1 1 14 GLY O    O   -5.215   2.259   1.658 1.00 . A A .  14 GLY O    1 1 
        1   162 1 1 15 CYS C    C   -4.493   4.676   0.123 1.00 . A A .  15 CYS C    1 1 
        1   163 1 1 15 CYS CA   C   -3.547   3.513  -0.165 1.00 . A A .  15 CYS CA   1 1 
        1   164 1 1 15 CYS CB   C   -2.675   3.839  -1.380 1.00 . A A .  15 CYS CB   1 1 
        1   165 1 1 15 CYS H    H   -4.217   1.832  -1.262 1.00 . A A .  15 CYS H    1 1 
        1   166 1 1 15 CYS HA   H   -2.910   3.362   0.693 1.00 . A A .  15 CYS HA   1 1 
        1   167 1 1 15 CYS HB2  H   -1.924   3.071  -1.490 1.00 . A A .  15 CYS HB2  1 1 
        1   168 1 1 15 CYS HB3  H   -3.296   3.859  -2.264 1.00 . A A .  15 CYS HB3  1 1 
        1   169 1 1 15 CYS N    N   -4.292   2.281  -0.394 1.00 . A A .  15 CYS N    1 1 
        1   170 1 1 15 CYS O    O   -5.538   4.811  -0.513 1.00 . A A .  15 CYS O    1 1 
        1   171 1 1 15 CYS SG   S   -1.816   5.442  -1.269 1.00 . A A .  15 CYS SG   1 1 
        1   172 1 1 16 SER C    C   -4.326   7.956   0.926 1.00 . A A .  16 SER C    1 1 
        1   173 1 1 16 SER CA   C   -4.933   6.662   1.460 1.00 . A A .  16 SER CA   1 1 
        1   174 1 1 16 SER CB   C   -5.073   6.740   2.981 1.00 . A A .  16 SER CB   1 1 
        1   175 1 1 16 SER H    H   -3.272   5.351   1.555 1.00 . A A .  16 SER H    1 1 
        1   176 1 1 16 SER HA   H   -5.912   6.530   1.023 1.00 . A A .  16 SER HA   1 1 
        1   177 1 1 16 SER HB2  H   -4.120   6.523   3.439 1.00 . A A .  16 SER HB2  1 1 
        1   178 1 1 16 SER HB3  H   -5.388   7.735   3.260 1.00 . A A .  16 SER HB3  1 1 
        1   179 1 1 16 SER HG   H   -5.582   5.013   3.754 1.00 . A A .  16 SER HG   1 1 
        1   180 1 1 16 SER N    N   -4.117   5.513   1.085 1.00 . A A .  16 SER N    1 1 
        1   181 1 1 16 SER O    O   -5.041   8.914   0.634 1.00 . A A .  16 SER O    1 1 
        1   182 1 1 16 SER OG   O   -6.030   5.808   3.454 1.00 . A A .  16 SER OG   1 1 
        1   183 1 1 17 GLU C    C   -2.984   9.709  -0.940 1.00 . A A .  17 GLU C    1 1 
        1   184 1 1 17 GLU CA   C   -2.299   9.151   0.305 1.00 . A A .  17 GLU CA   1 1 
        1   185 1 1 17 GLU CB   C   -0.843   8.806  -0.013 1.00 . A A .  17 GLU CB   1 1 
        1   186 1 1 17 GLU CD   C    0.019   9.842   2.123 1.00 . A A .  17 GLU CD   1 1 
        1   187 1 1 17 GLU CG   C    0.023   8.622   1.222 1.00 . A A .  17 GLU CG   1 1 
        1   188 1 1 17 GLU H    H   -2.487   7.179   1.052 1.00 . A A .  17 GLU H    1 1 
        1   189 1 1 17 GLU HA   H   -2.320   9.902   1.080 1.00 . A A .  17 GLU HA   1 1 
        1   190 1 1 17 GLU HB2  H   -0.819   7.889  -0.584 1.00 . A A .  17 GLU HB2  1 1 
        1   191 1 1 17 GLU HB3  H   -0.419   9.601  -0.609 1.00 . A A .  17 GLU HB3  1 1 
        1   192 1 1 17 GLU HG2  H   -0.348   7.778   1.784 1.00 . A A .  17 GLU HG2  1 1 
        1   193 1 1 17 GLU HG3  H    1.038   8.427   0.909 1.00 . A A .  17 GLU HG3  1 1 
        1   194 1 1 17 GLU N    N   -3.003   7.975   0.802 1.00 . A A .  17 GLU N    1 1 
        1   195 1 1 17 GLU O    O   -3.274  10.903  -1.020 1.00 . A A .  17 GLU O    1 1 
        1   196 1 1 17 GLU OE1  O   -0.177  10.962   1.606 1.00 . A A .  17 GLU OE1  1 1 
        1   197 1 1 17 GLU OE2  O    0.213   9.676   3.346 1.00 . A A .  17 GLU OE2  1 1 
        1   198 1 1 18 CYS C    C   -5.233   8.534  -3.314 1.00 . A A .  18 CYS C    1 1 
        1   199 1 1 18 CYS CA   C   -3.890   9.239  -3.149 1.00 . A A .  18 CYS CA   1 1 
        1   200 1 1 18 CYS CB   C   -2.988   8.929  -4.346 1.00 . A A .  18 CYS CB   1 1 
        1   201 1 1 18 CYS H    H   -2.986   7.897  -1.785 1.00 . A A .  18 CYS H    1 1 
        1   202 1 1 18 CYS HA   H   -4.060  10.304  -3.104 1.00 . A A .  18 CYS HA   1 1 
        1   203 1 1 18 CYS HB2  H   -3.477   9.261  -5.250 1.00 . A A .  18 CYS HB2  1 1 
        1   204 1 1 18 CYS HB3  H   -2.055   9.460  -4.231 1.00 . A A .  18 CYS HB3  1 1 
        1   205 1 1 18 CYS N    N   -3.240   8.836  -1.908 1.00 . A A .  18 CYS N    1 1 
        1   206 1 1 18 CYS O    O   -6.210   9.132  -3.764 1.00 . A A .  18 CYS O    1 1 
        1   207 1 1 18 CYS SG   S   -2.599   7.160  -4.545 1.00 . A A .  18 CYS SG   1 1 
        1   208 1 1 19 GLY C    C   -6.400   5.385  -4.094 1.00 . A A .  19 GLY C    1 1 
        1   209 1 1 19 GLY CA   C   -6.501   6.490  -3.062 1.00 . A A .  19 GLY CA   1 1 
        1   210 1 1 19 GLY H    H   -4.464   6.831  -2.595 1.00 . A A .  19 GLY H    1 1 
        1   211 1 1 19 GLY HA2  H   -6.730   6.052  -2.102 1.00 . A A .  19 GLY HA2  1 1 
        1   212 1 1 19 GLY HA3  H   -7.303   7.157  -3.342 1.00 . A A .  19 GLY HA3  1 1 
        1   213 1 1 19 GLY N    N   -5.274   7.256  -2.947 1.00 . A A .  19 GLY N    1 1 
        1   214 1 1 19 GLY O    O   -7.182   5.340  -5.045 1.00 . A A .  19 GLY O    1 1 
        1   215 1 1 20 LYS C    C   -5.222   2.050  -4.089 1.00 . A A .  20 LYS C    1 1 
        1   216 1 1 20 LYS CA   C   -5.232   3.382  -4.834 1.00 . A A .  20 LYS CA   1 1 
        1   217 1 1 20 LYS CB   C   -3.919   3.560  -5.599 1.00 . A A .  20 LYS CB   1 1 
        1   218 1 1 20 LYS CD   C   -2.643   3.222  -7.736 1.00 . A A .  20 LYS CD   1 1 
        1   219 1 1 20 LYS CE   C   -2.668   2.620  -9.133 1.00 . A A .  20 LYS CE   1 1 
        1   220 1 1 20 LYS CG   C   -3.937   2.947  -6.989 1.00 . A A .  20 LYS CG   1 1 
        1   221 1 1 20 LYS H    H   -4.842   4.582  -3.134 1.00 . A A .  20 LYS H    1 1 
        1   222 1 1 20 LYS HA   H   -6.051   3.381  -5.536 1.00 . A A .  20 LYS HA   1 1 
        1   223 1 1 20 LYS HB2  H   -3.714   4.616  -5.697 1.00 . A A .  20 LYS HB2  1 1 
        1   224 1 1 20 LYS HB3  H   -3.122   3.098  -5.035 1.00 . A A .  20 LYS HB3  1 1 
        1   225 1 1 20 LYS HD2  H   -2.505   4.290  -7.819 1.00 . A A .  20 LYS HD2  1 1 
        1   226 1 1 20 LYS HD3  H   -1.819   2.792  -7.183 1.00 . A A .  20 LYS HD3  1 1 
        1   227 1 1 20 LYS HE2  H   -1.652   2.502  -9.478 1.00 . A A .  20 LYS HE2  1 1 
        1   228 1 1 20 LYS HE3  H   -3.147   1.654  -9.086 1.00 . A A .  20 LYS HE3  1 1 
        1   229 1 1 20 LYS HG2  H   -4.068   1.878  -6.899 1.00 . A A .  20 LYS HG2  1 1 
        1   230 1 1 20 LYS HG3  H   -4.761   3.367  -7.547 1.00 . A A .  20 LYS HG3  1 1 
        1   231 1 1 20 LYS HZ1  H   -4.426   3.469  -9.877 1.00 . A A .  20 LYS HZ1  1 1 
        1   232 1 1 20 LYS HZ2  H   -3.268   3.137 -11.066 1.00 . A A .  20 LYS HZ2  1 1 
        1   233 1 1 20 LYS HZ3  H   -3.065   4.462 -10.035 1.00 . A A .  20 LYS HZ3  1 1 
        1   234 1 1 20 LYS N    N   -5.434   4.492  -3.911 1.00 . A A .  20 LYS N    1 1 
        1   235 1 1 20 LYS NZ   N   -3.409   3.482 -10.095 1.00 . A A .  20 LYS NZ   1 1 
        1   236 1 1 20 LYS O    O   -4.479   1.874  -3.125 1.00 . A A .  20 LYS O    1 1 
        1   237 1 1 21 ALA C    C   -5.261  -1.210  -4.660 1.00 . A A .  21 ALA C    1 1 
        1   238 1 1 21 ALA CA   C   -6.134  -0.199  -3.924 1.00 . A A .  21 ALA CA   1 1 
        1   239 1 1 21 ALA CB   C   -7.579  -0.675  -3.887 1.00 . A A .  21 ALA CB   1 1 
        1   240 1 1 21 ALA H    H   -6.619   1.317  -5.318 1.00 . A A .  21 ALA H    1 1 
        1   241 1 1 21 ALA HA   H   -5.784  -0.111  -2.905 1.00 . A A .  21 ALA HA   1 1 
        1   242 1 1 21 ALA HB1  H   -8.111  -0.149  -3.108 1.00 . A A .  21 ALA HB1  1 1 
        1   243 1 1 21 ALA HB2  H   -8.047  -0.476  -4.841 1.00 . A A .  21 ALA HB2  1 1 
        1   244 1 1 21 ALA HB3  H   -7.604  -1.736  -3.688 1.00 . A A .  21 ALA HB3  1 1 
        1   245 1 1 21 ALA N    N   -6.051   1.117  -4.545 1.00 . A A .  21 ALA N    1 1 
        1   246 1 1 21 ALA O    O   -4.897  -1.004  -5.818 1.00 . A A .  21 ALA O    1 1 
        1   247 1 1 22 PHE C    C   -4.458  -4.715  -4.004 1.00 . A A .  22 PHE C    1 1 
        1   248 1 1 22 PHE CA   C   -4.096  -3.345  -4.570 1.00 . A A .  22 PHE CA   1 1 
        1   249 1 1 22 PHE CB   C   -2.616  -3.050  -4.315 1.00 . A A .  22 PHE CB   1 1 
        1   250 1 1 22 PHE CD1  C   -2.069  -1.178  -5.893 1.00 . A A .  22 PHE CD1  1 1 
        1   251 1 1 22 PHE CD2  C   -2.035  -0.732  -3.551 1.00 . A A .  22 PHE CD2  1 1 
        1   252 1 1 22 PHE CE1  C   -1.715   0.133  -6.151 1.00 . A A .  22 PHE CE1  1 1 
        1   253 1 1 22 PHE CE2  C   -1.682   0.580  -3.802 1.00 . A A .  22 PHE CE2  1 1 
        1   254 1 1 22 PHE CG   C   -2.232  -1.625  -4.592 1.00 . A A .  22 PHE CG   1 1 
        1   255 1 1 22 PHE CZ   C   -1.523   1.014  -5.104 1.00 . A A .  22 PHE CZ   1 1 
        1   256 1 1 22 PHE H    H   -5.249  -2.410  -3.061 1.00 . A A .  22 PHE H    1 1 
        1   257 1 1 22 PHE HA   H   -4.275  -3.349  -5.634 1.00 . A A .  22 PHE HA   1 1 
        1   258 1 1 22 PHE HB2  H   -2.387  -3.260  -3.281 1.00 . A A .  22 PHE HB2  1 1 
        1   259 1 1 22 PHE HB3  H   -2.016  -3.686  -4.949 1.00 . A A .  22 PHE HB3  1 1 
        1   260 1 1 22 PHE HD1  H   -2.221  -1.864  -6.713 1.00 . A A .  22 PHE HD1  1 1 
        1   261 1 1 22 PHE HD2  H   -2.160  -1.070  -2.532 1.00 . A A .  22 PHE HD2  1 1 
        1   262 1 1 22 PHE HE1  H   -1.592   0.470  -7.169 1.00 . A A .  22 PHE HE1  1 1 
        1   263 1 1 22 PHE HE2  H   -1.532   1.266  -2.981 1.00 . A A .  22 PHE HE2  1 1 
        1   264 1 1 22 PHE HZ   H   -1.246   2.038  -5.302 1.00 . A A .  22 PHE HZ   1 1 
        1   265 1 1 22 PHE N    N   -4.928  -2.303  -3.981 1.00 . A A .  22 PHE N    1 1 
        1   266 1 1 22 PHE O    O   -4.719  -4.856  -2.810 1.00 . A A .  22 PHE O    1 1 
        1   267 1 1 23 SER C    C   -3.563  -7.826  -3.984 1.00 . A A .  23 SER C    1 1 
        1   268 1 1 23 SER CA   C   -4.806  -7.081  -4.460 1.00 . A A .  23 SER CA   1 1 
        1   269 1 1 23 SER CB   C   -5.458  -7.840  -5.617 1.00 . A A .  23 SER CB   1 1 
        1   270 1 1 23 SER H    H   -4.254  -5.546  -5.811 1.00 . A A .  23 SER H    1 1 
        1   271 1 1 23 SER HA   H   -5.508  -7.016  -3.642 1.00 . A A .  23 SER HA   1 1 
        1   272 1 1 23 SER HB2  H   -5.770  -8.815  -5.274 1.00 . A A .  23 SER HB2  1 1 
        1   273 1 1 23 SER HB3  H   -6.319  -7.289  -5.966 1.00 . A A .  23 SER HB3  1 1 
        1   274 1 1 23 SER HG   H   -3.948  -7.258  -6.721 1.00 . A A .  23 SER HG   1 1 
        1   275 1 1 23 SER N    N   -4.472  -5.722  -4.872 1.00 . A A .  23 SER N    1 1 
        1   276 1 1 23 SER O    O   -3.453  -9.041  -4.147 1.00 . A A .  23 SER O    1 1 
        1   277 1 1 23 SER OG   O   -4.552  -8.004  -6.695 1.00 . A A .  23 SER OG   1 1 
        1   278 1 1 24 SER C    C   -0.642  -6.693  -2.002 1.00 . A A .  24 SER C    1 1 
        1   279 1 1 24 SER CA   C   -1.389  -7.676  -2.899 1.00 . A A .  24 SER CA   1 1 
        1   280 1 1 24 SER CB   C   -0.496  -8.098  -4.067 1.00 . A A .  24 SER CB   1 1 
        1   281 1 1 24 SER H    H   -2.773  -6.123  -3.295 1.00 . A A .  24 SER H    1 1 
        1   282 1 1 24 SER HA   H   -1.647  -8.550  -2.319 1.00 . A A .  24 SER HA   1 1 
        1   283 1 1 24 SER HB2  H    0.539  -8.046  -3.763 1.00 . A A .  24 SER HB2  1 1 
        1   284 1 1 24 SER HB3  H   -0.736  -9.113  -4.352 1.00 . A A .  24 SER HB3  1 1 
        1   285 1 1 24 SER HG   H   -1.595  -7.322  -5.490 1.00 . A A .  24 SER HG   1 1 
        1   286 1 1 24 SER N    N   -2.627  -7.087  -3.396 1.00 . A A .  24 SER N    1 1 
        1   287 1 1 24 SER O    O   -0.144  -5.667  -2.465 1.00 . A A .  24 SER O    1 1 
        1   288 1 1 24 SER OG   O   -0.687  -7.252  -5.187 1.00 . A A .  24 SER OG   1 1 
        1   289 1 1 25 LYS C    C    1.445  -5.664  -0.314 1.00 . A A .  25 LYS C    1 1 
        1   290 1 1 25 LYS CA   C    0.119  -6.164   0.249 1.00 . A A .  25 LYS CA   1 1 
        1   291 1 1 25 LYS CB   C    0.361  -6.928   1.553 1.00 . A A .  25 LYS CB   1 1 
        1   292 1 1 25 LYS CD   C    2.102  -5.633   2.820 1.00 . A A .  25 LYS CD   1 1 
        1   293 1 1 25 LYS CE   C    2.473  -5.135   4.208 1.00 . A A .  25 LYS CE   1 1 
        1   294 1 1 25 LYS CG   C    0.636  -6.026   2.744 1.00 . A A .  25 LYS CG   1 1 
        1   295 1 1 25 LYS H    H   -0.985  -7.848  -0.406 1.00 . A A .  25 LYS H    1 1 
        1   296 1 1 25 LYS HA   H   -0.515  -5.314   0.452 1.00 . A A .  25 LYS HA   1 1 
        1   297 1 1 25 LYS HB2  H   -0.511  -7.525   1.774 1.00 . A A .  25 LYS HB2  1 1 
        1   298 1 1 25 LYS HB3  H    1.211  -7.582   1.420 1.00 . A A .  25 LYS HB3  1 1 
        1   299 1 1 25 LYS HD2  H    2.709  -6.495   2.585 1.00 . A A .  25 LYS HD2  1 1 
        1   300 1 1 25 LYS HD3  H    2.293  -4.849   2.102 1.00 . A A .  25 LYS HD3  1 1 
        1   301 1 1 25 LYS HE2  H    2.274  -4.076   4.262 1.00 . A A .  25 LYS HE2  1 1 
        1   302 1 1 25 LYS HE3  H    1.866  -5.652   4.937 1.00 . A A .  25 LYS HE3  1 1 
        1   303 1 1 25 LYS HG2  H    0.039  -5.130   2.651 1.00 . A A .  25 LYS HG2  1 1 
        1   304 1 1 25 LYS HG3  H    0.364  -6.549   3.650 1.00 . A A .  25 LYS HG3  1 1 
        1   305 1 1 25 LYS HZ1  H    4.417  -5.667   3.658 1.00 . A A .  25 LYS HZ1  1 1 
        1   306 1 1 25 LYS HZ2  H    4.002  -6.123   5.233 1.00 . A A .  25 LYS HZ2  1 1 
        1   307 1 1 25 LYS HZ3  H    4.347  -4.505   4.884 1.00 . A A .  25 LYS HZ3  1 1 
        1   308 1 1 25 LYS N    N   -0.568  -7.015  -0.715 1.00 . A A .  25 LYS N    1 1 
        1   309 1 1 25 LYS NZ   N    3.910  -5.374   4.517 1.00 . A A .  25 LYS NZ   1 1 
        1   310 1 1 25 LYS O    O    1.646  -4.461  -0.482 1.00 . A A .  25 LYS O    1 1 
        1   311 1 1 26 SER C    C    3.537  -5.139  -2.188 1.00 . A A .  26 SER C    1 1 
        1   312 1 1 26 SER CA   C    3.656  -6.249  -1.148 1.00 . A A .  26 SER CA   1 1 
        1   313 1 1 26 SER CB   C    4.315  -7.480  -1.774 1.00 . A A .  26 SER CB   1 1 
        1   314 1 1 26 SER H    H    2.129  -7.539  -0.450 1.00 . A A .  26 SER H    1 1 
        1   315 1 1 26 SER HA   H    4.271  -5.898  -0.333 1.00 . A A .  26 SER HA   1 1 
        1   316 1 1 26 SER HB2  H    3.712  -7.827  -2.599 1.00 . A A .  26 SER HB2  1 1 
        1   317 1 1 26 SER HB3  H    5.299  -7.216  -2.133 1.00 . A A .  26 SER HB3  1 1 
        1   318 1 1 26 SER HG   H    4.145  -9.352  -1.222 1.00 . A A .  26 SER HG   1 1 
        1   319 1 1 26 SER N    N    2.348  -6.596  -0.606 1.00 . A A .  26 SER N    1 1 
        1   320 1 1 26 SER O    O    4.313  -4.183  -2.184 1.00 . A A .  26 SER O    1 1 
        1   321 1 1 26 SER OG   O    4.440  -8.528  -0.828 1.00 . A A .  26 SER OG   1 1 
        1   322 1 1 27 TYR C    C    2.134  -2.894  -3.528 1.00 . A A .  27 TYR C    1 1 
        1   323 1 1 27 TYR CA   C    2.338  -4.283  -4.125 1.00 . A A .  27 TYR CA   1 1 
        1   324 1 1 27 TYR CB   C    1.124  -4.669  -4.972 1.00 . A A .  27 TYR CB   1 1 
        1   325 1 1 27 TYR CD1  C    2.206  -4.618  -7.253 1.00 . A A .  27 TYR CD1  1 1 
        1   326 1 1 27 TYR CD2  C    0.272  -3.272  -6.895 1.00 . A A .  27 TYR CD2  1 1 
        1   327 1 1 27 TYR CE1  C    2.281  -4.171  -8.558 1.00 . A A .  27 TYR CE1  1 1 
        1   328 1 1 27 TYR CE2  C    0.338  -2.821  -8.199 1.00 . A A .  27 TYR CE2  1 1 
        1   329 1 1 27 TYR CG   C    1.202  -4.178  -6.400 1.00 . A A .  27 TYR CG   1 1 
        1   330 1 1 27 TYR CZ   C    1.345  -3.273  -9.027 1.00 . A A .  27 TYR CZ   1 1 
        1   331 1 1 27 TYR H    H    1.972  -6.056  -3.029 1.00 . A A .  27 TYR H    1 1 
        1   332 1 1 27 TYR HA   H    3.214  -4.267  -4.756 1.00 . A A .  27 TYR HA   1 1 
        1   333 1 1 27 TYR HB2  H    1.039  -5.745  -4.997 1.00 . A A .  27 TYR HB2  1 1 
        1   334 1 1 27 TYR HB3  H    0.234  -4.252  -4.525 1.00 . A A .  27 TYR HB3  1 1 
        1   335 1 1 27 TYR HD1  H    2.938  -5.321  -6.884 1.00 . A A .  27 TYR HD1  1 1 
        1   336 1 1 27 TYR HD2  H   -0.515  -2.920  -6.244 1.00 . A A .  27 TYR HD2  1 1 
        1   337 1 1 27 TYR HE1  H    3.069  -4.525  -9.207 1.00 . A A .  27 TYR HE1  1 1 
        1   338 1 1 27 TYR HE2  H   -0.394  -2.117  -8.566 1.00 . A A .  27 TYR HE2  1 1 
        1   339 1 1 27 TYR HH   H    0.779  -3.302 -10.864 1.00 . A A .  27 TYR HH   1 1 
        1   340 1 1 27 TYR N    N    2.559  -5.273  -3.077 1.00 . A A .  27 TYR N    1 1 
        1   341 1 1 27 TYR O    O    2.787  -1.930  -3.930 1.00 . A A .  27 TYR O    1 1 
        1   342 1 1 27 TYR OH   O    1.416  -2.825 -10.326 1.00 . A A .  27 TYR OH   1 1 
        1   343 1 1 28 LEU C    C    2.216  -0.849  -1.445 1.00 . A A .  28 LEU C    1 1 
        1   344 1 1 28 LEU CA   C    0.933  -1.528  -1.910 1.00 . A A .  28 LEU CA   1 1 
        1   345 1 1 28 LEU CB   C   -0.002  -1.748  -0.720 1.00 . A A .  28 LEU CB   1 1 
        1   346 1 1 28 LEU CD1  C   -0.730   0.625  -0.367 1.00 . A A .  28 LEU CD1  1 1 
        1   347 1 1 28 LEU CD2  C   -0.888  -1.021   1.510 1.00 . A A .  28 LEU CD2  1 1 
        1   348 1 1 28 LEU CG   C   -0.096  -0.596   0.282 1.00 . A A .  28 LEU CG   1 1 
        1   349 1 1 28 LEU H    H    0.735  -3.601  -2.287 1.00 . A A .  28 LEU H    1 1 
        1   350 1 1 28 LEU HA   H    0.442  -0.890  -2.630 1.00 . A A .  28 LEU HA   1 1 
        1   351 1 1 28 LEU HB2  H   -0.993  -1.931  -1.106 1.00 . A A .  28 LEU HB2  1 1 
        1   352 1 1 28 LEU HB3  H    0.342  -2.624  -0.187 1.00 . A A .  28 LEU HB3  1 1 
        1   353 1 1 28 LEU HD11 H   -1.805   0.530  -0.339 1.00 . A A .  28 LEU HD11 1 1 
        1   354 1 1 28 LEU HD12 H   -0.401   0.698  -1.394 1.00 . A A .  28 LEU HD12 1 1 
        1   355 1 1 28 LEU HD13 H   -0.431   1.513   0.170 1.00 . A A .  28 LEU HD13 1 1 
        1   356 1 1 28 LEU HD21 H   -1.204  -2.047   1.398 1.00 . A A .  28 LEU HD21 1 1 
        1   357 1 1 28 LEU HD22 H   -1.755  -0.386   1.616 1.00 . A A .  28 LEU HD22 1 1 
        1   358 1 1 28 LEU HD23 H   -0.266  -0.929   2.389 1.00 . A A .  28 LEU HD23 1 1 
        1   359 1 1 28 LEU HG   H    0.900  -0.324   0.602 1.00 . A A .  28 LEU HG   1 1 
        1   360 1 1 28 LEU N    N    1.224  -2.799  -2.565 1.00 . A A .  28 LEU N    1 1 
        1   361 1 1 28 LEU O    O    2.410   0.348  -1.659 1.00 . A A .  28 LEU O    1 1 
        1   362 1 1 29 ILE C    C    5.133  -0.398  -1.429 1.00 . A A .  29 ILE C    1 1 
        1   363 1 1 29 ILE CA   C    4.358  -1.094  -0.316 1.00 . A A .  29 ILE CA   1 1 
        1   364 1 1 29 ILE CB   C    5.234  -2.208   0.286 1.00 . A A .  29 ILE CB   1 1 
        1   365 1 1 29 ILE CD1  C    5.053  -4.240   1.809 1.00 . A A .  29 ILE CD1  1 1 
        1   366 1 1 29 ILE CG1  C    4.521  -2.865   1.470 1.00 . A A .  29 ILE CG1  1 1 
        1   367 1 1 29 ILE CG2  C    6.581  -1.646   0.718 1.00 . A A .  29 ILE CG2  1 1 
        1   368 1 1 29 ILE H    H    2.880  -2.567  -0.668 1.00 . A A .  29 ILE H    1 1 
        1   369 1 1 29 ILE HA   H    4.140  -0.375   0.461 1.00 . A A .  29 ILE HA   1 1 
        1   370 1 1 29 ILE HB   H    5.409  -2.950  -0.477 1.00 . A A .  29 ILE HB   1 1 
        1   371 1 1 29 ILE HD11 H    4.267  -4.970   1.687 1.00 . A A .  29 ILE HD11 1 1 
        1   372 1 1 29 ILE HD12 H    5.873  -4.482   1.148 1.00 . A A .  29 ILE HD12 1 1 
        1   373 1 1 29 ILE HD13 H    5.399  -4.250   2.832 1.00 . A A .  29 ILE HD13 1 1 
        1   374 1 1 29 ILE HG12 H    4.634  -2.241   2.342 1.00 . A A .  29 ILE HG12 1 1 
        1   375 1 1 29 ILE HG13 H    3.470  -2.963   1.237 1.00 . A A .  29 ILE HG13 1 1 
        1   376 1 1 29 ILE HG21 H    6.461  -1.089   1.636 1.00 . A A .  29 ILE HG21 1 1 
        1   377 1 1 29 ILE HG22 H    7.274  -2.459   0.880 1.00 . A A .  29 ILE HG22 1 1 
        1   378 1 1 29 ILE HG23 H    6.963  -0.994  -0.052 1.00 . A A .  29 ILE HG23 1 1 
        1   379 1 1 29 ILE N    N    3.091  -1.621  -0.808 1.00 . A A .  29 ILE N    1 1 
        1   380 1 1 29 ILE O    O    5.576   0.741  -1.272 1.00 . A A .  29 ILE O    1 1 
        1   381 1 1 30 ILE C    C    5.394   0.783  -4.146 1.00 . A A .  30 ILE C    1 1 
        1   382 1 1 30 ILE CA   C    6.012  -0.535  -3.693 1.00 . A A .  30 ILE CA   1 1 
        1   383 1 1 30 ILE CB   C    6.027  -1.517  -4.880 1.00 . A A .  30 ILE CB   1 1 
        1   384 1 1 30 ILE CD1  C    6.441  -3.962  -5.452 1.00 . A A .  30 ILE CD1  1 1 
        1   385 1 1 30 ILE CG1  C    6.679  -2.838  -4.468 1.00 . A A .  30 ILE CG1  1 1 
        1   386 1 1 30 ILE CG2  C    6.760  -0.905  -6.064 1.00 . A A .  30 ILE CG2  1 1 
        1   387 1 1 30 ILE H    H    4.917  -1.991  -2.617 1.00 . A A .  30 ILE H    1 1 
        1   388 1 1 30 ILE HA   H    7.033  -0.355  -3.387 1.00 . A A .  30 ILE HA   1 1 
        1   389 1 1 30 ILE HB   H    5.007  -1.704  -5.176 1.00 . A A .  30 ILE HB   1 1 
        1   390 1 1 30 ILE HD11 H    5.861  -3.593  -6.286 1.00 . A A .  30 ILE HD11 1 1 
        1   391 1 1 30 ILE HD12 H    7.389  -4.334  -5.811 1.00 . A A .  30 ILE HD12 1 1 
        1   392 1 1 30 ILE HD13 H    5.901  -4.760  -4.965 1.00 . A A .  30 ILE HD13 1 1 
        1   393 1 1 30 ILE HG12 H    7.744  -2.695  -4.380 1.00 . A A .  30 ILE HG12 1 1 
        1   394 1 1 30 ILE HG13 H    6.281  -3.144  -3.511 1.00 . A A .  30 ILE HG13 1 1 
        1   395 1 1 30 ILE HG21 H    6.533   0.149  -6.122 1.00 . A A .  30 ILE HG21 1 1 
        1   396 1 1 30 ILE HG22 H    7.824  -1.036  -5.935 1.00 . A A .  30 ILE HG22 1 1 
        1   397 1 1 30 ILE HG23 H    6.444  -1.392  -6.974 1.00 . A A .  30 ILE HG23 1 1 
        1   398 1 1 30 ILE N    N    5.293  -1.088  -2.553 1.00 . A A .  30 ILE N    1 1 
        1   399 1 1 30 ILE O    O    6.099   1.696  -4.578 1.00 . A A .  30 ILE O    1 1 
        1   400 1 1 31 HIS C    C    3.594   3.210  -3.439 1.00 . A A .  31 HIS C    1 1 
        1   401 1 1 31 HIS CA   C    3.358   2.085  -4.441 1.00 . A A .  31 HIS CA   1 1 
        1   402 1 1 31 HIS CB   C    1.860   1.801  -4.562 1.00 . A A .  31 HIS CB   1 1 
        1   403 1 1 31 HIS CD2  C    0.420   3.821  -3.806 1.00 . A A .  31 HIS CD2  1 1 
        1   404 1 1 31 HIS CE1  C   -0.010   4.666  -5.782 1.00 . A A .  31 HIS CE1  1 1 
        1   405 1 1 31 HIS CG   C    1.028   3.035  -4.725 1.00 . A A .  31 HIS CG   1 1 
        1   406 1 1 31 HIS H    H    3.565   0.115  -3.693 1.00 . A A .  31 HIS H    1 1 
        1   407 1 1 31 HIS HA   H    3.736   2.392  -5.404 1.00 . A A .  31 HIS HA   1 1 
        1   408 1 1 31 HIS HB2  H    1.689   1.170  -5.422 1.00 . A A .  31 HIS HB2  1 1 
        1   409 1 1 31 HIS HB3  H    1.524   1.288  -3.673 1.00 . A A .  31 HIS HB3  1 1 
        1   410 1 1 31 HIS HD1  H    1.038   3.249  -6.821 1.00 . A A .  31 HIS HD1  1 1 
        1   411 1 1 31 HIS HD2  H    0.435   3.683  -2.734 1.00 . A A .  31 HIS HD2  1 1 
        1   412 1 1 31 HIS HE1  H   -0.388   5.305  -6.567 1.00 . A A .  31 HIS HE1  1 1 
        1   413 1 1 31 HIS N    N    4.072   0.877  -4.044 1.00 . A A .  31 HIS N    1 1 
        1   414 1 1 31 HIS ND1  N    0.738   3.591  -5.954 1.00 . A A .  31 HIS ND1  1 1 
        1   415 1 1 31 HIS NE2  N   -0.218   4.828  -4.488 1.00 . A A .  31 HIS NE2  1 1 
        1   416 1 1 31 HIS O    O    3.747   4.371  -3.819 1.00 . A A .  31 HIS O    1 1 
        1   417 1 1 32 MET C    C    5.228   4.466  -1.219 1.00 . A A .  32 MET C    1 1 
        1   418 1 1 32 MET CA   C    3.842   3.839  -1.101 1.00 . A A .  32 MET CA   1 1 
        1   419 1 1 32 MET CB   C    3.680   3.185   0.273 1.00 . A A .  32 MET CB   1 1 
        1   420 1 1 32 MET CE   C    1.202   5.008   1.686 1.00 . A A .  32 MET CE   1 1 
        1   421 1 1 32 MET CG   C    2.265   2.711   0.557 1.00 . A A .  32 MET CG   1 1 
        1   422 1 1 32 MET H    H    3.495   1.917  -1.916 1.00 . A A .  32 MET H    1 1 
        1   423 1 1 32 MET HA   H    3.099   4.615  -1.210 1.00 . A A .  32 MET HA   1 1 
        1   424 1 1 32 MET HB2  H    4.342   2.334   0.333 1.00 . A A .  32 MET HB2  1 1 
        1   425 1 1 32 MET HB3  H    3.957   3.900   1.034 1.00 . A A .  32 MET HB3  1 1 
        1   426 1 1 32 MET HE1  H    0.764   4.505   2.536 1.00 . A A .  32 MET HE1  1 1 
        1   427 1 1 32 MET HE2  H    2.250   5.189   1.876 1.00 . A A .  32 MET HE2  1 1 
        1   428 1 1 32 MET HE3  H    0.698   5.949   1.525 1.00 . A A .  32 MET HE3  1 1 
        1   429 1 1 32 MET HG2  H    2.054   1.854  -0.065 1.00 . A A .  32 MET HG2  1 1 
        1   430 1 1 32 MET HG3  H    2.199   2.422   1.596 1.00 . A A .  32 MET HG3  1 1 
        1   431 1 1 32 MET N    N    3.623   2.858  -2.157 1.00 . A A .  32 MET N    1 1 
        1   432 1 1 32 MET O    O    5.475   5.551  -0.693 1.00 . A A .  32 MET O    1 1 
        1   433 1 1 32 MET SD   S    1.027   3.980   0.229 1.00 . A A .  32 MET SD   1 1 
        1   434 1 1 33 ARG C    C    7.485   5.662  -2.709 1.00 . A A .  33 ARG C    1 1 
        1   435 1 1 33 ARG CA   C    7.488   4.264  -2.097 1.00 . A A .  33 ARG CA   1 1 
        1   436 1 1 33 ARG CB   C    8.279   3.307  -2.990 1.00 . A A .  33 ARG CB   1 1 
        1   437 1 1 33 ARG CD   C    9.120   0.972  -3.386 1.00 . A A .  33 ARG CD   1 1 
        1   438 1 1 33 ARG CG   C    8.390   1.900  -2.427 1.00 . A A .  33 ARG CG   1 1 
        1   439 1 1 33 ARG CZ   C   11.061   2.202  -4.259 1.00 . A A .  33 ARG CZ   1 1 
        1   440 1 1 33 ARG H    H    5.870   2.917  -2.308 1.00 . A A .  33 ARG H    1 1 
        1   441 1 1 33 ARG HA   H    7.959   4.310  -1.127 1.00 . A A .  33 ARG HA   1 1 
        1   442 1 1 33 ARG HB2  H    7.795   3.248  -3.954 1.00 . A A .  33 ARG HB2  1 1 
        1   443 1 1 33 ARG HB3  H    9.277   3.698  -3.121 1.00 . A A .  33 ARG HB3  1 1 
        1   444 1 1 33 ARG HD2  H    8.995  -0.046  -3.046 1.00 . A A .  33 ARG HD2  1 1 
        1   445 1 1 33 ARG HD3  H    8.687   1.079  -4.369 1.00 . A A .  33 ARG HD3  1 1 
        1   446 1 1 33 ARG HE   H   11.150   0.760  -2.885 1.00 . A A .  33 ARG HE   1 1 
        1   447 1 1 33 ARG HG2  H    8.934   1.936  -1.495 1.00 . A A .  33 ARG HG2  1 1 
        1   448 1 1 33 ARG HG3  H    7.397   1.513  -2.252 1.00 . A A .  33 ARG HG3  1 1 
        1   449 1 1 33 ARG HH11 H    9.282   2.754  -5.042 1.00 . A A .  33 ARG HH11 1 1 
        1   450 1 1 33 ARG HH12 H   10.658   3.613  -5.649 1.00 . A A .  33 ARG HH12 1 1 
        1   451 1 1 33 ARG HH21 H   12.970   1.884  -3.677 1.00 . A A .  33 ARG HH21 1 1 
        1   452 1 1 33 ARG HH22 H   12.755   3.117  -4.873 1.00 . A A .  33 ARG HH22 1 1 
        1   453 1 1 33 ARG N    N    6.127   3.776  -1.912 1.00 . A A .  33 ARG N    1 1 
        1   454 1 1 33 ARG NE   N   10.547   1.274  -3.460 1.00 . A A .  33 ARG NE   1 1 
        1   455 1 1 33 ARG NH1  N   10.268   2.914  -5.049 1.00 . A A .  33 ARG NH1  1 1 
        1   456 1 1 33 ARG NH2  N   12.370   2.419  -4.270 1.00 . A A .  33 ARG NH2  1 1 
        1   457 1 1 33 ARG O    O    8.368   6.476  -2.432 1.00 . A A .  33 ARG O    1 1 
        1   458 1 1 34 THR C    C    5.430   8.154  -3.424 1.00 . A A .  34 THR C    1 1 
        1   459 1 1 34 THR CA   C    6.370   7.234  -4.196 1.00 . A A .  34 THR CA   1 1 
        1   460 1 1 34 THR CB   C    5.858   7.092  -5.642 1.00 . A A .  34 THR CB   1 1 
        1   461 1 1 34 THR CG2  C    6.812   6.247  -6.472 1.00 . A A .  34 THR CG2  1 1 
        1   462 1 1 34 THR H    H    5.814   5.246  -3.724 1.00 . A A .  34 THR H    1 1 
        1   463 1 1 34 THR HA   H    7.352   7.682  -4.226 1.00 . A A .  34 THR HA   1 1 
        1   464 1 1 34 THR HB   H    5.795   8.076  -6.083 1.00 . A A .  34 THR HB   1 1 
        1   465 1 1 34 THR HG1  H    4.412   6.046  -6.481 1.00 . A A .  34 THR HG1  1 1 
        1   466 1 1 34 THR HG21 H    7.809   6.327  -6.067 1.00 . A A .  34 THR HG21 1 1 
        1   467 1 1 34 THR HG22 H    6.809   6.599  -7.493 1.00 . A A .  34 THR HG22 1 1 
        1   468 1 1 34 THR HG23 H    6.495   5.215  -6.447 1.00 . A A .  34 THR HG23 1 1 
        1   469 1 1 34 THR N    N    6.487   5.936  -3.543 1.00 . A A .  34 THR N    1 1 
        1   470 1 1 34 THR O    O    4.806   9.045  -4.001 1.00 . A A .  34 THR O    1 1 
        1   471 1 1 34 THR OG1  O    4.557   6.494  -5.644 1.00 . A A .  34 THR OG1  1 1 
        1   472 1 1 35 HIS C    C    5.246   9.294  -0.073 1.00 . A A .  35 HIS C    1 1 
        1   473 1 1 35 HIS CA   C    4.471   8.744  -1.266 1.00 . A A .  35 HIS CA   1 1 
        1   474 1 1 35 HIS CB   C    3.279   7.919  -0.779 1.00 . A A .  35 HIS CB   1 1 
        1   475 1 1 35 HIS CD2  C    1.577   6.952  -2.481 1.00 . A A .  35 HIS CD2  1 1 
        1   476 1 1 35 HIS CE1  C    0.408   8.773  -2.835 1.00 . A A .  35 HIS CE1  1 1 
        1   477 1 1 35 HIS CG   C    2.115   7.935  -1.721 1.00 . A A .  35 HIS CG   1 1 
        1   478 1 1 35 HIS H    H    5.856   7.208  -1.716 1.00 . A A .  35 HIS H    1 1 
        1   479 1 1 35 HIS HA   H    4.108   9.572  -1.856 1.00 . A A .  35 HIS HA   1 1 
        1   480 1 1 35 HIS HB2  H    3.588   6.892  -0.652 1.00 . A A .  35 HIS HB2  1 1 
        1   481 1 1 35 HIS HB3  H    2.944   8.309   0.171 1.00 . A A .  35 HIS HB3  1 1 
        1   482 1 1 35 HIS HD1  H    1.501   9.944  -1.562 1.00 . A A .  35 HIS HD1  1 1 
        1   483 1 1 35 HIS HD2  H    1.918   5.928  -2.540 1.00 . A A .  35 HIS HD2  1 1 
        1   484 1 1 35 HIS HE1  H   -0.333   9.461  -3.213 1.00 . A A .  35 HIS HE1  1 1 
        1   485 1 1 35 HIS N    N    5.334   7.933  -2.117 1.00 . A A .  35 HIS N    1 1 
        1   486 1 1 35 HIS ND1  N    1.360   9.063  -1.966 1.00 . A A .  35 HIS ND1  1 1 
        1   487 1 1 35 HIS NE2  N    0.518   7.499  -3.164 1.00 . A A .  35 HIS NE2  1 1 
        1   488 1 1 35 HIS O    O    5.119  10.468   0.275 1.00 . A A .  35 HIS O    1 1 
        1   489 1 1 36 SER C    C    7.860   9.905   1.327 1.00 . A A .  36 SER C    1 1 
        1   490 1 1 36 SER CA   C    6.840   8.836   1.709 1.00 . A A .  36 SER CA   1 1 
        1   491 1 1 36 SER CB   C    7.556   7.622   2.306 1.00 . A A .  36 SER CB   1 1 
        1   492 1 1 36 SER H    H    6.107   7.514   0.227 1.00 . A A .  36 SER H    1 1 
        1   493 1 1 36 SER HA   H    6.166   9.245   2.447 1.00 . A A .  36 SER HA   1 1 
        1   494 1 1 36 SER HB2  H    6.949   6.742   2.160 1.00 . A A .  36 SER HB2  1 1 
        1   495 1 1 36 SER HB3  H    8.508   7.490   1.812 1.00 . A A .  36 SER HB3  1 1 
        1   496 1 1 36 SER HG   H    7.847   8.733   3.894 1.00 . A A .  36 SER HG   1 1 
        1   497 1 1 36 SER N    N    6.048   8.437   0.551 1.00 . A A .  36 SER N    1 1 
        1   498 1 1 36 SER O    O    8.299   9.979   0.181 1.00 . A A .  36 SER O    1 1 
        1   499 1 1 36 SER OG   O    7.782   7.796   3.694 1.00 . A A .  36 SER OG   1 1 
        1   500 1 1 37 GLY C    C   10.032  12.114   3.269 1.00 . A A .  37 GLY C    1 1 
        1   501 1 1 37 GLY CA   C    9.196  11.787   2.047 1.00 . A A .  37 GLY CA   1 1 
        1   502 1 1 37 GLY H    H    7.848  10.626   3.195 1.00 . A A .  37 GLY H    1 1 
        1   503 1 1 37 GLY HA2  H    9.852  11.476   1.247 1.00 . A A .  37 GLY HA2  1 1 
        1   504 1 1 37 GLY HA3  H    8.667  12.677   1.738 1.00 . A A .  37 GLY HA3  1 1 
        1   505 1 1 37 GLY N    N    8.232  10.733   2.299 1.00 . A A .  37 GLY N    1 1 
        1   506 1 1 37 GLY O    O   10.035  11.363   4.244 1.00 . A A .  37 GLY O    1 1 
        1   507 1 1 38 GLU C    C   11.194  15.050   4.811 1.00 . A A .  38 GLU C    1 1 
        1   508 1 1 38 GLU CA   C   11.588  13.658   4.326 1.00 . A A .  38 GLU CA   1 1 
        1   509 1 1 38 GLU CB   C   13.060  13.648   3.908 1.00 . A A .  38 GLU CB   1 1 
        1   510 1 1 38 GLU CD   C   14.984  12.197   3.153 1.00 . A A .  38 GLU CD   1 1 
        1   511 1 1 38 GLU CG   C   13.695  12.269   3.949 1.00 . A A .  38 GLU CG   1 1 
        1   512 1 1 38 GLU H    H   10.698  13.792   2.410 1.00 . A A .  38 GLU H    1 1 
        1   513 1 1 38 GLU HA   H   11.448  12.956   5.134 1.00 . A A .  38 GLU HA   1 1 
        1   514 1 1 38 GLU HB2  H   13.138  14.029   2.900 1.00 . A A .  38 GLU HB2  1 1 
        1   515 1 1 38 GLU HB3  H   13.613  14.296   4.572 1.00 . A A .  38 GLU HB3  1 1 
        1   516 1 1 38 GLU HG2  H   13.910  12.016   4.976 1.00 . A A .  38 GLU HG2  1 1 
        1   517 1 1 38 GLU HG3  H   12.997  11.553   3.542 1.00 . A A .  38 GLU HG3  1 1 
        1   518 1 1 38 GLU N    N   10.743  13.236   3.215 1.00 . A A .  38 GLU N    1 1 
        1   519 1 1 38 GLU O    O   11.703  15.536   5.821 1.00 . A A .  38 GLU O    1 1 
        1   520 1 1 38 GLU OE1  O   14.945  12.468   1.935 1.00 . A A .  38 GLU OE1  1 1 
        1   521 1 1 38 GLU OE2  O   16.031  11.868   3.749 1.00 . A A .  38 GLU OE2  1 1 
        1   522 1 1 39 LYS C    C    8.295  17.086   4.447 1.00 . A A .  39 LYS C    1 1 
        1   523 1 1 39 LYS CA   C    9.820  17.024   4.436 1.00 . A A .  39 LYS CA   1 1 
        1   524 1 1 39 LYS CB   C   10.375  18.057   3.453 1.00 . A A .  39 LYS CB   1 1 
        1   525 1 1 39 LYS CD   C   12.354  19.444   2.766 1.00 . A A .  39 LYS CD   1 1 
        1   526 1 1 39 LYS CE   C   12.359  20.677   3.657 1.00 . A A .  39 LYS CE   1 1 
        1   527 1 1 39 LYS CG   C   11.885  18.213   3.523 1.00 . A A .  39 LYS CG   1 1 
        1   528 1 1 39 LYS H    H    9.914  15.249   3.287 1.00 . A A .  39 LYS H    1 1 
        1   529 1 1 39 LYS HA   H   10.184  17.250   5.427 1.00 . A A .  39 LYS HA   1 1 
        1   530 1 1 39 LYS HB2  H   10.111  17.759   2.449 1.00 . A A .  39 LYS HB2  1 1 
        1   531 1 1 39 LYS HB3  H    9.925  19.016   3.665 1.00 . A A .  39 LYS HB3  1 1 
        1   532 1 1 39 LYS HD2  H   13.356  19.272   2.403 1.00 . A A .  39 LYS HD2  1 1 
        1   533 1 1 39 LYS HD3  H   11.690  19.617   1.931 1.00 . A A .  39 LYS HD3  1 1 
        1   534 1 1 39 LYS HE2  H   11.379  21.127   3.632 1.00 . A A .  39 LYS HE2  1 1 
        1   535 1 1 39 LYS HE3  H   12.590  20.374   4.667 1.00 . A A .  39 LYS HE3  1 1 
        1   536 1 1 39 LYS HG2  H   12.180  18.305   4.558 1.00 . A A .  39 LYS HG2  1 1 
        1   537 1 1 39 LYS HG3  H   12.348  17.337   3.091 1.00 . A A .  39 LYS HG3  1 1 
        1   538 1 1 39 LYS HZ1  H   13.714  22.224   4.023 1.00 . A A .  39 LYS HZ1  1 1 
        1   539 1 1 39 LYS HZ2  H   12.935  22.336   2.526 1.00 . A A .  39 LYS HZ2  1 1 
        1   540 1 1 39 LYS HZ3  H   14.168  21.202   2.754 1.00 . A A .  39 LYS HZ3  1 1 
        1   541 1 1 39 LYS N    N   10.284  15.688   4.082 1.00 . A A .  39 LYS N    1 1 
        1   542 1 1 39 LYS NZ   N   13.365  21.680   3.209 1.00 . A A .  39 LYS NZ   1 1 
        1   543 1 1 39 LYS O    O    7.619  16.453   3.636 1.00 . A A .  39 LYS O    1 1 
        1   544 1 1 40 PRO C    C    5.684  18.821   4.368 1.00 . A A .  40 PRO C    1 1 
        1   545 1 1 40 PRO CA   C    6.290  18.030   5.523 1.00 . A A .  40 PRO CA   1 1 
        1   546 1 1 40 PRO CB   C    6.143  18.804   6.835 1.00 . A A .  40 PRO CB   1 1 
        1   547 1 1 40 PRO CD   C    8.486  18.649   6.386 1.00 . A A .  40 PRO CD   1 1 
        1   548 1 1 40 PRO CG   C    7.432  19.535   6.991 1.00 . A A .  40 PRO CG   1 1 
        1   549 1 1 40 PRO HA   H    5.789  17.077   5.607 1.00 . A A .  40 PRO HA   1 1 
        1   550 1 1 40 PRO HB2  H    5.307  19.486   6.763 1.00 . A A .  40 PRO HB2  1 1 
        1   551 1 1 40 PRO HB3  H    5.981  18.113   7.649 1.00 . A A .  40 PRO HB3  1 1 
        1   552 1 1 40 PRO HD2  H    9.254  19.245   5.915 1.00 . A A .  40 PRO HD2  1 1 
        1   553 1 1 40 PRO HD3  H    8.914  18.004   7.138 1.00 . A A .  40 PRO HD3  1 1 
        1   554 1 1 40 PRO HG2  H    7.385  20.476   6.465 1.00 . A A .  40 PRO HG2  1 1 
        1   555 1 1 40 PRO HG3  H    7.636  19.698   8.039 1.00 . A A .  40 PRO HG3  1 1 
        1   556 1 1 40 PRO N    N    7.740  17.866   5.386 1.00 . A A .  40 PRO N    1 1 
        1   557 1 1 40 PRO O    O    4.483  18.741   4.111 1.00 . A A .  40 PRO O    1 1 
        1   558 1 1 41 SER C    C    6.686  19.898   1.242 1.00 . A A .  41 SER C    1 1 
        1   559 1 1 41 SER CA   C    6.070  20.391   2.548 1.00 . A A .  41 SER CA   1 1 
        1   560 1 1 41 SER CB   C    6.428  21.861   2.771 1.00 . A A .  41 SER CB   1 1 
        1   561 1 1 41 SER H    H    7.471  19.604   3.927 1.00 . A A .  41 SER H    1 1 
        1   562 1 1 41 SER HA   H    4.996  20.296   2.484 1.00 . A A .  41 SER HA   1 1 
        1   563 1 1 41 SER HB2  H    6.094  22.166   3.751 1.00 . A A .  41 SER HB2  1 1 
        1   564 1 1 41 SER HB3  H    7.500  21.982   2.702 1.00 . A A .  41 SER HB3  1 1 
        1   565 1 1 41 SER HG   H    6.288  23.521   1.739 1.00 . A A .  41 SER HG   1 1 
        1   566 1 1 41 SER N    N    6.524  19.583   3.674 1.00 . A A .  41 SER N    1 1 
        1   567 1 1 41 SER O    O    7.527  19.000   1.240 1.00 . A A .  41 SER O    1 1 
        1   568 1 1 41 SER OG   O    5.812  22.689   1.800 1.00 . A A .  41 SER OG   1 1 
        1   569 1 1 42 GLY C    C    7.447  21.251  -1.893 1.00 . A A .  42 GLY C    1 1 
        1   570 1 1 42 GLY CA   C    6.780  20.102  -1.165 1.00 . A A .  42 GLY CA   1 1 
        1   571 1 1 42 GLY H    H    5.588  21.203   0.195 1.00 . A A .  42 GLY H    1 1 
        1   572 1 1 42 GLY HA2  H    7.500  19.309  -1.028 1.00 . A A .  42 GLY HA2  1 1 
        1   573 1 1 42 GLY HA3  H    5.964  19.733  -1.770 1.00 . A A .  42 GLY HA3  1 1 
        1   574 1 1 42 GLY N    N    6.260  20.493   0.132 1.00 . A A .  42 GLY N    1 1 
        1   575 1 1 42 GLY O    O    6.842  21.917  -2.734 1.00 . A A .  42 GLY O    1 1 
        1   576 1 1 43 PRO C    C    9.826  22.296  -3.649 1.00 . A A .  43 PRO C    1 1 
        1   577 1 1 43 PRO CA   C    9.503  22.579  -2.186 1.00 . A A .  43 PRO CA   1 1 
        1   578 1 1 43 PRO CB   C   10.785  22.613  -1.351 1.00 . A A .  43 PRO CB   1 1 
        1   579 1 1 43 PRO CD   C    9.509  20.747  -0.575 1.00 . A A .  43 PRO CD   1 1 
        1   580 1 1 43 PRO CG   C   10.913  21.236  -0.796 1.00 . A A .  43 PRO CG   1 1 
        1   581 1 1 43 PRO HA   H    8.995  23.529  -2.107 1.00 . A A .  43 PRO HA   1 1 
        1   582 1 1 43 PRO HB2  H   11.624  22.864  -1.986 1.00 . A A .  43 PRO HB2  1 1 
        1   583 1 1 43 PRO HB3  H   10.689  23.348  -0.566 1.00 . A A .  43 PRO HB3  1 1 
        1   584 1 1 43 PRO HD2  H    9.446  19.684  -0.760 1.00 . A A .  43 PRO HD2  1 1 
        1   585 1 1 43 PRO HD3  H    9.182  20.977   0.428 1.00 . A A .  43 PRO HD3  1 1 
        1   586 1 1 43 PRO HG2  H   11.425  20.601  -1.503 1.00 . A A .  43 PRO HG2  1 1 
        1   587 1 1 43 PRO HG3  H   11.450  21.267   0.140 1.00 . A A .  43 PRO HG3  1 1 
        1   588 1 1 43 PRO N    N    8.725  21.500  -1.569 1.00 . A A .  43 PRO N    1 1 
        1   589 1 1 43 PRO O    O   10.452  21.287  -3.972 1.00 . A A .  43 PRO O    1 1 
        1   590 1 1 44 SER C    C   10.325  24.277  -6.531 1.00 . A A .  44 SER C    1 1 
        1   591 1 1 44 SER CA   C    9.639  23.040  -5.959 1.00 . A A .  44 SER CA   1 1 
        1   592 1 1 44 SER CB   C    8.322  22.787  -6.696 1.00 . A A .  44 SER CB   1 1 
        1   593 1 1 44 SER H    H    8.904  23.979  -4.209 1.00 . A A .  44 SER H    1 1 
        1   594 1 1 44 SER HA   H   10.287  22.188  -6.095 1.00 . A A .  44 SER HA   1 1 
        1   595 1 1 44 SER HB2  H    7.652  23.616  -6.525 1.00 . A A .  44 SER HB2  1 1 
        1   596 1 1 44 SER HB3  H    8.517  22.695  -7.754 1.00 . A A .  44 SER HB3  1 1 
        1   597 1 1 44 SER HG   H    7.973  21.422  -5.335 1.00 . A A .  44 SER HG   1 1 
        1   598 1 1 44 SER N    N    9.397  23.195  -4.529 1.00 . A A .  44 SER N    1 1 
        1   599 1 1 44 SER O    O    9.900  24.821  -7.550 1.00 . A A .  44 SER O    1 1 
        1   600 1 1 44 SER OG   O    7.702  21.597  -6.239 1.00 . A A .  44 SER OG   1 1 
        1   601 1 1 45 SER C    C   13.201  25.507  -7.326 1.00 . A A .  45 SER C    1 1 
        1   602 1 1 45 SER CA   C   12.134  25.890  -6.305 1.00 . A A .  45 SER CA   1 1 
        1   603 1 1 45 SER CB   C   12.784  26.585  -5.107 1.00 . A A .  45 SER CB   1 1 
        1   604 1 1 45 SER H    H   11.680  24.239  -5.061 1.00 . A A .  45 SER H    1 1 
        1   605 1 1 45 SER HA   H   11.436  26.571  -6.770 1.00 . A A .  45 SER HA   1 1 
        1   606 1 1 45 SER HB2  H   13.314  27.462  -5.447 1.00 . A A .  45 SER HB2  1 1 
        1   607 1 1 45 SER HB3  H   12.017  26.877  -4.404 1.00 . A A .  45 SER HB3  1 1 
        1   608 1 1 45 SER HG   H   13.431  24.811  -4.584 1.00 . A A .  45 SER HG   1 1 
        1   609 1 1 45 SER N    N   11.390  24.715  -5.866 1.00 . A A .  45 SER N    1 1 
        1   610 1 1 45 SER O    O   14.026  26.331  -7.717 1.00 . A A .  45 SER O    1 1 
        1   611 1 1 45 SER OG   O   13.699  25.723  -4.453 1.00 . A A .  45 SER OG   1 1 
        1   612 1 1 46 GLY C    C   15.572  23.879  -8.219 1.00 . A A .  46 GLY C    1 1 
        1   613 1 1 46 GLY CA   C   14.147  23.777  -8.725 1.00 . A A .  46 GLY CA   1 1 
        1   614 1 1 46 GLY H    H   12.496  23.635  -7.407 1.00 . A A .  46 GLY H    1 1 
        1   615 1 1 46 GLY HA2  H   13.932  22.745  -8.960 1.00 . A A .  46 GLY HA2  1 1 
        1   616 1 1 46 GLY HA3  H   14.054  24.367  -9.625 1.00 . A A .  46 GLY HA3  1 1 
        1   617 1 1 46 GLY N    N   13.177  24.248  -7.754 1.00 . A A .  46 GLY N    1 1 
        1   618 1 1 46 GLY O    O   16.176  24.943  -8.342 1.00 . A A .  46 GLY O    1 1 
        1   619 2 2  1 ZN  ZN   ZN  -1.024   6.281  -3.211 1.00 . B A . 201 ZN  ZN   1 1 
        2   620 1 1  1 GLY C    C  -27.692  -3.537  11.429 1.00 . A A .   1 GLY C    1 1 
        2   621 1 1  1 GLY CA   C  -27.977  -5.025  11.397 1.00 . A A .   1 GLY CA   1 1 
        2   622 1 1  1 GLY H1   H  -29.981  -5.211  12.056 1.00 . A A .   1 GLY H1   1 1 
        2   623 1 1  1 GLY HA2  H  -27.082  -5.559  11.678 1.00 . A A .   1 GLY HA2  1 1 
        2   624 1 1  1 GLY HA3  H  -28.251  -5.306  10.391 1.00 . A A .   1 GLY HA3  1 1 
        2   625 1 1  1 GLY N    N  -29.051  -5.403  12.298 1.00 . A A .   1 GLY N    1 1 
        2   626 1 1  1 GLY O    O  -27.963  -2.866  12.424 1.00 . A A .   1 GLY O    1 1 
        2   627 1 1  2 SER C    C  -27.491  -0.963   9.035 1.00 . A A .   2 SER C    1 1 
        2   628 1 1  2 SER CA   C  -26.812  -1.601  10.244 1.00 . A A .   2 SER CA   1 1 
        2   629 1 1  2 SER CB   C  -25.297  -1.411  10.151 1.00 . A A .   2 SER CB   1 1 
        2   630 1 1  2 SER H    H  -26.947  -3.605   9.574 1.00 . A A .   2 SER H    1 1 
        2   631 1 1  2 SER HA   H  -27.172  -1.118  11.140 1.00 . A A .   2 SER HA   1 1 
        2   632 1 1  2 SER HB2  H  -25.073  -0.360  10.057 1.00 . A A .   2 SER HB2  1 1 
        2   633 1 1  2 SER HB3  H  -24.832  -1.800  11.045 1.00 . A A .   2 SER HB3  1 1 
        2   634 1 1  2 SER HG   H  -23.826  -1.911   8.957 1.00 . A A .   2 SER HG   1 1 
        2   635 1 1  2 SER N    N  -27.140  -3.019  10.336 1.00 . A A .   2 SER N    1 1 
        2   636 1 1  2 SER O    O  -26.886  -0.166   8.318 1.00 . A A .   2 SER O    1 1 
        2   637 1 1  2 SER OG   O  -24.766  -2.093   9.027 1.00 . A A .   2 SER OG   1 1 
        2   638 1 1  3 SER C    C  -28.883  -1.198   6.365 1.00 . A A .   3 SER C    1 1 
        2   639 1 1  3 SER CA   C  -29.513  -0.788   7.692 1.00 . A A .   3 SER CA   1 1 
        2   640 1 1  3 SER CB   C  -29.594   0.737   7.782 1.00 . A A .   3 SER CB   1 1 
        2   641 1 1  3 SER H    H  -29.180  -1.961   9.423 1.00 . A A .   3 SER H    1 1 
        2   642 1 1  3 SER HA   H  -30.512  -1.196   7.745 1.00 . A A .   3 SER HA   1 1 
        2   643 1 1  3 SER HB2  H  -29.769   1.027   8.806 1.00 . A A .   3 SER HB2  1 1 
        2   644 1 1  3 SER HB3  H  -28.662   1.165   7.441 1.00 . A A .   3 SER HB3  1 1 
        2   645 1 1  3 SER HG   H  -31.392   0.634   7.010 1.00 . A A .   3 SER HG   1 1 
        2   646 1 1  3 SER N    N  -28.752  -1.321   8.816 1.00 . A A .   3 SER N    1 1 
        2   647 1 1  3 SER O    O  -28.784  -0.397   5.438 1.00 . A A .   3 SER O    1 1 
        2   648 1 1  3 SER OG   O  -30.648   1.240   6.979 1.00 . A A .   3 SER OG   1 1 
        2   649 1 1  4 GLY C    C  -26.538  -2.246   4.746 1.00 . A A .   4 GLY C    1 1 
        2   650 1 1  4 GLY CA   C  -27.841  -2.952   5.066 1.00 . A A .   4 GLY CA   1 1 
        2   651 1 1  4 GLY H    H  -28.562  -3.050   7.055 1.00 . A A .   4 GLY H    1 1 
        2   652 1 1  4 GLY HA2  H  -27.648  -4.008   5.179 1.00 . A A .   4 GLY HA2  1 1 
        2   653 1 1  4 GLY HA3  H  -28.527  -2.807   4.244 1.00 . A A .   4 GLY HA3  1 1 
        2   654 1 1  4 GLY N    N  -28.457  -2.456   6.283 1.00 . A A .   4 GLY N    1 1 
        2   655 1 1  4 GLY O    O  -26.539  -1.164   4.159 1.00 . A A .   4 GLY O    1 1 
        2   656 1 1  5 SER C    C  -23.369  -3.050   3.801 1.00 . A A .   5 SER C    1 1 
        2   657 1 1  5 SER CA   C  -24.109  -2.279   4.890 1.00 . A A .   5 SER CA   1 1 
        2   658 1 1  5 SER CB   C  -23.283  -2.274   6.178 1.00 . A A .   5 SER CB   1 1 
        2   659 1 1  5 SER H    H  -25.489  -3.719   5.598 1.00 . A A .   5 SER H    1 1 
        2   660 1 1  5 SER HA   H  -24.251  -1.260   4.560 1.00 . A A .   5 SER HA   1 1 
        2   661 1 1  5 SER HB2  H  -22.300  -1.879   5.971 1.00 . A A .   5 SER HB2  1 1 
        2   662 1 1  5 SER HB3  H  -23.773  -1.652   6.914 1.00 . A A .   5 SER HB3  1 1 
        2   663 1 1  5 SER HG   H  -22.723  -4.147   6.052 1.00 . A A .   5 SER HG   1 1 
        2   664 1 1  5 SER N    N  -25.424  -2.858   5.134 1.00 . A A .   5 SER N    1 1 
        2   665 1 1  5 SER O    O  -22.708  -4.051   4.075 1.00 . A A .   5 SER O    1 1 
        2   666 1 1  5 SER OG   O  -23.148  -3.583   6.702 1.00 . A A .   5 SER OG   1 1 
        2   667 1 1  6 SER C    C  -21.370  -2.798   1.337 1.00 . A A .   6 SER C    1 1 
        2   668 1 1  6 SER CA   C  -22.832  -3.221   1.433 1.00 . A A .   6 SER CA   1 1 
        2   669 1 1  6 SER CB   C  -23.561  -2.878   0.132 1.00 . A A .   6 SER CB   1 1 
        2   670 1 1  6 SER H    H  -24.027  -1.773   2.411 1.00 . A A .   6 SER H    1 1 
        2   671 1 1  6 SER HA   H  -22.877  -4.289   1.590 1.00 . A A .   6 SER HA   1 1 
        2   672 1 1  6 SER HB2  H  -23.788  -1.823   0.117 1.00 . A A .   6 SER HB2  1 1 
        2   673 1 1  6 SER HB3  H  -22.926  -3.122  -0.708 1.00 . A A .   6 SER HB3  1 1 
        2   674 1 1  6 SER HG   H  -25.387  -3.313   0.692 1.00 . A A .   6 SER HG   1 1 
        2   675 1 1  6 SER N    N  -23.486  -2.575   2.565 1.00 . A A .   6 SER N    1 1 
        2   676 1 1  6 SER O    O  -20.479  -3.633   1.184 1.00 . A A .   6 SER O    1 1 
        2   677 1 1  6 SER OG   O  -24.771  -3.607   0.018 1.00 . A A .   6 SER OG   1 1 
        2   678 1 1  7 GLY C    C  -19.159  -1.180  -0.023 1.00 . A A .   7 GLY C    1 1 
        2   679 1 1  7 GLY CA   C  -19.775  -0.981   1.348 1.00 . A A .   7 GLY CA   1 1 
        2   680 1 1  7 GLY H    H  -21.880  -0.874   1.549 1.00 . A A .   7 GLY H    1 1 
        2   681 1 1  7 GLY HA2  H  -19.787   0.074   1.576 1.00 . A A .   7 GLY HA2  1 1 
        2   682 1 1  7 GLY HA3  H  -19.166  -1.491   2.081 1.00 . A A .   7 GLY HA3  1 1 
        2   683 1 1  7 GLY N    N  -21.130  -1.494   1.427 1.00 . A A .   7 GLY N    1 1 
        2   684 1 1  7 GLY O    O  -19.811  -1.683  -0.937 1.00 . A A .   7 GLY O    1 1 
        2   685 1 1  8 ALA C    C  -15.974  -1.823  -1.291 1.00 . A A .   8 ALA C    1 1 
        2   686 1 1  8 ALA CA   C  -17.195  -0.920  -1.436 1.00 . A A .   8 ALA CA   1 1 
        2   687 1 1  8 ALA CB   C  -16.783   0.446  -1.962 1.00 . A A .   8 ALA CB   1 1 
        2   688 1 1  8 ALA H    H  -17.431  -0.389   0.599 1.00 . A A .   8 ALA H    1 1 
        2   689 1 1  8 ALA HA   H  -17.875  -1.364  -2.148 1.00 . A A .   8 ALA HA   1 1 
        2   690 1 1  8 ALA HB1  H  -15.881   0.768  -1.463 1.00 . A A .   8 ALA HB1  1 1 
        2   691 1 1  8 ALA HB2  H  -16.604   0.383  -3.026 1.00 . A A .   8 ALA HB2  1 1 
        2   692 1 1  8 ALA HB3  H  -17.573   1.158  -1.772 1.00 . A A .   8 ALA HB3  1 1 
        2   693 1 1  8 ALA N    N  -17.899  -0.783  -0.167 1.00 . A A .   8 ALA N    1 1 
        2   694 1 1  8 ALA O    O  -14.844  -1.345  -1.195 1.00 . A A .   8 ALA O    1 1 
        2   695 1 1  9 GLY C    C  -14.041  -3.594  -0.191 1.00 . A A .   9 GLY C    1 1 
        2   696 1 1  9 GLY CA   C  -15.119  -4.080  -1.140 1.00 . A A .   9 GLY CA   1 1 
        2   697 1 1  9 GLY H    H  -17.131  -3.455  -1.355 1.00 . A A .   9 GLY H    1 1 
        2   698 1 1  9 GLY HA2  H  -15.513  -5.015  -0.773 1.00 . A A .   9 GLY HA2  1 1 
        2   699 1 1  9 GLY HA3  H  -14.678  -4.244  -2.113 1.00 . A A .   9 GLY HA3  1 1 
        2   700 1 1  9 GLY N    N  -16.209  -3.131  -1.275 1.00 . A A .   9 GLY N    1 1 
        2   701 1 1  9 GLY O    O  -12.930  -3.277  -0.614 1.00 . A A .   9 GLY O    1 1 
        2   702 1 1 10 GLU C    C  -12.168  -3.947   2.103 1.00 . A A .  10 GLU C    1 1 
        2   703 1 1 10 GLU CA   C  -13.423  -3.079   2.106 1.00 . A A .  10 GLU CA   1 1 
        2   704 1 1 10 GLU CB   C  -14.071  -3.104   3.492 1.00 . A A .  10 GLU CB   1 1 
        2   705 1 1 10 GLU CD   C  -13.954  -0.676   4.177 1.00 . A A .  10 GLU CD   1 1 
        2   706 1 1 10 GLU CG   C  -13.482  -2.089   4.457 1.00 . A A .  10 GLU CG   1 1 
        2   707 1 1 10 GLU H    H  -15.273  -3.799   1.371 1.00 . A A .  10 GLU H    1 1 
        2   708 1 1 10 GLU HA   H  -13.145  -2.064   1.867 1.00 . A A .  10 GLU HA   1 1 
        2   709 1 1 10 GLU HB2  H  -15.126  -2.901   3.387 1.00 . A A .  10 GLU HB2  1 1 
        2   710 1 1 10 GLU HB3  H  -13.944  -4.089   3.917 1.00 . A A .  10 GLU HB3  1 1 
        2   711 1 1 10 GLU HG2  H  -13.772  -2.356   5.462 1.00 . A A .  10 GLU HG2  1 1 
        2   712 1 1 10 GLU HG3  H  -12.405  -2.116   4.376 1.00 . A A .  10 GLU HG3  1 1 
        2   713 1 1 10 GLU N    N  -14.371  -3.533   1.095 1.00 . A A .  10 GLU N    1 1 
        2   714 1 1 10 GLU O    O  -12.155  -5.043   2.664 1.00 . A A .  10 GLU O    1 1 
        2   715 1 1 10 GLU OE1  O  -14.147  -0.338   2.990 1.00 . A A .  10 GLU OE1  1 1 
        2   716 1 1 10 GLU OE2  O  -14.131   0.093   5.145 1.00 . A A .  10 GLU OE2  1 1 
        2   717 1 1 11 LYS C    C   -8.818  -3.575   2.337 1.00 . A A .  11 LYS C    1 1 
        2   718 1 1 11 LYS CA   C   -9.852  -4.176   1.390 1.00 . A A .  11 LYS CA   1 1 
        2   719 1 1 11 LYS CB   C   -9.316  -4.160  -0.044 1.00 . A A .  11 LYS CB   1 1 
        2   720 1 1 11 LYS CD   C   -9.186  -5.400  -2.224 1.00 . A A .  11 LYS CD   1 1 
        2   721 1 1 11 LYS CE   C   -7.969  -6.272  -1.956 1.00 . A A .  11 LYS CE   1 1 
        2   722 1 1 11 LYS CG   C   -9.993  -5.166  -0.958 1.00 . A A .  11 LYS CG   1 1 
        2   723 1 1 11 LYS H    H  -11.185  -2.570   1.039 1.00 . A A .  11 LYS H    1 1 
        2   724 1 1 11 LYS HA   H  -10.039  -5.198   1.683 1.00 . A A .  11 LYS HA   1 1 
        2   725 1 1 11 LYS HB2  H   -9.462  -3.173  -0.458 1.00 . A A .  11 LYS HB2  1 1 
        2   726 1 1 11 LYS HB3  H   -8.258  -4.379  -0.022 1.00 . A A .  11 LYS HB3  1 1 
        2   727 1 1 11 LYS HD2  H   -9.812  -5.891  -2.954 1.00 . A A .  11 LYS HD2  1 1 
        2   728 1 1 11 LYS HD3  H   -8.857  -4.447  -2.612 1.00 . A A .  11 LYS HD3  1 1 
        2   729 1 1 11 LYS HE2  H   -7.277  -6.163  -2.777 1.00 . A A .  11 LYS HE2  1 1 
        2   730 1 1 11 LYS HE3  H   -7.499  -5.940  -1.042 1.00 . A A .  11 LYS HE3  1 1 
        2   731 1 1 11 LYS HG2  H  -10.097  -6.104  -0.432 1.00 . A A .  11 LYS HG2  1 1 
        2   732 1 1 11 LYS HG3  H  -10.970  -4.793  -1.228 1.00 . A A .  11 LYS HG3  1 1 
        2   733 1 1 11 LYS HZ1  H   -9.027  -7.973  -2.548 1.00 . A A .  11 LYS HZ1  1 1 
        2   734 1 1 11 LYS HZ2  H   -8.751  -7.883  -0.881 1.00 . A A .  11 LYS HZ2  1 1 
        2   735 1 1 11 LYS HZ3  H   -7.490  -8.305  -1.926 1.00 . A A .  11 LYS HZ3  1 1 
        2   736 1 1 11 LYS N    N  -11.113  -3.449   1.467 1.00 . A A .  11 LYS N    1 1 
        2   737 1 1 11 LYS NZ   N   -8.335  -7.709  -1.818 1.00 . A A .  11 LYS NZ   1 1 
        2   738 1 1 11 LYS O    O   -8.769  -2.364   2.552 1.00 . A A .  11 LYS O    1 1 
        2   739 1 1 12 PRO C    C   -5.809  -3.238   3.153 1.00 . A A .  12 PRO C    1 1 
        2   740 1 1 12 PRO CA   C   -6.922  -4.015   3.848 1.00 . A A .  12 PRO CA   1 1 
        2   741 1 1 12 PRO CB   C   -6.385  -5.336   4.403 1.00 . A A .  12 PRO CB   1 1 
        2   742 1 1 12 PRO CD   C   -7.972  -5.896   2.705 1.00 . A A .  12 PRO CD   1 1 
        2   743 1 1 12 PRO CG   C   -6.687  -6.342   3.346 1.00 . A A .  12 PRO CG   1 1 
        2   744 1 1 12 PRO HA   H   -7.325  -3.420   4.655 1.00 . A A .  12 PRO HA   1 1 
        2   745 1 1 12 PRO HB2  H   -5.322  -5.251   4.577 1.00 . A A .  12 PRO HB2  1 1 
        2   746 1 1 12 PRO HB3  H   -6.889  -5.573   5.328 1.00 . A A .  12 PRO HB3  1 1 
        2   747 1 1 12 PRO HD2  H   -7.971  -6.134   1.652 1.00 . A A .  12 PRO HD2  1 1 
        2   748 1 1 12 PRO HD3  H   -8.818  -6.355   3.196 1.00 . A A .  12 PRO HD3  1 1 
        2   749 1 1 12 PRO HG2  H   -5.891  -6.359   2.617 1.00 . A A .  12 PRO HG2  1 1 
        2   750 1 1 12 PRO HG3  H   -6.810  -7.318   3.792 1.00 . A A .  12 PRO HG3  1 1 
        2   751 1 1 12 PRO N    N   -7.971  -4.439   2.916 1.00 . A A .  12 PRO N    1 1 
        2   752 1 1 12 PRO O    O   -5.294  -2.258   3.691 1.00 . A A .  12 PRO O    1 1 
        2   753 1 1 13 TYR C    C   -4.964  -1.928   0.300 1.00 . A A .  13 TYR C    1 1 
        2   754 1 1 13 TYR CA   C   -4.390  -3.028   1.187 1.00 . A A .  13 TYR CA   1 1 
        2   755 1 1 13 TYR CB   C   -3.645  -4.053   0.330 1.00 . A A .  13 TYR CB   1 1 
        2   756 1 1 13 TYR CD1  C   -2.645  -5.514   2.132 1.00 . A A .  13 TYR CD1  1 1 
        2   757 1 1 13 TYR CD2  C   -4.093  -6.529   0.534 1.00 . A A .  13 TYR CD2  1 1 
        2   758 1 1 13 TYR CE1  C   -2.471  -6.733   2.756 1.00 . A A .  13 TYR CE1  1 1 
        2   759 1 1 13 TYR CE2  C   -3.925  -7.753   1.153 1.00 . A A .  13 TYR CE2  1 1 
        2   760 1 1 13 TYR CG   C   -3.457  -5.390   1.011 1.00 . A A .  13 TYR CG   1 1 
        2   761 1 1 13 TYR CZ   C   -3.113  -7.850   2.263 1.00 . A A .  13 TYR CZ   1 1 
        2   762 1 1 13 TYR H    H   -5.891  -4.467   1.579 1.00 . A A .  13 TYR H    1 1 
        2   763 1 1 13 TYR HA   H   -3.696  -2.586   1.887 1.00 . A A .  13 TYR HA   1 1 
        2   764 1 1 13 TYR HB2  H   -4.198  -4.220  -0.581 1.00 . A A .  13 TYR HB2  1 1 
        2   765 1 1 13 TYR HB3  H   -2.667  -3.665   0.086 1.00 . A A .  13 TYR HB3  1 1 
        2   766 1 1 13 TYR HD1  H   -2.144  -4.637   2.515 1.00 . A A .  13 TYR HD1  1 1 
        2   767 1 1 13 TYR HD2  H   -4.729  -6.451  -0.336 1.00 . A A .  13 TYR HD2  1 1 
        2   768 1 1 13 TYR HE1  H   -1.835  -6.809   3.626 1.00 . A A .  13 TYR HE1  1 1 
        2   769 1 1 13 TYR HE2  H   -4.428  -8.628   0.767 1.00 . A A .  13 TYR HE2  1 1 
        2   770 1 1 13 TYR HH   H   -2.284  -9.578   2.408 1.00 . A A .  13 TYR HH   1 1 
        2   771 1 1 13 TYR N    N   -5.443  -3.681   1.955 1.00 . A A .  13 TYR N    1 1 
        2   772 1 1 13 TYR O    O   -5.245  -2.147  -0.877 1.00 . A A .  13 TYR O    1 1 
        2   773 1 1 13 TYR OH   O   -2.943  -9.067   2.884 1.00 . A A .  13 TYR OH   1 1 
        2   774 1 1 14 GLY C    C   -5.096   1.706   0.568 1.00 . A A .  14 GLY C    1 1 
        2   775 1 1 14 GLY CA   C   -5.674   0.377   0.124 1.00 . A A .  14 GLY CA   1 1 
        2   776 1 1 14 GLY H    H   -4.893  -0.625   1.818 1.00 . A A .  14 GLY H    1 1 
        2   777 1 1 14 GLY HA2  H   -5.454   0.232  -0.923 1.00 . A A .  14 GLY HA2  1 1 
        2   778 1 1 14 GLY HA3  H   -6.746   0.401   0.257 1.00 . A A .  14 GLY HA3  1 1 
        2   779 1 1 14 GLY N    N   -5.135  -0.741   0.876 1.00 . A A .  14 GLY N    1 1 
        2   780 1 1 14 GLY O    O   -5.442   2.217   1.633 1.00 . A A .  14 GLY O    1 1 
        2   781 1 1 15 CYS C    C   -4.632   4.635   0.260 1.00 . A A .  15 CYS C    1 1 
        2   782 1 1 15 CYS CA   C   -3.583   3.544   0.064 1.00 . A A .  15 CYS CA   1 1 
        2   783 1 1 15 CYS CB   C   -2.615   3.947  -1.051 1.00 . A A .  15 CYS CB   1 1 
        2   784 1 1 15 CYS H    H   -3.977   1.811  -1.086 1.00 . A A .  15 CYS H    1 1 
        2   785 1 1 15 CYS HA   H   -3.030   3.425   0.983 1.00 . A A .  15 CYS HA   1 1 
        2   786 1 1 15 CYS HB2  H   -1.768   3.276  -1.042 1.00 . A A .  15 CYS HB2  1 1 
        2   787 1 1 15 CYS HB3  H   -3.120   3.868  -2.002 1.00 . A A .  15 CYS HB3  1 1 
        2   788 1 1 15 CYS N    N   -4.212   2.268  -0.250 1.00 . A A .  15 CYS N    1 1 
        2   789 1 1 15 CYS O    O   -5.703   4.595  -0.345 1.00 . A A .  15 CYS O    1 1 
        2   790 1 1 15 CYS SG   S   -1.974   5.646  -0.901 1.00 . A A .  15 CYS SG   1 1 
        2   791 1 1 16 SER C    C   -4.654   8.032   0.903 1.00 . A A .  16 SER C    1 1 
        2   792 1 1 16 SER CA   C   -5.232   6.706   1.388 1.00 . A A .  16 SER CA   1 1 
        2   793 1 1 16 SER CB   C   -5.528   6.784   2.887 1.00 . A A .  16 SER CB   1 1 
        2   794 1 1 16 SER H    H   -3.446   5.582   1.561 1.00 . A A .  16 SER H    1 1 
        2   795 1 1 16 SER HA   H   -6.153   6.513   0.858 1.00 . A A .  16 SER HA   1 1 
        2   796 1 1 16 SER HB2  H   -4.639   6.520   3.441 1.00 . A A .  16 SER HB2  1 1 
        2   797 1 1 16 SER HB3  H   -5.823   7.792   3.141 1.00 . A A .  16 SER HB3  1 1 
        2   798 1 1 16 SER HG   H   -6.608   5.172   2.620 1.00 . A A .  16 SER HG   1 1 
        2   799 1 1 16 SER N    N   -4.316   5.607   1.109 1.00 . A A .  16 SER N    1 1 
        2   800 1 1 16 SER O    O   -5.391   8.932   0.502 1.00 . A A .  16 SER O    1 1 
        2   801 1 1 16 SER OG   O   -6.572   5.897   3.248 1.00 . A A .  16 SER OG   1 1 
        2   802 1 1 17 GLU C    C   -3.208   9.842  -0.829 1.00 . A A .  17 GLU C    1 1 
        2   803 1 1 17 GLU CA   C   -2.652   9.359   0.508 1.00 . A A .  17 GLU CA   1 1 
        2   804 1 1 17 GLU CB   C   -1.147   9.115   0.389 1.00 . A A .  17 GLU CB   1 1 
        2   805 1 1 17 GLU CD   C   -0.926  11.504  -0.402 1.00 . A A .  17 GLU CD   1 1 
        2   806 1 1 17 GLU CG   C   -0.319  10.389   0.427 1.00 . A A .  17 GLU CG   1 1 
        2   807 1 1 17 GLU H    H   -2.797   7.390   1.273 1.00 . A A .  17 GLU H    1 1 
        2   808 1 1 17 GLU HA   H   -2.827  10.120   1.253 1.00 . A A .  17 GLU HA   1 1 
        2   809 1 1 17 GLU HB2  H   -0.831   8.480   1.203 1.00 . A A .  17 GLU HB2  1 1 
        2   810 1 1 17 GLU HB3  H   -0.949   8.611  -0.546 1.00 . A A .  17 GLU HB3  1 1 
        2   811 1 1 17 GLU HG2  H   -0.243  10.723   1.451 1.00 . A A .  17 GLU HG2  1 1 
        2   812 1 1 17 GLU HG3  H    0.668  10.173   0.046 1.00 . A A .  17 GLU HG3  1 1 
        2   813 1 1 17 GLU N    N   -3.330   8.143   0.943 1.00 . A A .  17 GLU N    1 1 
        2   814 1 1 17 GLU O    O   -3.483  11.029  -1.007 1.00 . A A .  17 GLU O    1 1 
        2   815 1 1 17 GLU OE1  O   -1.063  11.324  -1.630 1.00 . A A .  17 GLU OE1  1 1 
        2   816 1 1 17 GLU OE2  O   -1.264  12.557   0.178 1.00 . A A .  17 GLU OE2  1 1 
        2   817 1 1 18 CYS C    C   -5.138   8.424  -3.400 1.00 . A A .  18 CYS C    1 1 
        2   818 1 1 18 CYS CA   C   -3.890   9.244  -3.088 1.00 . A A .  18 CYS CA   1 1 
        2   819 1 1 18 CYS CB   C   -2.823   8.996  -4.156 1.00 . A A .  18 CYS CB   1 1 
        2   820 1 1 18 CYS H    H   -3.131   7.984  -1.565 1.00 . A A .  18 CYS H    1 1 
        2   821 1 1 18 CYS HA   H   -4.152  10.291  -3.089 1.00 . A A .  18 CYS HA   1 1 
        2   822 1 1 18 CYS HB2  H   -3.149   9.434  -5.088 1.00 . A A .  18 CYS HB2  1 1 
        2   823 1 1 18 CYS HB3  H   -1.900   9.464  -3.848 1.00 . A A .  18 CYS HB3  1 1 
        2   824 1 1 18 CYS N    N   -3.369   8.914  -1.767 1.00 . A A .  18 CYS N    1 1 
        2   825 1 1 18 CYS O    O   -6.090   8.926  -3.996 1.00 . A A .  18 CYS O    1 1 
        2   826 1 1 18 CYS SG   S   -2.476   7.235  -4.466 1.00 . A A .  18 CYS SG   1 1 
        2   827 1 1 19 GLY C    C   -5.968   5.230  -4.281 1.00 . A A .  19 GLY C    1 1 
        2   828 1 1 19 GLY CA   C   -6.262   6.290  -3.237 1.00 . A A .  19 GLY CA   1 1 
        2   829 1 1 19 GLY H    H   -4.340   6.813  -2.521 1.00 . A A .  19 GLY H    1 1 
        2   830 1 1 19 GLY HA2  H   -6.535   5.803  -2.313 1.00 . A A .  19 GLY HA2  1 1 
        2   831 1 1 19 GLY HA3  H   -7.094   6.890  -3.575 1.00 . A A .  19 GLY HA3  1 1 
        2   832 1 1 19 GLY N    N   -5.126   7.159  -2.992 1.00 . A A .  19 GLY N    1 1 
        2   833 1 1 19 GLY O    O   -6.525   5.257  -5.378 1.00 . A A .  19 GLY O    1 1 
        2   834 1 1 20 LYS C    C   -4.749   1.870  -4.149 1.00 . A A .  20 LYS C    1 1 
        2   835 1 1 20 LYS CA   C   -4.718   3.222  -4.856 1.00 . A A .  20 LYS CA   1 1 
        2   836 1 1 20 LYS CB   C   -3.325   3.475  -5.435 1.00 . A A .  20 LYS CB   1 1 
        2   837 1 1 20 LYS CD   C   -2.129   3.701  -7.633 1.00 . A A .  20 LYS CD   1 1 
        2   838 1 1 20 LYS CE   C   -2.724   5.025  -8.089 1.00 . A A .  20 LYS CE   1 1 
        2   839 1 1 20 LYS CG   C   -3.128   2.891  -6.824 1.00 . A A .  20 LYS CG   1 1 
        2   840 1 1 20 LYS H    H   -4.676   4.327  -3.051 1.00 . A A .  20 LYS H    1 1 
        2   841 1 1 20 LYS HA   H   -5.437   3.210  -5.661 1.00 . A A .  20 LYS HA   1 1 
        2   842 1 1 20 LYS HB2  H   -3.158   4.541  -5.489 1.00 . A A .  20 LYS HB2  1 1 
        2   843 1 1 20 LYS HB3  H   -2.589   3.037  -4.776 1.00 . A A .  20 LYS HB3  1 1 
        2   844 1 1 20 LYS HD2  H   -1.262   3.901  -7.022 1.00 . A A .  20 LYS HD2  1 1 
        2   845 1 1 20 LYS HD3  H   -1.835   3.130  -8.502 1.00 . A A .  20 LYS HD3  1 1 
        2   846 1 1 20 LYS HE2  H   -3.239   4.870  -9.025 1.00 . A A .  20 LYS HE2  1 1 
        2   847 1 1 20 LYS HE3  H   -3.427   5.365  -7.343 1.00 . A A .  20 LYS HE3  1 1 
        2   848 1 1 20 LYS HG2  H   -2.764   1.879  -6.731 1.00 . A A .  20 LYS HG2  1 1 
        2   849 1 1 20 LYS HG3  H   -4.078   2.888  -7.340 1.00 . A A .  20 LYS HG3  1 1 
        2   850 1 1 20 LYS HZ1  H   -1.867   6.881  -7.661 1.00 . A A .  20 LYS HZ1  1 1 
        2   851 1 1 20 LYS HZ2  H   -1.670   6.390  -9.268 1.00 . A A .  20 LYS HZ2  1 1 
        2   852 1 1 20 LYS HZ3  H   -0.741   5.679  -8.047 1.00 . A A .  20 LYS HZ3  1 1 
        2   853 1 1 20 LYS N    N   -5.087   4.295  -3.940 1.00 . A A .  20 LYS N    1 1 
        2   854 1 1 20 LYS NZ   N   -1.677   6.067  -8.279 1.00 . A A .  20 LYS NZ   1 1 
        2   855 1 1 20 LYS O    O   -3.995   1.635  -3.206 1.00 . A A .  20 LYS O    1 1 
        2   856 1 1 21 ALA C    C   -4.915  -1.364  -4.798 1.00 . A A .  21 ALA C    1 1 
        2   857 1 1 21 ALA CA   C   -5.749  -0.345  -4.029 1.00 . A A .  21 ALA CA   1 1 
        2   858 1 1 21 ALA CB   C   -7.210  -0.771  -3.998 1.00 . A A .  21 ALA CB   1 1 
        2   859 1 1 21 ALA H    H   -6.198   1.231  -5.369 1.00 . A A .  21 ALA H    1 1 
        2   860 1 1 21 ALA HA   H   -5.392  -0.296  -3.011 1.00 . A A .  21 ALA HA   1 1 
        2   861 1 1 21 ALA HB1  H   -7.652  -0.613  -4.970 1.00 . A A .  21 ALA HB1  1 1 
        2   862 1 1 21 ALA HB2  H   -7.272  -1.819  -3.739 1.00 . A A .  21 ALA HB2  1 1 
        2   863 1 1 21 ALA HB3  H   -7.740  -0.186  -3.261 1.00 . A A .  21 ALA HB3  1 1 
        2   864 1 1 21 ALA N    N   -5.624   0.985  -4.614 1.00 . A A .  21 ALA N    1 1 
        2   865 1 1 21 ALA O    O   -4.515  -1.121  -5.936 1.00 . A A .  21 ALA O    1 1 
        2   866 1 1 22 PHE C    C   -4.375  -4.937  -4.376 1.00 . A A .  22 PHE C    1 1 
        2   867 1 1 22 PHE CA   C   -3.866  -3.560  -4.792 1.00 . A A .  22 PHE CA   1 1 
        2   868 1 1 22 PHE CB   C   -2.390  -3.414  -4.415 1.00 . A A .  22 PHE CB   1 1 
        2   869 1 1 22 PHE CD1  C   -1.962  -1.023  -3.785 1.00 . A A .  22 PHE CD1  1 1 
        2   870 1 1 22 PHE CD2  C   -1.171  -1.797  -5.897 1.00 . A A .  22 PHE CD2  1 1 
        2   871 1 1 22 PHE CE1  C   -1.448   0.233  -4.048 1.00 . A A .  22 PHE CE1  1 1 
        2   872 1 1 22 PHE CE2  C   -0.654  -0.544  -6.165 1.00 . A A .  22 PHE CE2  1 1 
        2   873 1 1 22 PHE CG   C   -1.830  -2.050  -4.705 1.00 . A A .  22 PHE CG   1 1 
        2   874 1 1 22 PHE CZ   C   -0.794   0.473  -5.241 1.00 . A A .  22 PHE CZ   1 1 
        2   875 1 1 22 PHE H    H   -5.002  -2.639  -3.260 1.00 . A A .  22 PHE H    1 1 
        2   876 1 1 22 PHE HA   H   -3.967  -3.460  -5.861 1.00 . A A .  22 PHE HA   1 1 
        2   877 1 1 22 PHE HB2  H   -2.276  -3.601  -3.358 1.00 . A A .  22 PHE HB2  1 1 
        2   878 1 1 22 PHE HB3  H   -1.811  -4.137  -4.970 1.00 . A A .  22 PHE HB3  1 1 
        2   879 1 1 22 PHE HD1  H   -2.474  -1.210  -2.851 1.00 . A A .  22 PHE HD1  1 1 
        2   880 1 1 22 PHE HD2  H   -1.063  -2.590  -6.622 1.00 . A A .  22 PHE HD2  1 1 
        2   881 1 1 22 PHE HE1  H   -1.558   1.025  -3.323 1.00 . A A .  22 PHE HE1  1 1 
        2   882 1 1 22 PHE HE2  H   -0.144  -0.358  -7.099 1.00 . A A .  22 PHE HE2  1 1 
        2   883 1 1 22 PHE HZ   H   -0.390   1.453  -5.448 1.00 . A A .  22 PHE HZ   1 1 
        2   884 1 1 22 PHE N    N   -4.655  -2.504  -4.167 1.00 . A A .  22 PHE N    1 1 
        2   885 1 1 22 PHE O    O   -5.060  -5.078  -3.363 1.00 . A A .  22 PHE O    1 1 
        2   886 1 1 23 SER C    C   -3.714  -7.878  -3.675 1.00 . A A .  23 SER C    1 1 
        2   887 1 1 23 SER CA   C   -4.459  -7.317  -4.883 1.00 . A A .  23 SER CA   1 1 
        2   888 1 1 23 SER CB   C   -4.223  -8.209  -6.102 1.00 . A A .  23 SER CB   1 1 
        2   889 1 1 23 SER H    H   -3.485  -5.775  -5.959 1.00 . A A .  23 SER H    1 1 
        2   890 1 1 23 SER HA   H   -5.515  -7.296  -4.662 1.00 . A A .  23 SER HA   1 1 
        2   891 1 1 23 SER HB2  H   -3.174  -8.196  -6.358 1.00 . A A .  23 SER HB2  1 1 
        2   892 1 1 23 SER HB3  H   -4.524  -9.220  -5.869 1.00 . A A .  23 SER HB3  1 1 
        2   893 1 1 23 SER HG   H   -5.799  -8.239  -7.266 1.00 . A A .  23 SER HG   1 1 
        2   894 1 1 23 SER N    N   -4.034  -5.951  -5.165 1.00 . A A .  23 SER N    1 1 
        2   895 1 1 23 SER O    O   -4.318  -8.466  -2.778 1.00 . A A .  23 SER O    1 1 
        2   896 1 1 23 SER OG   O   -4.970  -7.757  -7.218 1.00 . A A .  23 SER OG   1 1 
        2   897 1 1 24 SER C    C   -1.067  -7.029  -1.705 1.00 . A A .  24 SER C    1 1 
        2   898 1 1 24 SER CA   C   -1.569  -8.184  -2.566 1.00 . A A .  24 SER CA   1 1 
        2   899 1 1 24 SER CB   C   -0.383  -8.979  -3.115 1.00 . A A .  24 SER CB   1 1 
        2   900 1 1 24 SER H    H   -1.975  -7.216  -4.406 1.00 . A A .  24 SER H    1 1 
        2   901 1 1 24 SER HA   H   -2.177  -8.835  -1.956 1.00 . A A .  24 SER HA   1 1 
        2   902 1 1 24 SER HB2  H    0.037  -8.458  -3.961 1.00 . A A .  24 SER HB2  1 1 
        2   903 1 1 24 SER HB3  H    0.368  -9.078  -2.344 1.00 . A A .  24 SER HB3  1 1 
        2   904 1 1 24 SER HG   H   -1.567 -10.538  -3.040 1.00 . A A .  24 SER HG   1 1 
        2   905 1 1 24 SER N    N   -2.398  -7.693  -3.661 1.00 . A A .  24 SER N    1 1 
        2   906 1 1 24 SER O    O   -1.376  -5.866  -1.963 1.00 . A A .  24 SER O    1 1 
        2   907 1 1 24 SER OG   O   -0.785 -10.273  -3.530 1.00 . A A .  24 SER OG   1 1 
        2   908 1 1 25 LYS C    C    1.476  -5.673  -0.396 1.00 . A A .  25 LYS C    1 1 
        2   909 1 1 25 LYS CA   C    0.258  -6.352   0.222 1.00 . A A .  25 LYS CA   1 1 
        2   910 1 1 25 LYS CB   C    0.640  -6.989   1.560 1.00 . A A .  25 LYS CB   1 1 
        2   911 1 1 25 LYS CD   C    2.960  -6.257   2.185 1.00 . A A .  25 LYS CD   1 1 
        2   912 1 1 25 LYS CE   C    3.793  -5.829   3.383 1.00 . A A .  25 LYS CE   1 1 
        2   913 1 1 25 LYS CG   C    1.474  -6.082   2.449 1.00 . A A .  25 LYS CG   1 1 
        2   914 1 1 25 LYS H    H   -0.079  -8.304  -0.524 1.00 . A A .  25 LYS H    1 1 
        2   915 1 1 25 LYS HA   H   -0.506  -5.608   0.392 1.00 . A A .  25 LYS HA   1 1 
        2   916 1 1 25 LYS HB2  H   -0.263  -7.248   2.093 1.00 . A A .  25 LYS HB2  1 1 
        2   917 1 1 25 LYS HB3  H    1.205  -7.889   1.368 1.00 . A A .  25 LYS HB3  1 1 
        2   918 1 1 25 LYS HD2  H    3.160  -7.297   1.974 1.00 . A A .  25 LYS HD2  1 1 
        2   919 1 1 25 LYS HD3  H    3.238  -5.655   1.331 1.00 . A A .  25 LYS HD3  1 1 
        2   920 1 1 25 LYS HE2  H    4.758  -5.495   3.034 1.00 . A A .  25 LYS HE2  1 1 
        2   921 1 1 25 LYS HE3  H    3.290  -5.015   3.883 1.00 . A A .  25 LYS HE3  1 1 
        2   922 1 1 25 LYS HG2  H    1.203  -5.055   2.255 1.00 . A A .  25 LYS HG2  1 1 
        2   923 1 1 25 LYS HG3  H    1.271  -6.321   3.483 1.00 . A A .  25 LYS HG3  1 1 
        2   924 1 1 25 LYS HZ1  H    4.876  -7.447   4.143 1.00 . A A .  25 LYS HZ1  1 1 
        2   925 1 1 25 LYS HZ2  H    3.198  -7.619   4.281 1.00 . A A .  25 LYS HZ2  1 1 
        2   926 1 1 25 LYS HZ3  H    4.030  -6.575   5.320 1.00 . A A .  25 LYS HZ3  1 1 
        2   927 1 1 25 LYS N    N   -0.290  -7.359  -0.679 1.00 . A A .  25 LYS N    1 1 
        2   928 1 1 25 LYS NZ   N    3.988  -6.946   4.349 1.00 . A A .  25 LYS NZ   1 1 
        2   929 1 1 25 LYS O    O    1.610  -4.451  -0.344 1.00 . A A .  25 LYS O    1 1 
        2   930 1 1 26 SER C    C    3.232  -4.816  -2.572 1.00 . A A .  26 SER C    1 1 
        2   931 1 1 26 SER CA   C    3.568  -5.951  -1.609 1.00 . A A .  26 SER CA   1 1 
        2   932 1 1 26 SER CB   C    4.305  -7.065  -2.354 1.00 . A A .  26 SER CB   1 1 
        2   933 1 1 26 SER H    H    2.196  -7.441  -0.991 1.00 . A A .  26 SER H    1 1 
        2   934 1 1 26 SER HA   H    4.207  -5.568  -0.828 1.00 . A A .  26 SER HA   1 1 
        2   935 1 1 26 SER HB2  H    5.091  -6.634  -2.955 1.00 . A A .  26 SER HB2  1 1 
        2   936 1 1 26 SER HB3  H    4.735  -7.751  -1.637 1.00 . A A .  26 SER HB3  1 1 
        2   937 1 1 26 SER HG   H    3.226  -8.636  -2.808 1.00 . A A .  26 SER HG   1 1 
        2   938 1 1 26 SER N    N    2.360  -6.474  -0.982 1.00 . A A .  26 SER N    1 1 
        2   939 1 1 26 SER O    O    3.657  -3.677  -2.378 1.00 . A A .  26 SER O    1 1 
        2   940 1 1 26 SER OG   O    3.424  -7.783  -3.201 1.00 . A A .  26 SER OG   1 1 
        2   941 1 1 27 TYR C    C    1.796  -2.796  -3.950 1.00 . A A .  27 TYR C    1 1 
        2   942 1 1 27 TYR CA   C    2.077  -4.145  -4.605 1.00 . A A .  27 TYR CA   1 1 
        2   943 1 1 27 TYR CB   C    0.840  -4.619  -5.369 1.00 . A A .  27 TYR CB   1 1 
        2   944 1 1 27 TYR CD1  C    1.919  -4.914  -7.633 1.00 . A A .  27 TYR CD1  1 1 
        2   945 1 1 27 TYR CD2  C    0.718  -6.755  -6.711 1.00 . A A .  27 TYR CD2  1 1 
        2   946 1 1 27 TYR CE1  C    2.217  -5.664  -8.755 1.00 . A A .  27 TYR CE1  1 1 
        2   947 1 1 27 TYR CE2  C    1.013  -7.513  -7.828 1.00 . A A .  27 TYR CE2  1 1 
        2   948 1 1 27 TYR CG   C    1.164  -5.445  -6.594 1.00 . A A .  27 TYR CG   1 1 
        2   949 1 1 27 TYR CZ   C    1.762  -6.963  -8.847 1.00 . A A .  27 TYR CZ   1 1 
        2   950 1 1 27 TYR H    H    2.160  -6.061  -3.710 1.00 . A A .  27 TYR H    1 1 
        2   951 1 1 27 TYR HA   H    2.896  -4.031  -5.300 1.00 . A A .  27 TYR HA   1 1 
        2   952 1 1 27 TYR HB2  H    0.231  -5.224  -4.715 1.00 . A A .  27 TYR HB2  1 1 
        2   953 1 1 27 TYR HB3  H    0.271  -3.759  -5.690 1.00 . A A .  27 TYR HB3  1 1 
        2   954 1 1 27 TYR HD1  H    2.274  -3.897  -7.558 1.00 . A A .  27 TYR HD1  1 1 
        2   955 1 1 27 TYR HD2  H    0.131  -7.183  -5.911 1.00 . A A .  27 TYR HD2  1 1 
        2   956 1 1 27 TYR HE1  H    2.804  -5.234  -9.552 1.00 . A A .  27 TYR HE1  1 1 
        2   957 1 1 27 TYR HE2  H    0.656  -8.530  -7.901 1.00 . A A .  27 TYR HE2  1 1 
        2   958 1 1 27 TYR HH   H    2.700  -8.389  -9.731 1.00 . A A .  27 TYR HH   1 1 
        2   959 1 1 27 TYR N    N    2.468  -5.136  -3.610 1.00 . A A .  27 TYR N    1 1 
        2   960 1 1 27 TYR O    O    2.210  -1.750  -4.452 1.00 . A A .  27 TYR O    1 1 
        2   961 1 1 27 TYR OH   O    2.058  -7.714  -9.962 1.00 . A A .  27 TYR OH   1 1 
        2   962 1 1 28 LEU C    C    2.011  -0.941  -1.543 1.00 . A A .  28 LEU C    1 1 
        2   963 1 1 28 LEU CA   C    0.756  -1.608  -2.097 1.00 . A A .  28 LEU CA   1 1 
        2   964 1 1 28 LEU CB   C   -0.214  -1.922  -0.957 1.00 . A A .  28 LEU CB   1 1 
        2   965 1 1 28 LEU CD1  C   -1.074   0.401  -0.571 1.00 . A A .  28 LEU CD1  1 1 
        2   966 1 1 28 LEU CD2  C   -1.259  -1.314   1.240 1.00 . A A .  28 LEU CD2  1 1 
        2   967 1 1 28 LEU CG   C   -0.420  -0.811   0.074 1.00 . A A .  28 LEU CG   1 1 
        2   968 1 1 28 LEU H    H    0.790  -3.690  -2.473 1.00 . A A .  28 LEU H    1 1 
        2   969 1 1 28 LEU HA   H    0.278  -0.931  -2.789 1.00 . A A .  28 LEU HA   1 1 
        2   970 1 1 28 LEU HB2  H   -1.175  -2.149  -1.393 1.00 . A A .  28 LEU HB2  1 1 
        2   971 1 1 28 LEU HB3  H    0.158  -2.792  -0.437 1.00 . A A .  28 LEU HB3  1 1 
        2   972 1 1 28 LEU HD11 H   -1.552   1.000   0.189 1.00 . A A .  28 LEU HD11 1 1 
        2   973 1 1 28 LEU HD12 H   -1.811   0.074  -1.289 1.00 . A A .  28 LEU HD12 1 1 
        2   974 1 1 28 LEU HD13 H   -0.321   0.991  -1.074 1.00 . A A .  28 LEU HD13 1 1 
        2   975 1 1 28 LEU HD21 H   -2.092  -1.889   0.862 1.00 . A A .  28 LEU HD21 1 1 
        2   976 1 1 28 LEU HD22 H   -1.629  -0.472   1.806 1.00 . A A .  28 LEU HD22 1 1 
        2   977 1 1 28 LEU HD23 H   -0.650  -1.937   1.878 1.00 . A A .  28 LEU HD23 1 1 
        2   978 1 1 28 LEU HG   H    0.542  -0.504   0.460 1.00 . A A .  28 LEU HG   1 1 
        2   979 1 1 28 LEU N    N    1.092  -2.827  -2.824 1.00 . A A .  28 LEU N    1 1 
        2   980 1 1 28 LEU O    O    2.180   0.274  -1.655 1.00 . A A .  28 LEU O    1 1 
        2   981 1 1 29 ILE C    C    4.945  -0.482  -1.429 1.00 . A A .  29 ILE C    1 1 
        2   982 1 1 29 ILE CA   C    4.128  -1.230  -0.381 1.00 . A A .  29 ILE CA   1 1 
        2   983 1 1 29 ILE CB   C    4.987  -2.364   0.210 1.00 . A A .  29 ILE CB   1 1 
        2   984 1 1 29 ILE CD1  C    3.617  -2.133   2.343 1.00 . A A .  29 ILE CD1  1 1 
        2   985 1 1 29 ILE CG1  C    4.228  -3.077   1.331 1.00 . A A .  29 ILE CG1  1 1 
        2   986 1 1 29 ILE CG2  C    6.309  -1.813   0.725 1.00 . A A .  29 ILE CG2  1 1 
        2   987 1 1 29 ILE H    H    2.696  -2.702  -0.891 1.00 . A A .  29 ILE H    1 1 
        2   988 1 1 29 ILE HA   H    3.872  -0.547   0.416 1.00 . A A .  29 ILE HA   1 1 
        2   989 1 1 29 ILE HB   H    5.201  -3.071  -0.576 1.00 . A A .  29 ILE HB   1 1 
        2   990 1 1 29 ILE HD11 H    2.574  -1.977   2.105 1.00 . A A .  29 ILE HD11 1 1 
        2   991 1 1 29 ILE HD12 H    3.699  -2.560   3.331 1.00 . A A .  29 ILE HD12 1 1 
        2   992 1 1 29 ILE HD13 H    4.137  -1.187   2.314 1.00 . A A .  29 ILE HD13 1 1 
        2   993 1 1 29 ILE HG12 H    3.432  -3.663   0.902 1.00 . A A .  29 ILE HG12 1 1 
        2   994 1 1 29 ILE HG13 H    4.909  -3.731   1.856 1.00 . A A .  29 ILE HG13 1 1 
        2   995 1 1 29 ILE HG21 H    6.150  -1.324   1.675 1.00 . A A .  29 ILE HG21 1 1 
        2   996 1 1 29 ILE HG22 H    7.011  -2.623   0.851 1.00 . A A .  29 ILE HG22 1 1 
        2   997 1 1 29 ILE HG23 H    6.703  -1.101   0.015 1.00 . A A .  29 ILE HG23 1 1 
        2   998 1 1 29 ILE N    N    2.887  -1.743  -0.949 1.00 . A A .  29 ILE N    1 1 
        2   999 1 1 29 ILE O    O    5.300   0.681  -1.239 1.00 . A A .  29 ILE O    1 1 
        2  1000 1 1 30 ILE C    C    5.458   0.817  -3.986 1.00 . A A .  30 ILE C    1 1 
        2  1001 1 1 30 ILE CA   C    6.009  -0.555  -3.615 1.00 . A A .  30 ILE CA   1 1 
        2  1002 1 1 30 ILE CB   C    6.015  -1.450  -4.869 1.00 . A A .  30 ILE CB   1 1 
        2  1003 1 1 30 ILE CD1  C    6.199  -3.900  -5.533 1.00 . A A .  30 ILE CD1  1 1 
        2  1004 1 1 30 ILE CG1  C    6.584  -2.830  -4.535 1.00 . A A .  30 ILE CG1  1 1 
        2  1005 1 1 30 ILE CG2  C    6.819  -0.795  -5.983 1.00 . A A .  30 ILE CG2  1 1 
        2  1006 1 1 30 ILE H    H    4.926  -2.082  -2.628 1.00 . A A .  30 ILE H    1 1 
        2  1007 1 1 30 ILE HA   H    7.028  -0.442  -3.274 1.00 . A A .  30 ILE HA   1 1 
        2  1008 1 1 30 ILE HB   H    4.997  -1.560  -5.210 1.00 . A A .  30 ILE HB   1 1 
        2  1009 1 1 30 ILE HD11 H    5.126  -4.028  -5.528 1.00 . A A .  30 ILE HD11 1 1 
        2  1010 1 1 30 ILE HD12 H    6.520  -3.603  -6.521 1.00 . A A .  30 ILE HD12 1 1 
        2  1011 1 1 30 ILE HD13 H    6.674  -4.831  -5.264 1.00 . A A .  30 ILE HD13 1 1 
        2  1012 1 1 30 ILE HG12 H    7.660  -2.773  -4.510 1.00 . A A .  30 ILE HG12 1 1 
        2  1013 1 1 30 ILE HG13 H    6.221  -3.135  -3.564 1.00 . A A .  30 ILE HG13 1 1 
        2  1014 1 1 30 ILE HG21 H    6.720   0.278  -5.915 1.00 . A A .  30 ILE HG21 1 1 
        2  1015 1 1 30 ILE HG22 H    7.859  -1.067  -5.883 1.00 . A A .  30 ILE HG22 1 1 
        2  1016 1 1 30 ILE HG23 H    6.449  -1.131  -6.940 1.00 . A A .  30 ILE HG23 1 1 
        2  1017 1 1 30 ILE N    N    5.237  -1.157  -2.535 1.00 . A A .  30 ILE N    1 1 
        2  1018 1 1 30 ILE O    O    6.213   1.733  -4.316 1.00 . A A .  30 ILE O    1 1 
        2  1019 1 1 31 HIS C    C    3.813   3.284  -3.216 1.00 . A A .  31 HIS C    1 1 
        2  1020 1 1 31 HIS CA   C    3.484   2.216  -4.256 1.00 . A A .  31 HIS CA   1 1 
        2  1021 1 1 31 HIS CB   C    1.970   2.024  -4.344 1.00 . A A .  31 HIS CB   1 1 
        2  1022 1 1 31 HIS CD2  C    0.650   4.012  -3.328 1.00 . A A .  31 HIS CD2  1 1 
        2  1023 1 1 31 HIS CE1  C    0.236   5.104  -5.184 1.00 . A A .  31 HIS CE1  1 1 
        2  1024 1 1 31 HIS CG   C    1.202   3.310  -4.345 1.00 . A A .  31 HIS CG   1 1 
        2  1025 1 1 31 HIS H    H    3.589   0.188  -3.658 1.00 . A A .  31 HIS H    1 1 
        2  1026 1 1 31 HIS HA   H    3.854   2.542  -5.217 1.00 . A A .  31 HIS HA   1 1 
        2  1027 1 1 31 HIS HB2  H    1.734   1.496  -5.257 1.00 . A A .  31 HIS HB2  1 1 
        2  1028 1 1 31 HIS HB3  H    1.638   1.438  -3.499 1.00 . A A .  31 HIS HB3  1 1 
        2  1029 1 1 31 HIS HD1  H    1.192   3.767  -6.402 1.00 . A A .  31 HIS HD1  1 1 
        2  1030 1 1 31 HIS HD2  H    0.673   3.749  -2.280 1.00 . A A .  31 HIS HD2  1 1 
        2  1031 1 1 31 HIS HE1  H   -0.119   5.848  -5.880 1.00 . A A .  31 HIS HE1  1 1 
        2  1032 1 1 31 HIS N    N    4.137   0.954  -3.928 1.00 . A A .  31 HIS N    1 1 
        2  1033 1 1 31 HIS ND1  N    0.924   4.019  -5.494 1.00 . A A .  31 HIS ND1  1 1 
        2  1034 1 1 31 HIS NE2  N    0.056   5.123  -3.875 1.00 . A A .  31 HIS NE2  1 1 
        2  1035 1 1 31 HIS O    O    4.137   4.420  -3.561 1.00 . A A .  31 HIS O    1 1 
        2  1036 1 1 32 MET C    C    5.337   4.560  -1.093 1.00 . A A .  32 MET C    1 1 
        2  1037 1 1 32 MET CA   C    4.016   3.836  -0.855 1.00 . A A .  32 MET CA   1 1 
        2  1038 1 1 32 MET CB   C    4.064   3.089   0.479 1.00 . A A .  32 MET CB   1 1 
        2  1039 1 1 32 MET CE   C    1.156   5.083   0.937 1.00 . A A .  32 MET CE   1 1 
        2  1040 1 1 32 MET CG   C    2.690   2.778   1.051 1.00 . A A .  32 MET CG   1 1 
        2  1041 1 1 32 MET H    H    3.464   1.991  -1.732 1.00 . A A .  32 MET H    1 1 
        2  1042 1 1 32 MET HA   H    3.221   4.565  -0.820 1.00 . A A .  32 MET HA   1 1 
        2  1043 1 1 32 MET HB2  H    4.591   2.157   0.337 1.00 . A A .  32 MET HB2  1 1 
        2  1044 1 1 32 MET HB3  H    4.601   3.691   1.197 1.00 . A A .  32 MET HB3  1 1 
        2  1045 1 1 32 MET HE1  H    0.106   5.069   1.191 1.00 . A A .  32 MET HE1  1 1 
        2  1046 1 1 32 MET HE2  H    1.519   6.100   0.963 1.00 . A A .  32 MET HE2  1 1 
        2  1047 1 1 32 MET HE3  H    1.293   4.677  -0.055 1.00 . A A .  32 MET HE3  1 1 
        2  1048 1 1 32 MET HG2  H    1.998   2.639   0.235 1.00 . A A .  32 MET HG2  1 1 
        2  1049 1 1 32 MET HG3  H    2.754   1.866   1.626 1.00 . A A .  32 MET HG3  1 1 
        2  1050 1 1 32 MET N    N    3.727   2.910  -1.944 1.00 . A A .  32 MET N    1 1 
        2  1051 1 1 32 MET O    O    5.537   5.679  -0.619 1.00 . A A .  32 MET O    1 1 
        2  1052 1 1 32 MET SD   S    2.069   4.092   2.118 1.00 . A A .  32 MET SD   1 1 
        2  1053 1 1 33 ARG C    C    7.385   5.875  -2.767 1.00 . A A .  33 ARG C    1 1 
        2  1054 1 1 33 ARG CA   C    7.539   4.497  -2.129 1.00 . A A .  33 ARG CA   1 1 
        2  1055 1 1 33 ARG CB   C    8.331   3.578  -3.061 1.00 . A A .  33 ARG CB   1 1 
        2  1056 1 1 33 ARG CD   C    9.158   1.249  -3.519 1.00 . A A .  33 ARG CD   1 1 
        2  1057 1 1 33 ARG CG   C    8.601   2.202  -2.473 1.00 . A A .  33 ARG CG   1 1 
        2  1058 1 1 33 ARG CZ   C   11.095   2.356  -4.551 1.00 . A A .  33 ARG CZ   1 1 
        2  1059 1 1 33 ARG H    H    6.019   3.026  -2.179 1.00 . A A .  33 ARG H    1 1 
        2  1060 1 1 33 ARG HA   H    8.077   4.602  -1.199 1.00 . A A .  33 ARG HA   1 1 
        2  1061 1 1 33 ARG HB2  H    7.775   3.450  -3.978 1.00 . A A .  33 ARG HB2  1 1 
        2  1062 1 1 33 ARG HB3  H    9.279   4.042  -3.285 1.00 . A A .  33 ARG HB3  1 1 
        2  1063 1 1 33 ARG HD2  H    8.986   0.235  -3.191 1.00 . A A .  33 ARG HD2  1 1 
        2  1064 1 1 33 ARG HD3  H    8.640   1.418  -4.452 1.00 . A A .  33 ARG HD3  1 1 
        2  1065 1 1 33 ARG HE   H   11.204   0.863  -3.234 1.00 . A A .  33 ARG HE   1 1 
        2  1066 1 1 33 ARG HG2  H    9.319   2.298  -1.672 1.00 . A A .  33 ARG HG2  1 1 
        2  1067 1 1 33 ARG HG3  H    7.678   1.799  -2.085 1.00 . A A .  33 ARG HG3  1 1 
        2  1068 1 1 33 ARG HH11 H    9.298   3.072  -5.133 1.00 . A A .  33 ARG HH11 1 1 
        2  1069 1 1 33 ARG HH12 H   10.672   3.844  -5.852 1.00 . A A .  33 ARG HH12 1 1 
        2  1070 1 1 33 ARG HH21 H   13.021   1.871  -4.174 1.00 . A A .  33 ARG HH21 1 1 
        2  1071 1 1 33 ARG HH22 H   12.789   3.159  -5.307 1.00 . A A .  33 ARG HH22 1 1 
        2  1072 1 1 33 ARG N    N    6.236   3.915  -1.830 1.00 . A A .  33 ARG N    1 1 
        2  1073 1 1 33 ARG NE   N   10.590   1.443  -3.729 1.00 . A A .  33 ARG NE   1 1 
        2  1074 1 1 33 ARG NH1  N   10.289   3.156  -5.235 1.00 . A A .  33 ARG NH1  1 1 
        2  1075 1 1 33 ARG NH2  N   12.410   2.472  -4.689 1.00 . A A .  33 ARG NH2  1 1 
        2  1076 1 1 33 ARG O    O    8.193   6.774  -2.532 1.00 . A A .  33 ARG O    1 1 
        2  1077 1 1 34 THR C    C    5.751   8.399  -3.245 1.00 . A A .  34 THR C    1 1 
        2  1078 1 1 34 THR CA   C    6.082   7.300  -4.249 1.00 . A A .  34 THR CA   1 1 
        2  1079 1 1 34 THR CB   C    4.923   7.174  -5.255 1.00 . A A .  34 THR CB   1 1 
        2  1080 1 1 34 THR CG2  C    5.228   6.112  -6.301 1.00 . A A .  34 THR CG2  1 1 
        2  1081 1 1 34 THR H    H    5.733   5.280  -3.722 1.00 . A A .  34 THR H    1 1 
        2  1082 1 1 34 THR HA   H    6.974   7.578  -4.791 1.00 . A A .  34 THR HA   1 1 
        2  1083 1 1 34 THR HB   H    4.795   8.124  -5.755 1.00 . A A .  34 THR HB   1 1 
        2  1084 1 1 34 THR HG1  H    3.901   6.202  -3.877 1.00 . A A .  34 THR HG1  1 1 
        2  1085 1 1 34 THR HG21 H    4.521   5.302  -6.208 1.00 . A A .  34 THR HG21 1 1 
        2  1086 1 1 34 THR HG22 H    6.229   5.735  -6.151 1.00 . A A .  34 THR HG22 1 1 
        2  1087 1 1 34 THR HG23 H    5.151   6.546  -7.287 1.00 . A A .  34 THR HG23 1 1 
        2  1088 1 1 34 THR N    N    6.342   6.034  -3.575 1.00 . A A .  34 THR N    1 1 
        2  1089 1 1 34 THR O    O    6.168   9.546  -3.406 1.00 . A A .  34 THR O    1 1 
        2  1090 1 1 34 THR OG1  O    3.712   6.841  -4.569 1.00 . A A .  34 THR OG1  1 1 
        2  1091 1 1 35 HIS C    C    5.740   9.187  -0.164 1.00 . A A .  35 HIS C    1 1 
        2  1092 1 1 35 HIS CA   C    4.615   8.996  -1.177 1.00 . A A .  35 HIS CA   1 1 
        2  1093 1 1 35 HIS CB   C    3.346   8.526  -0.464 1.00 . A A .  35 HIS CB   1 1 
        2  1094 1 1 35 HIS CD2  C    1.181   7.567  -1.522 1.00 . A A .  35 HIS CD2  1 1 
        2  1095 1 1 35 HIS CE1  C    0.685   9.259  -2.825 1.00 . A A .  35 HIS CE1  1 1 
        2  1096 1 1 35 HIS CG   C    2.135   8.511  -1.344 1.00 . A A .  35 HIS CG   1 1 
        2  1097 1 1 35 HIS H    H    4.699   7.111  -2.135 1.00 . A A .  35 HIS H    1 1 
        2  1098 1 1 35 HIS HA   H    4.417   9.942  -1.658 1.00 . A A .  35 HIS HA   1 1 
        2  1099 1 1 35 HIS HB2  H    3.500   7.522  -0.095 1.00 . A A .  35 HIS HB2  1 1 
        2  1100 1 1 35 HIS HB3  H    3.144   9.184   0.369 1.00 . A A .  35 HIS HB3  1 1 
        2  1101 1 1 35 HIS HD1  H    2.295  10.395  -2.274 1.00 . A A .  35 HIS HD1  1 1 
        2  1102 1 1 35 HIS HD2  H    1.128   6.607  -1.027 1.00 . A A .  35 HIS HD2  1 1 
        2  1103 1 1 35 HIS HE1  H    0.183   9.890  -3.543 1.00 . A A .  35 HIS HE1  1 1 
        2  1104 1 1 35 HIS N    N    5.000   8.040  -2.208 1.00 . A A .  35 HIS N    1 1 
        2  1105 1 1 35 HIS ND1  N    1.796   9.558  -2.176 1.00 . A A .  35 HIS ND1  1 1 
        2  1106 1 1 35 HIS NE2  N    0.291   8.057  -2.446 1.00 . A A .  35 HIS NE2  1 1 
        2  1107 1 1 35 HIS O    O    5.545   9.004   1.037 1.00 . A A .  35 HIS O    1 1 
        2  1108 1 1 36 SER C    C    8.229  11.243   0.555 1.00 . A A .  36 SER C    1 1 
        2  1109 1 1 36 SER CA   C    8.076   9.766   0.202 1.00 . A A .  36 SER CA   1 1 
        2  1110 1 1 36 SER CB   C    9.346   9.260  -0.483 1.00 . A A .  36 SER CB   1 1 
        2  1111 1 1 36 SER H    H    7.010   9.686  -1.626 1.00 . A A .  36 SER H    1 1 
        2  1112 1 1 36 SER HA   H    7.919   9.205   1.112 1.00 . A A .  36 SER HA   1 1 
        2  1113 1 1 36 SER HB2  H    9.244   9.369  -1.552 1.00 . A A .  36 SER HB2  1 1 
        2  1114 1 1 36 SER HB3  H   10.192   9.840  -0.142 1.00 . A A .  36 SER HB3  1 1 
        2  1115 1 1 36 SER HG   H   10.432   7.630  -0.533 1.00 . A A .  36 SER HG   1 1 
        2  1116 1 1 36 SER N    N    6.918   9.555  -0.659 1.00 . A A .  36 SER N    1 1 
        2  1117 1 1 36 SER O    O    8.235  11.615   1.727 1.00 . A A .  36 SER O    1 1 
        2  1118 1 1 36 SER OG   O    9.578   7.894  -0.183 1.00 . A A .  36 SER OG   1 1 
        2  1119 1 1 37 GLY C    C    9.956  13.940  -0.234 1.00 . A A .  37 GLY C    1 1 
        2  1120 1 1 37 GLY CA   C    8.503  13.507  -0.250 1.00 . A A .  37 GLY CA   1 1 
        2  1121 1 1 37 GLY H    H    8.340  11.727  -1.385 1.00 . A A .  37 GLY H    1 1 
        2  1122 1 1 37 GLY HA2  H    7.988  14.038  -1.036 1.00 . A A .  37 GLY HA2  1 1 
        2  1123 1 1 37 GLY HA3  H    8.053  13.762   0.699 1.00 . A A .  37 GLY HA3  1 1 
        2  1124 1 1 37 GLY N    N    8.352  12.080  -0.471 1.00 . A A .  37 GLY N    1 1 
        2  1125 1 1 37 GLY O    O   10.462  14.397   0.790 1.00 . A A .  37 GLY O    1 1 
        2  1126 1 1 38 GLU C    C   12.232  15.203  -2.589 1.00 . A A .  38 GLU C    1 1 
        2  1127 1 1 38 GLU CA   C   12.032  14.171  -1.483 1.00 . A A .  38 GLU CA   1 1 
        2  1128 1 1 38 GLU CB   C   12.894  12.938  -1.758 1.00 . A A .  38 GLU CB   1 1 
        2  1129 1 1 38 GLU CD   C   13.445  10.599  -0.980 1.00 . A A .  38 GLU CD   1 1 
        2  1130 1 1 38 GLU CG   C   12.996  11.989  -0.576 1.00 . A A .  38 GLU CG   1 1 
        2  1131 1 1 38 GLU H    H   10.169  13.423  -2.154 1.00 . A A .  38 GLU H    1 1 
        2  1132 1 1 38 GLU HA   H   12.333  14.607  -0.542 1.00 . A A .  38 GLU HA   1 1 
        2  1133 1 1 38 GLU HB2  H   12.472  12.397  -2.593 1.00 . A A .  38 GLU HB2  1 1 
        2  1134 1 1 38 GLU HB3  H   13.891  13.262  -2.019 1.00 . A A .  38 GLU HB3  1 1 
        2  1135 1 1 38 GLU HG2  H   13.708  12.389   0.131 1.00 . A A .  38 GLU HG2  1 1 
        2  1136 1 1 38 GLU HG3  H   12.026  11.916  -0.105 1.00 . A A .  38 GLU HG3  1 1 
        2  1137 1 1 38 GLU N    N   10.628  13.794  -1.372 1.00 . A A .  38 GLU N    1 1 
        2  1138 1 1 38 GLU O    O   11.362  15.395  -3.439 1.00 . A A .  38 GLU O    1 1 
        2  1139 1 1 38 GLU OE1  O   14.644  10.429  -1.286 1.00 . A A .  38 GLU OE1  1 1 
        2  1140 1 1 38 GLU OE2  O   12.599   9.681  -0.992 1.00 . A A .  38 GLU OE2  1 1 
        2  1141 1 1 39 LYS C    C   14.030  16.232  -4.913 1.00 . A A .  39 LYS C    1 1 
        2  1142 1 1 39 LYS CA   C   13.701  16.877  -3.571 1.00 . A A .  39 LYS CA   1 1 
        2  1143 1 1 39 LYS CB   C   14.878  17.735  -3.104 1.00 . A A .  39 LYS CB   1 1 
        2  1144 1 1 39 LYS CD   C   16.431  16.161  -1.911 1.00 . A A .  39 LYS CD   1 1 
        2  1145 1 1 39 LYS CE   C   17.911  15.919  -1.654 1.00 . A A .  39 LYS CE   1 1 
        2  1146 1 1 39 LYS CG   C   16.214  17.013  -3.151 1.00 . A A .  39 LYS CG   1 1 
        2  1147 1 1 39 LYS H    H   14.037  15.668  -1.867 1.00 . A A .  39 LYS H    1 1 
        2  1148 1 1 39 LYS HA   H   12.833  17.508  -3.692 1.00 . A A .  39 LYS HA   1 1 
        2  1149 1 1 39 LYS HB2  H   14.943  18.610  -3.733 1.00 . A A .  39 LYS HB2  1 1 
        2  1150 1 1 39 LYS HB3  H   14.698  18.048  -2.085 1.00 . A A .  39 LYS HB3  1 1 
        2  1151 1 1 39 LYS HD2  H   16.007  16.669  -1.058 1.00 . A A .  39 LYS HD2  1 1 
        2  1152 1 1 39 LYS HD3  H   15.938  15.209  -2.048 1.00 . A A .  39 LYS HD3  1 1 
        2  1153 1 1 39 LYS HE2  H   18.425  15.873  -2.602 1.00 . A A .  39 LYS HE2  1 1 
        2  1154 1 1 39 LYS HE3  H   18.301  16.742  -1.073 1.00 . A A .  39 LYS HE3  1 1 
        2  1155 1 1 39 LYS HG2  H   16.237  16.375  -4.022 1.00 . A A .  39 LYS HG2  1 1 
        2  1156 1 1 39 LYS HG3  H   17.006  17.745  -3.218 1.00 . A A .  39 LYS HG3  1 1 
        2  1157 1 1 39 LYS HZ1  H   17.527  14.603  -0.078 1.00 . A A .  39 LYS HZ1  1 1 
        2  1158 1 1 39 LYS HZ2  H   19.135  14.593  -0.604 1.00 . A A .  39 LYS HZ2  1 1 
        2  1159 1 1 39 LYS HZ3  H   17.939  13.834  -1.528 1.00 . A A .  39 LYS HZ3  1 1 
        2  1160 1 1 39 LYS N    N   13.384  15.865  -2.571 1.00 . A A .  39 LYS N    1 1 
        2  1161 1 1 39 LYS NZ   N   18.144  14.648  -0.914 1.00 . A A .  39 LYS NZ   1 1 
        2  1162 1 1 39 LYS O    O   14.623  15.155  -4.982 1.00 . A A .  39 LYS O    1 1 
        2  1163 1 1 40 PRO C    C   15.360  16.466  -7.744 1.00 . A A .  40 PRO C    1 1 
        2  1164 1 1 40 PRO CA   C   13.883  16.414  -7.366 1.00 . A A .  40 PRO CA   1 1 
        2  1165 1 1 40 PRO CB   C   13.073  17.375  -8.240 1.00 . A A .  40 PRO CB   1 1 
        2  1166 1 1 40 PRO CD   C   12.926  18.192  -5.999 1.00 . A A .  40 PRO CD   1 1 
        2  1167 1 1 40 PRO CG   C   12.976  18.626  -7.438 1.00 . A A .  40 PRO CG   1 1 
        2  1168 1 1 40 PRO HA   H   13.514  15.407  -7.498 1.00 . A A .  40 PRO HA   1 1 
        2  1169 1 1 40 PRO HB2  H   13.594  17.542  -9.173 1.00 . A A .  40 PRO HB2  1 1 
        2  1170 1 1 40 PRO HB3  H   12.098  16.954  -8.436 1.00 . A A .  40 PRO HB3  1 1 
        2  1171 1 1 40 PRO HD2  H   13.433  18.909  -5.371 1.00 . A A .  40 PRO HD2  1 1 
        2  1172 1 1 40 PRO HD3  H   11.902  18.064  -5.678 1.00 . A A .  40 PRO HD3  1 1 
        2  1173 1 1 40 PRO HG2  H   13.843  19.244  -7.613 1.00 . A A .  40 PRO HG2  1 1 
        2  1174 1 1 40 PRO HG3  H   12.074  19.160  -7.699 1.00 . A A .  40 PRO HG3  1 1 
        2  1175 1 1 40 PRO N    N   13.638  16.903  -6.006 1.00 . A A .  40 PRO N    1 1 
        2  1176 1 1 40 PRO O    O   16.186  16.977  -6.988 1.00 . A A .  40 PRO O    1 1 
        2  1177 1 1 41 SER C    C   17.376  17.175 -10.197 1.00 . A A .  41 SER C    1 1 
        2  1178 1 1 41 SER CA   C   17.063  15.916  -9.394 1.00 . A A .  41 SER CA   1 1 
        2  1179 1 1 41 SER CB   C   17.313  14.675 -10.252 1.00 . A A .  41 SER CB   1 1 
        2  1180 1 1 41 SER H    H   14.981  15.540  -9.475 1.00 . A A .  41 SER H    1 1 
        2  1181 1 1 41 SER HA   H   17.711  15.884  -8.531 1.00 . A A .  41 SER HA   1 1 
        2  1182 1 1 41 SER HB2  H   16.569  14.624 -11.033 1.00 . A A .  41 SER HB2  1 1 
        2  1183 1 1 41 SER HB3  H   18.296  14.739 -10.696 1.00 . A A .  41 SER HB3  1 1 
        2  1184 1 1 41 SER HG   H   17.494  13.689  -8.569 1.00 . A A .  41 SER HG   1 1 
        2  1185 1 1 41 SER N    N   15.685  15.933  -8.918 1.00 . A A .  41 SER N    1 1 
        2  1186 1 1 41 SER O    O   18.050  17.118 -11.224 1.00 . A A .  41 SER O    1 1 
        2  1187 1 1 41 SER OG   O   17.239  13.493  -9.474 1.00 . A A .  41 SER OG   1 1 
        2  1188 1 1 42 GLY C    C   15.828  20.259 -10.813 1.00 . A A .  42 GLY C    1 1 
        2  1189 1 1 42 GLY CA   C   17.115  19.570 -10.405 1.00 . A A .  42 GLY CA   1 1 
        2  1190 1 1 42 GLY H    H   16.348  18.298  -8.896 1.00 . A A .  42 GLY H    1 1 
        2  1191 1 1 42 GLY HA2  H   17.669  20.226  -9.750 1.00 . A A .  42 GLY HA2  1 1 
        2  1192 1 1 42 GLY HA3  H   17.704  19.380 -11.290 1.00 . A A .  42 GLY HA3  1 1 
        2  1193 1 1 42 GLY N    N   16.879  18.313  -9.720 1.00 . A A .  42 GLY N    1 1 
        2  1194 1 1 42 GLY O    O   14.815  19.615 -11.089 1.00 . A A .  42 GLY O    1 1 
        2  1195 1 1 43 PRO C    C   14.344  22.268 -12.709 1.00 . A A .  43 PRO C    1 1 
        2  1196 1 1 43 PRO CA   C   14.690  22.404 -11.230 1.00 . A A .  43 PRO CA   1 1 
        2  1197 1 1 43 PRO CB   C   15.131  23.835 -10.914 1.00 . A A .  43 PRO CB   1 1 
        2  1198 1 1 43 PRO CD   C   17.029  22.432 -10.539 1.00 . A A .  43 PRO CD   1 1 
        2  1199 1 1 43 PRO CG   C   16.618  23.802 -11.001 1.00 . A A .  43 PRO CG   1 1 
        2  1200 1 1 43 PRO HA   H   13.825  22.152 -10.635 1.00 . A A .  43 PRO HA   1 1 
        2  1201 1 1 43 PRO HB2  H   14.707  24.514 -11.640 1.00 . A A .  43 PRO HB2  1 1 
        2  1202 1 1 43 PRO HB3  H   14.799  24.107  -9.923 1.00 . A A .  43 PRO HB3  1 1 
        2  1203 1 1 43 PRO HD2  H   17.899  22.095 -11.083 1.00 . A A .  43 PRO HD2  1 1 
        2  1204 1 1 43 PRO HD3  H   17.224  22.434  -9.476 1.00 . A A .  43 PRO HD3  1 1 
        2  1205 1 1 43 PRO HG2  H   16.929  23.963 -12.021 1.00 . A A .  43 PRO HG2  1 1 
        2  1206 1 1 43 PRO HG3  H   17.040  24.557 -10.354 1.00 . A A .  43 PRO HG3  1 1 
        2  1207 1 1 43 PRO N    N   15.856  21.599 -10.855 1.00 . A A .  43 PRO N    1 1 
        2  1208 1 1 43 PRO O    O   13.173  22.299 -13.088 1.00 . A A .  43 PRO O    1 1 
        2  1209 1 1 44 SER C    C   14.175  23.013 -15.493 1.00 . A A .  44 SER C    1 1 
        2  1210 1 1 44 SER CA   C   15.173  21.980 -14.979 1.00 . A A .  44 SER CA   1 1 
        2  1211 1 1 44 SER CB   C   14.684  20.570 -15.316 1.00 . A A .  44 SER CB   1 1 
        2  1212 1 1 44 SER H    H   16.280  22.100 -13.179 1.00 . A A .  44 SER H    1 1 
        2  1213 1 1 44 SER HA   H   16.125  22.146 -15.461 1.00 . A A .  44 SER HA   1 1 
        2  1214 1 1 44 SER HB2  H   15.277  19.847 -14.777 1.00 . A A .  44 SER HB2  1 1 
        2  1215 1 1 44 SER HB3  H   13.647  20.473 -15.027 1.00 . A A .  44 SER HB3  1 1 
        2  1216 1 1 44 SER HG   H   15.687  20.011 -16.903 1.00 . A A .  44 SER HG   1 1 
        2  1217 1 1 44 SER N    N   15.369  22.117 -13.541 1.00 . A A .  44 SER N    1 1 
        2  1218 1 1 44 SER O    O   13.343  22.716 -16.350 1.00 . A A .  44 SER O    1 1 
        2  1219 1 1 44 SER OG   O   14.797  20.309 -16.705 1.00 . A A .  44 SER OG   1 1 
        2  1220 1 1 45 SER C    C   13.707  25.802 -16.764 1.00 . A A .  45 SER C    1 1 
        2  1221 1 1 45 SER CA   C   13.367  25.306 -15.362 1.00 . A A .  45 SER CA   1 1 
        2  1222 1 1 45 SER CB   C   13.449  26.463 -14.364 1.00 . A A .  45 SER CB   1 1 
        2  1223 1 1 45 SER H    H   14.949  24.403 -14.282 1.00 . A A .  45 SER H    1 1 
        2  1224 1 1 45 SER HA   H   12.361  24.915 -15.365 1.00 . A A .  45 SER HA   1 1 
        2  1225 1 1 45 SER HB2  H   13.271  26.089 -13.368 1.00 . A A .  45 SER HB2  1 1 
        2  1226 1 1 45 SER HB3  H   14.433  26.907 -14.413 1.00 . A A .  45 SER HB3  1 1 
        2  1227 1 1 45 SER HG   H   11.747  27.061 -15.129 1.00 . A A .  45 SER HG   1 1 
        2  1228 1 1 45 SER N    N   14.264  24.228 -14.961 1.00 . A A .  45 SER N    1 1 
        2  1229 1 1 45 SER O    O   14.707  26.490 -16.965 1.00 . A A .  45 SER O    1 1 
        2  1230 1 1 45 SER OG   O   12.484  27.458 -14.658 1.00 . A A .  45 SER OG   1 1 
        2  1231 1 1 46 GLY C    C   11.819  25.875 -19.924 1.00 . A A .  46 GLY C    1 1 
        2  1232 1 1 46 GLY CA   C   13.093  25.866 -19.101 1.00 . A A .  46 GLY CA   1 1 
        2  1233 1 1 46 GLY H    H   12.084  24.899 -17.511 1.00 . A A .  46 GLY H    1 1 
        2  1234 1 1 46 GLY HA2  H   13.514  26.860 -19.098 1.00 . A A .  46 GLY HA2  1 1 
        2  1235 1 1 46 GLY HA3  H   13.798  25.189 -19.560 1.00 . A A .  46 GLY HA3  1 1 
        2  1236 1 1 46 GLY N    N   12.865  25.448 -17.730 1.00 . A A .  46 GLY N    1 1 
        2  1237 1 1 46 GLY O    O   11.226  24.815 -20.120 1.00 . A A .  46 GLY O    1 1 
        2  1238 2 2  1 ZN  ZN   ZN  -0.963   6.462  -2.825 1.00 . B A . 201 ZN  ZN   1 1 
        3  1239 1 1  1 GLY C    C  -34.499   7.573  -0.897 1.00 . A A .   1 GLY C    1 1 
        3  1240 1 1  1 GLY CA   C  -35.317   7.785  -2.155 1.00 . A A .   1 GLY CA   1 1 
        3  1241 1 1  1 GLY H1   H  -37.388   7.670  -1.725 1.00 . A A .   1 GLY H1   1 1 
        3  1242 1 1  1 GLY HA2  H  -35.408   6.843  -2.676 1.00 . A A .   1 GLY HA2  1 1 
        3  1243 1 1  1 GLY HA3  H  -34.802   8.489  -2.792 1.00 . A A .   1 GLY HA3  1 1 
        3  1244 1 1  1 GLY N    N  -36.647   8.295  -1.873 1.00 . A A .   1 GLY N    1 1 
        3  1245 1 1  1 GLY O    O  -34.671   8.288   0.091 1.00 . A A .   1 GLY O    1 1 
        3  1246 1 1  2 SER C    C  -31.461   5.622  -0.227 1.00 . A A .   2 SER C    1 1 
        3  1247 1 1  2 SER CA   C  -32.762   6.282   0.217 1.00 . A A .   2 SER CA   1 1 
        3  1248 1 1  2 SER CB   C  -33.505   5.366   1.192 1.00 . A A .   2 SER CB   1 1 
        3  1249 1 1  2 SER H    H  -33.517   6.055  -1.748 1.00 . A A .   2 SER H    1 1 
        3  1250 1 1  2 SER HA   H  -32.530   7.211   0.715 1.00 . A A .   2 SER HA   1 1 
        3  1251 1 1  2 SER HB2  H  -32.830   5.056   1.975 1.00 . A A .   2 SER HB2  1 1 
        3  1252 1 1  2 SER HB3  H  -34.336   5.905   1.625 1.00 . A A .   2 SER HB3  1 1 
        3  1253 1 1  2 SER HG   H  -34.715   3.832   1.049 1.00 . A A .   2 SER HG   1 1 
        3  1254 1 1  2 SER N    N  -33.607   6.589  -0.931 1.00 . A A .   2 SER N    1 1 
        3  1255 1 1  2 SER O    O  -31.468   4.532  -0.799 1.00 . A A .   2 SER O    1 1 
        3  1256 1 1  2 SER OG   O  -34.001   4.214   0.533 1.00 . A A .   2 SER OG   1 1 
        3  1257 1 1  3 SER C    C  -28.381   5.045   0.839 1.00 . A A .   3 SER C    1 1 
        3  1258 1 1  3 SER CA   C  -29.033   5.772  -0.334 1.00 . A A .   3 SER CA   1 1 
        3  1259 1 1  3 SER CB   C  -28.128   6.910  -0.810 1.00 . A A .   3 SER CB   1 1 
        3  1260 1 1  3 SER H    H  -30.403   7.155   0.500 1.00 . A A .   3 SER H    1 1 
        3  1261 1 1  3 SER HA   H  -29.173   5.072  -1.144 1.00 . A A .   3 SER HA   1 1 
        3  1262 1 1  3 SER HB2  H  -28.632   7.467  -1.585 1.00 . A A .   3 SER HB2  1 1 
        3  1263 1 1  3 SER HB3  H  -27.911   7.565   0.021 1.00 . A A .   3 SER HB3  1 1 
        3  1264 1 1  3 SER HG   H  -26.717   5.556  -0.929 1.00 . A A .   3 SER HG   1 1 
        3  1265 1 1  3 SER N    N  -30.344   6.291   0.041 1.00 . A A .   3 SER N    1 1 
        3  1266 1 1  3 SER O    O  -28.550   5.431   1.994 1.00 . A A .   3 SER O    1 1 
        3  1267 1 1  3 SER OG   O  -26.908   6.408  -1.328 1.00 . A A .   3 SER OG   1 1 
        3  1268 1 1  4 GLY C    C  -26.878   1.748   1.232 1.00 . A A .   4 GLY C    1 1 
        3  1269 1 1  4 GLY CA   C  -26.969   3.223   1.568 1.00 . A A .   4 GLY CA   1 1 
        3  1270 1 1  4 GLY H    H  -27.536   3.727  -0.409 1.00 . A A .   4 GLY H    1 1 
        3  1271 1 1  4 GLY HA2  H  -25.971   3.613   1.703 1.00 . A A .   4 GLY HA2  1 1 
        3  1272 1 1  4 GLY HA3  H  -27.517   3.337   2.491 1.00 . A A .   4 GLY HA3  1 1 
        3  1273 1 1  4 GLY N    N  -27.635   3.988   0.530 1.00 . A A .   4 GLY N    1 1 
        3  1274 1 1  4 GLY O    O  -27.217   0.895   2.053 1.00 . A A .   4 GLY O    1 1 
        3  1275 1 1  5 SER C    C  -24.824  -0.354  -0.482 1.00 . A A .   5 SER C    1 1 
        3  1276 1 1  5 SER CA   C  -26.291   0.063  -0.423 1.00 . A A .   5 SER CA   1 1 
        3  1277 1 1  5 SER CB   C  -26.939  -0.116  -1.798 1.00 . A A .   5 SER CB   1 1 
        3  1278 1 1  5 SER H    H  -26.166   2.170  -0.588 1.00 . A A .   5 SER H    1 1 
        3  1279 1 1  5 SER HA   H  -26.803  -0.565   0.291 1.00 . A A .   5 SER HA   1 1 
        3  1280 1 1  5 SER HB2  H  -27.972   0.191  -1.748 1.00 . A A .   5 SER HB2  1 1 
        3  1281 1 1  5 SER HB3  H  -26.417   0.493  -2.521 1.00 . A A .   5 SER HB3  1 1 
        3  1282 1 1  5 SER HG   H  -26.949  -2.044  -1.449 1.00 . A A .   5 SER HG   1 1 
        3  1283 1 1  5 SER N    N  -26.420   1.445   0.021 1.00 . A A .   5 SER N    1 1 
        3  1284 1 1  5 SER O    O  -24.179  -0.248  -1.525 1.00 . A A .   5 SER O    1 1 
        3  1285 1 1  5 SER OG   O  -26.884  -1.469  -2.215 1.00 . A A .   5 SER OG   1 1 
        3  1286 1 1  6 SER C    C  -22.814  -2.781   0.716 1.00 . A A .   6 SER C    1 1 
        3  1287 1 1  6 SER CA   C  -22.913  -1.259   0.724 1.00 . A A .   6 SER CA   1 1 
        3  1288 1 1  6 SER CB   C  -22.256  -0.700   1.988 1.00 . A A .   6 SER CB   1 1 
        3  1289 1 1  6 SER H    H  -24.870  -0.889   1.444 1.00 . A A .   6 SER H    1 1 
        3  1290 1 1  6 SER HA   H  -22.397  -0.871  -0.141 1.00 . A A .   6 SER HA   1 1 
        3  1291 1 1  6 SER HB2  H  -22.422   0.365   2.036 1.00 . A A .   6 SER HB2  1 1 
        3  1292 1 1  6 SER HB3  H  -22.694  -1.172   2.856 1.00 . A A .   6 SER HB3  1 1 
        3  1293 1 1  6 SER HG   H  -20.702  -1.888   2.086 1.00 . A A .   6 SER HG   1 1 
        3  1294 1 1  6 SER N    N  -24.305  -0.829   0.645 1.00 . A A .   6 SER N    1 1 
        3  1295 1 1  6 SER O    O  -23.437  -3.460   1.531 1.00 . A A .   6 SER O    1 1 
        3  1296 1 1  6 SER OG   O  -20.861  -0.946   1.989 1.00 . A A .   6 SER OG   1 1 
        3  1297 1 1  7 GLY C    C  -20.421  -5.182  -0.088 1.00 . A A .   7 GLY C    1 1 
        3  1298 1 1  7 GLY CA   C  -21.856  -4.749  -0.312 1.00 . A A .   7 GLY CA   1 1 
        3  1299 1 1  7 GLY H    H  -21.552  -2.720  -0.837 1.00 . A A .   7 GLY H    1 1 
        3  1300 1 1  7 GLY HA2  H  -22.484  -5.225   0.426 1.00 . A A .   7 GLY HA2  1 1 
        3  1301 1 1  7 GLY HA3  H  -22.167  -5.069  -1.296 1.00 . A A .   7 GLY HA3  1 1 
        3  1302 1 1  7 GLY N    N  -22.024  -3.311  -0.214 1.00 . A A .   7 GLY N    1 1 
        3  1303 1 1  7 GLY O    O  -19.908  -5.101   1.027 1.00 . A A .   7 GLY O    1 1 
        3  1304 1 1  8 ALA C    C  -17.423  -4.968  -1.432 1.00 . A A .   8 ALA C    1 1 
        3  1305 1 1  8 ALA CA   C  -18.387  -6.092  -1.066 1.00 . A A .   8 ALA CA   1 1 
        3  1306 1 1  8 ALA CB   C  -18.164  -7.296  -1.970 1.00 . A A .   8 ALA CB   1 1 
        3  1307 1 1  8 ALA H    H  -20.234  -5.685  -2.014 1.00 . A A .   8 ALA H    1 1 
        3  1308 1 1  8 ALA HA   H  -18.197  -6.398  -0.047 1.00 . A A .   8 ALA HA   1 1 
        3  1309 1 1  8 ALA HB1  H  -17.219  -7.192  -2.481 1.00 . A A .   8 ALA HB1  1 1 
        3  1310 1 1  8 ALA HB2  H  -18.154  -8.196  -1.373 1.00 . A A .   8 ALA HB2  1 1 
        3  1311 1 1  8 ALA HB3  H  -18.962  -7.353  -2.695 1.00 . A A .   8 ALA HB3  1 1 
        3  1312 1 1  8 ALA N    N  -19.772  -5.645  -1.152 1.00 . A A .   8 ALA N    1 1 
        3  1313 1 1  8 ALA O    O  -17.834  -3.927  -1.943 1.00 . A A .   8 ALA O    1 1 
        3  1314 1 1  9 GLY C    C  -14.430  -3.670  -0.232 1.00 . A A .   9 GLY C    1 1 
        3  1315 1 1  9 GLY CA   C  -15.137  -4.182  -1.472 1.00 . A A .   9 GLY CA   1 1 
        3  1316 1 1  9 GLY H    H  -15.870  -6.035  -0.756 1.00 . A A .   9 GLY H    1 1 
        3  1317 1 1  9 GLY HA2  H  -14.406  -4.611  -2.140 1.00 . A A .   9 GLY HA2  1 1 
        3  1318 1 1  9 GLY HA3  H  -15.618  -3.350  -1.967 1.00 . A A .   9 GLY HA3  1 1 
        3  1319 1 1  9 GLY N    N  -16.139  -5.186  -1.165 1.00 . A A .   9 GLY N    1 1 
        3  1320 1 1  9 GLY O    O  -14.186  -2.471  -0.100 1.00 . A A .   9 GLY O    1 1 
        3  1321 1 1 10 GLU C    C  -12.074  -4.923   2.025 1.00 . A A .  10 GLU C    1 1 
        3  1322 1 1 10 GLU CA   C  -13.421  -4.214   1.914 1.00 . A A .  10 GLU CA   1 1 
        3  1323 1 1 10 GLU CB   C  -14.292  -4.559   3.124 1.00 . A A .  10 GLU CB   1 1 
        3  1324 1 1 10 GLU CD   C  -14.826  -4.116   5.553 1.00 . A A .  10 GLU CD   1 1 
        3  1325 1 1 10 GLU CG   C  -13.964  -3.742   4.363 1.00 . A A .  10 GLU CG   1 1 
        3  1326 1 1 10 GLU H    H  -14.323  -5.522   0.515 1.00 . A A .  10 GLU H    1 1 
        3  1327 1 1 10 GLU HA   H  -13.253  -3.148   1.896 1.00 . A A .  10 GLU HA   1 1 
        3  1328 1 1 10 GLU HB2  H  -15.327  -4.388   2.868 1.00 . A A .  10 GLU HB2  1 1 
        3  1329 1 1 10 GLU HB3  H  -14.158  -5.604   3.363 1.00 . A A .  10 GLU HB3  1 1 
        3  1330 1 1 10 GLU HG2  H  -12.929  -3.905   4.622 1.00 . A A .  10 GLU HG2  1 1 
        3  1331 1 1 10 GLU HG3  H  -14.119  -2.697   4.140 1.00 . A A .  10 GLU HG3  1 1 
        3  1332 1 1 10 GLU N    N  -14.102  -4.581   0.678 1.00 . A A .  10 GLU N    1 1 
        3  1333 1 1 10 GLU O    O  -11.957  -5.962   2.676 1.00 . A A .  10 GLU O    1 1 
        3  1334 1 1 10 GLU OE1  O  -14.526  -5.139   6.204 1.00 . A A .  10 GLU OE1  1 1 
        3  1335 1 1 10 GLU OE2  O  -15.800  -3.387   5.834 1.00 . A A .  10 GLU OE2  1 1 
        3  1336 1 1 11 LYS C    C   -8.885  -4.315   2.528 1.00 . A A .  11 LYS C    1 1 
        3  1337 1 1 11 LYS CA   C   -9.719  -4.929   1.409 1.00 . A A .  11 LYS CA   1 1 
        3  1338 1 1 11 LYS CB   C   -9.024  -4.713   0.063 1.00 . A A .  11 LYS CB   1 1 
        3  1339 1 1 11 LYS CD   C   -9.078  -5.043  -2.427 1.00 . A A .  11 LYS CD   1 1 
        3  1340 1 1 11 LYS CE   C   -7.940  -5.986  -2.785 1.00 . A A .  11 LYS CE   1 1 
        3  1341 1 1 11 LYS CG   C   -9.711  -5.414  -1.096 1.00 . A A .  11 LYS CG   1 1 
        3  1342 1 1 11 LYS H    H  -11.214  -3.527   0.881 1.00 . A A .  11 LYS H    1 1 
        3  1343 1 1 11 LYS HA   H   -9.816  -5.989   1.588 1.00 . A A .  11 LYS HA   1 1 
        3  1344 1 1 11 LYS HB2  H   -8.996  -3.655  -0.149 1.00 . A A .  11 LYS HB2  1 1 
        3  1345 1 1 11 LYS HB3  H   -8.011  -5.085   0.131 1.00 . A A .  11 LYS HB3  1 1 
        3  1346 1 1 11 LYS HD2  H   -9.830  -5.095  -3.201 1.00 . A A .  11 LYS HD2  1 1 
        3  1347 1 1 11 LYS HD3  H   -8.693  -4.035  -2.364 1.00 . A A .  11 LYS HD3  1 1 
        3  1348 1 1 11 LYS HE2  H   -8.316  -6.997  -2.792 1.00 . A A .  11 LYS HE2  1 1 
        3  1349 1 1 11 LYS HE3  H   -7.574  -5.730  -3.768 1.00 . A A .  11 LYS HE3  1 1 
        3  1350 1 1 11 LYS HG2  H   -9.632  -6.482  -0.958 1.00 . A A .  11 LYS HG2  1 1 
        3  1351 1 1 11 LYS HG3  H  -10.753  -5.127  -1.111 1.00 . A A .  11 LYS HG3  1 1 
        3  1352 1 1 11 LYS HZ1  H   -7.049  -6.424  -0.947 1.00 . A A .  11 LYS HZ1  1 1 
        3  1353 1 1 11 LYS HZ2  H   -6.643  -4.900  -1.559 1.00 . A A .  11 LYS HZ2  1 1 
        3  1354 1 1 11 LYS HZ3  H   -5.950  -6.291  -2.226 1.00 . A A .  11 LYS HZ3  1 1 
        3  1355 1 1 11 LYS N    N  -11.059  -4.354   1.384 1.00 . A A .  11 LYS N    1 1 
        3  1356 1 1 11 LYS NZ   N   -6.817  -5.894  -1.811 1.00 . A A .  11 LYS NZ   1 1 
        3  1357 1 1 11 LYS O    O   -9.003  -3.132   2.846 1.00 . A A .  11 LYS O    1 1 
        3  1358 1 1 12 PRO C    C   -6.056  -3.742   3.754 1.00 . A A .  12 PRO C    1 1 
        3  1359 1 1 12 PRO CA   C   -7.146  -4.695   4.232 1.00 . A A .  12 PRO CA   1 1 
        3  1360 1 1 12 PRO CB   C   -6.529  -5.999   4.743 1.00 . A A .  12 PRO CB   1 1 
        3  1361 1 1 12 PRO CD   C   -7.824  -6.559   2.813 1.00 . A A .  12 PRO CD   1 1 
        3  1362 1 1 12 PRO CG   C   -6.582  -6.925   3.577 1.00 . A A .  12 PRO CG   1 1 
        3  1363 1 1 12 PRO HA   H   -7.709  -4.226   5.026 1.00 . A A .  12 PRO HA   1 1 
        3  1364 1 1 12 PRO HB2  H   -5.511  -5.819   5.060 1.00 . A A .  12 PRO HB2  1 1 
        3  1365 1 1 12 PRO HB3  H   -7.109  -6.376   5.572 1.00 . A A .  12 PRO HB3  1 1 
        3  1366 1 1 12 PRO HD2  H   -7.668  -6.693   1.753 1.00 . A A .  12 PRO HD2  1 1 
        3  1367 1 1 12 PRO HD3  H   -8.663  -7.150   3.151 1.00 . A A .  12 PRO HD3  1 1 
        3  1368 1 1 12 PRO HG2  H   -5.707  -6.788   2.959 1.00 . A A .  12 PRO HG2  1 1 
        3  1369 1 1 12 PRO HG3  H   -6.642  -7.947   3.922 1.00 . A A .  12 PRO HG3  1 1 
        3  1370 1 1 12 PRO N    N   -8.018  -5.136   3.140 1.00 . A A .  12 PRO N    1 1 
        3  1371 1 1 12 PRO O    O   -5.446  -3.029   4.552 1.00 . A A .  12 PRO O    1 1 
        3  1372 1 1 13 TYR C    C   -5.434  -1.680   1.151 1.00 . A A .  13 TYR C    1 1 
        3  1373 1 1 13 TYR CA   C   -4.796  -2.869   1.863 1.00 . A A .  13 TYR CA   1 1 
        3  1374 1 1 13 TYR CB   C   -3.928  -3.659   0.882 1.00 . A A .  13 TYR CB   1 1 
        3  1375 1 1 13 TYR CD1  C   -3.007  -5.310   2.556 1.00 . A A .  13 TYR CD1  1 1 
        3  1376 1 1 13 TYR CD2  C   -3.972  -6.162   0.551 1.00 . A A .  13 TYR CD2  1 1 
        3  1377 1 1 13 TYR CE1  C   -2.732  -6.597   2.976 1.00 . A A .  13 TYR CE1  1 1 
        3  1378 1 1 13 TYR CE2  C   -3.702  -7.453   0.963 1.00 . A A .  13 TYR CE2  1 1 
        3  1379 1 1 13 TYR CG   C   -3.630  -5.070   1.338 1.00 . A A .  13 TYR CG   1 1 
        3  1380 1 1 13 TYR CZ   C   -3.081  -7.665   2.176 1.00 . A A .  13 TYR CZ   1 1 
        3  1381 1 1 13 TYR H    H   -6.333  -4.324   1.862 1.00 . A A .  13 TYR H    1 1 
        3  1382 1 1 13 TYR HA   H   -4.173  -2.502   2.665 1.00 . A A .  13 TYR HA   1 1 
        3  1383 1 1 13 TYR HB2  H   -4.435  -3.719  -0.069 1.00 . A A .  13 TYR HB2  1 1 
        3  1384 1 1 13 TYR HB3  H   -2.987  -3.147   0.752 1.00 . A A .  13 TYR HB3  1 1 
        3  1385 1 1 13 TYR HD1  H   -2.735  -4.471   3.181 1.00 . A A .  13 TYR HD1  1 1 
        3  1386 1 1 13 TYR HD2  H   -4.459  -5.993  -0.399 1.00 . A A .  13 TYR HD2  1 1 
        3  1387 1 1 13 TYR HE1  H   -2.246  -6.764   3.926 1.00 . A A .  13 TYR HE1  1 1 
        3  1388 1 1 13 TYR HE2  H   -3.976  -8.290   0.337 1.00 . A A .  13 TYR HE2  1 1 
        3  1389 1 1 13 TYR HH   H   -1.945  -9.213   2.269 1.00 . A A .  13 TYR HH   1 1 
        3  1390 1 1 13 TYR N    N   -5.815  -3.734   2.447 1.00 . A A .  13 TYR N    1 1 
        3  1391 1 1 13 TYR O    O   -6.501  -1.801   0.551 1.00 . A A .  13 TYR O    1 1 
        3  1392 1 1 13 TYR OH   O   -2.810  -8.949   2.592 1.00 . A A .  13 TYR OH   1 1 
        3  1393 1 1 14 GLY C    C   -4.416   1.880   0.835 1.00 . A A .  14 GLY C    1 1 
        3  1394 1 1 14 GLY CA   C   -5.286   0.665   0.582 1.00 . A A .  14 GLY CA   1 1 
        3  1395 1 1 14 GLY H    H   -3.924  -0.493   1.717 1.00 . A A .  14 GLY H    1 1 
        3  1396 1 1 14 GLY HA2  H   -5.346   0.492  -0.482 1.00 . A A .  14 GLY HA2  1 1 
        3  1397 1 1 14 GLY HA3  H   -6.278   0.863   0.960 1.00 . A A .  14 GLY HA3  1 1 
        3  1398 1 1 14 GLY N    N   -4.771  -0.530   1.224 1.00 . A A .  14 GLY N    1 1 
        3  1399 1 1 14 GLY O    O   -4.052   2.166   1.976 1.00 . A A .  14 GLY O    1 1 
        3  1400 1 1 15 CYS C    C   -4.061   4.983   0.353 1.00 . A A .  15 CYS C    1 1 
        3  1401 1 1 15 CYS CA   C   -3.243   3.786  -0.123 1.00 . A A .  15 CYS CA   1 1 
        3  1402 1 1 15 CYS CB   C   -2.591   4.103  -1.470 1.00 . A A .  15 CYS CB   1 1 
        3  1403 1 1 15 CYS H    H   -4.399   2.318  -1.117 1.00 . A A .  15 CYS H    1 1 
        3  1404 1 1 15 CYS HA   H   -2.470   3.583   0.602 1.00 . A A .  15 CYS HA   1 1 
        3  1405 1 1 15 CYS HB2  H   -1.746   3.446  -1.616 1.00 . A A .  15 CYS HB2  1 1 
        3  1406 1 1 15 CYS HB3  H   -3.311   3.936  -2.258 1.00 . A A .  15 CYS HB3  1 1 
        3  1407 1 1 15 CYS N    N   -4.078   2.596  -0.233 1.00 . A A .  15 CYS N    1 1 
        3  1408 1 1 15 CYS O    O   -5.070   5.340  -0.255 1.00 . A A .  15 CYS O    1 1 
        3  1409 1 1 15 CYS SG   S   -1.991   5.816  -1.621 1.00 . A A .  15 CYS SG   1 1 
        3  1410 1 1 16 SER C    C   -3.568   8.045   1.674 1.00 . A A .  16 SER C    1 1 
        3  1411 1 1 16 SER CA   C   -4.310   6.754   2.005 1.00 . A A .  16 SER CA   1 1 
        3  1412 1 1 16 SER CB   C   -4.449   6.606   3.521 1.00 . A A .  16 SER CB   1 1 
        3  1413 1 1 16 SER H    H   -2.808   5.267   1.885 1.00 . A A .  16 SER H    1 1 
        3  1414 1 1 16 SER HA   H   -5.295   6.796   1.564 1.00 . A A .  16 SER HA   1 1 
        3  1415 1 1 16 SER HB2  H   -3.486   6.370   3.947 1.00 . A A .  16 SER HB2  1 1 
        3  1416 1 1 16 SER HB3  H   -4.810   7.534   3.939 1.00 . A A .  16 SER HB3  1 1 
        3  1417 1 1 16 SER HG   H   -5.360   4.911   3.155 1.00 . A A .  16 SER HG   1 1 
        3  1418 1 1 16 SER N    N   -3.618   5.599   1.444 1.00 . A A .  16 SER N    1 1 
        3  1419 1 1 16 SER O    O   -3.383   8.904   2.535 1.00 . A A .  16 SER O    1 1 
        3  1420 1 1 16 SER OG   O   -5.360   5.571   3.851 1.00 . A A .  16 SER OG   1 1 
        3  1421 1 1 17 GLU C    C   -3.068   9.954  -1.273 1.00 . A A .  17 GLU C    1 1 
        3  1422 1 1 17 GLU CA   C   -2.423   9.359  -0.024 1.00 . A A .  17 GLU CA   1 1 
        3  1423 1 1 17 GLU CB   C   -0.959   9.015  -0.308 1.00 . A A .  17 GLU CB   1 1 
        3  1424 1 1 17 GLU CD   C    0.158  10.410   1.477 1.00 . A A .  17 GLU CD   1 1 
        3  1425 1 1 17 GLU CG   C   -0.082   9.015   0.933 1.00 . A A .  17 GLU CG   1 1 
        3  1426 1 1 17 GLU H    H   -3.324   7.454  -0.221 1.00 . A A .  17 GLU H    1 1 
        3  1427 1 1 17 GLU HA   H   -2.464  10.090   0.770 1.00 . A A .  17 GLU HA   1 1 
        3  1428 1 1 17 GLU HB2  H   -0.913   8.034  -0.756 1.00 . A A .  17 GLU HB2  1 1 
        3  1429 1 1 17 GLU HB3  H   -0.561   9.738  -1.004 1.00 . A A .  17 GLU HB3  1 1 
        3  1430 1 1 17 GLU HG2  H   -0.564   8.426   1.699 1.00 . A A .  17 GLU HG2  1 1 
        3  1431 1 1 17 GLU HG3  H    0.871   8.572   0.685 1.00 . A A .  17 GLU HG3  1 1 
        3  1432 1 1 17 GLU N    N   -3.146   8.173   0.420 1.00 . A A .  17 GLU N    1 1 
        3  1433 1 1 17 GLU O    O   -3.393  11.141  -1.313 1.00 . A A .  17 GLU O    1 1 
        3  1434 1 1 17 GLU OE1  O   -0.675  11.302   1.212 1.00 . A A .  17 GLU OE1  1 1 
        3  1435 1 1 17 GLU OE2  O    1.180  10.611   2.166 1.00 . A A .  17 GLU OE2  1 1 
        3  1436 1 1 18 CYS C    C   -5.210   8.894  -3.756 1.00 . A A .  18 CYS C    1 1 
        3  1437 1 1 18 CYS CA   C   -3.855   9.561  -3.543 1.00 . A A .  18 CYS CA   1 1 
        3  1438 1 1 18 CYS CB   C   -2.928   9.248  -4.720 1.00 . A A .  18 CYS CB   1 1 
        3  1439 1 1 18 CYS H    H   -2.970   8.184  -2.200 1.00 . A A .  18 CYS H    1 1 
        3  1440 1 1 18 CYS HA   H   -3.998  10.629  -3.484 1.00 . A A .  18 CYS HA   1 1 
        3  1441 1 1 18 CYS HB2  H   -3.367   9.638  -5.626 1.00 . A A .  18 CYS HB2  1 1 
        3  1442 1 1 18 CYS HB3  H   -1.974   9.724  -4.553 1.00 . A A .  18 CYS HB3  1 1 
        3  1443 1 1 18 CYS N    N   -3.250   9.120  -2.292 1.00 . A A .  18 CYS N    1 1 
        3  1444 1 1 18 CYS O    O   -6.192   9.553  -4.094 1.00 . A A .  18 CYS O    1 1 
        3  1445 1 1 18 CYS SG   S   -2.625   7.470  -4.974 1.00 . A A .  18 CYS SG   1 1 
        3  1446 1 1 19 GLY C    C   -6.343   5.672  -4.680 1.00 . A A .  19 GLY C    1 1 
        3  1447 1 1 19 GLY CA   C   -6.494   6.845  -3.732 1.00 . A A .  19 GLY CA   1 1 
        3  1448 1 1 19 GLY H    H   -4.440   7.106  -3.288 1.00 . A A .  19 GLY H    1 1 
        3  1449 1 1 19 GLY HA2  H   -6.821   6.478  -2.770 1.00 . A A .  19 GLY HA2  1 1 
        3  1450 1 1 19 GLY HA3  H   -7.245   7.515  -4.124 1.00 . A A .  19 GLY HA3  1 1 
        3  1451 1 1 19 GLY N    N   -5.255   7.580  -3.557 1.00 . A A .  19 GLY N    1 1 
        3  1452 1 1 19 GLY O    O   -7.046   5.583  -5.686 1.00 . A A .  19 GLY O    1 1 
        3  1453 1 1 20 LYS C    C   -5.114   2.331  -4.338 1.00 . A A .  20 LYS C    1 1 
        3  1454 1 1 20 LYS CA   C   -5.180   3.595  -5.189 1.00 . A A .  20 LYS CA   1 1 
        3  1455 1 1 20 LYS CB   C   -3.878   3.761  -5.975 1.00 . A A .  20 LYS CB   1 1 
        3  1456 1 1 20 LYS CD   C   -2.710   4.747  -7.969 1.00 . A A .  20 LYS CD   1 1 
        3  1457 1 1 20 LYS CE   C   -2.755   5.934  -8.919 1.00 . A A .  20 LYS CE   1 1 
        3  1458 1 1 20 LYS CG   C   -4.042   4.548  -7.264 1.00 . A A .  20 LYS CG   1 1 
        3  1459 1 1 20 LYS H    H   -4.893   4.895  -3.543 1.00 . A A .  20 LYS H    1 1 
        3  1460 1 1 20 LYS HA   H   -6.001   3.504  -5.884 1.00 . A A .  20 LYS HA   1 1 
        3  1461 1 1 20 LYS HB2  H   -3.159   4.274  -5.354 1.00 . A A .  20 LYS HB2  1 1 
        3  1462 1 1 20 LYS HB3  H   -3.493   2.782  -6.223 1.00 . A A .  20 LYS HB3  1 1 
        3  1463 1 1 20 LYS HD2  H   -1.943   4.921  -7.229 1.00 . A A .  20 LYS HD2  1 1 
        3  1464 1 1 20 LYS HD3  H   -2.474   3.855  -8.532 1.00 . A A .  20 LYS HD3  1 1 
        3  1465 1 1 20 LYS HE2  H   -3.007   6.820  -8.356 1.00 . A A .  20 LYS HE2  1 1 
        3  1466 1 1 20 LYS HE3  H   -1.779   6.058  -9.365 1.00 . A A .  20 LYS HE3  1 1 
        3  1467 1 1 20 LYS HG2  H   -4.708   4.009  -7.922 1.00 . A A .  20 LYS HG2  1 1 
        3  1468 1 1 20 LYS HG3  H   -4.465   5.515  -7.033 1.00 . A A .  20 LYS HG3  1 1 
        3  1469 1 1 20 LYS HZ1  H   -3.363   5.159 -10.761 1.00 . A A .  20 LYS HZ1  1 1 
        3  1470 1 1 20 LYS HZ2  H   -4.042   6.664 -10.393 1.00 . A A .  20 LYS HZ2  1 1 
        3  1471 1 1 20 LYS HZ3  H   -4.607   5.270  -9.620 1.00 . A A .  20 LYS HZ3  1 1 
        3  1472 1 1 20 LYS N    N   -5.422   4.769  -4.359 1.00 . A A .  20 LYS N    1 1 
        3  1473 1 1 20 LYS NZ   N   -3.762   5.743  -9.999 1.00 . A A .  20 LYS NZ   1 1 
        3  1474 1 1 20 LYS O    O   -4.633   2.358  -3.206 1.00 . A A .  20 LYS O    1 1 
        3  1475 1 1 21 ALA C    C   -4.819  -1.107  -4.964 1.00 . A A .  21 ALA C    1 1 
        3  1476 1 1 21 ALA CA   C   -5.593  -0.050  -4.183 1.00 . A A .  21 ALA CA   1 1 
        3  1477 1 1 21 ALA CB   C   -7.018  -0.519  -3.927 1.00 . A A .  21 ALA CB   1 1 
        3  1478 1 1 21 ALA H    H   -5.971   1.266  -5.797 1.00 . A A .  21 ALA H    1 1 
        3  1479 1 1 21 ALA HA   H   -5.113   0.102  -3.227 1.00 . A A .  21 ALA HA   1 1 
        3  1480 1 1 21 ALA HB1  H   -7.643  -0.245  -4.763 1.00 . A A .  21 ALA HB1  1 1 
        3  1481 1 1 21 ALA HB2  H   -7.026  -1.593  -3.808 1.00 . A A .  21 ALA HB2  1 1 
        3  1482 1 1 21 ALA HB3  H   -7.394  -0.054  -3.028 1.00 . A A .  21 ALA HB3  1 1 
        3  1483 1 1 21 ALA N    N   -5.600   1.224  -4.891 1.00 . A A .  21 ALA N    1 1 
        3  1484 1 1 21 ALA O    O   -4.443  -0.891  -6.116 1.00 . A A .  21 ALA O    1 1 
        3  1485 1 1 22 PHE C    C   -4.264  -4.686  -4.375 1.00 . A A .  22 PHE C    1 1 
        3  1486 1 1 22 PHE CA   C   -3.851  -3.340  -4.963 1.00 . A A .  22 PHE CA   1 1 
        3  1487 1 1 22 PHE CB   C   -2.344  -3.137  -4.793 1.00 . A A .  22 PHE CB   1 1 
        3  1488 1 1 22 PHE CD1  C   -1.869  -0.709  -4.377 1.00 . A A .  22 PHE CD1  1 1 
        3  1489 1 1 22 PHE CD2  C   -1.413  -1.598  -6.542 1.00 . A A .  22 PHE CD2  1 1 
        3  1490 1 1 22 PHE CE1  C   -1.429   0.534  -4.790 1.00 . A A .  22 PHE CE1  1 1 
        3  1491 1 1 22 PHE CE2  C   -0.972  -0.357  -6.961 1.00 . A A .  22 PHE CE2  1 1 
        3  1492 1 1 22 PHE CG   C   -1.866  -1.788  -5.246 1.00 . A A .  22 PHE CG   1 1 
        3  1493 1 1 22 PHE CZ   C   -0.981   0.711  -6.085 1.00 . A A .  22 PHE CZ   1 1 
        3  1494 1 1 22 PHE H    H   -4.908  -2.363  -3.410 1.00 . A A .  22 PHE H    1 1 
        3  1495 1 1 22 PHE HA   H   -4.091  -3.331  -6.015 1.00 . A A .  22 PHE HA   1 1 
        3  1496 1 1 22 PHE HB2  H   -2.088  -3.246  -3.750 1.00 . A A .  22 PHE HB2  1 1 
        3  1497 1 1 22 PHE HB3  H   -1.821  -3.887  -5.368 1.00 . A A .  22 PHE HB3  1 1 
        3  1498 1 1 22 PHE HD1  H   -2.220  -0.846  -3.363 1.00 . A A .  22 PHE HD1  1 1 
        3  1499 1 1 22 PHE HD2  H   -1.406  -2.431  -7.229 1.00 . A A .  22 PHE HD2  1 1 
        3  1500 1 1 22 PHE HE1  H   -1.438   1.367  -4.102 1.00 . A A .  22 PHE HE1  1 1 
        3  1501 1 1 22 PHE HE2  H   -0.622  -0.221  -7.974 1.00 . A A .  22 PHE HE2  1 1 
        3  1502 1 1 22 PHE HZ   H   -0.636   1.681  -6.410 1.00 . A A .  22 PHE HZ   1 1 
        3  1503 1 1 22 PHE N    N   -4.583  -2.250  -4.328 1.00 . A A .  22 PHE N    1 1 
        3  1504 1 1 22 PHE O    O   -4.506  -4.804  -3.174 1.00 . A A .  22 PHE O    1 1 
        3  1505 1 1 23 SER C    C   -3.535  -7.790  -4.224 1.00 . A A .  23 SER C    1 1 
        3  1506 1 1 23 SER CA   C   -4.730  -7.037  -4.800 1.00 . A A .  23 SER CA   1 1 
        3  1507 1 1 23 SER CB   C   -5.326  -7.822  -5.971 1.00 . A A .  23 SER CB   1 1 
        3  1508 1 1 23 SER H    H   -4.137  -5.543  -6.177 1.00 . A A .  23 SER H    1 1 
        3  1509 1 1 23 SER HA   H   -5.480  -6.933  -4.029 1.00 . A A .  23 SER HA   1 1 
        3  1510 1 1 23 SER HB2  H   -4.651  -7.775  -6.812 1.00 . A A .  23 SER HB2  1 1 
        3  1511 1 1 23 SER HB3  H   -5.464  -8.852  -5.677 1.00 . A A .  23 SER HB3  1 1 
        3  1512 1 1 23 SER HG   H   -6.531  -6.326  -6.358 1.00 . A A .  23 SER HG   1 1 
        3  1513 1 1 23 SER N    N   -4.343  -5.700  -5.232 1.00 . A A .  23 SER N    1 1 
        3  1514 1 1 23 SER O    O   -3.366  -8.986  -4.465 1.00 . A A .  23 SER O    1 1 
        3  1515 1 1 23 SER OG   O   -6.579  -7.285  -6.359 1.00 . A A .  23 SER OG   1 1 
        3  1516 1 1 24 SER C    C   -0.828  -6.688  -1.929 1.00 . A A .  24 SER C    1 1 
        3  1517 1 1 24 SER CA   C   -1.525  -7.680  -2.855 1.00 . A A .  24 SER CA   1 1 
        3  1518 1 1 24 SER CB   C   -0.554  -8.154  -3.938 1.00 . A A .  24 SER CB   1 1 
        3  1519 1 1 24 SER H    H   -2.897  -6.132  -3.308 1.00 . A A .  24 SER H    1 1 
        3  1520 1 1 24 SER HA   H   -1.847  -8.532  -2.274 1.00 . A A .  24 SER HA   1 1 
        3  1521 1 1 24 SER HB2  H   -1.110  -8.435  -4.819 1.00 . A A .  24 SER HB2  1 1 
        3  1522 1 1 24 SER HB3  H    0.127  -7.351  -4.183 1.00 . A A .  24 SER HB3  1 1 
        3  1523 1 1 24 SER HG   H    0.544  -9.097  -2.617 1.00 . A A .  24 SER HG   1 1 
        3  1524 1 1 24 SER N    N   -2.708  -7.081  -3.462 1.00 . A A .  24 SER N    1 1 
        3  1525 1 1 24 SER O    O   -0.540  -5.556  -2.317 1.00 . A A .  24 SER O    1 1 
        3  1526 1 1 24 SER OG   O    0.198  -9.271  -3.496 1.00 . A A .  24 SER OG   1 1 
        3  1527 1 1 25 LYS C    C    1.394  -5.690  -0.286 1.00 . A A .  25 LYS C    1 1 
        3  1528 1 1 25 LYS CA   C    0.103  -6.273   0.281 1.00 . A A .  25 LYS CA   1 1 
        3  1529 1 1 25 LYS CB   C    0.407  -7.072   1.551 1.00 . A A .  25 LYS CB   1 1 
        3  1530 1 1 25 LYS CD   C    1.916  -5.515   2.820 1.00 . A A .  25 LYS CD   1 1 
        3  1531 1 1 25 LYS CE   C    2.072  -4.649   4.060 1.00 . A A .  25 LYS CE   1 1 
        3  1532 1 1 25 LYS CG   C    0.564  -6.207   2.790 1.00 . A A .  25 LYS CG   1 1 
        3  1533 1 1 25 LYS H    H   -0.815  -8.034  -0.451 1.00 . A A .  25 LYS H    1 1 
        3  1534 1 1 25 LYS HA   H   -0.566  -5.463   0.527 1.00 . A A .  25 LYS HA   1 1 
        3  1535 1 1 25 LYS HB2  H   -0.399  -7.770   1.724 1.00 . A A .  25 LYS HB2  1 1 
        3  1536 1 1 25 LYS HB3  H    1.324  -7.623   1.405 1.00 . A A .  25 LYS HB3  1 1 
        3  1537 1 1 25 LYS HD2  H    2.694  -6.263   2.817 1.00 . A A .  25 LYS HD2  1 1 
        3  1538 1 1 25 LYS HD3  H    2.011  -4.892   1.942 1.00 . A A .  25 LYS HD3  1 1 
        3  1539 1 1 25 LYS HE2  H    1.633  -5.164   4.901 1.00 . A A .  25 LYS HE2  1 1 
        3  1540 1 1 25 LYS HE3  H    3.124  -4.492   4.244 1.00 . A A .  25 LYS HE3  1 1 
        3  1541 1 1 25 LYS HG2  H   -0.213  -5.456   2.795 1.00 . A A .  25 LYS HG2  1 1 
        3  1542 1 1 25 LYS HG3  H    0.469  -6.831   3.668 1.00 . A A .  25 LYS HG3  1 1 
        3  1543 1 1 25 LYS HZ1  H    1.210  -3.143   2.896 1.00 . A A .  25 LYS HZ1  1 1 
        3  1544 1 1 25 LYS HZ2  H    2.020  -2.571   4.266 1.00 . A A .  25 LYS HZ2  1 1 
        3  1545 1 1 25 LYS HZ3  H    0.509  -3.312   4.426 1.00 . A A .  25 LYS HZ3  1 1 
        3  1546 1 1 25 LYS N    N   -0.561  -7.121  -0.702 1.00 . A A .  25 LYS N    1 1 
        3  1547 1 1 25 LYS NZ   N    1.406  -3.326   3.901 1.00 . A A .  25 LYS NZ   1 1 
        3  1548 1 1 25 LYS O    O    1.558  -4.472  -0.356 1.00 . A A .  25 LYS O    1 1 
        3  1549 1 1 26 SER C    C    3.384  -5.012  -2.259 1.00 . A A .  26 SER C    1 1 
        3  1550 1 1 26 SER CA   C    3.583  -6.140  -1.251 1.00 . A A .  26 SER CA   1 1 
        3  1551 1 1 26 SER CB   C    4.291  -7.319  -1.920 1.00 . A A .  26 SER CB   1 1 
        3  1552 1 1 26 SER H    H    2.117  -7.526  -0.610 1.00 . A A .  26 SER H    1 1 
        3  1553 1 1 26 SER HA   H    4.195  -5.777  -0.439 1.00 . A A .  26 SER HA   1 1 
        3  1554 1 1 26 SER HB2  H    3.580  -7.875  -2.511 1.00 . A A .  26 SER HB2  1 1 
        3  1555 1 1 26 SER HB3  H    5.078  -6.946  -2.561 1.00 . A A .  26 SER HB3  1 1 
        3  1556 1 1 26 SER HG   H    4.380  -8.106  -0.129 1.00 . A A .  26 SER HG   1 1 
        3  1557 1 1 26 SER N    N    2.306  -6.568  -0.692 1.00 . A A .  26 SER N    1 1 
        3  1558 1 1 26 SER O    O    4.015  -3.960  -2.163 1.00 . A A .  26 SER O    1 1 
        3  1559 1 1 26 SER OG   O    4.861  -8.186  -0.955 1.00 . A A .  26 SER OG   1 1 
        3  1560 1 1 27 TYR C    C    1.983  -2.873  -3.633 1.00 . A A .  27 TYR C    1 1 
        3  1561 1 1 27 TYR CA   C    2.219  -4.246  -4.254 1.00 . A A .  27 TYR CA   1 1 
        3  1562 1 1 27 TYR CB   C    0.998  -4.664  -5.076 1.00 . A A .  27 TYR CB   1 1 
        3  1563 1 1 27 TYR CD1  C    1.241  -2.781  -6.741 1.00 . A A .  27 TYR CD1  1 1 
        3  1564 1 1 27 TYR CD2  C    0.785  -4.968  -7.573 1.00 . A A .  27 TYR CD2  1 1 
        3  1565 1 1 27 TYR CE1  C    1.250  -2.287  -8.031 1.00 . A A .  27 TYR CE1  1 1 
        3  1566 1 1 27 TYR CE2  C    0.794  -4.483  -8.867 1.00 . A A .  27 TYR CE2  1 1 
        3  1567 1 1 27 TYR CG   C    1.008  -4.128  -6.489 1.00 . A A .  27 TYR CG   1 1 
        3  1568 1 1 27 TYR CZ   C    1.026  -3.142  -9.091 1.00 . A A .  27 TYR CZ   1 1 
        3  1569 1 1 27 TYR H    H    2.029  -6.099  -3.249 1.00 . A A .  27 TYR H    1 1 
        3  1570 1 1 27 TYR HA   H    3.078  -4.191  -4.906 1.00 . A A .  27 TYR HA   1 1 
        3  1571 1 1 27 TYR HB2  H    0.961  -5.741  -5.130 1.00 . A A .  27 TYR HB2  1 1 
        3  1572 1 1 27 TYR HB3  H    0.105  -4.301  -4.589 1.00 . A A .  27 TYR HB3  1 1 
        3  1573 1 1 27 TYR HD1  H    1.416  -2.115  -5.909 1.00 . A A .  27 TYR HD1  1 1 
        3  1574 1 1 27 TYR HD2  H    0.603  -6.018  -7.395 1.00 . A A .  27 TYR HD2  1 1 
        3  1575 1 1 27 TYR HE1  H    1.432  -1.238  -8.207 1.00 . A A .  27 TYR HE1  1 1 
        3  1576 1 1 27 TYR HE2  H    0.618  -5.152  -9.697 1.00 . A A .  27 TYR HE2  1 1 
        3  1577 1 1 27 TYR HH   H    0.952  -1.698 -10.357 1.00 . A A .  27 TYR HH   1 1 
        3  1578 1 1 27 TYR N    N    2.501  -5.241  -3.225 1.00 . A A .  27 TYR N    1 1 
        3  1579 1 1 27 TYR O    O    2.630  -1.892  -4.003 1.00 . A A .  27 TYR O    1 1 
        3  1580 1 1 27 TYR OH   O    1.035  -2.654 -10.377 1.00 . A A .  27 TYR OH   1 1 
        3  1581 1 1 28 LEU C    C    1.998  -0.835  -1.570 1.00 . A A .  28 LEU C    1 1 
        3  1582 1 1 28 LEU CA   C    0.730  -1.558  -2.013 1.00 . A A .  28 LEU CA   1 1 
        3  1583 1 1 28 LEU CB   C   -0.168  -1.824  -0.803 1.00 . A A .  28 LEU CB   1 1 
        3  1584 1 1 28 LEU CD1  C   -1.050   0.507  -0.531 1.00 . A A .  28 LEU CD1  1 1 
        3  1585 1 1 28 LEU CD2  C   -1.145  -1.095   1.388 1.00 . A A .  28 LEU CD2  1 1 
        3  1586 1 1 28 LEU CG   C   -0.356  -0.654   0.164 1.00 . A A .  28 LEU CG   1 1 
        3  1587 1 1 28 LEU H    H    0.571  -3.625  -2.435 1.00 . A A .  28 LEU H    1 1 
        3  1588 1 1 28 LEU HA   H    0.199  -0.931  -2.714 1.00 . A A .  28 LEU HA   1 1 
        3  1589 1 1 28 LEU HB2  H   -1.142  -2.108  -1.171 1.00 . A A .  28 LEU HB2  1 1 
        3  1590 1 1 28 LEU HB3  H    0.260  -2.647  -0.249 1.00 . A A .  28 LEU HB3  1 1 
        3  1591 1 1 28 LEU HD11 H   -0.828   0.480  -1.587 1.00 . A A .  28 LEU HD11 1 1 
        3  1592 1 1 28 LEU HD12 H   -0.700   1.439  -0.113 1.00 . A A .  28 LEU HD12 1 1 
        3  1593 1 1 28 LEU HD13 H   -2.118   0.426  -0.385 1.00 . A A .  28 LEU HD13 1 1 
        3  1594 1 1 28 LEU HD21 H   -0.669  -1.956   1.831 1.00 . A A .  28 LEU HD21 1 1 
        3  1595 1 1 28 LEU HD22 H   -2.152  -1.351   1.093 1.00 . A A .  28 LEU HD22 1 1 
        3  1596 1 1 28 LEU HD23 H   -1.174  -0.289   2.106 1.00 . A A .  28 LEU HD23 1 1 
        3  1597 1 1 28 LEU HG   H    0.615  -0.311   0.496 1.00 . A A .  28 LEU HG   1 1 
        3  1598 1 1 28 LEU N    N    1.053  -2.811  -2.687 1.00 . A A .  28 LEU N    1 1 
        3  1599 1 1 28 LEU O    O    2.165   0.358  -1.823 1.00 . A A .  28 LEU O    1 1 
        3  1600 1 1 29 ILE C    C    4.900  -0.310  -1.568 1.00 . A A .  29 ILE C    1 1 
        3  1601 1 1 29 ILE CA   C    4.144  -0.996  -0.435 1.00 . A A .  29 ILE CA   1 1 
        3  1602 1 1 29 ILE CB   C    5.050  -2.072   0.194 1.00 . A A .  29 ILE CB   1 1 
        3  1603 1 1 29 ILE CD1  C    4.907  -4.104   1.719 1.00 . A A .  29 ILE CD1  1 1 
        3  1604 1 1 29 ILE CG1  C    4.336  -2.749   1.366 1.00 . A A .  29 ILE CG1  1 1 
        3  1605 1 1 29 ILE CG2  C    6.364  -1.456   0.651 1.00 . A A .  29 ILE CG2  1 1 
        3  1606 1 1 29 ILE H    H    2.700  -2.512  -0.739 1.00 . A A .  29 ILE H    1 1 
        3  1607 1 1 29 ILE HA   H    3.910  -0.263   0.323 1.00 . A A .  29 ILE HA   1 1 
        3  1608 1 1 29 ILE HB   H    5.269  -2.811  -0.561 1.00 . A A .  29 ILE HB   1 1 
        3  1609 1 1 29 ILE HD11 H    4.130  -4.721   2.149 1.00 . A A .  29 ILE HD11 1 1 
        3  1610 1 1 29 ILE HD12 H    5.289  -4.578   0.827 1.00 . A A .  29 ILE HD12 1 1 
        3  1611 1 1 29 ILE HD13 H    5.707  -3.983   2.434 1.00 . A A .  29 ILE HD13 1 1 
        3  1612 1 1 29 ILE HG12 H    4.413  -2.119   2.238 1.00 . A A .  29 ILE HG12 1 1 
        3  1613 1 1 29 ILE HG13 H    3.294  -2.882   1.114 1.00 . A A .  29 ILE HG13 1 1 
        3  1614 1 1 29 ILE HG21 H    6.219  -0.961   1.599 1.00 . A A .  29 ILE HG21 1 1 
        3  1615 1 1 29 ILE HG22 H    7.105  -2.233   0.761 1.00 . A A .  29 ILE HG22 1 1 
        3  1616 1 1 29 ILE HG23 H    6.700  -0.739  -0.083 1.00 . A A .  29 ILE HG23 1 1 
        3  1617 1 1 29 ILE N    N    2.890  -1.567  -0.910 1.00 . A A .  29 ILE N    1 1 
        3  1618 1 1 29 ILE O    O    5.282   0.855  -1.457 1.00 . A A .  29 ILE O    1 1 
        3  1619 1 1 30 ILE C    C    5.224   0.836  -4.246 1.00 . A A .  30 ILE C    1 1 
        3  1620 1 1 30 ILE CA   C    5.817  -0.501  -3.813 1.00 . A A .  30 ILE CA   1 1 
        3  1621 1 1 30 ILE CB   C    5.777  -1.477  -5.004 1.00 . A A .  30 ILE CB   1 1 
        3  1622 1 1 30 ILE CD1  C    6.081  -3.933  -5.601 1.00 . A A .  30 ILE CD1  1 1 
        3  1623 1 1 30 ILE CG1  C    6.359  -2.833  -4.600 1.00 . A A .  30 ILE CG1  1 1 
        3  1624 1 1 30 ILE CG2  C    6.538  -0.900  -6.188 1.00 . A A .  30 ILE CG2  1 1 
        3  1625 1 1 30 ILE H    H    4.781  -1.962  -2.687 1.00 . A A .  30 ILE H    1 1 
        3  1626 1 1 30 ILE HA   H    6.849  -0.351  -3.531 1.00 . A A .  30 ILE HA   1 1 
        3  1627 1 1 30 ILE HB   H    4.747  -1.609  -5.298 1.00 . A A .  30 ILE HB   1 1 
        3  1628 1 1 30 ILE HD11 H    5.791  -4.832  -5.076 1.00 . A A .  30 ILE HD11 1 1 
        3  1629 1 1 30 ILE HD12 H    5.281  -3.627  -6.259 1.00 . A A .  30 ILE HD12 1 1 
        3  1630 1 1 30 ILE HD13 H    6.971  -4.127  -6.180 1.00 . A A .  30 ILE HD13 1 1 
        3  1631 1 1 30 ILE HG12 H    7.429  -2.742  -4.496 1.00 . A A .  30 ILE HG12 1 1 
        3  1632 1 1 30 ILE HG13 H    5.934  -3.131  -3.652 1.00 . A A .  30 ILE HG13 1 1 
        3  1633 1 1 30 ILE HG21 H    6.520   0.179  -6.136 1.00 . A A .  30 ILE HG21 1 1 
        3  1634 1 1 30 ILE HG22 H    7.561  -1.244  -6.160 1.00 . A A .  30 ILE HG22 1 1 
        3  1635 1 1 30 ILE HG23 H    6.074  -1.223  -7.107 1.00 . A A .  30 ILE HG23 1 1 
        3  1636 1 1 30 ILE N    N    5.110  -1.040  -2.658 1.00 . A A .  30 ILE N    1 1 
        3  1637 1 1 30 ILE O    O    5.945   1.737  -4.677 1.00 . A A .  30 ILE O    1 1 
        3  1638 1 1 31 HIS C    C    3.460   3.285  -3.474 1.00 . A A .  31 HIS C    1 1 
        3  1639 1 1 31 HIS CA   C    3.216   2.187  -4.504 1.00 . A A .  31 HIS CA   1 1 
        3  1640 1 1 31 HIS CB   C    1.715   1.930  -4.647 1.00 . A A .  31 HIS CB   1 1 
        3  1641 1 1 31 HIS CD2  C    0.087   3.853  -4.032 1.00 . A A .  31 HIS CD2  1 1 
        3  1642 1 1 31 HIS CE1  C    0.109   4.917  -5.948 1.00 . A A .  31 HIS CE1  1 1 
        3  1643 1 1 31 HIS CG   C    0.912   3.176  -4.864 1.00 . A A .  31 HIS CG   1 1 
        3  1644 1 1 31 HIS H    H    3.386   0.205  -3.778 1.00 . A A .  31 HIS H    1 1 
        3  1645 1 1 31 HIS HA   H    3.609   2.510  -5.456 1.00 . A A .  31 HIS HA   1 1 
        3  1646 1 1 31 HIS HB2  H    1.548   1.277  -5.491 1.00 . A A .  31 HIS HB2  1 1 
        3  1647 1 1 31 HIS HB3  H    1.351   1.451  -3.750 1.00 . A A .  31 HIS HB3  1 1 
        3  1648 1 1 31 HIS HD1  H    1.407   3.627  -6.862 1.00 . A A .  31 HIS HD1  1 1 
        3  1649 1 1 31 HIS HD2  H   -0.146   3.594  -3.008 1.00 . A A .  31 HIS HD2  1 1 
        3  1650 1 1 31 HIS HE1  H   -0.092   5.641  -6.724 1.00 . A A .  31 HIS HE1  1 1 
        3  1651 1 1 31 HIS N    N    3.906   0.958  -4.127 1.00 . A A .  31 HIS N    1 1 
        3  1652 1 1 31 HIS ND1  N    0.904   3.868  -6.056 1.00 . A A .  31 HIS ND1  1 1 
        3  1653 1 1 31 HIS NE2  N   -0.400   4.931  -4.729 1.00 . A A .  31 HIS NE2  1 1 
        3  1654 1 1 31 HIS O    O    3.663   4.446  -3.827 1.00 . A A .  31 HIS O    1 1 
        3  1655 1 1 32 MET C    C    5.090   4.387  -1.137 1.00 . A A .  32 MET C    1 1 
        3  1656 1 1 32 MET CA   C    3.657   3.863  -1.118 1.00 . A A .  32 MET CA   1 1 
        3  1657 1 1 32 MET CB   C    3.358   3.212   0.234 1.00 . A A .  32 MET CB   1 1 
        3  1658 1 1 32 MET CE   C    0.612   4.977   1.529 1.00 . A A .  32 MET CE   1 1 
        3  1659 1 1 32 MET CG   C    1.904   2.800   0.401 1.00 . A A .  32 MET CG   1 1 
        3  1660 1 1 32 MET H    H    3.271   1.969  -1.980 1.00 . A A .  32 MET H    1 1 
        3  1661 1 1 32 MET HA   H    2.982   4.692  -1.265 1.00 . A A .  32 MET HA   1 1 
        3  1662 1 1 32 MET HB2  H    3.974   2.331   0.340 1.00 . A A .  32 MET HB2  1 1 
        3  1663 1 1 32 MET HB3  H    3.604   3.911   1.020 1.00 . A A .  32 MET HB3  1 1 
        3  1664 1 1 32 MET HE1  H    0.991   4.346   2.321 1.00 . A A .  32 MET HE1  1 1 
        3  1665 1 1 32 MET HE2  H    1.186   5.891   1.492 1.00 . A A .  32 MET HE2  1 1 
        3  1666 1 1 32 MET HE3  H   -0.425   5.210   1.719 1.00 . A A .  32 MET HE3  1 1 
        3  1667 1 1 32 MET HG2  H    1.710   1.948  -0.232 1.00 . A A .  32 MET HG2  1 1 
        3  1668 1 1 32 MET HG3  H    1.740   2.524   1.432 1.00 . A A .  32 MET HG3  1 1 
        3  1669 1 1 32 MET N    N    3.438   2.909  -2.199 1.00 . A A .  32 MET N    1 1 
        3  1670 1 1 32 MET O    O    5.386   5.433  -0.561 1.00 . A A .  32 MET O    1 1 
        3  1671 1 1 32 MET SD   S    0.754   4.118  -0.036 1.00 . A A .  32 MET SD   1 1 
        3  1672 1 1 33 ARG C    C    7.513   5.444  -2.481 1.00 . A A .  33 ARG C    1 1 
        3  1673 1 1 33 ARG CA   C    7.377   4.042  -1.895 1.00 . A A .  33 ARG CA   1 1 
        3  1674 1 1 33 ARG CB   C    8.151   3.041  -2.754 1.00 . A A .  33 ARG CB   1 1 
        3  1675 1 1 33 ARG CD   C    9.611   0.996  -2.692 1.00 . A A .  33 ARG CD   1 1 
        3  1676 1 1 33 ARG CG   C    8.448   1.730  -2.044 1.00 . A A .  33 ARG CG   1 1 
        3  1677 1 1 33 ARG CZ   C   11.343  -0.574  -1.931 1.00 . A A .  33 ARG CZ   1 1 
        3  1678 1 1 33 ARG H    H    5.678   2.827  -2.242 1.00 . A A .  33 ARG H    1 1 
        3  1679 1 1 33 ARG HA   H    7.788   4.040  -0.897 1.00 . A A .  33 ARG HA   1 1 
        3  1680 1 1 33 ARG HB2  H    7.573   2.822  -3.640 1.00 . A A .  33 ARG HB2  1 1 
        3  1681 1 1 33 ARG HB3  H    9.089   3.487  -3.047 1.00 . A A .  33 ARG HB3  1 1 
        3  1682 1 1 33 ARG HD2  H    9.281   0.589  -3.636 1.00 . A A .  33 ARG HD2  1 1 
        3  1683 1 1 33 ARG HD3  H   10.412   1.700  -2.864 1.00 . A A .  33 ARG HD3  1 1 
        3  1684 1 1 33 ARG HE   H    9.488  -0.481  -1.202 1.00 . A A .  33 ARG HE   1 1 
        3  1685 1 1 33 ARG HG2  H    8.697   1.938  -1.014 1.00 . A A .  33 ARG HG2  1 1 
        3  1686 1 1 33 ARG HG3  H    7.570   1.103  -2.085 1.00 . A A .  33 ARG HG3  1 1 
        3  1687 1 1 33 ARG HH11 H   11.922   0.681  -3.405 1.00 . A A .  33 ARG HH11 1 1 
        3  1688 1 1 33 ARG HH12 H   13.133  -0.431  -2.858 1.00 . A A .  33 ARG HH12 1 1 
        3  1689 1 1 33 ARG HH21 H   11.074  -1.950  -0.475 1.00 . A A .  33 ARG HH21 1 1 
        3  1690 1 1 33 ARG HH22 H   12.650  -1.928  -1.193 1.00 . A A .  33 ARG HH22 1 1 
        3  1691 1 1 33 ARG N    N    5.975   3.652  -1.803 1.00 . A A .  33 ARG N    1 1 
        3  1692 1 1 33 ARG NE   N   10.107  -0.092  -1.854 1.00 . A A .  33 ARG NE   1 1 
        3  1693 1 1 33 ARG NH1  N   12.203  -0.067  -2.803 1.00 . A A .  33 ARG NH1  1 1 
        3  1694 1 1 33 ARG NH2  N   11.720  -1.566  -1.134 1.00 . A A .  33 ARG NH2  1 1 
        3  1695 1 1 33 ARG O    O    8.455   6.172  -2.166 1.00 . A A .  33 ARG O    1 1 
        3  1696 1 1 34 THR C    C    5.599   8.078  -3.290 1.00 . A A .  34 THR C    1 1 
        3  1697 1 1 34 THR CA   C    6.582   7.131  -3.968 1.00 . A A .  34 THR CA   1 1 
        3  1698 1 1 34 THR CB   C    6.237   7.037  -5.467 1.00 . A A .  34 THR CB   1 1 
        3  1699 1 1 34 THR CG2  C    4.786   6.625  -5.664 1.00 . A A .  34 THR CG2  1 1 
        3  1700 1 1 34 THR H    H    5.842   5.193  -3.548 1.00 . A A .  34 THR H    1 1 
        3  1701 1 1 34 THR HA   H    7.580   7.534  -3.874 1.00 . A A .  34 THR HA   1 1 
        3  1702 1 1 34 THR HB   H    6.873   6.291  -5.921 1.00 . A A .  34 THR HB   1 1 
        3  1703 1 1 34 THR HG1  H    5.663   8.819  -6.089 1.00 . A A .  34 THR HG1  1 1 
        3  1704 1 1 34 THR HG21 H    4.496   6.808  -6.687 1.00 . A A .  34 THR HG21 1 1 
        3  1705 1 1 34 THR HG22 H    4.155   7.201  -5.003 1.00 . A A .  34 THR HG22 1 1 
        3  1706 1 1 34 THR HG23 H    4.677   5.574  -5.440 1.00 . A A .  34 THR HG23 1 1 
        3  1707 1 1 34 THR N    N    6.567   5.817  -3.337 1.00 . A A .  34 THR N    1 1 
        3  1708 1 1 34 THR O    O    5.098   9.017  -3.910 1.00 . A A .  34 THR O    1 1 
        3  1709 1 1 34 THR OG1  O    6.470   8.299  -6.103 1.00 . A A .  34 THR OG1  1 1 
        3  1710 1 1 35 HIS C    C    5.099   9.271  -0.038 1.00 . A A .  35 HIS C    1 1 
        3  1711 1 1 35 HIS CA   C    4.404   8.659  -1.251 1.00 . A A .  35 HIS CA   1 1 
        3  1712 1 1 35 HIS CB   C    3.196   7.837  -0.800 1.00 . A A .  35 HIS CB   1 1 
        3  1713 1 1 35 HIS CD2  C    1.519   6.843  -2.510 1.00 . A A .  35 HIS CD2  1 1 
        3  1714 1 1 35 HIS CE1  C    0.430   8.682  -2.998 1.00 . A A .  35 HIS CE1  1 1 
        3  1715 1 1 35 HIS CG   C    2.066   7.845  -1.782 1.00 . A A .  35 HIS CG   1 1 
        3  1716 1 1 35 HIS H    H    5.757   7.064  -1.575 1.00 . A A .  35 HIS H    1 1 
        3  1717 1 1 35 HIS HA   H    4.065   9.456  -1.896 1.00 . A A .  35 HIS HA   1 1 
        3  1718 1 1 35 HIS HB2  H    3.502   6.812  -0.654 1.00 . A A .  35 HIS HB2  1 1 
        3  1719 1 1 35 HIS HB3  H    2.827   8.235   0.135 1.00 . A A .  35 HIS HB3  1 1 
        3  1720 1 1 35 HIS HD1  H    1.521   9.880  -1.748 1.00 . A A .  35 HIS HD1  1 1 
        3  1721 1 1 35 HIS HD2  H    1.823   5.805  -2.504 1.00 . A A .  35 HIS HD2  1 1 
        3  1722 1 1 35 HIS HE1  H   -0.272   9.374  -3.437 1.00 . A A .  35 HIS HE1  1 1 
        3  1723 1 1 35 HIS N    N    5.327   7.827  -2.014 1.00 . A A .  35 HIS N    1 1 
        3  1724 1 1 35 HIS ND1  N    1.362   8.984  -2.112 1.00 . A A .  35 HIS ND1  1 1 
        3  1725 1 1 35 HIS NE2  N    0.505   7.389  -3.257 1.00 . A A .  35 HIS NE2  1 1 
        3  1726 1 1 35 HIS O    O    4.891  10.441   0.284 1.00 . A A .  35 HIS O    1 1 
        3  1727 1 1 36 SER C    C    8.154   8.815   1.605 1.00 . A A .  36 SER C    1 1 
        3  1728 1 1 36 SER CA   C    6.647   8.934   1.810 1.00 . A A .  36 SER CA   1 1 
        3  1729 1 1 36 SER CB   C    6.223   8.130   3.040 1.00 . A A .  36 SER CB   1 1 
        3  1730 1 1 36 SER H    H    6.049   7.549   0.324 1.00 . A A .  36 SER H    1 1 
        3  1731 1 1 36 SER HA   H    6.398   9.973   1.965 1.00 . A A .  36 SER HA   1 1 
        3  1732 1 1 36 SER HB2  H    6.240   7.077   2.803 1.00 . A A .  36 SER HB2  1 1 
        3  1733 1 1 36 SER HB3  H    6.911   8.327   3.850 1.00 . A A .  36 SER HB3  1 1 
        3  1734 1 1 36 SER HG   H    4.782   9.426   3.324 1.00 . A A .  36 SER HG   1 1 
        3  1735 1 1 36 SER N    N    5.925   8.472   0.630 1.00 . A A .  36 SER N    1 1 
        3  1736 1 1 36 SER O    O    8.619   8.054   0.756 1.00 . A A .  36 SER O    1 1 
        3  1737 1 1 36 SER OG   O    4.915   8.484   3.455 1.00 . A A .  36 SER OG   1 1 
        3  1738 1 1 37 GLY C    C   11.045   9.541   3.632 1.00 . A A .  37 GLY C    1 1 
        3  1739 1 1 37 GLY CA   C   10.361   9.539   2.279 1.00 . A A .  37 GLY CA   1 1 
        3  1740 1 1 37 GLY H    H    8.489  10.161   3.049 1.00 . A A .  37 GLY H    1 1 
        3  1741 1 1 37 GLY HA2  H   10.649   8.647   1.743 1.00 . A A .  37 GLY HA2  1 1 
        3  1742 1 1 37 GLY HA3  H   10.688  10.404   1.722 1.00 . A A .  37 GLY HA3  1 1 
        3  1743 1 1 37 GLY N    N    8.914   9.573   2.389 1.00 . A A .  37 GLY N    1 1 
        3  1744 1 1 37 GLY O    O   11.976   8.770   3.864 1.00 . A A .  37 GLY O    1 1 
        3  1745 1 1 38 GLU C    C   10.551   9.473   6.797 1.00 . A A .  38 GLU C    1 1 
        3  1746 1 1 38 GLU CA   C   11.162  10.512   5.860 1.00 . A A .  38 GLU CA   1 1 
        3  1747 1 1 38 GLU CB   C   10.947  11.916   6.428 1.00 . A A .  38 GLU CB   1 1 
        3  1748 1 1 38 GLU CD   C   13.190  13.036   6.119 1.00 . A A .  38 GLU CD   1 1 
        3  1749 1 1 38 GLU CG   C   11.733  12.994   5.701 1.00 . A A .  38 GLU CG   1 1 
        3  1750 1 1 38 GLU H    H    9.840  11.000   4.280 1.00 . A A .  38 GLU H    1 1 
        3  1751 1 1 38 GLU HA   H   12.222  10.325   5.778 1.00 . A A .  38 GLU HA   1 1 
        3  1752 1 1 38 GLU HB2  H    9.897  12.160   6.365 1.00 . A A .  38 GLU HB2  1 1 
        3  1753 1 1 38 GLU HB3  H   11.247  11.921   7.466 1.00 . A A .  38 GLU HB3  1 1 
        3  1754 1 1 38 GLU HG2  H   11.685  12.802   4.639 1.00 . A A .  38 GLU HG2  1 1 
        3  1755 1 1 38 GLU HG3  H   11.285  13.954   5.913 1.00 . A A .  38 GLU HG3  1 1 
        3  1756 1 1 38 GLU N    N   10.585  10.411   4.525 1.00 . A A .  38 GLU N    1 1 
        3  1757 1 1 38 GLU O    O   10.192   9.780   7.934 1.00 . A A .  38 GLU O    1 1 
        3  1758 1 1 38 GLU OE1  O   13.849  11.976   6.080 1.00 . A A .  38 GLU OE1  1 1 
        3  1759 1 1 38 GLU OE2  O   13.671  14.129   6.485 1.00 . A A .  38 GLU OE2  1 1 
        3  1760 1 1 39 LYS C    C   10.620   6.993   8.418 1.00 . A A .  39 LYS C    1 1 
        3  1761 1 1 39 LYS CA   C    9.867   7.157   7.101 1.00 . A A .  39 LYS CA   1 1 
        3  1762 1 1 39 LYS CB   C    9.908   5.847   6.311 1.00 . A A .  39 LYS CB   1 1 
        3  1763 1 1 39 LYS CD   C    7.446   5.448   6.011 1.00 . A A .  39 LYS CD   1 1 
        3  1764 1 1 39 LYS CE   C    7.327   4.002   6.468 1.00 . A A .  39 LYS CE   1 1 
        3  1765 1 1 39 LYS CG   C    8.772   5.703   5.313 1.00 . A A .  39 LYS CG   1 1 
        3  1766 1 1 39 LYS H    H   10.738   8.059   5.396 1.00 . A A .  39 LYS H    1 1 
        3  1767 1 1 39 LYS HA   H    8.839   7.406   7.317 1.00 . A A .  39 LYS HA   1 1 
        3  1768 1 1 39 LYS HB2  H   10.842   5.795   5.772 1.00 . A A .  39 LYS HB2  1 1 
        3  1769 1 1 39 LYS HB3  H    9.857   5.020   7.005 1.00 . A A .  39 LYS HB3  1 1 
        3  1770 1 1 39 LYS HD2  H    7.373   6.094   6.873 1.00 . A A .  39 LYS HD2  1 1 
        3  1771 1 1 39 LYS HD3  H    6.641   5.667   5.324 1.00 . A A .  39 LYS HD3  1 1 
        3  1772 1 1 39 LYS HE2  H    6.994   3.401   5.636 1.00 . A A .  39 LYS HE2  1 1 
        3  1773 1 1 39 LYS HE3  H    8.298   3.660   6.794 1.00 . A A .  39 LYS HE3  1 1 
        3  1774 1 1 39 LYS HG2  H    8.694   6.613   4.737 1.00 . A A .  39 LYS HG2  1 1 
        3  1775 1 1 39 LYS HG3  H    8.987   4.874   4.654 1.00 . A A .  39 LYS HG3  1 1 
        3  1776 1 1 39 LYS HZ1  H    6.298   4.741   8.130 1.00 . A A .  39 LYS HZ1  1 1 
        3  1777 1 1 39 LYS HZ2  H    6.667   3.093   8.229 1.00 . A A .  39 LYS HZ2  1 1 
        3  1778 1 1 39 LYS HZ3  H    5.416   3.620   7.221 1.00 . A A .  39 LYS HZ3  1 1 
        3  1779 1 1 39 LYS N    N   10.434   8.243   6.310 1.00 . A A .  39 LYS N    1 1 
        3  1780 1 1 39 LYS NZ   N    6.359   3.854   7.591 1.00 . A A .  39 LYS NZ   1 1 
        3  1781 1 1 39 LYS O    O   11.777   7.392   8.553 1.00 . A A .  39 LYS O    1 1 
        3  1782 1 1 40 PRO C    C   11.639   5.101  10.702 1.00 . A A .  40 PRO C    1 1 
        3  1783 1 1 40 PRO CA   C   10.540   6.157  10.734 1.00 . A A .  40 PRO CA   1 1 
        3  1784 1 1 40 PRO CB   C    9.353   5.668  11.569 1.00 . A A .  40 PRO CB   1 1 
        3  1785 1 1 40 PRO CD   C    8.570   5.888   9.321 1.00 . A A .  40 PRO CD   1 1 
        3  1786 1 1 40 PRO CG   C    8.410   5.078  10.578 1.00 . A A .  40 PRO CG   1 1 
        3  1787 1 1 40 PRO HA   H   10.930   7.069  11.161 1.00 . A A .  40 PRO HA   1 1 
        3  1788 1 1 40 PRO HB2  H    9.691   4.929  12.282 1.00 . A A .  40 PRO HB2  1 1 
        3  1789 1 1 40 PRO HB3  H    8.907   6.501  12.090 1.00 . A A .  40 PRO HB3  1 1 
        3  1790 1 1 40 PRO HD2  H    8.443   5.262   8.450 1.00 . A A .  40 PRO HD2  1 1 
        3  1791 1 1 40 PRO HD3  H    7.864   6.705   9.307 1.00 . A A .  40 PRO HD3  1 1 
        3  1792 1 1 40 PRO HG2  H    8.669   4.046  10.394 1.00 . A A .  40 PRO HG2  1 1 
        3  1793 1 1 40 PRO HG3  H    7.398   5.153  10.945 1.00 . A A .  40 PRO HG3  1 1 
        3  1794 1 1 40 PRO N    N    9.952   6.390   9.412 1.00 . A A .  40 PRO N    1 1 
        3  1795 1 1 40 PRO O    O   12.292   4.840  11.712 1.00 . A A .  40 PRO O    1 1 
        3  1796 1 1 41 SER C    C   14.064   4.010   8.611 1.00 . A A .  41 SER C    1 1 
        3  1797 1 1 41 SER CA   C   12.859   3.467   9.372 1.00 . A A .  41 SER CA   1 1 
        3  1798 1 1 41 SER CB   C   12.279   2.258   8.636 1.00 . A A .  41 SER CB   1 1 
        3  1799 1 1 41 SER H    H   11.287   4.749   8.766 1.00 . A A .  41 SER H    1 1 
        3  1800 1 1 41 SER HA   H   13.178   3.159  10.357 1.00 . A A .  41 SER HA   1 1 
        3  1801 1 1 41 SER HB2  H   11.291   2.047   9.016 1.00 . A A .  41 SER HB2  1 1 
        3  1802 1 1 41 SER HB3  H   12.218   2.478   7.580 1.00 . A A .  41 SER HB3  1 1 
        3  1803 1 1 41 SER HG   H   12.656   0.501   9.416 1.00 . A A .  41 SER HG   1 1 
        3  1804 1 1 41 SER N    N   11.840   4.497   9.535 1.00 . A A .  41 SER N    1 1 
        3  1805 1 1 41 SER O    O   13.962   4.368   7.438 1.00 . A A .  41 SER O    1 1 
        3  1806 1 1 41 SER OG   O   13.092   1.112   8.817 1.00 . A A .  41 SER OG   1 1 
        3  1807 1 1 42 GLY C    C   17.661   3.862   9.155 1.00 . A A .  42 GLY C    1 1 
        3  1808 1 1 42 GLY CA   C   16.416   4.571   8.662 1.00 . A A .  42 GLY CA   1 1 
        3  1809 1 1 42 GLY H    H   15.228   3.771  10.222 1.00 . A A .  42 GLY H    1 1 
        3  1810 1 1 42 GLY HA2  H   16.337   4.437   7.594 1.00 . A A .  42 GLY HA2  1 1 
        3  1811 1 1 42 GLY HA3  H   16.508   5.626   8.876 1.00 . A A .  42 GLY HA3  1 1 
        3  1812 1 1 42 GLY N    N   15.207   4.070   9.289 1.00 . A A .  42 GLY N    1 1 
        3  1813 1 1 42 GLY O    O   18.405   4.377   9.990 1.00 . A A .  42 GLY O    1 1 
        3  1814 1 1 43 PRO C    C   20.374   2.432   8.497 1.00 . A A .  43 PRO C    1 1 
        3  1815 1 1 43 PRO CA   C   19.066   1.842   9.013 1.00 . A A .  43 PRO CA   1 1 
        3  1816 1 1 43 PRO CB   C   18.790   0.491   8.349 1.00 . A A .  43 PRO CB   1 1 
        3  1817 1 1 43 PRO CD   C   17.058   1.975   7.634 1.00 . A A .  43 PRO CD   1 1 
        3  1818 1 1 43 PRO CG   C   17.901   0.808   7.197 1.00 . A A .  43 PRO CG   1 1 
        3  1819 1 1 43 PRO HA   H   19.127   1.714  10.084 1.00 . A A .  43 PRO HA   1 1 
        3  1820 1 1 43 PRO HB2  H   19.722   0.052   8.021 1.00 . A A .  43 PRO HB2  1 1 
        3  1821 1 1 43 PRO HB3  H   18.304  -0.168   9.053 1.00 . A A .  43 PRO HB3  1 1 
        3  1822 1 1 43 PRO HD2  H   16.854   2.627   6.798 1.00 . A A .  43 PRO HD2  1 1 
        3  1823 1 1 43 PRO HD3  H   16.137   1.629   8.079 1.00 . A A .  43 PRO HD3  1 1 
        3  1824 1 1 43 PRO HG2  H   18.496   1.076   6.337 1.00 . A A .  43 PRO HG2  1 1 
        3  1825 1 1 43 PRO HG3  H   17.275  -0.042   6.972 1.00 . A A .  43 PRO HG3  1 1 
        3  1826 1 1 43 PRO N    N   17.902   2.650   8.634 1.00 . A A .  43 PRO N    1 1 
        3  1827 1 1 43 PRO O    O   20.416   3.024   7.419 1.00 . A A .  43 PRO O    1 1 
        3  1828 1 1 44 SER C    C   23.504   1.780   8.033 1.00 . A A .  44 SER C    1 1 
        3  1829 1 1 44 SER CA   C   22.749   2.786   8.897 1.00 . A A .  44 SER CA   1 1 
        3  1830 1 1 44 SER CB   C   23.568   3.119  10.146 1.00 . A A .  44 SER CB   1 1 
        3  1831 1 1 44 SER H    H   21.342   1.785  10.123 1.00 . A A .  44 SER H    1 1 
        3  1832 1 1 44 SER HA   H   22.595   3.689   8.326 1.00 . A A .  44 SER HA   1 1 
        3  1833 1 1 44 SER HB2  H   24.475   3.624   9.854 1.00 . A A .  44 SER HB2  1 1 
        3  1834 1 1 44 SER HB3  H   22.988   3.764  10.791 1.00 . A A .  44 SER HB3  1 1 
        3  1835 1 1 44 SER HG   H   24.823   1.998  11.148 1.00 . A A .  44 SER HG   1 1 
        3  1836 1 1 44 SER N    N   21.439   2.266   9.274 1.00 . A A .  44 SER N    1 1 
        3  1837 1 1 44 SER O    O   23.074   0.638   7.872 1.00 . A A .  44 SER O    1 1 
        3  1838 1 1 44 SER OG   O   23.909   1.944  10.861 1.00 . A A .  44 SER OG   1 1 
        3  1839 1 1 45 SER C    C   25.658  -0.010   7.280 1.00 . A A .  45 SER C    1 1 
        3  1840 1 1 45 SER CA   C   25.446   1.354   6.630 1.00 . A A .  45 SER CA   1 1 
        3  1841 1 1 45 SER CB   C   26.798   2.013   6.348 1.00 . A A .  45 SER CB   1 1 
        3  1842 1 1 45 SER H    H   24.922   3.136   7.647 1.00 . A A .  45 SER H    1 1 
        3  1843 1 1 45 SER HA   H   24.920   1.218   5.697 1.00 . A A .  45 SER HA   1 1 
        3  1844 1 1 45 SER HB2  H   27.401   1.348   5.748 1.00 . A A .  45 SER HB2  1 1 
        3  1845 1 1 45 SER HB3  H   26.640   2.938   5.812 1.00 . A A .  45 SER HB3  1 1 
        3  1846 1 1 45 SER HG   H   28.013   1.533   7.808 1.00 . A A .  45 SER HG   1 1 
        3  1847 1 1 45 SER N    N   24.632   2.214   7.481 1.00 . A A .  45 SER N    1 1 
        3  1848 1 1 45 SER O    O   25.821  -0.112   8.495 1.00 . A A .  45 SER O    1 1 
        3  1849 1 1 45 SER OG   O   27.489   2.296   7.552 1.00 . A A .  45 SER OG   1 1 
        3  1850 1 1 46 GLY C    C   27.299  -2.834   6.931 1.00 . A A .  46 GLY C    1 1 
        3  1851 1 1 46 GLY CA   C   25.847  -2.400   6.971 1.00 . A A .  46 GLY CA   1 1 
        3  1852 1 1 46 GLY H    H   25.520  -0.914   5.499 1.00 . A A .  46 GLY H    1 1 
        3  1853 1 1 46 GLY HA2  H   25.499  -2.438   7.993 1.00 . A A .  46 GLY HA2  1 1 
        3  1854 1 1 46 GLY HA3  H   25.262  -3.087   6.377 1.00 . A A .  46 GLY HA3  1 1 
        3  1855 1 1 46 GLY N    N   25.654  -1.056   6.459 1.00 . A A .  46 GLY N    1 1 
        3  1856 1 1 46 GLY O    O   27.781  -3.402   7.910 1.00 . A A .  46 GLY O    1 1 
        3  1857 2 2  1 ZN  ZN   ZN  -1.134   6.486  -3.593 1.00 . B A . 201 ZN  ZN   1 1 
        4  1858 1 1  1 GLY C    C  -23.896   7.811   6.644 1.00 . A A .   1 GLY C    1 1 
        4  1859 1 1  1 GLY CA   C  -24.006   8.615   5.364 1.00 . A A .   1 GLY CA   1 1 
        4  1860 1 1  1 GLY H1   H  -24.539  10.661   5.246 1.00 . A A .   1 GLY H1   1 1 
        4  1861 1 1  1 GLY HA2  H  -24.403   7.982   4.586 1.00 . A A .   1 GLY HA2  1 1 
        4  1862 1 1  1 GLY HA3  H  -23.019   8.947   5.076 1.00 . A A .   1 GLY HA3  1 1 
        4  1863 1 1  1 GLY N    N  -24.865   9.776   5.510 1.00 . A A .   1 GLY N    1 1 
        4  1864 1 1  1 GLY O    O  -23.115   8.149   7.534 1.00 . A A .   1 GLY O    1 1 
        4  1865 1 1  2 SER C    C  -24.406   4.437   7.543 1.00 . A A .   2 SER C    1 1 
        4  1866 1 1  2 SER CA   C  -24.674   5.891   7.922 1.00 . A A .   2 SER CA   1 1 
        4  1867 1 1  2 SER CB   C  -26.008   5.999   8.664 1.00 . A A .   2 SER CB   1 1 
        4  1868 1 1  2 SER H    H  -25.283   6.525   5.996 1.00 . A A .   2 SER H    1 1 
        4  1869 1 1  2 SER HA   H  -23.882   6.233   8.572 1.00 . A A .   2 SER HA   1 1 
        4  1870 1 1  2 SER HB2  H  -26.812   6.057   7.947 1.00 . A A .   2 SER HB2  1 1 
        4  1871 1 1  2 SER HB3  H  -26.142   5.126   9.286 1.00 . A A .   2 SER HB3  1 1 
        4  1872 1 1  2 SER HG   H  -26.424   6.930  10.337 1.00 . A A .   2 SER HG   1 1 
        4  1873 1 1  2 SER N    N  -24.682   6.743   6.739 1.00 . A A .   2 SER N    1 1 
        4  1874 1 1  2 SER O    O  -24.461   4.070   6.369 1.00 . A A .   2 SER O    1 1 
        4  1875 1 1  2 SER OG   O  -26.043   7.154   9.484 1.00 . A A .   2 SER OG   1 1 
        4  1876 1 1  3 SER C    C  -25.122   1.381   8.349 1.00 . A A .   3 SER C    1 1 
        4  1877 1 1  3 SER CA   C  -23.836   2.201   8.319 1.00 . A A .   3 SER CA   1 1 
        4  1878 1 1  3 SER CB   C  -22.858   1.678   9.372 1.00 . A A .   3 SER CB   1 1 
        4  1879 1 1  3 SER H    H  -24.088   3.967   9.460 1.00 . A A .   3 SER H    1 1 
        4  1880 1 1  3 SER HA   H  -23.385   2.106   7.342 1.00 . A A .   3 SER HA   1 1 
        4  1881 1 1  3 SER HB2  H  -23.331   1.702  10.342 1.00 . A A .   3 SER HB2  1 1 
        4  1882 1 1  3 SER HB3  H  -22.584   0.661   9.131 1.00 . A A .   3 SER HB3  1 1 
        4  1883 1 1  3 SER HG   H  -21.085   2.118  10.079 1.00 . A A .   3 SER HG   1 1 
        4  1884 1 1  3 SER N    N  -24.116   3.614   8.546 1.00 . A A .   3 SER N    1 1 
        4  1885 1 1  3 SER O    O  -26.068   1.714   9.062 1.00 . A A .   3 SER O    1 1 
        4  1886 1 1  3 SER OG   O  -21.684   2.470   9.417 1.00 . A A .   3 SER OG   1 1 
        4  1887 1 1  4 GLY C    C  -26.413  -1.337   6.230 1.00 . A A .   4 GLY C    1 1 
        4  1888 1 1  4 GLY CA   C  -26.322  -0.548   7.521 1.00 . A A .   4 GLY CA   1 1 
        4  1889 1 1  4 GLY H    H  -24.365   0.087   7.022 1.00 . A A .   4 GLY H    1 1 
        4  1890 1 1  4 GLY HA2  H  -26.287  -1.238   8.351 1.00 . A A .   4 GLY HA2  1 1 
        4  1891 1 1  4 GLY HA3  H  -27.204   0.068   7.615 1.00 . A A .   4 GLY HA3  1 1 
        4  1892 1 1  4 GLY N    N  -25.149   0.304   7.569 1.00 . A A .   4 GLY N    1 1 
        4  1893 1 1  4 GLY O    O  -26.621  -2.550   6.249 1.00 . A A .   4 GLY O    1 1 
        4  1894 1 1  5 SER C    C  -25.467  -2.547   3.763 1.00 . A A .   5 SER C    1 1 
        4  1895 1 1  5 SER CA   C  -26.330  -1.289   3.797 1.00 . A A .   5 SER CA   1 1 
        4  1896 1 1  5 SER CB   C  -25.882  -0.319   2.703 1.00 . A A .   5 SER CB   1 1 
        4  1897 1 1  5 SER H    H  -26.095   0.319   5.154 1.00 . A A .   5 SER H    1 1 
        4  1898 1 1  5 SER HA   H  -27.358  -1.568   3.621 1.00 . A A .   5 SER HA   1 1 
        4  1899 1 1  5 SER HB2  H  -24.835  -0.091   2.834 1.00 . A A .   5 SER HB2  1 1 
        4  1900 1 1  5 SER HB3  H  -26.032  -0.777   1.736 1.00 . A A .   5 SER HB3  1 1 
        4  1901 1 1  5 SER HG   H  -26.663   1.278   1.881 1.00 . A A .   5 SER HG   1 1 
        4  1902 1 1  5 SER N    N  -26.259  -0.646   5.104 1.00 . A A .   5 SER N    1 1 
        4  1903 1 1  5 SER O    O  -24.252  -2.474   3.579 1.00 . A A .   5 SER O    1 1 
        4  1904 1 1  5 SER OG   O  -26.622   0.888   2.757 1.00 . A A .   5 SER OG   1 1 
        4  1905 1 1  6 SER C    C  -24.565  -5.127   2.663 1.00 . A A .   6 SER C    1 1 
        4  1906 1 1  6 SER CA   C  -25.395  -4.974   3.934 1.00 . A A .   6 SER CA   1 1 
        4  1907 1 1  6 SER CB   C  -26.386  -6.133   4.052 1.00 . A A .   6 SER CB   1 1 
        4  1908 1 1  6 SER H    H  -27.074  -3.692   4.083 1.00 . A A .   6 SER H    1 1 
        4  1909 1 1  6 SER HA   H  -24.733  -4.989   4.787 1.00 . A A .   6 SER HA   1 1 
        4  1910 1 1  6 SER HB2  H  -27.147  -6.032   3.293 1.00 . A A .   6 SER HB2  1 1 
        4  1911 1 1  6 SER HB3  H  -25.861  -7.068   3.913 1.00 . A A .   6 SER HB3  1 1 
        4  1912 1 1  6 SER HG   H  -27.173  -7.052   5.593 1.00 . A A .   6 SER HG   1 1 
        4  1913 1 1  6 SER N    N  -26.104  -3.700   3.941 1.00 . A A .   6 SER N    1 1 
        4  1914 1 1  6 SER O    O  -24.777  -4.418   1.680 1.00 . A A .   6 SER O    1 1 
        4  1915 1 1  6 SER OG   O  -27.009  -6.145   5.324 1.00 . A A .   6 SER OG   1 1 
        4  1916 1 1  7 GLY C    C  -21.311  -6.466   1.916 1.00 . A A .   7 GLY C    1 1 
        4  1917 1 1  7 GLY CA   C  -22.768  -6.289   1.537 1.00 . A A .   7 GLY CA   1 1 
        4  1918 1 1  7 GLY H    H  -23.493  -6.595   3.503 1.00 . A A .   7 GLY H    1 1 
        4  1919 1 1  7 GLY HA2  H  -23.107  -7.177   1.026 1.00 . A A .   7 GLY HA2  1 1 
        4  1920 1 1  7 GLY HA3  H  -22.854  -5.445   0.868 1.00 . A A .   7 GLY HA3  1 1 
        4  1921 1 1  7 GLY N    N  -23.617  -6.059   2.692 1.00 . A A .   7 GLY N    1 1 
        4  1922 1 1  7 GLY O    O  -20.870  -5.985   2.959 1.00 . A A .   7 GLY O    1 1 
        4  1923 1 1  8 ALA C    C  -18.317  -7.162   0.059 1.00 . A A .   8 ALA C    1 1 
        4  1924 1 1  8 ALA CA   C  -19.145  -7.401   1.317 1.00 . A A .   8 ALA CA   1 1 
        4  1925 1 1  8 ALA CB   C  -18.932  -8.817   1.830 1.00 . A A .   8 ALA CB   1 1 
        4  1926 1 1  8 ALA H    H  -20.970  -7.520   0.251 1.00 . A A .   8 ALA H    1 1 
        4  1927 1 1  8 ALA HA   H  -18.821  -6.713   2.085 1.00 . A A .   8 ALA HA   1 1 
        4  1928 1 1  8 ALA HB1  H  -19.836  -9.167   2.306 1.00 . A A .   8 ALA HB1  1 1 
        4  1929 1 1  8 ALA HB2  H  -18.687  -9.466   1.002 1.00 . A A .   8 ALA HB2  1 1 
        4  1930 1 1  8 ALA HB3  H  -18.123  -8.823   2.545 1.00 . A A .   8 ALA HB3  1 1 
        4  1931 1 1  8 ALA N    N  -20.561  -7.161   1.066 1.00 . A A .   8 ALA N    1 1 
        4  1932 1 1  8 ALA O    O  -18.449  -7.884  -0.929 1.00 . A A .   8 ALA O    1 1 
        4  1933 1 1  9 GLY C    C  -15.540  -4.826  -0.705 1.00 . A A .   9 GLY C    1 1 
        4  1934 1 1  9 GLY CA   C  -16.627  -5.828  -1.041 1.00 . A A .   9 GLY CA   1 1 
        4  1935 1 1  9 GLY H    H  -17.401  -5.603   0.917 1.00 . A A .   9 GLY H    1 1 
        4  1936 1 1  9 GLY HA2  H  -16.166  -6.737  -1.398 1.00 . A A .   9 GLY HA2  1 1 
        4  1937 1 1  9 GLY HA3  H  -17.248  -5.419  -1.825 1.00 . A A .   9 GLY HA3  1 1 
        4  1938 1 1  9 GLY N    N  -17.463  -6.144   0.102 1.00 . A A .   9 GLY N    1 1 
        4  1939 1 1  9 GLY O    O  -15.421  -3.789  -1.357 1.00 . A A .   9 GLY O    1 1 
        4  1940 1 1 10 GLU C    C  -12.358  -5.021   0.880 1.00 . A A .  10 GLU C    1 1 
        4  1941 1 1 10 GLU CA   C  -13.667  -4.251   0.738 1.00 . A A .  10 GLU CA   1 1 
        4  1942 1 1 10 GLU CB   C  -14.020  -3.574   2.064 1.00 . A A .  10 GLU CB   1 1 
        4  1943 1 1 10 GLU CD   C  -13.058  -5.197   3.744 1.00 . A A .  10 GLU CD   1 1 
        4  1944 1 1 10 GLU CG   C  -14.314  -4.554   3.188 1.00 . A A .  10 GLU CG   1 1 
        4  1945 1 1 10 GLU H    H  -14.892  -5.976   0.797 1.00 . A A .  10 GLU H    1 1 
        4  1946 1 1 10 GLU HA   H  -13.544  -3.493  -0.020 1.00 . A A .  10 GLU HA   1 1 
        4  1947 1 1 10 GLU HB2  H  -13.194  -2.948   2.366 1.00 . A A .  10 GLU HB2  1 1 
        4  1948 1 1 10 GLU HB3  H  -14.894  -2.956   1.917 1.00 . A A .  10 GLU HB3  1 1 
        4  1949 1 1 10 GLU HG2  H  -14.813  -4.027   3.987 1.00 . A A .  10 GLU HG2  1 1 
        4  1950 1 1 10 GLU HG3  H  -14.962  -5.331   2.811 1.00 . A A .  10 GLU HG3  1 1 
        4  1951 1 1 10 GLU N    N  -14.747  -5.135   0.316 1.00 . A A .  10 GLU N    1 1 
        4  1952 1 1 10 GLU O    O  -12.339  -6.251   0.831 1.00 . A A .  10 GLU O    1 1 
        4  1953 1 1 10 GLU OE1  O  -12.169  -4.455   4.210 1.00 . A A .  10 GLU OE1  1 1 
        4  1954 1 1 10 GLU OE2  O  -12.964  -6.442   3.711 1.00 . A A .  10 GLU OE2  1 1 
        4  1955 1 1 11 LYS C    C   -9.172  -4.249   2.347 1.00 . A A .  11 LYS C    1 1 
        4  1956 1 1 11 LYS CA   C   -9.948  -4.901   1.207 1.00 . A A .  11 LYS CA   1 1 
        4  1957 1 1 11 LYS CB   C   -9.156  -4.783  -0.097 1.00 . A A .  11 LYS CB   1 1 
        4  1958 1 1 11 LYS CD   C   -9.835  -2.674  -1.280 1.00 . A A .  11 LYS CD   1 1 
        4  1959 1 1 11 LYS CE   C   -9.858  -1.172  -1.036 1.00 . A A .  11 LYS CE   1 1 
        4  1960 1 1 11 LYS CG   C   -8.765  -3.357  -0.444 1.00 . A A .  11 LYS CG   1 1 
        4  1961 1 1 11 LYS H    H  -11.342  -3.312   1.087 1.00 . A A .  11 LYS H    1 1 
        4  1962 1 1 11 LYS HA   H  -10.093  -5.946   1.437 1.00 . A A .  11 LYS HA   1 1 
        4  1963 1 1 11 LYS HB2  H   -8.254  -5.370  -0.010 1.00 . A A .  11 LYS HB2  1 1 
        4  1964 1 1 11 LYS HB3  H   -9.755  -5.177  -0.905 1.00 . A A .  11 LYS HB3  1 1 
        4  1965 1 1 11 LYS HD2  H   -9.633  -2.854  -2.325 1.00 . A A .  11 LYS HD2  1 1 
        4  1966 1 1 11 LYS HD3  H  -10.800  -3.086  -1.021 1.00 . A A .  11 LYS HD3  1 1 
        4  1967 1 1 11 LYS HE2  H   -8.841  -0.816  -0.974 1.00 . A A .  11 LYS HE2  1 1 
        4  1968 1 1 11 LYS HE3  H  -10.357  -0.694  -1.866 1.00 . A A .  11 LYS HE3  1 1 
        4  1969 1 1 11 LYS HG2  H   -8.626  -2.798   0.470 1.00 . A A .  11 LYS HG2  1 1 
        4  1970 1 1 11 LYS HG3  H   -7.840  -3.373  -1.003 1.00 . A A .  11 LYS HG3  1 1 
        4  1971 1 1 11 LYS HZ1  H  -10.056  -0.079   0.733 1.00 . A A .  11 LYS HZ1  1 1 
        4  1972 1 1 11 LYS HZ2  H  -10.641  -1.663   0.837 1.00 . A A .  11 LYS HZ2  1 1 
        4  1973 1 1 11 LYS HZ3  H  -11.530  -0.486   0.009 1.00 . A A .  11 LYS HZ3  1 1 
        4  1974 1 1 11 LYS N    N  -11.263  -4.289   1.057 1.00 . A A .  11 LYS N    1 1 
        4  1975 1 1 11 LYS NZ   N  -10.571  -0.825   0.224 1.00 . A A .  11 LYS NZ   1 1 
        4  1976 1 1 11 LYS O    O   -9.346  -3.069   2.653 1.00 . A A .  11 LYS O    1 1 
        4  1977 1 1 12 PRO C    C   -6.405  -3.560   3.653 1.00 . A A .  12 PRO C    1 1 
        4  1978 1 1 12 PRO CA   C   -7.472  -4.552   4.105 1.00 . A A .  12 PRO CA   1 1 
        4  1979 1 1 12 PRO CB   C   -6.822  -5.829   4.643 1.00 . A A .  12 PRO CB   1 1 
        4  1980 1 1 12 PRO CD   C   -8.035  -6.449   2.679 1.00 . A A .  12 PRO CD   1 1 
        4  1981 1 1 12 PRO CG   C   -6.804  -6.763   3.482 1.00 . A A .  12 PRO CG   1 1 
        4  1982 1 1 12 PRO HA   H   -8.077  -4.101   4.878 1.00 . A A .  12 PRO HA   1 1 
        4  1983 1 1 12 PRO HB2  H   -5.822  -5.608   4.989 1.00 . A A .  12 PRO HB2  1 1 
        4  1984 1 1 12 PRO HB3  H   -7.412  -6.222   5.457 1.00 . A A .  12 PRO HB3  1 1 
        4  1985 1 1 12 PRO HD2  H   -7.843  -6.583   1.625 1.00 . A A .  12 PRO HD2  1 1 
        4  1986 1 1 12 PRO HD3  H   -8.861  -7.069   2.995 1.00 . A A .  12 PRO HD3  1 1 
        4  1987 1 1 12 PRO HG2  H   -5.917  -6.596   2.890 1.00 . A A .  12 PRO HG2  1 1 
        4  1988 1 1 12 PRO HG3  H   -6.836  -7.784   3.833 1.00 . A A .  12 PRO HG3  1 1 
        4  1989 1 1 12 PRO N    N   -8.294  -5.033   2.990 1.00 . A A .  12 PRO N    1 1 
        4  1990 1 1 12 PRO O    O   -6.141  -2.567   4.330 1.00 . A A .  12 PRO O    1 1 
        4  1991 1 1 13 TYR C    C   -5.367  -1.803   1.193 1.00 . A A .  13 TYR C    1 1 
        4  1992 1 1 13 TYR CA   C   -4.756  -2.969   1.964 1.00 . A A .  13 TYR CA   1 1 
        4  1993 1 1 13 TYR CB   C   -3.823  -3.766   1.052 1.00 . A A .  13 TYR CB   1 1 
        4  1994 1 1 13 TYR CD1  C   -2.741  -5.388   2.657 1.00 . A A .  13 TYR CD1  1 1 
        4  1995 1 1 13 TYR CD2  C   -4.086  -6.273   0.900 1.00 . A A .  13 TYR CD2  1 1 
        4  1996 1 1 13 TYR CE1  C   -2.483  -6.667   3.111 1.00 . A A .  13 TYR CE1  1 1 
        4  1997 1 1 13 TYR CE2  C   -3.836  -7.556   1.347 1.00 . A A .  13 TYR CE2  1 1 
        4  1998 1 1 13 TYR CG   C   -3.544  -5.168   1.545 1.00 . A A .  13 TYR CG   1 1 
        4  1999 1 1 13 TYR CZ   C   -3.033  -7.748   2.453 1.00 . A A .  13 TYR CZ   1 1 
        4  2000 1 1 13 TYR H    H   -6.050  -4.644   2.011 1.00 . A A .  13 TYR H    1 1 
        4  2001 1 1 13 TYR HA   H   -4.186  -2.578   2.794 1.00 . A A .  13 TYR HA   1 1 
        4  2002 1 1 13 TYR HB2  H   -4.267  -3.843   0.071 1.00 . A A .  13 TYR HB2  1 1 
        4  2003 1 1 13 TYR HB3  H   -2.878  -3.248   0.974 1.00 . A A .  13 TYR HB3  1 1 
        4  2004 1 1 13 TYR HD1  H   -2.312  -4.539   3.170 1.00 . A A .  13 TYR HD1  1 1 
        4  2005 1 1 13 TYR HD2  H   -4.714  -6.120   0.034 1.00 . A A .  13 TYR HD2  1 1 
        4  2006 1 1 13 TYR HE1  H   -1.856  -6.818   3.976 1.00 . A A .  13 TYR HE1  1 1 
        4  2007 1 1 13 TYR HE2  H   -4.266  -8.402   0.833 1.00 . A A .  13 TYR HE2  1 1 
        4  2008 1 1 13 TYR HH   H   -3.304  -9.650   2.398 1.00 . A A .  13 TYR HH   1 1 
        4  2009 1 1 13 TYR N    N   -5.796  -3.837   2.505 1.00 . A A .  13 TYR N    1 1 
        4  2010 1 1 13 TYR O    O   -6.550  -1.817   0.857 1.00 . A A .  13 TYR O    1 1 
        4  2011 1 1 13 TYR OH   O   -2.781  -9.023   2.903 1.00 . A A .  13 TYR OH   1 1 
        4  2012 1 1 14 GLY C    C   -4.334   1.646   0.616 1.00 . A A .  14 GLY C    1 1 
        4  2013 1 1 14 GLY CA   C   -5.023   0.367   0.184 1.00 . A A .  14 GLY CA   1 1 
        4  2014 1 1 14 GLY H    H   -3.613  -0.837   1.207 1.00 . A A .  14 GLY H    1 1 
        4  2015 1 1 14 GLY HA2  H   -4.846   0.213  -0.870 1.00 . A A .  14 GLY HA2  1 1 
        4  2016 1 1 14 GLY HA3  H   -6.085   0.472   0.349 1.00 . A A .  14 GLY HA3  1 1 
        4  2017 1 1 14 GLY N    N   -4.548  -0.793   0.914 1.00 . A A .  14 GLY N    1 1 
        4  2018 1 1 14 GLY O    O   -4.175   1.902   1.810 1.00 . A A .  14 GLY O    1 1 
        4  2019 1 1 15 CYS C    C   -4.251   4.816   0.228 1.00 . A A .  15 CYS C    1 1 
        4  2020 1 1 15 CYS CA   C   -3.242   3.710  -0.072 1.00 . A A .  15 CYS CA   1 1 
        4  2021 1 1 15 CYS CB   C   -2.359   4.117  -1.253 1.00 . A A .  15 CYS CB   1 1 
        4  2022 1 1 15 CYS H    H   -4.076   2.193  -1.290 1.00 . A A .  15 CYS H    1 1 
        4  2023 1 1 15 CYS HA   H   -2.620   3.563   0.797 1.00 . A A .  15 CYS HA   1 1 
        4  2024 1 1 15 CYS HB2  H   -1.479   3.490  -1.267 1.00 . A A .  15 CYS HB2  1 1 
        4  2025 1 1 15 CYS HB3  H   -2.911   3.974  -2.171 1.00 . A A .  15 CYS HB3  1 1 
        4  2026 1 1 15 CYS N    N   -3.921   2.452  -0.357 1.00 . A A .  15 CYS N    1 1 
        4  2027 1 1 15 CYS O    O   -5.378   4.793  -0.266 1.00 . A A .  15 CYS O    1 1 
        4  2028 1 1 15 CYS SG   S   -1.802   5.850  -1.204 1.00 . A A .  15 CYS SG   1 1 
        4  2029 1 1 16 SER C    C   -4.178   8.208   0.832 1.00 . A A .  16 SER C    1 1 
        4  2030 1 1 16 SER CA   C   -4.703   6.896   1.408 1.00 . A A .  16 SER CA   1 1 
        4  2031 1 1 16 SER CB   C   -4.813   7.002   2.930 1.00 . A A .  16 SER CB   1 1 
        4  2032 1 1 16 SER H    H   -2.926   5.746   1.401 1.00 . A A .  16 SER H    1 1 
        4  2033 1 1 16 SER HA   H   -5.683   6.703   0.998 1.00 . A A .  16 SER HA   1 1 
        4  2034 1 1 16 SER HB2  H   -5.477   7.814   3.185 1.00 . A A .  16 SER HB2  1 1 
        4  2035 1 1 16 SER HB3  H   -5.207   6.077   3.325 1.00 . A A .  16 SER HB3  1 1 
        4  2036 1 1 16 SER HG   H   -2.946   6.532   3.294 1.00 . A A .  16 SER HG   1 1 
        4  2037 1 1 16 SER N    N   -3.836   5.783   1.040 1.00 . A A .  16 SER N    1 1 
        4  2038 1 1 16 SER O    O   -4.952   9.061   0.400 1.00 . A A .  16 SER O    1 1 
        4  2039 1 1 16 SER OG   O   -3.546   7.247   3.517 1.00 . A A .  16 SER OG   1 1 
        4  2040 1 1 17 GLU C    C   -2.918  10.029  -0.973 1.00 . A A .  17 GLU C    1 1 
        4  2041 1 1 17 GLU CA   C   -2.229   9.567   0.308 1.00 . A A .  17 GLU CA   1 1 
        4  2042 1 1 17 GLU CB   C   -0.743   9.321   0.041 1.00 . A A .  17 GLU CB   1 1 
        4  2043 1 1 17 GLU CD   C    0.387  10.358   2.048 1.00 . A A .  17 GLU CD   1 1 
        4  2044 1 1 17 GLU CG   C    0.070   9.077   1.301 1.00 . A A .  17 GLU CG   1 1 
        4  2045 1 1 17 GLU H    H   -2.293   7.643   1.188 1.00 . A A .  17 GLU H    1 1 
        4  2046 1 1 17 GLU HA   H   -2.327  10.341   1.054 1.00 . A A .  17 GLU HA   1 1 
        4  2047 1 1 17 GLU HB2  H   -0.643   8.457  -0.600 1.00 . A A .  17 GLU HB2  1 1 
        4  2048 1 1 17 GLU HB3  H   -0.333  10.182  -0.465 1.00 . A A .  17 GLU HB3  1 1 
        4  2049 1 1 17 GLU HG2  H   -0.490   8.426   1.956 1.00 . A A .  17 GLU HG2  1 1 
        4  2050 1 1 17 GLU HG3  H    0.999   8.598   1.028 1.00 . A A .  17 GLU HG3  1 1 
        4  2051 1 1 17 GLU N    N   -2.858   8.360   0.830 1.00 . A A .  17 GLU N    1 1 
        4  2052 1 1 17 GLU O    O   -3.196  11.216  -1.148 1.00 . A A .  17 GLU O    1 1 
        4  2053 1 1 17 GLU OE1  O    1.008  11.258   1.445 1.00 . A A .  17 GLU OE1  1 1 
        4  2054 1 1 17 GLU OE2  O    0.013  10.460   3.235 1.00 . A A .  17 GLU OE2  1 1 
        4  2055 1 1 18 CYS C    C   -5.118   8.568  -3.299 1.00 . A A .  18 CYS C    1 1 
        4  2056 1 1 18 CYS CA   C   -3.844   9.391  -3.131 1.00 . A A .  18 CYS CA   1 1 
        4  2057 1 1 18 CYS CB   C   -2.893   9.122  -4.300 1.00 . A A .  18 CYS CB   1 1 
        4  2058 1 1 18 CYS H    H   -2.942   8.154  -1.669 1.00 . A A .  18 CYS H    1 1 
        4  2059 1 1 18 CYS HA   H   -4.104  10.438  -3.124 1.00 . A A .  18 CYS HA   1 1 
        4  2060 1 1 18 CYS HB2  H   -3.330   9.515  -5.207 1.00 . A A .  18 CYS HB2  1 1 
        4  2061 1 1 18 CYS HB3  H   -1.955   9.623  -4.113 1.00 . A A .  18 CYS HB3  1 1 
        4  2062 1 1 18 CYS N    N   -3.189   9.083  -1.866 1.00 . A A .  18 CYS N    1 1 
        4  2063 1 1 18 CYS O    O   -6.101   9.036  -3.871 1.00 . A A .  18 CYS O    1 1 
        4  2064 1 1 18 CYS SG   S   -2.536   7.358  -4.577 1.00 . A A .  18 CYS SG   1 1 
        4  2065 1 1 19 GLY C    C   -6.081   5.401  -3.960 1.00 . A A .  19 GLY C    1 1 
        4  2066 1 1 19 GLY CA   C   -6.250   6.469  -2.898 1.00 . A A .  19 GLY CA   1 1 
        4  2067 1 1 19 GLY H    H   -4.280   7.018  -2.349 1.00 . A A .  19 GLY H    1 1 
        4  2068 1 1 19 GLY HA2  H   -6.414   5.991  -1.944 1.00 . A A .  19 GLY HA2  1 1 
        4  2069 1 1 19 GLY HA3  H   -7.115   7.069  -3.142 1.00 . A A .  19 GLY HA3  1 1 
        4  2070 1 1 19 GLY N    N   -5.092   7.338  -2.794 1.00 . A A .  19 GLY N    1 1 
        4  2071 1 1 19 GLY O    O   -6.789   5.399  -4.967 1.00 . A A .  19 GLY O    1 1 
        4  2072 1 1 20 LYS C    C   -4.905   2.057  -3.983 1.00 . A A .  20 LYS C    1 1 
        4  2073 1 1 20 LYS CA   C   -4.877   3.413  -4.682 1.00 . A A .  20 LYS CA   1 1 
        4  2074 1 1 20 LYS CB   C   -3.522   3.620  -5.362 1.00 . A A .  20 LYS CB   1 1 
        4  2075 1 1 20 LYS CD   C   -2.064   3.214  -7.367 1.00 . A A .  20 LYS CD   1 1 
        4  2076 1 1 20 LYS CE   C   -1.820   2.251  -8.519 1.00 . A A .  20 LYS CE   1 1 
        4  2077 1 1 20 LYS CG   C   -3.436   3.004  -6.748 1.00 . A A .  20 LYS CG   1 1 
        4  2078 1 1 20 LYS H    H   -4.607   4.546  -2.915 1.00 . A A .  20 LYS H    1 1 
        4  2079 1 1 20 LYS HA   H   -5.654   3.433  -5.432 1.00 . A A .  20 LYS HA   1 1 
        4  2080 1 1 20 LYS HB2  H   -3.335   4.680  -5.450 1.00 . A A .  20 LYS HB2  1 1 
        4  2081 1 1 20 LYS HB3  H   -2.752   3.178  -4.746 1.00 . A A .  20 LYS HB3  1 1 
        4  2082 1 1 20 LYS HD2  H   -1.997   4.225  -7.738 1.00 . A A .  20 LYS HD2  1 1 
        4  2083 1 1 20 LYS HD3  H   -1.309   3.055  -6.610 1.00 . A A .  20 LYS HD3  1 1 
        4  2084 1 1 20 LYS HE2  H   -0.756   2.159  -8.675 1.00 . A A .  20 LYS HE2  1 1 
        4  2085 1 1 20 LYS HE3  H   -2.230   1.287  -8.258 1.00 . A A .  20 LYS HE3  1 1 
        4  2086 1 1 20 LYS HG2  H   -3.627   1.944  -6.673 1.00 . A A .  20 LYS HG2  1 1 
        4  2087 1 1 20 LYS HG3  H   -4.181   3.462  -7.382 1.00 . A A .  20 LYS HG3  1 1 
        4  2088 1 1 20 LYS HZ1  H   -2.022   2.249 -10.598 1.00 . A A .  20 LYS HZ1  1 1 
        4  2089 1 1 20 LYS HZ2  H   -2.329   3.751  -9.881 1.00 . A A .  20 LYS HZ2  1 1 
        4  2090 1 1 20 LYS HZ3  H   -3.473   2.510  -9.769 1.00 . A A .  20 LYS HZ3  1 1 
        4  2091 1 1 20 LYS N    N   -5.139   4.491  -3.737 1.00 . A A .  20 LYS N    1 1 
        4  2092 1 1 20 LYS NZ   N   -2.455   2.723  -9.781 1.00 . A A .  20 LYS NZ   1 1 
        4  2093 1 1 20 LYS O    O   -4.128   1.808  -3.061 1.00 . A A .  20 LYS O    1 1 
        4  2094 1 1 21 ALA C    C   -5.180  -1.181  -4.679 1.00 . A A .  21 ALA C    1 1 
        4  2095 1 1 21 ALA CA   C   -5.929  -0.146  -3.846 1.00 . A A .  21 ALA CA   1 1 
        4  2096 1 1 21 ALA CB   C   -7.396  -0.529  -3.718 1.00 . A A .  21 ALA CB   1 1 
        4  2097 1 1 21 ALA H    H   -6.395   1.442  -5.165 1.00 . A A .  21 ALA H    1 1 
        4  2098 1 1 21 ALA HA   H   -5.501  -0.118  -2.854 1.00 . A A .  21 ALA HA   1 1 
        4  2099 1 1 21 ALA HB1  H   -7.473  -1.574  -3.457 1.00 . A A .  21 ALA HB1  1 1 
        4  2100 1 1 21 ALA HB2  H   -7.857   0.070  -2.947 1.00 . A A .  21 ALA HB2  1 1 
        4  2101 1 1 21 ALA HB3  H   -7.897  -0.355  -4.659 1.00 . A A .  21 ALA HB3  1 1 
        4  2102 1 1 21 ALA N    N   -5.803   1.185  -4.428 1.00 . A A .  21 ALA N    1 1 
        4  2103 1 1 21 ALA O    O   -4.980  -1.000  -5.880 1.00 . A A .  21 ALA O    1 1 
        4  2104 1 1 22 PHE C    C   -4.565  -4.702  -4.298 1.00 . A A .  22 PHE C    1 1 
        4  2105 1 1 22 PHE CA   C   -4.040  -3.331  -4.713 1.00 . A A .  22 PHE CA   1 1 
        4  2106 1 1 22 PHE CB   C   -2.544  -3.231  -4.406 1.00 . A A .  22 PHE CB   1 1 
        4  2107 1 1 22 PHE CD1  C   -2.123  -0.811  -3.896 1.00 . A A .  22 PHE CD1  1 1 
        4  2108 1 1 22 PHE CD2  C   -1.222  -1.717  -5.909 1.00 . A A .  22 PHE CD2  1 1 
        4  2109 1 1 22 PHE CE1  C   -1.578   0.422  -4.203 1.00 . A A .  22 PHE CE1  1 1 
        4  2110 1 1 22 PHE CE2  C   -0.675  -0.487  -6.221 1.00 . A A .  22 PHE CE2  1 1 
        4  2111 1 1 22 PHE CG   C   -1.951  -1.893  -4.744 1.00 . A A .  22 PHE CG   1 1 
        4  2112 1 1 22 PHE CZ   C   -0.854   0.584  -5.368 1.00 . A A .  22 PHE CZ   1 1 
        4  2113 1 1 22 PHE H    H   -4.958  -2.354  -3.075 1.00 . A A .  22 PHE H    1 1 
        4  2114 1 1 22 PHE HA   H   -4.190  -3.208  -5.775 1.00 . A A .  22 PHE HA   1 1 
        4  2115 1 1 22 PHE HB2  H   -2.387  -3.407  -3.353 1.00 . A A .  22 PHE HB2  1 1 
        4  2116 1 1 22 PHE HB3  H   -2.016  -3.982  -4.975 1.00 . A A .  22 PHE HB3  1 1 
        4  2117 1 1 22 PHE HD1  H   -2.690  -0.937  -2.984 1.00 . A A .  22 PHE HD1  1 1 
        4  2118 1 1 22 PHE HD2  H   -1.082  -2.554  -6.578 1.00 . A A .  22 PHE HD2  1 1 
        4  2119 1 1 22 PHE HE1  H   -1.720   1.257  -3.533 1.00 . A A .  22 PHE HE1  1 1 
        4  2120 1 1 22 PHE HE2  H   -0.109  -0.363  -7.133 1.00 . A A .  22 PHE HE2  1 1 
        4  2121 1 1 22 PHE HZ   H   -0.427   1.546  -5.609 1.00 . A A .  22 PHE HZ   1 1 
        4  2122 1 1 22 PHE N    N   -4.768  -2.267  -4.033 1.00 . A A .  22 PHE N    1 1 
        4  2123 1 1 22 PHE O    O   -5.272  -4.831  -3.298 1.00 . A A .  22 PHE O    1 1 
        4  2124 1 1 23 SER C    C   -3.940  -7.640  -3.560 1.00 . A A .  23 SER C    1 1 
        4  2125 1 1 23 SER CA   C   -4.653  -7.084  -4.789 1.00 . A A .  23 SER CA   1 1 
        4  2126 1 1 23 SER CB   C   -4.394  -7.989  -5.995 1.00 . A A .  23 SER CB   1 1 
        4  2127 1 1 23 SER H    H   -3.649  -5.557  -5.856 1.00 . A A .  23 SER H    1 1 
        4  2128 1 1 23 SER HA   H   -5.715  -7.056  -4.592 1.00 . A A .  23 SER HA   1 1 
        4  2129 1 1 23 SER HB2  H   -3.475  -7.690  -6.475 1.00 . A A .  23 SER HB2  1 1 
        4  2130 1 1 23 SER HB3  H   -4.310  -9.013  -5.662 1.00 . A A .  23 SER HB3  1 1 
        4  2131 1 1 23 SER HG   H   -6.099  -8.584  -6.755 1.00 . A A .  23 SER HG   1 1 
        4  2132 1 1 23 SER N    N   -4.214  -5.723  -5.073 1.00 . A A .  23 SER N    1 1 
        4  2133 1 1 23 SER O    O   -4.565  -8.233  -2.680 1.00 . A A .  23 SER O    1 1 
        4  2134 1 1 23 SER OG   O   -5.451  -7.900  -6.935 1.00 . A A .  23 SER OG   1 1 
        4  2135 1 1 24 SER C    C   -1.269  -6.764  -1.575 1.00 . A A .  24 SER C    1 1 
        4  2136 1 1 24 SER CA   C   -1.826  -7.928  -2.388 1.00 . A A .  24 SER CA   1 1 
        4  2137 1 1 24 SER CB   C   -0.679  -8.805  -2.896 1.00 . A A .  24 SER CB   1 1 
        4  2138 1 1 24 SER H    H   -2.185  -6.964  -4.239 1.00 . A A .  24 SER H    1 1 
        4  2139 1 1 24 SER HA   H   -2.467  -8.522  -1.754 1.00 . A A .  24 SER HA   1 1 
        4  2140 1 1 24 SER HB2  H   -0.357  -9.465  -2.106 1.00 . A A .  24 SER HB2  1 1 
        4  2141 1 1 24 SER HB3  H   -1.023  -9.390  -3.737 1.00 . A A .  24 SER HB3  1 1 
        4  2142 1 1 24 SER HG   H    0.821  -7.596  -2.543 1.00 . A A .  24 SER HG   1 1 
        4  2143 1 1 24 SER N    N   -2.627  -7.444  -3.507 1.00 . A A .  24 SER N    1 1 
        4  2144 1 1 24 SER O    O   -1.546  -5.600  -1.864 1.00 . A A .  24 SER O    1 1 
        4  2145 1 1 24 SER OG   O    0.422  -8.015  -3.309 1.00 . A A .  24 SER OG   1 1 
        4  2146 1 1 25 LYS C    C    1.417  -5.549  -0.299 1.00 . A A .  25 LYS C    1 1 
        4  2147 1 1 25 LYS CA   C    0.116  -6.071   0.303 1.00 . A A .  25 LYS CA   1 1 
        4  2148 1 1 25 LYS CB   C    0.380  -6.641   1.698 1.00 . A A .  25 LYS CB   1 1 
        4  2149 1 1 25 LYS CD   C    2.051  -5.181   2.876 1.00 . A A .  25 LYS CD   1 1 
        4  2150 1 1 25 LYS CE   C    2.788  -6.054   3.880 1.00 . A A .  25 LYS CE   1 1 
        4  2151 1 1 25 LYS CG   C    0.588  -5.577   2.761 1.00 . A A .  25 LYS CG   1 1 
        4  2152 1 1 25 LYS H    H   -0.298  -8.033  -0.373 1.00 . A A .  25 LYS H    1 1 
        4  2153 1 1 25 LYS HA   H   -0.583  -5.252   0.384 1.00 . A A .  25 LYS HA   1 1 
        4  2154 1 1 25 LYS HB2  H   -0.461  -7.252   1.990 1.00 . A A .  25 LYS HB2  1 1 
        4  2155 1 1 25 LYS HB3  H    1.266  -7.259   1.660 1.00 . A A .  25 LYS HB3  1 1 
        4  2156 1 1 25 LYS HD2  H    2.521  -5.288   1.909 1.00 . A A .  25 LYS HD2  1 1 
        4  2157 1 1 25 LYS HD3  H    2.112  -4.150   3.195 1.00 . A A .  25 LYS HD3  1 1 
        4  2158 1 1 25 LYS HE2  H    3.672  -5.531   4.210 1.00 . A A .  25 LYS HE2  1 1 
        4  2159 1 1 25 LYS HE3  H    2.139  -6.234   4.724 1.00 . A A .  25 LYS HE3  1 1 
        4  2160 1 1 25 LYS HG2  H    0.009  -4.703   2.501 1.00 . A A .  25 LYS HG2  1 1 
        4  2161 1 1 25 LYS HG3  H    0.254  -5.962   3.714 1.00 . A A .  25 LYS HG3  1 1 
        4  2162 1 1 25 LYS HZ1  H    3.623  -7.213   2.356 1.00 . A A .  25 LYS HZ1  1 1 
        4  2163 1 1 25 LYS HZ2  H    2.356  -7.973   3.179 1.00 . A A .  25 LYS HZ2  1 1 
        4  2164 1 1 25 LYS HZ3  H    3.876  -7.837   3.908 1.00 . A A .  25 LYS HZ3  1 1 
        4  2165 1 1 25 LYS N    N   -0.482  -7.087  -0.554 1.00 . A A .  25 LYS N    1 1 
        4  2166 1 1 25 LYS NZ   N    3.189  -7.361   3.289 1.00 . A A .  25 LYS NZ   1 1 
        4  2167 1 1 25 LYS O    O    1.679  -4.346  -0.287 1.00 . A A .  25 LYS O    1 1 
        4  2168 1 1 26 SER C    C    3.308  -5.019  -2.497 1.00 . A A .  26 SER C    1 1 
        4  2169 1 1 26 SER CA   C    3.503  -6.092  -1.430 1.00 . A A .  26 SER CA   1 1 
        4  2170 1 1 26 SER CB   C    4.175  -7.322  -2.043 1.00 . A A .  26 SER CB   1 1 
        4  2171 1 1 26 SER H    H    1.964  -7.404  -0.804 1.00 . A A .  26 SER H    1 1 
        4  2172 1 1 26 SER HA   H    4.137  -5.696  -0.651 1.00 . A A .  26 SER HA   1 1 
        4  2173 1 1 26 SER HB2  H    4.780  -7.017  -2.883 1.00 . A A .  26 SER HB2  1 1 
        4  2174 1 1 26 SER HB3  H    4.802  -7.794  -1.301 1.00 . A A .  26 SER HB3  1 1 
        4  2175 1 1 26 SER HG   H    2.807  -7.941  -3.301 1.00 . A A .  26 SER HG   1 1 
        4  2176 1 1 26 SER N    N    2.228  -6.461  -0.825 1.00 . A A .  26 SER N    1 1 
        4  2177 1 1 26 SER O    O    4.149  -4.136  -2.667 1.00 . A A .  26 SER O    1 1 
        4  2178 1 1 26 SER OG   O    3.212  -8.259  -2.491 1.00 . A A .  26 SER OG   1 1 
        4  2179 1 1 27 TYR C    C    1.633  -2.757  -3.683 1.00 . A A .  27 TYR C    1 1 
        4  2180 1 1 27 TYR CA   C    1.887  -4.143  -4.268 1.00 . A A .  27 TYR CA   1 1 
        4  2181 1 1 27 TYR CB   C    0.668  -4.602  -5.068 1.00 . A A .  27 TYR CB   1 1 
        4  2182 1 1 27 TYR CD1  C    1.899  -5.044  -7.228 1.00 . A A .  27 TYR CD1  1 1 
        4  2183 1 1 27 TYR CD2  C    0.458  -6.746  -6.386 1.00 . A A .  27 TYR CD2  1 1 
        4  2184 1 1 27 TYR CE1  C    2.218  -5.843  -8.309 1.00 . A A .  27 TYR CE1  1 1 
        4  2185 1 1 27 TYR CE2  C    0.773  -7.552  -7.463 1.00 . A A .  27 TYR CE2  1 1 
        4  2186 1 1 27 TYR CG   C    1.014  -5.480  -6.250 1.00 . A A .  27 TYR CG   1 1 
        4  2187 1 1 27 TYR CZ   C    1.652  -7.096  -8.423 1.00 . A A .  27 TYR CZ   1 1 
        4  2188 1 1 27 TYR H    H    1.561  -5.830  -3.033 1.00 . A A .  27 TYR H    1 1 
        4  2189 1 1 27 TYR HA   H    2.741  -4.091  -4.928 1.00 . A A .  27 TYR HA   1 1 
        4  2190 1 1 27 TYR HB2  H    0.011  -5.163  -4.421 1.00 . A A .  27 TYR HB2  1 1 
        4  2191 1 1 27 TYR HB3  H    0.143  -3.735  -5.442 1.00 . A A .  27 TYR HB3  1 1 
        4  2192 1 1 27 TYR HD1  H    2.341  -4.062  -7.136 1.00 . A A .  27 TYR HD1  1 1 
        4  2193 1 1 27 TYR HD2  H   -0.231  -7.101  -5.633 1.00 . A A .  27 TYR HD2  1 1 
        4  2194 1 1 27 TYR HE1  H    2.908  -5.486  -9.060 1.00 . A A .  27 TYR HE1  1 1 
        4  2195 1 1 27 TYR HE2  H    0.330  -8.533  -7.553 1.00 . A A .  27 TYR HE2  1 1 
        4  2196 1 1 27 TYR HH   H    2.343  -8.721  -9.183 1.00 . A A .  27 TYR HH   1 1 
        4  2197 1 1 27 TYR N    N    2.193  -5.104  -3.215 1.00 . A A .  27 TYR N    1 1 
        4  2198 1 1 27 TYR O    O    1.867  -1.741  -4.339 1.00 . A A .  27 TYR O    1 1 
        4  2199 1 1 27 TYR OH   O    1.969  -7.895  -9.497 1.00 . A A .  27 TYR OH   1 1 
        4  2200 1 1 28 LEU C    C    2.152  -0.799  -1.286 1.00 . A A .  28 LEU C    1 1 
        4  2201 1 1 28 LEU CA   C    0.867  -1.462  -1.769 1.00 . A A .  28 LEU CA   1 1 
        4  2202 1 1 28 LEU CB   C   -0.076  -1.697  -0.588 1.00 . A A .  28 LEU CB   1 1 
        4  2203 1 1 28 LEU CD1  C   -1.208   0.527  -0.348 1.00 . A A .  28 LEU CD1  1 1 
        4  2204 1 1 28 LEU CD2  C   -0.919  -0.948   1.651 1.00 . A A .  28 LEU CD2  1 1 
        4  2205 1 1 28 LEU CG   C   -0.312  -0.497   0.331 1.00 . A A .  28 LEU CG   1 1 
        4  2206 1 1 28 LEU H    H    0.987  -3.565  -1.973 1.00 . A A .  28 LEU H    1 1 
        4  2207 1 1 28 LEU HA   H    0.384  -0.808  -2.480 1.00 . A A .  28 LEU HA   1 1 
        4  2208 1 1 28 LEU HB2  H   -1.032  -2.003  -0.983 1.00 . A A .  28 LEU HB2  1 1 
        4  2209 1 1 28 LEU HB3  H    0.338  -2.496   0.011 1.00 . A A .  28 LEU HB3  1 1 
        4  2210 1 1 28 LEU HD11 H   -0.999   1.508   0.050 1.00 . A A .  28 LEU HD11 1 1 
        4  2211 1 1 28 LEU HD12 H   -2.243   0.277  -0.166 1.00 . A A .  28 LEU HD12 1 1 
        4  2212 1 1 28 LEU HD13 H   -1.019   0.521  -1.412 1.00 . A A .  28 LEU HD13 1 1 
        4  2213 1 1 28 LEU HD21 H   -1.534  -1.820   1.486 1.00 . A A .  28 LEU HD21 1 1 
        4  2214 1 1 28 LEU HD22 H   -1.526  -0.152   2.058 1.00 . A A .  28 LEU HD22 1 1 
        4  2215 1 1 28 LEU HD23 H   -0.129  -1.189   2.347 1.00 . A A .  28 LEU HD23 1 1 
        4  2216 1 1 28 LEU HG   H    0.636  -0.022   0.543 1.00 . A A .  28 LEU HG   1 1 
        4  2217 1 1 28 LEU N    N    1.153  -2.723  -2.445 1.00 . A A .  28 LEU N    1 1 
        4  2218 1 1 28 LEU O    O    2.288   0.424  -1.333 1.00 . A A .  28 LEU O    1 1 
        4  2219 1 1 29 ILE C    C    5.157  -0.430  -1.451 1.00 . A A .  29 ILE C    1 1 
        4  2220 1 1 29 ILE CA   C    4.370  -1.107  -0.333 1.00 . A A .  29 ILE CA   1 1 
        4  2221 1 1 29 ILE CB   C    5.228  -2.233   0.274 1.00 . A A .  29 ILE CB   1 1 
        4  2222 1 1 29 ILE CD1  C    5.060  -4.251   1.816 1.00 . A A .  29 ILE CD1  1 1 
        4  2223 1 1 29 ILE CG1  C    4.478  -2.912   1.423 1.00 . A A .  29 ILE CG1  1 1 
        4  2224 1 1 29 ILE CG2  C    6.560  -1.681   0.758 1.00 . A A .  29 ILE CG2  1 1 
        4  2225 1 1 29 ILE H    H    2.927  -2.580  -0.810 1.00 . A A .  29 ILE H    1 1 
        4  2226 1 1 29 ILE HA   H    4.165  -0.381   0.440 1.00 . A A .  29 ILE HA   1 1 
        4  2227 1 1 29 ILE HB   H    5.425  -2.961  -0.497 1.00 . A A .  29 ILE HB   1 1 
        4  2228 1 1 29 ILE HD11 H    6.008  -4.100   2.312 1.00 . A A .  29 ILE HD11 1 1 
        4  2229 1 1 29 ILE HD12 H    4.381  -4.757   2.486 1.00 . A A .  29 ILE HD12 1 1 
        4  2230 1 1 29 ILE HD13 H    5.210  -4.853   0.932 1.00 . A A .  29 ILE HD13 1 1 
        4  2231 1 1 29 ILE HG12 H    4.505  -2.271   2.290 1.00 . A A .  29 ILE HG12 1 1 
        4  2232 1 1 29 ILE HG13 H    3.450  -3.069   1.128 1.00 . A A .  29 ILE HG13 1 1 
        4  2233 1 1 29 ILE HG21 H    6.407  -0.710   1.206 1.00 . A A .  29 ILE HG21 1 1 
        4  2234 1 1 29 ILE HG22 H    6.983  -2.352   1.490 1.00 . A A .  29 ILE HG22 1 1 
        4  2235 1 1 29 ILE HG23 H    7.237  -1.588  -0.079 1.00 . A A .  29 ILE HG23 1 1 
        4  2236 1 1 29 ILE N    N    3.094  -1.614  -0.822 1.00 . A A .  29 ILE N    1 1 
        4  2237 1 1 29 ILE O    O    5.661   0.681  -1.283 1.00 . A A .  29 ILE O    1 1 
        4  2238 1 1 30 ILE C    C    5.418   0.787  -4.153 1.00 . A A .  30 ILE C    1 1 
        4  2239 1 1 30 ILE CA   C    5.979  -0.569  -3.736 1.00 . A A .  30 ILE CA   1 1 
        4  2240 1 1 30 ILE CB   C    5.921  -1.528  -4.939 1.00 . A A .  30 ILE CB   1 1 
        4  2241 1 1 30 ILE CD1  C    5.936  -4.022  -5.449 1.00 . A A .  30 ILE CD1  1 1 
        4  2242 1 1 30 ILE CG1  C    6.421  -2.917  -4.536 1.00 . A A .  30 ILE CG1  1 1 
        4  2243 1 1 30 ILE CG2  C    6.743  -0.978  -6.096 1.00 . A A .  30 ILE CG2  1 1 
        4  2244 1 1 30 ILE H    H    4.833  -1.987  -2.662 1.00 . A A .  30 ILE H    1 1 
        4  2245 1 1 30 ILE HA   H    7.014  -0.445  -3.449 1.00 . A A .  30 ILE HA   1 1 
        4  2246 1 1 30 ILE HB   H    4.894  -1.603  -5.262 1.00 . A A .  30 ILE HB   1 1 
        4  2247 1 1 30 ILE HD11 H    4.859  -4.087  -5.394 1.00 . A A .  30 ILE HD11 1 1 
        4  2248 1 1 30 ILE HD12 H    6.231  -3.805  -6.465 1.00 . A A .  30 ILE HD12 1 1 
        4  2249 1 1 30 ILE HD13 H    6.369  -4.961  -5.140 1.00 . A A .  30 ILE HD13 1 1 
        4  2250 1 1 30 ILE HG12 H    7.499  -2.923  -4.552 1.00 . A A .  30 ILE HG12 1 1 
        4  2251 1 1 30 ILE HG13 H    6.078  -3.138  -3.536 1.00 . A A .  30 ILE HG13 1 1 
        4  2252 1 1 30 ILE HG21 H    7.777  -1.263  -5.969 1.00 . A A .  30 ILE HG21 1 1 
        4  2253 1 1 30 ILE HG22 H    6.370  -1.382  -7.025 1.00 . A A .  30 ILE HG22 1 1 
        4  2254 1 1 30 ILE HG23 H    6.664   0.098  -6.113 1.00 . A A .  30 ILE HG23 1 1 
        4  2255 1 1 30 ILE N    N    5.256  -1.106  -2.590 1.00 . A A .  30 ILE N    1 1 
        4  2256 1 1 30 ILE O    O    6.160   1.673  -4.579 1.00 . A A .  30 ILE O    1 1 
        4  2257 1 1 31 HIS C    C    3.817   3.305  -3.415 1.00 . A A .  31 HIS C    1 1 
        4  2258 1 1 31 HIS CA   C    3.443   2.191  -4.388 1.00 . A A .  31 HIS CA   1 1 
        4  2259 1 1 31 HIS CB   C    1.926   2.002  -4.407 1.00 . A A .  31 HIS CB   1 1 
        4  2260 1 1 31 HIS CD2  C    0.634   4.108  -3.617 1.00 . A A .  31 HIS CD2  1 1 
        4  2261 1 1 31 HIS CE1  C    0.197   4.973  -5.583 1.00 . A A .  31 HIS CE1  1 1 
        4  2262 1 1 31 HIS CG   C    1.165   3.284  -4.551 1.00 . A A .  31 HIS CG   1 1 
        4  2263 1 1 31 HIS H    H    3.567   0.199  -3.681 1.00 . A A .  31 HIS H    1 1 
        4  2264 1 1 31 HIS HA   H    3.775   2.467  -5.377 1.00 . A A .  31 HIS HA   1 1 
        4  2265 1 1 31 HIS HB2  H    1.660   1.365  -5.237 1.00 . A A .  31 HIS HB2  1 1 
        4  2266 1 1 31 HIS HB3  H    1.616   1.533  -3.485 1.00 . A A .  31 HIS HB3  1 1 
        4  2267 1 1 31 HIS HD1  H    1.126   3.493  -6.647 1.00 . A A .  31 HIS HD1  1 1 
        4  2268 1 1 31 HIS HD2  H    0.671   3.971  -2.545 1.00 . A A .  31 HIS HD2  1 1 
        4  2269 1 1 31 HIS HE1  H   -0.165   5.631  -6.358 1.00 . A A .  31 HIS HE1  1 1 
        4  2270 1 1 31 HIS N    N    4.104   0.942  -4.026 1.00 . A A .  31 HIS N    1 1 
        4  2271 1 1 31 HIS ND1  N    0.874   3.854  -5.772 1.00 . A A .  31 HIS ND1  1 1 
        4  2272 1 1 31 HIS NE2  N    0.038   5.149  -4.284 1.00 . A A .  31 HIS NE2  1 1 
        4  2273 1 1 31 HIS O    O    4.074   4.437  -3.823 1.00 . A A .  31 HIS O    1 1 
        4  2274 1 1 32 MET C    C    5.521   4.623  -1.409 1.00 . A A .  32 MET C    1 1 
        4  2275 1 1 32 MET CA   C    4.189   3.948  -1.098 1.00 . A A .  32 MET CA   1 1 
        4  2276 1 1 32 MET CB   C    4.255   3.271   0.272 1.00 . A A .  32 MET CB   1 1 
        4  2277 1 1 32 MET CE   C    1.386   5.510   1.023 1.00 . A A .  32 MET CE   1 1 
        4  2278 1 1 32 MET CG   C    2.912   3.197   0.980 1.00 . A A .  32 MET CG   1 1 
        4  2279 1 1 32 MET H    H    3.632   2.056  -1.864 1.00 . A A .  32 MET H    1 1 
        4  2280 1 1 32 MET HA   H    3.414   4.699  -1.081 1.00 . A A .  32 MET HA   1 1 
        4  2281 1 1 32 MET HB2  H    4.626   2.265   0.145 1.00 . A A .  32 MET HB2  1 1 
        4  2282 1 1 32 MET HB3  H    4.939   3.822   0.901 1.00 . A A .  32 MET HB3  1 1 
        4  2283 1 1 32 MET HE1  H    1.798   5.704   0.044 1.00 . A A .  32 MET HE1  1 1 
        4  2284 1 1 32 MET HE2  H    0.496   4.906   0.926 1.00 . A A .  32 MET HE2  1 1 
        4  2285 1 1 32 MET HE3  H    1.135   6.446   1.501 1.00 . A A .  32 MET HE3  1 1 
        4  2286 1 1 32 MET HG2  H    2.132   3.128   0.237 1.00 . A A .  32 MET HG2  1 1 
        4  2287 1 1 32 MET HG3  H    2.895   2.313   1.600 1.00 . A A .  32 MET HG3  1 1 
        4  2288 1 1 32 MET N    N    3.846   2.975  -2.128 1.00 . A A .  32 MET N    1 1 
        4  2289 1 1 32 MET O    O    5.773   5.748  -0.978 1.00 . A A .  32 MET O    1 1 
        4  2290 1 1 32 MET SD   S    2.594   4.638   2.017 1.00 . A A .  32 MET SD   1 1 
        4  2291 1 1 33 ARG C    C    7.551   5.881  -3.073 1.00 . A A .  33 ARG C    1 1 
        4  2292 1 1 33 ARG CA   C    7.676   4.461  -2.528 1.00 . A A .  33 ARG CA   1 1 
        4  2293 1 1 33 ARG CB   C    8.343   3.560  -3.569 1.00 . A A .  33 ARG CB   1 1 
        4  2294 1 1 33 ARG CD   C    9.807   1.555  -3.959 1.00 . A A .  33 ARG CD   1 1 
        4  2295 1 1 33 ARG CG   C    8.843   2.241  -3.003 1.00 . A A .  33 ARG CG   1 1 
        4  2296 1 1 33 ARG CZ   C   12.051   1.929  -4.891 1.00 . A A .  33 ARG CZ   1 1 
        4  2297 1 1 33 ARG H    H    6.111   3.037  -2.474 1.00 . A A .  33 ARG H    1 1 
        4  2298 1 1 33 ARG HA   H    8.288   4.482  -1.639 1.00 . A A .  33 ARG HA   1 1 
        4  2299 1 1 33 ARG HB2  H    7.629   3.344  -4.351 1.00 . A A .  33 ARG HB2  1 1 
        4  2300 1 1 33 ARG HB3  H    9.184   4.086  -3.997 1.00 . A A .  33 ARG HB3  1 1 
        4  2301 1 1 33 ARG HD2  H   10.113   0.615  -3.526 1.00 . A A .  33 ARG HD2  1 1 
        4  2302 1 1 33 ARG HD3  H    9.297   1.372  -4.893 1.00 . A A .  33 ARG HD3  1 1 
        4  2303 1 1 33 ARG HE   H   11.000   3.283  -3.870 1.00 . A A .  33 ARG HE   1 1 
        4  2304 1 1 33 ARG HG2  H    9.353   2.431  -2.070 1.00 . A A .  33 ARG HG2  1 1 
        4  2305 1 1 33 ARG HG3  H    7.998   1.592  -2.829 1.00 . A A .  33 ARG HG3  1 1 
        4  2306 1 1 33 ARG HH11 H   11.286   0.090  -5.228 1.00 . A A .  33 ARG HH11 1 1 
        4  2307 1 1 33 ARG HH12 H   12.867   0.367  -5.880 1.00 . A A .  33 ARG HH12 1 1 
        4  2308 1 1 33 ARG HH21 H   13.082   3.659  -4.723 1.00 . A A .  33 ARG HH21 1 1 
        4  2309 1 1 33 ARG HH22 H   13.888   2.397  -5.591 1.00 . A A .  33 ARG HH22 1 1 
        4  2310 1 1 33 ARG N    N    6.370   3.929  -2.160 1.00 . A A .  33 ARG N    1 1 
        4  2311 1 1 33 ARG NE   N   10.993   2.367  -4.217 1.00 . A A .  33 ARG NE   1 1 
        4  2312 1 1 33 ARG NH1  N   12.070   0.694  -5.372 1.00 . A A .  33 ARG NH1  1 1 
        4  2313 1 1 33 ARG NH2  N   13.093   2.727  -5.084 1.00 . A A .  33 ARG NH2  1 1 
        4  2314 1 1 33 ARG O    O    8.375   6.747  -2.776 1.00 . A A .  33 ARG O    1 1 
        4  2315 1 1 34 THR C    C    5.920   8.451  -3.392 1.00 . A A .  34 THR C    1 1 
        4  2316 1 1 34 THR CA   C    6.283   7.426  -4.461 1.00 . A A .  34 THR CA   1 1 
        4  2317 1 1 34 THR CB   C    5.161   7.380  -5.514 1.00 . A A .  34 THR CB   1 1 
        4  2318 1 1 34 THR CG2  C    5.586   6.560  -6.723 1.00 . A A .  34 THR CG2  1 1 
        4  2319 1 1 34 THR H    H    5.894   5.383  -4.072 1.00 . A A .  34 THR H    1 1 
        4  2320 1 1 34 THR HA   H    7.195   7.739  -4.950 1.00 . A A .  34 THR HA   1 1 
        4  2321 1 1 34 THR HB   H    4.950   8.389  -5.838 1.00 . A A .  34 THR HB   1 1 
        4  2322 1 1 34 THR HG1  H    3.204   7.269  -5.292 1.00 . A A .  34 THR HG1  1 1 
        4  2323 1 1 34 THR HG21 H    4.710   6.197  -7.238 1.00 . A A .  34 THR HG21 1 1 
        4  2324 1 1 34 THR HG22 H    6.185   5.722  -6.397 1.00 . A A .  34 THR HG22 1 1 
        4  2325 1 1 34 THR HG23 H    6.166   7.179  -7.391 1.00 . A A .  34 THR HG23 1 1 
        4  2326 1 1 34 THR N    N    6.515   6.113  -3.873 1.00 . A A .  34 THR N    1 1 
        4  2327 1 1 34 THR O    O    6.502   9.534  -3.332 1.00 . A A .  34 THR O    1 1 
        4  2328 1 1 34 THR OG1  O    3.975   6.816  -4.942 1.00 . A A .  34 THR OG1  1 1 
        4  2329 1 1 35 HIS C    C    5.613   9.177  -0.439 1.00 . A A .  35 HIS C    1 1 
        4  2330 1 1 35 HIS CA   C    4.513   8.991  -1.480 1.00 . A A .  35 HIS CA   1 1 
        4  2331 1 1 35 HIS CB   C    3.252   8.438  -0.815 1.00 . A A .  35 HIS CB   1 1 
        4  2332 1 1 35 HIS CD2  C    1.134   7.562  -2.028 1.00 . A A .  35 HIS CD2  1 1 
        4  2333 1 1 35 HIS CE1  C    0.528   9.430  -3.003 1.00 . A A .  35 HIS CE1  1 1 
        4  2334 1 1 35 HIS CG   C    2.034   8.512  -1.683 1.00 . A A .  35 HIS CG   1 1 
        4  2335 1 1 35 HIS H    H    4.527   7.225  -2.647 1.00 . A A .  35 HIS H    1 1 
        4  2336 1 1 35 HIS HA   H    4.285   9.951  -1.920 1.00 . A A .  35 HIS HA   1 1 
        4  2337 1 1 35 HIS HB2  H    3.414   7.402  -0.558 1.00 . A A .  35 HIS HB2  1 1 
        4  2338 1 1 35 HIS HB3  H    3.053   9.000   0.087 1.00 . A A .  35 HIS HB3  1 1 
        4  2339 1 1 35 HIS HD1  H    2.075  10.539  -2.256 1.00 . A A .  35 HIS HD1  1 1 
        4  2340 1 1 35 HIS HD2  H    1.142   6.527  -1.716 1.00 . A A .  35 HIS HD2  1 1 
        4  2341 1 1 35 HIS HE1  H   -0.017  10.150  -3.595 1.00 . A A .  35 HIS HE1  1 1 
        4  2342 1 1 35 HIS N    N    4.953   8.102  -2.549 1.00 . A A .  35 HIS N    1 1 
        4  2343 1 1 35 HIS ND1  N    1.627   9.670  -2.311 1.00 . A A .  35 HIS ND1  1 1 
        4  2344 1 1 35 HIS NE2  N    0.208   8.158  -2.849 1.00 . A A .  35 HIS NE2  1 1 
        4  2345 1 1 35 HIS O    O    5.672   8.449   0.552 1.00 . A A .  35 HIS O    1 1 
        4  2346 1 1 36 SER C    C    8.279   9.141   0.663 1.00 . A A .  36 SER C    1 1 
        4  2347 1 1 36 SER CA   C    7.583  10.432   0.243 1.00 . A A .  36 SER CA   1 1 
        4  2348 1 1 36 SER CB   C    7.072  11.174   1.479 1.00 . A A .  36 SER CB   1 1 
        4  2349 1 1 36 SER H    H    6.382  10.700  -1.480 1.00 . A A .  36 SER H    1 1 
        4  2350 1 1 36 SER HA   H    8.294  11.059  -0.275 1.00 . A A .  36 SER HA   1 1 
        4  2351 1 1 36 SER HB2  H    6.221  11.780   1.206 1.00 . A A .  36 SER HB2  1 1 
        4  2352 1 1 36 SER HB3  H    6.777  10.456   2.230 1.00 . A A .  36 SER HB3  1 1 
        4  2353 1 1 36 SER HG   H    7.858  12.932   1.838 1.00 . A A .  36 SER HG   1 1 
        4  2354 1 1 36 SER N    N    6.482  10.154  -0.672 1.00 . A A .  36 SER N    1 1 
        4  2355 1 1 36 SER O    O    8.625   8.960   1.830 1.00 . A A .  36 SER O    1 1 
        4  2356 1 1 36 SER OG   O    8.076  12.015   2.020 1.00 . A A .  36 SER OG   1 1 
        4  2357 1 1 37 GLY C    C   10.637   7.048  -0.211 1.00 . A A .  37 GLY C    1 1 
        4  2358 1 1 37 GLY CA   C    9.136   6.983  -0.011 1.00 . A A .  37 GLY CA   1 1 
        4  2359 1 1 37 GLY H    H    8.186   8.445  -1.212 1.00 . A A .  37 GLY H    1 1 
        4  2360 1 1 37 GLY HA2  H    8.932   6.710   1.014 1.00 . A A .  37 GLY HA2  1 1 
        4  2361 1 1 37 GLY HA3  H    8.730   6.223  -0.663 1.00 . A A .  37 GLY HA3  1 1 
        4  2362 1 1 37 GLY N    N    8.483   8.246  -0.299 1.00 . A A .  37 GLY N    1 1 
        4  2363 1 1 37 GLY O    O   11.223   6.170  -0.844 1.00 . A A .  37 GLY O    1 1 
        4  2364 1 1 38 GLU C    C   13.225   9.239   1.257 1.00 . A A .  38 GLU C    1 1 
        4  2365 1 1 38 GLU CA   C   12.702   8.267   0.203 1.00 . A A .  38 GLU CA   1 1 
        4  2366 1 1 38 GLU CB   C   13.056   8.775  -1.196 1.00 . A A .  38 GLU CB   1 1 
        4  2367 1 1 38 GLU CD   C   12.458  10.416  -3.020 1.00 . A A .  38 GLU CD   1 1 
        4  2368 1 1 38 GLU CG   C   12.425  10.115  -1.534 1.00 . A A .  38 GLU CG   1 1 
        4  2369 1 1 38 GLU H    H   10.738   8.757   0.823 1.00 . A A .  38 GLU H    1 1 
        4  2370 1 1 38 GLU HA   H   13.169   7.305   0.355 1.00 . A A .  38 GLU HA   1 1 
        4  2371 1 1 38 GLU HB2  H   14.129   8.877  -1.268 1.00 . A A .  38 GLU HB2  1 1 
        4  2372 1 1 38 GLU HB3  H   12.724   8.050  -1.923 1.00 . A A .  38 GLU HB3  1 1 
        4  2373 1 1 38 GLU HG2  H   11.396  10.106  -1.208 1.00 . A A .  38 GLU HG2  1 1 
        4  2374 1 1 38 GLU HG3  H   12.960  10.894  -1.012 1.00 . A A .  38 GLU HG3  1 1 
        4  2375 1 1 38 GLU N    N   11.260   8.090   0.329 1.00 . A A .  38 GLU N    1 1 
        4  2376 1 1 38 GLU O    O   12.486  10.086   1.758 1.00 . A A .  38 GLU O    1 1 
        4  2377 1 1 38 GLU OE1  O   13.555  10.701  -3.544 1.00 . A A .  38 GLU OE1  1 1 
        4  2378 1 1 38 GLU OE2  O   11.386  10.367  -3.659 1.00 . A A .  38 GLU OE2  1 1 
        4  2379 1 1 39 LYS C    C   16.266  10.783   1.962 1.00 . A A .  39 LYS C    1 1 
        4  2380 1 1 39 LYS CA   C   15.130   9.976   2.582 1.00 . A A .  39 LYS CA   1 1 
        4  2381 1 1 39 LYS CB   C   15.660   9.144   3.752 1.00 . A A .  39 LYS CB   1 1 
        4  2382 1 1 39 LYS CD   C   15.037   7.705   5.714 1.00 . A A .  39 LYS CD   1 1 
        4  2383 1 1 39 LYS CE   C   15.887   8.189   6.879 1.00 . A A .  39 LYS CE   1 1 
        4  2384 1 1 39 LYS CG   C   14.615   8.855   4.816 1.00 . A A .  39 LYS CG   1 1 
        4  2385 1 1 39 LYS H    H   15.044   8.415   1.154 1.00 . A A .  39 LYS H    1 1 
        4  2386 1 1 39 LYS HA   H   14.377  10.658   2.948 1.00 . A A .  39 LYS HA   1 1 
        4  2387 1 1 39 LYS HB2  H   16.027   8.202   3.372 1.00 . A A .  39 LYS HB2  1 1 
        4  2388 1 1 39 LYS HB3  H   16.477   9.678   4.216 1.00 . A A .  39 LYS HB3  1 1 
        4  2389 1 1 39 LYS HD2  H   14.154   7.222   6.105 1.00 . A A .  39 LYS HD2  1 1 
        4  2390 1 1 39 LYS HD3  H   15.609   6.996   5.132 1.00 . A A .  39 LYS HD3  1 1 
        4  2391 1 1 39 LYS HE2  H   16.585   8.928   6.515 1.00 . A A .  39 LYS HE2  1 1 
        4  2392 1 1 39 LYS HE3  H   15.240   8.638   7.617 1.00 . A A .  39 LYS HE3  1 1 
        4  2393 1 1 39 LYS HG2  H   14.477   9.739   5.422 1.00 . A A .  39 LYS HG2  1 1 
        4  2394 1 1 39 LYS HG3  H   13.683   8.599   4.332 1.00 . A A .  39 LYS HG3  1 1 
        4  2395 1 1 39 LYS HZ1  H   17.029   6.443   6.782 1.00 . A A .  39 LYS HZ1  1 1 
        4  2396 1 1 39 LYS HZ2  H   16.021   6.528   8.138 1.00 . A A .  39 LYS HZ2  1 1 
        4  2397 1 1 39 LYS HZ3  H   17.434   7.455   8.074 1.00 . A A .  39 LYS HZ3  1 1 
        4  2398 1 1 39 LYS N    N   14.505   9.110   1.589 1.00 . A A .  39 LYS N    1 1 
        4  2399 1 1 39 LYS NZ   N   16.646   7.076   7.512 1.00 . A A .  39 LYS NZ   1 1 
        4  2400 1 1 39 LYS O    O   16.997  10.306   1.094 1.00 . A A .  39 LYS O    1 1 
        4  2401 1 1 40 PRO C    C   18.861  12.498   2.362 1.00 . A A .  40 PRO C    1 1 
        4  2402 1 1 40 PRO CA   C   17.468  12.934   1.924 1.00 . A A .  40 PRO CA   1 1 
        4  2403 1 1 40 PRO CB   C   17.106  14.281   2.555 1.00 . A A .  40 PRO CB   1 1 
        4  2404 1 1 40 PRO CD   C   15.586  12.669   3.452 1.00 . A A .  40 PRO CD   1 1 
        4  2405 1 1 40 PRO CG   C   16.336  13.930   3.781 1.00 . A A .  40 PRO CG   1 1 
        4  2406 1 1 40 PRO HA   H   17.441  13.020   0.847 1.00 . A A .  40 PRO HA   1 1 
        4  2407 1 1 40 PRO HB2  H   18.010  14.823   2.796 1.00 . A A .  40 PRO HB2  1 1 
        4  2408 1 1 40 PRO HB3  H   16.508  14.857   1.865 1.00 . A A .  40 PRO HB3  1 1 
        4  2409 1 1 40 PRO HD2  H   15.508  12.038   4.326 1.00 . A A .  40 PRO HD2  1 1 
        4  2410 1 1 40 PRO HD3  H   14.605  12.904   3.065 1.00 . A A .  40 PRO HD3  1 1 
        4  2411 1 1 40 PRO HG2  H   17.014  13.760   4.604 1.00 . A A .  40 PRO HG2  1 1 
        4  2412 1 1 40 PRO HG3  H   15.645  14.725   4.020 1.00 . A A .  40 PRO HG3  1 1 
        4  2413 1 1 40 PRO N    N   16.421  12.035   2.418 1.00 . A A .  40 PRO N    1 1 
        4  2414 1 1 40 PRO O    O   19.371  12.953   3.386 1.00 . A A .  40 PRO O    1 1 
        4  2415 1 1 41 SER C    C   21.805  11.523   0.812 1.00 . A A .  41 SER C    1 1 
        4  2416 1 1 41 SER CA   C   20.807  11.113   1.891 1.00 . A A .  41 SER CA   1 1 
        4  2417 1 1 41 SER CB   C   20.784   9.589   2.028 1.00 . A A .  41 SER CB   1 1 
        4  2418 1 1 41 SER H    H   19.014  11.288   0.778 1.00 . A A .  41 SER H    1 1 
        4  2419 1 1 41 SER HA   H   21.113  11.546   2.832 1.00 . A A .  41 SER HA   1 1 
        4  2420 1 1 41 SER HB2  H   19.837   9.282   2.446 1.00 . A A .  41 SER HB2  1 1 
        4  2421 1 1 41 SER HB3  H   20.910   9.141   1.053 1.00 . A A .  41 SER HB3  1 1 
        4  2422 1 1 41 SER HG   H   22.043   8.228   2.660 1.00 . A A .  41 SER HG   1 1 
        4  2423 1 1 41 SER N    N   19.473  11.613   1.581 1.00 . A A .  41 SER N    1 1 
        4  2424 1 1 41 SER O    O   21.943  10.851  -0.209 1.00 . A A .  41 SER O    1 1 
        4  2425 1 1 41 SER OG   O   21.825   9.138   2.876 1.00 . A A .  41 SER OG   1 1 
        4  2426 1 1 42 GLY C    C   23.567  14.626   0.064 1.00 . A A .  42 GLY C    1 1 
        4  2427 1 1 42 GLY CA   C   23.476  13.113   0.089 1.00 . A A .  42 GLY CA   1 1 
        4  2428 1 1 42 GLY H    H   22.348  13.127   1.881 1.00 . A A .  42 GLY H    1 1 
        4  2429 1 1 42 GLY HA2  H   24.445  12.710   0.344 1.00 . A A .  42 GLY HA2  1 1 
        4  2430 1 1 42 GLY HA3  H   23.200  12.765  -0.895 1.00 . A A .  42 GLY HA3  1 1 
        4  2431 1 1 42 GLY N    N   22.500  12.632   1.048 1.00 . A A .  42 GLY N    1 1 
        4  2432 1 1 42 GLY O    O   22.774  15.328   0.694 1.00 . A A .  42 GLY O    1 1 
        4  2433 1 1 43 PRO C    C   23.668  17.281  -1.602 1.00 . A A .  43 PRO C    1 1 
        4  2434 1 1 43 PRO CA   C   24.768  16.597  -0.799 1.00 . A A .  43 PRO CA   1 1 
        4  2435 1 1 43 PRO CB   C   26.107  16.695  -1.535 1.00 . A A .  43 PRO CB   1 1 
        4  2436 1 1 43 PRO CD   C   25.534  14.376  -1.455 1.00 . A A .  43 PRO CD   1 1 
        4  2437 1 1 43 PRO CG   C   26.216  15.419  -2.296 1.00 . A A .  43 PRO CG   1 1 
        4  2438 1 1 43 PRO HA   H   24.852  17.068   0.169 1.00 . A A .  43 PRO HA   1 1 
        4  2439 1 1 43 PRO HB2  H   26.095  17.551  -2.196 1.00 . A A .  43 PRO HB2  1 1 
        4  2440 1 1 43 PRO HB3  H   26.909  16.797  -0.819 1.00 . A A .  43 PRO HB3  1 1 
        4  2441 1 1 43 PRO HD2  H   25.041  13.648  -2.082 1.00 . A A .  43 PRO HD2  1 1 
        4  2442 1 1 43 PRO HD3  H   26.247  13.893  -0.802 1.00 . A A .  43 PRO HD3  1 1 
        4  2443 1 1 43 PRO HG2  H   25.719  15.516  -3.249 1.00 . A A .  43 PRO HG2  1 1 
        4  2444 1 1 43 PRO HG3  H   27.256  15.165  -2.438 1.00 . A A .  43 PRO HG3  1 1 
        4  2445 1 1 43 PRO N    N   24.553  15.152  -0.678 1.00 . A A .  43 PRO N    1 1 
        4  2446 1 1 43 PRO O    O   23.642  18.506  -1.721 1.00 . A A .  43 PRO O    1 1 
        4  2447 1 1 44 SER C    C   20.522  17.494  -2.050 1.00 . A A .  44 SER C    1 1 
        4  2448 1 1 44 SER CA   C   21.657  17.012  -2.948 1.00 . A A .  44 SER CA   1 1 
        4  2449 1 1 44 SER CB   C   21.139  15.945  -3.914 1.00 . A A .  44 SER CB   1 1 
        4  2450 1 1 44 SER H    H   22.833  15.514  -2.022 1.00 . A A .  44 SER H    1 1 
        4  2451 1 1 44 SER HA   H   22.031  17.850  -3.516 1.00 . A A .  44 SER HA   1 1 
        4  2452 1 1 44 SER HB2  H   20.286  16.331  -4.450 1.00 . A A .  44 SER HB2  1 1 
        4  2453 1 1 44 SER HB3  H   21.920  15.690  -4.617 1.00 . A A .  44 SER HB3  1 1 
        4  2454 1 1 44 SER HG   H   21.106  14.002  -3.667 1.00 . A A .  44 SER HG   1 1 
        4  2455 1 1 44 SER N    N   22.759  16.482  -2.152 1.00 . A A .  44 SER N    1 1 
        4  2456 1 1 44 SER O    O   19.774  16.692  -1.491 1.00 . A A .  44 SER O    1 1 
        4  2457 1 1 44 SER OG   O   20.750  14.773  -3.219 1.00 . A A .  44 SER OG   1 1 
        4  2458 1 1 45 SER C    C   18.336  20.144  -1.938 1.00 . A A .  45 SER C    1 1 
        4  2459 1 1 45 SER CA   C   19.359  19.402  -1.084 1.00 . A A .  45 SER CA   1 1 
        4  2460 1 1 45 SER CB   C   19.976  20.358  -0.061 1.00 . A A .  45 SER CB   1 1 
        4  2461 1 1 45 SER H    H   21.027  19.399  -2.388 1.00 . A A .  45 SER H    1 1 
        4  2462 1 1 45 SER HA   H   18.859  18.601  -0.559 1.00 . A A .  45 SER HA   1 1 
        4  2463 1 1 45 SER HB2  H   20.809  20.875  -0.512 1.00 . A A .  45 SER HB2  1 1 
        4  2464 1 1 45 SER HB3  H   19.232  21.077   0.250 1.00 . A A .  45 SER HB3  1 1 
        4  2465 1 1 45 SER HG   H   21.360  19.873   1.238 1.00 . A A .  45 SER HG   1 1 
        4  2466 1 1 45 SER N    N   20.400  18.811  -1.916 1.00 . A A .  45 SER N    1 1 
        4  2467 1 1 45 SER O    O   18.688  20.803  -2.916 1.00 . A A .  45 SER O    1 1 
        4  2468 1 1 45 SER OG   O   20.438  19.656   1.080 1.00 . A A .  45 SER OG   1 1 
        4  2469 1 1 46 GLY C    C   14.634  20.405  -1.738 1.00 . A A .  46 GLY C    1 1 
        4  2470 1 1 46 GLY CA   C   16.010  20.696  -2.302 1.00 . A A .  46 GLY CA   1 1 
        4  2471 1 1 46 GLY H    H   16.844  19.493  -0.772 1.00 . A A .  46 GLY H    1 1 
        4  2472 1 1 46 GLY HA2  H   16.181  21.762  -2.274 1.00 . A A .  46 GLY HA2  1 1 
        4  2473 1 1 46 GLY HA3  H   16.043  20.364  -3.329 1.00 . A A .  46 GLY HA3  1 1 
        4  2474 1 1 46 GLY N    N   17.066  20.032  -1.561 1.00 . A A .  46 GLY N    1 1 
        4  2475 1 1 46 GLY O    O   13.943  21.338  -1.331 1.00 . A A .  46 GLY O    1 1 
        4  2476 2 2  1 ZN  ZN   ZN  -1.037   6.538  -3.137 1.00 . B A . 201 ZN  ZN   1 1 
        5  2477 1 1  1 GLY C    C  -32.489   0.773 -12.351 1.00 . A A .   1 GLY C    1 1 
        5  2478 1 1  1 GLY CA   C  -33.693  -0.141 -12.451 1.00 . A A .   1 GLY CA   1 1 
        5  2479 1 1  1 GLY H1   H  -35.324   0.241 -13.746 1.00 . A A .   1 GLY H1   1 1 
        5  2480 1 1  1 GLY HA2  H  -34.384   0.102 -11.658 1.00 . A A .   1 GLY HA2  1 1 
        5  2481 1 1  1 GLY HA3  H  -33.365  -1.163 -12.329 1.00 . A A .   1 GLY HA3  1 1 
        5  2482 1 1  1 GLY N    N  -34.379  -0.019 -13.724 1.00 . A A .   1 GLY N    1 1 
        5  2483 1 1  1 GLY O    O  -31.737   0.929 -13.314 1.00 . A A .   1 GLY O    1 1 
        5  2484 1 1  2 SER C    C  -30.739   2.259  -9.505 1.00 . A A .   2 SER C    1 1 
        5  2485 1 1  2 SER CA   C  -31.186   2.291 -10.964 1.00 . A A .   2 SER CA   1 1 
        5  2486 1 1  2 SER CB   C  -31.575   3.717 -11.358 1.00 . A A .   2 SER CB   1 1 
        5  2487 1 1  2 SER H    H  -32.939   1.218 -10.455 1.00 . A A .   2 SER H    1 1 
        5  2488 1 1  2 SER HA   H  -30.366   1.965 -11.586 1.00 . A A .   2 SER HA   1 1 
        5  2489 1 1  2 SER HB2  H  -32.266   3.683 -12.186 1.00 . A A .   2 SER HB2  1 1 
        5  2490 1 1  2 SER HB3  H  -32.044   4.205 -10.517 1.00 . A A .   2 SER HB3  1 1 
        5  2491 1 1  2 SER HG   H  -29.727   4.320 -11.115 1.00 . A A .   2 SER HG   1 1 
        5  2492 1 1  2 SER N    N  -32.305   1.382 -11.184 1.00 . A A .   2 SER N    1 1 
        5  2493 1 1  2 SER O    O  -31.489   2.638  -8.606 1.00 . A A .   2 SER O    1 1 
        5  2494 1 1  2 SER OG   O  -30.436   4.467 -11.745 1.00 . A A .   2 SER OG   1 1 
        5  2495 1 1  3 SER C    C  -27.450   1.903  -7.945 1.00 . A A .   3 SER C    1 1 
        5  2496 1 1  3 SER CA   C  -28.964   1.717  -7.930 1.00 . A A .   3 SER CA   1 1 
        5  2497 1 1  3 SER CB   C  -29.317   0.369  -7.299 1.00 . A A .   3 SER CB   1 1 
        5  2498 1 1  3 SER H    H  -28.961   1.516 -10.038 1.00 . A A .   3 SER H    1 1 
        5  2499 1 1  3 SER HA   H  -29.406   2.507  -7.342 1.00 . A A .   3 SER HA   1 1 
        5  2500 1 1  3 SER HB2  H  -30.378   0.334  -7.100 1.00 . A A .   3 SER HB2  1 1 
        5  2501 1 1  3 SER HB3  H  -29.053  -0.425  -7.982 1.00 . A A .   3 SER HB3  1 1 
        5  2502 1 1  3 SER HG   H  -28.174  -0.674  -6.098 1.00 . A A .   3 SER HG   1 1 
        5  2503 1 1  3 SER N    N  -29.511   1.803  -9.279 1.00 . A A .   3 SER N    1 1 
        5  2504 1 1  3 SER O    O  -26.770   1.479  -8.879 1.00 . A A .   3 SER O    1 1 
        5  2505 1 1  3 SER OG   O  -28.618   0.177  -6.081 1.00 . A A .   3 SER OG   1 1 
        5  2506 1 1  4 GLY C    C  -24.795   1.740  -5.955 1.00 . A A .   4 GLY C    1 1 
        5  2507 1 1  4 GLY CA   C  -25.498   2.773  -6.814 1.00 . A A .   4 GLY CA   1 1 
        5  2508 1 1  4 GLY H    H  -27.518   2.857  -6.186 1.00 . A A .   4 GLY H    1 1 
        5  2509 1 1  4 GLY HA2  H  -25.078   2.746  -7.808 1.00 . A A .   4 GLY HA2  1 1 
        5  2510 1 1  4 GLY HA3  H  -25.329   3.752  -6.389 1.00 . A A .   4 GLY HA3  1 1 
        5  2511 1 1  4 GLY N    N  -26.928   2.541  -6.902 1.00 . A A .   4 GLY N    1 1 
        5  2512 1 1  4 GLY O    O  -25.138   0.558  -5.988 1.00 . A A .   4 GLY O    1 1 
        5  2513 1 1  5 SER C    C  -22.300   0.245  -5.139 1.00 . A A .   5 SER C    1 1 
        5  2514 1 1  5 SER CA   C  -23.050   1.291  -4.319 1.00 . A A .   5 SER CA   1 1 
        5  2515 1 1  5 SER CB   C  -23.983   0.601  -3.323 1.00 . A A .   5 SER CB   1 1 
        5  2516 1 1  5 SER H    H  -23.580   3.140  -5.204 1.00 . A A .   5 SER H    1 1 
        5  2517 1 1  5 SER HA   H  -22.332   1.886  -3.774 1.00 . A A .   5 SER HA   1 1 
        5  2518 1 1  5 SER HB2  H  -24.690   1.320  -2.938 1.00 . A A .   5 SER HB2  1 1 
        5  2519 1 1  5 SER HB3  H  -24.516  -0.195  -3.824 1.00 . A A .   5 SER HB3  1 1 
        5  2520 1 1  5 SER HG   H  -23.613  -0.812  -2.017 1.00 . A A .   5 SER HG   1 1 
        5  2521 1 1  5 SER N    N  -23.807   2.186  -5.186 1.00 . A A .   5 SER N    1 1 
        5  2522 1 1  5 SER O    O  -22.319  -0.943  -4.817 1.00 . A A .   5 SER O    1 1 
        5  2523 1 1  5 SER OG   O  -23.256   0.051  -2.238 1.00 . A A .   5 SER OG   1 1 
        5  2524 1 1  6 SER C    C  -19.493  -0.455  -6.510 1.00 . A A .   6 SER C    1 1 
        5  2525 1 1  6 SER CA   C  -20.888  -0.199  -7.071 1.00 . A A .   6 SER CA   1 1 
        5  2526 1 1  6 SER CB   C  -20.784   0.391  -8.479 1.00 . A A .   6 SER CB   1 1 
        5  2527 1 1  6 SER H    H  -21.664   1.655  -6.406 1.00 . A A .   6 SER H    1 1 
        5  2528 1 1  6 SER HA   H  -21.421  -1.137  -7.122 1.00 . A A .   6 SER HA   1 1 
        5  2529 1 1  6 SER HB2  H  -20.154  -0.242  -9.086 1.00 . A A .   6 SER HB2  1 1 
        5  2530 1 1  6 SER HB3  H  -21.770   0.445  -8.918 1.00 . A A .   6 SER HB3  1 1 
        5  2531 1 1  6 SER HG   H  -20.849   2.318  -8.827 1.00 . A A .   6 SER HG   1 1 
        5  2532 1 1  6 SER N    N  -21.641   0.697  -6.201 1.00 . A A .   6 SER N    1 1 
        5  2533 1 1  6 SER O    O  -18.501  -0.410  -7.237 1.00 . A A .   6 SER O    1 1 
        5  2534 1 1  6 SER OG   O  -20.227   1.693  -8.446 1.00 . A A .   6 SER OG   1 1 
        5  2535 1 1  7 GLY C    C  -17.584  -2.344  -4.933 1.00 . A A .   7 GLY C    1 1 
        5  2536 1 1  7 GLY CA   C  -18.147  -0.984  -4.572 1.00 . A A .   7 GLY CA   1 1 
        5  2537 1 1  7 GLY H    H  -20.248  -0.747  -4.680 1.00 . A A .   7 GLY H    1 1 
        5  2538 1 1  7 GLY HA2  H  -17.444  -0.223  -4.876 1.00 . A A .   7 GLY HA2  1 1 
        5  2539 1 1  7 GLY HA3  H  -18.276  -0.933  -3.501 1.00 . A A .   7 GLY HA3  1 1 
        5  2540 1 1  7 GLY N    N  -19.424  -0.725  -5.210 1.00 . A A .   7 GLY N    1 1 
        5  2541 1 1  7 GLY O    O  -17.854  -3.335  -4.255 1.00 . A A .   7 GLY O    1 1 
        5  2542 1 1  8 ALA C    C  -14.801  -3.820  -5.869 1.00 . A A .   8 ALA C    1 1 
        5  2543 1 1  8 ALA CA   C  -16.198  -3.642  -6.455 1.00 . A A .   8 ALA CA   1 1 
        5  2544 1 1  8 ALA CB   C  -16.145  -3.685  -7.975 1.00 . A A .   8 ALA CB   1 1 
        5  2545 1 1  8 ALA H    H  -16.622  -1.569  -6.505 1.00 . A A .   8 ALA H    1 1 
        5  2546 1 1  8 ALA HA   H  -16.825  -4.455  -6.118 1.00 . A A .   8 ALA HA   1 1 
        5  2547 1 1  8 ALA HB1  H  -16.219  -2.681  -8.366 1.00 . A A .   8 ALA HB1  1 1 
        5  2548 1 1  8 ALA HB2  H  -15.209  -4.126  -8.289 1.00 . A A .   8 ALA HB2  1 1 
        5  2549 1 1  8 ALA HB3  H  -16.966  -4.279  -8.347 1.00 . A A .   8 ALA HB3  1 1 
        5  2550 1 1  8 ALA N    N  -16.800  -2.393  -6.005 1.00 . A A .   8 ALA N    1 1 
        5  2551 1 1  8 ALA O    O  -13.900  -4.332  -6.532 1.00 . A A .   8 ALA O    1 1 
        5  2552 1 1  9 GLY C    C  -13.458  -3.587  -2.459 1.00 . A A .   9 GLY C    1 1 
        5  2553 1 1  9 GLY CA   C  -13.339  -3.513  -3.968 1.00 . A A .   9 GLY CA   1 1 
        5  2554 1 1  9 GLY H    H  -15.384  -2.992  -4.141 1.00 . A A .   9 GLY H    1 1 
        5  2555 1 1  9 GLY HA2  H  -12.849  -4.407  -4.324 1.00 . A A .   9 GLY HA2  1 1 
        5  2556 1 1  9 GLY HA3  H  -12.735  -2.656  -4.229 1.00 . A A .   9 GLY HA3  1 1 
        5  2557 1 1  9 GLY N    N  -14.629  -3.393  -4.622 1.00 . A A .   9 GLY N    1 1 
        5  2558 1 1  9 GLY O    O  -14.010  -2.685  -1.830 1.00 . A A .   9 GLY O    1 1 
        5  2559 1 1 10 GLU C    C  -11.645  -5.323   0.105 1.00 . A A .  10 GLU C    1 1 
        5  2560 1 1 10 GLU CA   C  -12.993  -4.852  -0.433 1.00 . A A .  10 GLU CA   1 1 
        5  2561 1 1 10 GLU CB   C  -14.082  -5.863  -0.068 1.00 . A A .  10 GLU CB   1 1 
        5  2562 1 1 10 GLU CD   C  -14.985  -8.202  -0.373 1.00 . A A .  10 GLU CD   1 1 
        5  2563 1 1 10 GLU CG   C  -13.822  -7.259  -0.611 1.00 . A A .  10 GLU CG   1 1 
        5  2564 1 1 10 GLU H    H  -12.511  -5.348  -2.433 1.00 . A A .  10 GLU H    1 1 
        5  2565 1 1 10 GLU HA   H  -13.234  -3.900   0.017 1.00 . A A .  10 GLU HA   1 1 
        5  2566 1 1 10 GLU HB2  H  -14.153  -5.925   1.008 1.00 . A A .  10 GLU HB2  1 1 
        5  2567 1 1 10 GLU HB3  H  -15.025  -5.516  -0.462 1.00 . A A .  10 GLU HB3  1 1 
        5  2568 1 1 10 GLU HG2  H  -13.645  -7.191  -1.674 1.00 . A A .  10 GLU HG2  1 1 
        5  2569 1 1 10 GLU HG3  H  -12.946  -7.663  -0.126 1.00 . A A .  10 GLU HG3  1 1 
        5  2570 1 1 10 GLU N    N  -12.939  -4.664  -1.878 1.00 . A A .  10 GLU N    1 1 
        5  2571 1 1 10 GLU O    O  -11.575  -6.249   0.913 1.00 . A A .  10 GLU O    1 1 
        5  2572 1 1 10 GLU OE1  O  -15.132  -8.690   0.767 1.00 . A A .  10 GLU OE1  1 1 
        5  2573 1 1 10 GLU OE2  O  -15.750  -8.453  -1.329 1.00 . A A .  10 GLU OE2  1 1 
        5  2574 1 1 11 LYS C    C   -8.836  -4.239   1.330 1.00 . A A .  11 LYS C    1 1 
        5  2575 1 1 11 LYS CA   C   -9.228  -5.028   0.085 1.00 . A A .  11 LYS CA   1 1 
        5  2576 1 1 11 LYS CB   C   -8.223  -4.764  -1.038 1.00 . A A .  11 LYS CB   1 1 
        5  2577 1 1 11 LYS CD   C   -8.171  -6.739  -2.589 1.00 . A A .  11 LYS CD   1 1 
        5  2578 1 1 11 LYS CE   C   -9.184  -7.752  -2.078 1.00 . A A .  11 LYS CE   1 1 
        5  2579 1 1 11 LYS CG   C   -8.658  -5.314  -2.385 1.00 . A A .  11 LYS CG   1 1 
        5  2580 1 1 11 LYS H    H  -10.695  -3.948  -0.992 1.00 . A A .  11 LYS H    1 1 
        5  2581 1 1 11 LYS HA   H   -9.220  -6.081   0.324 1.00 . A A .  11 LYS HA   1 1 
        5  2582 1 1 11 LYS HB2  H   -8.084  -3.697  -1.135 1.00 . A A .  11 LYS HB2  1 1 
        5  2583 1 1 11 LYS HB3  H   -7.279  -5.219  -0.774 1.00 . A A .  11 LYS HB3  1 1 
        5  2584 1 1 11 LYS HD2  H   -8.010  -6.908  -3.643 1.00 . A A .  11 LYS HD2  1 1 
        5  2585 1 1 11 LYS HD3  H   -7.240  -6.872  -2.055 1.00 . A A .  11 LYS HD3  1 1 
        5  2586 1 1 11 LYS HE2  H   -8.681  -8.693  -1.915 1.00 . A A .  11 LYS HE2  1 1 
        5  2587 1 1 11 LYS HE3  H   -9.590  -7.394  -1.143 1.00 . A A .  11 LYS HE3  1 1 
        5  2588 1 1 11 LYS HG2  H   -9.736  -5.302  -2.438 1.00 . A A .  11 LYS HG2  1 1 
        5  2589 1 1 11 LYS HG3  H   -8.250  -4.688  -3.167 1.00 . A A .  11 LYS HG3  1 1 
        5  2590 1 1 11 LYS HZ1  H  -10.034  -7.586  -3.978 1.00 . A A .  11 LYS HZ1  1 1 
        5  2591 1 1 11 LYS HZ2  H  -11.152  -7.465  -2.714 1.00 . A A .  11 LYS HZ2  1 1 
        5  2592 1 1 11 LYS HZ3  H  -10.510  -8.973  -3.133 1.00 . A A .  11 LYS HZ3  1 1 
        5  2593 1 1 11 LYS N    N  -10.575  -4.678  -0.349 1.00 . A A .  11 LYS N    1 1 
        5  2594 1 1 11 LYS NZ   N  -10.298  -7.958  -3.044 1.00 . A A .  11 LYS NZ   1 1 
        5  2595 1 1 11 LYS O    O   -9.193  -3.072   1.493 1.00 . A A .  11 LYS O    1 1 
        5  2596 1 1 12 PRO C    C   -6.574  -3.184   3.229 1.00 . A A .  12 PRO C    1 1 
        5  2597 1 1 12 PRO CA   C   -7.622  -4.264   3.474 1.00 . A A .  12 PRO CA   1 1 
        5  2598 1 1 12 PRO CB   C   -7.013  -5.433   4.253 1.00 . A A .  12 PRO CB   1 1 
        5  2599 1 1 12 PRO CD   C   -7.618  -6.280   2.101 1.00 . A A .  12 PRO CD   1 1 
        5  2600 1 1 12 PRO CG   C   -6.609  -6.415   3.208 1.00 . A A .  12 PRO CG   1 1 
        5  2601 1 1 12 PRO HA   H   -8.445  -3.846   4.036 1.00 . A A .  12 PRO HA   1 1 
        5  2602 1 1 12 PRO HB2  H   -6.161  -5.086   4.820 1.00 . A A .  12 PRO HB2  1 1 
        5  2603 1 1 12 PRO HB3  H   -7.752  -5.849   4.921 1.00 . A A .  12 PRO HB3  1 1 
        5  2604 1 1 12 PRO HD2  H   -7.150  -6.443   1.141 1.00 . A A .  12 PRO HD2  1 1 
        5  2605 1 1 12 PRO HD3  H   -8.434  -6.972   2.247 1.00 . A A .  12 PRO HD3  1 1 
        5  2606 1 1 12 PRO HG2  H   -5.621  -6.180   2.845 1.00 . A A .  12 PRO HG2  1 1 
        5  2607 1 1 12 PRO HG3  H   -6.633  -7.415   3.615 1.00 . A A .  12 PRO HG3  1 1 
        5  2608 1 1 12 PRO N    N   -8.081  -4.888   2.230 1.00 . A A .  12 PRO N    1 1 
        5  2609 1 1 12 PRO O    O   -6.646  -2.095   3.800 1.00 . A A .  12 PRO O    1 1 
        5  2610 1 1 13 TYR C    C   -5.021  -1.498   1.062 1.00 . A A .  13 TYR C    1 1 
        5  2611 1 1 13 TYR CA   C   -4.538  -2.547   2.059 1.00 . A A .  13 TYR CA   1 1 
        5  2612 1 1 13 TYR CB   C   -3.325  -3.285   1.492 1.00 . A A .  13 TYR CB   1 1 
        5  2613 1 1 13 TYR CD1  C   -2.319  -4.510   3.458 1.00 . A A .  13 TYR CD1  1 1 
        5  2614 1 1 13 TYR CD2  C   -3.330  -5.800   1.728 1.00 . A A .  13 TYR CD2  1 1 
        5  2615 1 1 13 TYR CE1  C   -2.005  -5.667   4.144 1.00 . A A .  13 TYR CE1  1 1 
        5  2616 1 1 13 TYR CE2  C   -3.022  -6.962   2.407 1.00 . A A .  13 TYR CE2  1 1 
        5  2617 1 1 13 TYR CG   C   -2.985  -4.555   2.240 1.00 . A A .  13 TYR CG   1 1 
        5  2618 1 1 13 TYR CZ   C   -2.359  -6.891   3.615 1.00 . A A .  13 TYR CZ   1 1 
        5  2619 1 1 13 TYR H    H   -5.599  -4.375   1.955 1.00 . A A .  13 TYR H    1 1 
        5  2620 1 1 13 TYR HA   H   -4.250  -2.051   2.975 1.00 . A A .  13 TYR HA   1 1 
        5  2621 1 1 13 TYR HB2  H   -3.521  -3.549   0.464 1.00 . A A .  13 TYR HB2  1 1 
        5  2622 1 1 13 TYR HB3  H   -2.464  -2.635   1.534 1.00 . A A .  13 TYR HB3  1 1 
        5  2623 1 1 13 TYR HD1  H   -2.044  -3.550   3.870 1.00 . A A .  13 TYR HD1  1 1 
        5  2624 1 1 13 TYR HD2  H   -3.849  -5.852   0.781 1.00 . A A .  13 TYR HD2  1 1 
        5  2625 1 1 13 TYR HE1  H   -1.487  -5.611   5.090 1.00 . A A .  13 TYR HE1  1 1 
        5  2626 1 1 13 TYR HE2  H   -3.298  -7.921   1.993 1.00 . A A .  13 TYR HE2  1 1 
        5  2627 1 1 13 TYR HH   H   -1.217  -8.396   3.971 1.00 . A A .  13 TYR HH   1 1 
        5  2628 1 1 13 TYR N    N   -5.602  -3.491   2.378 1.00 . A A .  13 TYR N    1 1 
        5  2629 1 1 13 TYR O    O   -5.303  -1.808  -0.095 1.00 . A A .  13 TYR O    1 1 
        5  2630 1 1 13 TYR OH   O   -2.050  -8.046   4.296 1.00 . A A .  13 TYR OH   1 1 
        5  2631 1 1 14 GLY C    C   -4.826   2.122   0.919 1.00 . A A .  14 GLY C    1 1 
        5  2632 1 1 14 GLY CA   C   -5.563   0.823   0.657 1.00 . A A .  14 GLY CA   1 1 
        5  2633 1 1 14 GLY H    H   -4.877  -0.065   2.453 1.00 . A A .  14 GLY H    1 1 
        5  2634 1 1 14 GLY HA2  H   -5.407   0.534  -0.371 1.00 . A A .  14 GLY HA2  1 1 
        5  2635 1 1 14 GLY HA3  H   -6.619   0.983   0.820 1.00 . A A .  14 GLY HA3  1 1 
        5  2636 1 1 14 GLY N    N   -5.115  -0.253   1.521 1.00 . A A .  14 GLY N    1 1 
        5  2637 1 1 14 GLY O    O   -4.819   2.624   2.043 1.00 . A A .  14 GLY O    1 1 
        5  2638 1 1 15 CYS C    C   -4.372   5.054   0.439 1.00 . A A .  15 CYS C    1 1 
        5  2639 1 1 15 CYS CA   C   -3.457   3.913   0.002 1.00 . A A .  15 CYS CA   1 1 
        5  2640 1 1 15 CYS CB   C   -2.786   4.263  -1.327 1.00 . A A .  15 CYS CB   1 1 
        5  2641 1 1 15 CYS H    H   -4.245   2.218  -0.992 1.00 . A A .  15 CYS H    1 1 
        5  2642 1 1 15 CYS HA   H   -2.695   3.772   0.754 1.00 . A A .  15 CYS HA   1 1 
        5  2643 1 1 15 CYS HB2  H   -2.090   3.479  -1.588 1.00 . A A .  15 CYS HB2  1 1 
        5  2644 1 1 15 CYS HB3  H   -3.542   4.336  -2.095 1.00 . A A .  15 CYS HB3  1 1 
        5  2645 1 1 15 CYS N    N   -4.203   2.666  -0.120 1.00 . A A .  15 CYS N    1 1 
        5  2646 1 1 15 CYS O    O   -5.559   5.070   0.113 1.00 . A A .  15 CYS O    1 1 
        5  2647 1 1 15 CYS SG   S   -1.865   5.835  -1.304 1.00 . A A .  15 CYS SG   1 1 
        5  2648 1 1 16 SER C    C   -4.078   8.444   1.031 1.00 . A A .  16 SER C    1 1 
        5  2649 1 1 16 SER CA   C   -4.577   7.148   1.662 1.00 . A A .  16 SER CA   1 1 
        5  2650 1 1 16 SER CB   C   -4.484   7.242   3.187 1.00 . A A .  16 SER CB   1 1 
        5  2651 1 1 16 SER H    H   -2.860   5.936   1.405 1.00 . A A .  16 SER H    1 1 
        5  2652 1 1 16 SER HA   H   -5.609   6.999   1.382 1.00 . A A .  16 SER HA   1 1 
        5  2653 1 1 16 SER HB2  H   -3.458   7.103   3.491 1.00 . A A .  16 SER HB2  1 1 
        5  2654 1 1 16 SER HB3  H   -4.827   8.215   3.506 1.00 . A A .  16 SER HB3  1 1 
        5  2655 1 1 16 SER HG   H   -5.784   6.645   4.526 1.00 . A A .  16 SER HG   1 1 
        5  2656 1 1 16 SER N    N   -3.811   6.005   1.178 1.00 . A A .  16 SER N    1 1 
        5  2657 1 1 16 SER O    O   -4.862   9.346   0.738 1.00 . A A .  16 SER O    1 1 
        5  2658 1 1 16 SER OG   O   -5.283   6.250   3.808 1.00 . A A .  16 SER OG   1 1 
        5  2659 1 1 17 GLU C    C   -2.950  10.168  -0.997 1.00 . A A .  17 GLU C    1 1 
        5  2660 1 1 17 GLU CA   C   -2.162   9.713   0.228 1.00 . A A .  17 GLU CA   1 1 
        5  2661 1 1 17 GLU CB   C   -0.710   9.430  -0.162 1.00 . A A .  17 GLU CB   1 1 
        5  2662 1 1 17 GLU CD   C    0.093  10.692   1.873 1.00 . A A .  17 GLU CD   1 1 
        5  2663 1 1 17 GLU CG   C    0.252   9.453   1.014 1.00 . A A .  17 GLU CG   1 1 
        5  2664 1 1 17 GLU H    H   -2.194   7.775   1.079 1.00 . A A .  17 GLU H    1 1 
        5  2665 1 1 17 GLU HA   H   -2.180  10.501   0.965 1.00 . A A .  17 GLU HA   1 1 
        5  2666 1 1 17 GLU HB2  H   -0.657   8.456  -0.626 1.00 . A A .  17 GLU HB2  1 1 
        5  2667 1 1 17 GLU HB3  H   -0.390  10.176  -0.875 1.00 . A A .  17 GLU HB3  1 1 
        5  2668 1 1 17 GLU HG2  H    0.071   8.583   1.627 1.00 . A A .  17 GLU HG2  1 1 
        5  2669 1 1 17 GLU HG3  H    1.263   9.422   0.636 1.00 . A A .  17 GLU HG3  1 1 
        5  2670 1 1 17 GLU N    N   -2.767   8.527   0.824 1.00 . A A .  17 GLU N    1 1 
        5  2671 1 1 17 GLU O    O   -3.392  11.314  -1.075 1.00 . A A .  17 GLU O    1 1 
        5  2672 1 1 17 GLU OE1  O    0.754  11.709   1.577 1.00 . A A .  17 GLU OE1  1 1 
        5  2673 1 1 17 GLU OE2  O   -0.693  10.644   2.843 1.00 . A A .  17 GLU OE2  1 1 
        5  2674 1 1 18 CYS C    C   -5.214   8.874  -3.183 1.00 . A A .  18 CYS C    1 1 
        5  2675 1 1 18 CYS CA   C   -3.855   9.567  -3.176 1.00 . A A .  18 CYS CA   1 1 
        5  2676 1 1 18 CYS CB   C   -3.045   9.139  -4.401 1.00 . A A .  18 CYS CB   1 1 
        5  2677 1 1 18 CYS H    H   -2.745   8.363  -1.834 1.00 . A A .  18 CYS H    1 1 
        5  2678 1 1 18 CYS HA   H   -4.009  10.635  -3.212 1.00 . A A .  18 CYS HA   1 1 
        5  2679 1 1 18 CYS HB2  H   -3.475   9.591  -5.283 1.00 . A A .  18 CYS HB2  1 1 
        5  2680 1 1 18 CYS HB3  H   -2.027   9.481  -4.288 1.00 . A A .  18 CYS HB3  1 1 
        5  2681 1 1 18 CYS N    N   -3.122   9.261  -1.953 1.00 . A A .  18 CYS N    1 1 
        5  2682 1 1 18 CYS O    O   -6.203   9.428  -3.660 1.00 . A A .  18 CYS O    1 1 
        5  2683 1 1 18 CYS SG   S   -2.999   7.338  -4.670 1.00 . A A .  18 CYS SG   1 1 
        5  2684 1 1 19 GLY C    C   -6.524   5.769  -3.605 1.00 . A A .  19 GLY C    1 1 
        5  2685 1 1 19 GLY CA   C   -6.496   6.907  -2.604 1.00 . A A .  19 GLY CA   1 1 
        5  2686 1 1 19 GLY H    H   -4.434   7.264  -2.284 1.00 . A A .  19 GLY H    1 1 
        5  2687 1 1 19 GLY HA2  H   -6.624   6.503  -1.611 1.00 . A A .  19 GLY HA2  1 1 
        5  2688 1 1 19 GLY HA3  H   -7.316   7.578  -2.817 1.00 . A A .  19 GLY HA3  1 1 
        5  2689 1 1 19 GLY N    N   -5.254   7.657  -2.649 1.00 . A A .  19 GLY N    1 1 
        5  2690 1 1 19 GLY O    O   -7.095   5.898  -4.688 1.00 . A A .  19 GLY O    1 1 
        5  2691 1 1 20 LYS C    C   -5.996   2.196  -3.312 1.00 . A A .  20 LYS C    1 1 
        5  2692 1 1 20 LYS CA   C   -5.857   3.485  -4.117 1.00 . A A .  20 LYS CA   1 1 
        5  2693 1 1 20 LYS CB   C   -4.548   3.465  -4.909 1.00 . A A .  20 LYS CB   1 1 
        5  2694 1 1 20 LYS CD   C   -3.510   3.826  -7.167 1.00 . A A .  20 LYS CD   1 1 
        5  2695 1 1 20 LYS CE   C   -3.262   4.884  -8.232 1.00 . A A .  20 LYS CE   1 1 
        5  2696 1 1 20 LYS CG   C   -4.612   4.246  -6.210 1.00 . A A .  20 LYS CG   1 1 
        5  2697 1 1 20 LYS H    H   -5.466   4.609  -2.367 1.00 . A A .  20 LYS H    1 1 
        5  2698 1 1 20 LYS HA   H   -6.684   3.554  -4.808 1.00 . A A .  20 LYS HA   1 1 
        5  2699 1 1 20 LYS HB2  H   -3.765   3.889  -4.297 1.00 . A A .  20 LYS HB2  1 1 
        5  2700 1 1 20 LYS HB3  H   -4.296   2.440  -5.140 1.00 . A A .  20 LYS HB3  1 1 
        5  2701 1 1 20 LYS HD2  H   -2.598   3.673  -6.609 1.00 . A A .  20 LYS HD2  1 1 
        5  2702 1 1 20 LYS HD3  H   -3.797   2.902  -7.650 1.00 . A A .  20 LYS HD3  1 1 
        5  2703 1 1 20 LYS HE2  H   -3.110   5.835  -7.746 1.00 . A A .  20 LYS HE2  1 1 
        5  2704 1 1 20 LYS HE3  H   -2.374   4.617  -8.786 1.00 . A A .  20 LYS HE3  1 1 
        5  2705 1 1 20 LYS HG2  H   -5.568   4.069  -6.679 1.00 . A A .  20 LYS HG2  1 1 
        5  2706 1 1 20 LYS HG3  H   -4.505   5.300  -5.992 1.00 . A A .  20 LYS HG3  1 1 
        5  2707 1 1 20 LYS HZ1  H   -4.267   4.363  -9.987 1.00 . A A .  20 LYS HZ1  1 1 
        5  2708 1 1 20 LYS HZ2  H   -4.486   5.976  -9.525 1.00 . A A .  20 LYS HZ2  1 1 
        5  2709 1 1 20 LYS HZ3  H   -5.293   4.742  -8.697 1.00 . A A .  20 LYS HZ3  1 1 
        5  2710 1 1 20 LYS N    N   -5.903   4.651  -3.244 1.00 . A A .  20 LYS N    1 1 
        5  2711 1 1 20 LYS NZ   N   -4.407   4.999  -9.176 1.00 . A A .  20 LYS NZ   1 1 
        5  2712 1 1 20 LYS O    O   -6.153   2.230  -2.092 1.00 . A A .  20 LYS O    1 1 
        5  2713 1 1 21 ALA C    C   -5.295  -1.309  -4.129 1.00 . A A .  21 ALA C    1 1 
        5  2714 1 1 21 ALA CA   C   -6.051  -0.236  -3.352 1.00 . A A .  21 ALA CA   1 1 
        5  2715 1 1 21 ALA CB   C   -7.514  -0.623  -3.201 1.00 . A A .  21 ALA CB   1 1 
        5  2716 1 1 21 ALA H    H   -5.809   1.101  -4.974 1.00 . A A .  21 ALA H    1 1 
        5  2717 1 1 21 ALA HA   H   -5.622  -0.153  -2.363 1.00 . A A .  21 ALA HA   1 1 
        5  2718 1 1 21 ALA HB1  H   -7.584  -1.657  -2.899 1.00 . A A .  21 ALA HB1  1 1 
        5  2719 1 1 21 ALA HB2  H   -7.976   0.004  -2.452 1.00 . A A .  21 ALA HB2  1 1 
        5  2720 1 1 21 ALA HB3  H   -8.021  -0.489  -4.145 1.00 . A A .  21 ALA HB3  1 1 
        5  2721 1 1 21 ALA N    N   -5.935   1.063  -4.003 1.00 . A A .  21 ALA N    1 1 
        5  2722 1 1 21 ALA O    O   -4.854  -1.079  -5.255 1.00 . A A .  21 ALA O    1 1 
        5  2723 1 1 22 PHE C    C   -4.908  -4.926  -3.583 1.00 . A A .  22 PHE C    1 1 
        5  2724 1 1 22 PHE CA   C   -4.445  -3.589  -4.155 1.00 . A A .  22 PHE CA   1 1 
        5  2725 1 1 22 PHE CB   C   -2.934  -3.437  -3.966 1.00 . A A .  22 PHE CB   1 1 
        5  2726 1 1 22 PHE CD1  C   -2.547  -0.995  -3.540 1.00 . A A .  22 PHE CD1  1 1 
        5  2727 1 1 22 PHE CD2  C   -1.786  -1.919  -5.602 1.00 . A A .  22 PHE CD2  1 1 
        5  2728 1 1 22 PHE CE1  C   -2.067   0.246  -3.915 1.00 . A A .  22 PHE CE1  1 1 
        5  2729 1 1 22 PHE CE2  C   -1.304  -0.681  -5.982 1.00 . A A .  22 PHE CE2  1 1 
        5  2730 1 1 22 PHE CG   C   -2.412  -2.090  -4.377 1.00 . A A .  22 PHE CG   1 1 
        5  2731 1 1 22 PHE CZ   C   -1.445   0.403  -5.138 1.00 . A A .  22 PHE CZ   1 1 
        5  2732 1 1 22 PHE H    H   -5.523  -2.604  -2.623 1.00 . A A .  22 PHE H    1 1 
        5  2733 1 1 22 PHE HA   H   -4.672  -3.565  -5.210 1.00 . A A .  22 PHE HA   1 1 
        5  2734 1 1 22 PHE HB2  H   -2.692  -3.582  -2.924 1.00 . A A .  22 PHE HB2  1 1 
        5  2735 1 1 22 PHE HB3  H   -2.428  -4.185  -4.557 1.00 . A A .  22 PHE HB3  1 1 
        5  2736 1 1 22 PHE HD1  H   -3.033  -1.117  -2.582 1.00 . A A .  22 PHE HD1  1 1 
        5  2737 1 1 22 PHE HD2  H   -1.676  -2.766  -6.264 1.00 . A A .  22 PHE HD2  1 1 
        5  2738 1 1 22 PHE HE1  H   -2.179   1.092  -3.252 1.00 . A A .  22 PHE HE1  1 1 
        5  2739 1 1 22 PHE HE2  H   -0.819  -0.561  -6.939 1.00 . A A .  22 PHE HE2  1 1 
        5  2740 1 1 22 PHE HZ   H   -1.069   1.371  -5.433 1.00 . A A .  22 PHE HZ   1 1 
        5  2741 1 1 22 PHE N    N   -5.149  -2.481  -3.520 1.00 . A A .  22 PHE N    1 1 
        5  2742 1 1 22 PHE O    O   -5.743  -4.972  -2.680 1.00 . A A .  22 PHE O    1 1 
        5  2743 1 1 23 SER C    C   -3.815  -7.798  -2.517 1.00 . A A .  23 SER C    1 1 
        5  2744 1 1 23 SER CA   C   -4.718  -7.352  -3.664 1.00 . A A .  23 SER CA   1 1 
        5  2745 1 1 23 SER CB   C   -4.621  -8.348  -4.821 1.00 . A A .  23 SER CB   1 1 
        5  2746 1 1 23 SER H    H   -3.698  -5.912  -4.834 1.00 . A A .  23 SER H    1 1 
        5  2747 1 1 23 SER HA   H   -5.738  -7.320  -3.311 1.00 . A A .  23 SER HA   1 1 
        5  2748 1 1 23 SER HB2  H   -3.842  -8.034  -5.498 1.00 . A A .  23 SER HB2  1 1 
        5  2749 1 1 23 SER HB3  H   -4.386  -9.327  -4.430 1.00 . A A .  23 SER HB3  1 1 
        5  2750 1 1 23 SER HG   H   -5.667  -8.388  -6.477 1.00 . A A .  23 SER HG   1 1 
        5  2751 1 1 23 SER N    N   -4.359  -6.013  -4.117 1.00 . A A .  23 SER N    1 1 
        5  2752 1 1 23 SER O    O   -4.287  -8.321  -1.508 1.00 . A A .  23 SER O    1 1 
        5  2753 1 1 23 SER OG   O   -5.844  -8.422  -5.534 1.00 . A A .  23 SER OG   1 1 
        5  2754 1 1 24 SER C    C   -0.837  -6.741  -1.095 1.00 . A A .  24 SER C    1 1 
        5  2755 1 1 24 SER CA   C   -1.542  -7.969  -1.663 1.00 . A A .  24 SER CA   1 1 
        5  2756 1 1 24 SER CB   C   -0.513  -8.938  -2.248 1.00 . A A .  24 SER CB   1 1 
        5  2757 1 1 24 SER H    H   -2.198  -7.165  -3.508 1.00 . A A .  24 SER H    1 1 
        5  2758 1 1 24 SER HA   H   -2.076  -8.464  -0.865 1.00 . A A .  24 SER HA   1 1 
        5  2759 1 1 24 SER HB2  H    0.105  -8.415  -2.962 1.00 . A A .  24 SER HB2  1 1 
        5  2760 1 1 24 SER HB3  H    0.106  -9.325  -1.452 1.00 . A A .  24 SER HB3  1 1 
        5  2761 1 1 24 SER HG   H   -0.495 -10.692  -3.120 1.00 . A A .  24 SER HG   1 1 
        5  2762 1 1 24 SER N    N   -2.513  -7.586  -2.681 1.00 . A A .  24 SER N    1 1 
        5  2763 1 1 24 SER O    O   -0.932  -5.645  -1.648 1.00 . A A .  24 SER O    1 1 
        5  2764 1 1 24 SER OG   O   -1.148 -10.023  -2.902 1.00 . A A .  24 SER OG   1 1 
        5  2765 1 1 25 LYS C    C    1.758  -5.373  -0.213 1.00 . A A .  25 LYS C    1 1 
        5  2766 1 1 25 LYS CA   C    0.596  -5.843   0.656 1.00 . A A .  25 LYS CA   1 1 
        5  2767 1 1 25 LYS CB   C    1.116  -6.288   2.025 1.00 . A A .  25 LYS CB   1 1 
        5  2768 1 1 25 LYS CD   C    2.505  -5.739   4.044 1.00 . A A .  25 LYS CD   1 1 
        5  2769 1 1 25 LYS CE   C    2.618  -4.653   5.104 1.00 . A A .  25 LYS CE   1 1 
        5  2770 1 1 25 LYS CG   C    1.884  -5.206   2.764 1.00 . A A .  25 LYS CG   1 1 
        5  2771 1 1 25 LYS H    H   -0.090  -7.830   0.406 1.00 . A A .  25 LYS H    1 1 
        5  2772 1 1 25 LYS HA   H   -0.092  -5.022   0.791 1.00 . A A .  25 LYS HA   1 1 
        5  2773 1 1 25 LYS HB2  H    0.277  -6.586   2.636 1.00 . A A .  25 LYS HB2  1 1 
        5  2774 1 1 25 LYS HB3  H    1.771  -7.136   1.889 1.00 . A A .  25 LYS HB3  1 1 
        5  2775 1 1 25 LYS HD2  H    1.888  -6.538   4.428 1.00 . A A .  25 LYS HD2  1 1 
        5  2776 1 1 25 LYS HD3  H    3.493  -6.119   3.824 1.00 . A A .  25 LYS HD3  1 1 
        5  2777 1 1 25 LYS HE2  H    3.432  -3.995   4.841 1.00 . A A .  25 LYS HE2  1 1 
        5  2778 1 1 25 LYS HE3  H    1.695  -4.093   5.125 1.00 . A A .  25 LYS HE3  1 1 
        5  2779 1 1 25 LYS HG2  H    2.670  -4.833   2.124 1.00 . A A .  25 LYS HG2  1 1 
        5  2780 1 1 25 LYS HG3  H    1.206  -4.401   3.012 1.00 . A A .  25 LYS HG3  1 1 
        5  2781 1 1 25 LYS HZ1  H    3.312  -4.506   7.068 1.00 . A A .  25 LYS HZ1  1 1 
        5  2782 1 1 25 LYS HZ2  H    3.508  -6.041   6.385 1.00 . A A .  25 LYS HZ2  1 1 
        5  2783 1 1 25 LYS HZ3  H    1.977  -5.529   6.888 1.00 . A A .  25 LYS HZ3  1 1 
        5  2784 1 1 25 LYS N    N   -0.128  -6.933   0.012 1.00 . A A .  25 LYS N    1 1 
        5  2785 1 1 25 LYS NZ   N    2.872  -5.222   6.456 1.00 . A A .  25 LYS NZ   1 1 
        5  2786 1 1 25 LYS O    O    1.850  -4.196  -0.559 1.00 . A A .  25 LYS O    1 1 
        5  2787 1 1 26 SER C    C    3.431  -4.970  -2.472 1.00 . A A .  26 SER C    1 1 
        5  2788 1 1 26 SER CA   C    3.799  -5.982  -1.391 1.00 . A A .  26 SER CA   1 1 
        5  2789 1 1 26 SER CB   C    4.360  -7.252  -2.034 1.00 . A A .  26 SER CB   1 1 
        5  2790 1 1 26 SER H    H    2.514  -7.224  -0.256 1.00 . A A .  26 SER H    1 1 
        5  2791 1 1 26 SER HA   H    4.554  -5.549  -0.751 1.00 . A A .  26 SER HA   1 1 
        5  2792 1 1 26 SER HB2  H    3.547  -7.840  -2.432 1.00 . A A .  26 SER HB2  1 1 
        5  2793 1 1 26 SER HB3  H    5.033  -6.979  -2.834 1.00 . A A .  26 SER HB3  1 1 
        5  2794 1 1 26 SER HG   H    5.979  -7.732  -1.040 1.00 . A A .  26 SER HG   1 1 
        5  2795 1 1 26 SER N    N    2.642  -6.302  -0.563 1.00 . A A .  26 SER N    1 1 
        5  2796 1 1 26 SER O    O    4.096  -3.946  -2.632 1.00 . A A .  26 SER O    1 1 
        5  2797 1 1 26 SER OG   O    5.068  -8.033  -1.087 1.00 . A A .  26 SER OG   1 1 
        5  2798 1 1 27 TYR C    C    1.750  -2.954  -3.774 1.00 . A A .  27 TYR C    1 1 
        5  2799 1 1 27 TYR CA   C    1.912  -4.384  -4.280 1.00 . A A .  27 TYR CA   1 1 
        5  2800 1 1 27 TYR CB   C    0.586  -4.887  -4.854 1.00 . A A .  27 TYR CB   1 1 
        5  2801 1 1 27 TYR CD1  C    1.647  -6.039  -6.835 1.00 . A A .  27 TYR CD1  1 1 
        5  2802 1 1 27 TYR CD2  C   -0.024  -7.218  -5.611 1.00 . A A .  27 TYR CD2  1 1 
        5  2803 1 1 27 TYR CE1  C    1.789  -7.116  -7.687 1.00 . A A .  27 TYR CE1  1 1 
        5  2804 1 1 27 TYR CE2  C    0.112  -8.300  -6.458 1.00 . A A .  27 TYR CE2  1 1 
        5  2805 1 1 27 TYR CG   C    0.739  -6.069  -5.784 1.00 . A A .  27 TYR CG   1 1 
        5  2806 1 1 27 TYR CZ   C    1.020  -8.245  -7.495 1.00 . A A .  27 TYR CZ   1 1 
        5  2807 1 1 27 TYR H    H    1.879  -6.096  -3.036 1.00 . A A .  27 TYR H    1 1 
        5  2808 1 1 27 TYR HA   H    2.658  -4.395  -5.061 1.00 . A A .  27 TYR HA   1 1 
        5  2809 1 1 27 TYR HB2  H   -0.059  -5.186  -4.042 1.00 . A A .  27 TYR HB2  1 1 
        5  2810 1 1 27 TYR HB3  H    0.115  -4.088  -5.407 1.00 . A A .  27 TYR HB3  1 1 
        5  2811 1 1 27 TYR HD1  H    2.249  -5.154  -6.982 1.00 . A A .  27 TYR HD1  1 1 
        5  2812 1 1 27 TYR HD2  H   -0.735  -7.258  -4.798 1.00 . A A .  27 TYR HD2  1 1 
        5  2813 1 1 27 TYR HE1  H    2.501  -7.073  -8.499 1.00 . A A .  27 TYR HE1  1 1 
        5  2814 1 1 27 TYR HE2  H   -0.491  -9.184  -6.308 1.00 . A A .  27 TYR HE2  1 1 
        5  2815 1 1 27 TYR HH   H    0.803  -9.097  -9.204 1.00 . A A .  27 TYR HH   1 1 
        5  2816 1 1 27 TYR N    N    2.368  -5.265  -3.212 1.00 . A A .  27 TYR N    1 1 
        5  2817 1 1 27 TYR O    O    2.129  -1.997  -4.450 1.00 . A A .  27 TYR O    1 1 
        5  2818 1 1 27 TYR OH   O    1.160  -9.321  -8.341 1.00 . A A .  27 TYR OH   1 1 
        5  2819 1 1 28 LEU C    C    2.297  -0.779  -1.772 1.00 . A A .  28 LEU C    1 1 
        5  2820 1 1 28 LEU CA   C    0.971  -1.503  -1.981 1.00 . A A .  28 LEU CA   1 1 
        5  2821 1 1 28 LEU CB   C    0.237  -1.642  -0.647 1.00 . A A .  28 LEU CB   1 1 
        5  2822 1 1 28 LEU CD1  C   -0.805   0.637  -0.618 1.00 . A A .  28 LEU CD1  1 1 
        5  2823 1 1 28 LEU CD2  C   -0.570  -0.654   1.511 1.00 . A A .  28 LEU CD2  1 1 
        5  2824 1 1 28 LEU CG   C    0.052  -0.354   0.155 1.00 . A A .  28 LEU CG   1 1 
        5  2825 1 1 28 LEU H    H    0.902  -3.615  -2.089 1.00 . A A .  28 LEU H    1 1 
        5  2826 1 1 28 LEU HA   H    0.362  -0.924  -2.660 1.00 . A A .  28 LEU HA   1 1 
        5  2827 1 1 28 LEU HB2  H   -0.742  -2.049  -0.849 1.00 . A A .  28 LEU HB2  1 1 
        5  2828 1 1 28 LEU HB3  H    0.794  -2.337  -0.035 1.00 . A A .  28 LEU HB3  1 1 
        5  2829 1 1 28 LEU HD11 H   -1.844   0.484  -0.371 1.00 . A A .  28 LEU HD11 1 1 
        5  2830 1 1 28 LEU HD12 H   -0.660   0.488  -1.677 1.00 . A A .  28 LEU HD12 1 1 
        5  2831 1 1 28 LEU HD13 H   -0.517   1.644  -0.353 1.00 . A A .  28 LEU HD13 1 1 
        5  2832 1 1 28 LEU HD21 H   -1.643  -0.708   1.412 1.00 . A A .  28 LEU HD21 1 1 
        5  2833 1 1 28 LEU HD22 H   -0.311   0.130   2.207 1.00 . A A .  28 LEU HD22 1 1 
        5  2834 1 1 28 LEU HD23 H   -0.194  -1.599   1.878 1.00 . A A .  28 LEU HD23 1 1 
        5  2835 1 1 28 LEU HG   H    1.018   0.101   0.323 1.00 . A A .  28 LEU HG   1 1 
        5  2836 1 1 28 LEU N    N    1.184  -2.816  -2.580 1.00 . A A .  28 LEU N    1 1 
        5  2837 1 1 28 LEU O    O    2.421   0.409  -2.073 1.00 . A A .  28 LEU O    1 1 
        5  2838 1 1 29 ILE C    C    5.182  -0.316  -2.280 1.00 . A A .  29 ILE C    1 1 
        5  2839 1 1 29 ILE CA   C    4.603  -0.929  -1.010 1.00 . A A .  29 ILE CA   1 1 
        5  2840 1 1 29 ILE CB   C    5.584  -1.985  -0.470 1.00 . A A .  29 ILE CB   1 1 
        5  2841 1 1 29 ILE CD1  C    5.824  -3.771   1.328 1.00 . A A .  29 ILE CD1  1 1 
        5  2842 1 1 29 ILE CG1  C    5.099  -2.522   0.879 1.00 . A A .  29 ILE CG1  1 1 
        5  2843 1 1 29 ILE CG2  C    6.980  -1.394  -0.340 1.00 . A A .  29 ILE CG2  1 1 
        5  2844 1 1 29 ILE H    H    3.125  -2.443  -1.037 1.00 . A A .  29 ILE H    1 1 
        5  2845 1 1 29 ILE HA   H    4.495  -0.153  -0.265 1.00 . A A .  29 ILE HA   1 1 
        5  2846 1 1 29 ILE HB   H    5.629  -2.799  -1.178 1.00 . A A .  29 ILE HB   1 1 
        5  2847 1 1 29 ILE HD11 H    5.693  -3.900   2.393 1.00 . A A .  29 ILE HD11 1 1 
        5  2848 1 1 29 ILE HD12 H    5.420  -4.629   0.811 1.00 . A A .  29 ILE HD12 1 1 
        5  2849 1 1 29 ILE HD13 H    6.876  -3.678   1.104 1.00 . A A .  29 ILE HD13 1 1 
        5  2850 1 1 29 ILE HG12 H    5.245  -1.765   1.633 1.00 . A A .  29 ILE HG12 1 1 
        5  2851 1 1 29 ILE HG13 H    4.047  -2.756   0.807 1.00 . A A .  29 ILE HG13 1 1 
        5  2852 1 1 29 ILE HG21 H    6.906  -0.328  -0.182 1.00 . A A .  29 ILE HG21 1 1 
        5  2853 1 1 29 ILE HG22 H    7.486  -1.847   0.500 1.00 . A A .  29 ILE HG22 1 1 
        5  2854 1 1 29 ILE HG23 H    7.539  -1.587  -1.243 1.00 . A A .  29 ILE HG23 1 1 
        5  2855 1 1 29 ILE N    N    3.285  -1.502  -1.256 1.00 . A A .  29 ILE N    1 1 
        5  2856 1 1 29 ILE O    O    5.727   0.788  -2.256 1.00 . A A .  29 ILE O    1 1 
        5  2857 1 1 30 ILE C    C    4.903   0.750  -5.072 1.00 . A A .  30 ILE C    1 1 
        5  2858 1 1 30 ILE CA   C    5.566  -0.563  -4.670 1.00 . A A .  30 ILE CA   1 1 
        5  2859 1 1 30 ILE CB   C    5.340  -1.602  -5.785 1.00 . A A .  30 ILE CB   1 1 
        5  2860 1 1 30 ILE CD1  C    5.432  -4.108  -6.219 1.00 . A A .  30 ILE CD1  1 1 
        5  2861 1 1 30 ILE CG1  C    5.933  -2.953  -5.380 1.00 . A A .  30 ILE CG1  1 1 
        5  2862 1 1 30 ILE CG2  C    5.953  -1.119  -7.091 1.00 . A A .  30 ILE CG2  1 1 
        5  2863 1 1 30 ILE H    H    4.613  -1.910  -3.344 1.00 . A A .  30 ILE H    1 1 
        5  2864 1 1 30 ILE HA   H    6.629  -0.401  -4.567 1.00 . A A .  30 ILE HA   1 1 
        5  2865 1 1 30 ILE HB   H    4.277  -1.713  -5.933 1.00 . A A .  30 ILE HB   1 1 
        5  2866 1 1 30 ILE HD11 H    6.253  -4.777  -6.437 1.00 . A A .  30 ILE HD11 1 1 
        5  2867 1 1 30 ILE HD12 H    4.668  -4.644  -5.675 1.00 . A A .  30 ILE HD12 1 1 
        5  2868 1 1 30 ILE HD13 H    5.020  -3.731  -7.143 1.00 . A A .  30 ILE HD13 1 1 
        5  2869 1 1 30 ILE HG12 H    7.006  -2.913  -5.479 1.00 . A A .  30 ILE HG12 1 1 
        5  2870 1 1 30 ILE HG13 H    5.678  -3.156  -4.350 1.00 . A A .  30 ILE HG13 1 1 
        5  2871 1 1 30 ILE HG21 H    5.671  -1.788  -7.890 1.00 . A A .  30 ILE HG21 1 1 
        5  2872 1 1 30 ILE HG22 H    5.592  -0.125  -7.311 1.00 . A A .  30 ILE HG22 1 1 
        5  2873 1 1 30 ILE HG23 H    7.028  -1.100  -6.999 1.00 . A A .  30 ILE HG23 1 1 
        5  2874 1 1 30 ILE N    N    5.058  -1.038  -3.389 1.00 . A A .  30 ILE N    1 1 
        5  2875 1 1 30 ILE O    O    5.457   1.524  -5.853 1.00 . A A .  30 ILE O    1 1 
        5  2876 1 1 31 HIS C    C    3.292   3.308  -3.813 1.00 . A A .  31 HIS C    1 1 
        5  2877 1 1 31 HIS CA   C    2.976   2.217  -4.832 1.00 . A A .  31 HIS CA   1 1 
        5  2878 1 1 31 HIS CB   C    1.473   1.939  -4.849 1.00 . A A .  31 HIS CB   1 1 
        5  2879 1 1 31 HIS CD2  C   -0.072   3.816  -3.945 1.00 . A A .  31 HIS CD2  1 1 
        5  2880 1 1 31 HIS CE1  C   -0.332   4.942  -5.808 1.00 . A A .  31 HIS CE1  1 1 
        5  2881 1 1 31 HIS CG   C    0.634   3.179  -4.908 1.00 . A A .  31 HIS CG   1 1 
        5  2882 1 1 31 HIS H    H    3.324   0.341  -3.916 1.00 . A A .  31 HIS H    1 1 
        5  2883 1 1 31 HIS HA   H    3.281   2.557  -5.810 1.00 . A A .  31 HIS HA   1 1 
        5  2884 1 1 31 HIS HB2  H    1.234   1.337  -5.713 1.00 . A A .  31 HIS HB2  1 1 
        5  2885 1 1 31 HIS HB3  H    1.203   1.398  -3.953 1.00 . A A .  31 HIS HB3  1 1 
        5  2886 1 1 31 HIS HD1  H    0.836   3.701  -6.939 1.00 . A A .  31 HIS HD1  1 1 
        5  2887 1 1 31 HIS HD2  H   -0.156   3.521  -2.908 1.00 . A A .  31 HIS HD2  1 1 
        5  2888 1 1 31 HIS HE1  H   -0.648   5.687  -6.523 1.00 . A A .  31 HIS HE1  1 1 
        5  2889 1 1 31 HIS N    N    3.714   0.996  -4.532 1.00 . A A .  31 HIS N    1 1 
        5  2890 1 1 31 HIS ND1  N    0.450   3.909  -6.063 1.00 . A A .  31 HIS ND1  1 1 
        5  2891 1 1 31 HIS NE2  N   -0.664   4.909  -4.530 1.00 . A A .  31 HIS NE2  1 1 
        5  2892 1 1 31 HIS O    O    3.408   4.482  -4.162 1.00 . A A .  31 HIS O    1 1 
        5  2893 1 1 32 MET C    C    5.218   4.204  -1.471 1.00 . A A .  32 MET C    1 1 
        5  2894 1 1 32 MET CA   C    3.733   3.855  -1.483 1.00 . A A .  32 MET CA   1 1 
        5  2895 1 1 32 MET CB   C    3.323   3.273  -0.129 1.00 . A A .  32 MET CB   1 1 
        5  2896 1 1 32 MET CE   C    1.067   5.353   1.650 1.00 . A A .  32 MET CE   1 1 
        5  2897 1 1 32 MET CG   C    1.818   3.203   0.072 1.00 . A A .  32 MET CG   1 1 
        5  2898 1 1 32 MET H    H    3.326   1.961  -2.335 1.00 . A A .  32 MET H    1 1 
        5  2899 1 1 32 MET HA   H    3.165   4.755  -1.665 1.00 . A A .  32 MET HA   1 1 
        5  2900 1 1 32 MET HB2  H    3.723   2.274  -0.043 1.00 . A A .  32 MET HB2  1 1 
        5  2901 1 1 32 MET HB3  H    3.740   3.888   0.655 1.00 . A A .  32 MET HB3  1 1 
        5  2902 1 1 32 MET HE1  H    0.236   4.917   2.186 1.00 . A A .  32 MET HE1  1 1 
        5  2903 1 1 32 MET HE2  H    1.994   5.036   2.104 1.00 . A A .  32 MET HE2  1 1 
        5  2904 1 1 32 MET HE3  H    0.997   6.430   1.690 1.00 . A A .  32 MET HE3  1 1 
        5  2905 1 1 32 MET HG2  H    1.398   2.550  -0.679 1.00 . A A .  32 MET HG2  1 1 
        5  2906 1 1 32 MET HG3  H    1.618   2.796   1.052 1.00 . A A .  32 MET HG3  1 1 
        5  2907 1 1 32 MET N    N    3.430   2.911  -2.552 1.00 . A A .  32 MET N    1 1 
        5  2908 1 1 32 MET O    O    5.633   5.169  -0.829 1.00 . A A .  32 MET O    1 1 
        5  2909 1 1 32 MET SD   S    1.023   4.816  -0.058 1.00 . A A .  32 MET SD   1 1 
        5  2910 1 1 33 ARG C    C    7.759   5.104  -2.550 1.00 . A A .  33 ARG C    1 1 
        5  2911 1 1 33 ARG CA   C    7.452   3.639  -2.253 1.00 . A A .  33 ARG CA   1 1 
        5  2912 1 1 33 ARG CB   C    8.078   2.748  -3.328 1.00 . A A .  33 ARG CB   1 1 
        5  2913 1 1 33 ARG CD   C    8.384   2.257  -5.773 1.00 . A A .  33 ARG CD   1 1 
        5  2914 1 1 33 ARG CG   C    7.732   3.169  -4.746 1.00 . A A .  33 ARG CG   1 1 
        5  2915 1 1 33 ARG CZ   C    8.961   2.422  -8.158 1.00 . A A .  33 ARG CZ   1 1 
        5  2916 1 1 33 ARG H    H    5.623   2.660  -2.674 1.00 . A A .  33 ARG H    1 1 
        5  2917 1 1 33 ARG HA   H    7.875   3.381  -1.294 1.00 . A A .  33 ARG HA   1 1 
        5  2918 1 1 33 ARG HB2  H    9.152   2.774  -3.220 1.00 . A A .  33 ARG HB2  1 1 
        5  2919 1 1 33 ARG HB3  H    7.735   1.734  -3.183 1.00 . A A .  33 ARG HB3  1 1 
        5  2920 1 1 33 ARG HD2  H    9.446   2.223  -5.582 1.00 . A A .  33 ARG HD2  1 1 
        5  2921 1 1 33 ARG HD3  H    7.967   1.266  -5.671 1.00 . A A .  33 ARG HD3  1 1 
        5  2922 1 1 33 ARG HE   H    7.384   3.295  -7.304 1.00 . A A .  33 ARG HE   1 1 
        5  2923 1 1 33 ARG HG2  H    6.660   3.127  -4.873 1.00 . A A .  33 ARG HG2  1 1 
        5  2924 1 1 33 ARG HG3  H    8.075   4.181  -4.905 1.00 . A A .  33 ARG HG3  1 1 
        5  2925 1 1 33 ARG HH11 H   10.227   1.302  -7.052 1.00 . A A .  33 ARG HH11 1 1 
        5  2926 1 1 33 ARG HH12 H   10.622   1.426  -8.734 1.00 . A A .  33 ARG HH12 1 1 
        5  2927 1 1 33 ARG HH21 H    7.893   3.466  -9.520 1.00 . A A .  33 ARG HH21 1 1 
        5  2928 1 1 33 ARG HH22 H    9.295   2.658 -10.137 1.00 . A A .  33 ARG HH22 1 1 
        5  2929 1 1 33 ARG N    N    6.013   3.413  -2.184 1.00 . A A .  33 ARG N    1 1 
        5  2930 1 1 33 ARG NE   N    8.164   2.726  -7.139 1.00 . A A .  33 ARG NE   1 1 
        5  2931 1 1 33 ARG NH1  N   10.025   1.654  -7.965 1.00 . A A .  33 ARG NH1  1 1 
        5  2932 1 1 33 ARG NH2  N    8.694   2.887  -9.372 1.00 . A A .  33 ARG NH2  1 1 
        5  2933 1 1 33 ARG O    O    8.699   5.677  -1.997 1.00 . A A .  33 ARG O    1 1 
        5  2934 1 1 34 THR C    C    6.446   8.031  -2.813 1.00 . A A .  34 THR C    1 1 
        5  2935 1 1 34 THR CA   C    7.147   7.102  -3.797 1.00 . A A .  34 THR CA   1 1 
        5  2936 1 1 34 THR CB   C    6.618   7.381  -5.217 1.00 . A A .  34 THR CB   1 1 
        5  2937 1 1 34 THR CG2  C    5.123   7.111  -5.299 1.00 . A A .  34 THR CG2  1 1 
        5  2938 1 1 34 THR H    H    6.229   5.195  -3.832 1.00 . A A .  34 THR H    1 1 
        5  2939 1 1 34 THR HA   H    8.207   7.312  -3.783 1.00 . A A .  34 THR HA   1 1 
        5  2940 1 1 34 THR HB   H    7.126   6.726  -5.910 1.00 . A A .  34 THR HB   1 1 
        5  2941 1 1 34 THR HG1  H    7.677   9.043  -5.132 1.00 . A A .  34 THR HG1  1 1 
        5  2942 1 1 34 THR HG21 H    4.582   7.960  -4.910 1.00 . A A .  34 THR HG21 1 1 
        5  2943 1 1 34 THR HG22 H    4.883   6.234  -4.717 1.00 . A A .  34 THR HG22 1 1 
        5  2944 1 1 34 THR HG23 H    4.843   6.947  -6.329 1.00 . A A .  34 THR HG23 1 1 
        5  2945 1 1 34 THR N    N    6.960   5.705  -3.426 1.00 . A A .  34 THR N    1 1 
        5  2946 1 1 34 THR O    O    6.994   9.060  -2.417 1.00 . A A .  34 THR O    1 1 
        5  2947 1 1 34 THR OG1  O    6.882   8.741  -5.579 1.00 . A A .  34 THR OG1  1 1 
        5  2948 1 1 35 HIS C    C    5.291   8.828  -0.259 1.00 . A A .  35 HIS C    1 1 
        5  2949 1 1 35 HIS CA   C    4.455   8.463  -1.481 1.00 . A A .  35 HIS CA   1 1 
        5  2950 1 1 35 HIS CB   C    3.200   7.704  -1.046 1.00 . A A .  35 HIS CB   1 1 
        5  2951 1 1 35 HIS CD2  C    1.292   6.892  -2.603 1.00 . A A .  35 HIS CD2  1 1 
        5  2952 1 1 35 HIS CE1  C    0.583   8.849  -3.290 1.00 . A A .  35 HIS CE1  1 1 
        5  2953 1 1 35 HIS CG   C    2.059   7.834  -2.007 1.00 . A A .  35 HIS CG   1 1 
        5  2954 1 1 35 HIS H    H    4.847   6.831  -2.772 1.00 . A A .  35 HIS H    1 1 
        5  2955 1 1 35 HIS HA   H    4.159   9.371  -1.984 1.00 . A A .  35 HIS HA   1 1 
        5  2956 1 1 35 HIS HB2  H    3.437   6.654  -0.953 1.00 . A A .  35 HIS HB2  1 1 
        5  2957 1 1 35 HIS HB3  H    2.873   8.081  -0.088 1.00 . A A .  35 HIS HB3  1 1 
        5  2958 1 1 35 HIS HD1  H    1.942   9.928  -2.206 1.00 . A A .  35 HIS HD1  1 1 
        5  2959 1 1 35 HIS HD2  H    1.378   5.821  -2.479 1.00 . A A .  35 HIS HD2  1 1 
        5  2960 1 1 35 HIS HE1  H    0.020   9.618  -3.798 1.00 . A A .  35 HIS HE1  1 1 
        5  2961 1 1 35 HIS N    N    5.231   7.662  -2.421 1.00 . A A .  35 HIS N    1 1 
        5  2962 1 1 35 HIS ND1  N    1.590   9.050  -2.459 1.00 . A A .  35 HIS ND1  1 1 
        5  2963 1 1 35 HIS NE2  N    0.382   7.548  -3.395 1.00 . A A .  35 HIS NE2  1 1 
        5  2964 1 1 35 HIS O    O    5.207   9.945   0.252 1.00 . A A .  35 HIS O    1 1 
        5  2965 1 1 36 SER C    C    8.185   7.211   1.317 1.00 . A A .  36 SER C    1 1 
        5  2966 1 1 36 SER CA   C    6.947   8.101   1.371 1.00 . A A .  36 SER CA   1 1 
        5  2967 1 1 36 SER CB   C    6.165   7.829   2.657 1.00 . A A .  36 SER CB   1 1 
        5  2968 1 1 36 SER H    H    6.121   7.009  -0.245 1.00 . A A .  36 SER H    1 1 
        5  2969 1 1 36 SER HA   H    7.260   9.134   1.362 1.00 . A A .  36 SER HA   1 1 
        5  2970 1 1 36 SER HB2  H    5.140   8.141   2.525 1.00 . A A .  36 SER HB2  1 1 
        5  2971 1 1 36 SER HB3  H    6.194   6.771   2.876 1.00 . A A .  36 SER HB3  1 1 
        5  2972 1 1 36 SER HG   H    6.677   9.480   3.578 1.00 . A A .  36 SER HG   1 1 
        5  2973 1 1 36 SER N    N    6.098   7.880   0.206 1.00 . A A .  36 SER N    1 1 
        5  2974 1 1 36 SER O    O    8.102   6.033   0.973 1.00 . A A .  36 SER O    1 1 
        5  2975 1 1 36 SER OG   O    6.720   8.537   3.751 1.00 . A A .  36 SER OG   1 1 
        5  2976 1 1 37 GLY C    C   11.672   7.704   2.446 1.00 . A A .  37 GLY C    1 1 
        5  2977 1 1 37 GLY CA   C   10.574   7.031   1.646 1.00 . A A .  37 GLY CA   1 1 
        5  2978 1 1 37 GLY H    H    9.340   8.729   1.927 1.00 . A A .  37 GLY H    1 1 
        5  2979 1 1 37 GLY HA2  H   10.391   6.050   2.059 1.00 . A A .  37 GLY HA2  1 1 
        5  2980 1 1 37 GLY HA3  H   10.904   6.924   0.623 1.00 . A A .  37 GLY HA3  1 1 
        5  2981 1 1 37 GLY N    N    9.334   7.785   1.661 1.00 . A A .  37 GLY N    1 1 
        5  2982 1 1 37 GLY O    O   11.401   8.572   3.275 1.00 . A A .  37 GLY O    1 1 
        5  2983 1 1 38 GLU C    C   14.396   9.256   2.361 1.00 . A A .  38 GLU C    1 1 
        5  2984 1 1 38 GLU CA   C   14.056   7.871   2.904 1.00 . A A .  38 GLU CA   1 1 
        5  2985 1 1 38 GLU CB   C   15.272   6.950   2.780 1.00 . A A .  38 GLU CB   1 1 
        5  2986 1 1 38 GLU CD   C   17.771   6.810   3.121 1.00 . A A .  38 GLU CD   1 1 
        5  2987 1 1 38 GLU CG   C   16.461   7.397   3.612 1.00 . A A .  38 GLU CG   1 1 
        5  2988 1 1 38 GLU H    H   13.067   6.606   1.525 1.00 . A A .  38 GLU H    1 1 
        5  2989 1 1 38 GLU HA   H   13.790   7.961   3.946 1.00 . A A .  38 GLU HA   1 1 
        5  2990 1 1 38 GLU HB2  H   14.989   5.956   3.097 1.00 . A A .  38 GLU HB2  1 1 
        5  2991 1 1 38 GLU HB3  H   15.576   6.914   1.745 1.00 . A A .  38 GLU HB3  1 1 
        5  2992 1 1 38 GLU HG2  H   16.530   8.474   3.571 1.00 . A A .  38 GLU HG2  1 1 
        5  2993 1 1 38 GLU HG3  H   16.306   7.087   4.635 1.00 . A A .  38 GLU HG3  1 1 
        5  2994 1 1 38 GLU N    N   12.914   7.302   2.198 1.00 . A A .  38 GLU N    1 1 
        5  2995 1 1 38 GLU O    O   14.551   9.442   1.154 1.00 . A A .  38 GLU O    1 1 
        5  2996 1 1 38 GLU OE1  O   18.224   7.206   2.026 1.00 . A A .  38 GLU OE1  1 1 
        5  2997 1 1 38 GLU OE2  O   18.341   5.955   3.830 1.00 . A A .  38 GLU OE2  1 1 
        5  2998 1 1 39 LYS C    C   16.006  12.128   3.693 1.00 . A A .  39 LYS C    1 1 
        5  2999 1 1 39 LYS CA   C   14.833  11.595   2.876 1.00 . A A .  39 LYS CA   1 1 
        5  3000 1 1 39 LYS CB   C   13.614  12.500   3.064 1.00 . A A .  39 LYS CB   1 1 
        5  3001 1 1 39 LYS CD   C   12.310  14.475   2.222 1.00 . A A .  39 LYS CD   1 1 
        5  3002 1 1 39 LYS CE   C   11.368  13.938   1.155 1.00 . A A .  39 LYS CE   1 1 
        5  3003 1 1 39 LYS CG   C   13.645  13.750   2.202 1.00 . A A .  39 LYS CG   1 1 
        5  3004 1 1 39 LYS H    H   14.376  10.016   4.210 1.00 . A A .  39 LYS H    1 1 
        5  3005 1 1 39 LYS HA   H   15.109  11.589   1.833 1.00 . A A .  39 LYS HA   1 1 
        5  3006 1 1 39 LYS HB2  H   12.724  11.940   2.818 1.00 . A A .  39 LYS HB2  1 1 
        5  3007 1 1 39 LYS HB3  H   13.562  12.804   4.100 1.00 . A A .  39 LYS HB3  1 1 
        5  3008 1 1 39 LYS HD2  H   11.852  14.342   3.191 1.00 . A A .  39 LYS HD2  1 1 
        5  3009 1 1 39 LYS HD3  H   12.480  15.528   2.043 1.00 . A A .  39 LYS HD3  1 1 
        5  3010 1 1 39 LYS HE2  H   11.389  12.859   1.185 1.00 . A A .  39 LYS HE2  1 1 
        5  3011 1 1 39 LYS HE3  H   10.368  14.284   1.370 1.00 . A A .  39 LYS HE3  1 1 
        5  3012 1 1 39 LYS HG2  H   14.410  14.415   2.575 1.00 . A A .  39 LYS HG2  1 1 
        5  3013 1 1 39 LYS HG3  H   13.877  13.468   1.184 1.00 . A A .  39 LYS HG3  1 1 
        5  3014 1 1 39 LYS HZ1  H   11.258  13.833  -0.928 1.00 . A A .  39 LYS HZ1  1 1 
        5  3015 1 1 39 LYS HZ2  H   12.782  14.279  -0.344 1.00 . A A .  39 LYS HZ2  1 1 
        5  3016 1 1 39 LYS HZ3  H   11.512  15.396  -0.334 1.00 . A A .  39 LYS HZ3  1 1 
        5  3017 1 1 39 LYS N    N   14.511  10.226   3.262 1.00 . A A .  39 LYS N    1 1 
        5  3018 1 1 39 LYS NZ   N   11.757  14.393  -0.208 1.00 . A A .  39 LYS NZ   1 1 
        5  3019 1 1 39 LYS O    O   15.833  12.854   4.672 1.00 . A A .  39 LYS O    1 1 
        5  3020 1 1 40 PRO C    C   18.729  13.682   3.770 1.00 . A A .  40 PRO C    1 1 
        5  3021 1 1 40 PRO CA   C   18.455  12.194   3.960 1.00 . A A .  40 PRO CA   1 1 
        5  3022 1 1 40 PRO CB   C   19.547  11.359   3.287 1.00 . A A .  40 PRO CB   1 1 
        5  3023 1 1 40 PRO CD   C   17.510  10.898   2.123 1.00 . A A .  40 PRO CD   1 1 
        5  3024 1 1 40 PRO CG   C   18.997  11.031   1.942 1.00 . A A .  40 PRO CG   1 1 
        5  3025 1 1 40 PRO HA   H   18.425  11.967   5.016 1.00 . A A .  40 PRO HA   1 1 
        5  3026 1 1 40 PRO HB2  H   20.454  11.941   3.213 1.00 . A A .  40 PRO HB2  1 1 
        5  3027 1 1 40 PRO HB3  H   19.731  10.467   3.866 1.00 . A A .  40 PRO HB3  1 1 
        5  3028 1 1 40 PRO HD2  H   16.990  11.251   1.244 1.00 . A A .  40 PRO HD2  1 1 
        5  3029 1 1 40 PRO HD3  H   17.246   9.873   2.334 1.00 . A A .  40 PRO HD3  1 1 
        5  3030 1 1 40 PRO HG2  H   19.221  11.828   1.249 1.00 . A A .  40 PRO HG2  1 1 
        5  3031 1 1 40 PRO HG3  H   19.416  10.099   1.592 1.00 . A A .  40 PRO HG3  1 1 
        5  3032 1 1 40 PRO N    N   17.229  11.762   3.282 1.00 . A A .  40 PRO N    1 1 
        5  3033 1 1 40 PRO O    O   19.692  14.221   4.315 1.00 . A A .  40 PRO O    1 1 
        5  3034 1 1 41 SER C    C   17.733  16.587   3.979 1.00 . A A .  41 SER C    1 1 
        5  3035 1 1 41 SER CA   C   18.028  15.767   2.727 1.00 . A A .  41 SER CA   1 1 
        5  3036 1 1 41 SER CB   C   17.099  16.198   1.590 1.00 . A A .  41 SER CB   1 1 
        5  3037 1 1 41 SER H    H   17.127  13.856   2.585 1.00 . A A .  41 SER H    1 1 
        5  3038 1 1 41 SER HA   H   19.052  15.941   2.429 1.00 . A A .  41 SER HA   1 1 
        5  3039 1 1 41 SER HB2  H   16.073  16.112   1.915 1.00 . A A .  41 SER HB2  1 1 
        5  3040 1 1 41 SER HB3  H   17.308  17.226   1.328 1.00 . A A .  41 SER HB3  1 1 
        5  3041 1 1 41 SER HG   H   17.936  15.793  -0.134 1.00 . A A .  41 SER HG   1 1 
        5  3042 1 1 41 SER N    N   17.876  14.342   2.992 1.00 . A A .  41 SER N    1 1 
        5  3043 1 1 41 SER O    O   18.527  17.438   4.379 1.00 . A A .  41 SER O    1 1 
        5  3044 1 1 41 SER OG   O   17.286  15.387   0.444 1.00 . A A .  41 SER OG   1 1 
        5  3045 1 1 42 GLY C    C   16.539  16.283   7.060 1.00 . A A .  42 GLY C    1 1 
        5  3046 1 1 42 GLY CA   C   16.203  17.046   5.794 1.00 . A A .  42 GLY CA   1 1 
        5  3047 1 1 42 GLY H    H   15.990  15.635   4.230 1.00 . A A .  42 GLY H    1 1 
        5  3048 1 1 42 GLY HA2  H   16.719  17.994   5.810 1.00 . A A .  42 GLY HA2  1 1 
        5  3049 1 1 42 GLY HA3  H   15.139  17.227   5.769 1.00 . A A .  42 GLY HA3  1 1 
        5  3050 1 1 42 GLY N    N   16.584  16.325   4.594 1.00 . A A .  42 GLY N    1 1 
        5  3051 1 1 42 GLY O    O   16.486  15.054   7.103 1.00 . A A .  42 GLY O    1 1 
        5  3052 1 1 43 PRO C    C   16.045  15.814  10.122 1.00 . A A .  43 PRO C    1 1 
        5  3053 1 1 43 PRO CA   C   17.250  16.426   9.415 1.00 . A A .  43 PRO CA   1 1 
        5  3054 1 1 43 PRO CB   C   17.793  17.613  10.215 1.00 . A A .  43 PRO CB   1 1 
        5  3055 1 1 43 PRO CD   C   16.981  18.490   8.144 1.00 . A A .  43 PRO CD   1 1 
        5  3056 1 1 43 PRO CG   C   17.145  18.808   9.605 1.00 . A A .  43 PRO CG   1 1 
        5  3057 1 1 43 PRO HA   H   18.022  15.678   9.310 1.00 . A A .  43 PRO HA   1 1 
        5  3058 1 1 43 PRO HB2  H   17.521  17.503  11.255 1.00 . A A .  43 PRO HB2  1 1 
        5  3059 1 1 43 PRO HB3  H   18.867  17.655  10.120 1.00 . A A .  43 PRO HB3  1 1 
        5  3060 1 1 43 PRO HD2  H   16.075  18.934   7.761 1.00 . A A .  43 PRO HD2  1 1 
        5  3061 1 1 43 PRO HD3  H   17.839  18.834   7.585 1.00 . A A .  43 PRO HD3  1 1 
        5  3062 1 1 43 PRO HG2  H   16.182  18.977  10.062 1.00 . A A .  43 PRO HG2  1 1 
        5  3063 1 1 43 PRO HG3  H   17.779  19.673   9.731 1.00 . A A .  43 PRO HG3  1 1 
        5  3064 1 1 43 PRO N    N   16.896  17.020   8.123 1.00 . A A .  43 PRO N    1 1 
        5  3065 1 1 43 PRO O    O   14.903  16.024   9.715 1.00 . A A .  43 PRO O    1 1 
        5  3066 1 1 44 SER C    C   15.240  14.897  13.389 1.00 . A A .  44 SER C    1 1 
        5  3067 1 1 44 SER CA   C   15.245  14.411  11.943 1.00 . A A .  44 SER CA   1 1 
        5  3068 1 1 44 SER CB   C   15.412  12.890  11.905 1.00 . A A .  44 SER CB   1 1 
        5  3069 1 1 44 SER H    H   17.240  14.926  11.456 1.00 . A A .  44 SER H    1 1 
        5  3070 1 1 44 SER HA   H   14.303  14.672  11.484 1.00 . A A .  44 SER HA   1 1 
        5  3071 1 1 44 SER HB2  H   15.506  12.566  10.879 1.00 . A A .  44 SER HB2  1 1 
        5  3072 1 1 44 SER HB3  H   16.302  12.615  12.452 1.00 . A A .  44 SER HB3  1 1 
        5  3073 1 1 44 SER HG   H   13.525  12.807  12.425 1.00 . A A .  44 SER HG   1 1 
        5  3074 1 1 44 SER N    N   16.308  15.056  11.182 1.00 . A A .  44 SER N    1 1 
        5  3075 1 1 44 SER O    O   15.814  14.260  14.272 1.00 . A A .  44 SER O    1 1 
        5  3076 1 1 44 SER OG   O   14.297  12.240  12.489 1.00 . A A .  44 SER OG   1 1 
        5  3077 1 1 45 SER C    C   13.617  15.761  15.864 1.00 . A A .  45 SER C    1 1 
        5  3078 1 1 45 SER CA   C   14.509  16.606  14.960 1.00 . A A .  45 SER CA   1 1 
        5  3079 1 1 45 SER CB   C   13.974  18.038  14.892 1.00 . A A .  45 SER CB   1 1 
        5  3080 1 1 45 SER H    H   14.149  16.493  12.877 1.00 . A A .  45 SER H    1 1 
        5  3081 1 1 45 SER HA   H   15.507  16.623  15.372 1.00 . A A .  45 SER HA   1 1 
        5  3082 1 1 45 SER HB2  H   14.624  18.633  14.269 1.00 . A A .  45 SER HB2  1 1 
        5  3083 1 1 45 SER HB3  H   12.980  18.028  14.469 1.00 . A A .  45 SER HB3  1 1 
        5  3084 1 1 45 SER HG   H   13.493  19.483  16.125 1.00 . A A .  45 SER HG   1 1 
        5  3085 1 1 45 SER N    N   14.586  16.031  13.622 1.00 . A A .  45 SER N    1 1 
        5  3086 1 1 45 SER O    O   14.000  15.410  16.980 1.00 . A A .  45 SER O    1 1 
        5  3087 1 1 45 SER OG   O   13.916  18.623  16.181 1.00 . A A .  45 SER OG   1 1 
        5  3088 1 1 46 GLY C    C   11.417  13.203  15.660 1.00 . A A .  46 GLY C    1 1 
        5  3089 1 1 46 GLY CA   C   11.496  14.635  16.149 1.00 . A A .  46 GLY CA   1 1 
        5  3090 1 1 46 GLY H    H   12.173  15.745  14.478 1.00 . A A .  46 GLY H    1 1 
        5  3091 1 1 46 GLY HA2  H   11.813  14.635  17.181 1.00 . A A .  46 GLY HA2  1 1 
        5  3092 1 1 46 GLY HA3  H   10.514  15.080  16.084 1.00 . A A .  46 GLY HA3  1 1 
        5  3093 1 1 46 GLY N    N   12.424  15.437  15.374 1.00 . A A .  46 GLY N    1 1 
        5  3094 1 1 46 GLY O    O   12.447  12.533  15.601 1.00 . A A .  46 GLY O    1 1 
        5  3095 2 2  1 ZN  ZN   ZN  -1.237   6.495  -3.296 1.00 . B A . 201 ZN  ZN   1 1 
        6  3096 1 1  1 GLY C    C  -28.367  -7.061   5.480 1.00 . A A .   1 GLY C    1 1 
        6  3097 1 1  1 GLY CA   C  -29.686  -6.893   6.207 1.00 . A A .   1 GLY CA   1 1 
        6  3098 1 1  1 GLY H1   H  -29.527  -4.782   6.160 1.00 . A A .   1 GLY H1   1 1 
        6  3099 1 1  1 GLY HA2  H  -29.704  -7.558   7.058 1.00 . A A .   1 GLY HA2  1 1 
        6  3100 1 1  1 GLY HA3  H  -30.490  -7.161   5.537 1.00 . A A .   1 GLY HA3  1 1 
        6  3101 1 1  1 GLY N    N  -29.897  -5.534   6.669 1.00 . A A .   1 GLY N    1 1 
        6  3102 1 1  1 GLY O    O  -27.586  -6.116   5.372 1.00 . A A .   1 GLY O    1 1 
        6  3103 1 1  2 SER C    C  -27.115  -8.569   2.758 1.00 . A A .   2 SER C    1 1 
        6  3104 1 1  2 SER CA   C  -26.880  -8.557   4.266 1.00 . A A .   2 SER CA   1 1 
        6  3105 1 1  2 SER CB   C  -26.310  -9.904   4.715 1.00 . A A .   2 SER CB   1 1 
        6  3106 1 1  2 SER H    H  -28.779  -8.980   5.101 1.00 . A A .   2 SER H    1 1 
        6  3107 1 1  2 SER HA   H  -26.170  -7.779   4.502 1.00 . A A .   2 SER HA   1 1 
        6  3108 1 1  2 SER HB2  H  -25.373 -10.082   4.209 1.00 . A A .   2 SER HB2  1 1 
        6  3109 1 1  2 SER HB3  H  -26.144  -9.884   5.783 1.00 . A A .   2 SER HB3  1 1 
        6  3110 1 1  2 SER HG   H  -27.052 -11.691   5.018 1.00 . A A .   2 SER HG   1 1 
        6  3111 1 1  2 SER N    N  -28.117  -8.267   4.982 1.00 . A A .   2 SER N    1 1 
        6  3112 1 1  2 SER O    O  -28.012  -9.251   2.264 1.00 . A A .   2 SER O    1 1 
        6  3113 1 1  2 SER OG   O  -27.202 -10.962   4.411 1.00 . A A .   2 SER OG   1 1 
        6  3114 1 1  3 SER C    C  -25.745  -8.920  -0.086 1.00 . A A .   3 SER C    1 1 
        6  3115 1 1  3 SER CA   C  -26.421  -7.727   0.582 1.00 . A A .   3 SER CA   1 1 
        6  3116 1 1  3 SER CB   C  -25.804  -6.423   0.071 1.00 . A A .   3 SER CB   1 1 
        6  3117 1 1  3 SER H    H  -25.604  -7.287   2.486 1.00 . A A .   3 SER H    1 1 
        6  3118 1 1  3 SER HA   H  -27.472  -7.739   0.336 1.00 . A A .   3 SER HA   1 1 
        6  3119 1 1  3 SER HB2  H  -24.767  -6.378   0.367 1.00 . A A .   3 SER HB2  1 1 
        6  3120 1 1  3 SER HB3  H  -25.873  -6.395  -1.007 1.00 . A A .   3 SER HB3  1 1 
        6  3121 1 1  3 SER HG   H  -26.460  -5.333   1.560 1.00 . A A .   3 SER HG   1 1 
        6  3122 1 1  3 SER N    N  -26.301  -7.808   2.033 1.00 . A A .   3 SER N    1 1 
        6  3123 1 1  3 SER O    O  -24.572  -9.200   0.158 1.00 . A A .   3 SER O    1 1 
        6  3124 1 1  3 SER OG   O  -26.480  -5.297   0.601 1.00 . A A .   3 SER OG   1 1 
        6  3125 1 1  4 GLY C    C  -25.622 -10.479  -3.074 1.00 . A A .   4 GLY C    1 1 
        6  3126 1 1  4 GLY CA   C  -25.953 -10.774  -1.624 1.00 . A A .   4 GLY CA   1 1 
        6  3127 1 1  4 GLY H    H  -27.424  -9.349  -1.088 1.00 . A A .   4 GLY H    1 1 
        6  3128 1 1  4 GLY HA2  H  -25.054 -11.093  -1.118 1.00 . A A .   4 GLY HA2  1 1 
        6  3129 1 1  4 GLY HA3  H  -26.678 -11.574  -1.588 1.00 . A A .   4 GLY HA3  1 1 
        6  3130 1 1  4 GLY N    N  -26.495  -9.619  -0.933 1.00 . A A .   4 GLY N    1 1 
        6  3131 1 1  4 GLY O    O  -26.514 -10.406  -3.919 1.00 . A A .   4 GLY O    1 1 
        6  3132 1 1  5 SER C    C  -22.399 -10.298  -4.875 1.00 . A A .   5 SER C    1 1 
        6  3133 1 1  5 SER CA   C  -23.890 -10.014  -4.720 1.00 . A A .   5 SER CA   1 1 
        6  3134 1 1  5 SER CB   C  -24.182  -8.553  -5.070 1.00 . A A .   5 SER CB   1 1 
        6  3135 1 1  5 SER H    H  -23.672 -10.379  -2.646 1.00 . A A .   5 SER H    1 1 
        6  3136 1 1  5 SER HA   H  -24.439 -10.653  -5.395 1.00 . A A .   5 SER HA   1 1 
        6  3137 1 1  5 SER HB2  H  -23.722  -8.314  -6.016 1.00 . A A .   5 SER HB2  1 1 
        6  3138 1 1  5 SER HB3  H  -25.250  -8.410  -5.141 1.00 . A A .   5 SER HB3  1 1 
        6  3139 1 1  5 SER HG   H  -23.769  -6.770  -4.370 1.00 . A A .   5 SER HG   1 1 
        6  3140 1 1  5 SER N    N  -24.336 -10.308  -3.363 1.00 . A A .   5 SER N    1 1 
        6  3141 1 1  5 SER O    O  -21.725 -10.676  -3.917 1.00 . A A .   5 SER O    1 1 
        6  3142 1 1  5 SER OG   O  -23.669  -7.679  -4.079 1.00 . A A .   5 SER OG   1 1 
        6  3143 1 1  6 SER C    C  -19.625  -9.184  -5.896 1.00 . A A .   6 SER C    1 1 
        6  3144 1 1  6 SER CA   C  -20.481 -10.353  -6.373 1.00 . A A .   6 SER CA   1 1 
        6  3145 1 1  6 SER CB   C  -20.271 -10.575  -7.872 1.00 . A A .   6 SER CB   1 1 
        6  3146 1 1  6 SER H    H  -22.480  -9.811  -6.813 1.00 . A A .   6 SER H    1 1 
        6  3147 1 1  6 SER HA   H  -20.183 -11.244  -5.841 1.00 . A A .   6 SER HA   1 1 
        6  3148 1 1  6 SER HB2  H  -20.782 -11.477  -8.175 1.00 . A A .   6 SER HB2  1 1 
        6  3149 1 1  6 SER HB3  H  -20.673  -9.734  -8.418 1.00 . A A .   6 SER HB3  1 1 
        6  3150 1 1  6 SER HG   H  -18.452 -11.182  -7.476 1.00 . A A .   6 SER HG   1 1 
        6  3151 1 1  6 SER N    N  -21.891 -10.113  -6.090 1.00 . A A .   6 SER N    1 1 
        6  3152 1 1  6 SER O    O  -19.298  -8.283  -6.668 1.00 . A A .   6 SER O    1 1 
        6  3153 1 1  6 SER OG   O  -18.894 -10.705  -8.181 1.00 . A A .   6 SER OG   1 1 
        6  3154 1 1  7 GLY C    C  -17.622  -8.610  -2.874 1.00 . A A .   7 GLY C    1 1 
        6  3155 1 1  7 GLY CA   C  -18.448  -8.145  -4.057 1.00 . A A .   7 GLY CA   1 1 
        6  3156 1 1  7 GLY H    H  -19.553  -9.951  -4.048 1.00 . A A .   7 GLY H    1 1 
        6  3157 1 1  7 GLY HA2  H  -17.784  -7.774  -4.823 1.00 . A A .   7 GLY HA2  1 1 
        6  3158 1 1  7 GLY HA3  H  -19.095  -7.342  -3.735 1.00 . A A .   7 GLY HA3  1 1 
        6  3159 1 1  7 GLY N    N  -19.264  -9.207  -4.616 1.00 . A A .   7 GLY N    1 1 
        6  3160 1 1  7 GLY O    O  -18.146  -9.228  -1.948 1.00 . A A .   7 GLY O    1 1 
        6  3161 1 1  8 ALA C    C  -15.749  -7.951  -0.543 1.00 . A A .   8 ALA C    1 1 
        6  3162 1 1  8 ALA CA   C  -15.427  -8.705  -1.828 1.00 . A A .   8 ALA CA   1 1 
        6  3163 1 1  8 ALA CB   C  -13.981  -8.465  -2.235 1.00 . A A .   8 ALA CB   1 1 
        6  3164 1 1  8 ALA H    H  -15.969  -7.818  -3.672 1.00 . A A .   8 ALA H    1 1 
        6  3165 1 1  8 ALA HA   H  -15.555  -9.764  -1.654 1.00 . A A .   8 ALA HA   1 1 
        6  3166 1 1  8 ALA HB1  H  -13.558  -7.686  -1.618 1.00 . A A .   8 ALA HB1  1 1 
        6  3167 1 1  8 ALA HB2  H  -13.415  -9.376  -2.104 1.00 . A A .   8 ALA HB2  1 1 
        6  3168 1 1  8 ALA HB3  H  -13.944  -8.163  -3.271 1.00 . A A .   8 ALA HB3  1 1 
        6  3169 1 1  8 ALA N    N  -16.327  -8.313  -2.906 1.00 . A A .   8 ALA N    1 1 
        6  3170 1 1  8 ALA O    O  -15.805  -8.539   0.536 1.00 . A A .   8 ALA O    1 1 
        6  3171 1 1  9 GLY C    C  -15.338  -4.646   0.643 1.00 . A A .   9 GLY C    1 1 
        6  3172 1 1  9 GLY CA   C  -16.273  -5.830   0.495 1.00 . A A .   9 GLY CA   1 1 
        6  3173 1 1  9 GLY H    H  -15.902  -6.228  -1.551 1.00 . A A .   9 GLY H    1 1 
        6  3174 1 1  9 GLY HA2  H  -17.285  -5.467   0.404 1.00 . A A .   9 GLY HA2  1 1 
        6  3175 1 1  9 GLY HA3  H  -16.199  -6.444   1.381 1.00 . A A .   9 GLY HA3  1 1 
        6  3176 1 1  9 GLY N    N  -15.960  -6.643  -0.665 1.00 . A A .   9 GLY N    1 1 
        6  3177 1 1  9 GLY O    O  -15.571  -3.587   0.061 1.00 . A A .   9 GLY O    1 1 
        6  3178 1 1 10 GLU C    C  -11.892  -4.327   1.745 1.00 . A A .  10 GLU C    1 1 
        6  3179 1 1 10 GLU CA   C  -13.306  -3.761   1.647 1.00 . A A .  10 GLU CA   1 1 
        6  3180 1 1 10 GLU CB   C  -13.647  -2.988   2.923 1.00 . A A .  10 GLU CB   1 1 
        6  3181 1 1 10 GLU CD   C  -14.590  -3.210   5.256 1.00 . A A .  10 GLU CD   1 1 
        6  3182 1 1 10 GLU CG   C  -13.793  -3.873   4.150 1.00 . A A .  10 GLU CG   1 1 
        6  3183 1 1 10 GLU H    H  -14.145  -5.693   1.860 1.00 . A A .  10 GLU H    1 1 
        6  3184 1 1 10 GLU HA   H  -13.353  -3.087   0.806 1.00 . A A .  10 GLU HA   1 1 
        6  3185 1 1 10 GLU HB2  H  -12.865  -2.269   3.114 1.00 . A A .  10 GLU HB2  1 1 
        6  3186 1 1 10 GLU HB3  H  -14.578  -2.462   2.772 1.00 . A A .  10 GLU HB3  1 1 
        6  3187 1 1 10 GLU HG2  H  -14.295  -4.785   3.863 1.00 . A A .  10 GLU HG2  1 1 
        6  3188 1 1 10 GLU HG3  H  -12.808  -4.109   4.527 1.00 . A A .  10 GLU HG3  1 1 
        6  3189 1 1 10 GLU N    N  -14.277  -4.825   1.424 1.00 . A A .  10 GLU N    1 1 
        6  3190 1 1 10 GLU O    O  -11.545  -4.999   2.717 1.00 . A A .  10 GLU O    1 1 
        6  3191 1 1 10 GLU OE1  O  -15.653  -2.628   4.953 1.00 . A A .  10 GLU OE1  1 1 
        6  3192 1 1 10 GLU OE2  O  -14.152  -3.273   6.424 1.00 . A A .  10 GLU OE2  1 1 
        6  3193 1 1 11 LYS C    C   -8.919  -4.011   1.902 1.00 . A A .  11 LYS C    1 1 
        6  3194 1 1 11 LYS CA   C   -9.702  -4.530   0.701 1.00 . A A .  11 LYS CA   1 1 
        6  3195 1 1 11 LYS CB   C   -9.017  -4.093  -0.596 1.00 . A A .  11 LYS CB   1 1 
        6  3196 1 1 11 LYS CD   C   -9.793  -1.784  -1.208 1.00 . A A .  11 LYS CD   1 1 
        6  3197 1 1 11 LYS CE   C  -10.189  -2.269  -2.594 1.00 . A A .  11 LYS CE   1 1 
        6  3198 1 1 11 LYS CG   C   -8.662  -2.617  -0.629 1.00 . A A .  11 LYS CG   1 1 
        6  3199 1 1 11 LYS H    H  -11.413  -3.509  -0.015 1.00 . A A .  11 LYS H    1 1 
        6  3200 1 1 11 LYS HA   H   -9.726  -5.608   0.741 1.00 . A A .  11 LYS HA   1 1 
        6  3201 1 1 11 LYS HB2  H   -8.108  -4.664  -0.718 1.00 . A A .  11 LYS HB2  1 1 
        6  3202 1 1 11 LYS HB3  H   -9.677  -4.302  -1.425 1.00 . A A .  11 LYS HB3  1 1 
        6  3203 1 1 11 LYS HD2  H  -10.651  -1.855  -0.556 1.00 . A A .  11 LYS HD2  1 1 
        6  3204 1 1 11 LYS HD3  H   -9.473  -0.754  -1.275 1.00 . A A .  11 LYS HD3  1 1 
        6  3205 1 1 11 LYS HE2  H   -9.303  -2.605  -3.111 1.00 . A A .  11 LYS HE2  1 1 
        6  3206 1 1 11 LYS HE3  H  -10.879  -3.094  -2.489 1.00 . A A .  11 LYS HE3  1 1 
        6  3207 1 1 11 LYS HG2  H   -8.461  -2.281   0.378 1.00 . A A .  11 LYS HG2  1 1 
        6  3208 1 1 11 LYS HG3  H   -7.779  -2.482  -1.238 1.00 . A A .  11 LYS HG3  1 1 
        6  3209 1 1 11 LYS HZ1  H  -11.720  -1.547  -3.819 1.00 . A A .  11 LYS HZ1  1 1 
        6  3210 1 1 11 LYS HZ2  H  -10.201  -0.879  -4.153 1.00 . A A .  11 LYS HZ2  1 1 
        6  3211 1 1 11 LYS HZ3  H  -11.062  -0.381  -2.785 1.00 . A A .  11 LYS HZ3  1 1 
        6  3212 1 1 11 LYS N    N  -11.079  -4.050   0.731 1.00 . A A .  11 LYS N    1 1 
        6  3213 1 1 11 LYS NZ   N  -10.839  -1.194  -3.393 1.00 . A A .  11 LYS NZ   1 1 
        6  3214 1 1 11 LYS O    O   -9.157  -2.910   2.401 1.00 . A A .  11 LYS O    1 1 
        6  3215 1 1 12 PRO C    C   -6.146  -3.333   3.202 1.00 . A A .  12 PRO C    1 1 
        6  3216 1 1 12 PRO CA   C   -7.121  -4.460   3.526 1.00 . A A .  12 PRO CA   1 1 
        6  3217 1 1 12 PRO CB   C   -6.360  -5.754   3.827 1.00 . A A .  12 PRO CB   1 1 
        6  3218 1 1 12 PRO CD   C   -7.621  -6.144   1.834 1.00 . A A .  12 PRO CD   1 1 
        6  3219 1 1 12 PRO CG   C   -6.334  -6.489   2.532 1.00 . A A .  12 PRO CG   1 1 
        6  3220 1 1 12 PRO HA   H   -7.717  -4.183   4.383 1.00 . A A .  12 PRO HA   1 1 
        6  3221 1 1 12 PRO HB2  H   -5.362  -5.517   4.168 1.00 . A A .  12 PRO HB2  1 1 
        6  3222 1 1 12 PRO HB3  H   -6.883  -6.314   4.588 1.00 . A A .  12 PRO HB3  1 1 
        6  3223 1 1 12 PRO HD2  H   -7.470  -6.095   0.766 1.00 . A A .  12 PRO HD2  1 1 
        6  3224 1 1 12 PRO HD3  H   -8.387  -6.867   2.076 1.00 . A A .  12 PRO HD3  1 1 
        6  3225 1 1 12 PRO HG2  H   -5.490  -6.165   1.943 1.00 . A A .  12 PRO HG2  1 1 
        6  3226 1 1 12 PRO HG3  H   -6.281  -7.552   2.714 1.00 . A A .  12 PRO HG3  1 1 
        6  3227 1 1 12 PRO N    N   -7.960  -4.819   2.379 1.00 . A A .  12 PRO N    1 1 
        6  3228 1 1 12 PRO O    O   -5.906  -2.451   4.026 1.00 . A A .  12 PRO O    1 1 
        6  3229 1 1 13 TYR C    C   -5.337  -1.261   0.756 1.00 . A A .  13 TYR C    1 1 
        6  3230 1 1 13 TYR CA   C   -4.638  -2.350   1.564 1.00 . A A .  13 TYR CA   1 1 
        6  3231 1 1 13 TYR CB   C   -3.524  -2.985   0.730 1.00 . A A .  13 TYR CB   1 1 
        6  3232 1 1 13 TYR CD1  C   -2.297  -4.621   2.211 1.00 . A A .  13 TYR CD1  1 1 
        6  3233 1 1 13 TYR CD2  C   -3.719  -5.493   0.509 1.00 . A A .  13 TYR CD2  1 1 
        6  3234 1 1 13 TYR CE1  C   -1.973  -5.905   2.605 1.00 . A A .  13 TYR CE1  1 1 
        6  3235 1 1 13 TYR CE2  C   -3.402  -6.780   0.897 1.00 . A A .  13 TYR CE2  1 1 
        6  3236 1 1 13 TYR CG   C   -3.173  -4.392   1.158 1.00 . A A .  13 TYR CG   1 1 
        6  3237 1 1 13 TYR CZ   C   -2.528  -6.981   1.945 1.00 . A A .  13 TYR CZ   1 1 
        6  3238 1 1 13 TYR H    H   -5.820  -4.097   1.384 1.00 . A A .  13 TYR H    1 1 
        6  3239 1 1 13 TYR HA   H   -4.204  -1.905   2.448 1.00 . A A .  13 TYR HA   1 1 
        6  3240 1 1 13 TYR HB2  H   -3.833  -3.020  -0.303 1.00 . A A .  13 TYR HB2  1 1 
        6  3241 1 1 13 TYR HB3  H   -2.632  -2.380   0.813 1.00 . A A .  13 TYR HB3  1 1 
        6  3242 1 1 13 TYR HD1  H   -1.864  -3.775   2.726 1.00 . A A .  13 TYR HD1  1 1 
        6  3243 1 1 13 TYR HD2  H   -4.403  -5.332  -0.312 1.00 . A A .  13 TYR HD2  1 1 
        6  3244 1 1 13 TYR HE1  H   -1.289  -6.062   3.426 1.00 . A A .  13 TYR HE1  1 1 
        6  3245 1 1 13 TYR HE2  H   -3.836  -7.623   0.380 1.00 . A A .  13 TYR HE2  1 1 
        6  3246 1 1 13 TYR HH   H   -1.858  -8.245   3.228 1.00 . A A .  13 TYR HH   1 1 
        6  3247 1 1 13 TYR N    N   -5.588  -3.368   1.997 1.00 . A A .  13 TYR N    1 1 
        6  3248 1 1 13 TYR O    O   -5.827  -1.507  -0.345 1.00 . A A .  13 TYR O    1 1 
        6  3249 1 1 13 TYR OH   O   -2.209  -8.261   2.335 1.00 . A A .  13 TYR OH   1 1 
        6  3250 1 1 14 GLY C    C   -5.278   2.364   0.836 1.00 . A A .  14 GLY C    1 1 
        6  3251 1 1 14 GLY CA   C   -6.016   1.056   0.632 1.00 . A A .  14 GLY CA   1 1 
        6  3252 1 1 14 GLY H    H   -4.969   0.083   2.194 1.00 . A A .  14 GLY H    1 1 
        6  3253 1 1 14 GLY HA2  H   -6.058   0.840  -0.425 1.00 . A A .  14 GLY HA2  1 1 
        6  3254 1 1 14 GLY HA3  H   -7.023   1.162   1.007 1.00 . A A .  14 GLY HA3  1 1 
        6  3255 1 1 14 GLY N    N   -5.377  -0.054   1.313 1.00 . A A .  14 GLY N    1 1 
        6  3256 1 1 14 GLY O    O   -5.639   3.160   1.703 1.00 . A A .  14 GLY O    1 1 
        6  3257 1 1 15 CYS C    C   -4.327   4.999   0.502 1.00 . A A .  15 CYS C    1 1 
        6  3258 1 1 15 CYS CA   C   -3.448   3.807   0.134 1.00 . A A .  15 CYS CA   1 1 
        6  3259 1 1 15 CYS CB   C   -2.727   4.079  -1.188 1.00 . A A .  15 CYS CB   1 1 
        6  3260 1 1 15 CYS H    H   -4.002   1.915  -0.637 1.00 . A A .  15 CYS H    1 1 
        6  3261 1 1 15 CYS HA   H   -2.713   3.664   0.911 1.00 . A A .  15 CYS HA   1 1 
        6  3262 1 1 15 CYS HB2  H   -1.911   3.379  -1.295 1.00 . A A .  15 CYS HB2  1 1 
        6  3263 1 1 15 CYS HB3  H   -3.422   3.941  -2.003 1.00 . A A .  15 CYS HB3  1 1 
        6  3264 1 1 15 CYS N    N   -4.241   2.588   0.036 1.00 . A A .  15 CYS N    1 1 
        6  3265 1 1 15 CYS O    O   -5.271   5.332  -0.214 1.00 . A A .  15 CYS O    1 1 
        6  3266 1 1 15 CYS SG   S   -2.036   5.759  -1.326 1.00 . A A .  15 CYS SG   1 1 
        6  3267 1 1 16 SER C    C   -4.042   8.091   1.763 1.00 . A A .  16 SER C    1 1 
        6  3268 1 1 16 SER CA   C   -4.771   6.791   2.089 1.00 . A A .  16 SER CA   1 1 
        6  3269 1 1 16 SER CB   C   -5.014   6.693   3.596 1.00 . A A .  16 SER CB   1 1 
        6  3270 1 1 16 SER H    H   -3.244   5.325   2.151 1.00 . A A .  16 SER H    1 1 
        6  3271 1 1 16 SER HA   H   -5.722   6.787   1.578 1.00 . A A .  16 SER HA   1 1 
        6  3272 1 1 16 SER HB2  H   -5.530   5.771   3.816 1.00 . A A .  16 SER HB2  1 1 
        6  3273 1 1 16 SER HB3  H   -4.065   6.707   4.112 1.00 . A A .  16 SER HB3  1 1 
        6  3274 1 1 16 SER HG   H   -6.731   7.547   3.996 1.00 . A A .  16 SER HG   1 1 
        6  3275 1 1 16 SER N    N   -4.009   5.638   1.623 1.00 . A A .  16 SER N    1 1 
        6  3276 1 1 16 SER O    O   -3.998   9.011   2.579 1.00 . A A .  16 SER O    1 1 
        6  3277 1 1 16 SER OG   O   -5.801   7.778   4.057 1.00 . A A .  16 SER OG   1 1 
        6  3278 1 1 17 GLU C    C   -3.307   9.878  -1.185 1.00 . A A .  17 GLU C    1 1 
        6  3279 1 1 17 GLU CA   C   -2.745   9.346   0.130 1.00 . A A .  17 GLU CA   1 1 
        6  3280 1 1 17 GLU CB   C   -1.257   9.029  -0.031 1.00 . A A .  17 GLU CB   1 1 
        6  3281 1 1 17 GLU CD   C   -0.848   8.283   2.348 1.00 . A A .  17 GLU CD   1 1 
        6  3282 1 1 17 GLU CG   C   -0.450   9.238   1.240 1.00 . A A .  17 GLU CG   1 1 
        6  3283 1 1 17 GLU H    H   -3.543   7.392  -0.043 1.00 . A A .  17 GLU H    1 1 
        6  3284 1 1 17 GLU HA   H   -2.862  10.103   0.890 1.00 . A A .  17 GLU HA   1 1 
        6  3285 1 1 17 GLU HB2  H   -1.151   7.997  -0.334 1.00 . A A .  17 GLU HB2  1 1 
        6  3286 1 1 17 GLU HB3  H   -0.847   9.665  -0.801 1.00 . A A .  17 GLU HB3  1 1 
        6  3287 1 1 17 GLU HG2  H    0.596   9.089   1.015 1.00 . A A .  17 GLU HG2  1 1 
        6  3288 1 1 17 GLU HG3  H   -0.602  10.250   1.585 1.00 . A A .  17 GLU HG3  1 1 
        6  3289 1 1 17 GLU N    N   -3.473   8.159   0.564 1.00 . A A .  17 GLU N    1 1 
        6  3290 1 1 17 GLU O    O   -3.741  11.027  -1.268 1.00 . A A .  17 GLU O    1 1 
        6  3291 1 1 17 GLU OE1  O   -0.985   7.073   2.067 1.00 . A A .  17 GLU OE1  1 1 
        6  3292 1 1 17 GLU OE2  O   -1.022   8.744   3.495 1.00 . A A .  17 GLU OE2  1 1 
        6  3293 1 1 18 CYS C    C   -5.190   8.829  -3.764 1.00 . A A .  18 CYS C    1 1 
        6  3294 1 1 18 CYS CA   C   -3.803   9.418  -3.523 1.00 . A A .  18 CYS CA   1 1 
        6  3295 1 1 18 CYS CB   C   -2.842   8.954  -4.620 1.00 . A A .  18 CYS CB   1 1 
        6  3296 1 1 18 CYS H    H   -2.937   8.131  -2.084 1.00 . A A .  18 CYS H    1 1 
        6  3297 1 1 18 CYS HA   H   -3.873  10.495  -3.550 1.00 . A A .  18 CYS HA   1 1 
        6  3298 1 1 18 CYS HB2  H   -3.119   9.425  -5.553 1.00 . A A .  18 CYS HB2  1 1 
        6  3299 1 1 18 CYS HB3  H   -1.838   9.251  -4.358 1.00 . A A .  18 CYS HB3  1 1 
        6  3300 1 1 18 CYS N    N   -3.296   9.034  -2.212 1.00 . A A .  18 CYS N    1 1 
        6  3301 1 1 18 CYS O    O   -6.097   9.520  -4.226 1.00 . A A .  18 CYS O    1 1 
        6  3302 1 1 18 CYS SG   S   -2.837   7.153  -4.891 1.00 . A A .  18 CYS SG   1 1 
        6  3303 1 1 19 GLY C    C   -6.514   5.645  -4.497 1.00 . A A .  19 GLY C    1 1 
        6  3304 1 1 19 GLY CA   C   -6.624   6.887  -3.636 1.00 . A A .  19 GLY CA   1 1 
        6  3305 1 1 19 GLY H    H   -4.586   7.046  -3.083 1.00 . A A .  19 GLY H    1 1 
        6  3306 1 1 19 GLY HA2  H   -7.019   6.609  -2.670 1.00 . A A .  19 GLY HA2  1 1 
        6  3307 1 1 19 GLY HA3  H   -7.307   7.578  -4.107 1.00 . A A .  19 GLY HA3  1 1 
        6  3308 1 1 19 GLY N    N   -5.346   7.547  -3.447 1.00 . A A .  19 GLY N    1 1 
        6  3309 1 1 19 GLY O    O   -7.324   5.431  -5.399 1.00 . A A .  19 GLY O    1 1 
        6  3310 1 1 20 LYS C    C   -5.304   2.380  -4.057 1.00 . A A .  20 LYS C    1 1 
        6  3311 1 1 20 LYS CA   C   -5.291   3.596  -4.978 1.00 . A A .  20 LYS CA   1 1 
        6  3312 1 1 20 LYS CB   C   -3.962   3.664  -5.733 1.00 . A A .  20 LYS CB   1 1 
        6  3313 1 1 20 LYS CD   C   -2.673   5.038  -7.394 1.00 . A A .  20 LYS CD   1 1 
        6  3314 1 1 20 LYS CE   C   -1.894   4.076  -8.278 1.00 . A A .  20 LYS CE   1 1 
        6  3315 1 1 20 LYS CG   C   -4.031   4.472  -7.017 1.00 . A A .  20 LYS CG   1 1 
        6  3316 1 1 20 LYS H    H   -4.893   5.048  -3.490 1.00 . A A .  20 LYS H    1 1 
        6  3317 1 1 20 LYS HA   H   -6.096   3.500  -5.692 1.00 . A A .  20 LYS HA   1 1 
        6  3318 1 1 20 LYS HB2  H   -3.219   4.112  -5.089 1.00 . A A .  20 LYS HB2  1 1 
        6  3319 1 1 20 LYS HB3  H   -3.651   2.659  -5.981 1.00 . A A .  20 LYS HB3  1 1 
        6  3320 1 1 20 LYS HD2  H   -2.814   5.966  -7.928 1.00 . A A .  20 LYS HD2  1 1 
        6  3321 1 1 20 LYS HD3  H   -2.107   5.223  -6.492 1.00 . A A .  20 LYS HD3  1 1 
        6  3322 1 1 20 LYS HE2  H   -1.866   3.110  -7.799 1.00 . A A .  20 LYS HE2  1 1 
        6  3323 1 1 20 LYS HE3  H   -2.399   3.993  -9.229 1.00 . A A .  20 LYS HE3  1 1 
        6  3324 1 1 20 LYS HG2  H   -4.377   3.833  -7.816 1.00 . A A .  20 LYS HG2  1 1 
        6  3325 1 1 20 LYS HG3  H   -4.726   5.288  -6.880 1.00 . A A .  20 LYS HG3  1 1 
        6  3326 1 1 20 LYS HZ1  H    0.173   3.915  -8.022 1.00 . A A .  20 LYS HZ1  1 1 
        6  3327 1 1 20 LYS HZ2  H   -0.380   5.509  -8.145 1.00 . A A .  20 LYS HZ2  1 1 
        6  3328 1 1 20 LYS HZ3  H   -0.284   4.538  -9.527 1.00 . A A .  20 LYS HZ3  1 1 
        6  3329 1 1 20 LYS N    N   -5.507   4.823  -4.222 1.00 . A A .  20 LYS N    1 1 
        6  3330 1 1 20 LYS NZ   N   -0.498   4.542  -8.509 1.00 . A A .  20 LYS NZ   1 1 
        6  3331 1 1 20 LYS O    O   -5.258   2.515  -2.835 1.00 . A A .  20 LYS O    1 1 
        6  3332 1 1 21 ALA C    C   -4.662  -1.164  -4.634 1.00 . A A .  21 ALA C    1 1 
        6  3333 1 1 21 ALA CA   C   -5.380  -0.046  -3.885 1.00 . A A .  21 ALA CA   1 1 
        6  3334 1 1 21 ALA CB   C   -6.811  -0.454  -3.569 1.00 . A A .  21 ALA CB   1 1 
        6  3335 1 1 21 ALA H    H   -5.400   1.150  -5.631 1.00 . A A .  21 ALA H    1 1 
        6  3336 1 1 21 ALA HA   H   -4.868   0.133  -2.951 1.00 . A A .  21 ALA HA   1 1 
        6  3337 1 1 21 ALA HB1  H   -7.482   0.343  -3.849 1.00 . A A .  21 ALA HB1  1 1 
        6  3338 1 1 21 ALA HB2  H   -7.061  -1.347  -4.124 1.00 . A A .  21 ALA HB2  1 1 
        6  3339 1 1 21 ALA HB3  H   -6.904  -0.650  -2.511 1.00 . A A .  21 ALA HB3  1 1 
        6  3340 1 1 21 ALA N    N   -5.365   1.193  -4.653 1.00 . A A .  21 ALA N    1 1 
        6  3341 1 1 21 ALA O    O   -4.216  -0.980  -5.767 1.00 . A A .  21 ALA O    1 1 
        6  3342 1 1 22 PHE C    C   -4.324  -4.770  -3.927 1.00 . A A .  22 PHE C    1 1 
        6  3343 1 1 22 PHE CA   C   -3.889  -3.472  -4.600 1.00 . A A .  22 PHE CA   1 1 
        6  3344 1 1 22 PHE CB   C   -2.369  -3.318  -4.503 1.00 . A A .  22 PHE CB   1 1 
        6  3345 1 1 22 PHE CD1  C   -1.557  -1.816  -6.341 1.00 . A A .  22 PHE CD1  1 1 
        6  3346 1 1 22 PHE CD2  C   -1.708  -0.925  -4.135 1.00 . A A .  22 PHE CD2  1 1 
        6  3347 1 1 22 PHE CE1  C   -1.094  -0.598  -6.804 1.00 . A A .  22 PHE CE1  1 1 
        6  3348 1 1 22 PHE CE2  C   -1.247   0.295  -4.591 1.00 . A A .  22 PHE CE2  1 1 
        6  3349 1 1 22 PHE CG   C   -1.868  -1.993  -5.003 1.00 . A A .  22 PHE CG   1 1 
        6  3350 1 1 22 PHE CZ   C   -0.940   0.459  -5.928 1.00 . A A .  22 PHE CZ   1 1 
        6  3351 1 1 22 PHE H    H   -4.930  -2.410  -3.094 1.00 . A A .  22 PHE H    1 1 
        6  3352 1 1 22 PHE HA   H   -4.172  -3.507  -5.641 1.00 . A A .  22 PHE HA   1 1 
        6  3353 1 1 22 PHE HB2  H   -2.070  -3.417  -3.470 1.00 . A A .  22 PHE HB2  1 1 
        6  3354 1 1 22 PHE HB3  H   -1.898  -4.094  -5.086 1.00 . A A .  22 PHE HB3  1 1 
        6  3355 1 1 22 PHE HD1  H   -1.677  -2.641  -7.028 1.00 . A A .  22 PHE HD1  1 1 
        6  3356 1 1 22 PHE HD2  H   -1.948  -1.053  -3.088 1.00 . A A .  22 PHE HD2  1 1 
        6  3357 1 1 22 PHE HE1  H   -0.855  -0.473  -7.849 1.00 . A A .  22 PHE HE1  1 1 
        6  3358 1 1 22 PHE HE2  H   -1.128   1.119  -3.904 1.00 . A A .  22 PHE HE2  1 1 
        6  3359 1 1 22 PHE HZ   H   -0.579   1.411  -6.287 1.00 . A A .  22 PHE HZ   1 1 
        6  3360 1 1 22 PHE N    N   -4.554  -2.324  -3.995 1.00 . A A .  22 PHE N    1 1 
        6  3361 1 1 22 PHE O    O   -4.626  -4.793  -2.734 1.00 . A A .  22 PHE O    1 1 
        6  3362 1 1 23 SER C    C   -3.544  -7.940  -3.695 1.00 . A A .  23 SER C    1 1 
        6  3363 1 1 23 SER CA   C   -4.756  -7.152  -4.183 1.00 . A A .  23 SER CA   1 1 
        6  3364 1 1 23 SER CB   C   -5.496  -7.948  -5.260 1.00 . A A .  23 SER CB   1 1 
        6  3365 1 1 23 SER H    H   -4.101  -5.768  -5.645 1.00 . A A .  23 SER H    1 1 
        6  3366 1 1 23 SER HA   H   -5.422  -6.985  -3.349 1.00 . A A .  23 SER HA   1 1 
        6  3367 1 1 23 SER HB2  H   -6.272  -7.333  -5.688 1.00 . A A .  23 SER HB2  1 1 
        6  3368 1 1 23 SER HB3  H   -4.798  -8.237  -6.032 1.00 . A A .  23 SER HB3  1 1 
        6  3369 1 1 23 SER HG   H   -6.442  -8.920  -3.846 1.00 . A A .  23 SER HG   1 1 
        6  3370 1 1 23 SER N    N   -4.354  -5.850  -4.702 1.00 . A A .  23 SER N    1 1 
        6  3371 1 1 23 SER O    O   -3.468  -9.156  -3.872 1.00 . A A .  23 SER O    1 1 
        6  3372 1 1 23 SER OG   O   -6.086  -9.116  -4.716 1.00 . A A .  23 SER OG   1 1 
        6  3373 1 1 24 SER C    C   -0.556  -6.878  -1.760 1.00 . A A .  24 SER C    1 1 
        6  3374 1 1 24 SER CA   C   -1.388  -7.870  -2.567 1.00 . A A .  24 SER CA   1 1 
        6  3375 1 1 24 SER CB   C   -0.555  -8.432  -3.721 1.00 . A A .  24 SER CB   1 1 
        6  3376 1 1 24 SER H    H   -2.717  -6.271  -2.967 1.00 . A A .  24 SER H    1 1 
        6  3377 1 1 24 SER HA   H   -1.686  -8.682  -1.921 1.00 . A A .  24 SER HA   1 1 
        6  3378 1 1 24 SER HB2  H    0.439  -8.659  -3.366 1.00 . A A .  24 SER HB2  1 1 
        6  3379 1 1 24 SER HB3  H   -1.020  -9.334  -4.091 1.00 . A A .  24 SER HB3  1 1 
        6  3380 1 1 24 SER HG   H   -0.286  -7.964  -5.604 1.00 . A A .  24 SER HG   1 1 
        6  3381 1 1 24 SER N    N   -2.599  -7.238  -3.078 1.00 . A A .  24 SER N    1 1 
        6  3382 1 1 24 SER O    O   -0.177  -5.818  -2.258 1.00 . A A .  24 SER O    1 1 
        6  3383 1 1 24 SER OG   O   -0.459  -7.498  -4.782 1.00 . A A .  24 SER OG   1 1 
        6  3384 1 1 25 LYS C    C    1.762  -5.868  -0.342 1.00 . A A .  25 LYS C    1 1 
        6  3385 1 1 25 LYS CA   C    0.511  -6.373   0.369 1.00 . A A .  25 LYS CA   1 1 
        6  3386 1 1 25 LYS CB   C    0.903  -7.132   1.638 1.00 . A A .  25 LYS CB   1 1 
        6  3387 1 1 25 LYS CD   C    2.501  -7.236   3.574 1.00 . A A .  25 LYS CD   1 1 
        6  3388 1 1 25 LYS CE   C    3.624  -8.029   2.923 1.00 . A A .  25 LYS CE   1 1 
        6  3389 1 1 25 LYS CG   C    1.801  -6.336   2.570 1.00 . A A .  25 LYS CG   1 1 
        6  3390 1 1 25 LYS H    H   -0.608  -8.088  -0.169 1.00 . A A .  25 LYS H    1 1 
        6  3391 1 1 25 LYS HA   H   -0.100  -5.525   0.641 1.00 . A A .  25 LYS HA   1 1 
        6  3392 1 1 25 LYS HB2  H    0.006  -7.398   2.177 1.00 . A A .  25 LYS HB2  1 1 
        6  3393 1 1 25 LYS HB3  H    1.424  -8.036   1.356 1.00 . A A .  25 LYS HB3  1 1 
        6  3394 1 1 25 LYS HD2  H    2.917  -6.627   4.363 1.00 . A A .  25 LYS HD2  1 1 
        6  3395 1 1 25 LYS HD3  H    1.780  -7.926   3.990 1.00 . A A .  25 LYS HD3  1 1 
        6  3396 1 1 25 LYS HE2  H    4.044  -7.441   2.121 1.00 . A A .  25 LYS HE2  1 1 
        6  3397 1 1 25 LYS HE3  H    4.386  -8.224   3.663 1.00 . A A .  25 LYS HE3  1 1 
        6  3398 1 1 25 LYS HG2  H    2.547  -5.820   1.984 1.00 . A A .  25 LYS HG2  1 1 
        6  3399 1 1 25 LYS HG3  H    1.199  -5.615   3.105 1.00 . A A .  25 LYS HG3  1 1 
        6  3400 1 1 25 LYS HZ1  H    2.220  -9.570   2.788 1.00 . A A .  25 LYS HZ1  1 1 
        6  3401 1 1 25 LYS HZ2  H    3.820 -10.082   2.590 1.00 . A A .  25 LYS HZ2  1 1 
        6  3402 1 1 25 LYS HZ3  H    3.036  -9.258   1.339 1.00 . A A .  25 LYS HZ3  1 1 
        6  3403 1 1 25 LYS N    N   -0.277  -7.230  -0.509 1.00 . A A .  25 LYS N    1 1 
        6  3404 1 1 25 LYS NZ   N    3.141  -9.325   2.371 1.00 . A A .  25 LYS NZ   1 1 
        6  3405 1 1 25 LYS O    O    2.073  -4.678  -0.303 1.00 . A A .  25 LYS O    1 1 
        6  3406 1 1 26 SER C    C    3.466  -5.217  -2.609 1.00 . A A .  26 SER C    1 1 
        6  3407 1 1 26 SER CA   C    3.696  -6.429  -1.711 1.00 . A A .  26 SER CA   1 1 
        6  3408 1 1 26 SER CB   C    4.180  -7.614  -2.548 1.00 . A A .  26 SER CB   1 1 
        6  3409 1 1 26 SER H    H    2.177  -7.715  -0.987 1.00 . A A .  26 SER H    1 1 
        6  3410 1 1 26 SER HA   H    4.451  -6.183  -0.980 1.00 . A A .  26 SER HA   1 1 
        6  3411 1 1 26 SER HB2  H    3.444  -7.842  -3.304 1.00 . A A .  26 SER HB2  1 1 
        6  3412 1 1 26 SER HB3  H    5.116  -7.357  -3.023 1.00 . A A .  26 SER HB3  1 1 
        6  3413 1 1 26 SER HG   H    3.818  -8.706  -0.963 1.00 . A A .  26 SER HG   1 1 
        6  3414 1 1 26 SER N    N    2.476  -6.781  -0.993 1.00 . A A .  26 SER N    1 1 
        6  3415 1 1 26 SER O    O    4.134  -4.192  -2.470 1.00 . A A .  26 SER O    1 1 
        6  3416 1 1 26 SER OG   O    4.377  -8.762  -1.742 1.00 . A A .  26 SER OG   1 1 
        6  3417 1 1 27 TYR C    C    2.101  -2.926  -3.716 1.00 . A A .  27 TYR C    1 1 
        6  3418 1 1 27 TYR CA   C    2.200  -4.259  -4.452 1.00 . A A .  27 TYR CA   1 1 
        6  3419 1 1 27 TYR CB   C    0.887  -4.550  -5.181 1.00 . A A .  27 TYR CB   1 1 
        6  3420 1 1 27 TYR CD1  C    1.191  -2.631  -6.795 1.00 . A A .  27 TYR CD1  1 1 
        6  3421 1 1 27 TYR CD2  C    0.381  -4.703  -7.651 1.00 . A A .  27 TYR CD2  1 1 
        6  3422 1 1 27 TYR CE1  C    1.129  -2.079  -8.060 1.00 . A A .  27 TYR CE1  1 1 
        6  3423 1 1 27 TYR CE2  C    0.317  -4.159  -8.919 1.00 . A A .  27 TYR CE2  1 1 
        6  3424 1 1 27 TYR CG   C    0.818  -3.950  -6.568 1.00 . A A .  27 TYR CG   1 1 
        6  3425 1 1 27 TYR CZ   C    0.692  -2.847  -9.118 1.00 . A A .  27 TYR CZ   1 1 
        6  3426 1 1 27 TYR H    H    2.018  -6.183  -3.591 1.00 . A A .  27 TYR H    1 1 
        6  3427 1 1 27 TYR HA   H    2.997  -4.197  -5.178 1.00 . A A .  27 TYR HA   1 1 
        6  3428 1 1 27 TYR HB2  H    0.765  -5.618  -5.277 1.00 . A A .  27 TYR HB2  1 1 
        6  3429 1 1 27 TYR HB3  H    0.066  -4.148  -4.605 1.00 . A A .  27 TYR HB3  1 1 
        6  3430 1 1 27 TYR HD1  H    1.534  -2.032  -5.963 1.00 . A A .  27 TYR HD1  1 1 
        6  3431 1 1 27 TYR HD2  H    0.088  -5.731  -7.491 1.00 . A A .  27 TYR HD2  1 1 
        6  3432 1 1 27 TYR HE1  H    1.423  -1.052  -8.216 1.00 . A A .  27 TYR HE1  1 1 
        6  3433 1 1 27 TYR HE2  H   -0.026  -4.760  -9.749 1.00 . A A .  27 TYR HE2  1 1 
        6  3434 1 1 27 TYR HH   H    0.000  -2.794 -10.911 1.00 . A A .  27 TYR HH   1 1 
        6  3435 1 1 27 TYR N    N    2.517  -5.342  -3.529 1.00 . A A .  27 TYR N    1 1 
        6  3436 1 1 27 TYR O    O    2.836  -1.984  -4.012 1.00 . A A .  27 TYR O    1 1 
        6  3437 1 1 27 TYR OH   O    0.630  -2.301 -10.380 1.00 . A A .  27 TYR OH   1 1 
        6  3438 1 1 28 LEU C    C    2.329  -1.027  -1.574 1.00 . A A .  28 LEU C    1 1 
        6  3439 1 1 28 LEU CA   C    0.991  -1.640  -1.972 1.00 . A A .  28 LEU CA   1 1 
        6  3440 1 1 28 LEU CB   C    0.163  -1.942  -0.722 1.00 . A A .  28 LEU CB   1 1 
        6  3441 1 1 28 LEU CD1  C   -0.968   0.269  -0.385 1.00 . A A .  28 LEU CD1  1 1 
        6  3442 1 1 28 LEU CD2  C   -0.625  -1.266   1.560 1.00 . A A .  28 LEU CD2  1 1 
        6  3443 1 1 28 LEU CG   C   -0.053  -0.772   0.239 1.00 . A A .  28 LEU CG   1 1 
        6  3444 1 1 28 LEU H    H    0.631  -3.640  -2.564 1.00 . A A .  28 LEU H    1 1 
        6  3445 1 1 28 LEU HA   H    0.454  -0.934  -2.588 1.00 . A A .  28 LEU HA   1 1 
        6  3446 1 1 28 LEU HB2  H   -0.807  -2.288  -1.044 1.00 . A A .  28 LEU HB2  1 1 
        6  3447 1 1 28 LEU HB3  H    0.662  -2.731  -0.178 1.00 . A A .  28 LEU HB3  1 1 
        6  3448 1 1 28 LEU HD11 H   -0.822   1.218   0.108 1.00 . A A .  28 LEU HD11 1 1 
        6  3449 1 1 28 LEU HD12 H   -1.997  -0.041  -0.271 1.00 . A A .  28 LEU HD12 1 1 
        6  3450 1 1 28 LEU HD13 H   -0.737   0.369  -1.436 1.00 . A A .  28 LEU HD13 1 1 
        6  3451 1 1 28 LEU HD21 H   -0.674  -2.344   1.550 1.00 . A A .  28 LEU HD21 1 1 
        6  3452 1 1 28 LEU HD22 H   -1.617  -0.861   1.695 1.00 . A A .  28 LEU HD22 1 1 
        6  3453 1 1 28 LEU HD23 H    0.010  -0.941   2.371 1.00 . A A .  28 LEU HD23 1 1 
        6  3454 1 1 28 LEU HG   H    0.899  -0.301   0.441 1.00 . A A .  28 LEU HG   1 1 
        6  3455 1 1 28 LEU N    N    1.187  -2.856  -2.754 1.00 . A A .  28 LEU N    1 1 
        6  3456 1 1 28 LEU O    O    2.565   0.163  -1.785 1.00 . A A .  28 LEU O    1 1 
        6  3457 1 1 29 ILE C    C    5.217  -0.616  -1.690 1.00 . A A .  29 ILE C    1 1 
        6  3458 1 1 29 ILE CA   C    4.518  -1.386  -0.575 1.00 . A A .  29 ILE CA   1 1 
        6  3459 1 1 29 ILE CB   C    5.413  -2.561  -0.139 1.00 . A A .  29 ILE CB   1 1 
        6  3460 1 1 29 ILE CD1  C    5.461  -4.637   1.333 1.00 . A A .  29 ILE CD1  1 1 
        6  3461 1 1 29 ILE CG1  C    4.743  -3.351   0.987 1.00 . A A .  29 ILE CG1  1 1 
        6  3462 1 1 29 ILE CG2  C    6.777  -2.053   0.303 1.00 . A A .  29 ILE CG2  1 1 
        6  3463 1 1 29 ILE H    H    2.956  -2.785  -0.858 1.00 . A A .  29 ILE H    1 1 
        6  3464 1 1 29 ILE HA   H    4.383  -0.729   0.272 1.00 . A A .  29 ILE HA   1 1 
        6  3465 1 1 29 ILE HB   H    5.556  -3.210  -0.989 1.00 . A A .  29 ILE HB   1 1 
        6  3466 1 1 29 ILE HD11 H    4.774  -5.311   1.825 1.00 . A A .  29 ILE HD11 1 1 
        6  3467 1 1 29 ILE HD12 H    5.831  -5.098   0.429 1.00 . A A .  29 ILE HD12 1 1 
        6  3468 1 1 29 ILE HD13 H    6.287  -4.422   1.993 1.00 . A A .  29 ILE HD13 1 1 
        6  3469 1 1 29 ILE HG12 H    4.709  -2.741   1.875 1.00 . A A .  29 ILE HG12 1 1 
        6  3470 1 1 29 ILE HG13 H    3.735  -3.603   0.689 1.00 . A A .  29 ILE HG13 1 1 
        6  3471 1 1 29 ILE HG21 H    7.307  -2.842   0.815 1.00 . A A .  29 ILE HG21 1 1 
        6  3472 1 1 29 ILE HG22 H    7.343  -1.743  -0.563 1.00 . A A .  29 ILE HG22 1 1 
        6  3473 1 1 29 ILE HG23 H    6.650  -1.213   0.970 1.00 . A A .  29 ILE HG23 1 1 
        6  3474 1 1 29 ILE N    N    3.202  -1.847  -0.999 1.00 . A A .  29 ILE N    1 1 
        6  3475 1 1 29 ILE O    O    5.575   0.550  -1.522 1.00 . A A .  29 ILE O    1 1 
        6  3476 1 1 30 ILE C    C    5.462   0.721  -4.265 1.00 . A A .  30 ILE C    1 1 
        6  3477 1 1 30 ILE CA   C    6.059  -0.651  -3.972 1.00 . A A .  30 ILE CA   1 1 
        6  3478 1 1 30 ILE CB   C    5.945  -1.528  -5.233 1.00 . A A .  30 ILE CB   1 1 
        6  3479 1 1 30 ILE CD1  C    5.924  -4.010  -5.799 1.00 . A A .  30 ILE CD1  1 1 
        6  3480 1 1 30 ILE CG1  C    6.556  -2.907  -4.978 1.00 . A A .  30 ILE CG1  1 1 
        6  3481 1 1 30 ILE CG2  C    6.625  -0.851  -6.413 1.00 . A A .  30 ILE CG2  1 1 
        6  3482 1 1 30 ILE H    H    5.098  -2.202  -2.900 1.00 . A A .  30 ILE H    1 1 
        6  3483 1 1 30 ILE HA   H    7.106  -0.533  -3.734 1.00 . A A .  30 ILE HA   1 1 
        6  3484 1 1 30 ILE HB   H    4.898  -1.644  -5.470 1.00 . A A .  30 ILE HB   1 1 
        6  3485 1 1 30 ILE HD11 H    6.684  -4.495  -6.395 1.00 . A A .  30 ILE HD11 1 1 
        6  3486 1 1 30 ILE HD12 H    5.468  -4.733  -5.140 1.00 . A A .  30 ILE HD12 1 1 
        6  3487 1 1 30 ILE HD13 H    5.172  -3.589  -6.449 1.00 . A A .  30 ILE HD13 1 1 
        6  3488 1 1 30 ILE HG12 H    7.608  -2.878  -5.218 1.00 . A A .  30 ILE HG12 1 1 
        6  3489 1 1 30 ILE HG13 H    6.436  -3.159  -3.935 1.00 . A A .  30 ILE HG13 1 1 
        6  3490 1 1 30 ILE HG21 H    6.117   0.075  -6.638 1.00 . A A .  30 ILE HG21 1 1 
        6  3491 1 1 30 ILE HG22 H    7.655  -0.643  -6.164 1.00 . A A .  30 ILE HG22 1 1 
        6  3492 1 1 30 ILE HG23 H    6.587  -1.501  -7.274 1.00 . A A .  30 ILE HG23 1 1 
        6  3493 1 1 30 ILE N    N    5.406  -1.275  -2.828 1.00 . A A .  30 ILE N    1 1 
        6  3494 1 1 30 ILE O    O    6.180   1.665  -4.597 1.00 . A A .  30 ILE O    1 1 
        6  3495 1 1 31 HIS C    C    3.752   3.099  -3.290 1.00 . A A .  31 HIS C    1 1 
        6  3496 1 1 31 HIS CA   C    3.448   2.084  -4.388 1.00 . A A .  31 HIS CA   1 1 
        6  3497 1 1 31 HIS CB   C    1.940   1.849  -4.478 1.00 . A A .  31 HIS CB   1 1 
        6  3498 1 1 31 HIS CD2  C    0.511   3.747  -3.437 1.00 . A A .  31 HIS CD2  1 1 
        6  3499 1 1 31 HIS CE1  C    0.160   4.919  -5.256 1.00 . A A .  31 HIS CE1  1 1 
        6  3500 1 1 31 HIS CG   C    1.135   3.112  -4.456 1.00 . A A .  31 HIS CG   1 1 
        6  3501 1 1 31 HIS H    H    3.624   0.038  -3.872 1.00 . A A .  31 HIS H    1 1 
        6  3502 1 1 31 HIS HA   H    3.799   2.475  -5.331 1.00 . A A .  31 HIS HA   1 1 
        6  3503 1 1 31 HIS HB2  H    1.717   1.330  -5.398 1.00 . A A .  31 HIS HB2  1 1 
        6  3504 1 1 31 HIS HB3  H    1.626   1.240  -3.642 1.00 . A A .  31 HIS HB3  1 1 
        6  3505 1 1 31 HIS HD1  H    1.216   3.671  -6.486 1.00 . A A .  31 HIS HD1  1 1 
        6  3506 1 1 31 HIS HD2  H    0.489   3.432  -2.402 1.00 . A A .  31 HIS HD2  1 1 
        6  3507 1 1 31 HIS HE1  H   -0.182   5.687  -5.933 1.00 . A A .  31 HIS HE1  1 1 
        6  3508 1 1 31 HIS N    N    4.143   0.825  -4.139 1.00 . A A .  31 HIS N    1 1 
        6  3509 1 1 31 HIS ND1  N    0.895   3.870  -5.582 1.00 . A A .  31 HIS ND1  1 1 
        6  3510 1 1 31 HIS NE2  N   -0.087   4.867  -3.959 1.00 . A A .  31 HIS NE2  1 1 
        6  3511 1 1 31 HIS O    O    4.009   4.270  -3.569 1.00 . A A .  31 HIS O    1 1 
        6  3512 1 1 32 MET C    C    5.297   4.276  -1.105 1.00 . A A .  32 MET C    1 1 
        6  3513 1 1 32 MET CA   C    3.993   3.510  -0.904 1.00 . A A .  32 MET CA   1 1 
        6  3514 1 1 32 MET CB   C    4.064   2.689   0.385 1.00 . A A .  32 MET CB   1 1 
        6  3515 1 1 32 MET CE   C    1.391   4.964   1.250 1.00 . A A .  32 MET CE   1 1 
        6  3516 1 1 32 MET CG   C    2.722   2.539   1.084 1.00 . A A .  32 MET CG   1 1 
        6  3517 1 1 32 MET H    H    3.510   1.697  -1.884 1.00 . A A .  32 MET H    1 1 
        6  3518 1 1 32 MET HA   H    3.182   4.218  -0.825 1.00 . A A .  32 MET HA   1 1 
        6  3519 1 1 32 MET HB2  H    4.436   1.703   0.150 1.00 . A A .  32 MET HB2  1 1 
        6  3520 1 1 32 MET HB3  H    4.749   3.170   1.068 1.00 . A A .  32 MET HB3  1 1 
        6  3521 1 1 32 MET HE1  H    0.482   5.207   1.782 1.00 . A A .  32 MET HE1  1 1 
        6  3522 1 1 32 MET HE2  H    1.940   5.870   1.044 1.00 . A A .  32 MET HE2  1 1 
        6  3523 1 1 32 MET HE3  H    1.144   4.472   0.321 1.00 . A A .  32 MET HE3  1 1 
        6  3524 1 1 32 MET HG2  H    1.941   2.534   0.339 1.00 . A A .  32 MET HG2  1 1 
        6  3525 1 1 32 MET HG3  H    2.713   1.600   1.617 1.00 . A A .  32 MET HG3  1 1 
        6  3526 1 1 32 MET N    N    3.721   2.641  -2.043 1.00 . A A .  32 MET N    1 1 
        6  3527 1 1 32 MET O    O    5.481   5.362  -0.553 1.00 . A A .  32 MET O    1 1 
        6  3528 1 1 32 MET SD   S    2.395   3.872   2.254 1.00 . A A .  32 MET SD   1 1 
        6  3529 1 1 33 ARG C    C    7.296   5.736  -2.738 1.00 . A A .  33 ARG C    1 1 
        6  3530 1 1 33 ARG CA   C    7.485   4.333  -2.168 1.00 . A A .  33 ARG CA   1 1 
        6  3531 1 1 33 ARG CB   C    8.298   3.480  -3.143 1.00 . A A .  33 ARG CB   1 1 
        6  3532 1 1 33 ARG CD   C    9.633   1.386  -3.528 1.00 . A A .  33 ARG CD   1 1 
        6  3533 1 1 33 ARG CG   C    8.717   2.135  -2.573 1.00 . A A .  33 ARG CG   1 1 
        6  3534 1 1 33 ARG CZ   C   10.927   3.066  -4.773 1.00 . A A .  33 ARG CZ   1 1 
        6  3535 1 1 33 ARG H    H    5.994   2.838  -2.307 1.00 . A A .  33 ARG H    1 1 
        6  3536 1 1 33 ARG HA   H    8.023   4.407  -1.234 1.00 . A A .  33 ARG HA   1 1 
        6  3537 1 1 33 ARG HB2  H    7.706   3.302  -4.028 1.00 . A A .  33 ARG HB2  1 1 
        6  3538 1 1 33 ARG HB3  H    9.190   4.023  -3.420 1.00 . A A .  33 ARG HB3  1 1 
        6  3539 1 1 33 ARG HD2  H    9.907   0.443  -3.078 1.00 . A A .  33 ARG HD2  1 1 
        6  3540 1 1 33 ARG HD3  H    9.100   1.204  -4.449 1.00 . A A .  33 ARG HD3  1 1 
        6  3541 1 1 33 ARG HE   H   11.646   1.944  -3.288 1.00 . A A .  33 ARG HE   1 1 
        6  3542 1 1 33 ARG HG2  H    9.240   2.296  -1.642 1.00 . A A .  33 ARG HG2  1 1 
        6  3543 1 1 33 ARG HG3  H    7.834   1.540  -2.394 1.00 . A A .  33 ARG HG3  1 1 
        6  3544 1 1 33 ARG HH11 H    9.003   2.869  -5.357 1.00 . A A .  33 ARG HH11 1 1 
        6  3545 1 1 33 ARG HH12 H    9.925   4.050  -6.227 1.00 . A A .  33 ARG HH12 1 1 
        6  3546 1 1 33 ARG HH21 H   12.871   3.496  -4.426 1.00 . A A .  33 ARG HH21 1 1 
        6  3547 1 1 33 ARG HH22 H   12.126   4.405  -5.697 1.00 . A A .  33 ARG HH22 1 1 
        6  3548 1 1 33 ARG N    N    6.199   3.704  -1.896 1.00 . A A .  33 ARG N    1 1 
        6  3549 1 1 33 ARG NE   N   10.849   2.139  -3.824 1.00 . A A .  33 ARG NE   1 1 
        6  3550 1 1 33 ARG NH1  N    9.865   3.351  -5.514 1.00 . A A .  33 ARG NH1  1 1 
        6  3551 1 1 33 ARG NH2  N   12.068   3.709  -4.982 1.00 . A A .  33 ARG NH2  1 1 
        6  3552 1 1 33 ARG O    O    8.072   6.647  -2.449 1.00 . A A .  33 ARG O    1 1 
        6  3553 1 1 34 THR C    C    5.533   8.213  -3.118 1.00 . A A .  34 THR C    1 1 
        6  3554 1 1 34 THR CA   C    5.966   7.193  -4.164 1.00 . A A .  34 THR CA   1 1 
        6  3555 1 1 34 THR CB   C    4.864   7.071  -5.233 1.00 . A A .  34 THR CB   1 1 
        6  3556 1 1 34 THR CG2  C    5.285   6.114  -6.338 1.00 . A A .  34 THR CG2  1 1 
        6  3557 1 1 34 THR H    H    5.675   5.139  -3.744 1.00 . A A .  34 THR H    1 1 
        6  3558 1 1 34 THR HA   H    6.867   7.545  -4.645 1.00 . A A .  34 THR HA   1 1 
        6  3559 1 1 34 THR HB   H    4.694   8.046  -5.667 1.00 . A A .  34 THR HB   1 1 
        6  3560 1 1 34 THR HG1  H    3.854   6.089  -3.852 1.00 . A A .  34 THR HG1  1 1 
        6  3561 1 1 34 THR HG21 H    6.031   5.433  -5.959 1.00 . A A .  34 THR HG21 1 1 
        6  3562 1 1 34 THR HG22 H    5.698   6.676  -7.163 1.00 . A A .  34 THR HG22 1 1 
        6  3563 1 1 34 THR HG23 H    4.426   5.555  -6.678 1.00 . A A .  34 THR HG23 1 1 
        6  3564 1 1 34 THR N    N    6.257   5.903  -3.552 1.00 . A A .  34 THR N    1 1 
        6  3565 1 1 34 THR O    O    5.900   9.386  -3.190 1.00 . A A .  34 THR O    1 1 
        6  3566 1 1 34 THR OG1  O    3.648   6.609  -4.633 1.00 . A A .  34 THR OG1  1 1 
        6  3567 1 1 35 HIS C    C    5.280   8.714   0.058 1.00 . A A .  35 HIS C    1 1 
        6  3568 1 1 35 HIS CA   C    4.267   8.633  -1.081 1.00 . A A .  35 HIS CA   1 1 
        6  3569 1 1 35 HIS CB   C    2.924   8.132  -0.549 1.00 . A A .  35 HIS CB   1 1 
        6  3570 1 1 35 HIS CD2  C    0.825   7.377  -1.872 1.00 . A A .  35 HIS CD2  1 1 
        6  3571 1 1 35 HIS CE1  C    0.554   9.175  -3.097 1.00 . A A .  35 HIS CE1  1 1 
        6  3572 1 1 35 HIS CG   C    1.807   8.247  -1.540 1.00 . A A .  35 HIS CG   1 1 
        6  3573 1 1 35 HIS H    H    4.491   6.814  -2.140 1.00 . A A .  35 HIS H    1 1 
        6  3574 1 1 35 HIS HA   H    4.134   9.620  -1.498 1.00 . A A .  35 HIS HA   1 1 
        6  3575 1 1 35 HIS HB2  H    3.019   7.091  -0.276 1.00 . A A .  35 HIS HB2  1 1 
        6  3576 1 1 35 HIS HB3  H    2.654   8.705   0.326 1.00 . A A .  35 HIS HB3  1 1 
        6  3577 1 1 35 HIS HD1  H    2.162  10.172  -2.318 1.00 . A A .  35 HIS HD1  1 1 
        6  3578 1 1 35 HIS HD2  H    0.670   6.393  -1.452 1.00 . A A .  35 HIS HD2  1 1 
        6  3579 1 1 35 HIS HE1  H    0.162   9.880  -3.814 1.00 . A A .  35 HIS HE1  1 1 
        6  3580 1 1 35 HIS N    N    4.750   7.759  -2.144 1.00 . A A .  35 HIS N    1 1 
        6  3581 1 1 35 HIS ND1  N    1.610   9.363  -2.326 1.00 . A A .  35 HIS ND1  1 1 
        6  3582 1 1 35 HIS NE2  N    0.059   7.977  -2.841 1.00 . A A .  35 HIS NE2  1 1 
        6  3583 1 1 35 HIS O    O    4.928   8.557   1.227 1.00 . A A .  35 HIS O    1 1 
        6  3584 1 1 36 SER C    C    7.134   9.835   1.925 1.00 . A A .  36 SER C    1 1 
        6  3585 1 1 36 SER CA   C    7.603   9.058   0.699 1.00 . A A .  36 SER CA   1 1 
        6  3586 1 1 36 SER CB   C    8.834   9.733   0.092 1.00 . A A .  36 SER CB   1 1 
        6  3587 1 1 36 SER H    H    6.756   9.076  -1.241 1.00 . A A .  36 SER H    1 1 
        6  3588 1 1 36 SER HA   H    7.866   8.055   1.002 1.00 . A A .  36 SER HA   1 1 
        6  3589 1 1 36 SER HB2  H    9.085   9.249  -0.839 1.00 . A A .  36 SER HB2  1 1 
        6  3590 1 1 36 SER HB3  H    8.615  10.776  -0.091 1.00 . A A .  36 SER HB3  1 1 
        6  3591 1 1 36 SER HG   H    9.844   8.884   1.540 1.00 . A A .  36 SER HG   1 1 
        6  3592 1 1 36 SER N    N    6.539   8.960  -0.293 1.00 . A A .  36 SER N    1 1 
        6  3593 1 1 36 SER O    O    6.601  10.938   1.808 1.00 . A A .  36 SER O    1 1 
        6  3594 1 1 36 SER OG   O    9.946   9.647   0.966 1.00 . A A .  36 SER OG   1 1 
        6  3595 1 1 37 GLY C    C    7.723   9.424   5.532 1.00 . A A .  37 GLY C    1 1 
        6  3596 1 1 37 GLY CA   C    6.929   9.902   4.333 1.00 . A A .  37 GLY CA   1 1 
        6  3597 1 1 37 GLY H    H    7.766   8.371   3.135 1.00 . A A .  37 GLY H    1 1 
        6  3598 1 1 37 GLY HA2  H    7.065  10.968   4.226 1.00 . A A .  37 GLY HA2  1 1 
        6  3599 1 1 37 GLY HA3  H    5.882   9.699   4.505 1.00 . A A .  37 GLY HA3  1 1 
        6  3600 1 1 37 GLY N    N    7.336   9.251   3.102 1.00 . A A .  37 GLY N    1 1 
        6  3601 1 1 37 GLY O    O    8.280  10.230   6.277 1.00 . A A .  37 GLY O    1 1 
        6  3602 1 1 38 GLU C    C    9.687   6.697   6.346 1.00 . A A .  38 GLU C    1 1 
        6  3603 1 1 38 GLU CA   C    8.505   7.526   6.840 1.00 . A A .  38 GLU CA   1 1 
        6  3604 1 1 38 GLU CB   C    7.575   6.654   7.686 1.00 . A A .  38 GLU CB   1 1 
        6  3605 1 1 38 GLU CD   C    8.363   6.981  10.063 1.00 . A A .  38 GLU CD   1 1 
        6  3606 1 1 38 GLU CG   C    8.257   6.027   8.890 1.00 . A A .  38 GLU CG   1 1 
        6  3607 1 1 38 GLU H    H    7.311   7.518   5.092 1.00 . A A .  38 GLU H    1 1 
        6  3608 1 1 38 GLU HA   H    8.878   8.335   7.449 1.00 . A A .  38 GLU HA   1 1 
        6  3609 1 1 38 GLU HB2  H    6.754   7.261   8.038 1.00 . A A .  38 GLU HB2  1 1 
        6  3610 1 1 38 GLU HB3  H    7.183   5.861   7.066 1.00 . A A .  38 GLU HB3  1 1 
        6  3611 1 1 38 GLU HG2  H    7.689   5.162   9.199 1.00 . A A .  38 GLU HG2  1 1 
        6  3612 1 1 38 GLU HG3  H    9.252   5.719   8.604 1.00 . A A .  38 GLU HG3  1 1 
        6  3613 1 1 38 GLU N    N    7.775   8.109   5.720 1.00 . A A .  38 GLU N    1 1 
        6  3614 1 1 38 GLU O    O    9.622   5.469   6.296 1.00 . A A .  38 GLU O    1 1 
        6  3615 1 1 38 GLU OE1  O    7.312   7.322  10.646 1.00 . A A .  38 GLU OE1  1 1 
        6  3616 1 1 38 GLU OE2  O    9.495   7.387  10.399 1.00 . A A .  38 GLU OE2  1 1 
        6  3617 1 1 39 LYS C    C   12.940   6.431   6.630 1.00 . A A .  39 LYS C    1 1 
        6  3618 1 1 39 LYS CA   C   11.966   6.707   5.489 1.00 . A A .  39 LYS CA   1 1 
        6  3619 1 1 39 LYS CB   C   12.648   7.557   4.415 1.00 . A A .  39 LYS CB   1 1 
        6  3620 1 1 39 LYS CD   C   12.158   6.189   2.367 1.00 . A A .  39 LYS CD   1 1 
        6  3621 1 1 39 LYS CE   C   13.463   6.176   1.586 1.00 . A A .  39 LYS CE   1 1 
        6  3622 1 1 39 LYS CG   C   11.944   7.519   3.070 1.00 . A A .  39 LYS CG   1 1 
        6  3623 1 1 39 LYS H    H   10.759   8.357   6.041 1.00 . A A .  39 LYS H    1 1 
        6  3624 1 1 39 LYS HA   H   11.665   5.766   5.054 1.00 . A A .  39 LYS HA   1 1 
        6  3625 1 1 39 LYS HB2  H   12.681   8.583   4.752 1.00 . A A .  39 LYS HB2  1 1 
        6  3626 1 1 39 LYS HB3  H   13.659   7.200   4.279 1.00 . A A .  39 LYS HB3  1 1 
        6  3627 1 1 39 LYS HD2  H   12.185   5.401   3.105 1.00 . A A .  39 LYS HD2  1 1 
        6  3628 1 1 39 LYS HD3  H   11.338   6.017   1.684 1.00 . A A .  39 LYS HD3  1 1 
        6  3629 1 1 39 LYS HE2  H   13.418   6.936   0.821 1.00 . A A .  39 LYS HE2  1 1 
        6  3630 1 1 39 LYS HE3  H   14.275   6.394   2.264 1.00 . A A .  39 LYS HE3  1 1 
        6  3631 1 1 39 LYS HG2  H   10.885   7.666   3.224 1.00 . A A .  39 LYS HG2  1 1 
        6  3632 1 1 39 LYS HG3  H   12.333   8.312   2.448 1.00 . A A .  39 LYS HG3  1 1 
        6  3633 1 1 39 LYS HZ1  H   14.684   4.812   0.578 1.00 . A A .  39 LYS HZ1  1 1 
        6  3634 1 1 39 LYS HZ2  H   13.049   4.714   0.152 1.00 . A A .  39 LYS HZ2  1 1 
        6  3635 1 1 39 LYS HZ3  H   13.577   4.090   1.633 1.00 . A A .  39 LYS HZ3  1 1 
        6  3636 1 1 39 LYS N    N   10.768   7.378   5.979 1.00 . A A .  39 LYS N    1 1 
        6  3637 1 1 39 LYS NZ   N   13.711   4.856   0.942 1.00 . A A .  39 LYS NZ   1 1 
        6  3638 1 1 39 LYS O    O   13.047   7.200   7.586 1.00 . A A .  39 LYS O    1 1 
        6  3639 1 1 40 PRO C    C   15.873   5.820   7.558 1.00 . A A .  40 PRO C    1 1 
        6  3640 1 1 40 PRO CA   C   14.650   4.909   7.542 1.00 . A A .  40 PRO CA   1 1 
        6  3641 1 1 40 PRO CB   C   15.043   3.493   7.114 1.00 . A A .  40 PRO CB   1 1 
        6  3642 1 1 40 PRO CD   C   13.594   4.348   5.416 1.00 . A A .  40 PRO CD   1 1 
        6  3643 1 1 40 PRO CG   C   14.780   3.454   5.648 1.00 . A A .  40 PRO CG   1 1 
        6  3644 1 1 40 PRO HA   H   14.211   4.880   8.529 1.00 . A A .  40 PRO HA   1 1 
        6  3645 1 1 40 PRO HB2  H   16.088   3.326   7.333 1.00 . A A .  40 PRO HB2  1 1 
        6  3646 1 1 40 PRO HB3  H   14.439   2.772   7.643 1.00 . A A .  40 PRO HB3  1 1 
        6  3647 1 1 40 PRO HD2  H   13.681   4.851   4.465 1.00 . A A .  40 PRO HD2  1 1 
        6  3648 1 1 40 PRO HD3  H   12.677   3.779   5.462 1.00 . A A .  40 PRO HD3  1 1 
        6  3649 1 1 40 PRO HG2  H   15.640   3.824   5.111 1.00 . A A .  40 PRO HG2  1 1 
        6  3650 1 1 40 PRO HG3  H   14.552   2.443   5.344 1.00 . A A .  40 PRO HG3  1 1 
        6  3651 1 1 40 PRO N    N   13.670   5.310   6.528 1.00 . A A .  40 PRO N    1 1 
        6  3652 1 1 40 PRO O    O   15.912   6.834   6.862 1.00 . A A .  40 PRO O    1 1 
        6  3653 1 1 41 SER C    C   18.674   6.531   7.087 1.00 . A A .  41 SER C    1 1 
        6  3654 1 1 41 SER CA   C   18.092   6.237   8.467 1.00 . A A .  41 SER CA   1 1 
        6  3655 1 1 41 SER CB   C   19.123   5.499   9.321 1.00 . A A .  41 SER CB   1 1 
        6  3656 1 1 41 SER H    H   16.777   4.632   8.888 1.00 . A A .  41 SER H    1 1 
        6  3657 1 1 41 SER HA   H   17.843   7.173   8.946 1.00 . A A .  41 SER HA   1 1 
        6  3658 1 1 41 SER HB2  H   18.646   5.127  10.215 1.00 . A A .  41 SER HB2  1 1 
        6  3659 1 1 41 SER HB3  H   19.527   4.670   8.757 1.00 . A A .  41 SER HB3  1 1 
        6  3660 1 1 41 SER HG   H   20.986   5.843   9.823 1.00 . A A .  41 SER HG   1 1 
        6  3661 1 1 41 SER N    N   16.869   5.451   8.358 1.00 . A A .  41 SER N    1 1 
        6  3662 1 1 41 SER O    O   19.198   5.640   6.420 1.00 . A A .  41 SER O    1 1 
        6  3663 1 1 41 SER OG   O   20.186   6.358   9.695 1.00 . A A .  41 SER OG   1 1 
        6  3664 1 1 42 GLY C    C   20.332   9.052   5.479 1.00 . A A .  42 GLY C    1 1 
        6  3665 1 1 42 GLY CA   C   19.098   8.179   5.369 1.00 . A A .  42 GLY CA   1 1 
        6  3666 1 1 42 GLY H    H   18.150   8.457   7.242 1.00 . A A .  42 GLY H    1 1 
        6  3667 1 1 42 GLY HA2  H   19.348   7.289   4.811 1.00 . A A .  42 GLY HA2  1 1 
        6  3668 1 1 42 GLY HA3  H   18.333   8.723   4.836 1.00 . A A .  42 GLY HA3  1 1 
        6  3669 1 1 42 GLY N    N   18.578   7.789   6.667 1.00 . A A .  42 GLY N    1 1 
        6  3670 1 1 42 GLY O    O   21.457   8.563   5.589 1.00 . A A .  42 GLY O    1 1 
        6  3671 1 1 43 PRO C    C   21.854  11.379   6.929 1.00 . A A .  43 PRO C    1 1 
        6  3672 1 1 43 PRO CA   C   21.224  11.348   5.541 1.00 . A A .  43 PRO CA   1 1 
        6  3673 1 1 43 PRO CB   C   20.540  12.683   5.234 1.00 . A A .  43 PRO CB   1 1 
        6  3674 1 1 43 PRO CD   C   18.816  11.030   5.318 1.00 . A A .  43 PRO CD   1 1 
        6  3675 1 1 43 PRO CG   C   19.114  12.475   5.610 1.00 . A A .  43 PRO CG   1 1 
        6  3676 1 1 43 PRO HA   H   21.989  11.156   4.803 1.00 . A A .  43 PRO HA   1 1 
        6  3677 1 1 43 PRO HB2  H   20.995  13.467   5.823 1.00 . A A .  43 PRO HB2  1 1 
        6  3678 1 1 43 PRO HB3  H   20.642  12.910   4.183 1.00 . A A .  43 PRO HB3  1 1 
        6  3679 1 1 43 PRO HD2  H   18.116  10.636   6.040 1.00 . A A .  43 PRO HD2  1 1 
        6  3680 1 1 43 PRO HD3  H   18.429  10.921   4.315 1.00 . A A .  43 PRO HD3  1 1 
        6  3681 1 1 43 PRO HG2  H   18.978  12.680   6.661 1.00 . A A .  43 PRO HG2  1 1 
        6  3682 1 1 43 PRO HG3  H   18.480  13.116   5.016 1.00 . A A .  43 PRO HG3  1 1 
        6  3683 1 1 43 PRO N    N   20.129  10.377   5.447 1.00 . A A .  43 PRO N    1 1 
        6  3684 1 1 43 PRO O    O   21.587  10.513   7.762 1.00 . A A .  43 PRO O    1 1 
        6  3685 1 1 44 SER C    C   22.553  13.416   9.397 1.00 . A A .  44 SER C    1 1 
        6  3686 1 1 44 SER CA   C   23.361  12.525   8.459 1.00 . A A .  44 SER CA   1 1 
        6  3687 1 1 44 SER CB   C   24.763  13.107   8.266 1.00 . A A .  44 SER CB   1 1 
        6  3688 1 1 44 SER H    H   22.863  13.043   6.467 1.00 . A A .  44 SER H    1 1 
        6  3689 1 1 44 SER HA   H   23.446  11.542   8.898 1.00 . A A .  44 SER HA   1 1 
        6  3690 1 1 44 SER HB2  H   25.209  12.679   7.381 1.00 . A A .  44 SER HB2  1 1 
        6  3691 1 1 44 SER HB3  H   24.692  14.179   8.151 1.00 . A A .  44 SER HB3  1 1 
        6  3692 1 1 44 SER HG   H   25.416  13.451  10.080 1.00 . A A .  44 SER HG   1 1 
        6  3693 1 1 44 SER N    N   22.691  12.383   7.172 1.00 . A A .  44 SER N    1 1 
        6  3694 1 1 44 SER O    O   23.069  14.392   9.942 1.00 . A A .  44 SER O    1 1 
        6  3695 1 1 44 SER OG   O   25.592  12.820   9.379 1.00 . A A .  44 SER OG   1 1 
        6  3696 1 1 45 SER C    C   19.337  12.945  11.076 1.00 . A A .  45 SER C    1 1 
        6  3697 1 1 45 SER CA   C   20.401  13.842  10.451 1.00 . A A .  45 SER CA   1 1 
        6  3698 1 1 45 SER CB   C   19.734  14.972   9.664 1.00 . A A .  45 SER CB   1 1 
        6  3699 1 1 45 SER H    H   20.930  12.283   9.119 1.00 . A A .  45 SER H    1 1 
        6  3700 1 1 45 SER HA   H   21.003  14.270  11.239 1.00 . A A .  45 SER HA   1 1 
        6  3701 1 1 45 SER HB2  H   19.530  14.636   8.659 1.00 . A A .  45 SER HB2  1 1 
        6  3702 1 1 45 SER HB3  H   18.806  15.244  10.147 1.00 . A A .  45 SER HB3  1 1 
        6  3703 1 1 45 SER HG   H   20.684  16.475  10.486 1.00 . A A .  45 SER HG   1 1 
        6  3704 1 1 45 SER N    N   21.283  13.072   9.581 1.00 . A A .  45 SER N    1 1 
        6  3705 1 1 45 SER O    O   18.723  12.123  10.397 1.00 . A A .  45 SER O    1 1 
        6  3706 1 1 45 SER OG   O   20.570  16.114   9.604 1.00 . A A .  45 SER OG   1 1 
        6  3707 1 1 46 GLY C    C   16.861  12.132  12.271 1.00 . A A .  46 GLY C    1 1 
        6  3708 1 1 46 GLY CA   C   18.134  12.310  13.075 1.00 . A A .  46 GLY CA   1 1 
        6  3709 1 1 46 GLY H    H   19.642  13.781  12.870 1.00 . A A .  46 GLY H    1 1 
        6  3710 1 1 46 GLY HA2  H   18.555  11.337  13.283 1.00 . A A .  46 GLY HA2  1 1 
        6  3711 1 1 46 GLY HA3  H   17.890  12.793  14.010 1.00 . A A .  46 GLY HA3  1 1 
        6  3712 1 1 46 GLY N    N   19.123  13.110  12.378 1.00 . A A .  46 GLY N    1 1 
        6  3713 1 1 46 GLY O    O   15.789  12.022  12.863 1.00 . A A .  46 GLY O    1 1 
        6  3714 2 2  1 ZN  ZN   ZN  -1.293   6.432  -3.273 1.00 . B A . 201 ZN  ZN   1 1 
        7  3715 1 1  1 GLY C    C  -33.339   6.722  -0.027 1.00 . A A .   1 GLY C    1 1 
        7  3716 1 1  1 GLY CA   C  -34.289   6.314  -1.136 1.00 . A A .   1 GLY CA   1 1 
        7  3717 1 1  1 GLY H1   H  -35.758   7.624  -0.354 1.00 . A A .   1 GLY H1   1 1 
        7  3718 1 1  1 GLY HA2  H  -34.555   5.276  -1.004 1.00 . A A .   1 GLY HA2  1 1 
        7  3719 1 1  1 GLY HA3  H  -33.787   6.428  -2.085 1.00 . A A .   1 GLY HA3  1 1 
        7  3720 1 1  1 GLY N    N  -35.502   7.111  -1.149 1.00 . A A .   1 GLY N    1 1 
        7  3721 1 1  1 GLY O    O  -33.451   6.246   1.102 1.00 . A A .   1 GLY O    1 1 
        7  3722 1 1  2 SER C    C  -30.633   6.906   1.206 1.00 . A A .   2 SER C    1 1 
        7  3723 1 1  2 SER CA   C  -31.424   8.075   0.625 1.00 . A A .   2 SER CA   1 1 
        7  3724 1 1  2 SER CB   C  -32.122   8.841   1.750 1.00 . A A .   2 SER CB   1 1 
        7  3725 1 1  2 SER H    H  -32.363   7.949  -1.268 1.00 . A A .   2 SER H    1 1 
        7  3726 1 1  2 SER HA   H  -30.741   8.739   0.118 1.00 . A A .   2 SER HA   1 1 
        7  3727 1 1  2 SER HB2  H  -33.003   8.300   2.059 1.00 . A A .   2 SER HB2  1 1 
        7  3728 1 1  2 SER HB3  H  -31.447   8.939   2.588 1.00 . A A .   2 SER HB3  1 1 
        7  3729 1 1  2 SER HG   H  -33.260  10.065   0.727 1.00 . A A .   2 SER HG   1 1 
        7  3730 1 1  2 SER N    N  -32.401   7.606  -0.350 1.00 . A A .   2 SER N    1 1 
        7  3731 1 1  2 SER O    O  -30.379   6.851   2.409 1.00 . A A .   2 SER O    1 1 
        7  3732 1 1  2 SER OG   O  -32.509  10.136   1.321 1.00 . A A .   2 SER OG   1 1 
        7  3733 1 1  3 SER C    C  -28.503   4.371  -0.316 1.00 . A A .   3 SER C    1 1 
        7  3734 1 1  3 SER CA   C  -29.486   4.804   0.767 1.00 . A A .   3 SER CA   1 1 
        7  3735 1 1  3 SER CB   C  -30.433   3.650   1.103 1.00 . A A .   3 SER CB   1 1 
        7  3736 1 1  3 SER H    H  -30.478   6.075  -0.606 1.00 . A A .   3 SER H    1 1 
        7  3737 1 1  3 SER HA   H  -28.932   5.073   1.654 1.00 . A A .   3 SER HA   1 1 
        7  3738 1 1  3 SER HB2  H  -30.979   3.887   2.004 1.00 . A A .   3 SER HB2  1 1 
        7  3739 1 1  3 SER HB3  H  -31.128   3.509   0.288 1.00 . A A .   3 SER HB3  1 1 
        7  3740 1 1  3 SER HG   H  -30.326   1.703   1.292 1.00 . A A .   3 SER HG   1 1 
        7  3741 1 1  3 SER N    N  -30.246   5.974   0.341 1.00 . A A .   3 SER N    1 1 
        7  3742 1 1  3 SER O    O  -28.752   4.554  -1.506 1.00 . A A .   3 SER O    1 1 
        7  3743 1 1  3 SER OG   O  -29.717   2.445   1.306 1.00 . A A .   3 SER OG   1 1 
        7  3744 1 1  4 GLY C    C  -25.047   3.048  -0.172 1.00 . A A .   4 GLY C    1 1 
        7  3745 1 1  4 GLY CA   C  -26.377   3.343  -0.837 1.00 . A A .   4 GLY CA   1 1 
        7  3746 1 1  4 GLY H    H  -27.237   3.674   1.070 1.00 . A A .   4 GLY H    1 1 
        7  3747 1 1  4 GLY HA2  H  -26.732   2.447  -1.323 1.00 . A A .   4 GLY HA2  1 1 
        7  3748 1 1  4 GLY HA3  H  -26.230   4.111  -1.582 1.00 . A A .   4 GLY HA3  1 1 
        7  3749 1 1  4 GLY N    N  -27.382   3.794   0.108 1.00 . A A .   4 GLY N    1 1 
        7  3750 1 1  4 GLY O    O  -24.163   3.903  -0.130 1.00 . A A .   4 GLY O    1 1 
        7  3751 1 1  5 SER C    C  -22.707   0.784   0.039 1.00 . A A .   5 SER C    1 1 
        7  3752 1 1  5 SER CA   C  -23.677   1.430   1.024 1.00 . A A .   5 SER CA   1 1 
        7  3753 1 1  5 SER CB   C  -23.989   0.457   2.162 1.00 . A A .   5 SER CB   1 1 
        7  3754 1 1  5 SER H    H  -25.648   1.197   0.287 1.00 . A A .   5 SER H    1 1 
        7  3755 1 1  5 SER HA   H  -23.217   2.316   1.435 1.00 . A A .   5 SER HA   1 1 
        7  3756 1 1  5 SER HB2  H  -24.764  -0.225   1.847 1.00 . A A .   5 SER HB2  1 1 
        7  3757 1 1  5 SER HB3  H  -23.097  -0.101   2.409 1.00 . A A .   5 SER HB3  1 1 
        7  3758 1 1  5 SER HG   H  -25.135   0.651   3.739 1.00 . A A .   5 SER HG   1 1 
        7  3759 1 1  5 SER N    N  -24.906   1.834   0.352 1.00 . A A .   5 SER N    1 1 
        7  3760 1 1  5 SER O    O  -23.108   0.307  -1.022 1.00 . A A .   5 SER O    1 1 
        7  3761 1 1  5 SER OG   O  -24.430   1.148   3.318 1.00 . A A .   5 SER OG   1 1 
        7  3762 1 1  6 SER C    C  -20.532  -1.328  -0.506 1.00 . A A .   6 SER C    1 1 
        7  3763 1 1  6 SER CA   C  -20.398   0.191  -0.454 1.00 . A A .   6 SER CA   1 1 
        7  3764 1 1  6 SER CB   C  -19.007   0.574   0.055 1.00 . A A .   6 SER CB   1 1 
        7  3765 1 1  6 SER H    H  -21.169   1.170   1.258 1.00 . A A .   6 SER H    1 1 
        7  3766 1 1  6 SER HA   H  -20.529   0.587  -1.450 1.00 . A A .   6 SER HA   1 1 
        7  3767 1 1  6 SER HB2  H  -18.987   1.630   0.279 1.00 . A A .   6 SER HB2  1 1 
        7  3768 1 1  6 SER HB3  H  -18.787   0.011   0.951 1.00 . A A .   6 SER HB3  1 1 
        7  3769 1 1  6 SER HG   H  -17.929   1.042  -1.512 1.00 . A A .   6 SER HG   1 1 
        7  3770 1 1  6 SER N    N  -21.427   0.774   0.399 1.00 . A A .   6 SER N    1 1 
        7  3771 1 1  6 SER O    O  -20.822  -1.972   0.502 1.00 . A A .   6 SER O    1 1 
        7  3772 1 1  6 SER OG   O  -18.014   0.294  -0.916 1.00 . A A .   6 SER OG   1 1 
        7  3773 1 1  7 GLY C    C  -19.555  -4.091  -0.866 1.00 . A A .   7 GLY C    1 1 
        7  3774 1 1  7 GLY CA   C  -20.420  -3.333  -1.853 1.00 . A A .   7 GLY CA   1 1 
        7  3775 1 1  7 GLY H    H  -20.091  -1.331  -2.459 1.00 . A A .   7 GLY H    1 1 
        7  3776 1 1  7 GLY HA2  H  -21.450  -3.628  -1.714 1.00 . A A .   7 GLY HA2  1 1 
        7  3777 1 1  7 GLY HA3  H  -20.114  -3.592  -2.856 1.00 . A A .   7 GLY HA3  1 1 
        7  3778 1 1  7 GLY N    N  -20.319  -1.894  -1.690 1.00 . A A .   7 GLY N    1 1 
        7  3779 1 1  7 GLY O    O  -18.480  -3.626  -0.488 1.00 . A A .   7 GLY O    1 1 
        7  3780 1 1  8 ALA C    C  -18.171  -6.859  -0.195 1.00 . A A .   8 ALA C    1 1 
        7  3781 1 1  8 ALA CA   C  -19.286  -6.085   0.502 1.00 . A A .   8 ALA CA   1 1 
        7  3782 1 1  8 ALA CB   C  -20.229  -7.042   1.216 1.00 . A A .   8 ALA CB   1 1 
        7  3783 1 1  8 ALA H    H  -20.888  -5.579  -0.785 1.00 . A A .   8 ALA H    1 1 
        7  3784 1 1  8 ALA HA   H  -18.848  -5.431   1.242 1.00 . A A .   8 ALA HA   1 1 
        7  3785 1 1  8 ALA HB1  H  -19.900  -7.178   2.235 1.00 . A A .   8 ALA HB1  1 1 
        7  3786 1 1  8 ALA HB2  H  -21.228  -6.632   1.211 1.00 . A A .   8 ALA HB2  1 1 
        7  3787 1 1  8 ALA HB3  H  -20.228  -7.995   0.707 1.00 . A A .   8 ALA HB3  1 1 
        7  3788 1 1  8 ALA N    N  -20.024  -5.261  -0.447 1.00 . A A .   8 ALA N    1 1 
        7  3789 1 1  8 ALA O    O  -18.369  -7.991  -0.633 1.00 . A A .   8 ALA O    1 1 
        7  3790 1 1  9 GLY C    C  -14.712  -5.935  -1.166 1.00 . A A .   9 GLY C    1 1 
        7  3791 1 1  9 GLY CA   C  -15.871  -6.885  -0.938 1.00 . A A .   9 GLY CA   1 1 
        7  3792 1 1  9 GLY H    H  -16.899  -5.337   0.076 1.00 . A A .   9 GLY H    1 1 
        7  3793 1 1  9 GLY HA2  H  -15.535  -7.703  -0.318 1.00 . A A .   9 GLY HA2  1 1 
        7  3794 1 1  9 GLY HA3  H  -16.192  -7.277  -1.892 1.00 . A A .   9 GLY HA3  1 1 
        7  3795 1 1  9 GLY N    N  -16.999  -6.239  -0.293 1.00 . A A .   9 GLY N    1 1 
        7  3796 1 1  9 GLY O    O  -14.489  -5.475  -2.285 1.00 . A A .   9 GLY O    1 1 
        7  3797 1 1 10 GLU C    C  -11.645  -5.277   0.600 1.00 . A A .  10 GLU C    1 1 
        7  3798 1 1 10 GLU CA   C  -12.832  -4.735  -0.191 1.00 . A A .  10 GLU CA   1 1 
        7  3799 1 1 10 GLU CB   C  -13.212  -3.346   0.326 1.00 . A A .  10 GLU CB   1 1 
        7  3800 1 1 10 GLU CD   C  -12.094  -3.122   2.580 1.00 . A A .  10 GLU CD   1 1 
        7  3801 1 1 10 GLU CG   C  -13.403  -3.289   1.833 1.00 . A A .  10 GLU CG   1 1 
        7  3802 1 1 10 GLU H    H  -14.200  -6.038   0.765 1.00 . A A .  10 GLU H    1 1 
        7  3803 1 1 10 GLU HA   H  -12.551  -4.658  -1.230 1.00 . A A .  10 GLU HA   1 1 
        7  3804 1 1 10 GLU HB2  H  -12.433  -2.649   0.055 1.00 . A A .  10 GLU HB2  1 1 
        7  3805 1 1 10 GLU HB3  H  -14.135  -3.041  -0.144 1.00 . A A .  10 GLU HB3  1 1 
        7  3806 1 1 10 GLU HG2  H  -14.044  -2.453   2.070 1.00 . A A .  10 GLU HG2  1 1 
        7  3807 1 1 10 GLU HG3  H  -13.872  -4.205   2.158 1.00 . A A .  10 GLU HG3  1 1 
        7  3808 1 1 10 GLU N    N  -13.973  -5.639  -0.101 1.00 . A A .  10 GLU N    1 1 
        7  3809 1 1 10 GLU O    O  -11.815  -6.010   1.575 1.00 . A A .  10 GLU O    1 1 
        7  3810 1 1 10 GLU OE1  O  -11.611  -1.975   2.681 1.00 . A A .  10 GLU OE1  1 1 
        7  3811 1 1 10 GLU OE2  O  -11.553  -4.138   3.065 1.00 . A A .  10 GLU OE2  1 1 
        7  3812 1 1 11 LYS C    C   -8.692  -4.284   1.781 1.00 . A A .  11 LYS C    1 1 
        7  3813 1 1 11 LYS CA   C   -9.224  -5.360   0.839 1.00 . A A .  11 LYS CA   1 1 
        7  3814 1 1 11 LYS CB   C   -8.155  -5.722  -0.194 1.00 . A A .  11 LYS CB   1 1 
        7  3815 1 1 11 LYS CD   C   -8.126  -8.234  -0.217 1.00 . A A .  11 LYS CD   1 1 
        7  3816 1 1 11 LYS CE   C   -8.826  -9.455  -0.793 1.00 . A A .  11 LYS CE   1 1 
        7  3817 1 1 11 LYS CG   C   -8.478  -6.974  -0.991 1.00 . A A .  11 LYS CG   1 1 
        7  3818 1 1 11 LYS H    H  -10.369  -4.327  -0.610 1.00 . A A .  11 LYS H    1 1 
        7  3819 1 1 11 LYS HA   H   -9.466  -6.239   1.417 1.00 . A A .  11 LYS HA   1 1 
        7  3820 1 1 11 LYS HB2  H   -8.046  -4.899  -0.885 1.00 . A A .  11 LYS HB2  1 1 
        7  3821 1 1 11 LYS HB3  H   -7.215  -5.878   0.316 1.00 . A A .  11 LYS HB3  1 1 
        7  3822 1 1 11 LYS HD2  H   -7.058  -8.388  -0.265 1.00 . A A .  11 LYS HD2  1 1 
        7  3823 1 1 11 LYS HD3  H   -8.427  -8.109   0.813 1.00 . A A .  11 LYS HD3  1 1 
        7  3824 1 1 11 LYS HE2  H   -8.761 -10.261  -0.078 1.00 . A A .  11 LYS HE2  1 1 
        7  3825 1 1 11 LYS HE3  H   -9.863  -9.211  -0.966 1.00 . A A .  11 LYS HE3  1 1 
        7  3826 1 1 11 LYS HG2  H   -9.535  -6.985  -1.214 1.00 . A A .  11 LYS HG2  1 1 
        7  3827 1 1 11 LYS HG3  H   -7.914  -6.959  -1.913 1.00 . A A .  11 LYS HG3  1 1 
        7  3828 1 1 11 LYS HZ1  H   -8.003 -10.913  -2.042 1.00 . A A .  11 LYS HZ1  1 1 
        7  3829 1 1 11 LYS HZ2  H   -7.323  -9.376  -2.242 1.00 . A A .  11 LYS HZ2  1 1 
        7  3830 1 1 11 LYS HZ3  H   -8.860  -9.709  -2.866 1.00 . A A .  11 LYS HZ3  1 1 
        7  3831 1 1 11 LYS N    N  -10.441  -4.912   0.173 1.00 . A A .  11 LYS N    1 1 
        7  3832 1 1 11 LYS NZ   N   -8.210  -9.894  -2.075 1.00 . A A .  11 LYS NZ   1 1 
        7  3833 1 1 11 LYS O    O   -8.889  -3.087   1.569 1.00 . A A .  11 LYS O    1 1 
        7  3834 1 1 12 PRO C    C   -6.252  -3.005   3.280 1.00 . A A .  12 PRO C    1 1 
        7  3835 1 1 12 PRO CA   C   -7.423  -3.806   3.838 1.00 . A A .  12 PRO CA   1 1 
        7  3836 1 1 12 PRO CB   C   -6.946  -4.747   4.948 1.00 . A A .  12 PRO CB   1 1 
        7  3837 1 1 12 PRO CD   C   -7.725  -6.129   3.160 1.00 . A A .  12 PRO CD   1 1 
        7  3838 1 1 12 PRO CG   C   -6.707  -6.049   4.264 1.00 . A A .  12 PRO CG   1 1 
        7  3839 1 1 12 PRO HA   H   -8.166  -3.129   4.233 1.00 . A A .  12 PRO HA   1 1 
        7  3840 1 1 12 PRO HB2  H   -6.038  -4.358   5.387 1.00 . A A .  12 PRO HB2  1 1 
        7  3841 1 1 12 PRO HB3  H   -7.711  -4.833   5.705 1.00 . A A .  12 PRO HB3  1 1 
        7  3842 1 1 12 PRO HD2  H   -7.313  -6.642   2.303 1.00 . A A .  12 PRO HD2  1 1 
        7  3843 1 1 12 PRO HD3  H   -8.619  -6.627   3.506 1.00 . A A .  12 PRO HD3  1 1 
        7  3844 1 1 12 PRO HG2  H   -5.709  -6.071   3.855 1.00 . A A .  12 PRO HG2  1 1 
        7  3845 1 1 12 PRO HG3  H   -6.847  -6.861   4.962 1.00 . A A .  12 PRO HG3  1 1 
        7  3846 1 1 12 PRO N    N   -7.999  -4.717   2.845 1.00 . A A .  12 PRO N    1 1 
        7  3847 1 1 12 PRO O    O   -5.928  -1.928   3.782 1.00 . A A .  12 PRO O    1 1 
        7  3848 1 1 13 TYR C    C   -4.951  -1.735   0.704 1.00 . A A .  13 TYR C    1 1 
        7  3849 1 1 13 TYR CA   C   -4.486  -2.869   1.612 1.00 . A A .  13 TYR CA   1 1 
        7  3850 1 1 13 TYR CB   C   -3.658  -3.874   0.808 1.00 . A A .  13 TYR CB   1 1 
        7  3851 1 1 13 TYR CD1  C   -2.554  -5.352   2.533 1.00 . A A .  13 TYR CD1  1 1 
        7  3852 1 1 13 TYR CD2  C   -4.230  -6.312   1.136 1.00 . A A .  13 TYR CD2  1 1 
        7  3853 1 1 13 TYR CE1  C   -2.385  -6.565   3.172 1.00 . A A .  13 TYR CE1  1 1 
        7  3854 1 1 13 TYR CE2  C   -4.068  -7.529   1.770 1.00 . A A .  13 TYR CE2  1 1 
        7  3855 1 1 13 TYR CG   C   -3.477  -5.204   1.505 1.00 . A A .  13 TYR CG   1 1 
        7  3856 1 1 13 TYR CZ   C   -3.144  -7.650   2.786 1.00 . A A .  13 TYR CZ   1 1 
        7  3857 1 1 13 TYR H    H   -5.927  -4.396   1.882 1.00 . A A .  13 TYR H    1 1 
        7  3858 1 1 13 TYR HA   H   -3.869  -2.457   2.397 1.00 . A A .  13 TYR HA   1 1 
        7  3859 1 1 13 TYR HB2  H   -4.147  -4.059  -0.136 1.00 . A A .  13 TYR HB2  1 1 
        7  3860 1 1 13 TYR HB3  H   -2.678  -3.459   0.626 1.00 . A A .  13 TYR HB3  1 1 
        7  3861 1 1 13 TYR HD1  H   -1.962  -4.500   2.832 1.00 . A A .  13 TYR HD1  1 1 
        7  3862 1 1 13 TYR HD2  H   -4.952  -6.214   0.338 1.00 . A A .  13 TYR HD2  1 1 
        7  3863 1 1 13 TYR HE1  H   -1.662  -6.661   3.968 1.00 . A A .  13 TYR HE1  1 1 
        7  3864 1 1 13 TYR HE2  H   -4.662  -8.379   1.468 1.00 . A A .  13 TYR HE2  1 1 
        7  3865 1 1 13 TYR HH   H   -3.727  -9.429   3.224 1.00 . A A .  13 TYR HH   1 1 
        7  3866 1 1 13 TYR N    N   -5.622  -3.535   2.238 1.00 . A A .  13 TYR N    1 1 
        7  3867 1 1 13 TYR O    O   -5.353  -1.962  -0.436 1.00 . A A .  13 TYR O    1 1 
        7  3868 1 1 13 TYR OH   O   -2.979  -8.860   3.421 1.00 . A A .  13 TYR OH   1 1 
        7  3869 1 1 14 GLY C    C   -4.538   1.896   0.806 1.00 . A A .  14 GLY C    1 1 
        7  3870 1 1 14 GLY CA   C   -5.309   0.642   0.443 1.00 . A A .  14 GLY CA   1 1 
        7  3871 1 1 14 GLY H    H   -4.562  -0.390   2.135 1.00 . A A .  14 GLY H    1 1 
        7  3872 1 1 14 GLY HA2  H   -5.159   0.430  -0.605 1.00 . A A .  14 GLY HA2  1 1 
        7  3873 1 1 14 GLY HA3  H   -6.361   0.817   0.617 1.00 . A A .  14 GLY HA3  1 1 
        7  3874 1 1 14 GLY N    N   -4.892  -0.511   1.220 1.00 . A A .  14 GLY N    1 1 
        7  3875 1 1 14 GLY O    O   -4.433   2.250   1.981 1.00 . A A .  14 GLY O    1 1 
        7  3876 1 1 15 CYS C    C   -4.124   4.908   0.536 1.00 . A A .  15 CYS C    1 1 
        7  3877 1 1 15 CYS CA   C   -3.228   3.788   0.014 1.00 . A A .  15 CYS CA   1 1 
        7  3878 1 1 15 CYS CB   C   -2.548   4.226  -1.284 1.00 . A A .  15 CYS CB   1 1 
        7  3879 1 1 15 CYS H    H   -4.114   2.235  -1.118 1.00 . A A .  15 CYS H    1 1 
        7  3880 1 1 15 CYS HA   H   -2.471   3.576   0.754 1.00 . A A .  15 CYS HA   1 1 
        7  3881 1 1 15 CYS HB2  H   -1.783   3.508  -1.541 1.00 . A A .  15 CYS HB2  1 1 
        7  3882 1 1 15 CYS HB3  H   -3.284   4.258  -2.074 1.00 . A A .  15 CYS HB3  1 1 
        7  3883 1 1 15 CYS N    N   -3.996   2.568  -0.203 1.00 . A A .  15 CYS N    1 1 
        7  3884 1 1 15 CYS O    O   -5.245   5.092   0.062 1.00 . A A .  15 CYS O    1 1 
        7  3885 1 1 15 CYS SG   S   -1.759   5.866  -1.193 1.00 . A A .  15 CYS SG   1 1 
        7  3886 1 1 16 SER C    C   -3.672   8.086   1.861 1.00 . A A .  16 SER C    1 1 
        7  3887 1 1 16 SER CA   C   -4.375   6.754   2.103 1.00 . A A .  16 SER CA   1 1 
        7  3888 1 1 16 SER CB   C   -4.561   6.527   3.604 1.00 . A A .  16 SER CB   1 1 
        7  3889 1 1 16 SER H    H   -2.720   5.458   1.850 1.00 . A A .  16 SER H    1 1 
        7  3890 1 1 16 SER HA   H   -5.345   6.781   1.629 1.00 . A A .  16 SER HA   1 1 
        7  3891 1 1 16 SER HB2  H   -3.593   6.431   4.073 1.00 . A A .  16 SER HB2  1 1 
        7  3892 1 1 16 SER HB3  H   -5.085   7.371   4.031 1.00 . A A .  16 SER HB3  1 1 
        7  3893 1 1 16 SER HG   H   -4.734   4.584   3.784 1.00 . A A .  16 SER HG   1 1 
        7  3894 1 1 16 SER N    N   -3.620   5.654   1.514 1.00 . A A .  16 SER N    1 1 
        7  3895 1 1 16 SER O    O   -3.594   8.929   2.754 1.00 . A A .  16 SER O    1 1 
        7  3896 1 1 16 SER OG   O   -5.309   5.350   3.854 1.00 . A A .  16 SER OG   1 1 
        7  3897 1 1 17 GLU C    C   -3.012  10.071  -1.016 1.00 . A A .  17 GLU C    1 1 
        7  3898 1 1 17 GLU CA   C   -2.464   9.496   0.287 1.00 . A A .  17 GLU CA   1 1 
        7  3899 1 1 17 GLU CB   C   -0.963   9.235   0.151 1.00 . A A .  17 GLU CB   1 1 
        7  3900 1 1 17 GLU CD   C    0.285  10.655   1.826 1.00 . A A .  17 GLU CD   1 1 
        7  3901 1 1 17 GLU CG   C   -0.216   9.268   1.474 1.00 . A A .  17 GLU CG   1 1 
        7  3902 1 1 17 GLU H    H   -3.256   7.557  -0.023 1.00 . A A .  17 GLU H    1 1 
        7  3903 1 1 17 GLU HA   H   -2.625  10.212   1.079 1.00 . A A .  17 GLU HA   1 1 
        7  3904 1 1 17 GLU HB2  H   -0.817   8.263  -0.297 1.00 . A A .  17 GLU HB2  1 1 
        7  3905 1 1 17 GLU HB3  H   -0.537   9.987  -0.497 1.00 . A A .  17 GLU HB3  1 1 
        7  3906 1 1 17 GLU HG2  H   -0.881   8.934   2.256 1.00 . A A .  17 GLU HG2  1 1 
        7  3907 1 1 17 GLU HG3  H    0.630   8.600   1.413 1.00 . A A .  17 GLU HG3  1 1 
        7  3908 1 1 17 GLU N    N   -3.162   8.267   0.647 1.00 . A A .  17 GLU N    1 1 
        7  3909 1 1 17 GLU O    O   -3.288  11.268  -1.112 1.00 . A A .  17 GLU O    1 1 
        7  3910 1 1 17 GLU OE1  O   -0.371  11.641   1.430 1.00 . A A .  17 GLU OE1  1 1 
        7  3911 1 1 17 GLU OE2  O    1.333  10.755   2.498 1.00 . A A .  17 GLU OE2  1 1 
        7  3912 1 1 18 CYS C    C   -5.065   9.044  -3.568 1.00 . A A .  18 CYS C    1 1 
        7  3913 1 1 18 CYS CA   C   -3.679   9.632  -3.315 1.00 . A A .  18 CYS CA   1 1 
        7  3914 1 1 18 CYS CB   C   -2.721   9.206  -4.428 1.00 . A A .  18 CYS CB   1 1 
        7  3915 1 1 18 CYS H    H   -2.928   8.270  -1.879 1.00 . A A .  18 CYS H    1 1 
        7  3916 1 1 18 CYS HA   H   -3.754  10.709  -3.309 1.00 . A A .  18 CYS HA   1 1 
        7  3917 1 1 18 CYS HB2  H   -3.049   9.640  -5.361 1.00 . A A .  18 CYS HB2  1 1 
        7  3918 1 1 18 CYS HB3  H   -1.729   9.567  -4.198 1.00 . A A .  18 CYS HB3  1 1 
        7  3919 1 1 18 CYS N    N   -3.166   9.211  -2.017 1.00 . A A .  18 CYS N    1 1 
        7  3920 1 1 18 CYS O    O   -5.968   9.736  -4.037 1.00 . A A .  18 CYS O    1 1 
        7  3921 1 1 18 CYS SG   S   -2.613   7.403  -4.666 1.00 . A A .  18 CYS SG   1 1 
        7  3922 1 1 19 GLY C    C   -6.396   5.901  -4.373 1.00 . A A .  19 GLY C    1 1 
        7  3923 1 1 19 GLY CA   C   -6.501   7.103  -3.455 1.00 . A A .  19 GLY CA   1 1 
        7  3924 1 1 19 GLY H    H   -4.468   7.260  -2.884 1.00 . A A .  19 GLY H    1 1 
        7  3925 1 1 19 GLY HA2  H   -6.881   6.779  -2.497 1.00 . A A .  19 GLY HA2  1 1 
        7  3926 1 1 19 GLY HA3  H   -7.195   7.810  -3.885 1.00 . A A .  19 GLY HA3  1 1 
        7  3927 1 1 19 GLY N    N   -5.224   7.762  -3.254 1.00 . A A .  19 GLY N    1 1 
        7  3928 1 1 19 GLY O    O   -7.063   5.839  -5.406 1.00 . A A .  19 GLY O    1 1 
        7  3929 1 1 20 LYS C    C   -5.676   2.490  -3.977 1.00 . A A .  20 LYS C    1 1 
        7  3930 1 1 20 LYS CA   C   -5.361   3.738  -4.795 1.00 . A A .  20 LYS CA   1 1 
        7  3931 1 1 20 LYS CB   C   -3.924   3.671  -5.317 1.00 . A A .  20 LYS CB   1 1 
        7  3932 1 1 20 LYS CD   C   -2.481   3.909  -7.359 1.00 . A A .  20 LYS CD   1 1 
        7  3933 1 1 20 LYS CE   C   -2.434   4.423  -8.790 1.00 . A A .  20 LYS CE   1 1 
        7  3934 1 1 20 LYS CG   C   -3.719   4.405  -6.631 1.00 . A A .  20 LYS CG   1 1 
        7  3935 1 1 20 LYS H    H   -5.049   5.051  -3.164 1.00 . A A .  20 LYS H    1 1 
        7  3936 1 1 20 LYS HA   H   -6.039   3.784  -5.634 1.00 . A A .  20 LYS HA   1 1 
        7  3937 1 1 20 LYS HB2  H   -3.266   4.105  -4.579 1.00 . A A .  20 LYS HB2  1 1 
        7  3938 1 1 20 LYS HB3  H   -3.655   2.634  -5.462 1.00 . A A .  20 LYS HB3  1 1 
        7  3939 1 1 20 LYS HD2  H   -1.603   4.256  -6.835 1.00 . A A .  20 LYS HD2  1 1 
        7  3940 1 1 20 LYS HD3  H   -2.491   2.829  -7.374 1.00 . A A .  20 LYS HD3  1 1 
        7  3941 1 1 20 LYS HE2  H   -3.207   3.933  -9.361 1.00 . A A .  20 LYS HE2  1 1 
        7  3942 1 1 20 LYS HE3  H   -2.613   5.488  -8.782 1.00 . A A .  20 LYS HE3  1 1 
        7  3943 1 1 20 LYS HG2  H   -4.582   4.246  -7.260 1.00 . A A .  20 LYS HG2  1 1 
        7  3944 1 1 20 LYS HG3  H   -3.609   5.461  -6.429 1.00 . A A .  20 LYS HG3  1 1 
        7  3945 1 1 20 LYS HZ1  H   -0.841   3.165  -9.285 1.00 . A A .  20 LYS HZ1  1 1 
        7  3946 1 1 20 LYS HZ2  H   -0.387   4.773  -9.017 1.00 . A A .  20 LYS HZ2  1 1 
        7  3947 1 1 20 LYS HZ3  H   -1.171   4.344 -10.453 1.00 . A A .  20 LYS HZ3  1 1 
        7  3948 1 1 20 LYS N    N   -5.554   4.944  -3.998 1.00 . A A .  20 LYS N    1 1 
        7  3949 1 1 20 LYS NZ   N   -1.116   4.157  -9.431 1.00 . A A .  20 LYS NZ   1 1 
        7  3950 1 1 20 LYS O    O   -5.949   2.573  -2.780 1.00 . A A .  20 LYS O    1 1 
        7  3951 1 1 21 ALA C    C   -5.102  -1.068  -4.581 1.00 . A A .  21 ALA C    1 1 
        7  3952 1 1 21 ALA CA   C   -5.910   0.068  -3.962 1.00 . A A .  21 ALA CA   1 1 
        7  3953 1 1 21 ALA CB   C   -7.397  -0.247  -4.023 1.00 . A A .  21 ALA CB   1 1 
        7  3954 1 1 21 ALA H    H   -5.409   1.332  -5.584 1.00 . A A .  21 ALA H    1 1 
        7  3955 1 1 21 ALA HA   H   -5.630   0.171  -2.924 1.00 . A A .  21 ALA HA   1 1 
        7  3956 1 1 21 ALA HB1  H   -7.922   0.354  -3.295 1.00 . A A .  21 ALA HB1  1 1 
        7  3957 1 1 21 ALA HB2  H   -7.772  -0.023  -5.011 1.00 . A A .  21 ALA HB2  1 1 
        7  3958 1 1 21 ALA HB3  H   -7.553  -1.293  -3.806 1.00 . A A .  21 ALA HB3  1 1 
        7  3959 1 1 21 ALA N    N   -5.633   1.334  -4.631 1.00 . A A .  21 ALA N    1 1 
        7  3960 1 1 21 ALA O    O   -4.581  -0.940  -5.690 1.00 . A A .  21 ALA O    1 1 
        7  3961 1 1 22 PHE C    C   -4.861  -4.631  -3.806 1.00 . A A .  22 PHE C    1 1 
        7  3962 1 1 22 PHE CA   C   -4.253  -3.336  -4.336 1.00 . A A .  22 PHE CA   1 1 
        7  3963 1 1 22 PHE CB   C   -2.787  -3.235  -3.909 1.00 . A A .  22 PHE CB   1 1 
        7  3964 1 1 22 PHE CD1  C   -2.396  -0.905  -3.064 1.00 . A A .  22 PHE CD1  1 1 
        7  3965 1 1 22 PHE CD2  C   -1.492  -1.508  -5.187 1.00 . A A .  22 PHE CD2  1 1 
        7  3966 1 1 22 PHE CE1  C   -1.868   0.365  -3.196 1.00 . A A .  22 PHE CE1  1 1 
        7  3967 1 1 22 PHE CE2  C   -0.961  -0.239  -5.324 1.00 . A A .  22 PHE CE2  1 1 
        7  3968 1 1 22 PHE CG   C   -2.213  -1.855  -4.056 1.00 . A A .  22 PHE CG   1 1 
        7  3969 1 1 22 PHE CZ   C   -1.151   0.699  -4.328 1.00 . A A .  22 PHE CZ   1 1 
        7  3970 1 1 22 PHE H    H   -5.438  -2.219  -2.982 1.00 . A A .  22 PHE H    1 1 
        7  3971 1 1 22 PHE HA   H   -4.306  -3.341  -5.413 1.00 . A A .  22 PHE HA   1 1 
        7  3972 1 1 22 PHE HB2  H   -2.702  -3.521  -2.871 1.00 . A A .  22 PHE HB2  1 1 
        7  3973 1 1 22 PHE HB3  H   -2.197  -3.908  -4.513 1.00 . A A .  22 PHE HB3  1 1 
        7  3974 1 1 22 PHE HD1  H   -2.957  -1.166  -2.177 1.00 . A A .  22 PHE HD1  1 1 
        7  3975 1 1 22 PHE HD2  H   -1.343  -2.240  -5.967 1.00 . A A .  22 PHE HD2  1 1 
        7  3976 1 1 22 PHE HE1  H   -2.018   1.096  -2.415 1.00 . A A .  22 PHE HE1  1 1 
        7  3977 1 1 22 PHE HE2  H   -0.401   0.019  -6.210 1.00 . A A .  22 PHE HE2  1 1 
        7  3978 1 1 22 PHE HZ   H   -0.738   1.691  -4.433 1.00 . A A .  22 PHE HZ   1 1 
        7  3979 1 1 22 PHE N    N   -5.000  -2.178  -3.858 1.00 . A A .  22 PHE N    1 1 
        7  3980 1 1 22 PHE O    O   -5.731  -4.611  -2.935 1.00 . A A .  22 PHE O    1 1 
        7  3981 1 1 23 SER C    C   -4.003  -7.671  -2.850 1.00 . A A .  23 SER C    1 1 
        7  3982 1 1 23 SER CA   C   -4.898  -7.062  -3.926 1.00 . A A .  23 SER CA   1 1 
        7  3983 1 1 23 SER CB   C   -4.984  -8.005  -5.128 1.00 . A A .  23 SER CB   1 1 
        7  3984 1 1 23 SER H    H   -3.704  -5.708  -5.031 1.00 . A A .  23 SER H    1 1 
        7  3985 1 1 23 SER HA   H   -5.888  -6.923  -3.517 1.00 . A A .  23 SER HA   1 1 
        7  3986 1 1 23 SER HB2  H   -5.362  -8.963  -4.805 1.00 . A A .  23 SER HB2  1 1 
        7  3987 1 1 23 SER HB3  H   -5.652  -7.583  -5.865 1.00 . A A .  23 SER HB3  1 1 
        7  3988 1 1 23 SER HG   H   -3.363  -9.051  -5.467 1.00 . A A .  23 SER HG   1 1 
        7  3989 1 1 23 SER N    N   -4.398  -5.757  -4.340 1.00 . A A .  23 SER N    1 1 
        7  3990 1 1 23 SER O    O   -4.488  -8.230  -1.867 1.00 . A A .  23 SER O    1 1 
        7  3991 1 1 23 SER OG   O   -3.710  -8.192  -5.720 1.00 . A A .  23 SER OG   1 1 
        7  3992 1 1 24 SER C    C   -1.137  -6.993  -1.231 1.00 . A A .  24 SER C    1 1 
        7  3993 1 1 24 SER CA   C   -1.729  -8.101  -2.097 1.00 . A A .  24 SER CA   1 1 
        7  3994 1 1 24 SER CB   C   -0.611  -8.838  -2.837 1.00 . A A .  24 SER CB   1 1 
        7  3995 1 1 24 SER H    H   -2.368  -7.102  -3.851 1.00 . A A .  24 SER H    1 1 
        7  3996 1 1 24 SER HA   H   -2.249  -8.800  -1.459 1.00 . A A .  24 SER HA   1 1 
        7  3997 1 1 24 SER HB2  H   -0.098  -8.147  -3.488 1.00 . A A .  24 SER HB2  1 1 
        7  3998 1 1 24 SER HB3  H    0.087  -9.242  -2.118 1.00 . A A .  24 SER HB3  1 1 
        7  3999 1 1 24 SER HG   H   -0.408 -10.371  -4.039 1.00 . A A .  24 SER HG   1 1 
        7  4000 1 1 24 SER N    N   -2.693  -7.559  -3.047 1.00 . A A .  24 SER N    1 1 
        7  4001 1 1 24 SER O    O   -1.464  -5.817  -1.397 1.00 . A A .  24 SER O    1 1 
        7  4002 1 1 24 SER OG   O   -1.130  -9.900  -3.617 1.00 . A A .  24 SER OG   1 1 
        7  4003 1 1 25 LYS C    C    1.591  -5.779  -0.082 1.00 . A A .  25 LYS C    1 1 
        7  4004 1 1 25 LYS CA   C    0.377  -6.417   0.586 1.00 . A A .  25 LYS CA   1 1 
        7  4005 1 1 25 LYS CB   C    0.800  -7.103   1.887 1.00 . A A .  25 LYS CB   1 1 
        7  4006 1 1 25 LYS CD   C    1.128  -4.937   3.116 1.00 . A A .  25 LYS CD   1 1 
        7  4007 1 1 25 LYS CE   C    1.761  -4.370   4.378 1.00 . A A .  25 LYS CE   1 1 
        7  4008 1 1 25 LYS CG   C    1.747  -6.271   2.733 1.00 . A A .  25 LYS CG   1 1 
        7  4009 1 1 25 LYS H    H   -0.043  -8.328  -0.223 1.00 . A A .  25 LYS H    1 1 
        7  4010 1 1 25 LYS HA   H   -0.341  -5.644   0.813 1.00 . A A .  25 LYS HA   1 1 
        7  4011 1 1 25 LYS HB2  H   -0.083  -7.313   2.472 1.00 . A A .  25 LYS HB2  1 1 
        7  4012 1 1 25 LYS HB3  H    1.291  -8.035   1.645 1.00 . A A .  25 LYS HB3  1 1 
        7  4013 1 1 25 LYS HD2  H    1.273  -4.236   2.308 1.00 . A A .  25 LYS HD2  1 1 
        7  4014 1 1 25 LYS HD3  H    0.069  -5.078   3.287 1.00 . A A .  25 LYS HD3  1 1 
        7  4015 1 1 25 LYS HE2  H    2.832  -4.474   4.305 1.00 . A A .  25 LYS HE2  1 1 
        7  4016 1 1 25 LYS HE3  H    1.505  -3.324   4.454 1.00 . A A .  25 LYS HE3  1 1 
        7  4017 1 1 25 LYS HG2  H    1.985  -6.817   3.634 1.00 . A A .  25 LYS HG2  1 1 
        7  4018 1 1 25 LYS HG3  H    2.652  -6.088   2.171 1.00 . A A .  25 LYS HG3  1 1 
        7  4019 1 1 25 LYS HZ1  H    1.691  -4.629   6.450 1.00 . A A .  25 LYS HZ1  1 1 
        7  4020 1 1 25 LYS HZ2  H    1.581  -6.073   5.574 1.00 . A A .  25 LYS HZ2  1 1 
        7  4021 1 1 25 LYS HZ3  H    0.250  -5.032   5.660 1.00 . A A .  25 LYS HZ3  1 1 
        7  4022 1 1 25 LYS N    N   -0.263  -7.376  -0.307 1.00 . A A .  25 LYS N    1 1 
        7  4023 1 1 25 LYS NZ   N    1.287  -5.075   5.601 1.00 . A A .  25 LYS NZ   1 1 
        7  4024 1 1 25 LYS O    O    1.833  -4.580   0.063 1.00 . A A .  25 LYS O    1 1 
        7  4025 1 1 26 SER C    C    3.187  -4.980  -2.476 1.00 . A A .  26 SER C    1 1 
        7  4026 1 1 26 SER CA   C    3.541  -6.101  -1.504 1.00 . A A .  26 SER CA   1 1 
        7  4027 1 1 26 SER CB   C    4.224  -7.245  -2.255 1.00 . A A .  26 SER CB   1 1 
        7  4028 1 1 26 SER H    H    2.106  -7.533  -0.892 1.00 . A A .  26 SER H    1 1 
        7  4029 1 1 26 SER HA   H    4.220  -5.714  -0.759 1.00 . A A .  26 SER HA   1 1 
        7  4030 1 1 26 SER HB2  H    3.498  -7.751  -2.873 1.00 . A A .  26 SER HB2  1 1 
        7  4031 1 1 26 SER HB3  H    5.011  -6.844  -2.878 1.00 . A A .  26 SER HB3  1 1 
        7  4032 1 1 26 SER HG   H    5.161  -7.717  -0.600 1.00 . A A .  26 SER HG   1 1 
        7  4033 1 1 26 SER N    N    2.351  -6.587  -0.815 1.00 . A A .  26 SER N    1 1 
        7  4034 1 1 26 SER O    O    3.840  -3.936  -2.502 1.00 . A A .  26 SER O    1 1 
        7  4035 1 1 26 SER OG   O    4.788  -8.182  -1.353 1.00 . A A .  26 SER OG   1 1 
        7  4036 1 1 27 TYR C    C    1.588  -2.834  -3.610 1.00 . A A .  27 TYR C    1 1 
        7  4037 1 1 27 TYR CA   C    1.707  -4.214  -4.249 1.00 . A A .  27 TYR CA   1 1 
        7  4038 1 1 27 TYR CB   C    0.364  -4.626  -4.854 1.00 . A A .  27 TYR CB   1 1 
        7  4039 1 1 27 TYR CD1  C    1.180  -5.047  -7.206 1.00 . A A .  27 TYR CD1  1 1 
        7  4040 1 1 27 TYR CD2  C   -0.067  -6.766  -6.123 1.00 . A A .  27 TYR CD2  1 1 
        7  4041 1 1 27 TYR CE1  C    1.301  -5.838  -8.332 1.00 . A A .  27 TYR CE1  1 1 
        7  4042 1 1 27 TYR CE2  C    0.051  -7.564  -7.244 1.00 . A A .  27 TYR CE2  1 1 
        7  4043 1 1 27 TYR CG   C    0.494  -5.495  -6.084 1.00 . A A .  27 TYR CG   1 1 
        7  4044 1 1 27 TYR CZ   C    0.735  -7.096  -8.346 1.00 . A A .  27 TYR CZ   1 1 
        7  4045 1 1 27 TYR H    H    1.667  -6.054  -3.206 1.00 . A A .  27 TYR H    1 1 
        7  4046 1 1 27 TYR HA   H    2.447  -4.171  -5.036 1.00 . A A .  27 TYR HA   1 1 
        7  4047 1 1 27 TYR HB2  H   -0.200  -5.177  -4.117 1.00 . A A .  27 TYR HB2  1 1 
        7  4048 1 1 27 TYR HB3  H   -0.186  -3.738  -5.131 1.00 . A A .  27 TYR HB3  1 1 
        7  4049 1 1 27 TYR HD1  H    1.622  -4.061  -7.191 1.00 . A A .  27 TYR HD1  1 1 
        7  4050 1 1 27 TYR HD2  H   -0.602  -7.130  -5.258 1.00 . A A .  27 TYR HD2  1 1 
        7  4051 1 1 27 TYR HE1  H    1.837  -5.471  -9.195 1.00 . A A .  27 TYR HE1  1 1 
        7  4052 1 1 27 TYR HE2  H   -0.393  -8.549  -7.256 1.00 . A A .  27 TYR HE2  1 1 
        7  4053 1 1 27 TYR HH   H    1.738  -7.796  -9.829 1.00 . A A .  27 TYR HH   1 1 
        7  4054 1 1 27 TYR N    N    2.148  -5.203  -3.273 1.00 . A A .  27 TYR N    1 1 
        7  4055 1 1 27 TYR O    O    2.122  -1.850  -4.124 1.00 . A A .  27 TYR O    1 1 
        7  4056 1 1 27 TYR OH   O    0.854  -7.887  -9.466 1.00 . A A .  27 TYR OH   1 1 
        7  4057 1 1 28 LEU C    C    2.035  -0.864  -1.441 1.00 . A A .  28 LEU C    1 1 
        7  4058 1 1 28 LEU CA   C    0.694  -1.510  -1.774 1.00 . A A .  28 LEU CA   1 1 
        7  4059 1 1 28 LEU CB   C   -0.105  -1.742  -0.490 1.00 . A A .  28 LEU CB   1 1 
        7  4060 1 1 28 LEU CD1  C   -0.934   0.601  -0.164 1.00 . A A .  28 LEU CD1  1 1 
        7  4061 1 1 28 LEU CD2  C   -0.855  -0.976   1.776 1.00 . A A .  28 LEU CD2  1 1 
        7  4062 1 1 28 LEU CG   C   -0.185  -0.559   0.475 1.00 . A A .  28 LEU CG   1 1 
        7  4063 1 1 28 LEU H    H    0.482  -3.586  -2.125 1.00 . A A .  28 LEU H    1 1 
        7  4064 1 1 28 LEU HA   H    0.138  -0.845  -2.418 1.00 . A A .  28 LEU HA   1 1 
        7  4065 1 1 28 LEU HB2  H   -1.113  -2.008  -0.772 1.00 . A A .  28 LEU HB2  1 1 
        7  4066 1 1 28 LEU HB3  H    0.350  -2.570   0.036 1.00 . A A .  28 LEU HB3  1 1 
        7  4067 1 1 28 LEU HD11 H   -0.410   0.922  -1.051 1.00 . A A .  28 LEU HD11 1 1 
        7  4068 1 1 28 LEU HD12 H   -0.993   1.421   0.537 1.00 . A A .  28 LEU HD12 1 1 
        7  4069 1 1 28 LEU HD13 H   -1.931   0.282  -0.430 1.00 . A A .  28 LEU HD13 1 1 
        7  4070 1 1 28 LEU HD21 H   -0.238  -1.705   2.280 1.00 . A A .  28 LEU HD21 1 1 
        7  4071 1 1 28 LEU HD22 H   -1.821  -1.408   1.561 1.00 . A A .  28 LEU HD22 1 1 
        7  4072 1 1 28 LEU HD23 H   -0.980  -0.110   2.410 1.00 . A A .  28 LEU HD23 1 1 
        7  4073 1 1 28 LEU HG   H    0.816  -0.222   0.705 1.00 . A A .  28 LEU HG   1 1 
        7  4074 1 1 28 LEU N    N    0.884  -2.769  -2.486 1.00 . A A .  28 LEU N    1 1 
        7  4075 1 1 28 LEU O    O    2.248   0.320  -1.705 1.00 . A A .  28 LEU O    1 1 
        7  4076 1 1 29 ILE C    C    4.949  -0.502  -1.690 1.00 . A A .  29 ILE C    1 1 
        7  4077 1 1 29 ILE CA   C    4.258  -1.156  -0.498 1.00 . A A .  29 ILE CA   1 1 
        7  4078 1 1 29 ILE CB   C    5.153  -2.286   0.043 1.00 . A A .  29 ILE CB   1 1 
        7  4079 1 1 29 ILE CD1  C    5.156  -4.252   1.660 1.00 . A A .  29 ILE CD1  1 1 
        7  4080 1 1 29 ILE CG1  C    4.492  -2.956   1.250 1.00 . A A .  29 ILE CG1  1 1 
        7  4081 1 1 29 ILE CG2  C    6.525  -1.744   0.417 1.00 . A A .  29 ILE CG2  1 1 
        7  4082 1 1 29 ILE H    H    2.708  -2.584  -0.678 1.00 . A A .  29 ILE H    1 1 
        7  4083 1 1 29 ILE HA   H    4.134  -0.418   0.282 1.00 . A A .  29 ILE HA   1 1 
        7  4084 1 1 29 ILE HB   H    5.283  -3.018  -0.739 1.00 . A A .  29 ILE HB   1 1 
        7  4085 1 1 29 ILE HD11 H    5.615  -4.711   0.796 1.00 . A A .  29 ILE HD11 1 1 
        7  4086 1 1 29 ILE HD12 H    5.913  -4.050   2.403 1.00 . A A .  29 ILE HD12 1 1 
        7  4087 1 1 29 ILE HD13 H    4.416  -4.922   2.072 1.00 . A A .  29 ILE HD13 1 1 
        7  4088 1 1 29 ILE HG12 H    4.530  -2.284   2.092 1.00 . A A .  29 ILE HG12 1 1 
        7  4089 1 1 29 ILE HG13 H    3.460  -3.172   1.012 1.00 . A A .  29 ILE HG13 1 1 
        7  4090 1 1 29 ILE HG21 H    6.482  -1.306   1.403 1.00 . A A .  29 ILE HG21 1 1 
        7  4091 1 1 29 ILE HG22 H    7.243  -2.550   0.413 1.00 . A A .  29 ILE HG22 1 1 
        7  4092 1 1 29 ILE HG23 H    6.822  -0.993  -0.299 1.00 . A A .  29 ILE HG23 1 1 
        7  4093 1 1 29 ILE N    N    2.937  -1.650  -0.863 1.00 . A A .  29 ILE N    1 1 
        7  4094 1 1 29 ILE O    O    5.366   0.655  -1.620 1.00 . A A .  29 ILE O    1 1 
        7  4095 1 1 30 ILE C    C    5.179   0.645  -4.347 1.00 . A A .  30 ILE C    1 1 
        7  4096 1 1 30 ILE CA   C    5.703  -0.741  -3.990 1.00 . A A .  30 ILE CA   1 1 
        7  4097 1 1 30 ILE CB   C    5.478  -1.687  -5.185 1.00 . A A .  30 ILE CB   1 1 
        7  4098 1 1 30 ILE CD1  C    5.506  -4.160  -5.784 1.00 . A A .  30 ILE CD1  1 1 
        7  4099 1 1 30 ILE CG1  C    6.046  -3.074  -4.880 1.00 . A A .  30 ILE CG1  1 1 
        7  4100 1 1 30 ILE CG2  C    6.116  -1.112  -6.442 1.00 . A A .  30 ILE CG2  1 1 
        7  4101 1 1 30 ILE H    H    4.714  -2.164  -2.775 1.00 . A A .  30 ILE H    1 1 
        7  4102 1 1 30 ILE HA   H    6.766  -0.676  -3.804 1.00 . A A .  30 ILE HA   1 1 
        7  4103 1 1 30 ILE HB   H    4.416  -1.769  -5.355 1.00 . A A .  30 ILE HB   1 1 
        7  4104 1 1 30 ILE HD11 H    6.105  -4.212  -6.682 1.00 . A A .  30 ILE HD11 1 1 
        7  4105 1 1 30 ILE HD12 H    5.546  -5.110  -5.271 1.00 . A A .  30 ILE HD12 1 1 
        7  4106 1 1 30 ILE HD13 H    4.483  -3.935  -6.047 1.00 . A A .  30 ILE HD13 1 1 
        7  4107 1 1 30 ILE HG12 H    7.118  -3.051  -4.994 1.00 . A A .  30 ILE HG12 1 1 
        7  4108 1 1 30 ILE HG13 H    5.802  -3.338  -3.861 1.00 . A A .  30 ILE HG13 1 1 
        7  4109 1 1 30 ILE HG21 H    6.131  -1.867  -7.214 1.00 . A A .  30 ILE HG21 1 1 
        7  4110 1 1 30 ILE HG22 H    5.541  -0.264  -6.781 1.00 . A A .  30 ILE HG22 1 1 
        7  4111 1 1 30 ILE HG23 H    7.125  -0.800  -6.223 1.00 . A A .  30 ILE HG23 1 1 
        7  4112 1 1 30 ILE N    N    5.066  -1.249  -2.782 1.00 . A A .  30 ILE N    1 1 
        7  4113 1 1 30 ILE O    O    5.922   1.493  -4.842 1.00 . A A .  30 ILE O    1 1 
        7  4114 1 1 31 HIS C    C    3.750   3.227  -3.408 1.00 . A A .  31 HIS C    1 1 
        7  4115 1 1 31 HIS CA   C    3.270   2.156  -4.383 1.00 . A A .  31 HIS CA   1 1 
        7  4116 1 1 31 HIS CB   C    1.747   2.034  -4.316 1.00 . A A .  31 HIS CB   1 1 
        7  4117 1 1 31 HIS CD2  C    0.563   4.145  -3.383 1.00 . A A .  31 HIS CD2  1 1 
        7  4118 1 1 31 HIS CE1  C    0.119   5.132  -5.289 1.00 . A A .  31 HIS CE1  1 1 
        7  4119 1 1 31 HIS CG   C    1.038   3.352  -4.372 1.00 . A A .  31 HIS CG   1 1 
        7  4120 1 1 31 HIS H    H    3.353   0.155  -3.696 1.00 . A A .  31 HIS H    1 1 
        7  4121 1 1 31 HIS HA   H    3.555   2.443  -5.383 1.00 . A A .  31 HIS HA   1 1 
        7  4122 1 1 31 HIS HB2  H    1.403   1.437  -5.148 1.00 . A A .  31 HIS HB2  1 1 
        7  4123 1 1 31 HIS HB3  H    1.472   1.547  -3.391 1.00 . A A .  31 HIS HB3  1 1 
        7  4124 1 1 31 HIS HD1  H    0.961   3.675  -6.453 1.00 . A A .  31 HIS HD1  1 1 
        7  4125 1 1 31 HIS HD2  H    0.619   3.949  -2.321 1.00 . A A .  31 HIS HD2  1 1 
        7  4126 1 1 31 HIS HE1  H   -0.232   5.846  -6.020 1.00 . A A .  31 HIS HE1  1 1 
        7  4127 1 1 31 HIS N    N    3.894   0.870  -4.091 1.00 . A A .  31 HIS N    1 1 
        7  4128 1 1 31 HIS ND1  N    0.743   3.998  -5.554 1.00 . A A .  31 HIS ND1  1 1 
        7  4129 1 1 31 HIS NE2  N   -0.003   5.244  -3.979 1.00 . A A .  31 HIS NE2  1 1 
        7  4130 1 1 31 HIS O    O    4.131   4.324  -3.815 1.00 . A A .  31 HIS O    1 1 
        7  4131 1 1 32 MET C    C    5.492   4.480  -1.463 1.00 . A A .  32 MET C    1 1 
        7  4132 1 1 32 MET CA   C    4.162   3.834  -1.088 1.00 . A A .  32 MET CA   1 1 
        7  4133 1 1 32 MET CB   C    4.291   3.117   0.257 1.00 . A A .  32 MET CB   1 1 
        7  4134 1 1 32 MET CE   C    0.963   4.831   1.434 1.00 . A A .  32 MET CE   1 1 
        7  4135 1 1 32 MET CG   C    2.971   2.972   0.998 1.00 . A A .  32 MET CG   1 1 
        7  4136 1 1 32 MET H    H    3.414   2.010  -1.857 1.00 . A A .  32 MET H    1 1 
        7  4137 1 1 32 MET HA   H    3.412   4.606  -1.004 1.00 . A A .  32 MET HA   1 1 
        7  4138 1 1 32 MET HB2  H    4.695   2.130   0.089 1.00 . A A .  32 MET HB2  1 1 
        7  4139 1 1 32 MET HB3  H    4.971   3.674   0.885 1.00 . A A .  32 MET HB3  1 1 
        7  4140 1 1 32 MET HE1  H    0.595   5.688   1.980 1.00 . A A .  32 MET HE1  1 1 
        7  4141 1 1 32 MET HE2  H    1.016   5.069   0.382 1.00 . A A .  32 MET HE2  1 1 
        7  4142 1 1 32 MET HE3  H    0.294   3.996   1.581 1.00 . A A .  32 MET HE3  1 1 
        7  4143 1 1 32 MET HG2  H    2.179   2.852   0.275 1.00 . A A .  32 MET HG2  1 1 
        7  4144 1 1 32 MET HG3  H    3.021   2.094   1.624 1.00 . A A .  32 MET HG3  1 1 
        7  4145 1 1 32 MET N    N    3.728   2.900  -2.120 1.00 . A A .  32 MET N    1 1 
        7  4146 1 1 32 MET O    O    5.787   5.601  -1.049 1.00 . A A .  32 MET O    1 1 
        7  4147 1 1 32 MET SD   S    2.595   4.400   2.033 1.00 . A A .  32 MET SD   1 1 
        7  4148 1 1 33 ARG C    C    7.484   5.716  -3.148 1.00 . A A .  33 ARG C    1 1 
        7  4149 1 1 33 ARG CA   C    7.590   4.268  -2.678 1.00 . A A .  33 ARG CA   1 1 
        7  4150 1 1 33 ARG CB   C    8.153   3.396  -3.801 1.00 . A A .  33 ARG CB   1 1 
        7  4151 1 1 33 ARG CD   C    9.958   1.928  -2.851 1.00 . A A .  33 ARG CD   1 1 
        7  4152 1 1 33 ARG CG   C    8.524   1.992  -3.354 1.00 . A A .  33 ARG CG   1 1 
        7  4153 1 1 33 ARG CZ   C   12.188   1.740  -3.869 1.00 . A A .  33 ARG CZ   1 1 
        7  4154 1 1 33 ARG H    H    6.000   2.878  -2.546 1.00 . A A .  33 ARG H    1 1 
        7  4155 1 1 33 ARG HA   H    8.259   4.225  -1.831 1.00 . A A .  33 ARG HA   1 1 
        7  4156 1 1 33 ARG HB2  H    7.414   3.317  -4.585 1.00 . A A .  33 ARG HB2  1 1 
        7  4157 1 1 33 ARG HB3  H    9.038   3.870  -4.199 1.00 . A A .  33 ARG HB3  1 1 
        7  4158 1 1 33 ARG HD2  H   10.094   2.687  -2.095 1.00 . A A .  33 ARG HD2  1 1 
        7  4159 1 1 33 ARG HD3  H   10.130   0.954  -2.417 1.00 . A A .  33 ARG HD3  1 1 
        7  4160 1 1 33 ARG HE   H   10.616   2.624  -4.722 1.00 . A A .  33 ARG HE   1 1 
        7  4161 1 1 33 ARG HG2  H    7.861   1.690  -2.557 1.00 . A A .  33 ARG HG2  1 1 
        7  4162 1 1 33 ARG HG3  H    8.415   1.317  -4.190 1.00 . A A .  33 ARG HG3  1 1 
        7  4163 1 1 33 ARG HH11 H   12.019   0.912  -2.034 1.00 . A A .  33 ARG HH11 1 1 
        7  4164 1 1 33 ARG HH12 H   13.585   0.787  -2.763 1.00 . A A .  33 ARG HH12 1 1 
        7  4165 1 1 33 ARG HH21 H   12.674   2.465  -5.692 1.00 . A A .  33 ARG HH21 1 1 
        7  4166 1 1 33 ARG HH22 H   13.958   1.671  -4.843 1.00 . A A .  33 ARG HH22 1 1 
        7  4167 1 1 33 ARG N    N    6.291   3.765  -2.248 1.00 . A A .  33 ARG N    1 1 
        7  4168 1 1 33 ARG NE   N   10.925   2.148  -3.923 1.00 . A A .  33 ARG NE   1 1 
        7  4169 1 1 33 ARG NH1  N   12.634   1.094  -2.801 1.00 . A A .  33 ARG NH1  1 1 
        7  4170 1 1 33 ARG NH2  N   13.007   1.978  -4.885 1.00 . A A .  33 ARG NH2  1 1 
        7  4171 1 1 33 ARG O    O    8.377   6.528  -2.901 1.00 . A A .  33 ARG O    1 1 
        7  4172 1 1 34 THR C    C    5.839   8.349  -3.199 1.00 . A A .  34 THR C    1 1 
        7  4173 1 1 34 THR CA   C    6.164   7.382  -4.333 1.00 . A A .  34 THR CA   1 1 
        7  4174 1 1 34 THR CB   C    5.019   7.414  -5.362 1.00 . A A .  34 THR CB   1 1 
        7  4175 1 1 34 THR CG2  C    5.389   6.623  -6.608 1.00 . A A .  34 THR CG2  1 1 
        7  4176 1 1 34 THR H    H    5.711   5.343  -3.991 1.00 . A A .  34 THR H    1 1 
        7  4177 1 1 34 THR HA   H    7.070   7.708  -4.822 1.00 . A A .  34 THR HA   1 1 
        7  4178 1 1 34 THR HB   H    4.839   8.441  -5.646 1.00 . A A .  34 THR HB   1 1 
        7  4179 1 1 34 THR HG1  H    3.940   5.931  -4.638 1.00 . A A .  34 THR HG1  1 1 
        7  4180 1 1 34 THR HG21 H    6.321   6.996  -7.006 1.00 . A A .  34 THR HG21 1 1 
        7  4181 1 1 34 THR HG22 H    4.612   6.734  -7.349 1.00 . A A .  34 THR HG22 1 1 
        7  4182 1 1 34 THR HG23 H    5.499   5.580  -6.353 1.00 . A A .  34 THR HG23 1 1 
        7  4183 1 1 34 THR N    N    6.386   6.034  -3.826 1.00 . A A .  34 THR N    1 1 
        7  4184 1 1 34 THR O    O    6.388   9.449  -3.131 1.00 . A A .  34 THR O    1 1 
        7  4185 1 1 34 THR OG1  O    3.825   6.873  -4.785 1.00 . A A .  34 THR OG1  1 1 
        7  4186 1 1 35 HIS C    C    5.664   8.831  -0.139 1.00 . A A .  35 HIS C    1 1 
        7  4187 1 1 35 HIS CA   C    4.548   8.759  -1.176 1.00 . A A .  35 HIS CA   1 1 
        7  4188 1 1 35 HIS CB   C    3.274   8.208  -0.535 1.00 . A A .  35 HIS CB   1 1 
        7  4189 1 1 35 HIS CD2  C    1.158   7.456  -1.834 1.00 . A A .  35 HIS CD2  1 1 
        7  4190 1 1 35 HIS CE1  C    0.545   9.412  -2.609 1.00 . A A .  35 HIS CE1  1 1 
        7  4191 1 1 35 HIS CG   C    2.055   8.368  -1.391 1.00 . A A .  35 HIS CG   1 1 
        7  4192 1 1 35 HIS H    H    4.542   7.044  -2.417 1.00 . A A .  35 HIS H    1 1 
        7  4193 1 1 35 HIS HA   H    4.353   9.755  -1.546 1.00 . A A .  35 HIS HA   1 1 
        7  4194 1 1 35 HIS HB2  H    3.405   7.154  -0.339 1.00 . A A .  35 HIS HB2  1 1 
        7  4195 1 1 35 HIS HB3  H    3.095   8.724   0.397 1.00 . A A .  35 HIS HB3  1 1 
        7  4196 1 1 35 HIS HD1  H    2.089  10.444  -1.750 1.00 . A A .  35 HIS HD1  1 1 
        7  4197 1 1 35 HIS HD2  H    1.170   6.394  -1.631 1.00 . A A .  35 HIS HD2  1 1 
        7  4198 1 1 35 HIS HE1  H   -0.003  10.188  -3.122 1.00 . A A .  35 HIS HE1  1 1 
        7  4199 1 1 35 HIS N    N    4.944   7.931  -2.309 1.00 . A A .  35 HIS N    1 1 
        7  4200 1 1 35 HIS ND1  N    1.643   9.584  -1.895 1.00 . A A .  35 HIS ND1  1 1 
        7  4201 1 1 35 HIS NE2  N    0.230   8.130  -2.588 1.00 . A A .  35 HIS NE2  1 1 
        7  4202 1 1 35 HIS O    O    5.744   7.993   0.760 1.00 . A A .  35 HIS O    1 1 
        7  4203 1 1 36 SER C    C    7.698  11.452   1.162 1.00 . A A .  36 SER C    1 1 
        7  4204 1 1 36 SER CA   C    7.637  10.015   0.655 1.00 . A A .  36 SER CA   1 1 
        7  4205 1 1 36 SER CB   C    8.957   9.647  -0.027 1.00 . A A .  36 SER CB   1 1 
        7  4206 1 1 36 SER H    H    6.406  10.472  -1.006 1.00 . A A .  36 SER H    1 1 
        7  4207 1 1 36 SER HA   H    7.480   9.355   1.495 1.00 . A A .  36 SER HA   1 1 
        7  4208 1 1 36 SER HB2  H    8.933   8.607  -0.313 1.00 . A A .  36 SER HB2  1 1 
        7  4209 1 1 36 SER HB3  H    9.086  10.260  -0.908 1.00 . A A .  36 SER HB3  1 1 
        7  4210 1 1 36 SER HG   H   10.778  10.260   0.354 1.00 . A A .  36 SER HG   1 1 
        7  4211 1 1 36 SER N    N    6.523   9.837  -0.269 1.00 . A A .  36 SER N    1 1 
        7  4212 1 1 36 SER O    O    8.253  12.332   0.505 1.00 . A A .  36 SER O    1 1 
        7  4213 1 1 36 SER OG   O   10.056   9.858   0.842 1.00 . A A .  36 SER OG   1 1 
        7  4214 1 1 37 GLY C    C    6.115  13.935   2.247 1.00 . A A .  37 GLY C    1 1 
        7  4215 1 1 37 GLY CA   C    7.118  13.015   2.914 1.00 . A A .  37 GLY CA   1 1 
        7  4216 1 1 37 GLY H    H    6.692  10.943   2.817 1.00 . A A .  37 GLY H    1 1 
        7  4217 1 1 37 GLY HA2  H    6.879  12.940   3.965 1.00 . A A .  37 GLY HA2  1 1 
        7  4218 1 1 37 GLY HA3  H    8.105  13.441   2.810 1.00 . A A .  37 GLY HA3  1 1 
        7  4219 1 1 37 GLY N    N    7.120  11.683   2.338 1.00 . A A .  37 GLY N    1 1 
        7  4220 1 1 37 GLY O    O    5.214  14.458   2.900 1.00 . A A .  37 GLY O    1 1 
        7  4221 1 1 38 GLU C    C    5.072  14.404  -1.185 1.00 . A A .  38 GLU C    1 1 
        7  4222 1 1 38 GLU CA   C    5.375  14.998   0.187 1.00 . A A .  38 GLU CA   1 1 
        7  4223 1 1 38 GLU CB   C    5.987  16.391   0.028 1.00 . A A .  38 GLU CB   1 1 
        7  4224 1 1 38 GLU CD   C    5.988  18.761   0.903 1.00 . A A .  38 GLU CD   1 1 
        7  4225 1 1 38 GLU CG   C    5.759  17.297   1.226 1.00 . A A .  38 GLU CG   1 1 
        7  4226 1 1 38 GLU H    H    7.012  13.687   0.476 1.00 . A A .  38 GLU H    1 1 
        7  4227 1 1 38 GLU HA   H    4.452  15.082   0.741 1.00 . A A .  38 GLU HA   1 1 
        7  4228 1 1 38 GLU HB2  H    7.051  16.289  -0.123 1.00 . A A .  38 GLU HB2  1 1 
        7  4229 1 1 38 GLU HB3  H    5.554  16.864  -0.842 1.00 . A A .  38 GLU HB3  1 1 
        7  4230 1 1 38 GLU HG2  H    4.741  17.175   1.565 1.00 . A A .  38 GLU HG2  1 1 
        7  4231 1 1 38 GLU HG3  H    6.437  17.007   2.015 1.00 . A A .  38 GLU HG3  1 1 
        7  4232 1 1 38 GLU N    N    6.273  14.133   0.942 1.00 . A A .  38 GLU N    1 1 
        7  4233 1 1 38 GLU O    O    5.965  14.251  -2.019 1.00 . A A .  38 GLU O    1 1 
        7  4234 1 1 38 GLU OE1  O    5.285  19.290   0.017 1.00 . A A .  38 GLU OE1  1 1 
        7  4235 1 1 38 GLU OE2  O    6.871  19.377   1.536 1.00 . A A .  38 GLU OE2  1 1 
        7  4236 1 1 39 LYS C    C    4.182  14.081  -3.841 1.00 . A A .  39 LYS C    1 1 
        7  4237 1 1 39 LYS CA   C    3.383  13.492  -2.683 1.00 . A A .  39 LYS CA   1 1 
        7  4238 1 1 39 LYS CB   C    1.889  13.735  -2.904 1.00 . A A .  39 LYS CB   1 1 
        7  4239 1 1 39 LYS CD   C   -0.353  13.628  -1.775 1.00 . A A .  39 LYS CD   1 1 
        7  4240 1 1 39 LYS CE   C   -1.339  13.189  -2.847 1.00 . A A .  39 LYS CE   1 1 
        7  4241 1 1 39 LYS CG   C    0.998  12.955  -1.952 1.00 . A A .  39 LYS CG   1 1 
        7  4242 1 1 39 LYS H    H    3.140  14.215  -0.708 1.00 . A A .  39 LYS H    1 1 
        7  4243 1 1 39 LYS HA   H    3.564  12.428  -2.641 1.00 . A A .  39 LYS HA   1 1 
        7  4244 1 1 39 LYS HB2  H    1.684  14.787  -2.775 1.00 . A A .  39 LYS HB2  1 1 
        7  4245 1 1 39 LYS HB3  H    1.636  13.449  -3.916 1.00 . A A .  39 LYS HB3  1 1 
        7  4246 1 1 39 LYS HD2  H   -0.751  13.367  -0.807 1.00 . A A .  39 LYS HD2  1 1 
        7  4247 1 1 39 LYS HD3  H   -0.222  14.700  -1.836 1.00 . A A .  39 LYS HD3  1 1 
        7  4248 1 1 39 LYS HE2  H   -1.138  13.742  -3.751 1.00 . A A .  39 LYS HE2  1 1 
        7  4249 1 1 39 LYS HE3  H   -1.202  12.134  -3.032 1.00 . A A .  39 LYS HE3  1 1 
        7  4250 1 1 39 LYS HG2  H    0.844  11.963  -2.349 1.00 . A A .  39 LYS HG2  1 1 
        7  4251 1 1 39 LYS HG3  H    1.486  12.889  -0.990 1.00 . A A .  39 LYS HG3  1 1 
        7  4252 1 1 39 LYS HZ1  H   -3.325  12.584  -2.618 1.00 . A A .  39 LYS HZ1  1 1 
        7  4253 1 1 39 LYS HZ2  H   -3.146  14.229  -2.970 1.00 . A A .  39 LYS HZ2  1 1 
        7  4254 1 1 39 LYS HZ3  H   -2.792  13.653  -1.420 1.00 . A A .  39 LYS HZ3  1 1 
        7  4255 1 1 39 LYS N    N    3.806  14.069  -1.413 1.00 . A A .  39 LYS N    1 1 
        7  4256 1 1 39 LYS NZ   N   -2.749  13.430  -2.434 1.00 . A A .  39 LYS NZ   1 1 
        7  4257 1 1 39 LYS O    O    4.528  15.262  -3.851 1.00 . A A .  39 LYS O    1 1 
        7  4258 1 1 40 PRO C    C    4.447  14.597  -6.923 1.00 . A A .  40 PRO C    1 1 
        7  4259 1 1 40 PRO CA   C    5.242  13.656  -6.025 1.00 . A A .  40 PRO CA   1 1 
        7  4260 1 1 40 PRO CB   C    5.523  12.337  -6.748 1.00 . A A .  40 PRO CB   1 1 
        7  4261 1 1 40 PRO CD   C    4.103  11.818  -4.897 1.00 . A A .  40 PRO CD   1 1 
        7  4262 1 1 40 PRO CG   C    4.430  11.425  -6.311 1.00 . A A .  40 PRO CG   1 1 
        7  4263 1 1 40 PRO HA   H    6.176  14.125  -5.752 1.00 . A A .  40 PRO HA   1 1 
        7  4264 1 1 40 PRO HB2  H    5.501  12.498  -7.817 1.00 . A A .  40 PRO HB2  1 1 
        7  4265 1 1 40 PRO HB3  H    6.492  11.961  -6.455 1.00 . A A .  40 PRO HB3  1 1 
        7  4266 1 1 40 PRO HD2  H    3.048  11.693  -4.705 1.00 . A A .  40 PRO HD2  1 1 
        7  4267 1 1 40 PRO HD3  H    4.687  11.237  -4.199 1.00 . A A .  40 PRO HD3  1 1 
        7  4268 1 1 40 PRO HG2  H    3.567  11.555  -6.946 1.00 . A A .  40 PRO HG2  1 1 
        7  4269 1 1 40 PRO HG3  H    4.771  10.401  -6.345 1.00 . A A .  40 PRO HG3  1 1 
        7  4270 1 1 40 PRO N    N    4.482  13.240  -4.842 1.00 . A A .  40 PRO N    1 1 
        7  4271 1 1 40 PRO O    O    3.421  14.215  -7.486 1.00 . A A .  40 PRO O    1 1 
        7  4272 1 1 41 SER C    C    4.956  16.971  -9.230 1.00 . A A .  41 SER C    1 1 
        7  4273 1 1 41 SER CA   C    4.258  16.827  -7.881 1.00 . A A .  41 SER CA   1 1 
        7  4274 1 1 41 SER CB   C    4.226  18.178  -7.164 1.00 . A A .  41 SER CB   1 1 
        7  4275 1 1 41 SER H    H    5.749  16.075  -6.579 1.00 . A A .  41 SER H    1 1 
        7  4276 1 1 41 SER HA   H    3.244  16.494  -8.047 1.00 . A A .  41 SER HA   1 1 
        7  4277 1 1 41 SER HB2  H    5.170  18.341  -6.667 1.00 . A A .  41 SER HB2  1 1 
        7  4278 1 1 41 SER HB3  H    4.061  18.963  -7.888 1.00 . A A .  41 SER HB3  1 1 
        7  4279 1 1 41 SER HG   H    2.793  19.094  -6.193 1.00 . A A .  41 SER HG   1 1 
        7  4280 1 1 41 SER N    N    4.926  15.830  -7.053 1.00 . A A .  41 SER N    1 1 
        7  4281 1 1 41 SER O    O    4.913  18.030  -9.855 1.00 . A A .  41 SER O    1 1 
        7  4282 1 1 41 SER OG   O    3.189  18.220  -6.199 1.00 . A A .  41 SER OG   1 1 
        7  4283 1 1 42 GLY C    C    7.281  17.072 -11.043 1.00 . A A .  42 GLY C    1 1 
        7  4284 1 1 42 GLY CA   C    6.300  15.921 -10.944 1.00 . A A .  42 GLY CA   1 1 
        7  4285 1 1 42 GLY H    H    5.601  15.078  -9.132 1.00 . A A .  42 GLY H    1 1 
        7  4286 1 1 42 GLY HA2  H    6.837  14.992 -11.066 1.00 . A A .  42 GLY HA2  1 1 
        7  4287 1 1 42 GLY HA3  H    5.574  16.012 -11.739 1.00 . A A .  42 GLY HA3  1 1 
        7  4288 1 1 42 GLY N    N    5.601  15.895  -9.673 1.00 . A A .  42 GLY N    1 1 
        7  4289 1 1 42 GLY O    O    7.433  17.868 -10.116 1.00 . A A .  42 GLY O    1 1 
        7  4290 1 1 43 PRO C    C    8.304  19.601 -12.591 1.00 . A A .  43 PRO C    1 1 
        7  4291 1 1 43 PRO CA   C    8.953  18.230 -12.434 1.00 . A A .  43 PRO CA   1 1 
        7  4292 1 1 43 PRO CB   C    9.618  17.801 -13.744 1.00 . A A .  43 PRO CB   1 1 
        7  4293 1 1 43 PRO CD   C    7.838  16.259 -13.339 1.00 . A A .  43 PRO CD   1 1 
        7  4294 1 1 43 PRO CG   C    8.598  16.960 -14.430 1.00 . A A .  43 PRO CG   1 1 
        7  4295 1 1 43 PRO HA   H    9.694  18.272 -11.649 1.00 . A A .  43 PRO HA   1 1 
        7  4296 1 1 43 PRO HB2  H    9.868  18.676 -14.328 1.00 . A A .  43 PRO HB2  1 1 
        7  4297 1 1 43 PRO HB3  H   10.514  17.238 -13.530 1.00 . A A .  43 PRO HB3  1 1 
        7  4298 1 1 43 PRO HD2  H    6.802  16.136 -13.618 1.00 . A A .  43 PRO HD2  1 1 
        7  4299 1 1 43 PRO HD3  H    8.287  15.301 -13.122 1.00 . A A .  43 PRO HD3  1 1 
        7  4300 1 1 43 PRO HG2  H    7.933  17.586 -15.006 1.00 . A A .  43 PRO HG2  1 1 
        7  4301 1 1 43 PRO HG3  H    9.086  16.240 -15.069 1.00 . A A .  43 PRO HG3  1 1 
        7  4302 1 1 43 PRO N    N    7.969  17.172 -12.191 1.00 . A A .  43 PRO N    1 1 
        7  4303 1 1 43 PRO O    O    7.463  19.804 -13.467 1.00 . A A .  43 PRO O    1 1 
        7  4304 1 1 44 SER C    C    9.186  22.878 -12.310 1.00 . A A .  44 SER C    1 1 
        7  4305 1 1 44 SER CA   C    8.153  21.890 -11.778 1.00 . A A .  44 SER CA   1 1 
        7  4306 1 1 44 SER CB   C    7.690  22.320 -10.384 1.00 . A A .  44 SER CB   1 1 
        7  4307 1 1 44 SER H    H    9.373  20.316 -11.060 1.00 . A A .  44 SER H    1 1 
        7  4308 1 1 44 SER HA   H    7.302  21.884 -12.444 1.00 . A A .  44 SER HA   1 1 
        7  4309 1 1 44 SER HB2  H    7.030  21.568  -9.979 1.00 . A A .  44 SER HB2  1 1 
        7  4310 1 1 44 SER HB3  H    8.551  22.428  -9.740 1.00 . A A .  44 SER HB3  1 1 
        7  4311 1 1 44 SER HG   H    6.500  23.610 -11.253 1.00 . A A .  44 SER HG   1 1 
        7  4312 1 1 44 SER N    N    8.699  20.539 -11.736 1.00 . A A .  44 SER N    1 1 
        7  4313 1 1 44 SER O    O   10.021  23.384 -11.560 1.00 . A A .  44 SER O    1 1 
        7  4314 1 1 44 SER OG   O    6.999  23.555 -10.434 1.00 . A A .  44 SER OG   1 1 
        7  4315 1 1 45 SER C    C    9.337  25.335 -14.711 1.00 . A A .  45 SER C    1 1 
        7  4316 1 1 45 SER CA   C   10.056  24.072 -14.245 1.00 . A A .  45 SER CA   1 1 
        7  4317 1 1 45 SER CB   C   10.747  23.398 -15.431 1.00 . A A .  45 SER CB   1 1 
        7  4318 1 1 45 SER H    H    8.435  22.713 -14.155 1.00 . A A .  45 SER H    1 1 
        7  4319 1 1 45 SER HA   H   10.801  24.346 -13.513 1.00 . A A .  45 SER HA   1 1 
        7  4320 1 1 45 SER HB2  H   11.193  22.470 -15.106 1.00 . A A .  45 SER HB2  1 1 
        7  4321 1 1 45 SER HB3  H   10.017  23.195 -16.202 1.00 . A A .  45 SER HB3  1 1 
        7  4322 1 1 45 SER HG   H   11.450  24.626 -16.786 1.00 . A A .  45 SER HG   1 1 
        7  4323 1 1 45 SER N    N    9.124  23.148 -13.610 1.00 . A A .  45 SER N    1 1 
        7  4324 1 1 45 SER O    O    8.653  25.332 -15.733 1.00 . A A .  45 SER O    1 1 
        7  4325 1 1 45 SER OG   O   11.762  24.228 -15.970 1.00 . A A .  45 SER OG   1 1 
        7  4326 1 1 46 GLY C    C    9.721  28.871 -13.971 1.00 . A A .  46 GLY C    1 1 
        7  4327 1 1 46 GLY CA   C    8.858  27.669 -14.301 1.00 . A A .  46 GLY CA   1 1 
        7  4328 1 1 46 GLY H    H   10.054  26.358 -13.146 1.00 . A A .  46 GLY H    1 1 
        7  4329 1 1 46 GLY HA2  H    8.648  27.670 -15.360 1.00 . A A .  46 GLY HA2  1 1 
        7  4330 1 1 46 GLY HA3  H    7.927  27.749 -13.759 1.00 . A A .  46 GLY HA3  1 1 
        7  4331 1 1 46 GLY N    N    9.498  26.414 -13.951 1.00 . A A .  46 GLY N    1 1 
        7  4332 1 1 46 GLY O    O   10.911  28.857 -14.280 1.00 . A A .  46 GLY O    1 1 
        7  4333 2 2  1 ZN  ZN   ZN  -1.006   6.708  -3.228 1.00 . B A . 201 ZN  ZN   1 1 
        8  4334 1 1  1 GLY C    C  -28.254   1.063  -9.384 1.00 . A A .   1 GLY C    1 1 
        8  4335 1 1  1 GLY CA   C  -28.824   2.457  -9.207 1.00 . A A .   1 GLY CA   1 1 
        8  4336 1 1  1 GLY H1   H  -29.986   1.843  -7.547 1.00 . A A .   1 GLY H1   1 1 
        8  4337 1 1  1 GLY HA2  H  -29.507   2.661 -10.018 1.00 . A A .   1 GLY HA2  1 1 
        8  4338 1 1  1 GLY HA3  H  -28.015   3.171  -9.243 1.00 . A A .   1 GLY HA3  1 1 
        8  4339 1 1  1 GLY N    N  -29.531   2.612  -7.949 1.00 . A A .   1 GLY N    1 1 
        8  4340 1 1  1 GLY O    O  -28.708   0.114  -8.744 1.00 . A A .   1 GLY O    1 1 
        8  4341 1 1  2 SER C    C  -25.121  -0.193 -10.689 1.00 . A A .   2 SER C    1 1 
        8  4342 1 1  2 SER CA   C  -26.629  -0.350 -10.518 1.00 . A A .   2 SER CA   1 1 
        8  4343 1 1  2 SER CB   C  -27.232  -0.990 -11.770 1.00 . A A .   2 SER CB   1 1 
        8  4344 1 1  2 SER H    H  -26.941   1.733 -10.734 1.00 . A A .   2 SER H    1 1 
        8  4345 1 1  2 SER HA   H  -26.819  -0.991  -9.670 1.00 . A A .   2 SER HA   1 1 
        8  4346 1 1  2 SER HB2  H  -28.307  -0.899 -11.735 1.00 . A A .   2 SER HB2  1 1 
        8  4347 1 1  2 SER HB3  H  -26.856  -0.483 -12.647 1.00 . A A .   2 SER HB3  1 1 
        8  4348 1 1  2 SER HG   H  -26.337  -2.508 -12.624 1.00 . A A .   2 SER HG   1 1 
        8  4349 1 1  2 SER N    N  -27.258   0.939 -10.255 1.00 . A A .   2 SER N    1 1 
        8  4350 1 1  2 SER O    O  -24.654   0.715 -11.376 1.00 . A A .   2 SER O    1 1 
        8  4351 1 1  2 SER OG   O  -26.893  -2.363 -11.855 1.00 . A A .   2 SER OG   1 1 
        8  4352 1 1  3 SER C    C  -22.325  -2.456 -10.126 1.00 . A A .   3 SER C    1 1 
        8  4353 1 1  3 SER CA   C  -22.909  -1.046 -10.137 1.00 . A A .   3 SER CA   1 1 
        8  4354 1 1  3 SER CB   C  -22.336  -0.236  -8.972 1.00 . A A .   3 SER CB   1 1 
        8  4355 1 1  3 SER H    H  -24.796  -1.787  -9.526 1.00 . A A .   3 SER H    1 1 
        8  4356 1 1  3 SER HA   H  -22.640  -0.565 -11.065 1.00 . A A .   3 SER HA   1 1 
        8  4357 1 1  3 SER HB2  H  -22.948  -0.389  -8.096 1.00 . A A .   3 SER HB2  1 1 
        8  4358 1 1  3 SER HB3  H  -21.328  -0.566  -8.769 1.00 . A A .   3 SER HB3  1 1 
        8  4359 1 1  3 SER HG   H  -21.565   1.559  -8.836 1.00 . A A .   3 SER HG   1 1 
        8  4360 1 1  3 SER N    N  -24.364  -1.086 -10.058 1.00 . A A .   3 SER N    1 1 
        8  4361 1 1  3 SER O    O  -22.812  -3.336  -9.417 1.00 . A A .   3 SER O    1 1 
        8  4362 1 1  3 SER OG   O  -22.312   1.148  -9.276 1.00 . A A .   3 SER OG   1 1 
        8  4363 1 1  4 GLY C    C  -20.301  -4.516  -9.616 1.00 . A A .   4 GLY C    1 1 
        8  4364 1 1  4 GLY CA   C  -20.644  -3.966 -10.986 1.00 . A A .   4 GLY CA   1 1 
        8  4365 1 1  4 GLY H    H  -20.933  -1.923 -11.462 1.00 . A A .   4 GLY H    1 1 
        8  4366 1 1  4 GLY HA2  H  -21.313  -4.654 -11.481 1.00 . A A .   4 GLY HA2  1 1 
        8  4367 1 1  4 GLY HA3  H  -19.737  -3.883 -11.566 1.00 . A A .   4 GLY HA3  1 1 
        8  4368 1 1  4 GLY N    N  -21.278  -2.662 -10.918 1.00 . A A .   4 GLY N    1 1 
        8  4369 1 1  4 GLY O    O  -19.302  -4.122  -9.014 1.00 . A A .   4 GLY O    1 1 
        8  4370 1 1  5 SER C    C  -19.467  -6.487  -7.656 1.00 . A A .   5 SER C    1 1 
        8  4371 1 1  5 SER CA   C  -20.913  -6.028  -7.810 1.00 . A A .   5 SER CA   1 1 
        8  4372 1 1  5 SER CB   C  -21.861  -7.211  -7.603 1.00 . A A .   5 SER CB   1 1 
        8  4373 1 1  5 SER H    H  -21.911  -5.701  -9.648 1.00 . A A .   5 SER H    1 1 
        8  4374 1 1  5 SER HA   H  -21.121  -5.277  -7.062 1.00 . A A .   5 SER HA   1 1 
        8  4375 1 1  5 SER HB2  H  -21.672  -7.956  -8.361 1.00 . A A .   5 SER HB2  1 1 
        8  4376 1 1  5 SER HB3  H  -21.689  -7.640  -6.627 1.00 . A A .   5 SER HB3  1 1 
        8  4377 1 1  5 SER HG   H  -23.284  -6.050  -8.284 1.00 . A A .   5 SER HG   1 1 
        8  4378 1 1  5 SER N    N  -21.131  -5.427  -9.120 1.00 . A A .   5 SER N    1 1 
        8  4379 1 1  5 SER O    O  -19.081  -7.539  -8.166 1.00 . A A .   5 SER O    1 1 
        8  4380 1 1  5 SER OG   O  -23.215  -6.802  -7.692 1.00 . A A .   5 SER OG   1 1 
        8  4381 1 1  6 SER C    C  -17.109  -7.029  -5.606 1.00 . A A .   6 SER C    1 1 
        8  4382 1 1  6 SER CA   C  -17.265  -6.012  -6.732 1.00 . A A .   6 SER CA   1 1 
        8  4383 1 1  6 SER CB   C  -16.475  -4.744  -6.403 1.00 . A A .   6 SER CB   1 1 
        8  4384 1 1  6 SER H    H  -19.038  -4.865  -6.569 1.00 . A A .   6 SER H    1 1 
        8  4385 1 1  6 SER HA   H  -16.878  -6.440  -7.645 1.00 . A A .   6 SER HA   1 1 
        8  4386 1 1  6 SER HB2  H  -16.696  -3.984  -7.137 1.00 . A A .   6 SER HB2  1 1 
        8  4387 1 1  6 SER HB3  H  -16.760  -4.391  -5.422 1.00 . A A .   6 SER HB3  1 1 
        8  4388 1 1  6 SER HG   H  -14.894  -5.780  -5.890 1.00 . A A .   6 SER HG   1 1 
        8  4389 1 1  6 SER N    N  -18.671  -5.690  -6.951 1.00 . A A .   6 SER N    1 1 
        8  4390 1 1  6 SER O    O  -16.372  -8.006  -5.734 1.00 . A A .   6 SER O    1 1 
        8  4391 1 1  6 SER OG   O  -15.081  -4.995  -6.411 1.00 . A A .   6 SER OG   1 1 
        8  4392 1 1  7 GLY C    C  -18.418  -7.136  -2.135 1.00 . A A .   7 GLY C    1 1 
        8  4393 1 1  7 GLY CA   C  -17.736  -7.696  -3.368 1.00 . A A .   7 GLY CA   1 1 
        8  4394 1 1  7 GLY H    H  -18.382  -5.998  -4.456 1.00 . A A .   7 GLY H    1 1 
        8  4395 1 1  7 GLY HA2  H  -18.208  -8.630  -3.635 1.00 . A A .   7 GLY HA2  1 1 
        8  4396 1 1  7 GLY HA3  H  -16.698  -7.881  -3.138 1.00 . A A .   7 GLY HA3  1 1 
        8  4397 1 1  7 GLY N    N  -17.810  -6.792  -4.502 1.00 . A A .   7 GLY N    1 1 
        8  4398 1 1  7 GLY O    O  -18.654  -5.932  -2.042 1.00 . A A .   7 GLY O    1 1 
        8  4399 1 1  8 ALA C    C  -18.373  -7.247   1.122 1.00 . A A .   8 ALA C    1 1 
        8  4400 1 1  8 ALA CA   C  -19.394  -7.598   0.045 1.00 . A A .   8 ALA CA   1 1 
        8  4401 1 1  8 ALA CB   C  -20.329  -8.693   0.538 1.00 . A A .   8 ALA CB   1 1 
        8  4402 1 1  8 ALA H    H  -18.521  -8.958  -1.320 1.00 . A A .   8 ALA H    1 1 
        8  4403 1 1  8 ALA HA   H  -19.989  -6.722  -0.172 1.00 . A A .   8 ALA HA   1 1 
        8  4404 1 1  8 ALA HB1  H  -19.790  -9.354   1.201 1.00 . A A .   8 ALA HB1  1 1 
        8  4405 1 1  8 ALA HB2  H  -21.157  -8.246   1.069 1.00 . A A .   8 ALA HB2  1 1 
        8  4406 1 1  8 ALA HB3  H  -20.702  -9.254  -0.306 1.00 . A A .   8 ALA HB3  1 1 
        8  4407 1 1  8 ALA N    N  -18.736  -8.012  -1.188 1.00 . A A .   8 ALA N    1 1 
        8  4408 1 1  8 ALA O    O  -17.981  -8.097   1.920 1.00 . A A .   8 ALA O    1 1 
        8  4409 1 1  9 GLY C    C  -15.883  -4.686   1.513 1.00 . A A .   9 GLY C    1 1 
        8  4410 1 1  9 GLY CA   C  -16.972  -5.548   2.120 1.00 . A A .   9 GLY CA   1 1 
        8  4411 1 1  9 GLY H    H  -18.292  -5.354   0.477 1.00 . A A .   9 GLY H    1 1 
        8  4412 1 1  9 GLY HA2  H  -17.480  -4.981   2.886 1.00 . A A .   9 GLY HA2  1 1 
        8  4413 1 1  9 GLY HA3  H  -16.516  -6.417   2.573 1.00 . A A .   9 GLY HA3  1 1 
        8  4414 1 1  9 GLY N    N  -17.945  -5.988   1.138 1.00 . A A .   9 GLY N    1 1 
        8  4415 1 1  9 GLY O    O  -15.912  -4.391   0.318 1.00 . A A .   9 GLY O    1 1 
        8  4416 1 1 10 GLU C    C  -12.524  -4.244   1.800 1.00 . A A .  10 GLU C    1 1 
        8  4417 1 1 10 GLU CA   C  -13.821  -3.444   1.873 1.00 . A A .  10 GLU CA   1 1 
        8  4418 1 1 10 GLU CB   C  -13.640  -2.240   2.799 1.00 . A A .  10 GLU CB   1 1 
        8  4419 1 1 10 GLU CD   C  -12.654  -1.422   4.976 1.00 . A A .  10 GLU CD   1 1 
        8  4420 1 1 10 GLU CG   C  -13.180  -2.613   4.199 1.00 . A A .  10 GLU CG   1 1 
        8  4421 1 1 10 GLU H    H  -14.955  -4.549   3.279 1.00 . A A .  10 GLU H    1 1 
        8  4422 1 1 10 GLU HA   H  -14.068  -3.091   0.883 1.00 . A A .  10 GLU HA   1 1 
        8  4423 1 1 10 GLU HB2  H  -12.907  -1.575   2.366 1.00 . A A .  10 GLU HB2  1 1 
        8  4424 1 1 10 GLU HB3  H  -14.582  -1.719   2.880 1.00 . A A .  10 GLU HB3  1 1 
        8  4425 1 1 10 GLU HG2  H  -14.015  -3.035   4.738 1.00 . A A .  10 GLU HG2  1 1 
        8  4426 1 1 10 GLU HG3  H  -12.394  -3.349   4.121 1.00 . A A .  10 GLU HG3  1 1 
        8  4427 1 1 10 GLU N    N  -14.922  -4.280   2.337 1.00 . A A .  10 GLU N    1 1 
        8  4428 1 1 10 GLU O    O  -12.400  -5.305   2.413 1.00 . A A .  10 GLU O    1 1 
        8  4429 1 1 10 GLU OE1  O  -13.199  -0.312   4.800 1.00 . A A .  10 GLU OE1  1 1 
        8  4430 1 1 10 GLU OE2  O  -11.699  -1.600   5.760 1.00 . A A .  10 GLU OE2  1 1 
        8  4431 1 1 11 LYS C    C   -9.362  -4.099   2.083 1.00 . A A .  11 LYS C    1 1 
        8  4432 1 1 11 LYS CA   C  -10.270  -4.392   0.893 1.00 . A A .  11 LYS CA   1 1 
        8  4433 1 1 11 LYS CB   C   -9.592  -3.942  -0.403 1.00 . A A .  11 LYS CB   1 1 
        8  4434 1 1 11 LYS CD   C  -10.201  -5.600  -2.189 1.00 . A A .  11 LYS CD   1 1 
        8  4435 1 1 11 LYS CE   C   -8.938  -5.675  -3.034 1.00 . A A .  11 LYS CE   1 1 
        8  4436 1 1 11 LYS CG   C  -10.426  -4.198  -1.647 1.00 . A A .  11 LYS CG   1 1 
        8  4437 1 1 11 LYS H    H  -11.718  -2.879   0.582 1.00 . A A .  11 LYS H    1 1 
        8  4438 1 1 11 LYS HA   H  -10.448  -5.456   0.845 1.00 . A A .  11 LYS HA   1 1 
        8  4439 1 1 11 LYS HB2  H   -9.392  -2.882  -0.341 1.00 . A A .  11 LYS HB2  1 1 
        8  4440 1 1 11 LYS HB3  H   -8.655  -4.470  -0.508 1.00 . A A .  11 LYS HB3  1 1 
        8  4441 1 1 11 LYS HD2  H  -10.108  -6.287  -1.361 1.00 . A A .  11 LYS HD2  1 1 
        8  4442 1 1 11 LYS HD3  H  -11.048  -5.880  -2.799 1.00 . A A .  11 LYS HD3  1 1 
        8  4443 1 1 11 LYS HE2  H   -9.002  -4.937  -3.819 1.00 . A A .  11 LYS HE2  1 1 
        8  4444 1 1 11 LYS HE3  H   -8.087  -5.458  -2.405 1.00 . A A .  11 LYS HE3  1 1 
        8  4445 1 1 11 LYS HG2  H  -11.470  -4.083  -1.399 1.00 . A A .  11 LYS HG2  1 1 
        8  4446 1 1 11 LYS HG3  H  -10.153  -3.480  -2.406 1.00 . A A .  11 LYS HG3  1 1 
        8  4447 1 1 11 LYS HZ1  H   -9.043  -6.999  -4.645 1.00 . A A .  11 LYS HZ1  1 1 
        8  4448 1 1 11 LYS HZ2  H   -9.342  -7.721  -3.144 1.00 . A A .  11 LYS HZ2  1 1 
        8  4449 1 1 11 LYS HZ3  H   -7.762  -7.310  -3.585 1.00 . A A .  11 LYS HZ3  1 1 
        8  4450 1 1 11 LYS N    N  -11.559  -3.729   1.046 1.00 . A A .  11 LYS N    1 1 
        8  4451 1 1 11 LYS NZ   N   -8.759  -7.020  -3.645 1.00 . A A .  11 LYS NZ   1 1 
        8  4452 1 1 11 LYS O    O   -9.375  -3.006   2.650 1.00 . A A .  11 LYS O    1 1 
        8  4453 1 1 12 PRO C    C   -6.467  -4.017   3.286 1.00 . A A .  12 PRO C    1 1 
        8  4454 1 1 12 PRO CA   C   -7.620  -4.966   3.595 1.00 . A A .  12 PRO CA   1 1 
        8  4455 1 1 12 PRO CB   C   -7.101  -6.393   3.791 1.00 . A A .  12 PRO CB   1 1 
        8  4456 1 1 12 PRO CD   C   -8.482  -6.424   1.840 1.00 . A A .  12 PRO CD   1 1 
        8  4457 1 1 12 PRO CG   C   -7.257  -7.039   2.457 1.00 . A A .  12 PRO CG   1 1 
        8  4458 1 1 12 PRO HA   H   -8.124  -4.638   4.492 1.00 . A A .  12 PRO HA   1 1 
        8  4459 1 1 12 PRO HB2  H   -6.065  -6.363   4.097 1.00 . A A .  12 PRO HB2  1 1 
        8  4460 1 1 12 PRO HB3  H   -7.691  -6.894   4.543 1.00 . A A .  12 PRO HB3  1 1 
        8  4461 1 1 12 PRO HD2  H   -8.363  -6.338   0.770 1.00 . A A .  12 PRO HD2  1 1 
        8  4462 1 1 12 PRO HD3  H   -9.359  -7.009   2.078 1.00 . A A .  12 PRO HD3  1 1 
        8  4463 1 1 12 PRO HG2  H   -6.389  -6.838   1.848 1.00 . A A .  12 PRO HG2  1 1 
        8  4464 1 1 12 PRO HG3  H   -7.393  -8.103   2.580 1.00 . A A .  12 PRO HG3  1 1 
        8  4465 1 1 12 PRO N    N   -8.552  -5.095   2.470 1.00 . A A .  12 PRO N    1 1 
        8  4466 1 1 12 PRO O    O   -5.943  -3.351   4.179 1.00 . A A .  12 PRO O    1 1 
        8  4467 1 1 13 TYR C    C   -5.515  -1.869   0.857 1.00 . A A .  13 TYR C    1 1 
        8  4468 1 1 13 TYR CA   C   -4.983  -3.095   1.593 1.00 . A A .  13 TYR CA   1 1 
        8  4469 1 1 13 TYR CB   C   -4.015  -3.864   0.692 1.00 . A A .  13 TYR CB   1 1 
        8  4470 1 1 13 TYR CD1  C   -2.792  -5.532   2.141 1.00 . A A .  13 TYR CD1  1 1 
        8  4471 1 1 13 TYR CD2  C   -4.440  -6.353   0.627 1.00 . A A .  13 TYR CD2  1 1 
        8  4472 1 1 13 TYR CE1  C   -2.539  -6.820   2.572 1.00 . A A .  13 TYR CE1  1 1 
        8  4473 1 1 13 TYR CE2  C   -4.196  -7.644   1.054 1.00 . A A .  13 TYR CE2  1 1 
        8  4474 1 1 13 TYR CG   C   -3.744  -5.276   1.162 1.00 . A A .  13 TYR CG   1 1 
        8  4475 1 1 13 TYR CZ   C   -3.244  -7.872   2.026 1.00 . A A .  13 TYR CZ   1 1 
        8  4476 1 1 13 TYR H    H   -6.532  -4.517   1.352 1.00 . A A .  13 TYR H    1 1 
        8  4477 1 1 13 TYR HA   H   -4.455  -2.769   2.477 1.00 . A A .  13 TYR HA   1 1 
        8  4478 1 1 13 TYR HB2  H   -4.428  -3.921  -0.303 1.00 . A A .  13 TYR HB2  1 1 
        8  4479 1 1 13 TYR HB3  H   -3.072  -3.339   0.657 1.00 . A A .  13 TYR HB3  1 1 
        8  4480 1 1 13 TYR HD1  H   -2.242  -4.705   2.567 1.00 . A A .  13 TYR HD1  1 1 
        8  4481 1 1 13 TYR HD2  H   -5.185  -6.171  -0.134 1.00 . A A .  13 TYR HD2  1 1 
        8  4482 1 1 13 TYR HE1  H   -1.795  -6.999   3.334 1.00 . A A .  13 TYR HE1  1 1 
        8  4483 1 1 13 TYR HE2  H   -4.747  -8.469   0.626 1.00 . A A .  13 TYR HE2  1 1 
        8  4484 1 1 13 TYR HH   H   -3.615  -9.386   3.152 1.00 . A A .  13 TYR HH   1 1 
        8  4485 1 1 13 TYR N    N   -6.076  -3.961   2.018 1.00 . A A .  13 TYR N    1 1 
        8  4486 1 1 13 TYR O    O   -6.687  -1.811   0.489 1.00 . A A .  13 TYR O    1 1 
        8  4487 1 1 13 TYR OH   O   -2.997  -9.157   2.454 1.00 . A A .  13 TYR OH   1 1 
        8  4488 1 1 14 GLY C    C   -4.202   1.521   0.354 1.00 . A A .  14 GLY C    1 1 
        8  4489 1 1 14 GLY CA   C   -5.039   0.323  -0.047 1.00 . A A .  14 GLY CA   1 1 
        8  4490 1 1 14 GLY H    H   -3.719  -0.990   0.960 1.00 . A A .  14 GLY H    1 1 
        8  4491 1 1 14 GLY HA2  H   -4.939   0.167  -1.111 1.00 . A A .  14 GLY HA2  1 1 
        8  4492 1 1 14 GLY HA3  H   -6.075   0.530   0.180 1.00 . A A .  14 GLY HA3  1 1 
        8  4493 1 1 14 GLY N    N   -4.641  -0.889   0.644 1.00 . A A .  14 GLY N    1 1 
        8  4494 1 1 14 GLY O    O   -3.604   1.538   1.431 1.00 . A A .  14 GLY O    1 1 
        8  4495 1 1 15 CYS C    C   -4.306   4.906   0.085 1.00 . A A .  15 CYS C    1 1 
        8  4496 1 1 15 CYS CA   C   -3.386   3.734  -0.245 1.00 . A A .  15 CYS CA   1 1 
        8  4497 1 1 15 CYS CB   C   -2.510   4.083  -1.450 1.00 . A A .  15 CYS CB   1 1 
        8  4498 1 1 15 CYS H    H   -4.655   2.455  -1.355 1.00 . A A .  15 CYS H    1 1 
        8  4499 1 1 15 CYS HA   H   -2.751   3.541   0.606 1.00 . A A .  15 CYS HA   1 1 
        8  4500 1 1 15 CYS HB2  H   -1.729   3.343  -1.544 1.00 . A A .  15 CYS HB2  1 1 
        8  4501 1 1 15 CYS HB3  H   -3.118   4.072  -2.343 1.00 . A A .  15 CYS HB3  1 1 
        8  4502 1 1 15 CYS N    N   -4.157   2.527  -0.513 1.00 . A A .  15 CYS N    1 1 
        8  4503 1 1 15 CYS O    O   -4.902   5.510  -0.807 1.00 . A A .  15 CYS O    1 1 
        8  4504 1 1 15 CYS SG   S   -1.712   5.717  -1.342 1.00 . A A .  15 CYS SG   1 1 
        8  4505 1 1 16 SER C    C   -4.523   7.648   1.740 1.00 . A A .  16 SER C    1 1 
        8  4506 1 1 16 SER CA   C   -5.266   6.318   1.820 1.00 . A A .  16 SER CA   1 1 
        8  4507 1 1 16 SER CB   C   -5.739   6.070   3.253 1.00 . A A .  16 SER CB   1 1 
        8  4508 1 1 16 SER H    H   -3.915   4.701   2.035 1.00 . A A .  16 SER H    1 1 
        8  4509 1 1 16 SER HA   H   -6.125   6.359   1.168 1.00 . A A .  16 SER HA   1 1 
        8  4510 1 1 16 SER HB2  H   -4.883   6.012   3.908 1.00 . A A .  16 SER HB2  1 1 
        8  4511 1 1 16 SER HB3  H   -6.376   6.885   3.565 1.00 . A A .  16 SER HB3  1 1 
        8  4512 1 1 16 SER HG   H   -6.240   4.410   4.165 1.00 . A A .  16 SER HG   1 1 
        8  4513 1 1 16 SER N    N   -4.416   5.221   1.371 1.00 . A A .  16 SER N    1 1 
        8  4514 1 1 16 SER O    O   -4.795   8.569   2.510 1.00 . A A .  16 SER O    1 1 
        8  4515 1 1 16 SER OG   O   -6.469   4.859   3.348 1.00 . A A .  16 SER OG   1 1 
        8  4516 1 1 17 GLU C    C   -3.277   9.732  -0.603 1.00 . A A .  17 GLU C    1 1 
        8  4517 1 1 17 GLU CA   C   -2.802   8.957   0.623 1.00 . A A .  17 GLU CA   1 1 
        8  4518 1 1 17 GLU CB   C   -1.317   8.618   0.482 1.00 . A A .  17 GLU CB   1 1 
        8  4519 1 1 17 GLU CD   C   -0.669  11.048   0.239 1.00 . A A .  17 GLU CD   1 1 
        8  4520 1 1 17 GLU CG   C   -0.392   9.733   0.943 1.00 . A A .  17 GLU CG   1 1 
        8  4521 1 1 17 GLU H    H   -3.415   6.971   0.220 1.00 . A A .  17 GLU H    1 1 
        8  4522 1 1 17 GLU HA   H   -2.940   9.572   1.499 1.00 . A A .  17 GLU HA   1 1 
        8  4523 1 1 17 GLU HB2  H   -1.104   7.736   1.068 1.00 . A A .  17 GLU HB2  1 1 
        8  4524 1 1 17 GLU HB3  H   -1.105   8.410  -0.556 1.00 . A A .  17 GLU HB3  1 1 
        8  4525 1 1 17 GLU HG2  H   -0.523   9.876   2.005 1.00 . A A .  17 GLU HG2  1 1 
        8  4526 1 1 17 GLU HG3  H    0.628   9.442   0.743 1.00 . A A .  17 GLU HG3  1 1 
        8  4527 1 1 17 GLU N    N   -3.585   7.740   0.803 1.00 . A A .  17 GLU N    1 1 
        8  4528 1 1 17 GLU O    O   -3.512  10.939  -0.535 1.00 . A A .  17 GLU O    1 1 
        8  4529 1 1 17 GLU OE1  O   -0.870  11.032  -0.993 1.00 . A A .  17 GLU OE1  1 1 
        8  4530 1 1 17 GLU OE2  O   -0.684  12.093   0.923 1.00 . A A .  17 GLU OE2  1 1 
        8  4531 1 1 18 CYS C    C   -5.186   9.054  -3.426 1.00 . A A .  18 CYS C    1 1 
        8  4532 1 1 18 CYS CA   C   -3.860   9.651  -2.964 1.00 . A A .  18 CYS CA   1 1 
        8  4533 1 1 18 CYS CB   C   -2.802   9.476  -4.055 1.00 . A A .  18 CYS CB   1 1 
        8  4534 1 1 18 CYS H    H   -3.212   8.071  -1.714 1.00 . A A .  18 CYS H    1 1 
        8  4535 1 1 18 CYS HA   H   -4.000  10.705  -2.777 1.00 . A A .  18 CYS HA   1 1 
        8  4536 1 1 18 CYS HB2  H   -3.119  10.003  -4.943 1.00 . A A .  18 CYS HB2  1 1 
        8  4537 1 1 18 CYS HB3  H   -1.867   9.893  -3.710 1.00 . A A .  18 CYS HB3  1 1 
        8  4538 1 1 18 CYS N    N   -3.415   9.031  -1.722 1.00 . A A .  18 CYS N    1 1 
        8  4539 1 1 18 CYS O    O   -6.110   9.777  -3.796 1.00 . A A .  18 CYS O    1 1 
        8  4540 1 1 18 CYS SG   S   -2.496   7.741  -4.522 1.00 . A A .  18 CYS SG   1 1 
        8  4541 1 1 19 GLY C    C   -6.212   5.854  -4.702 1.00 . A A .  19 GLY C    1 1 
        8  4542 1 1 19 GLY CA   C   -6.488   7.055  -3.819 1.00 . A A .  19 GLY CA   1 1 
        8  4543 1 1 19 GLY H    H   -4.503   7.201  -3.096 1.00 . A A .  19 GLY H    1 1 
        8  4544 1 1 19 GLY HA2  H   -7.025   6.727  -2.942 1.00 . A A .  19 GLY HA2  1 1 
        8  4545 1 1 19 GLY HA3  H   -7.103   7.755  -4.365 1.00 . A A .  19 GLY HA3  1 1 
        8  4546 1 1 19 GLY N    N   -5.272   7.727  -3.401 1.00 . A A .  19 GLY N    1 1 
        8  4547 1 1 19 GLY O    O   -6.784   5.725  -5.785 1.00 . A A .  19 GLY O    1 1 
        8  4548 1 1 20 LYS C    C   -5.409   2.516  -4.250 1.00 . A A .  20 LYS C    1 1 
        8  4549 1 1 20 LYS CA   C   -4.980   3.775  -4.996 1.00 . A A .  20 LYS CA   1 1 
        8  4550 1 1 20 LYS CB   C   -3.472   3.737  -5.257 1.00 . A A .  20 LYS CB   1 1 
        8  4551 1 1 20 LYS CD   C   -3.005   4.644  -7.553 1.00 . A A .  20 LYS CD   1 1 
        8  4552 1 1 20 LYS CE   C   -3.020   5.933  -8.360 1.00 . A A .  20 LYS CE   1 1 
        8  4553 1 1 20 LYS CG   C   -2.964   4.923  -6.060 1.00 . A A .  20 LYS CG   1 1 
        8  4554 1 1 20 LYS H    H   -4.909   5.130  -3.371 1.00 . A A .  20 LYS H    1 1 
        8  4555 1 1 20 LYS HA   H   -5.499   3.814  -5.941 1.00 . A A .  20 LYS HA   1 1 
        8  4556 1 1 20 LYS HB2  H   -2.955   3.723  -4.309 1.00 . A A .  20 LYS HB2  1 1 
        8  4557 1 1 20 LYS HB3  H   -3.236   2.834  -5.801 1.00 . A A .  20 LYS HB3  1 1 
        8  4558 1 1 20 LYS HD2  H   -2.132   4.071  -7.828 1.00 . A A .  20 LYS HD2  1 1 
        8  4559 1 1 20 LYS HD3  H   -3.896   4.076  -7.780 1.00 . A A .  20 LYS HD3  1 1 
        8  4560 1 1 20 LYS HE2  H   -4.016   6.347  -8.333 1.00 . A A .  20 LYS HE2  1 1 
        8  4561 1 1 20 LYS HE3  H   -2.328   6.631  -7.913 1.00 . A A .  20 LYS HE3  1 1 
        8  4562 1 1 20 LYS HG2  H   -3.583   5.782  -5.848 1.00 . A A .  20 LYS HG2  1 1 
        8  4563 1 1 20 LYS HG3  H   -1.944   5.131  -5.769 1.00 . A A .  20 LYS HG3  1 1 
        8  4564 1 1 20 LYS HZ1  H   -3.478   5.603 -10.371 1.00 . A A .  20 LYS HZ1  1 1 
        8  4565 1 1 20 LYS HZ2  H   -2.060   4.837  -9.856 1.00 . A A .  20 LYS HZ2  1 1 
        8  4566 1 1 20 LYS HZ3  H   -2.068   6.506 -10.128 1.00 . A A .  20 LYS HZ3  1 1 
        8  4567 1 1 20 LYS N    N   -5.332   4.972  -4.241 1.00 . A A .  20 LYS N    1 1 
        8  4568 1 1 20 LYS NZ   N   -2.629   5.704  -9.779 1.00 . A A .  20 LYS NZ   1 1 
        8  4569 1 1 20 LYS O    O   -5.901   2.587  -3.124 1.00 . A A .  20 LYS O    1 1 
        8  4570 1 1 21 ALA C    C   -4.695  -1.038  -4.798 1.00 . A A .  21 ALA C    1 1 
        8  4571 1 1 21 ALA CA   C   -5.583   0.089  -4.280 1.00 . A A .  21 ALA CA   1 1 
        8  4572 1 1 21 ALA CB   C   -7.047  -0.224  -4.550 1.00 . A A .  21 ALA CB   1 1 
        8  4573 1 1 21 ALA H    H   -4.822   1.372  -5.781 1.00 . A A .  21 ALA H    1 1 
        8  4574 1 1 21 ALA HA   H   -5.450   0.176  -3.212 1.00 . A A .  21 ALA HA   1 1 
        8  4575 1 1 21 ALA HB1  H   -7.190  -1.294  -4.566 1.00 . A A .  21 ALA HB1  1 1 
        8  4576 1 1 21 ALA HB2  H   -7.656   0.209  -3.769 1.00 . A A .  21 ALA HB2  1 1 
        8  4577 1 1 21 ALA HB3  H   -7.335   0.193  -5.503 1.00 . A A .  21 ALA HB3  1 1 
        8  4578 1 1 21 ALA N    N   -5.219   1.364  -4.885 1.00 . A A .  21 ALA N    1 1 
        8  4579 1 1 21 ALA O    O   -3.996  -0.881  -5.799 1.00 . A A .  21 ALA O    1 1 
        8  4580 1 1 22 PHE C    C   -4.527  -4.619  -3.953 1.00 . A A .  22 PHE C    1 1 
        8  4581 1 1 22 PHE CA   C   -3.925  -3.328  -4.500 1.00 . A A .  22 PHE CA   1 1 
        8  4582 1 1 22 PHE CB   C   -2.489  -3.168  -3.999 1.00 . A A .  22 PHE CB   1 1 
        8  4583 1 1 22 PHE CD1  C   -2.325  -0.708  -3.534 1.00 . A A .  22 PHE CD1  1 1 
        8  4584 1 1 22 PHE CD2  C   -0.946  -1.631  -5.247 1.00 . A A .  22 PHE CD2  1 1 
        8  4585 1 1 22 PHE CE1  C   -1.793   0.545  -3.776 1.00 . A A .  22 PHE CE1  1 1 
        8  4586 1 1 22 PHE CE2  C   -0.411  -0.381  -5.493 1.00 . A A .  22 PHE CE2  1 1 
        8  4587 1 1 22 PHE CG   C   -1.908  -1.809  -4.265 1.00 . A A .  22 PHE CG   1 1 
        8  4588 1 1 22 PHE CZ   C   -0.835   0.708  -4.758 1.00 . A A .  22 PHE CZ   1 1 
        8  4589 1 1 22 PHE H    H   -5.306  -2.239  -3.321 1.00 . A A .  22 PHE H    1 1 
        8  4590 1 1 22 PHE HA   H   -3.918  -3.376  -5.578 1.00 . A A .  22 PHE HA   1 1 
        8  4591 1 1 22 PHE HB2  H   -2.466  -3.335  -2.933 1.00 . A A .  22 PHE HB2  1 1 
        8  4592 1 1 22 PHE HB3  H   -1.862  -3.899  -4.487 1.00 . A A .  22 PHE HB3  1 1 
        8  4593 1 1 22 PHE HD1  H   -3.075  -0.835  -2.766 1.00 . A A .  22 PHE HD1  1 1 
        8  4594 1 1 22 PHE HD2  H   -0.614  -2.482  -5.823 1.00 . A A .  22 PHE HD2  1 1 
        8  4595 1 1 22 PHE HE1  H   -2.127   1.394  -3.200 1.00 . A A .  22 PHE HE1  1 1 
        8  4596 1 1 22 PHE HE2  H    0.338  -0.256  -6.261 1.00 . A A .  22 PHE HE2  1 1 
        8  4597 1 1 22 PHE HZ   H   -0.417   1.686  -4.948 1.00 . A A .  22 PHE HZ   1 1 
        8  4598 1 1 22 PHE N    N   -4.728  -2.174  -4.110 1.00 . A A .  22 PHE N    1 1 
        8  4599 1 1 22 PHE O    O   -5.380  -4.592  -3.067 1.00 . A A .  22 PHE O    1 1 
        8  4600 1 1 23 SER C    C   -3.675  -7.640  -2.971 1.00 . A A .  23 SER C    1 1 
        8  4601 1 1 23 SER CA   C   -4.570  -7.051  -4.057 1.00 . A A .  23 SER CA   1 1 
        8  4602 1 1 23 SER CB   C   -4.647  -8.010  -5.247 1.00 . A A .  23 SER CB   1 1 
        8  4603 1 1 23 SER H    H   -3.393  -5.705  -5.191 1.00 . A A .  23 SER H    1 1 
        8  4604 1 1 23 SER HA   H   -5.562  -6.911  -3.654 1.00 . A A .  23 SER HA   1 1 
        8  4605 1 1 23 SER HB2  H   -4.951  -7.464  -6.127 1.00 . A A .  23 SER HB2  1 1 
        8  4606 1 1 23 SER HB3  H   -3.674  -8.449  -5.414 1.00 . A A .  23 SER HB3  1 1 
        8  4607 1 1 23 SER HG   H   -5.439  -9.759  -5.634 1.00 . A A .  23 SER HG   1 1 
        8  4608 1 1 23 SER N    N   -4.074  -5.748  -4.488 1.00 . A A .  23 SER N    1 1 
        8  4609 1 1 23 SER O    O   -4.158  -8.252  -2.019 1.00 . A A .  23 SER O    1 1 
        8  4610 1 1 23 SER OG   O   -5.582  -9.047  -5.006 1.00 . A A .  23 SER OG   1 1 
        8  4611 1 1 24 SER C    C   -0.760  -6.828  -1.372 1.00 . A A .  24 SER C    1 1 
        8  4612 1 1 24 SER CA   C   -1.405  -7.966  -2.157 1.00 . A A .  24 SER CA   1 1 
        8  4613 1 1 24 SER CB   C   -0.326  -8.785  -2.869 1.00 . A A .  24 SER CB   1 1 
        8  4614 1 1 24 SER H    H   -2.045  -6.954  -3.903 1.00 . A A .  24 SER H    1 1 
        8  4615 1 1 24 SER HA   H   -1.935  -8.607  -1.469 1.00 . A A .  24 SER HA   1 1 
        8  4616 1 1 24 SER HB2  H    0.035  -9.555  -2.205 1.00 . A A .  24 SER HB2  1 1 
        8  4617 1 1 24 SER HB3  H   -0.749  -9.240  -3.753 1.00 . A A .  24 SER HB3  1 1 
        8  4618 1 1 24 SER HG   H    1.485  -8.078  -2.630 1.00 . A A .  24 SER HG   1 1 
        8  4619 1 1 24 SER N    N   -2.368  -7.450  -3.122 1.00 . A A .  24 SER N    1 1 
        8  4620 1 1 24 SER O    O   -0.985  -5.653  -1.661 1.00 . A A .  24 SER O    1 1 
        8  4621 1 1 24 SER OG   O    0.765  -7.966  -3.254 1.00 . A A .  24 SER OG   1 1 
        8  4622 1 1 25 LYS C    C    1.899  -5.576  -0.296 1.00 . A A .  25 LYS C    1 1 
        8  4623 1 1 25 LYS CA   C    0.724  -6.196   0.452 1.00 . A A .  25 LYS CA   1 1 
        8  4624 1 1 25 LYS CB   C    1.214  -6.839   1.751 1.00 . A A .  25 LYS CB   1 1 
        8  4625 1 1 25 LYS CD   C    2.360  -6.503   3.961 1.00 . A A .  25 LYS CD   1 1 
        8  4626 1 1 25 LYS CE   C    3.826  -6.741   3.632 1.00 . A A .  25 LYS CE   1 1 
        8  4627 1 1 25 LYS CG   C    1.633  -5.832   2.808 1.00 . A A .  25 LYS CG   1 1 
        8  4628 1 1 25 LYS H    H    0.184  -8.139  -0.194 1.00 . A A .  25 LYS H    1 1 
        8  4629 1 1 25 LYS HA   H    0.014  -5.419   0.690 1.00 . A A .  25 LYS HA   1 1 
        8  4630 1 1 25 LYS HB2  H    0.421  -7.449   2.159 1.00 . A A .  25 LYS HB2  1 1 
        8  4631 1 1 25 LYS HB3  H    2.063  -7.470   1.529 1.00 . A A .  25 LYS HB3  1 1 
        8  4632 1 1 25 LYS HD2  H    2.297  -5.869   4.833 1.00 . A A .  25 LYS HD2  1 1 
        8  4633 1 1 25 LYS HD3  H    1.888  -7.453   4.169 1.00 . A A .  25 LYS HD3  1 1 
        8  4634 1 1 25 LYS HE2  H    3.916  -6.941   2.576 1.00 . A A .  25 LYS HE2  1 1 
        8  4635 1 1 25 LYS HE3  H    4.386  -5.851   3.879 1.00 . A A .  25 LYS HE3  1 1 
        8  4636 1 1 25 LYS HG2  H    2.290  -5.103   2.357 1.00 . A A .  25 LYS HG2  1 1 
        8  4637 1 1 25 LYS HG3  H    0.751  -5.337   3.190 1.00 . A A .  25 LYS HG3  1 1 
        8  4638 1 1 25 LYS HZ1  H    3.927  -7.962   5.324 1.00 . A A .  25 LYS HZ1  1 1 
        8  4639 1 1 25 LYS HZ2  H    5.408  -7.766   4.531 1.00 . A A .  25 LYS HZ2  1 1 
        8  4640 1 1 25 LYS HZ3  H    4.224  -8.778   3.872 1.00 . A A .  25 LYS HZ3  1 1 
        8  4641 1 1 25 LYS N    N    0.044  -7.185  -0.376 1.00 . A A .  25 LYS N    1 1 
        8  4642 1 1 25 LYS NZ   N    4.385  -7.893   4.393 1.00 . A A .  25 LYS NZ   1 1 
        8  4643 1 1 25 LYS O    O    1.910  -4.376  -0.570 1.00 . A A .  25 LYS O    1 1 
        8  4644 1 1 26 SER C    C    3.677  -5.025  -2.501 1.00 . A A .  26 SER C    1 1 
        8  4645 1 1 26 SER CA   C    4.069  -5.934  -1.340 1.00 . A A .  26 SER CA   1 1 
        8  4646 1 1 26 SER CB   C    4.881  -7.122  -1.859 1.00 . A A .  26 SER CB   1 1 
        8  4647 1 1 26 SER H    H    2.821  -7.349  -0.379 1.00 . A A .  26 SER H    1 1 
        8  4648 1 1 26 SER HA   H    4.675  -5.371  -0.646 1.00 . A A .  26 SER HA   1 1 
        8  4649 1 1 26 SER HB2  H    4.245  -7.755  -2.459 1.00 . A A .  26 SER HB2  1 1 
        8  4650 1 1 26 SER HB3  H    5.700  -6.759  -2.463 1.00 . A A .  26 SER HB3  1 1 
        8  4651 1 1 26 SER HG   H    6.354  -7.997  -0.908 1.00 . A A .  26 SER HG   1 1 
        8  4652 1 1 26 SER N    N    2.888  -6.403  -0.625 1.00 . A A .  26 SER N    1 1 
        8  4653 1 1 26 SER O    O    4.261  -3.958  -2.692 1.00 . A A .  26 SER O    1 1 
        8  4654 1 1 26 SER OG   O    5.407  -7.887  -0.789 1.00 . A A .  26 SER OG   1 1 
        8  4655 1 1 27 TYR C    C    1.802  -3.278  -3.991 1.00 . A A .  27 TYR C    1 1 
        8  4656 1 1 27 TYR CA   C    2.217  -4.684  -4.416 1.00 . A A .  27 TYR CA   1 1 
        8  4657 1 1 27 TYR CB   C    1.041  -5.393  -5.090 1.00 . A A .  27 TYR CB   1 1 
        8  4658 1 1 27 TYR CD1  C    1.385  -3.991  -7.161 1.00 . A A .  27 TYR CD1  1 1 
        8  4659 1 1 27 TYR CD2  C   -0.833  -4.680  -6.626 1.00 . A A .  27 TYR CD2  1 1 
        8  4660 1 1 27 TYR CE1  C    0.916  -3.333  -8.282 1.00 . A A .  27 TYR CE1  1 1 
        8  4661 1 1 27 TYR CE2  C   -1.311  -4.026  -7.745 1.00 . A A .  27 TYR CE2  1 1 
        8  4662 1 1 27 TYR CG   C    0.521  -4.675  -6.315 1.00 . A A .  27 TYR CG   1 1 
        8  4663 1 1 27 TYR CZ   C   -0.433  -3.354  -8.569 1.00 . A A .  27 TYR CZ   1 1 
        8  4664 1 1 27 TYR H    H    2.260  -6.315  -3.069 1.00 . A A .  27 TYR H    1 1 
        8  4665 1 1 27 TYR HA   H    3.031  -4.608  -5.122 1.00 . A A .  27 TYR HA   1 1 
        8  4666 1 1 27 TYR HB2  H    1.350  -6.381  -5.392 1.00 . A A .  27 TYR HB2  1 1 
        8  4667 1 1 27 TYR HB3  H    0.227  -5.476  -4.384 1.00 . A A .  27 TYR HB3  1 1 
        8  4668 1 1 27 TYR HD1  H    2.441  -3.976  -6.933 1.00 . A A .  27 TYR HD1  1 1 
        8  4669 1 1 27 TYR HD2  H   -1.518  -5.207  -5.978 1.00 . A A .  27 TYR HD2  1 1 
        8  4670 1 1 27 TYR HE1  H    1.603  -2.806  -8.928 1.00 . A A .  27 TYR HE1  1 1 
        8  4671 1 1 27 TYR HE2  H   -2.367  -4.042  -7.970 1.00 . A A .  27 TYR HE2  1 1 
        8  4672 1 1 27 TYR HH   H   -1.378  -1.908  -9.414 1.00 . A A .  27 TYR HH   1 1 
        8  4673 1 1 27 TYR N    N    2.686  -5.456  -3.272 1.00 . A A .  27 TYR N    1 1 
        8  4674 1 1 27 TYR O    O    1.940  -2.320  -4.753 1.00 . A A .  27 TYR O    1 1 
        8  4675 1 1 27 TYR OH   O   -0.906  -2.700  -9.684 1.00 . A A .  27 TYR OH   1 1 
        8  4676 1 1 28 LEU C    C    2.052  -1.038  -1.795 1.00 . A A .  28 LEU C    1 1 
        8  4677 1 1 28 LEU CA   C    0.858  -1.875  -2.240 1.00 . A A .  28 LEU CA   1 1 
        8  4678 1 1 28 LEU CB   C   -0.101  -2.081  -1.067 1.00 . A A .  28 LEU CB   1 1 
        8  4679 1 1 28 LEU CD1  C   -0.779   0.270  -0.524 1.00 . A A .  28 LEU CD1  1 1 
        8  4680 1 1 28 LEU CD2  C   -0.788  -1.476   1.267 1.00 . A A .  28 LEU CD2  1 1 
        8  4681 1 1 28 LEU CG   C   -0.101  -0.986   0.000 1.00 . A A .  28 LEU CG   1 1 
        8  4682 1 1 28 LEU H    H    1.208  -3.962  -2.209 1.00 . A A .  28 LEU H    1 1 
        8  4683 1 1 28 LEU HA   H    0.340  -1.351  -3.030 1.00 . A A .  28 LEU HA   1 1 
        8  4684 1 1 28 LEU HB2  H   -1.101  -2.154  -1.466 1.00 . A A .  28 LEU HB2  1 1 
        8  4685 1 1 28 LEU HB3  H    0.162  -3.013  -0.586 1.00 . A A .  28 LEU HB3  1 1 
        8  4686 1 1 28 LEU HD11 H   -0.892   0.197  -1.595 1.00 . A A .  28 LEU HD11 1 1 
        8  4687 1 1 28 LEU HD12 H   -0.175   1.132  -0.283 1.00 . A A .  28 LEU HD12 1 1 
        8  4688 1 1 28 LEU HD13 H   -1.751   0.373  -0.064 1.00 . A A .  28 LEU HD13 1 1 
        8  4689 1 1 28 LEU HD21 H   -1.856  -1.362   1.164 1.00 . A A .  28 LEU HD21 1 1 
        8  4690 1 1 28 LEU HD22 H   -0.443  -0.896   2.110 1.00 . A A .  28 LEU HD22 1 1 
        8  4691 1 1 28 LEU HD23 H   -0.549  -2.518   1.426 1.00 . A A .  28 LEU HD23 1 1 
        8  4692 1 1 28 LEU HG   H    0.921  -0.734   0.249 1.00 . A A .  28 LEU HG   1 1 
        8  4693 1 1 28 LEU N    N    1.293  -3.163  -2.770 1.00 . A A .  28 LEU N    1 1 
        8  4694 1 1 28 LEU O    O    2.137   0.153  -2.099 1.00 . A A .  28 LEU O    1 1 
        8  4695 1 1 29 ILE C    C    4.935  -0.338  -1.740 1.00 . A A .  29 ILE C    1 1 
        8  4696 1 1 29 ILE CA   C    4.166  -0.981  -0.591 1.00 . A A .  29 ILE CA   1 1 
        8  4697 1 1 29 ILE CB   C    5.102  -1.943   0.164 1.00 . A A .  29 ILE CB   1 1 
        8  4698 1 1 29 ILE CD1  C    5.055  -3.784   1.921 1.00 . A A .  29 ILE CD1  1 1 
        8  4699 1 1 29 ILE CG1  C    4.385  -2.543   1.375 1.00 . A A .  29 ILE CG1  1 1 
        8  4700 1 1 29 ILE CG2  C    6.368  -1.219   0.597 1.00 . A A .  29 ILE CG2  1 1 
        8  4701 1 1 29 ILE H    H    2.851  -2.617  -0.865 1.00 . A A .  29 ILE H    1 1 
        8  4702 1 1 29 ILE HA   H    3.849  -0.208   0.094 1.00 . A A .  29 ILE HA   1 1 
        8  4703 1 1 29 ILE HB   H    5.383  -2.738  -0.509 1.00 . A A .  29 ILE HB   1 1 
        8  4704 1 1 29 ILE HD11 H    4.491  -4.156   2.764 1.00 . A A .  29 ILE HD11 1 1 
        8  4705 1 1 29 ILE HD12 H    5.093  -4.541   1.153 1.00 . A A .  29 ILE HD12 1 1 
        8  4706 1 1 29 ILE HD13 H    6.058  -3.541   2.239 1.00 . A A .  29 ILE HD13 1 1 
        8  4707 1 1 29 ILE HG12 H    4.351  -1.810   2.165 1.00 . A A .  29 ILE HG12 1 1 
        8  4708 1 1 29 ILE HG13 H    3.376  -2.807   1.092 1.00 . A A .  29 ILE HG13 1 1 
        8  4709 1 1 29 ILE HG21 H    6.109  -0.405   1.258 1.00 . A A .  29 ILE HG21 1 1 
        8  4710 1 1 29 ILE HG22 H    7.018  -1.909   1.113 1.00 . A A .  29 ILE HG22 1 1 
        8  4711 1 1 29 ILE HG23 H    6.875  -0.829  -0.273 1.00 . A A .  29 ILE HG23 1 1 
        8  4712 1 1 29 ILE N    N    2.974  -1.668  -1.075 1.00 . A A .  29 ILE N    1 1 
        8  4713 1 1 29 ILE O    O    5.261   0.849  -1.694 1.00 . A A .  29 ILE O    1 1 
        8  4714 1 1 30 ILE C    C    5.434   0.735  -4.361 1.00 . A A .  30 ILE C    1 1 
        8  4715 1 1 30 ILE CA   C    5.947  -0.635  -3.932 1.00 . A A .  30 ILE CA   1 1 
        8  4716 1 1 30 ILE CB   C    5.836  -1.608  -5.120 1.00 . A A .  30 ILE CB   1 1 
        8  4717 1 1 30 ILE CD1  C    5.917  -4.105  -5.605 1.00 . A A .  30 ILE CD1  1 1 
        8  4718 1 1 30 ILE CG1  C    6.434  -2.967  -4.753 1.00 . A A .  30 ILE CG1  1 1 
        8  4719 1 1 30 ILE CG2  C    6.530  -1.030  -6.345 1.00 . A A .  30 ILE CG2  1 1 
        8  4720 1 1 30 ILE H    H    4.933  -2.065  -2.747 1.00 . A A .  30 ILE H    1 1 
        8  4721 1 1 30 ILE HA   H    6.990  -0.548  -3.660 1.00 . A A .  30 ILE HA   1 1 
        8  4722 1 1 30 ILE HB   H    4.790  -1.734  -5.356 1.00 . A A .  30 ILE HB   1 1 
        8  4723 1 1 30 ILE HD11 H    5.369  -4.799  -4.984 1.00 . A A .  30 ILE HD11 1 1 
        8  4724 1 1 30 ILE HD12 H    5.263  -3.714  -6.370 1.00 . A A .  30 ILE HD12 1 1 
        8  4725 1 1 30 ILE HD13 H    6.748  -4.616  -6.067 1.00 . A A .  30 ILE HD13 1 1 
        8  4726 1 1 30 ILE HG12 H    7.505  -2.926  -4.871 1.00 . A A .  30 ILE HG12 1 1 
        8  4727 1 1 30 ILE HG13 H    6.198  -3.189  -3.723 1.00 . A A .  30 ILE HG13 1 1 
        8  4728 1 1 30 ILE HG21 H    7.469  -0.585  -6.049 1.00 . A A .  30 ILE HG21 1 1 
        8  4729 1 1 30 ILE HG22 H    6.716  -1.819  -7.058 1.00 . A A .  30 ILE HG22 1 1 
        8  4730 1 1 30 ILE HG23 H    5.901  -0.277  -6.794 1.00 . A A .  30 ILE HG23 1 1 
        8  4731 1 1 30 ILE N    N    5.220  -1.128  -2.769 1.00 . A A .  30 ILE N    1 1 
        8  4732 1 1 30 ILE O    O    6.200   1.579  -4.828 1.00 . A A .  30 ILE O    1 1 
        8  4733 1 1 31 HIS C    C    3.894   3.316  -3.573 1.00 . A A .  31 HIS C    1 1 
        8  4734 1 1 31 HIS CA   C    3.517   2.221  -4.566 1.00 . A A .  31 HIS CA   1 1 
        8  4735 1 1 31 HIS CB   C    1.996   2.075  -4.630 1.00 . A A .  31 HIS CB   1 1 
        8  4736 1 1 31 HIS CD2  C    0.350   3.963  -3.954 1.00 . A A .  31 HIS CD2  1 1 
        8  4737 1 1 31 HIS CE1  C    0.699   5.312  -5.647 1.00 . A A .  31 HIS CE1  1 1 
        8  4738 1 1 31 HIS CG   C    1.274   3.381  -4.755 1.00 . A A .  31 HIS CG   1 1 
        8  4739 1 1 31 HIS H    H    3.574   0.241  -3.821 1.00 . A A .  31 HIS H    1 1 
        8  4740 1 1 31 HIS HA   H    3.884   2.497  -5.543 1.00 . A A .  31 HIS HA   1 1 
        8  4741 1 1 31 HIS HB2  H    1.735   1.468  -5.484 1.00 . A A .  31 HIS HB2  1 1 
        8  4742 1 1 31 HIS HB3  H    1.650   1.589  -3.729 1.00 . A A .  31 HIS HB3  1 1 
        8  4743 1 1 31 HIS HD1  H    2.082   4.112  -6.558 1.00 . A A .  31 HIS HD1  1 1 
        8  4744 1 1 31 HIS HD2  H   -0.045   3.560  -3.032 1.00 . A A .  31 HIS HD2  1 1 
        8  4745 1 1 31 HIS HE1  H    0.641   6.159  -6.315 1.00 . A A .  31 HIS HE1  1 1 
        8  4746 1 1 31 HIS N    N    4.133   0.952  -4.198 1.00 . A A .  31 HIS N    1 1 
        8  4747 1 1 31 HIS ND1  N    1.469   4.251  -5.807 1.00 . A A .  31 HIS ND1  1 1 
        8  4748 1 1 31 HIS NE2  N    0.009   5.162  -4.530 1.00 . A A .  31 HIS NE2  1 1 
        8  4749 1 1 31 HIS O    O    4.327   4.400  -3.964 1.00 . A A .  31 HIS O    1 1 
        8  4750 1 1 32 MET C    C    5.425   4.598  -1.466 1.00 . A A .  32 MET C    1 1 
        8  4751 1 1 32 MET CA   C    4.047   3.986  -1.238 1.00 . A A .  32 MET CA   1 1 
        8  4752 1 1 32 MET CB   C    3.996   3.311   0.134 1.00 . A A .  32 MET CB   1 1 
        8  4753 1 1 32 MET CE   C    1.102   4.138   2.452 1.00 . A A .  32 MET CE   1 1 
        8  4754 1 1 32 MET CG   C    2.608   2.833   0.525 1.00 . A A .  32 MET CG   1 1 
        8  4755 1 1 32 MET H    H    3.374   2.145  -2.037 1.00 . A A .  32 MET H    1 1 
        8  4756 1 1 32 MET HA   H    3.307   4.772  -1.270 1.00 . A A .  32 MET HA   1 1 
        8  4757 1 1 32 MET HB2  H    4.658   2.458   0.127 1.00 . A A .  32 MET HB2  1 1 
        8  4758 1 1 32 MET HB3  H    4.335   4.014   0.881 1.00 . A A .  32 MET HB3  1 1 
        8  4759 1 1 32 MET HE1  H    0.857   4.287   3.494 1.00 . A A .  32 MET HE1  1 1 
        8  4760 1 1 32 MET HE2  H    1.487   5.058   2.038 1.00 . A A .  32 MET HE2  1 1 
        8  4761 1 1 32 MET HE3  H    0.215   3.843   1.911 1.00 . A A .  32 MET HE3  1 1 
        8  4762 1 1 32 MET HG2  H    1.875   3.476   0.060 1.00 . A A .  32 MET HG2  1 1 
        8  4763 1 1 32 MET HG3  H    2.476   1.823   0.167 1.00 . A A .  32 MET HG3  1 1 
        8  4764 1 1 32 MET N    N    3.724   3.026  -2.287 1.00 . A A .  32 MET N    1 1 
        8  4765 1 1 32 MET O    O    5.685   5.733  -1.066 1.00 . A A .  32 MET O    1 1 
        8  4766 1 1 32 MET SD   S    2.343   2.854   2.309 1.00 . A A .  32 MET SD   1 1 
        8  4767 1 1 33 ARG C    C    7.648   5.767  -2.831 1.00 . A A .  33 ARG C    1 1 
        8  4768 1 1 33 ARG CA   C    7.658   4.306  -2.391 1.00 . A A .  33 ARG CA   1 1 
        8  4769 1 1 33 ARG CB   C    8.305   3.441  -3.474 1.00 . A A .  33 ARG CB   1 1 
        8  4770 1 1 33 ARG CD   C    9.560   1.848  -1.989 1.00 . A A .  33 ARG CD   1 1 
        8  4771 1 1 33 ARG CG   C    8.493   1.989  -3.062 1.00 . A A .  33 ARG CG   1 1 
        8  4772 1 1 33 ARG CZ   C   11.603   1.055  -3.104 1.00 . A A .  33 ARG CZ   1 1 
        8  4773 1 1 33 ARG H    H    6.039   2.942  -2.405 1.00 . A A .  33 ARG H    1 1 
        8  4774 1 1 33 ARG HA   H    8.233   4.220  -1.482 1.00 . A A .  33 ARG HA   1 1 
        8  4775 1 1 33 ARG HB2  H    7.684   3.464  -4.357 1.00 . A A .  33 ARG HB2  1 1 
        8  4776 1 1 33 ARG HB3  H    9.274   3.852  -3.714 1.00 . A A .  33 ARG HB3  1 1 
        8  4777 1 1 33 ARG HD2  H    9.386   2.593  -1.227 1.00 . A A .  33 ARG HD2  1 1 
        8  4778 1 1 33 ARG HD3  H    9.486   0.863  -1.553 1.00 . A A .  33 ARG HD3  1 1 
        8  4779 1 1 33 ARG HE   H   11.309   2.918  -2.456 1.00 . A A .  33 ARG HE   1 1 
        8  4780 1 1 33 ARG HG2  H    7.558   1.611  -2.677 1.00 . A A .  33 ARG HG2  1 1 
        8  4781 1 1 33 ARG HG3  H    8.787   1.415  -3.928 1.00 . A A .  33 ARG HG3  1 1 
        8  4782 1 1 33 ARG HH11 H   10.165  -0.345  -2.866 1.00 . A A .  33 ARG HH11 1 1 
        8  4783 1 1 33 ARG HH12 H   11.610  -0.891  -3.651 1.00 . A A .  33 ARG HH12 1 1 
        8  4784 1 1 33 ARG HH21 H   13.216   2.211  -3.488 1.00 . A A .  33 ARG HH21 1 1 
        8  4785 1 1 33 ARG HH22 H   13.345   0.563  -4.004 1.00 . A A .  33 ARG HH22 1 1 
        8  4786 1 1 33 ARG N    N    6.305   3.839  -2.111 1.00 . A A .  33 ARG N    1 1 
        8  4787 1 1 33 ARG NE   N   10.906   2.028  -2.528 1.00 . A A .  33 ARG NE   1 1 
        8  4788 1 1 33 ARG NH1  N   11.084  -0.160  -3.216 1.00 . A A .  33 ARG NH1  1 1 
        8  4789 1 1 33 ARG NH2  N   12.821   1.296  -3.571 1.00 . A A .  33 ARG NH2  1 1 
        8  4790 1 1 33 ARG O    O    8.518   6.549  -2.446 1.00 . A A .  33 ARG O    1 1 
        8  4791 1 1 34 THR C    C    6.118   8.448  -3.019 1.00 . A A .  34 THR C    1 1 
        8  4792 1 1 34 THR CA   C    6.535   7.495  -4.133 1.00 . A A .  34 THR CA   1 1 
        8  4793 1 1 34 THR CB   C    5.512   7.588  -5.281 1.00 . A A .  34 THR CB   1 1 
        8  4794 1 1 34 THR CG2  C    5.922   6.698  -6.445 1.00 . A A .  34 THR CG2  1 1 
        8  4795 1 1 34 THR H    H    5.994   5.461  -3.911 1.00 . A A .  34 THR H    1 1 
        8  4796 1 1 34 THR HA   H    7.499   7.801  -4.513 1.00 . A A .  34 THR HA   1 1 
        8  4797 1 1 34 THR HB   H    5.473   8.611  -5.627 1.00 . A A .  34 THR HB   1 1 
        8  4798 1 1 34 THR HG1  H    4.256   6.316  -4.448 1.00 . A A .  34 THR HG1  1 1 
        8  4799 1 1 34 THR HG21 H    5.078   6.101  -6.756 1.00 . A A .  34 THR HG21 1 1 
        8  4800 1 1 34 THR HG22 H    6.727   6.049  -6.135 1.00 . A A .  34 THR HG22 1 1 
        8  4801 1 1 34 THR HG23 H    6.251   7.313  -7.269 1.00 . A A .  34 THR HG23 1 1 
        8  4802 1 1 34 THR N    N    6.657   6.130  -3.640 1.00 . A A .  34 THR N    1 1 
        8  4803 1 1 34 THR O    O    6.689   9.528  -2.865 1.00 . A A .  34 THR O    1 1 
        8  4804 1 1 34 THR OG1  O    4.214   7.203  -4.814 1.00 . A A .  34 THR OG1  1 1 
        8  4805 1 1 35 HIS C    C    5.635   8.890   0.006 1.00 . A A .  35 HIS C    1 1 
        8  4806 1 1 35 HIS CA   C    4.627   8.858  -1.138 1.00 . A A .  35 HIS CA   1 1 
        8  4807 1 1 35 HIS CB   C    3.285   8.322  -0.637 1.00 . A A .  35 HIS CB   1 1 
        8  4808 1 1 35 HIS CD2  C    1.284   7.443  -2.034 1.00 . A A .  35 HIS CD2  1 1 
        8  4809 1 1 35 HIS CE1  C    0.945   9.225  -3.265 1.00 . A A .  35 HIS CE1  1 1 
        8  4810 1 1 35 HIS CG   C    2.198   8.371  -1.667 1.00 . A A .  35 HIS CG   1 1 
        8  4811 1 1 35 HIS H    H    4.704   7.170  -2.413 1.00 . A A .  35 HIS H    1 1 
        8  4812 1 1 35 HIS HA   H    4.487   9.863  -1.507 1.00 . A A .  35 HIS HA   1 1 
        8  4813 1 1 35 HIS HB2  H    3.408   7.292  -0.334 1.00 . A A .  35 HIS HB2  1 1 
        8  4814 1 1 35 HIS HB3  H    2.966   8.907   0.213 1.00 . A A .  35 HIS HB3  1 1 
        8  4815 1 1 35 HIS HD1  H    2.459  10.318  -2.428 1.00 . A A .  35 HIS HD1  1 1 
        8  4816 1 1 35 HIS HD2  H    1.177   6.449  -1.622 1.00 . A A .  35 HIS HD2  1 1 
        8  4817 1 1 35 HIS HE1  H    0.535   9.907  -3.994 1.00 . A A .  35 HIS HE1  1 1 
        8  4818 1 1 35 HIS N    N    5.119   8.040  -2.241 1.00 . A A .  35 HIS N    1 1 
        8  4819 1 1 35 HIS ND1  N    1.960   9.475  -2.457 1.00 . A A .  35 HIS ND1  1 1 
        8  4820 1 1 35 HIS NE2  N    0.517   7.998  -3.029 1.00 . A A .  35 HIS NE2  1 1 
        8  4821 1 1 35 HIS O    O    5.492   8.168   0.993 1.00 . A A .  35 HIS O    1 1 
        8  4822 1 1 36 SER C    C    7.300  10.897   1.932 1.00 . A A .  36 SER C    1 1 
        8  4823 1 1 36 SER CA   C    7.689   9.855   0.888 1.00 . A A .  36 SER CA   1 1 
        8  4824 1 1 36 SER CB   C    9.025  10.232   0.246 1.00 . A A .  36 SER CB   1 1 
        8  4825 1 1 36 SER H    H    6.713  10.281  -0.942 1.00 . A A .  36 SER H    1 1 
        8  4826 1 1 36 SER HA   H    7.790   8.896   1.374 1.00 . A A .  36 SER HA   1 1 
        8  4827 1 1 36 SER HB2  H    8.857  10.977  -0.517 1.00 . A A .  36 SER HB2  1 1 
        8  4828 1 1 36 SER HB3  H    9.683  10.634   1.003 1.00 . A A .  36 SER HB3  1 1 
        8  4829 1 1 36 SER HG   H    8.975   8.456  -0.579 1.00 . A A .  36 SER HG   1 1 
        8  4830 1 1 36 SER N    N    6.654   9.732  -0.133 1.00 . A A .  36 SER N    1 1 
        8  4831 1 1 36 SER O    O    6.867  11.998   1.596 1.00 . A A .  36 SER O    1 1 
        8  4832 1 1 36 SER OG   O    9.644   9.103  -0.345 1.00 . A A .  36 SER OG   1 1 
        8  4833 1 1 37 GLY C    C    8.241  11.600   5.289 1.00 . A A .  37 GLY C    1 1 
        8  4834 1 1 37 GLY CA   C    7.121  11.454   4.278 1.00 . A A .  37 GLY CA   1 1 
        8  4835 1 1 37 GLY H    H    7.809   9.648   3.412 1.00 . A A .  37 GLY H    1 1 
        8  4836 1 1 37 GLY HA2  H    6.902  12.423   3.857 1.00 . A A .  37 GLY HA2  1 1 
        8  4837 1 1 37 GLY HA3  H    6.241  11.085   4.785 1.00 . A A .  37 GLY HA3  1 1 
        8  4838 1 1 37 GLY N    N    7.459  10.540   3.203 1.00 . A A .  37 GLY N    1 1 
        8  4839 1 1 37 GLY O    O    8.588  12.713   5.683 1.00 . A A .  37 GLY O    1 1 
        8  4840 1 1 38 GLU C    C   11.084  11.279   6.162 1.00 . A A .  38 GLU C    1 1 
        8  4841 1 1 38 GLU CA   C    9.892  10.482   6.684 1.00 . A A .  38 GLU CA   1 1 
        8  4842 1 1 38 GLU CB   C   10.326   9.051   7.010 1.00 . A A .  38 GLU CB   1 1 
        8  4843 1 1 38 GLU CD   C    9.916   6.966   8.376 1.00 . A A .  38 GLU CD   1 1 
        8  4844 1 1 38 GLU CG   C    9.457   8.375   8.057 1.00 . A A .  38 GLU CG   1 1 
        8  4845 1 1 38 GLU H    H    8.486   9.616   5.359 1.00 . A A .  38 GLU H    1 1 
        8  4846 1 1 38 GLU HA   H    9.527  10.951   7.584 1.00 . A A .  38 GLU HA   1 1 
        8  4847 1 1 38 GLU HB2  H   10.289   8.461   6.106 1.00 . A A .  38 GLU HB2  1 1 
        8  4848 1 1 38 GLU HB3  H   11.342   9.070   7.375 1.00 . A A .  38 GLU HB3  1 1 
        8  4849 1 1 38 GLU HG2  H    9.486   8.961   8.964 1.00 . A A .  38 GLU HG2  1 1 
        8  4850 1 1 38 GLU HG3  H    8.441   8.333   7.691 1.00 . A A .  38 GLU HG3  1 1 
        8  4851 1 1 38 GLU N    N    8.807  10.473   5.710 1.00 . A A .  38 GLU N    1 1 
        8  4852 1 1 38 GLU O    O   11.193  11.543   4.965 1.00 . A A .  38 GLU O    1 1 
        8  4853 1 1 38 GLU OE1  O    9.587   6.044   7.600 1.00 . A A .  38 GLU OE1  1 1 
        8  4854 1 1 38 GLU OE2  O   10.605   6.785   9.402 1.00 . A A .  38 GLU OE2  1 1 
        8  4855 1 1 39 LYS C    C   12.847  13.412   5.582 1.00 . A A .  39 LYS C    1 1 
        8  4856 1 1 39 LYS CA   C   13.161  12.428   6.704 1.00 . A A .  39 LYS CA   1 1 
        8  4857 1 1 39 LYS CB   C   14.289  11.489   6.273 1.00 . A A .  39 LYS CB   1 1 
        8  4858 1 1 39 LYS CD   C   15.517   9.393   6.913 1.00 . A A .  39 LYS CD   1 1 
        8  4859 1 1 39 LYS CE   C   16.819   9.673   6.180 1.00 . A A .  39 LYS CE   1 1 
        8  4860 1 1 39 LYS CG   C   14.873  10.675   7.414 1.00 . A A .  39 LYS CG   1 1 
        8  4861 1 1 39 LYS H    H   11.834  11.421   8.010 1.00 . A A .  39 LYS H    1 1 
        8  4862 1 1 39 LYS HA   H   13.479  12.983   7.574 1.00 . A A .  39 LYS HA   1 1 
        8  4863 1 1 39 LYS HB2  H   13.906  10.804   5.530 1.00 . A A .  39 LYS HB2  1 1 
        8  4864 1 1 39 LYS HB3  H   15.082  12.076   5.834 1.00 . A A .  39 LYS HB3  1 1 
        8  4865 1 1 39 LYS HD2  H   15.722   8.750   7.756 1.00 . A A .  39 LYS HD2  1 1 
        8  4866 1 1 39 LYS HD3  H   14.833   8.898   6.239 1.00 . A A .  39 LYS HD3  1 1 
        8  4867 1 1 39 LYS HE2  H   16.610  10.300   5.327 1.00 . A A .  39 LYS HE2  1 1 
        8  4868 1 1 39 LYS HE3  H   17.491  10.189   6.850 1.00 . A A .  39 LYS HE3  1 1 
        8  4869 1 1 39 LYS HG2  H   15.622  11.267   7.920 1.00 . A A .  39 LYS HG2  1 1 
        8  4870 1 1 39 LYS HG3  H   14.083  10.424   8.107 1.00 . A A .  39 LYS HG3  1 1 
        8  4871 1 1 39 LYS HZ1  H   17.353   8.317   4.683 1.00 . A A .  39 LYS HZ1  1 1 
        8  4872 1 1 39 LYS HZ2  H   17.045   7.596   6.183 1.00 . A A .  39 LYS HZ2  1 1 
        8  4873 1 1 39 LYS HZ3  H   18.488   8.441   5.931 1.00 . A A .  39 LYS HZ3  1 1 
        8  4874 1 1 39 LYS N    N   11.976  11.661   7.070 1.00 . A A .  39 LYS N    1 1 
        8  4875 1 1 39 LYS NZ   N   17.472   8.419   5.711 1.00 . A A .  39 LYS NZ   1 1 
        8  4876 1 1 39 LYS O    O   13.497  13.427   4.537 1.00 . A A .  39 LYS O    1 1 
        8  4877 1 1 40 PRO C    C   12.428  16.381   4.662 1.00 . A A .  40 PRO C    1 1 
        8  4878 1 1 40 PRO CA   C   11.406  15.260   4.820 1.00 . A A .  40 PRO CA   1 1 
        8  4879 1 1 40 PRO CB   C   10.102  15.805   5.408 1.00 . A A .  40 PRO CB   1 1 
        8  4880 1 1 40 PRO CD   C   11.008  14.295   7.025 1.00 . A A .  40 PRO CD   1 1 
        8  4881 1 1 40 PRO CG   C   10.218  15.565   6.874 1.00 . A A .  40 PRO CG   1 1 
        8  4882 1 1 40 PRO HA   H   11.210  14.815   3.856 1.00 . A A .  40 PRO HA   1 1 
        8  4883 1 1 40 PRO HB2  H   10.016  16.859   5.185 1.00 . A A .  40 PRO HB2  1 1 
        8  4884 1 1 40 PRO HB3  H    9.262  15.273   4.987 1.00 . A A .  40 PRO HB3  1 1 
        8  4885 1 1 40 PRO HD2  H   11.632  14.341   7.905 1.00 . A A .  40 PRO HD2  1 1 
        8  4886 1 1 40 PRO HD3  H   10.347  13.442   7.072 1.00 . A A .  40 PRO HD3  1 1 
        8  4887 1 1 40 PRO HG2  H   10.737  16.388   7.341 1.00 . A A .  40 PRO HG2  1 1 
        8  4888 1 1 40 PRO HG3  H    9.234  15.448   7.305 1.00 . A A .  40 PRO HG3  1 1 
        8  4889 1 1 40 PRO N    N   11.827  14.256   5.801 1.00 . A A .  40 PRO N    1 1 
        8  4890 1 1 40 PRO O    O   13.235  16.629   5.558 1.00 . A A .  40 PRO O    1 1 
        8  4891 1 1 41 SER C    C   14.754  17.652   3.240 1.00 . A A .  41 SER C    1 1 
        8  4892 1 1 41 SER CA   C   13.312  18.149   3.241 1.00 . A A .  41 SER CA   1 1 
        8  4893 1 1 41 SER CB   C   13.145  19.261   4.278 1.00 . A A .  41 SER CB   1 1 
        8  4894 1 1 41 SER H    H   11.720  16.811   2.842 1.00 . A A .  41 SER H    1 1 
        8  4895 1 1 41 SER HA   H   13.078  18.542   2.263 1.00 . A A .  41 SER HA   1 1 
        8  4896 1 1 41 SER HB2  H   12.960  18.823   5.247 1.00 . A A .  41 SER HB2  1 1 
        8  4897 1 1 41 SER HB3  H   14.048  19.852   4.317 1.00 . A A .  41 SER HB3  1 1 
        8  4898 1 1 41 SER HG   H   11.972  20.160   2.991 1.00 . A A .  41 SER HG   1 1 
        8  4899 1 1 41 SER N    N   12.387  17.056   3.518 1.00 . A A .  41 SER N    1 1 
        8  4900 1 1 41 SER O    O   15.648  18.305   3.777 1.00 . A A .  41 SER O    1 1 
        8  4901 1 1 41 SER OG   O   12.058  20.109   3.946 1.00 . A A .  41 SER OG   1 1 
        8  4902 1 1 42 GLY C    C   16.944  15.791   3.941 1.00 . A A .  42 GLY C    1 1 
        8  4903 1 1 42 GLY CA   C   16.308  15.924   2.571 1.00 . A A .  42 GLY CA   1 1 
        8  4904 1 1 42 GLY H    H   14.222  16.013   2.221 1.00 . A A .  42 GLY H    1 1 
        8  4905 1 1 42 GLY HA2  H   16.253  14.947   2.114 1.00 . A A .  42 GLY HA2  1 1 
        8  4906 1 1 42 GLY HA3  H   16.929  16.562   1.959 1.00 . A A .  42 GLY HA3  1 1 
        8  4907 1 1 42 GLY N    N   14.973  16.490   2.632 1.00 . A A .  42 GLY N    1 1 
        8  4908 1 1 42 GLY O    O   16.275  15.883   4.970 1.00 . A A .  42 GLY O    1 1 
        8  4909 1 1 43 PRO C    C   19.130  16.722   5.987 1.00 . A A .  43 PRO C    1 1 
        8  4910 1 1 43 PRO CA   C   19.021  15.414   5.212 1.00 . A A .  43 PRO CA   1 1 
        8  4911 1 1 43 PRO CB   C   20.402  14.957   4.736 1.00 . A A .  43 PRO CB   1 1 
        8  4912 1 1 43 PRO CD   C   19.126  15.445   2.775 1.00 . A A .  43 PRO CD   1 1 
        8  4913 1 1 43 PRO CG   C   20.517  15.479   3.346 1.00 . A A .  43 PRO CG   1 1 
        8  4914 1 1 43 PRO HA   H   18.588  14.655   5.847 1.00 . A A .  43 PRO HA   1 1 
        8  4915 1 1 43 PRO HB2  H   21.164  15.374   5.380 1.00 . A A .  43 PRO HB2  1 1 
        8  4916 1 1 43 PRO HB3  H   20.456  13.879   4.759 1.00 . A A .  43 PRO HB3  1 1 
        8  4917 1 1 43 PRO HD2  H   18.974  16.276   2.102 1.00 . A A .  43 PRO HD2  1 1 
        8  4918 1 1 43 PRO HD3  H   18.950  14.508   2.267 1.00 . A A .  43 PRO HD3  1 1 
        8  4919 1 1 43 PRO HG2  H   20.890  16.491   3.364 1.00 . A A .  43 PRO HG2  1 1 
        8  4920 1 1 43 PRO HG3  H   21.174  14.845   2.769 1.00 . A A .  43 PRO HG3  1 1 
        8  4921 1 1 43 PRO N    N   18.266  15.566   3.964 1.00 . A A .  43 PRO N    1 1 
        8  4922 1 1 43 PRO O    O   20.079  17.485   5.805 1.00 . A A .  43 PRO O    1 1 
        8  4923 1 1 44 SER C    C   18.259  17.869   9.139 1.00 . A A .  44 SER C    1 1 
        8  4924 1 1 44 SER CA   C   18.139  18.194   7.653 1.00 . A A .  44 SER CA   1 1 
        8  4925 1 1 44 SER CB   C   16.854  18.984   7.395 1.00 . A A .  44 SER CB   1 1 
        8  4926 1 1 44 SER H    H   17.424  16.328   6.952 1.00 . A A .  44 SER H    1 1 
        8  4927 1 1 44 SER HA   H   18.986  18.795   7.358 1.00 . A A .  44 SER HA   1 1 
        8  4928 1 1 44 SER HB2  H   16.813  19.270   6.355 1.00 . A A .  44 SER HB2  1 1 
        8  4929 1 1 44 SER HB3  H   16.001  18.365   7.631 1.00 . A A .  44 SER HB3  1 1 
        8  4930 1 1 44 SER HG   H   16.924  19.917   9.116 1.00 . A A .  44 SER HG   1 1 
        8  4931 1 1 44 SER N    N   18.153  16.975   6.852 1.00 . A A .  44 SER N    1 1 
        8  4932 1 1 44 SER O    O   17.511  17.048   9.669 1.00 . A A .  44 SER O    1 1 
        8  4933 1 1 44 SER OG   O   16.805  20.153   8.193 1.00 . A A .  44 SER OG   1 1 
        8  4934 1 1 45 SER C    C   18.757  19.386  12.060 1.00 . A A .  45 SER C    1 1 
        8  4935 1 1 45 SER CA   C   19.430  18.298  11.229 1.00 . A A .  45 SER CA   1 1 
        8  4936 1 1 45 SER CB   C   20.929  18.263  11.533 1.00 . A A .  45 SER CB   1 1 
        8  4937 1 1 45 SER H    H   19.772  19.162   9.327 1.00 . A A .  45 SER H    1 1 
        8  4938 1 1 45 SER HA   H   18.997  17.344  11.488 1.00 . A A .  45 SER HA   1 1 
        8  4939 1 1 45 SER HB2  H   21.444  17.751  10.735 1.00 . A A .  45 SER HB2  1 1 
        8  4940 1 1 45 SER HB3  H   21.302  19.274  11.611 1.00 . A A .  45 SER HB3  1 1 
        8  4941 1 1 45 SER HG   H   20.471  16.973  12.934 1.00 . A A .  45 SER HG   1 1 
        8  4942 1 1 45 SER N    N   19.208  18.520   9.805 1.00 . A A .  45 SER N    1 1 
        8  4943 1 1 45 SER O    O   19.077  20.567  11.933 1.00 . A A .  45 SER O    1 1 
        8  4944 1 1 45 SER OG   O   21.187  17.586  12.751 1.00 . A A .  45 SER OG   1 1 
        8  4945 1 1 46 GLY C    C   16.829  19.380  15.135 1.00 . A A .  46 GLY C    1 1 
        8  4946 1 1 46 GLY CA   C   17.116  19.929  13.751 1.00 . A A .  46 GLY CA   1 1 
        8  4947 1 1 46 GLY H    H   17.607  18.023  12.970 1.00 . A A .  46 GLY H    1 1 
        8  4948 1 1 46 GLY HA2  H   17.716  20.822  13.847 1.00 . A A .  46 GLY HA2  1 1 
        8  4949 1 1 46 GLY HA3  H   16.180  20.185  13.277 1.00 . A A .  46 GLY HA3  1 1 
        8  4950 1 1 46 GLY N    N   17.821  18.978  12.912 1.00 . A A .  46 GLY N    1 1 
        8  4951 1 1 46 GLY O    O   16.343  18.255  15.243 1.00 . A A .  46 GLY O    1 1 
        8  4952 2 2  1 ZN  ZN   ZN  -0.984   6.570  -3.344 1.00 . B A . 201 ZN  ZN   1 1 
        9  4953 1 1  1 GLY C    C  -19.168   9.938 -13.281 1.00 . A A .   1 GLY C    1 1 
        9  4954 1 1  1 GLY CA   C  -18.548  10.443 -14.568 1.00 . A A .   1 GLY CA   1 1 
        9  4955 1 1  1 GLY H1   H  -19.966  10.602 -16.133 1.00 . A A .   1 GLY H1   1 1 
        9  4956 1 1  1 GLY HA2  H  -18.123   9.607 -15.103 1.00 . A A .   1 GLY HA2  1 1 
        9  4957 1 1  1 GLY HA3  H  -17.760  11.141 -14.325 1.00 . A A .   1 GLY HA3  1 1 
        9  4958 1 1  1 GLY N    N  -19.513  11.107 -15.426 1.00 . A A .   1 GLY N    1 1 
        9  4959 1 1  1 GLY O    O  -20.022  10.602 -12.693 1.00 . A A .   1 GLY O    1 1 
        9  4960 1 1  2 SER C    C  -18.126   7.702 -10.710 1.00 . A A .   2 SER C    1 1 
        9  4961 1 1  2 SER CA   C  -19.262   8.163 -11.618 1.00 . A A .   2 SER CA   1 1 
        9  4962 1 1  2 SER CB   C  -20.175   6.982 -11.951 1.00 . A A .   2 SER CB   1 1 
        9  4963 1 1  2 SER H    H  -18.056   8.278 -13.354 1.00 . A A .   2 SER H    1 1 
        9  4964 1 1  2 SER HA   H  -19.837   8.917 -11.101 1.00 . A A .   2 SER HA   1 1 
        9  4965 1 1  2 SER HB2  H  -20.590   6.582 -11.038 1.00 . A A .   2 SER HB2  1 1 
        9  4966 1 1  2 SER HB3  H  -20.977   7.320 -12.592 1.00 . A A .   2 SER HB3  1 1 
        9  4967 1 1  2 SER HG   H  -18.964   5.442 -11.974 1.00 . A A .   2 SER HG   1 1 
        9  4968 1 1  2 SER N    N  -18.739   8.759 -12.841 1.00 . A A .   2 SER N    1 1 
        9  4969 1 1  2 SER O    O  -17.156   7.098 -11.169 1.00 . A A .   2 SER O    1 1 
        9  4970 1 1  2 SER OG   O  -19.460   5.955 -12.616 1.00 . A A .   2 SER OG   1 1 
        9  4971 1 1  3 SER C    C  -17.495   6.203  -7.913 1.00 . A A .   3 SER C    1 1 
        9  4972 1 1  3 SER CA   C  -17.237   7.609  -8.446 1.00 . A A .   3 SER CA   1 1 
        9  4973 1 1  3 SER CB   C  -17.210   8.609  -7.287 1.00 . A A .   3 SER CB   1 1 
        9  4974 1 1  3 SER H    H  -19.051   8.474  -9.114 1.00 . A A .   3 SER H    1 1 
        9  4975 1 1  3 SER HA   H  -16.279   7.623  -8.944 1.00 . A A .   3 SER HA   1 1 
        9  4976 1 1  3 SER HB2  H  -18.221   8.874  -7.020 1.00 . A A .   3 SER HB2  1 1 
        9  4977 1 1  3 SER HB3  H  -16.720   8.156  -6.437 1.00 . A A .   3 SER HB3  1 1 
        9  4978 1 1  3 SER HG   H  -16.617  10.446  -6.958 1.00 . A A .   3 SER HG   1 1 
        9  4979 1 1  3 SER N    N  -18.254   7.991  -9.419 1.00 . A A .   3 SER N    1 1 
        9  4980 1 1  3 SER O    O  -18.627   5.848  -7.590 1.00 . A A .   3 SER O    1 1 
        9  4981 1 1  3 SER OG   O  -16.508   9.786  -7.646 1.00 . A A .   3 SER OG   1 1 
        9  4982 1 1  4 GLY C    C  -15.341   3.589  -6.564 1.00 . A A .   4 GLY C    1 1 
        9  4983 1 1  4 GLY CA   C  -16.565   4.048  -7.331 1.00 . A A .   4 GLY CA   1 1 
        9  4984 1 1  4 GLY H    H  -15.555   5.744  -8.097 1.00 . A A .   4 GLY H    1 1 
        9  4985 1 1  4 GLY HA2  H  -17.426   3.994  -6.682 1.00 . A A .   4 GLY HA2  1 1 
        9  4986 1 1  4 GLY HA3  H  -16.718   3.386  -8.171 1.00 . A A .   4 GLY HA3  1 1 
        9  4987 1 1  4 GLY N    N  -16.434   5.407  -7.825 1.00 . A A .   4 GLY N    1 1 
        9  4988 1 1  4 GLY O    O  -14.215   3.952  -6.904 1.00 . A A .   4 GLY O    1 1 
        9  4989 1 1  5 SER C    C  -13.959   0.950  -5.237 1.00 . A A .   5 SER C    1 1 
        9  4990 1 1  5 SER CA   C  -14.467   2.286  -4.703 1.00 . A A .   5 SER CA   1 1 
        9  4991 1 1  5 SER CB   C  -14.922   2.129  -3.251 1.00 . A A .   5 SER CB   1 1 
        9  4992 1 1  5 SER H    H  -16.482   2.537  -5.304 1.00 . A A .   5 SER H    1 1 
        9  4993 1 1  5 SER HA   H  -13.663   3.006  -4.744 1.00 . A A .   5 SER HA   1 1 
        9  4994 1 1  5 SER HB2  H  -14.104   1.744  -2.660 1.00 . A A .   5 SER HB2  1 1 
        9  4995 1 1  5 SER HB3  H  -15.223   3.092  -2.865 1.00 . A A .   5 SER HB3  1 1 
        9  4996 1 1  5 SER HG   H  -15.690   0.344  -3.002 1.00 . A A .   5 SER HG   1 1 
        9  4997 1 1  5 SER N    N  -15.561   2.791  -5.525 1.00 . A A .   5 SER N    1 1 
        9  4998 1 1  5 SER O    O  -14.744   0.073  -5.594 1.00 . A A .   5 SER O    1 1 
        9  4999 1 1  5 SER OG   O  -16.016   1.234  -3.154 1.00 . A A .   5 SER OG   1 1 
        9  5000 1 1  6 SER C    C  -11.630  -1.336  -4.623 1.00 . A A .   6 SER C    1 1 
        9  5001 1 1  6 SER CA   C  -12.024  -0.423  -5.780 1.00 . A A .   6 SER CA   1 1 
        9  5002 1 1  6 SER CB   C  -10.793  -0.097  -6.628 1.00 . A A .   6 SER CB   1 1 
        9  5003 1 1  6 SER H    H  -12.064   1.540  -4.988 1.00 . A A .   6 SER H    1 1 
        9  5004 1 1  6 SER HA   H  -12.749  -0.933  -6.396 1.00 . A A .   6 SER HA   1 1 
        9  5005 1 1  6 SER HB2  H  -10.305  -1.015  -6.919 1.00 . A A .   6 SER HB2  1 1 
        9  5006 1 1  6 SER HB3  H  -11.101   0.443  -7.512 1.00 . A A .   6 SER HB3  1 1 
        9  5007 1 1  6 SER HG   H   -9.139   0.943  -6.476 1.00 . A A .   6 SER HG   1 1 
        9  5008 1 1  6 SER N    N  -12.638   0.804  -5.287 1.00 . A A .   6 SER N    1 1 
        9  5009 1 1  6 SER O    O  -12.066  -2.485  -4.548 1.00 . A A .   6 SER O    1 1 
        9  5010 1 1  6 SER OG   O   -9.872   0.701  -5.905 1.00 . A A .   6 SER OG   1 1 
        9  5011 1 1  7 GLY C    C  -10.390  -0.804  -1.290 1.00 . A A .   7 GLY C    1 1 
        9  5012 1 1  7 GLY CA   C  -10.363  -1.598  -2.580 1.00 . A A .   7 GLY CA   1 1 
        9  5013 1 1  7 GLY H    H  -10.487   0.105  -3.833 1.00 . A A .   7 GLY H    1 1 
        9  5014 1 1  7 GLY HA2  H  -11.009  -2.457  -2.476 1.00 . A A .   7 GLY HA2  1 1 
        9  5015 1 1  7 GLY HA3  H   -9.353  -1.938  -2.759 1.00 . A A .   7 GLY HA3  1 1 
        9  5016 1 1  7 GLY N    N  -10.802  -0.817  -3.722 1.00 . A A .   7 GLY N    1 1 
        9  5017 1 1  7 GLY O    O   -9.343  -0.427  -0.763 1.00 . A A .   7 GLY O    1 1 
        9  5018 1 1  8 ALA C    C  -12.220  -0.695   1.594 1.00 . A A .   8 ALA C    1 1 
        9  5019 1 1  8 ALA CA   C  -11.748   0.207   0.458 1.00 . A A .   8 ALA CA   1 1 
        9  5020 1 1  8 ALA CB   C  -12.724   1.356   0.254 1.00 . A A .   8 ALA CB   1 1 
        9  5021 1 1  8 ALA H    H  -12.387  -0.875  -1.245 1.00 . A A .   8 ALA H    1 1 
        9  5022 1 1  8 ALA HA   H  -10.787   0.625   0.720 1.00 . A A .   8 ALA HA   1 1 
        9  5023 1 1  8 ALA HB1  H  -13.662   0.970  -0.117 1.00 . A A .   8 ALA HB1  1 1 
        9  5024 1 1  8 ALA HB2  H  -12.889   1.858   1.196 1.00 . A A .   8 ALA HB2  1 1 
        9  5025 1 1  8 ALA HB3  H  -12.313   2.054  -0.459 1.00 . A A .   8 ALA HB3  1 1 
        9  5026 1 1  8 ALA N    N  -11.590  -0.548  -0.779 1.00 . A A .   8 ALA N    1 1 
        9  5027 1 1  8 ALA O    O  -11.547  -0.826   2.616 1.00 . A A .   8 ALA O    1 1 
        9  5028 1 1  9 GLY C    C  -13.665  -3.658   2.125 1.00 . A A .   9 GLY C    1 1 
        9  5029 1 1  9 GLY CA   C  -13.923  -2.195   2.427 1.00 . A A .   9 GLY CA   1 1 
        9  5030 1 1  9 GLY H    H  -13.875  -1.172   0.574 1.00 . A A .   9 GLY H    1 1 
        9  5031 1 1  9 GLY HA2  H  -13.472  -1.949   3.377 1.00 . A A .   9 GLY HA2  1 1 
        9  5032 1 1  9 GLY HA3  H  -14.989  -2.036   2.494 1.00 . A A .   9 GLY HA3  1 1 
        9  5033 1 1  9 GLY N    N  -13.381  -1.314   1.409 1.00 . A A .   9 GLY N    1 1 
        9  5034 1 1  9 GLY O    O  -13.376  -4.443   3.028 1.00 . A A .   9 GLY O    1 1 
        9  5035 1 1 10 GLU C    C  -12.138  -5.860   0.786 1.00 . A A .  10 GLU C    1 1 
        9  5036 1 1 10 GLU CA   C  -13.551  -5.406   0.435 1.00 . A A .  10 GLU CA   1 1 
        9  5037 1 1 10 GLU CB   C  -13.787  -5.551  -1.070 1.00 . A A .  10 GLU CB   1 1 
        9  5038 1 1 10 GLU CD   C  -16.087  -4.664  -1.622 1.00 . A A .  10 GLU CD   1 1 
        9  5039 1 1 10 GLU CG   C  -15.222  -5.895  -1.431 1.00 . A A .  10 GLU CG   1 1 
        9  5040 1 1 10 GLU H    H  -14.007  -3.354   0.178 1.00 . A A .  10 GLU H    1 1 
        9  5041 1 1 10 GLU HA   H  -14.258  -6.029   0.962 1.00 . A A .  10 GLU HA   1 1 
        9  5042 1 1 10 GLU HB2  H  -13.528  -4.621  -1.554 1.00 . A A .  10 GLU HB2  1 1 
        9  5043 1 1 10 GLU HB3  H  -13.145  -6.333  -1.448 1.00 . A A .  10 GLU HB3  1 1 
        9  5044 1 1 10 GLU HG2  H  -15.222  -6.462  -2.350 1.00 . A A .  10 GLU HG2  1 1 
        9  5045 1 1 10 GLU HG3  H  -15.645  -6.495  -0.639 1.00 . A A .  10 GLU HG3  1 1 
        9  5046 1 1 10 GLU N    N  -13.773  -4.026   0.852 1.00 . A A .  10 GLU N    1 1 
        9  5047 1 1 10 GLU O    O  -11.938  -6.950   1.323 1.00 . A A .  10 GLU O    1 1 
        9  5048 1 1 10 GLU OE1  O  -15.539  -3.609  -2.005 1.00 . A A .  10 GLU OE1  1 1 
        9  5049 1 1 10 GLU OE2  O  -17.310  -4.756  -1.388 1.00 . A A .  10 GLU OE2  1 1 
        9  5050 1 1 11 LYS C    C   -9.229  -4.459   1.896 1.00 . A A .  11 LYS C    1 1 
        9  5051 1 1 11 LYS CA   C   -9.762  -5.329   0.762 1.00 . A A .  11 LYS CA   1 1 
        9  5052 1 1 11 LYS CB   C   -8.909  -5.128  -0.493 1.00 . A A .  11 LYS CB   1 1 
        9  5053 1 1 11 LYS CD   C   -8.605  -7.347  -1.630 1.00 . A A .  11 LYS CD   1 1 
        9  5054 1 1 11 LYS CE   C   -9.282  -8.364  -2.537 1.00 . A A .  11 LYS CE   1 1 
        9  5055 1 1 11 LYS CG   C   -9.325  -6.010  -1.658 1.00 . A A .  11 LYS CG   1 1 
        9  5056 1 1 11 LYS H    H  -11.380  -4.162   0.053 1.00 . A A .  11 LYS H    1 1 
        9  5057 1 1 11 LYS HA   H   -9.708  -6.364   1.063 1.00 . A A .  11 LYS HA   1 1 
        9  5058 1 1 11 LYS HB2  H   -8.984  -4.097  -0.804 1.00 . A A .  11 LYS HB2  1 1 
        9  5059 1 1 11 LYS HB3  H   -7.879  -5.349  -0.252 1.00 . A A .  11 LYS HB3  1 1 
        9  5060 1 1 11 LYS HD2  H   -7.588  -7.206  -1.964 1.00 . A A .  11 LYS HD2  1 1 
        9  5061 1 1 11 LYS HD3  H   -8.605  -7.725  -0.617 1.00 . A A .  11 LYS HD3  1 1 
        9  5062 1 1 11 LYS HE2  H   -9.380  -7.938  -3.523 1.00 . A A .  11 LYS HE2  1 1 
        9  5063 1 1 11 LYS HE3  H   -8.666  -9.249  -2.587 1.00 . A A .  11 LYS HE3  1 1 
        9  5064 1 1 11 LYS HG2  H  -10.389  -6.185  -1.603 1.00 . A A .  11 LYS HG2  1 1 
        9  5065 1 1 11 LYS HG3  H   -9.089  -5.503  -2.583 1.00 . A A .  11 LYS HG3  1 1 
        9  5066 1 1 11 LYS HZ1  H  -11.271  -8.931  -2.835 1.00 . A A .  11 LYS HZ1  1 1 
        9  5067 1 1 11 LYS HZ2  H  -11.031  -7.968  -1.465 1.00 . A A .  11 LYS HZ2  1 1 
        9  5068 1 1 11 LYS HZ3  H  -10.569  -9.595  -1.445 1.00 . A A .  11 LYS HZ3  1 1 
        9  5069 1 1 11 LYS N    N  -11.158  -5.016   0.479 1.00 . A A .  11 LYS N    1 1 
        9  5070 1 1 11 LYS NZ   N  -10.633  -8.741  -2.035 1.00 . A A .  11 LYS NZ   1 1 
        9  5071 1 1 11 LYS O    O   -9.586  -3.289   2.034 1.00 . A A .  11 LYS O    1 1 
        9  5072 1 1 12 PRO C    C   -6.764  -3.260   3.420 1.00 . A A .  12 PRO C    1 1 
        9  5073 1 1 12 PRO CA   C   -7.750  -4.336   3.863 1.00 . A A .  12 PRO CA   1 1 
        9  5074 1 1 12 PRO CB   C   -7.022  -5.447   4.625 1.00 . A A .  12 PRO CB   1 1 
        9  5075 1 1 12 PRO CD   C   -7.881  -6.432   2.624 1.00 . A A .  12 PRO CD   1 1 
        9  5076 1 1 12 PRO CG   C   -6.737  -6.487   3.597 1.00 . A A .  12 PRO CG   1 1 
        9  5077 1 1 12 PRO HA   H   -8.502  -3.894   4.500 1.00 . A A .  12 PRO HA   1 1 
        9  5078 1 1 12 PRO HB2  H   -6.112  -5.055   5.055 1.00 . A A .  12 PRO HB2  1 1 
        9  5079 1 1 12 PRO HB3  H   -7.661  -5.830   5.406 1.00 . A A .  12 PRO HB3  1 1 
        9  5080 1 1 12 PRO HD2  H   -7.537  -6.649   1.623 1.00 . A A .  12 PRO HD2  1 1 
        9  5081 1 1 12 PRO HD3  H   -8.658  -7.124   2.915 1.00 . A A .  12 PRO HD3  1 1 
        9  5082 1 1 12 PRO HG2  H   -5.807  -6.262   3.096 1.00 . A A .  12 PRO HG2  1 1 
        9  5083 1 1 12 PRO HG3  H   -6.687  -7.459   4.063 1.00 . A A .  12 PRO HG3  1 1 
        9  5084 1 1 12 PRO N    N   -8.352  -5.041   2.728 1.00 . A A .  12 PRO N    1 1 
        9  5085 1 1 12 PRO O    O   -6.665  -2.202   4.042 1.00 . A A .  12 PRO O    1 1 
        9  5086 1 1 13 TYR C    C   -5.747  -1.432   1.108 1.00 . A A .  13 TYR C    1 1 
        9  5087 1 1 13 TYR CA   C   -5.059  -2.593   1.818 1.00 . A A .  13 TYR CA   1 1 
        9  5088 1 1 13 TYR CB   C   -4.103  -3.300   0.856 1.00 . A A .  13 TYR CB   1 1 
        9  5089 1 1 13 TYR CD1  C   -3.082  -4.824   2.591 1.00 . A A .  13 TYR CD1  1 1 
        9  5090 1 1 13 TYR CD2  C   -3.812  -5.788   0.537 1.00 . A A .  13 TYR CD2  1 1 
        9  5091 1 1 13 TYR CE1  C   -2.672  -6.067   3.034 1.00 . A A .  13 TYR CE1  1 1 
        9  5092 1 1 13 TYR CE2  C   -3.407  -7.035   0.972 1.00 . A A .  13 TYR CE2  1 1 
        9  5093 1 1 13 TYR CG   C   -3.657  -4.662   1.337 1.00 . A A .  13 TYR CG   1 1 
        9  5094 1 1 13 TYR CZ   C   -2.837  -7.169   2.221 1.00 . A A .  13 TYR CZ   1 1 
        9  5095 1 1 13 TYR H    H   -6.162  -4.397   1.891 1.00 . A A .  13 TYR H    1 1 
        9  5096 1 1 13 TYR HA   H   -4.492  -2.205   2.652 1.00 . A A .  13 TYR HA   1 1 
        9  5097 1 1 13 TYR HB2  H   -4.592  -3.429  -0.097 1.00 . A A .  13 TYR HB2  1 1 
        9  5098 1 1 13 TYR HB3  H   -3.221  -2.690   0.723 1.00 . A A .  13 TYR HB3  1 1 
        9  5099 1 1 13 TYR HD1  H   -2.954  -3.959   3.225 1.00 . A A .  13 TYR HD1  1 1 
        9  5100 1 1 13 TYR HD2  H   -4.259  -5.679  -0.441 1.00 . A A .  13 TYR HD2  1 1 
        9  5101 1 1 13 TYR HE1  H   -2.227  -6.173   4.012 1.00 . A A .  13 TYR HE1  1 1 
        9  5102 1 1 13 TYR HE2  H   -3.536  -7.898   0.336 1.00 . A A .  13 TYR HE2  1 1 
        9  5103 1 1 13 TYR HH   H   -2.746  -9.082   2.050 1.00 . A A .  13 TYR HH   1 1 
        9  5104 1 1 13 TYR N    N   -6.038  -3.537   2.343 1.00 . A A .  13 TYR N    1 1 
        9  5105 1 1 13 TYR O    O   -6.922  -1.516   0.752 1.00 . A A .  13 TYR O    1 1 
        9  5106 1 1 13 TYR OH   O   -2.432  -8.409   2.659 1.00 . A A .  13 TYR OH   1 1 
        9  5107 1 1 14 GLY C    C   -4.746   2.070   0.485 1.00 . A A .  14 GLY C    1 1 
        9  5108 1 1 14 GLY CA   C   -5.560   0.816   0.235 1.00 . A A .  14 GLY CA   1 1 
        9  5109 1 1 14 GLY H    H   -4.074  -0.337   1.208 1.00 . A A .  14 GLY H    1 1 
        9  5110 1 1 14 GLY HA2  H   -5.593   0.626  -0.827 1.00 . A A .  14 GLY HA2  1 1 
        9  5111 1 1 14 GLY HA3  H   -6.566   0.976   0.594 1.00 . A A .  14 GLY HA3  1 1 
        9  5112 1 1 14 GLY N    N   -5.005  -0.347   0.903 1.00 . A A .  14 GLY N    1 1 
        9  5113 1 1 14 GLY O    O   -4.941   2.757   1.488 1.00 . A A .  14 GLY O    1 1 
        9  5114 1 1 15 CYS C    C   -3.755   4.715   0.304 1.00 . A A .  15 CYS C    1 1 
        9  5115 1 1 15 CYS CA   C   -2.981   3.549  -0.304 1.00 . A A .  15 CYS CA   1 1 
        9  5116 1 1 15 CYS CB   C   -2.423   3.950  -1.671 1.00 . A A .  15 CYS CB   1 1 
        9  5117 1 1 15 CYS H    H   -3.720   1.784  -1.208 1.00 . A A .  15 CYS H    1 1 
        9  5118 1 1 15 CYS HA   H   -2.160   3.299   0.351 1.00 . A A .  15 CYS HA   1 1 
        9  5119 1 1 15 CYS HB2  H   -1.752   3.178  -2.018 1.00 . A A .  15 CYS HB2  1 1 
        9  5120 1 1 15 CYS HB3  H   -3.241   4.049  -2.369 1.00 . A A .  15 CYS HB3  1 1 
        9  5121 1 1 15 CYS N    N   -3.829   2.370  -0.429 1.00 . A A .  15 CYS N    1 1 
        9  5122 1 1 15 CYS O    O   -4.624   5.300  -0.342 1.00 . A A .  15 CYS O    1 1 
        9  5123 1 1 15 CYS SG   S   -1.503   5.522  -1.666 1.00 . A A .  15 CYS SG   1 1 
        9  5124 1 1 16 SER C    C   -3.385   7.462   1.996 1.00 . A A .  16 SER C    1 1 
        9  5125 1 1 16 SER CA   C   -4.102   6.139   2.247 1.00 . A A .  16 SER CA   1 1 
        9  5126 1 1 16 SER CB   C   -4.160   5.855   3.749 1.00 . A A .  16 SER CB   1 1 
        9  5127 1 1 16 SER H    H   -2.733   4.541   2.013 1.00 . A A .  16 SER H    1 1 
        9  5128 1 1 16 SER HA   H   -5.109   6.210   1.864 1.00 . A A .  16 SER HA   1 1 
        9  5129 1 1 16 SER HB2  H   -4.549   6.721   4.262 1.00 . A A .  16 SER HB2  1 1 
        9  5130 1 1 16 SER HB3  H   -4.808   5.009   3.928 1.00 . A A .  16 SER HB3  1 1 
        9  5131 1 1 16 SER HG   H   -2.937   5.375   5.203 1.00 . A A .  16 SER HG   1 1 
        9  5132 1 1 16 SER N    N   -3.434   5.046   1.551 1.00 . A A .  16 SER N    1 1 
        9  5133 1 1 16 SER O    O   -3.188   8.257   2.914 1.00 . A A .  16 SER O    1 1 
        9  5134 1 1 16 SER OG   O   -2.873   5.560   4.263 1.00 . A A .  16 SER OG   1 1 
        9  5135 1 1 17 GLU C    C   -2.945   9.555  -0.855 1.00 . A A .  17 GLU C    1 1 
        9  5136 1 1 17 GLU CA   C   -2.301   8.915   0.372 1.00 . A A .  17 GLU CA   1 1 
        9  5137 1 1 17 GLU CB   C   -0.825   8.625   0.094 1.00 . A A .  17 GLU CB   1 1 
        9  5138 1 1 17 GLU CD   C   -0.371   7.715   2.407 1.00 . A A .  17 GLU CD   1 1 
        9  5139 1 1 17 GLU CG   C    0.053   8.697   1.332 1.00 . A A .  17 GLU CG   1 1 
        9  5140 1 1 17 GLU H    H   -3.183   7.017   0.057 1.00 . A A .  17 GLU H    1 1 
        9  5141 1 1 17 GLU HA   H   -2.373   9.603   1.201 1.00 . A A .  17 GLU HA   1 1 
        9  5142 1 1 17 GLU HB2  H   -0.738   7.634  -0.327 1.00 . A A .  17 GLU HB2  1 1 
        9  5143 1 1 17 GLU HB3  H   -0.458   9.344  -0.623 1.00 . A A .  17 GLU HB3  1 1 
        9  5144 1 1 17 GLU HG2  H    1.072   8.479   1.049 1.00 . A A .  17 GLU HG2  1 1 
        9  5145 1 1 17 GLU HG3  H    0.000   9.697   1.738 1.00 . A A .  17 GLU HG3  1 1 
        9  5146 1 1 17 GLU N    N   -2.997   7.689   0.745 1.00 . A A .  17 GLU N    1 1 
        9  5147 1 1 17 GLU O    O   -3.306  10.732  -0.837 1.00 . A A .  17 GLU O    1 1 
        9  5148 1 1 17 GLU OE1  O   -0.925   6.653   2.053 1.00 . A A .  17 GLU OE1  1 1 
        9  5149 1 1 17 GLU OE2  O   -0.151   8.009   3.600 1.00 . A A .  17 GLU OE2  1 1 
        9  5150 1 1 18 CYS C    C   -5.064   8.648  -3.369 1.00 . A A .  18 CYS C    1 1 
        9  5151 1 1 18 CYS CA   C   -3.683   9.260  -3.155 1.00 . A A .  18 CYS CA   1 1 
        9  5152 1 1 18 CYS CB   C   -2.779   8.935  -4.346 1.00 . A A .  18 CYS CB   1 1 
        9  5153 1 1 18 CYS H    H   -2.776   7.841  -1.872 1.00 . A A .  18 CYS H    1 1 
        9  5154 1 1 18 CYS HA   H   -3.785  10.331  -3.074 1.00 . A A .  18 CYS HA   1 1 
        9  5155 1 1 18 CYS HB2  H   -3.189   9.394  -5.235 1.00 . A A .  18 CYS HB2  1 1 
        9  5156 1 1 18 CYS HB3  H   -1.794   9.338  -4.161 1.00 . A A .  18 CYS HB3  1 1 
        9  5157 1 1 18 CYS N    N   -3.084   8.772  -1.919 1.00 . A A .  18 CYS N    1 1 
        9  5158 1 1 18 CYS O    O   -6.010   9.340  -3.744 1.00 . A A .  18 CYS O    1 1 
        9  5159 1 1 18 CYS SG   S   -2.598   7.153  -4.679 1.00 . A A .  18 CYS SG   1 1 
        9  5160 1 1 19 GLY C    C   -6.339   5.476  -4.238 1.00 . A A .  19 GLY C    1 1 
        9  5161 1 1 19 GLY CA   C   -6.441   6.662  -3.299 1.00 . A A .  19 GLY CA   1 1 
        9  5162 1 1 19 GLY H    H   -4.384   6.844  -2.830 1.00 . A A .  19 GLY H    1 1 
        9  5163 1 1 19 GLY HA2  H   -6.785   6.317  -2.335 1.00 . A A .  19 GLY HA2  1 1 
        9  5164 1 1 19 GLY HA3  H   -7.162   7.361  -3.698 1.00 . A A .  19 GLY HA3  1 1 
        9  5165 1 1 19 GLY N    N   -5.173   7.345  -3.128 1.00 . A A .  19 GLY N    1 1 
        9  5166 1 1 19 GLY O    O   -7.190   5.288  -5.107 1.00 . A A .  19 GLY O    1 1 
        9  5167 1 1 20 LYS C    C   -5.068   2.228  -4.063 1.00 . A A .  20 LYS C    1 1 
        9  5168 1 1 20 LYS CA   C   -5.082   3.501  -4.903 1.00 . A A .  20 LYS CA   1 1 
        9  5169 1 1 20 LYS CB   C   -3.766   3.630  -5.673 1.00 . A A .  20 LYS CB   1 1 
        9  5170 1 1 20 LYS CD   C   -2.616   4.420  -7.762 1.00 . A A .  20 LYS CD   1 1 
        9  5171 1 1 20 LYS CE   C   -2.587   3.127  -8.562 1.00 . A A .  20 LYS CE   1 1 
        9  5172 1 1 20 LYS CG   C   -3.866   4.515  -6.903 1.00 . A A .  20 LYS CG   1 1 
        9  5173 1 1 20 LYS H    H   -4.649   4.877  -3.354 1.00 . A A .  20 LYS H    1 1 
        9  5174 1 1 20 LYS HA   H   -5.898   3.444  -5.607 1.00 . A A .  20 LYS HA   1 1 
        9  5175 1 1 20 LYS HB2  H   -3.017   4.046  -5.016 1.00 . A A .  20 LYS HB2  1 1 
        9  5176 1 1 20 LYS HB3  H   -3.450   2.646  -5.989 1.00 . A A .  20 LYS HB3  1 1 
        9  5177 1 1 20 LYS HD2  H   -2.596   5.255  -8.448 1.00 . A A .  20 LYS HD2  1 1 
        9  5178 1 1 20 LYS HD3  H   -1.746   4.458  -7.122 1.00 . A A .  20 LYS HD3  1 1 
        9  5179 1 1 20 LYS HE2  H   -2.999   2.335  -7.956 1.00 . A A .  20 LYS HE2  1 1 
        9  5180 1 1 20 LYS HE3  H   -3.191   3.254  -9.449 1.00 . A A .  20 LYS HE3  1 1 
        9  5181 1 1 20 LYS HG2  H   -4.718   4.205  -7.491 1.00 . A A .  20 LYS HG2  1 1 
        9  5182 1 1 20 LYS HG3  H   -3.998   5.541  -6.588 1.00 . A A .  20 LYS HG3  1 1 
        9  5183 1 1 20 LYS HZ1  H   -0.808   3.484  -9.598 1.00 . A A .  20 LYS HZ1  1 1 
        9  5184 1 1 20 LYS HZ2  H   -1.208   1.845  -9.468 1.00 . A A .  20 LYS HZ2  1 1 
        9  5185 1 1 20 LYS HZ3  H   -0.594   2.675  -8.128 1.00 . A A .  20 LYS HZ3  1 1 
        9  5186 1 1 20 LYS N    N   -5.294   4.675  -4.064 1.00 . A A .  20 LYS N    1 1 
        9  5187 1 1 20 LYS NZ   N   -1.202   2.757  -8.968 1.00 . A A .  20 LYS NZ   1 1 
        9  5188 1 1 20 LYS O    O   -4.346   2.135  -3.070 1.00 . A A .  20 LYS O    1 1 
        9  5189 1 1 21 ALA C    C   -5.307  -1.145  -4.563 1.00 . A A .  21 ALA C    1 1 
        9  5190 1 1 21 ALA CA   C   -5.947  -0.021  -3.754 1.00 . A A .  21 ALA CA   1 1 
        9  5191 1 1 21 ALA CB   C   -7.395  -0.358  -3.432 1.00 . A A .  21 ALA CB   1 1 
        9  5192 1 1 21 ALA H    H   -6.421   1.381  -5.267 1.00 . A A .  21 ALA H    1 1 
        9  5193 1 1 21 ALA HA   H   -5.412   0.088  -2.822 1.00 . A A .  21 ALA HA   1 1 
        9  5194 1 1 21 ALA HB1  H   -7.708   0.196  -2.560 1.00 . A A .  21 ALA HB1  1 1 
        9  5195 1 1 21 ALA HB2  H   -8.021  -0.092  -4.272 1.00 . A A .  21 ALA HB2  1 1 
        9  5196 1 1 21 ALA HB3  H   -7.483  -1.416  -3.237 1.00 . A A .  21 ALA HB3  1 1 
        9  5197 1 1 21 ALA N    N   -5.870   1.248  -4.468 1.00 . A A .  21 ALA N    1 1 
        9  5198 1 1 21 ALA O    O   -5.371  -1.153  -5.792 1.00 . A A .  21 ALA O    1 1 
        9  5199 1 1 22 PHE C    C   -4.575  -4.544  -3.983 1.00 . A A .  22 PHE C    1 1 
        9  5200 1 1 22 PHE CA   C   -4.037  -3.220  -4.517 1.00 . A A .  22 PHE CA   1 1 
        9  5201 1 1 22 PHE CB   C   -2.523  -3.151  -4.308 1.00 . A A .  22 PHE CB   1 1 
        9  5202 1 1 22 PHE CD1  C   -1.990  -0.725  -3.954 1.00 . A A .  22 PHE CD1  1 1 
        9  5203 1 1 22 PHE CD2  C   -1.267  -1.760  -5.977 1.00 . A A .  22 PHE CD2  1 1 
        9  5204 1 1 22 PHE CE1  C   -1.432   0.472  -4.362 1.00 . A A .  22 PHE CE1  1 1 
        9  5205 1 1 22 PHE CE2  C   -0.706  -0.566  -6.390 1.00 . A A .  22 PHE CE2  1 1 
        9  5206 1 1 22 PHE CG   C   -1.914  -1.853  -4.755 1.00 . A A .  22 PHE CG   1 1 
        9  5207 1 1 22 PHE CZ   C   -0.789   0.551  -5.582 1.00 . A A .  22 PHE CZ   1 1 
        9  5208 1 1 22 PHE H    H   -4.673  -2.030  -2.886 1.00 . A A .  22 PHE H    1 1 
        9  5209 1 1 22 PHE HA   H   -4.249  -3.159  -5.574 1.00 . A A .  22 PHE HA   1 1 
        9  5210 1 1 22 PHE HB2  H   -2.305  -3.275  -3.258 1.00 . A A .  22 PHE HB2  1 1 
        9  5211 1 1 22 PHE HB3  H   -2.053  -3.948  -4.865 1.00 . A A .  22 PHE HB3  1 1 
        9  5212 1 1 22 PHE HD1  H   -2.493  -0.786  -2.999 1.00 . A A .  22 PHE HD1  1 1 
        9  5213 1 1 22 PHE HD2  H   -1.202  -2.632  -6.610 1.00 . A A .  22 PHE HD2  1 1 
        9  5214 1 1 22 PHE HE1  H   -1.499   1.343  -3.728 1.00 . A A .  22 PHE HE1  1 1 
        9  5215 1 1 22 PHE HE2  H   -0.204  -0.507  -7.344 1.00 . A A .  22 PHE HE2  1 1 
        9  5216 1 1 22 PHE HZ   H   -0.351   1.485  -5.903 1.00 . A A .  22 PHE HZ   1 1 
        9  5217 1 1 22 PHE N    N   -4.690  -2.092  -3.864 1.00 . A A .  22 PHE N    1 1 
        9  5218 1 1 22 PHE O    O   -5.365  -4.570  -3.039 1.00 . A A .  22 PHE O    1 1 
        9  5219 1 1 23 SER C    C   -3.736  -7.491  -3.028 1.00 . A A .  23 SER C    1 1 
        9  5220 1 1 23 SER CA   C   -4.584  -6.970  -4.184 1.00 . A A .  23 SER CA   1 1 
        9  5221 1 1 23 SER CB   C   -4.511  -7.942  -5.364 1.00 . A A .  23 SER CB   1 1 
        9  5222 1 1 23 SER H    H   -3.513  -5.557  -5.341 1.00 . A A .  23 SER H    1 1 
        9  5223 1 1 23 SER HA   H   -5.610  -6.892  -3.856 1.00 . A A .  23 SER HA   1 1 
        9  5224 1 1 23 SER HB2  H   -5.201  -7.626  -6.131 1.00 . A A .  23 SER HB2  1 1 
        9  5225 1 1 23 SER HB3  H   -3.506  -7.946  -5.762 1.00 . A A .  23 SER HB3  1 1 
        9  5226 1 1 23 SER HG   H   -4.582  -9.880  -5.643 1.00 . A A .  23 SER HG   1 1 
        9  5227 1 1 23 SER N    N   -4.142  -5.642  -4.595 1.00 . A A .  23 SER N    1 1 
        9  5228 1 1 23 SER O    O   -4.261  -8.020  -2.048 1.00 . A A .  23 SER O    1 1 
        9  5229 1 1 23 SER OG   O   -4.847  -9.258  -4.961 1.00 . A A .  23 SER OG   1 1 
        9  5230 1 1 24 SER C    C   -0.815  -6.613  -1.437 1.00 . A A .  24 SER C    1 1 
        9  5231 1 1 24 SER CA   C   -1.499  -7.795  -2.117 1.00 . A A .  24 SER CA   1 1 
        9  5232 1 1 24 SER CB   C   -0.448  -8.729  -2.720 1.00 . A A .  24 SER CB   1 1 
        9  5233 1 1 24 SER H    H   -2.063  -6.907  -3.955 1.00 . A A .  24 SER H    1 1 
        9  5234 1 1 24 SER HA   H   -2.070  -8.339  -1.380 1.00 . A A .  24 SER HA   1 1 
        9  5235 1 1 24 SER HB2  H   -0.074  -8.301  -3.638 1.00 . A A .  24 SER HB2  1 1 
        9  5236 1 1 24 SER HB3  H    0.367  -8.849  -2.021 1.00 . A A .  24 SER HB3  1 1 
        9  5237 1 1 24 SER HG   H   -0.369 -10.521  -3.507 1.00 . A A .  24 SER HG   1 1 
        9  5238 1 1 24 SER N    N   -2.421  -7.337  -3.150 1.00 . A A .  24 SER N    1 1 
        9  5239 1 1 24 SER O    O   -0.554  -5.587  -2.064 1.00 . A A .  24 SER O    1 1 
        9  5240 1 1 24 SER OG   O   -1.000 -10.004  -3.002 1.00 . A A .  24 SER OG   1 1 
        9  5241 1 1 25 LYS C    C    1.369  -5.203  -0.105 1.00 . A A .  25 LYS C    1 1 
        9  5242 1 1 25 LYS CA   C    0.127  -5.713   0.620 1.00 . A A .  25 LYS CA   1 1 
        9  5243 1 1 25 LYS CB   C    0.510  -6.230   2.008 1.00 . A A .  25 LYS CB   1 1 
        9  5244 1 1 25 LYS CD   C    2.170  -5.948   3.872 1.00 . A A .  25 LYS CD   1 1 
        9  5245 1 1 25 LYS CE   C    1.376  -6.192   5.146 1.00 . A A .  25 LYS CE   1 1 
        9  5246 1 1 25 LYS CG   C    1.331  -5.243   2.819 1.00 . A A .  25 LYS CG   1 1 
        9  5247 1 1 25 LYS H    H   -0.761  -7.608   0.297 1.00 . A A .  25 LYS H    1 1 
        9  5248 1 1 25 LYS HA   H   -0.572  -4.898   0.728 1.00 . A A .  25 LYS HA   1 1 
        9  5249 1 1 25 LYS HB2  H   -0.392  -6.454   2.558 1.00 . A A .  25 LYS HB2  1 1 
        9  5250 1 1 25 LYS HB3  H    1.086  -7.138   1.895 1.00 . A A .  25 LYS HB3  1 1 
        9  5251 1 1 25 LYS HD2  H    2.501  -6.898   3.480 1.00 . A A .  25 LYS HD2  1 1 
        9  5252 1 1 25 LYS HD3  H    3.029  -5.334   4.106 1.00 . A A .  25 LYS HD3  1 1 
        9  5253 1 1 25 LYS HE2  H    0.399  -6.567   4.879 1.00 . A A .  25 LYS HE2  1 1 
        9  5254 1 1 25 LYS HE3  H    1.893  -6.930   5.741 1.00 . A A .  25 LYS HE3  1 1 
        9  5255 1 1 25 LYS HG2  H    1.988  -4.702   2.154 1.00 . A A .  25 LYS HG2  1 1 
        9  5256 1 1 25 LYS HG3  H    0.662  -4.550   3.310 1.00 . A A .  25 LYS HG3  1 1 
        9  5257 1 1 25 LYS HZ1  H    2.033  -4.322   5.803 1.00 . A A .  25 LYS HZ1  1 1 
        9  5258 1 1 25 LYS HZ2  H    1.145  -5.181   6.959 1.00 . A A .  25 LYS HZ2  1 1 
        9  5259 1 1 25 LYS HZ3  H    0.352  -4.445   5.659 1.00 . A A .  25 LYS HZ3  1 1 
        9  5260 1 1 25 LYS N    N   -0.528  -6.766  -0.149 1.00 . A A .  25 LYS N    1 1 
        9  5261 1 1 25 LYS NZ   N    1.215  -4.948   5.948 1.00 . A A .  25 LYS NZ   1 1 
        9  5262 1 1 25 LYS O    O    1.580  -3.996  -0.218 1.00 . A A .  25 LYS O    1 1 
        9  5263 1 1 26 SER C    C    3.114  -4.773  -2.421 1.00 . A A .  26 SER C    1 1 
        9  5264 1 1 26 SER CA   C    3.407  -5.774  -1.307 1.00 . A A .  26 SER CA   1 1 
        9  5265 1 1 26 SER CB   C    4.067  -7.025  -1.890 1.00 . A A .  26 SER CB   1 1 
        9  5266 1 1 26 SER H    H    1.962  -7.077  -0.472 1.00 . A A .  26 SER H    1 1 
        9  5267 1 1 26 SER HA   H    4.083  -5.318  -0.598 1.00 . A A .  26 SER HA   1 1 
        9  5268 1 1 26 SER HB2  H    4.772  -6.735  -2.653 1.00 . A A .  26 SER HB2  1 1 
        9  5269 1 1 26 SER HB3  H    4.585  -7.555  -1.104 1.00 . A A .  26 SER HB3  1 1 
        9  5270 1 1 26 SER HG   H    2.876  -7.578  -3.343 1.00 . A A .  26 SER HG   1 1 
        9  5271 1 1 26 SER N    N    2.185  -6.130  -0.595 1.00 . A A .  26 SER N    1 1 
        9  5272 1 1 26 SER O    O    3.802  -3.761  -2.558 1.00 . A A .  26 SER O    1 1 
        9  5273 1 1 26 SER OG   O    3.102  -7.889  -2.464 1.00 . A A .  26 SER OG   1 1 
        9  5274 1 1 27 TYR C    C    1.486  -2.762  -3.832 1.00 . A A .  27 TYR C    1 1 
        9  5275 1 1 27 TYR CA   C    1.706  -4.192  -4.318 1.00 . A A .  27 TYR CA   1 1 
        9  5276 1 1 27 TYR CB   C    0.435  -4.715  -4.990 1.00 . A A .  27 TYR CB   1 1 
        9  5277 1 1 27 TYR CD1  C    1.587  -5.366  -7.141 1.00 . A A .  27 TYR CD1  1 1 
        9  5278 1 1 27 TYR CD2  C    0.071  -6.923  -6.160 1.00 . A A .  27 TYR CD2  1 1 
        9  5279 1 1 27 TYR CE1  C    1.833  -6.250  -8.174 1.00 . A A .  27 TYR CE1  1 1 
        9  5280 1 1 27 TYR CE2  C    0.313  -7.813  -7.189 1.00 . A A .  27 TYR CE2  1 1 
        9  5281 1 1 27 TYR CG   C    0.702  -5.685  -6.118 1.00 . A A .  27 TYR CG   1 1 
        9  5282 1 1 27 TYR CZ   C    1.194  -7.472  -8.193 1.00 . A A .  27 TYR CZ   1 1 
        9  5283 1 1 27 TYR H    H    1.578  -5.885  -3.054 1.00 . A A .  27 TYR H    1 1 
        9  5284 1 1 27 TYR HA   H    2.510  -4.196  -5.038 1.00 . A A .  27 TYR HA   1 1 
        9  5285 1 1 27 TYR HB2  H   -0.171  -5.221  -4.255 1.00 . A A .  27 TYR HB2  1 1 
        9  5286 1 1 27 TYR HB3  H   -0.119  -3.881  -5.394 1.00 . A A .  27 TYR HB3  1 1 
        9  5287 1 1 27 TYR HD1  H    2.086  -4.408  -7.123 1.00 . A A .  27 TYR HD1  1 1 
        9  5288 1 1 27 TYR HD2  H   -0.619  -7.187  -5.372 1.00 . A A .  27 TYR HD2  1 1 
        9  5289 1 1 27 TYR HE1  H    2.524  -5.983  -8.960 1.00 . A A .  27 TYR HE1  1 1 
        9  5290 1 1 27 TYR HE2  H   -0.188  -8.770  -7.205 1.00 . A A .  27 TYR HE2  1 1 
        9  5291 1 1 27 TYR HH   H    1.839  -9.153  -8.867 1.00 . A A .  27 TYR HH   1 1 
        9  5292 1 1 27 TYR N    N    2.089  -5.064  -3.214 1.00 . A A .  27 TYR N    1 1 
        9  5293 1 1 27 TYR O    O    1.787  -1.801  -4.541 1.00 . A A .  27 TYR O    1 1 
        9  5294 1 1 27 TYR OH   O    1.438  -8.355  -9.220 1.00 . A A .  27 TYR OH   1 1 
        9  5295 1 1 28 LEU C    C    2.002  -0.641  -1.619 1.00 . A A .  28 LEU C    1 1 
        9  5296 1 1 28 LEU CA   C    0.701  -1.319  -2.036 1.00 . A A .  28 LEU CA   1 1 
        9  5297 1 1 28 LEU CB   C   -0.229  -1.451  -0.829 1.00 . A A .  28 LEU CB   1 1 
        9  5298 1 1 28 LEU CD1  C   -0.983   0.934  -0.661 1.00 . A A .  28 LEU CD1  1 1 
        9  5299 1 1 28 LEU CD2  C   -1.106  -0.557   1.343 1.00 . A A .  28 LEU CD2  1 1 
        9  5300 1 1 28 LEU CG   C   -0.330  -0.224   0.078 1.00 . A A .  28 LEU CG   1 1 
        9  5301 1 1 28 LEU H    H    0.742  -3.434  -2.103 1.00 . A A .  28 LEU H    1 1 
        9  5302 1 1 28 LEU HA   H    0.218  -0.712  -2.788 1.00 . A A .  28 LEU HA   1 1 
        9  5303 1 1 28 LEU HB2  H   -1.219  -1.672  -1.196 1.00 . A A .  28 LEU HB2  1 1 
        9  5304 1 1 28 LEU HB3  H    0.125  -2.278  -0.229 1.00 . A A .  28 LEU HB3  1 1 
        9  5305 1 1 28 LEU HD11 H   -1.968   1.109  -0.257 1.00 . A A .  28 LEU HD11 1 1 
        9  5306 1 1 28 LEU HD12 H   -1.063   0.691  -1.711 1.00 . A A .  28 LEU HD12 1 1 
        9  5307 1 1 28 LEU HD13 H   -0.381   1.823  -0.542 1.00 . A A .  28 LEU HD13 1 1 
        9  5308 1 1 28 LEU HD21 H   -1.458   0.355   1.800 1.00 . A A .  28 LEU HD21 1 1 
        9  5309 1 1 28 LEU HD22 H   -0.462  -1.081   2.033 1.00 . A A .  28 LEU HD22 1 1 
        9  5310 1 1 28 LEU HD23 H   -1.950  -1.184   1.092 1.00 . A A .  28 LEU HD23 1 1 
        9  5311 1 1 28 LEU HG   H    0.666   0.085   0.367 1.00 . A A .  28 LEU HG   1 1 
        9  5312 1 1 28 LEU N    N    0.961  -2.631  -2.619 1.00 . A A .  28 LEU N    1 1 
        9  5313 1 1 28 LEU O    O    2.226   0.532  -1.919 1.00 . A A .  28 LEU O    1 1 
        9  5314 1 1 29 ILE C    C    4.936  -0.277  -1.635 1.00 . A A .  29 ILE C    1 1 
        9  5315 1 1 29 ILE CA   C    4.137  -0.859  -0.473 1.00 . A A .  29 ILE CA   1 1 
        9  5316 1 1 29 ILE CB   C    4.980  -1.946   0.221 1.00 . A A .  29 ILE CB   1 1 
        9  5317 1 1 29 ILE CD1  C    4.825  -3.798   1.959 1.00 . A A .  29 ILE CD1  1 1 
        9  5318 1 1 29 ILE CG1  C    4.224  -2.519   1.422 1.00 . A A .  29 ILE CG1  1 1 
        9  5319 1 1 29 ILE CG2  C    6.322  -1.377   0.656 1.00 . A A .  29 ILE CG2  1 1 
        9  5320 1 1 29 ILE H    H    2.622  -2.315  -0.720 1.00 . A A .  29 ILE H    1 1 
        9  5321 1 1 29 ILE HA   H    3.938  -0.074   0.242 1.00 . A A .  29 ILE HA   1 1 
        9  5322 1 1 29 ILE HB   H    5.164  -2.736  -0.490 1.00 . A A .  29 ILE HB   1 1 
        9  5323 1 1 29 ILE HD11 H    5.773  -3.581   2.429 1.00 . A A .  29 ILE HD11 1 1 
        9  5324 1 1 29 ILE HD12 H    4.155  -4.233   2.687 1.00 . A A .  29 ILE HD12 1 1 
        9  5325 1 1 29 ILE HD13 H    4.977  -4.494   1.148 1.00 . A A .  29 ILE HD13 1 1 
        9  5326 1 1 29 ILE HG12 H    4.223  -1.792   2.219 1.00 . A A .  29 ILE HG12 1 1 
        9  5327 1 1 29 ILE HG13 H    3.204  -2.727   1.129 1.00 . A A .  29 ILE HG13 1 1 
        9  5328 1 1 29 ILE HG21 H    7.113  -1.855   0.098 1.00 . A A .  29 ILE HG21 1 1 
        9  5329 1 1 29 ILE HG22 H    6.341  -0.314   0.467 1.00 . A A .  29 ILE HG22 1 1 
        9  5330 1 1 29 ILE HG23 H    6.466  -1.558   1.711 1.00 . A A .  29 ILE HG23 1 1 
        9  5331 1 1 29 ILE N    N    2.857  -1.388  -0.928 1.00 . A A .  29 ILE N    1 1 
        9  5332 1 1 29 ILE O    O    5.354   0.880  -1.595 1.00 . A A .  29 ILE O    1 1 
        9  5333 1 1 30 ILE C    C    5.407   0.715  -4.323 1.00 . A A .  30 ILE C    1 1 
        9  5334 1 1 30 ILE CA   C    5.887  -0.651  -3.842 1.00 . A A .  30 ILE CA   1 1 
        9  5335 1 1 30 ILE CB   C    5.761  -1.662  -4.997 1.00 . A A .  30 ILE CB   1 1 
        9  5336 1 1 30 ILE CD1  C    5.801  -4.166  -5.455 1.00 . A A .  30 ILE CD1  1 1 
        9  5337 1 1 30 ILE CG1  C    6.257  -3.040  -4.554 1.00 . A A .  30 ILE CG1  1 1 
        9  5338 1 1 30 ILE CG2  C    6.538  -1.179  -6.212 1.00 . A A .  30 ILE CG2  1 1 
        9  5339 1 1 30 ILE H    H    4.783  -1.998  -2.641 1.00 . A A .  30 ILE H    1 1 
        9  5340 1 1 30 ILE HA   H    6.929  -0.578  -3.567 1.00 . A A .  30 ILE HA   1 1 
        9  5341 1 1 30 ILE HB   H    4.719  -1.734  -5.271 1.00 . A A .  30 ILE HB   1 1 
        9  5342 1 1 30 ILE HD11 H    5.784  -5.090  -4.896 1.00 . A A .  30 ILE HD11 1 1 
        9  5343 1 1 30 ILE HD12 H    4.809  -3.952  -5.825 1.00 . A A .  30 ILE HD12 1 1 
        9  5344 1 1 30 ILE HD13 H    6.483  -4.261  -6.286 1.00 . A A .  30 ILE HD13 1 1 
        9  5345 1 1 30 ILE HG12 H    7.336  -3.041  -4.543 1.00 . A A .  30 ILE HG12 1 1 
        9  5346 1 1 30 ILE HG13 H    5.892  -3.242  -3.557 1.00 . A A .  30 ILE HG13 1 1 
        9  5347 1 1 30 ILE HG21 H    6.336  -1.829  -7.051 1.00 . A A .  30 ILE HG21 1 1 
        9  5348 1 1 30 ILE HG22 H    6.232  -0.172  -6.457 1.00 . A A .  30 ILE HG22 1 1 
        9  5349 1 1 30 ILE HG23 H    7.594  -1.192  -5.993 1.00 . A A .  30 ILE HG23 1 1 
        9  5350 1 1 30 ILE N    N    5.141  -1.086  -2.668 1.00 . A A .  30 ILE N    1 1 
        9  5351 1 1 30 ILE O    O    6.207   1.557  -4.732 1.00 . A A .  30 ILE O    1 1 
        9  5352 1 1 31 HIS C    C    3.858   3.311  -3.720 1.00 . A A .  31 HIS C    1 1 
        9  5353 1 1 31 HIS CA   C    3.509   2.192  -4.697 1.00 . A A .  31 HIS CA   1 1 
        9  5354 1 1 31 HIS CB   C    1.990   2.059  -4.817 1.00 . A A .  31 HIS CB   1 1 
        9  5355 1 1 31 HIS CD2  C    0.683   4.193  -4.135 1.00 . A A .  31 HIS CD2  1 1 
        9  5356 1 1 31 HIS CE1  C    0.491   5.100  -6.122 1.00 . A A .  31 HIS CE1  1 1 
        9  5357 1 1 31 HIS CG   C    1.289   3.367  -5.019 1.00 . A A .  31 HIS CG   1 1 
        9  5358 1 1 31 HIS H    H    3.510   0.217  -3.934 1.00 . A A .  31 HIS H    1 1 
        9  5359 1 1 31 HIS HA   H    3.917   2.437  -5.666 1.00 . A A .  31 HIS HA   1 1 
        9  5360 1 1 31 HIS HB2  H    1.757   1.424  -5.658 1.00 . A A .  31 HIS HB2  1 1 
        9  5361 1 1 31 HIS HB3  H    1.602   1.610  -3.914 1.00 . A A .  31 HIS HB3  1 1 
        9  5362 1 1 31 HIS HD1  H    1.486   3.606  -7.103 1.00 . A A .  31 HIS HD1  1 1 
        9  5363 1 1 31 HIS HD2  H    0.599   4.041  -3.068 1.00 . A A .  31 HIS HD2  1 1 
        9  5364 1 1 31 HIS HE1  H    0.235   5.781  -6.920 1.00 . A A .  31 HIS HE1  1 1 
        9  5365 1 1 31 HIS N    N    4.096   0.928  -4.269 1.00 . A A .  31 HIS N    1 1 
        9  5366 1 1 31 HIS ND1  N    1.150   3.963  -6.255 1.00 . A A .  31 HIS ND1  1 1 
        9  5367 1 1 31 HIS NE2  N    0.195   5.263  -4.845 1.00 . A A .  31 HIS NE2  1 1 
        9  5368 1 1 31 HIS O    O    4.286   4.391  -4.126 1.00 . A A .  31 HIS O    1 1 
        9  5369 1 1 32 MET C    C    5.373   4.592  -1.569 1.00 . A A .  32 MET C    1 1 
        9  5370 1 1 32 MET CA   C    3.966   4.029  -1.397 1.00 . A A .  32 MET CA   1 1 
        9  5371 1 1 32 MET CB   C    3.821   3.402  -0.010 1.00 . A A .  32 MET CB   1 1 
        9  5372 1 1 32 MET CE   C    1.276   5.103   1.668 1.00 . A A .  32 MET CE   1 1 
        9  5373 1 1 32 MET CG   C    2.402   2.963   0.314 1.00 . A A .  32 MET CG   1 1 
        9  5374 1 1 32 MET H    H    3.326   2.165  -2.169 1.00 . A A .  32 MET H    1 1 
        9  5375 1 1 32 MET HA   H    3.254   4.835  -1.494 1.00 . A A .  32 MET HA   1 1 
        9  5376 1 1 32 MET HB2  H    4.465   2.537   0.051 1.00 . A A .  32 MET HB2  1 1 
        9  5377 1 1 32 MET HB3  H    4.129   4.123   0.733 1.00 . A A .  32 MET HB3  1 1 
        9  5378 1 1 32 MET HE1  H    0.386   4.873   2.236 1.00 . A A .  32 MET HE1  1 1 
        9  5379 1 1 32 MET HE2  H    2.146   4.760   2.207 1.00 . A A .  32 MET HE2  1 1 
        9  5380 1 1 32 MET HE3  H    1.342   6.171   1.520 1.00 . A A .  32 MET HE3  1 1 
        9  5381 1 1 32 MET HG2  H    2.139   2.137  -0.330 1.00 . A A .  32 MET HG2  1 1 
        9  5382 1 1 32 MET HG3  H    2.366   2.641   1.344 1.00 . A A .  32 MET HG3  1 1 
        9  5383 1 1 32 MET N    N    3.670   3.045  -2.432 1.00 . A A .  32 MET N    1 1 
        9  5384 1 1 32 MET O    O    5.653   5.723  -1.170 1.00 . A A .  32 MET O    1 1 
        9  5385 1 1 32 MET SD   S    1.196   4.283   0.078 1.00 . A A .  32 MET SD   1 1 
        9  5386 1 1 33 ARG C    C    7.691   5.659  -2.878 1.00 . A A .  33 ARG C    1 1 
        9  5387 1 1 33 ARG CA   C    7.634   4.215  -2.387 1.00 . A A .  33 ARG CA   1 1 
        9  5388 1 1 33 ARG CB   C    8.313   3.293  -3.401 1.00 . A A .  33 ARG CB   1 1 
        9  5389 1 1 33 ARG CD   C    9.526   1.767  -1.815 1.00 . A A .  33 ARG CD   1 1 
        9  5390 1 1 33 ARG CG   C    8.476   1.864  -2.911 1.00 . A A .  33 ARG CG   1 1 
        9  5391 1 1 33 ARG CZ   C   11.527   0.827  -2.890 1.00 . A A .  33 ARG CZ   1 1 
        9  5392 1 1 33 ARG H    H    5.973   2.906  -2.460 1.00 . A A .  33 ARG H    1 1 
        9  5393 1 1 33 ARG HA   H    8.158   4.147  -1.445 1.00 . A A .  33 ARG HA   1 1 
        9  5394 1 1 33 ARG HB2  H    7.721   3.275  -4.305 1.00 . A A .  33 ARG HB2  1 1 
        9  5395 1 1 33 ARG HB3  H    9.292   3.687  -3.629 1.00 . A A .  33 ARG HB3  1 1 
        9  5396 1 1 33 ARG HD2  H    9.372   2.575  -1.115 1.00 . A A .  33 ARG HD2  1 1 
        9  5397 1 1 33 ARG HD3  H    9.409   0.823  -1.306 1.00 . A A .  33 ARG HD3  1 1 
        9  5398 1 1 33 ARG HE   H   11.335   2.722  -2.298 1.00 . A A .  33 ARG HE   1 1 
        9  5399 1 1 33 ARG HG2  H    7.531   1.516  -2.520 1.00 . A A .  33 ARG HG2  1 1 
        9  5400 1 1 33 ARG HG3  H    8.776   1.241  -3.741 1.00 . A A .  33 ARG HG3  1 1 
        9  5401 1 1 33 ARG HH11 H   10.011  -0.481  -2.624 1.00 . A A .  33 ARG HH11 1 1 
        9  5402 1 1 33 ARG HH12 H   11.428  -1.131  -3.381 1.00 . A A .  33 ARG HH12 1 1 
        9  5403 1 1 33 ARG HH21 H   13.206   1.878  -3.294 1.00 . A A .  33 ARG HH21 1 1 
        9  5404 1 1 33 ARG HH22 H   13.245   0.212  -3.761 1.00 . A A .  33 ARG HH22 1 1 
        9  5405 1 1 33 ARG N    N    6.256   3.796  -2.164 1.00 . A A .  33 ARG N    1 1 
        9  5406 1 1 33 ARG NE   N   10.883   1.855  -2.348 1.00 . A A .  33 ARG NE   1 1 
        9  5407 1 1 33 ARG NH1  N   10.941  -0.359  -2.971 1.00 . A A .  33 ARG NH1  1 1 
        9  5408 1 1 33 ARG NH2  N   12.761   0.985  -3.353 1.00 . A A .  33 ARG NH2  1 1 
        9  5409 1 1 33 ARG O    O    8.567   6.428  -2.480 1.00 . A A .  33 ARG O    1 1 
        9  5410 1 1 34 THR C    C    6.258   8.375  -3.233 1.00 . A A .  34 THR C    1 1 
        9  5411 1 1 34 THR CA   C    6.696   7.371  -4.292 1.00 . A A .  34 THR CA   1 1 
        9  5412 1 1 34 THR CB   C    5.731   7.452  -5.490 1.00 . A A .  34 THR CB   1 1 
        9  5413 1 1 34 THR CG2  C    6.218   6.580  -6.638 1.00 . A A .  34 THR CG2  1 1 
        9  5414 1 1 34 THR H    H    6.081   5.363  -4.024 1.00 . A A .  34 THR H    1 1 
        9  5415 1 1 34 THR HA   H    7.686   7.633  -4.636 1.00 . A A .  34 THR HA   1 1 
        9  5416 1 1 34 THR HB   H    5.688   8.477  -5.830 1.00 . A A .  34 THR HB   1 1 
        9  5417 1 1 34 THR HG1  H    3.764   7.599  -5.512 1.00 . A A .  34 THR HG1  1 1 
        9  5418 1 1 34 THR HG21 H    6.787   5.752  -6.243 1.00 . A A .  34 THR HG21 1 1 
        9  5419 1 1 34 THR HG22 H    6.843   7.166  -7.295 1.00 . A A .  34 THR HG22 1 1 
        9  5420 1 1 34 THR HG23 H    5.369   6.203  -7.189 1.00 . A A .  34 THR HG23 1 1 
        9  5421 1 1 34 THR N    N    6.752   6.021  -3.746 1.00 . A A .  34 THR N    1 1 
        9  5422 1 1 34 THR O    O    6.909   9.401  -3.028 1.00 . A A .  34 THR O    1 1 
        9  5423 1 1 34 THR OG1  O    4.419   7.037  -5.092 1.00 . A A .  34 THR OG1  1 1 
        9  5424 1 1 35 HIS C    C    5.659   9.163  -0.416 1.00 . A A .  35 HIS C    1 1 
        9  5425 1 1 35 HIS CA   C    4.627   8.952  -1.519 1.00 . A A .  35 HIS CA   1 1 
        9  5426 1 1 35 HIS CB   C    3.344   8.368  -0.929 1.00 . A A .  35 HIS CB   1 1 
        9  5427 1 1 35 HIS CD2  C    1.252   7.521  -2.208 1.00 . A A .  35 HIS CD2  1 1 
        9  5428 1 1 35 HIS CE1  C    0.749   9.376  -3.263 1.00 . A A .  35 HIS CE1  1 1 
        9  5429 1 1 35 HIS CG   C    2.167   8.453  -1.852 1.00 . A A .  35 HIS CG   1 1 
        9  5430 1 1 35 HIS H    H    4.677   7.244  -2.768 1.00 . A A .  35 HIS H    1 1 
        9  5431 1 1 35 HIS HA   H    4.403   9.906  -1.972 1.00 . A A .  35 HIS HA   1 1 
        9  5432 1 1 35 HIS HB2  H    3.505   7.327  -0.694 1.00 . A A .  35 HIS HB2  1 1 
        9  5433 1 1 35 HIS HB3  H    3.096   8.903  -0.023 1.00 . A A .  35 HIS HB3  1 1 
        9  5434 1 1 35 HIS HD1  H    2.298  10.459  -2.481 1.00 . A A .  35 HIS HD1  1 1 
        9  5435 1 1 35 HIS HD2  H    1.213   6.497  -1.866 1.00 . A A .  35 HIS HD2  1 1 
        9  5436 1 1 35 HIS HE1  H    0.254  10.094  -3.899 1.00 . A A .  35 HIS HE1  1 1 
        9  5437 1 1 35 HIS N    N    5.151   8.075  -2.560 1.00 . A A .  35 HIS N    1 1 
        9  5438 1 1 35 HIS ND1  N    1.824   9.603  -2.531 1.00 . A A .  35 HIS ND1  1 1 
        9  5439 1 1 35 HIS NE2  N    0.382   8.120  -3.086 1.00 . A A .  35 HIS NE2  1 1 
        9  5440 1 1 35 HIS O    O    6.023  10.296  -0.100 1.00 . A A .  35 HIS O    1 1 
        9  5441 1 1 36 SER C    C    8.402   8.784   0.754 1.00 . A A .  36 SER C    1 1 
        9  5442 1 1 36 SER CA   C    7.113   8.128   1.240 1.00 . A A .  36 SER CA   1 1 
        9  5443 1 1 36 SER CB   C    7.411   6.725   1.772 1.00 . A A .  36 SER CB   1 1 
        9  5444 1 1 36 SER H    H    5.798   7.189  -0.128 1.00 . A A .  36 SER H    1 1 
        9  5445 1 1 36 SER HA   H    6.698   8.726   2.038 1.00 . A A .  36 SER HA   1 1 
        9  5446 1 1 36 SER HB2  H    8.130   6.793   2.575 1.00 . A A .  36 SER HB2  1 1 
        9  5447 1 1 36 SER HB3  H    6.498   6.283   2.143 1.00 . A A .  36 SER HB3  1 1 
        9  5448 1 1 36 SER HG   H    7.735   4.978   0.948 1.00 . A A .  36 SER HG   1 1 
        9  5449 1 1 36 SER N    N    6.126   8.064   0.168 1.00 . A A .  36 SER N    1 1 
        9  5450 1 1 36 SER O    O    9.113   8.234  -0.086 1.00 . A A .  36 SER O    1 1 
        9  5451 1 1 36 SER OG   O    7.941   5.895   0.753 1.00 . A A .  36 SER OG   1 1 
        9  5452 1 1 37 GLY C    C   10.073  11.979   1.656 1.00 . A A .  37 GLY C    1 1 
        9  5453 1 1 37 GLY CA   C    9.897  10.679   0.897 1.00 . A A .  37 GLY CA   1 1 
        9  5454 1 1 37 GLY H    H    8.091  10.357   1.953 1.00 . A A .  37 GLY H    1 1 
        9  5455 1 1 37 GLY HA2  H   10.754  10.047   1.082 1.00 . A A .  37 GLY HA2  1 1 
        9  5456 1 1 37 GLY HA3  H    9.845  10.897  -0.160 1.00 . A A .  37 GLY HA3  1 1 
        9  5457 1 1 37 GLY N    N    8.695   9.966   1.288 1.00 . A A .  37 GLY N    1 1 
        9  5458 1 1 37 GLY O    O   10.459  12.994   1.078 1.00 . A A .  37 GLY O    1 1 
        9  5459 1 1 38 GLU C    C   10.680  12.818   5.072 1.00 . A A .  38 GLU C    1 1 
        9  5460 1 1 38 GLU CA   C    9.914  13.135   3.791 1.00 . A A .  38 GLU CA   1 1 
        9  5461 1 1 38 GLU CB   C    8.531  13.693   4.136 1.00 . A A .  38 GLU CB   1 1 
        9  5462 1 1 38 GLU CD   C    7.241  14.027   1.990 1.00 . A A .  38 GLU CD   1 1 
        9  5463 1 1 38 GLU CG   C    8.007  14.692   3.118 1.00 . A A .  38 GLU CG   1 1 
        9  5464 1 1 38 GLU H    H    9.484  11.108   3.357 1.00 . A A .  38 GLU H    1 1 
        9  5465 1 1 38 GLU HA   H   10.462  13.878   3.233 1.00 . A A .  38 GLU HA   1 1 
        9  5466 1 1 38 GLU HB2  H    7.831  12.873   4.200 1.00 . A A .  38 GLU HB2  1 1 
        9  5467 1 1 38 GLU HB3  H    8.585  14.185   5.096 1.00 . A A .  38 GLU HB3  1 1 
        9  5468 1 1 38 GLU HG2  H    7.349  15.386   3.619 1.00 . A A .  38 GLU HG2  1 1 
        9  5469 1 1 38 GLU HG3  H    8.843  15.230   2.697 1.00 . A A .  38 GLU HG3  1 1 
        9  5470 1 1 38 GLU N    N    9.787  11.948   2.954 1.00 . A A .  38 GLU N    1 1 
        9  5471 1 1 38 GLU O    O   10.317  13.275   6.156 1.00 . A A .  38 GLU O    1 1 
        9  5472 1 1 38 GLU OE1  O    6.076  13.637   2.215 1.00 . A A .  38 GLU OE1  1 1 
        9  5473 1 1 38 GLU OE2  O    7.806  13.897   0.885 1.00 . A A .  38 GLU OE2  1 1 
        9  5474 1 1 39 LYS C    C   11.690  11.272   7.276 1.00 . A A .  39 LYS C    1 1 
        9  5475 1 1 39 LYS CA   C   12.562  11.652   6.084 1.00 . A A .  39 LYS CA   1 1 
        9  5476 1 1 39 LYS CB   C   13.499  12.799   6.469 1.00 . A A .  39 LYS CB   1 1 
        9  5477 1 1 39 LYS CD   C   15.757  13.494   7.323 1.00 . A A .  39 LYS CD   1 1 
        9  5478 1 1 39 LYS CE   C   16.804  13.161   8.375 1.00 . A A .  39 LYS CE   1 1 
        9  5479 1 1 39 LYS CG   C   14.798  12.336   7.105 1.00 . A A .  39 LYS CG   1 1 
        9  5480 1 1 39 LYS H    H   11.982  11.698   4.049 1.00 . A A .  39 LYS H    1 1 
        9  5481 1 1 39 LYS HA   H   13.154  10.795   5.799 1.00 . A A .  39 LYS HA   1 1 
        9  5482 1 1 39 LYS HB2  H   13.739  13.365   5.581 1.00 . A A .  39 LYS HB2  1 1 
        9  5483 1 1 39 LYS HB3  H   12.989  13.444   7.170 1.00 . A A .  39 LYS HB3  1 1 
        9  5484 1 1 39 LYS HD2  H   16.256  13.717   6.392 1.00 . A A .  39 LYS HD2  1 1 
        9  5485 1 1 39 LYS HD3  H   15.195  14.359   7.649 1.00 . A A .  39 LYS HD3  1 1 
        9  5486 1 1 39 LYS HE2  H   17.413  14.035   8.547 1.00 . A A .  39 LYS HE2  1 1 
        9  5487 1 1 39 LYS HE3  H   16.301  12.887   9.291 1.00 . A A .  39 LYS HE3  1 1 
        9  5488 1 1 39 LYS HG2  H   14.579  11.880   8.060 1.00 . A A .  39 LYS HG2  1 1 
        9  5489 1 1 39 LYS HG3  H   15.267  11.610   6.457 1.00 . A A .  39 LYS HG3  1 1 
        9  5490 1 1 39 LYS HZ1  H   17.779  12.032   6.913 1.00 . A A .  39 LYS HZ1  1 1 
        9  5491 1 1 39 LYS HZ2  H   17.270  11.129   8.250 1.00 . A A .  39 LYS HZ2  1 1 
        9  5492 1 1 39 LYS HZ3  H   18.624  12.136   8.374 1.00 . A A .  39 LYS HZ3  1 1 
        9  5493 1 1 39 LYS N    N   11.743  12.031   4.939 1.00 . A A .  39 LYS N    1 1 
        9  5494 1 1 39 LYS NZ   N   17.681  12.036   7.948 1.00 . A A .  39 LYS NZ   1 1 
        9  5495 1 1 39 LYS O    O   11.842  11.797   8.380 1.00 . A A .  39 LYS O    1 1 
        9  5496 1 1 40 PRO C    C   10.553   9.037   9.160 1.00 . A A .  40 PRO C    1 1 
        9  5497 1 1 40 PRO CA   C    9.840   9.866   8.097 1.00 . A A .  40 PRO CA   1 1 
        9  5498 1 1 40 PRO CB   C    8.838   9.001   7.327 1.00 . A A .  40 PRO CB   1 1 
        9  5499 1 1 40 PRO CD   C   10.517   9.669   5.762 1.00 . A A .  40 PRO CD   1 1 
        9  5500 1 1 40 PRO CG   C    9.580   8.548   6.117 1.00 . A A .  40 PRO CG   1 1 
        9  5501 1 1 40 PRO HA   H    9.321  10.686   8.570 1.00 . A A .  40 PRO HA   1 1 
        9  5502 1 1 40 PRO HB2  H    8.535   8.165   7.942 1.00 . A A .  40 PRO HB2  1 1 
        9  5503 1 1 40 PRO HB3  H    7.975   9.593   7.063 1.00 . A A .  40 PRO HB3  1 1 
        9  5504 1 1 40 PRO HD2  H   11.437   9.277   5.355 1.00 . A A .  40 PRO HD2  1 1 
        9  5505 1 1 40 PRO HD3  H   10.049  10.343   5.059 1.00 . A A .  40 PRO HD3  1 1 
        9  5506 1 1 40 PRO HG2  H   10.137   7.651   6.342 1.00 . A A .  40 PRO HG2  1 1 
        9  5507 1 1 40 PRO HG3  H    8.887   8.368   5.309 1.00 . A A .  40 PRO HG3  1 1 
        9  5508 1 1 40 PRO N    N   10.754  10.338   7.052 1.00 . A A .  40 PRO N    1 1 
        9  5509 1 1 40 PRO O    O   10.402   9.282  10.356 1.00 . A A .  40 PRO O    1 1 
        9  5510 1 1 41 SER C    C   13.570   7.391   9.479 1.00 . A A .  41 SER C    1 1 
        9  5511 1 1 41 SER CA   C   12.066   7.188   9.629 1.00 . A A .  41 SER CA   1 1 
        9  5512 1 1 41 SER CB   C   11.709   5.723   9.372 1.00 . A A .  41 SER CB   1 1 
        9  5513 1 1 41 SER H    H   11.411   7.910   7.749 1.00 . A A .  41 SER H    1 1 
        9  5514 1 1 41 SER HA   H   11.778   7.449  10.636 1.00 . A A .  41 SER HA   1 1 
        9  5515 1 1 41 SER HB2  H   10.648   5.584   9.509 1.00 . A A .  41 SER HB2  1 1 
        9  5516 1 1 41 SER HB3  H   11.978   5.462   8.358 1.00 . A A .  41 SER HB3  1 1 
        9  5517 1 1 41 SER HG   H   13.203   5.298  10.566 1.00 . A A .  41 SER HG   1 1 
        9  5518 1 1 41 SER N    N   11.331   8.055   8.715 1.00 . A A .  41 SER N    1 1 
        9  5519 1 1 41 SER O    O   14.067   7.654   8.384 1.00 . A A .  41 SER O    1 1 
        9  5520 1 1 41 SER OG   O   12.401   4.866  10.263 1.00 . A A .  41 SER OG   1 1 
        9  5521 1 1 42 GLY C    C   16.475   6.118  10.563 1.00 . A A .  42 GLY C    1 1 
        9  5522 1 1 42 GLY CA   C   15.732   7.439  10.561 1.00 . A A .  42 GLY CA   1 1 
        9  5523 1 1 42 GLY H    H   13.841   7.056  11.434 1.00 . A A .  42 GLY H    1 1 
        9  5524 1 1 42 GLY HA2  H   16.001   7.990   9.673 1.00 . A A .  42 GLY HA2  1 1 
        9  5525 1 1 42 GLY HA3  H   16.032   8.008  11.430 1.00 . A A .  42 GLY HA3  1 1 
        9  5526 1 1 42 GLY N    N   14.291   7.266  10.589 1.00 . A A .  42 GLY N    1 1 
        9  5527 1 1 42 GLY O    O   16.865   5.600   9.516 1.00 . A A .  42 GLY O    1 1 
        9  5528 1 1 43 PRO C    C   16.574   3.096  11.396 1.00 . A A .  43 PRO C    1 1 
        9  5529 1 1 43 PRO CA   C   17.384   4.276  11.923 1.00 . A A .  43 PRO CA   1 1 
        9  5530 1 1 43 PRO CB   C   17.570   4.163  13.438 1.00 . A A .  43 PRO CB   1 1 
        9  5531 1 1 43 PRO CD   C   16.243   6.113  13.050 1.00 . A A .  43 PRO CD   1 1 
        9  5532 1 1 43 PRO CG   C   16.469   4.984  14.017 1.00 . A A .  43 PRO CG   1 1 
        9  5533 1 1 43 PRO HA   H   18.351   4.291  11.441 1.00 . A A .  43 PRO HA   1 1 
        9  5534 1 1 43 PRO HB2  H   17.490   3.127  13.737 1.00 . A A .  43 PRO HB2  1 1 
        9  5535 1 1 43 PRO HB3  H   18.539   4.550  13.716 1.00 . A A .  43 PRO HB3  1 1 
        9  5536 1 1 43 PRO HD2  H   15.197   6.380  13.019 1.00 . A A .  43 PRO HD2  1 1 
        9  5537 1 1 43 PRO HD3  H   16.845   6.968  13.321 1.00 . A A .  43 PRO HD3  1 1 
        9  5538 1 1 43 PRO HG2  H   15.576   4.386  14.111 1.00 . A A .  43 PRO HG2  1 1 
        9  5539 1 1 43 PRO HG3  H   16.768   5.370  14.980 1.00 . A A .  43 PRO HG3  1 1 
        9  5540 1 1 43 PRO N    N   16.681   5.552  11.761 1.00 . A A .  43 PRO N    1 1 
        9  5541 1 1 43 PRO O    O   15.514   3.277  10.797 1.00 . A A .  43 PRO O    1 1 
        9  5542 1 1 44 SER C    C   16.817  -0.524  12.012 1.00 . A A .  44 SER C    1 1 
        9  5543 1 1 44 SER CA   C   16.404   0.679  11.169 1.00 . A A .  44 SER CA   1 1 
        9  5544 1 1 44 SER CB   C   16.721   0.416   9.695 1.00 . A A .  44 SER CB   1 1 
        9  5545 1 1 44 SER H    H   17.929   1.809  12.107 1.00 . A A .  44 SER H    1 1 
        9  5546 1 1 44 SER HA   H   15.341   0.832  11.278 1.00 . A A .  44 SER HA   1 1 
        9  5547 1 1 44 SER HB2  H   17.784   0.269   9.579 1.00 . A A .  44 SER HB2  1 1 
        9  5548 1 1 44 SER HB3  H   16.197  -0.471   9.370 1.00 . A A .  44 SER HB3  1 1 
        9  5549 1 1 44 SER HG   H   16.694   1.408   8.006 1.00 . A A .  44 SER HG   1 1 
        9  5550 1 1 44 SER N    N   17.080   1.888  11.624 1.00 . A A .  44 SER N    1 1 
        9  5551 1 1 44 SER O    O   17.996  -0.871  12.083 1.00 . A A .  44 SER O    1 1 
        9  5552 1 1 44 SER OG   O   16.319   1.507   8.885 1.00 . A A .  44 SER OG   1 1 
        9  5553 1 1 45 SER C    C   16.148  -3.594  12.656 1.00 . A A .  45 SER C    1 1 
        9  5554 1 1 45 SER CA   C   16.097  -2.318  13.491 1.00 . A A .  45 SER CA   1 1 
        9  5555 1 1 45 SER CB   C   15.020  -2.444  14.571 1.00 . A A .  45 SER CB   1 1 
        9  5556 1 1 45 SER H    H   14.917  -0.831  12.553 1.00 . A A .  45 SER H    1 1 
        9  5557 1 1 45 SER HA   H   17.056  -2.175  13.967 1.00 . A A .  45 SER HA   1 1 
        9  5558 1 1 45 SER HB2  H   14.993  -1.537  15.156 1.00 . A A .  45 SER HB2  1 1 
        9  5559 1 1 45 SER HB3  H   14.060  -2.598  14.100 1.00 . A A .  45 SER HB3  1 1 
        9  5560 1 1 45 SER HG   H   15.820  -4.187  14.969 1.00 . A A .  45 SER HG   1 1 
        9  5561 1 1 45 SER N    N   15.837  -1.156  12.649 1.00 . A A .  45 SER N    1 1 
        9  5562 1 1 45 SER O    O   17.060  -4.407  12.799 1.00 . A A .  45 SER O    1 1 
        9  5563 1 1 45 SER OG   O   15.287  -3.536  15.433 1.00 . A A .  45 SER OG   1 1 
        9  5564 1 1 46 GLY C    C   13.857  -4.988  10.084 1.00 . A A .  46 GLY C    1 1 
        9  5565 1 1 46 GLY CA   C   15.109  -4.939  10.936 1.00 . A A .  46 GLY CA   1 1 
        9  5566 1 1 46 GLY H    H   14.460  -3.079  11.711 1.00 . A A .  46 GLY H    1 1 
        9  5567 1 1 46 GLY HA2  H   15.974  -4.942  10.289 1.00 . A A .  46 GLY HA2  1 1 
        9  5568 1 1 46 GLY HA3  H   15.139  -5.819  11.562 1.00 . A A .  46 GLY HA3  1 1 
        9  5569 1 1 46 GLY N    N   15.160  -3.761  11.782 1.00 . A A .  46 GLY N    1 1 
        9  5570 1 1 46 GLY O    O   12.863  -5.573  10.512 1.00 . A A .  46 GLY O    1 1 
        9  5571 2 2  1 ZN  ZN   ZN  -0.811   6.453  -3.525 1.00 . B A . 201 ZN  ZN   1 1 
       10  5572 1 1  1 GLY C    C  -34.704  -6.378  -3.506 1.00 . A A .   1 GLY C    1 1 
       10  5573 1 1  1 GLY CA   C  -35.714  -5.253  -3.611 1.00 . A A .   1 GLY CA   1 1 
       10  5574 1 1  1 GLY H1   H  -37.146  -6.242  -4.817 1.00 . A A .   1 GLY H1   1 1 
       10  5575 1 1  1 GLY HA2  H  -35.186  -4.318  -3.725 1.00 . A A .   1 GLY HA2  1 1 
       10  5576 1 1  1 GLY HA3  H  -36.294  -5.219  -2.701 1.00 . A A .   1 GLY HA3  1 1 
       10  5577 1 1  1 GLY N    N  -36.617  -5.421  -4.735 1.00 . A A .   1 GLY N    1 1 
       10  5578 1 1  1 GLY O    O  -34.609  -7.041  -2.473 1.00 . A A .   1 GLY O    1 1 
       10  5579 1 1  2 SER C    C  -31.605  -7.117  -5.098 1.00 . A A .   2 SER C    1 1 
       10  5580 1 1  2 SER CA   C  -32.945  -7.653  -4.603 1.00 . A A .   2 SER CA   1 1 
       10  5581 1 1  2 SER CB   C  -33.408  -8.804  -5.497 1.00 . A A .   2 SER CB   1 1 
       10  5582 1 1  2 SER H    H  -34.072  -6.034  -5.371 1.00 . A A .   2 SER H    1 1 
       10  5583 1 1  2 SER HA   H  -32.823  -8.019  -3.595 1.00 . A A .   2 SER HA   1 1 
       10  5584 1 1  2 SER HB2  H  -32.638  -9.560  -5.535 1.00 . A A .   2 SER HB2  1 1 
       10  5585 1 1  2 SER HB3  H  -34.313  -9.232  -5.090 1.00 . A A .   2 SER HB3  1 1 
       10  5586 1 1  2 SER HG   H  -32.903  -7.884  -7.151 1.00 . A A .   2 SER HG   1 1 
       10  5587 1 1  2 SER N    N  -33.949  -6.596  -4.578 1.00 . A A .   2 SER N    1 1 
       10  5588 1 1  2 SER O    O  -31.464  -6.746  -6.263 1.00 . A A .   2 SER O    1 1 
       10  5589 1 1  2 SER OG   O  -33.670  -8.353  -6.815 1.00 . A A .   2 SER OG   1 1 
       10  5590 1 1  3 SER C    C  -28.279  -7.726  -4.565 1.00 . A A .   3 SER C    1 1 
       10  5591 1 1  3 SER CA   C  -29.294  -6.587  -4.547 1.00 . A A .   3 SER CA   1 1 
       10  5592 1 1  3 SER CB   C  -28.853  -5.512  -3.551 1.00 . A A .   3 SER CB   1 1 
       10  5593 1 1  3 SER H    H  -30.796  -7.391  -3.290 1.00 . A A .   3 SER H    1 1 
       10  5594 1 1  3 SER HA   H  -29.347  -6.152  -5.534 1.00 . A A .   3 SER HA   1 1 
       10  5595 1 1  3 SER HB2  H  -29.253  -5.743  -2.576 1.00 . A A .   3 SER HB2  1 1 
       10  5596 1 1  3 SER HB3  H  -27.774  -5.492  -3.502 1.00 . A A .   3 SER HB3  1 1 
       10  5597 1 1  3 SER HG   H  -30.274  -4.247  -4.018 1.00 . A A .   3 SER HG   1 1 
       10  5598 1 1  3 SER N    N  -30.622  -7.081  -4.203 1.00 . A A .   3 SER N    1 1 
       10  5599 1 1  3 SER O    O  -28.159  -8.481  -3.601 1.00 . A A .   3 SER O    1 1 
       10  5600 1 1  3 SER OG   O  -29.317  -4.232  -3.944 1.00 . A A .   3 SER OG   1 1 
       10  5601 1 1  4 GLY C    C  -25.476  -8.552  -6.804 1.00 . A A .   4 GLY C    1 1 
       10  5602 1 1  4 GLY CA   C  -26.555  -8.893  -5.795 1.00 . A A .   4 GLY CA   1 1 
       10  5603 1 1  4 GLY H    H  -27.690  -7.213  -6.408 1.00 . A A .   4 GLY H    1 1 
       10  5604 1 1  4 GLY HA2  H  -26.095  -9.054  -4.832 1.00 . A A .   4 GLY HA2  1 1 
       10  5605 1 1  4 GLY HA3  H  -27.046  -9.804  -6.105 1.00 . A A .   4 GLY HA3  1 1 
       10  5606 1 1  4 GLY N    N  -27.550  -7.844  -5.671 1.00 . A A .   4 GLY N    1 1 
       10  5607 1 1  4 GLY O    O  -25.727  -8.533  -8.009 1.00 . A A .   4 GLY O    1 1 
       10  5608 1 1  5 SER C    C  -21.931  -8.789  -6.858 1.00 . A A .   5 SER C    1 1 
       10  5609 1 1  5 SER CA   C  -23.152  -7.933  -7.178 1.00 . A A .   5 SER CA   1 1 
       10  5610 1 1  5 SER CB   C  -22.804  -6.451  -7.027 1.00 . A A .   5 SER CB   1 1 
       10  5611 1 1  5 SER H    H  -24.135  -8.312  -5.341 1.00 . A A .   5 SER H    1 1 
       10  5612 1 1  5 SER HA   H  -23.452  -8.121  -8.198 1.00 . A A .   5 SER HA   1 1 
       10  5613 1 1  5 SER HB2  H  -23.633  -5.852  -7.372 1.00 . A A .   5 SER HB2  1 1 
       10  5614 1 1  5 SER HB3  H  -22.611  -6.234  -5.986 1.00 . A A .   5 SER HB3  1 1 
       10  5615 1 1  5 SER HG   H  -20.947  -6.735  -7.582 1.00 . A A .   5 SER HG   1 1 
       10  5616 1 1  5 SER N    N  -24.272  -8.280  -6.311 1.00 . A A .   5 SER N    1 1 
       10  5617 1 1  5 SER O    O  -21.271  -8.592  -5.838 1.00 . A A .   5 SER O    1 1 
       10  5618 1 1  5 SER OG   O  -21.653  -6.117  -7.784 1.00 . A A .   5 SER OG   1 1 
       10  5619 1 1  6 SER C    C  -19.258 -10.085  -8.249 1.00 . A A .   6 SER C    1 1 
       10  5620 1 1  6 SER CA   C  -20.497 -10.631  -7.547 1.00 . A A .   6 SER CA   1 1 
       10  5621 1 1  6 SER CB   C  -20.822 -12.030  -8.076 1.00 . A A .   6 SER CB   1 1 
       10  5622 1 1  6 SER H    H  -22.201  -9.849  -8.531 1.00 . A A .   6 SER H    1 1 
       10  5623 1 1  6 SER HA   H  -20.298 -10.694  -6.488 1.00 . A A .   6 SER HA   1 1 
       10  5624 1 1  6 SER HB2  H  -20.037 -12.712  -7.788 1.00 . A A .   6 SER HB2  1 1 
       10  5625 1 1  6 SER HB3  H  -21.760 -12.362  -7.656 1.00 . A A .   6 SER HB3  1 1 
       10  5626 1 1  6 SER HG   H  -21.342 -11.211  -9.778 1.00 . A A .   6 SER HG   1 1 
       10  5627 1 1  6 SER N    N  -21.636  -9.741  -7.737 1.00 . A A .   6 SER N    1 1 
       10  5628 1 1  6 SER O    O  -19.068 -10.290  -9.447 1.00 . A A .   6 SER O    1 1 
       10  5629 1 1  6 SER OG   O  -20.930 -12.028  -9.489 1.00 . A A .   6 SER OG   1 1 
       10  5630 1 1  7 GLY C    C  -16.043  -8.848  -7.086 1.00 . A A .   7 GLY C    1 1 
       10  5631 1 1  7 GLY CA   C  -17.205  -8.820  -8.058 1.00 . A A .   7 GLY CA   1 1 
       10  5632 1 1  7 GLY H    H  -18.619  -9.255  -6.543 1.00 . A A .   7 GLY H    1 1 
       10  5633 1 1  7 GLY HA2  H  -16.937  -9.382  -8.941 1.00 . A A .   7 GLY HA2  1 1 
       10  5634 1 1  7 GLY HA3  H  -17.399  -7.796  -8.341 1.00 . A A .   7 GLY HA3  1 1 
       10  5635 1 1  7 GLY N    N  -18.416  -9.387  -7.493 1.00 . A A .   7 GLY N    1 1 
       10  5636 1 1  7 GLY O    O  -15.762  -9.878  -6.473 1.00 . A A .   7 GLY O    1 1 
       10  5637 1 1  8 ALA C    C  -14.687  -7.434  -4.596 1.00 . A A .   8 ALA C    1 1 
       10  5638 1 1  8 ALA CA   C  -14.227  -7.613  -6.039 1.00 . A A .   8 ALA CA   1 1 
       10  5639 1 1  8 ALA CB   C  -13.324  -6.460  -6.454 1.00 . A A .   8 ALA CB   1 1 
       10  5640 1 1  8 ALA H    H  -15.637  -6.927  -7.460 1.00 . A A .   8 ALA H    1 1 
       10  5641 1 1  8 ALA HA   H  -13.658  -8.528  -6.114 1.00 . A A .   8 ALA HA   1 1 
       10  5642 1 1  8 ALA HB1  H  -12.509  -6.839  -7.051 1.00 . A A .   8 ALA HB1  1 1 
       10  5643 1 1  8 ALA HB2  H  -13.894  -5.748  -7.032 1.00 . A A .   8 ALA HB2  1 1 
       10  5644 1 1  8 ALA HB3  H  -12.931  -5.976  -5.572 1.00 . A A .   8 ALA HB3  1 1 
       10  5645 1 1  8 ALA N    N  -15.365  -7.714  -6.944 1.00 . A A .   8 ALA N    1 1 
       10  5646 1 1  8 ALA O    O  -14.207  -8.116  -3.692 1.00 . A A .   8 ALA O    1 1 
       10  5647 1 1  9 GLY C    C  -15.319  -5.214  -2.311 1.00 . A A .   9 GLY C    1 1 
       10  5648 1 1  9 GLY CA   C  -16.130  -6.258  -3.052 1.00 . A A .   9 GLY CA   1 1 
       10  5649 1 1  9 GLY H    H  -15.967  -5.996  -5.147 1.00 . A A .   9 GLY H    1 1 
       10  5650 1 1  9 GLY HA2  H  -17.152  -5.919  -3.126 1.00 . A A .   9 GLY HA2  1 1 
       10  5651 1 1  9 GLY HA3  H  -16.107  -7.181  -2.491 1.00 . A A .   9 GLY HA3  1 1 
       10  5652 1 1  9 GLY N    N  -15.621  -6.510  -4.388 1.00 . A A .   9 GLY N    1 1 
       10  5653 1 1  9 GLY O    O  -15.640  -4.027  -2.350 1.00 . A A .   9 GLY O    1 1 
       10  5654 1 1 10 GLU C    C  -12.034  -5.373  -0.640 1.00 . A A .  10 GLU C    1 1 
       10  5655 1 1 10 GLU CA   C  -13.408  -4.752  -0.876 1.00 . A A .  10 GLU CA   1 1 
       10  5656 1 1 10 GLU CB   C  -14.057  -4.399   0.464 1.00 . A A .  10 GLU CB   1 1 
       10  5657 1 1 10 GLU CD   C  -15.003  -5.266   2.641 1.00 . A A .  10 GLU CD   1 1 
       10  5658 1 1 10 GLU CG   C  -14.157  -5.576   1.421 1.00 . A A .  10 GLU CG   1 1 
       10  5659 1 1 10 GLU H    H  -14.061  -6.616  -1.638 1.00 . A A .  10 GLU H    1 1 
       10  5660 1 1 10 GLU HA   H  -13.287  -3.849  -1.455 1.00 . A A .  10 GLU HA   1 1 
       10  5661 1 1 10 GLU HB2  H  -13.475  -3.624   0.940 1.00 . A A .  10 GLU HB2  1 1 
       10  5662 1 1 10 GLU HB3  H  -15.054  -4.027   0.280 1.00 . A A .  10 GLU HB3  1 1 
       10  5663 1 1 10 GLU HG2  H  -14.599  -6.411   0.899 1.00 . A A .  10 GLU HG2  1 1 
       10  5664 1 1 10 GLU HG3  H  -13.163  -5.843   1.748 1.00 . A A .  10 GLU HG3  1 1 
       10  5665 1 1 10 GLU N    N  -14.266  -5.658  -1.631 1.00 . A A .  10 GLU N    1 1 
       10  5666 1 1 10 GLU O    O  -11.810  -6.545  -0.944 1.00 . A A .  10 GLU O    1 1 
       10  5667 1 1 10 GLU OE1  O  -14.482  -4.624   3.576 1.00 . A A .  10 GLU OE1  1 1 
       10  5668 1 1 10 GLU OE2  O  -16.186  -5.667   2.659 1.00 . A A .  10 GLU OE2  1 1 
       10  5669 1 1 11 LYS C    C   -9.281  -4.539   1.534 1.00 . A A .  11 LYS C    1 1 
       10  5670 1 1 11 LYS CA   C   -9.766  -5.048   0.181 1.00 . A A .  11 LYS CA   1 1 
       10  5671 1 1 11 LYS CB   C   -8.808  -4.590  -0.922 1.00 . A A .  11 LYS CB   1 1 
       10  5672 1 1 11 LYS CD   C   -8.557  -6.760  -2.162 1.00 . A A .  11 LYS CD   1 1 
       10  5673 1 1 11 LYS CE   C   -8.519  -7.410  -3.536 1.00 . A A .  11 LYS CE   1 1 
       10  5674 1 1 11 LYS CG   C   -9.011  -5.312  -2.242 1.00 . A A .  11 LYS CG   1 1 
       10  5675 1 1 11 LYS H    H  -11.358  -3.653   0.123 1.00 . A A .  11 LYS H    1 1 
       10  5676 1 1 11 LYS HA   H   -9.787  -6.127   0.202 1.00 . A A .  11 LYS HA   1 1 
       10  5677 1 1 11 LYS HB2  H   -8.950  -3.532  -1.088 1.00 . A A .  11 LYS HB2  1 1 
       10  5678 1 1 11 LYS HB3  H   -7.793  -4.761  -0.594 1.00 . A A .  11 LYS HB3  1 1 
       10  5679 1 1 11 LYS HD2  H   -7.567  -6.795  -1.732 1.00 . A A .  11 LYS HD2  1 1 
       10  5680 1 1 11 LYS HD3  H   -9.244  -7.309  -1.533 1.00 . A A .  11 LYS HD3  1 1 
       10  5681 1 1 11 LYS HE2  H   -8.001  -6.751  -4.217 1.00 . A A .  11 LYS HE2  1 1 
       10  5682 1 1 11 LYS HE3  H   -7.984  -8.345  -3.463 1.00 . A A .  11 LYS HE3  1 1 
       10  5683 1 1 11 LYS HG2  H  -10.060  -5.289  -2.498 1.00 . A A .  11 LYS HG2  1 1 
       10  5684 1 1 11 LYS HG3  H   -8.440  -4.808  -3.009 1.00 . A A .  11 LYS HG3  1 1 
       10  5685 1 1 11 LYS HZ1  H  -10.056  -7.104  -4.917 1.00 . A A .  11 LYS HZ1  1 1 
       10  5686 1 1 11 LYS HZ2  H  -10.599  -7.426  -3.347 1.00 . A A .  11 LYS HZ2  1 1 
       10  5687 1 1 11 LYS HZ3  H   -9.988  -8.680  -4.305 1.00 . A A .  11 LYS HZ3  1 1 
       10  5688 1 1 11 LYS N    N  -11.118  -4.579  -0.097 1.00 . A A .  11 LYS N    1 1 
       10  5689 1 1 11 LYS NZ   N   -9.886  -7.673  -4.064 1.00 . A A .  11 LYS NZ   1 1 
       10  5690 1 1 11 LYS O    O   -9.650  -3.455   1.986 1.00 . A A .  11 LYS O    1 1 
       10  5691 1 1 12 PRO C    C   -6.882  -3.833   3.427 1.00 . A A .  12 PRO C    1 1 
       10  5692 1 1 12 PRO CA   C   -7.875  -4.987   3.508 1.00 . A A .  12 PRO CA   1 1 
       10  5693 1 1 12 PRO CB   C   -7.169  -6.271   3.949 1.00 . A A .  12 PRO CB   1 1 
       10  5694 1 1 12 PRO CD   C   -7.947  -6.643   1.720 1.00 . A A .  12 PRO CD   1 1 
       10  5695 1 1 12 PRO CG   C   -6.838  -6.976   2.679 1.00 . A A .  12 PRO CG   1 1 
       10  5696 1 1 12 PRO HA   H   -8.654  -4.741   4.216 1.00 . A A .  12 PRO HA   1 1 
       10  5697 1 1 12 PRO HB2  H   -6.277  -6.021   4.507 1.00 . A A .  12 PRO HB2  1 1 
       10  5698 1 1 12 PRO HB3  H   -7.833  -6.858   4.565 1.00 . A A .  12 PRO HB3  1 1 
       10  5699 1 1 12 PRO HD2  H   -7.565  -6.568   0.712 1.00 . A A .  12 PRO HD2  1 1 
       10  5700 1 1 12 PRO HD3  H   -8.729  -7.386   1.774 1.00 . A A .  12 PRO HD3  1 1 
       10  5701 1 1 12 PRO HG2  H   -5.893  -6.622   2.297 1.00 . A A .  12 PRO HG2  1 1 
       10  5702 1 1 12 PRO HG3  H   -6.800  -8.042   2.851 1.00 . A A .  12 PRO HG3  1 1 
       10  5703 1 1 12 PRO N    N   -8.431  -5.337   2.198 1.00 . A A .  12 PRO N    1 1 
       10  5704 1 1 12 PRO O    O   -6.821  -2.989   4.321 1.00 . A A .  12 PRO O    1 1 
       10  5705 1 1 13 TYR C    C   -5.694  -1.598   1.343 1.00 . A A .  13 TYR C    1 1 
       10  5706 1 1 13 TYR CA   C   -5.113  -2.753   2.152 1.00 . A A .  13 TYR CA   1 1 
       10  5707 1 1 13 TYR CB   C   -3.878  -3.315   1.446 1.00 . A A .  13 TYR CB   1 1 
       10  5708 1 1 13 TYR CD1  C   -2.700  -4.906   3.013 1.00 . A A .  13 TYR CD1  1 1 
       10  5709 1 1 13 TYR CD2  C   -3.956  -5.828   1.210 1.00 . A A .  13 TYR CD2  1 1 
       10  5710 1 1 13 TYR CE1  C   -2.355  -6.177   3.429 1.00 . A A .  13 TYR CE1  1 1 
       10  5711 1 1 13 TYR CE2  C   -3.617  -7.103   1.620 1.00 . A A .  13 TYR CE2  1 1 
       10  5712 1 1 13 TYR CG   C   -3.504  -4.709   1.898 1.00 . A A .  13 TYR CG   1 1 
       10  5713 1 1 13 TYR CZ   C   -2.816  -7.272   2.730 1.00 . A A .  13 TYR CZ   1 1 
       10  5714 1 1 13 TYR H    H   -6.200  -4.503   1.671 1.00 . A A .  13 TYR H    1 1 
       10  5715 1 1 13 TYR HA   H   -4.821  -2.385   3.125 1.00 . A A .  13 TYR HA   1 1 
       10  5716 1 1 13 TYR HB2  H   -4.065  -3.351   0.383 1.00 . A A .  13 TYR HB2  1 1 
       10  5717 1 1 13 TYR HB3  H   -3.036  -2.667   1.636 1.00 . A A .  13 TYR HB3  1 1 
       10  5718 1 1 13 TYR HD1  H   -2.341  -4.046   3.560 1.00 . A A .  13 TYR HD1  1 1 
       10  5719 1 1 13 TYR HD2  H   -4.583  -5.692   0.341 1.00 . A A .  13 TYR HD2  1 1 
       10  5720 1 1 13 TYR HE1  H   -1.728  -6.310   4.299 1.00 . A A .  13 TYR HE1  1 1 
       10  5721 1 1 13 TYR HE2  H   -3.978  -7.962   1.072 1.00 . A A .  13 TYR HE2  1 1 
       10  5722 1 1 13 TYR HH   H   -3.274  -9.043   3.323 1.00 . A A .  13 TYR HH   1 1 
       10  5723 1 1 13 TYR N    N   -6.105  -3.802   2.349 1.00 . A A .  13 TYR N    1 1 
       10  5724 1 1 13 TYR O    O   -6.827  -1.665   0.869 1.00 . A A .  13 TYR O    1 1 
       10  5725 1 1 13 TYR OH   O   -2.476  -8.541   3.142 1.00 . A A .  13 TYR OH   1 1 
       10  5726 1 1 14 GLY C    C   -4.543   1.860   0.732 1.00 . A A .  14 GLY C    1 1 
       10  5727 1 1 14 GLY CA   C   -5.360   0.618   0.434 1.00 . A A .  14 GLY CA   1 1 
       10  5728 1 1 14 GLY H    H   -4.013  -0.539   1.588 1.00 . A A .  14 GLY H    1 1 
       10  5729 1 1 14 GLY HA2  H   -5.288   0.397  -0.620 1.00 . A A .  14 GLY HA2  1 1 
       10  5730 1 1 14 GLY HA3  H   -6.393   0.813   0.682 1.00 . A A .  14 GLY HA3  1 1 
       10  5731 1 1 14 GLY N    N   -4.907  -0.537   1.187 1.00 . A A .  14 GLY N    1 1 
       10  5732 1 1 14 GLY O    O   -4.552   2.363   1.856 1.00 . A A .  14 GLY O    1 1 
       10  5733 1 1 15 CYS C    C   -3.806   4.684   0.511 1.00 . A A .  15 CYS C    1 1 
       10  5734 1 1 15 CYS CA   C   -3.007   3.546  -0.117 1.00 . A A .  15 CYS CA   1 1 
       10  5735 1 1 15 CYS CB   C   -2.447   3.988  -1.471 1.00 . A A .  15 CYS CB   1 1 
       10  5736 1 1 15 CYS H    H   -3.869   1.911  -1.150 1.00 . A A .  15 CYS H    1 1 
       10  5737 1 1 15 CYS HA   H   -2.187   3.295   0.537 1.00 . A A .  15 CYS HA   1 1 
       10  5738 1 1 15 CYS HB2  H   -1.619   3.346  -1.736 1.00 . A A .  15 CYS HB2  1 1 
       10  5739 1 1 15 CYS HB3  H   -3.220   3.895  -2.219 1.00 . A A .  15 CYS HB3  1 1 
       10  5740 1 1 15 CYS N    N   -3.835   2.356  -0.276 1.00 . A A .  15 CYS N    1 1 
       10  5741 1 1 15 CYS O    O   -4.676   5.273  -0.130 1.00 . A A .  15 CYS O    1 1 
       10  5742 1 1 15 CYS SG   S   -1.846   5.707  -1.502 1.00 . A A .  15 CYS SG   1 1 
       10  5743 1 1 16 SER C    C   -3.467   7.384   2.316 1.00 . A A .  16 SER C    1 1 
       10  5744 1 1 16 SER CA   C   -4.195   6.054   2.485 1.00 . A A .  16 SER CA   1 1 
       10  5745 1 1 16 SER CB   C   -4.308   5.708   3.971 1.00 . A A .  16 SER CB   1 1 
       10  5746 1 1 16 SER H    H   -2.799   4.483   2.226 1.00 . A A .  16 SER H    1 1 
       10  5747 1 1 16 SER HA   H   -5.187   6.144   2.068 1.00 . A A .  16 SER HA   1 1 
       10  5748 1 1 16 SER HB2  H   -3.321   5.664   4.404 1.00 . A A .  16 SER HB2  1 1 
       10  5749 1 1 16 SER HB3  H   -4.888   6.469   4.472 1.00 . A A .  16 SER HB3  1 1 
       10  5750 1 1 16 SER HG   H   -5.763   4.434   3.656 1.00 . A A .  16 SER HG   1 1 
       10  5751 1 1 16 SER N    N   -3.503   4.989   1.769 1.00 . A A .  16 SER N    1 1 
       10  5752 1 1 16 SER O    O   -3.390   8.184   3.247 1.00 . A A .  16 SER O    1 1 
       10  5753 1 1 16 SER OG   O   -4.944   4.455   4.155 1.00 . A A .  16 SER OG   1 1 
       10  5754 1 1 17 GLU C    C   -2.908   9.635  -0.278 1.00 . A A .  17 GLU C    1 1 
       10  5755 1 1 17 GLU CA   C   -2.212   8.845   0.827 1.00 . A A .  17 GLU CA   1 1 
       10  5756 1 1 17 GLU CB   C   -0.772   8.533   0.417 1.00 . A A .  17 GLU CB   1 1 
       10  5757 1 1 17 GLU CD   C    0.736  10.280   1.443 1.00 . A A .  17 GLU CD   1 1 
       10  5758 1 1 17 GLU CG   C    0.075   9.772   0.177 1.00 . A A .  17 GLU CG   1 1 
       10  5759 1 1 17 GLU H    H   -3.030   6.936   0.416 1.00 . A A .  17 GLU H    1 1 
       10  5760 1 1 17 GLU HA   H   -2.199   9.442   1.726 1.00 . A A .  17 GLU HA   1 1 
       10  5761 1 1 17 GLU HB2  H   -0.306   7.949   1.197 1.00 . A A .  17 GLU HB2  1 1 
       10  5762 1 1 17 GLU HB3  H   -0.788   7.952  -0.494 1.00 . A A .  17 GLU HB3  1 1 
       10  5763 1 1 17 GLU HG2  H    0.845   9.532  -0.542 1.00 . A A .  17 GLU HG2  1 1 
       10  5764 1 1 17 GLU HG3  H   -0.557  10.552  -0.221 1.00 . A A .  17 GLU HG3  1 1 
       10  5765 1 1 17 GLU N    N   -2.935   7.612   1.119 1.00 . A A .  17 GLU N    1 1 
       10  5766 1 1 17 GLU O    O   -3.240  10.807  -0.103 1.00 . A A .  17 GLU O    1 1 
       10  5767 1 1 17 GLU OE1  O    1.768   9.703   1.846 1.00 . A A .  17 GLU OE1  1 1 
       10  5768 1 1 17 GLU OE2  O    0.223  11.255   2.031 1.00 . A A .  17 GLU OE2  1 1 
       10  5769 1 1 18 CYS C    C   -5.151   9.006  -2.806 1.00 . A A .  18 CYS C    1 1 
       10  5770 1 1 18 CYS CA   C   -3.779   9.623  -2.550 1.00 . A A .  18 CYS CA   1 1 
       10  5771 1 1 18 CYS CB   C   -2.910   9.499  -3.804 1.00 . A A .  18 CYS CB   1 1 
       10  5772 1 1 18 CYS H    H   -2.837   8.049  -1.495 1.00 . A A .  18 CYS H    1 1 
       10  5773 1 1 18 CYS HA   H   -3.907  10.668  -2.314 1.00 . A A .  18 CYS HA   1 1 
       10  5774 1 1 18 CYS HB2  H   -3.389  10.024  -4.617 1.00 . A A .  18 CYS HB2  1 1 
       10  5775 1 1 18 CYS HB3  H   -1.947   9.946  -3.610 1.00 . A A .  18 CYS HB3  1 1 
       10  5776 1 1 18 CYS N    N   -3.124   8.984  -1.416 1.00 . A A .  18 CYS N    1 1 
       10  5777 1 1 18 CYS O    O   -6.120   9.712  -3.082 1.00 . A A .  18 CYS O    1 1 
       10  5778 1 1 18 CYS SG   S   -2.628   7.782  -4.345 1.00 . A A .  18 CYS SG   1 1 
       10  5779 1 1 19 GLY C    C   -6.344   5.836  -3.905 1.00 . A A .  19 GLY C    1 1 
       10  5780 1 1 19 GLY CA   C   -6.482   6.991  -2.933 1.00 . A A .  19 GLY CA   1 1 
       10  5781 1 1 19 GLY H    H   -4.420   7.169  -2.487 1.00 . A A .  19 GLY H    1 1 
       10  5782 1 1 19 GLY HA2  H   -6.845   6.613  -1.989 1.00 . A A .  19 GLY HA2  1 1 
       10  5783 1 1 19 GLY HA3  H   -7.201   7.694  -3.328 1.00 . A A .  19 GLY HA3  1 1 
       10  5784 1 1 19 GLY N    N   -5.225   7.681  -2.710 1.00 . A A .  19 GLY N    1 1 
       10  5785 1 1 19 GLY O    O   -7.028   5.789  -4.928 1.00 . A A .  19 GLY O    1 1 
       10  5786 1 1 20 LYS C    C   -5.418   2.444  -3.655 1.00 . A A .  20 LYS C    1 1 
       10  5787 1 1 20 LYS CA   C   -5.229   3.738  -4.438 1.00 . A A .  20 LYS CA   1 1 
       10  5788 1 1 20 LYS CB   C   -3.820   3.785  -5.035 1.00 . A A .  20 LYS CB   1 1 
       10  5789 1 1 20 LYS CD   C   -2.589   3.500  -7.206 1.00 . A A .  20 LYS CD   1 1 
       10  5790 1 1 20 LYS CE   C   -3.170   4.496  -8.198 1.00 . A A .  20 LYS CE   1 1 
       10  5791 1 1 20 LYS CG   C   -3.662   2.940  -6.287 1.00 . A A .  20 LYS CG   1 1 
       10  5792 1 1 20 LYS H    H   -4.941   4.992  -2.757 1.00 . A A .  20 LYS H    1 1 
       10  5793 1 1 20 LYS HA   H   -5.951   3.769  -5.240 1.00 . A A .  20 LYS HA   1 1 
       10  5794 1 1 20 LYS HB2  H   -3.581   4.808  -5.284 1.00 . A A .  20 LYS HB2  1 1 
       10  5795 1 1 20 LYS HB3  H   -3.117   3.430  -4.295 1.00 . A A .  20 LYS HB3  1 1 
       10  5796 1 1 20 LYS HD2  H   -1.841   4.000  -6.609 1.00 . A A .  20 LYS HD2  1 1 
       10  5797 1 1 20 LYS HD3  H   -2.133   2.686  -7.751 1.00 . A A .  20 LYS HD3  1 1 
       10  5798 1 1 20 LYS HE2  H   -3.840   5.159  -7.672 1.00 . A A .  20 LYS HE2  1 1 
       10  5799 1 1 20 LYS HE3  H   -2.362   5.069  -8.628 1.00 . A A .  20 LYS HE3  1 1 
       10  5800 1 1 20 LYS HG2  H   -3.386   1.936  -6.000 1.00 . A A .  20 LYS HG2  1 1 
       10  5801 1 1 20 LYS HG3  H   -4.603   2.919  -6.817 1.00 . A A .  20 LYS HG3  1 1 
       10  5802 1 1 20 LYS HZ1  H   -3.502   2.885  -9.485 1.00 . A A .  20 LYS HZ1  1 1 
       10  5803 1 1 20 LYS HZ2  H   -3.882   4.390 -10.158 1.00 . A A .  20 LYS HZ2  1 1 
       10  5804 1 1 20 LYS HZ3  H   -4.915   3.690  -9.016 1.00 . A A .  20 LYS HZ3  1 1 
       10  5805 1 1 20 LYS N    N   -5.456   4.900  -3.587 1.00 . A A .  20 LYS N    1 1 
       10  5806 1 1 20 LYS NZ   N   -3.920   3.817  -9.291 1.00 . A A .  20 LYS NZ   1 1 
       10  5807 1 1 20 LYS O    O   -5.305   2.427  -2.429 1.00 . A A .  20 LYS O    1 1 
       10  5808 1 1 21 ALA C    C   -5.165  -1.035  -4.497 1.00 . A A .  21 ALA C    1 1 
       10  5809 1 1 21 ALA CA   C   -5.907   0.061  -3.741 1.00 . A A .  21 ALA CA   1 1 
       10  5810 1 1 21 ALA CB   C   -7.391  -0.262  -3.661 1.00 . A A .  21 ALA CB   1 1 
       10  5811 1 1 21 ALA H    H   -5.783   1.438  -5.343 1.00 . A A .  21 ALA H    1 1 
       10  5812 1 1 21 ALA HA   H   -5.520   0.115  -2.733 1.00 . A A .  21 ALA HA   1 1 
       10  5813 1 1 21 ALA HB1  H   -7.892   0.129  -4.534 1.00 . A A .  21 ALA HB1  1 1 
       10  5814 1 1 21 ALA HB2  H   -7.524  -1.334  -3.619 1.00 . A A .  21 ALA HB2  1 1 
       10  5815 1 1 21 ALA HB3  H   -7.810   0.188  -2.773 1.00 . A A .  21 ALA HB3  1 1 
       10  5816 1 1 21 ALA N    N   -5.706   1.361  -4.370 1.00 . A A .  21 ALA N    1 1 
       10  5817 1 1 21 ALA O    O   -4.820  -0.872  -5.668 1.00 . A A .  21 ALA O    1 1 
       10  5818 1 1 22 PHE C    C   -4.714  -4.602  -3.860 1.00 . A A .  22 PHE C    1 1 
       10  5819 1 1 22 PHE CA   C   -4.217  -3.276  -4.430 1.00 . A A .  22 PHE CA   1 1 
       10  5820 1 1 22 PHE CB   C   -2.710  -3.144  -4.203 1.00 . A A .  22 PHE CB   1 1 
       10  5821 1 1 22 PHE CD1  C   -2.234  -0.736  -3.682 1.00 . A A .  22 PHE CD1  1 1 
       10  5822 1 1 22 PHE CD2  C   -1.582  -1.585  -5.813 1.00 . A A .  22 PHE CD2  1 1 
       10  5823 1 1 22 PHE CE1  C   -1.733   0.507  -4.020 1.00 . A A .  22 PHE CE1  1 1 
       10  5824 1 1 22 PHE CE2  C   -1.078  -0.344  -6.156 1.00 . A A .  22 PHE CE2  1 1 
       10  5825 1 1 22 PHE CG   C   -2.164  -1.795  -4.574 1.00 . A A .  22 PHE CG   1 1 
       10  5826 1 1 22 PHE CZ   C   -1.155   0.703  -5.258 1.00 . A A .  22 PHE CZ   1 1 
       10  5827 1 1 22 PHE H    H   -5.221  -2.224  -2.891 1.00 . A A .  22 PHE H    1 1 
       10  5828 1 1 22 PHE HA   H   -4.417  -3.256  -5.490 1.00 . A A .  22 PHE HA   1 1 
       10  5829 1 1 22 PHE HB2  H   -2.493  -3.314  -3.160 1.00 . A A .  22 PHE HB2  1 1 
       10  5830 1 1 22 PHE HB3  H   -2.198  -3.885  -4.799 1.00 . A A .  22 PHE HB3  1 1 
       10  5831 1 1 22 PHE HD1  H   -2.687  -0.889  -2.712 1.00 . A A .  22 PHE HD1  1 1 
       10  5832 1 1 22 PHE HD2  H   -1.522  -2.402  -6.516 1.00 . A A .  22 PHE HD2  1 1 
       10  5833 1 1 22 PHE HE1  H   -1.794   1.323  -3.315 1.00 . A A .  22 PHE HE1  1 1 
       10  5834 1 1 22 PHE HE2  H   -0.627  -0.193  -7.125 1.00 . A A .  22 PHE HE2  1 1 
       10  5835 1 1 22 PHE HZ   H   -0.762   1.673  -5.524 1.00 . A A .  22 PHE HZ   1 1 
       10  5836 1 1 22 PHE N    N   -4.921  -2.153  -3.821 1.00 . A A .  22 PHE N    1 1 
       10  5837 1 1 22 PHE O    O   -5.602  -4.630  -3.008 1.00 . A A .  22 PHE O    1 1 
       10  5838 1 1 23 SER C    C   -3.888  -7.343  -2.528 1.00 . A A .  23 SER C    1 1 
       10  5839 1 1 23 SER CA   C   -4.521  -7.028  -3.880 1.00 . A A .  23 SER CA   1 1 
       10  5840 1 1 23 SER CB   C   -4.108  -8.084  -4.907 1.00 . A A .  23 SER CB   1 1 
       10  5841 1 1 23 SER H    H   -3.433  -5.611  -5.016 1.00 . A A .  23 SER H    1 1 
       10  5842 1 1 23 SER HA   H   -5.596  -7.043  -3.774 1.00 . A A .  23 SER HA   1 1 
       10  5843 1 1 23 SER HB2  H   -4.662  -7.930  -5.821 1.00 . A A .  23 SER HB2  1 1 
       10  5844 1 1 23 SER HB3  H   -3.050  -7.993  -5.108 1.00 . A A .  23 SER HB3  1 1 
       10  5845 1 1 23 SER HG   H   -4.043 -10.036  -5.060 1.00 . A A .  23 SER HG   1 1 
       10  5846 1 1 23 SER N    N   -4.135  -5.699  -4.338 1.00 . A A .  23 SER N    1 1 
       10  5847 1 1 23 SER O    O   -4.586  -7.626  -1.555 1.00 . A A .  23 SER O    1 1 
       10  5848 1 1 23 SER OG   O   -4.371  -9.392  -4.428 1.00 . A A .  23 SER OG   1 1 
       10  5849 1 1 24 SER C    C   -1.061  -6.343  -0.776 1.00 . A A .  24 SER C    1 1 
       10  5850 1 1 24 SER CA   C   -1.832  -7.573  -1.246 1.00 . A A .  24 SER CA   1 1 
       10  5851 1 1 24 SER CB   C   -0.869  -8.743  -1.455 1.00 . A A .  24 SER CB   1 1 
       10  5852 1 1 24 SER H    H   -2.060  -7.058  -3.287 1.00 . A A .  24 SER H    1 1 
       10  5853 1 1 24 SER HA   H   -2.553  -7.842  -0.488 1.00 . A A .  24 SER HA   1 1 
       10  5854 1 1 24 SER HB2  H   -0.155  -8.485  -2.222 1.00 . A A .  24 SER HB2  1 1 
       10  5855 1 1 24 SER HB3  H   -0.348  -8.946  -0.531 1.00 . A A .  24 SER HB3  1 1 
       10  5856 1 1 24 SER HG   H   -2.133  -9.706  -2.601 1.00 . A A .  24 SER HG   1 1 
       10  5857 1 1 24 SER N    N   -2.561  -7.290  -2.477 1.00 . A A .  24 SER N    1 1 
       10  5858 1 1 24 SER O    O   -1.083  -5.296  -1.425 1.00 . A A .  24 SER O    1 1 
       10  5859 1 1 24 SER OG   O   -1.566  -9.911  -1.854 1.00 . A A .  24 SER OG   1 1 
       10  5860 1 1 25 LYS C    C    1.612  -5.072   0.040 1.00 . A A .  25 LYS C    1 1 
       10  5861 1 1 25 LYS CA   C    0.401  -5.378   0.915 1.00 . A A .  25 LYS CA   1 1 
       10  5862 1 1 25 LYS CB   C    0.856  -5.719   2.335 1.00 . A A .  25 LYS CB   1 1 
       10  5863 1 1 25 LYS CD   C    2.144  -5.020   4.375 1.00 . A A .  25 LYS CD   1 1 
       10  5864 1 1 25 LYS CE   C    0.953  -4.747   5.281 1.00 . A A .  25 LYS CE   1 1 
       10  5865 1 1 25 LYS CG   C    1.823  -4.707   2.923 1.00 . A A .  25 LYS CG   1 1 
       10  5866 1 1 25 LYS H    H   -0.401  -7.335   0.829 1.00 . A A .  25 LYS H    1 1 
       10  5867 1 1 25 LYS HA   H   -0.233  -4.505   0.949 1.00 . A A .  25 LYS HA   1 1 
       10  5868 1 1 25 LYS HB2  H   -0.011  -5.772   2.976 1.00 . A A .  25 LYS HB2  1 1 
       10  5869 1 1 25 LYS HB3  H    1.343  -6.684   2.322 1.00 . A A .  25 LYS HB3  1 1 
       10  5870 1 1 25 LYS HD2  H    2.413  -6.062   4.459 1.00 . A A .  25 LYS HD2  1 1 
       10  5871 1 1 25 LYS HD3  H    2.974  -4.405   4.692 1.00 . A A .  25 LYS HD3  1 1 
       10  5872 1 1 25 LYS HE2  H    0.606  -3.740   5.104 1.00 . A A .  25 LYS HE2  1 1 
       10  5873 1 1 25 LYS HE3  H    0.166  -5.446   5.039 1.00 . A A .  25 LYS HE3  1 1 
       10  5874 1 1 25 LYS HG2  H    2.740  -4.723   2.352 1.00 . A A .  25 LYS HG2  1 1 
       10  5875 1 1 25 LYS HG3  H    1.379  -3.723   2.867 1.00 . A A .  25 LYS HG3  1 1 
       10  5876 1 1 25 LYS HZ1  H    0.449  -4.824   7.307 1.00 . A A .  25 LYS HZ1  1 1 
       10  5877 1 1 25 LYS HZ2  H    1.967  -4.142   7.003 1.00 . A A .  25 LYS HZ2  1 1 
       10  5878 1 1 25 LYS HZ3  H    1.754  -5.815   6.887 1.00 . A A .  25 LYS HZ3  1 1 
       10  5879 1 1 25 LYS N    N   -0.379  -6.476   0.356 1.00 . A A .  25 LYS N    1 1 
       10  5880 1 1 25 LYS NZ   N    1.305  -4.892   6.720 1.00 . A A .  25 LYS NZ   1 1 
       10  5881 1 1 25 LYS O    O    1.870  -3.917  -0.298 1.00 . A A .  25 LYS O    1 1 
       10  5882 1 1 26 SER C    C    3.282  -4.960  -2.284 1.00 . A A .  26 SER C    1 1 
       10  5883 1 1 26 SER CA   C    3.539  -5.956  -1.157 1.00 . A A .  26 SER CA   1 1 
       10  5884 1 1 26 SER CB   C    3.962  -7.306  -1.740 1.00 . A A .  26 SER CB   1 1 
       10  5885 1 1 26 SER H    H    2.096  -7.011  -0.021 1.00 . A A .  26 SER H    1 1 
       10  5886 1 1 26 SER HA   H    4.335  -5.578  -0.532 1.00 . A A .  26 SER HA   1 1 
       10  5887 1 1 26 SER HB2  H    4.637  -7.142  -2.566 1.00 . A A .  26 SER HB2  1 1 
       10  5888 1 1 26 SER HB3  H    4.462  -7.884  -0.976 1.00 . A A .  26 SER HB3  1 1 
       10  5889 1 1 26 SER HG   H    3.124  -8.896  -2.518 1.00 . A A .  26 SER HG   1 1 
       10  5890 1 1 26 SER N    N    2.353  -6.114  -0.323 1.00 . A A .  26 SER N    1 1 
       10  5891 1 1 26 SER O    O    4.092  -4.068  -2.535 1.00 . A A .  26 SER O    1 1 
       10  5892 1 1 26 SER OG   O    2.839  -8.035  -2.204 1.00 . A A .  26 SER OG   1 1 
       10  5893 1 1 27 TYR C    C    1.523  -2.822  -3.561 1.00 . A A .  27 TYR C    1 1 
       10  5894 1 1 27 TYR CA   C    1.786  -4.238  -4.062 1.00 . A A .  27 TYR CA   1 1 
       10  5895 1 1 27 TYR CB   C    0.549  -4.774  -4.784 1.00 . A A .  27 TYR CB   1 1 
       10  5896 1 1 27 TYR CD1  C    1.557  -5.323  -7.034 1.00 . A A .  27 TYR CD1  1 1 
       10  5897 1 1 27 TYR CD2  C    0.491  -7.076  -5.821 1.00 . A A .  27 TYR CD2  1 1 
       10  5898 1 1 27 TYR CE1  C    1.853  -6.203  -8.056 1.00 . A A .  27 TYR CE1  1 1 
       10  5899 1 1 27 TYR CE2  C    0.784  -7.964  -6.838 1.00 . A A .  27 TYR CE2  1 1 
       10  5900 1 1 27 TYR CG   C    0.871  -5.742  -5.901 1.00 . A A .  27 TYR CG   1 1 
       10  5901 1 1 27 TYR CZ   C    1.464  -7.523  -7.954 1.00 . A A .  27 TYR CZ   1 1 
       10  5902 1 1 27 TYR H    H    1.545  -5.851  -2.712 1.00 . A A .  27 TYR H    1 1 
       10  5903 1 1 27 TYR HA   H    2.614  -4.215  -4.755 1.00 . A A .  27 TYR HA   1 1 
       10  5904 1 1 27 TYR HB2  H   -0.081  -5.286  -4.074 1.00 . A A .  27 TYR HB2  1 1 
       10  5905 1 1 27 TYR HB3  H    0.003  -3.945  -5.211 1.00 . A A .  27 TYR HB3  1 1 
       10  5906 1 1 27 TYR HD1  H    1.861  -4.288  -7.110 1.00 . A A .  27 TYR HD1  1 1 
       10  5907 1 1 27 TYR HD2  H   -0.043  -7.418  -4.946 1.00 . A A .  27 TYR HD2  1 1 
       10  5908 1 1 27 TYR HE1  H    2.387  -5.858  -8.929 1.00 . A A .  27 TYR HE1  1 1 
       10  5909 1 1 27 TYR HE2  H    0.479  -8.997  -6.759 1.00 . A A .  27 TYR HE2  1 1 
       10  5910 1 1 27 TYR HH   H    2.054  -9.237  -8.595 1.00 . A A .  27 TYR HH   1 1 
       10  5911 1 1 27 TYR N    N    2.150  -5.121  -2.959 1.00 . A A .  27 TYR N    1 1 
       10  5912 1 1 27 TYR O    O    1.732  -1.846  -4.283 1.00 . A A .  27 TYR O    1 1 
       10  5913 1 1 27 TYR OH   O    1.759  -8.403  -8.969 1.00 . A A .  27 TYR OH   1 1 
       10  5914 1 1 28 LEU C    C    2.056  -0.701  -1.321 1.00 . A A .  28 LEU C    1 1 
       10  5915 1 1 28 LEU CA   C    0.771  -1.419  -1.719 1.00 . A A .  28 LEU CA   1 1 
       10  5916 1 1 28 LEU CB   C   -0.130  -1.592  -0.495 1.00 . A A .  28 LEU CB   1 1 
       10  5917 1 1 28 LEU CD1  C   -1.047   0.738  -0.382 1.00 . A A .  28 LEU CD1  1 1 
       10  5918 1 1 28 LEU CD2  C   -1.067  -0.711   1.657 1.00 . A A .  28 LEU CD2  1 1 
       10  5919 1 1 28 LEU CG   C   -0.315  -0.354   0.383 1.00 . A A .  28 LEU CG   1 1 
       10  5920 1 1 28 LEU H    H    0.916  -3.529  -1.793 1.00 . A A .  28 LEU H    1 1 
       10  5921 1 1 28 LEU HA   H    0.253  -0.822  -2.456 1.00 . A A .  28 LEU HA   1 1 
       10  5922 1 1 28 LEU HB2  H   -1.104  -1.900  -0.842 1.00 . A A .  28 LEU HB2  1 1 
       10  5923 1 1 28 LEU HB3  H    0.295  -2.374   0.119 1.00 . A A .  28 LEU HB3  1 1 
       10  5924 1 1 28 LEU HD11 H   -2.049   0.839   0.006 1.00 . A A .  28 LEU HD11 1 1 
       10  5925 1 1 28 LEU HD12 H   -1.091   0.476  -1.429 1.00 . A A .  28 LEU HD12 1 1 
       10  5926 1 1 28 LEU HD13 H   -0.519   1.673  -0.267 1.00 . A A .  28 LEU HD13 1 1 
       10  5927 1 1 28 LEU HD21 H   -0.938   0.077   2.383 1.00 . A A .  28 LEU HD21 1 1 
       10  5928 1 1 28 LEU HD22 H   -0.678  -1.636   2.056 1.00 . A A .  28 LEU HD22 1 1 
       10  5929 1 1 28 LEU HD23 H   -2.118  -0.828   1.434 1.00 . A A .  28 LEU HD23 1 1 
       10  5930 1 1 28 LEU HG   H    0.656   0.030   0.663 1.00 . A A .  28 LEU HG   1 1 
       10  5931 1 1 28 LEU N    N    1.063  -2.716  -2.319 1.00 . A A .  28 LEU N    1 1 
       10  5932 1 1 28 LEU O    O    2.141   0.526  -1.390 1.00 . A A .  28 LEU O    1 1 
       10  5933 1 1 29 ILE C    C    5.072  -0.303  -1.692 1.00 . A A .  29 ILE C    1 1 
       10  5934 1 1 29 ILE CA   C    4.337  -0.911  -0.502 1.00 . A A .  29 ILE CA   1 1 
       10  5935 1 1 29 ILE CB   C    5.237  -1.976   0.153 1.00 . A A .  29 ILE CB   1 1 
       10  5936 1 1 29 ILE CD1  C    4.315  -1.765   2.516 1.00 . A A .  29 ILE CD1  1 1 
       10  5937 1 1 29 ILE CG1  C    4.501  -2.657   1.308 1.00 . A A .  29 ILE CG1  1 1 
       10  5938 1 1 29 ILE CG2  C    6.533  -1.346   0.641 1.00 . A A .  29 ILE CG2  1 1 
       10  5939 1 1 29 ILE H    H    2.927  -2.444  -0.874 1.00 . A A .  29 ILE H    1 1 
       10  5940 1 1 29 ILE HA   H    4.146  -0.134   0.224 1.00 . A A .  29 ILE HA   1 1 
       10  5941 1 1 29 ILE HB   H    5.483  -2.716  -0.593 1.00 . A A .  29 ILE HB   1 1 
       10  5942 1 1 29 ILE HD11 H    4.873  -2.167   3.350 1.00 . A A .  29 ILE HD11 1 1 
       10  5943 1 1 29 ILE HD12 H    4.675  -0.772   2.289 1.00 . A A .  29 ILE HD12 1 1 
       10  5944 1 1 29 ILE HD13 H    3.268  -1.719   2.773 1.00 . A A .  29 ILE HD13 1 1 
       10  5945 1 1 29 ILE HG12 H    3.524  -2.966   0.972 1.00 . A A .  29 ILE HG12 1 1 
       10  5946 1 1 29 ILE HG13 H    5.061  -3.526   1.620 1.00 . A A .  29 ILE HG13 1 1 
       10  5947 1 1 29 ILE HG21 H    7.046  -2.039   1.292 1.00 . A A .  29 ILE HG21 1 1 
       10  5948 1 1 29 ILE HG22 H    7.162  -1.116  -0.205 1.00 . A A .  29 ILE HG22 1 1 
       10  5949 1 1 29 ILE HG23 H    6.311  -0.439   1.183 1.00 . A A .  29 ILE HG23 1 1 
       10  5950 1 1 29 ILE N    N    3.055  -1.473  -0.907 1.00 . A A .  29 ILE N    1 1 
       10  5951 1 1 29 ILE O    O    5.511   0.846  -1.642 1.00 . A A .  29 ILE O    1 1 
       10  5952 1 1 30 ILE C    C    5.326   0.726  -4.426 1.00 . A A .  30 ILE C    1 1 
       10  5953 1 1 30 ILE CA   C    5.879  -0.618  -3.965 1.00 . A A .  30 ILE CA   1 1 
       10  5954 1 1 30 ILE CB   C    5.746  -1.636  -5.113 1.00 . A A .  30 ILE CB   1 1 
       10  5955 1 1 30 ILE CD1  C    5.911  -4.128  -5.605 1.00 . A A .  30 ILE CD1  1 1 
       10  5956 1 1 30 ILE CG1  C    6.311  -2.993  -4.689 1.00 . A A .  30 ILE CG1  1 1 
       10  5957 1 1 30 ILE CG2  C    6.456  -1.126  -6.358 1.00 . A A .  30 ILE CG2  1 1 
       10  5958 1 1 30 ILE H    H    4.830  -1.988  -2.740 1.00 . A A .  30 ILE H    1 1 
       10  5959 1 1 30 ILE HA   H    6.928  -0.503  -3.733 1.00 . A A .  30 ILE HA   1 1 
       10  5960 1 1 30 ILE HB   H    4.698  -1.748  -5.346 1.00 . A A .  30 ILE HB   1 1 
       10  5961 1 1 30 ILE HD11 H    6.794  -4.545  -6.069 1.00 . A A .  30 ILE HD11 1 1 
       10  5962 1 1 30 ILE HD12 H    5.410  -4.895  -5.032 1.00 . A A .  30 ILE HD12 1 1 
       10  5963 1 1 30 ILE HD13 H    5.245  -3.756  -6.370 1.00 . A A .  30 ILE HD13 1 1 
       10  5964 1 1 30 ILE HG12 H    7.389  -2.940  -4.679 1.00 . A A .  30 ILE HG12 1 1 
       10  5965 1 1 30 ILE HG13 H    5.958  -3.227  -3.695 1.00 . A A .  30 ILE HG13 1 1 
       10  5966 1 1 30 ILE HG21 H    6.372  -0.050  -6.405 1.00 . A A .  30 ILE HG21 1 1 
       10  5967 1 1 30 ILE HG22 H    7.498  -1.404  -6.317 1.00 . A A .  30 ILE HG22 1 1 
       10  5968 1 1 30 ILE HG23 H    6.001  -1.561  -7.236 1.00 . A A .  30 ILE HG23 1 1 
       10  5969 1 1 30 ILE N    N    5.200  -1.081  -2.761 1.00 . A A .  30 ILE N    1 1 
       10  5970 1 1 30 ILE O    O    6.066   1.581  -4.913 1.00 . A A .  30 ILE O    1 1 
       10  5971 1 1 31 HIS C    C    3.779   3.298  -3.749 1.00 . A A .  31 HIS C    1 1 
       10  5972 1 1 31 HIS CA   C    3.365   2.149  -4.664 1.00 . A A .  31 HIS CA   1 1 
       10  5973 1 1 31 HIS CB   C    1.845   1.982  -4.637 1.00 . A A .  31 HIS CB   1 1 
       10  5974 1 1 31 HIS CD2  C    0.571   4.070  -3.776 1.00 . A A .  31 HIS CD2  1 1 
       10  5975 1 1 31 HIS CE1  C    0.153   5.012  -5.711 1.00 . A A .  31 HIS CE1  1 1 
       10  5976 1 1 31 HIS CG   C    1.099   3.276  -4.737 1.00 . A A .  31 HIS CG   1 1 
       10  5977 1 1 31 HIS H    H    3.481   0.189  -3.873 1.00 . A A .  31 HIS H    1 1 
       10  5978 1 1 31 HIS HA   H    3.675   2.379  -5.672 1.00 . A A .  31 HIS HA   1 1 
       10  5979 1 1 31 HIS HB2  H    1.543   1.361  -5.468 1.00 . A A .  31 HIS HB2  1 1 
       10  5980 1 1 31 HIS HB3  H    1.559   1.503  -3.712 1.00 . A A .  31 HIS HB3  1 1 
       10  5981 1 1 31 HIS HD1  H    1.072   3.563  -6.824 1.00 . A A .  31 HIS HD1  1 1 
       10  5982 1 1 31 HIS HD2  H    0.601   3.894  -2.709 1.00 . A A .  31 HIS HD2  1 1 
       10  5983 1 1 31 HIS HE1  H   -0.198   5.702  -6.463 1.00 . A A .  31 HIS HE1  1 1 
       10  5984 1 1 31 HIS N    N    4.018   0.907  -4.267 1.00 . A A .  31 HIS N    1 1 
       10  5985 1 1 31 HIS ND1  N    0.819   3.894  -5.938 1.00 . A A .  31 HIS ND1  1 1 
       10  5986 1 1 31 HIS NE2  N   -0.011   5.142  -4.407 1.00 . A A .  31 HIS NE2  1 1 
       10  5987 1 1 31 HIS O    O    4.099   4.390  -4.215 1.00 . A A .  31 HIS O    1 1 
       10  5988 1 1 32 MET C    C    5.525   4.622  -1.771 1.00 . A A .  32 MET C    1 1 
       10  5989 1 1 32 MET CA   C    4.142   4.054  -1.465 1.00 . A A .  32 MET CA   1 1 
       10  5990 1 1 32 MET CB   C    4.122   3.462  -0.054 1.00 . A A .  32 MET CB   1 1 
       10  5991 1 1 32 MET CE   C    0.724   5.361   1.168 1.00 . A A .  32 MET CE   1 1 
       10  5992 1 1 32 MET CG   C    2.770   3.571   0.631 1.00 . A A .  32 MET CG   1 1 
       10  5993 1 1 32 MET H    H    3.503   2.151  -2.134 1.00 . A A .  32 MET H    1 1 
       10  5994 1 1 32 MET HA   H    3.418   4.853  -1.520 1.00 . A A .  32 MET HA   1 1 
       10  5995 1 1 32 MET HB2  H    4.390   2.418  -0.111 1.00 . A A .  32 MET HB2  1 1 
       10  5996 1 1 32 MET HB3  H    4.851   3.980   0.552 1.00 . A A .  32 MET HB3  1 1 
       10  5997 1 1 32 MET HE1  H    0.518   5.913   0.263 1.00 . A A .  32 MET HE1  1 1 
       10  5998 1 1 32 MET HE2  H    0.273   4.382   1.103 1.00 . A A .  32 MET HE2  1 1 
       10  5999 1 1 32 MET HE3  H    0.313   5.891   2.015 1.00 . A A .  32 MET HE3  1 1 
       10  6000 1 1 32 MET HG2  H    1.995   3.389  -0.099 1.00 . A A .  32 MET HG2  1 1 
       10  6001 1 1 32 MET HG3  H    2.714   2.820   1.406 1.00 . A A .  32 MET HG3  1 1 
       10  6002 1 1 32 MET N    N    3.768   3.042  -2.445 1.00 . A A .  32 MET N    1 1 
       10  6003 1 1 32 MET O    O    5.854   5.734  -1.359 1.00 . A A .  32 MET O    1 1 
       10  6004 1 1 32 MET SD   S    2.495   5.191   1.373 1.00 . A A .  32 MET SD   1 1 
       10  6005 1 1 33 ARG C    C    7.643   5.593  -3.626 1.00 . A A .  33 ARG C    1 1 
       10  6006 1 1 33 ARG CA   C    7.677   4.277  -2.854 1.00 . A A .  33 ARG CA   1 1 
       10  6007 1 1 33 ARG CB   C    8.369   3.200  -3.691 1.00 . A A .  33 ARG CB   1 1 
       10  6008 1 1 33 ARG CD   C    9.135   0.813  -3.867 1.00 . A A .  33 ARG CD   1 1 
       10  6009 1 1 33 ARG CG   C    8.559   1.884  -2.954 1.00 . A A .  33 ARG CG   1 1 
       10  6010 1 1 33 ARG CZ   C    9.615  -1.595  -3.752 1.00 . A A .  33 ARG CZ   1 1 
       10  6011 1 1 33 ARG H    H    6.010   2.974  -2.794 1.00 . A A .  33 ARG H    1 1 
       10  6012 1 1 33 ARG HA   H    8.233   4.423  -1.941 1.00 . A A .  33 ARG HA   1 1 
       10  6013 1 1 33 ARG HB2  H    7.776   3.010  -4.574 1.00 . A A .  33 ARG HB2  1 1 
       10  6014 1 1 33 ARG HB3  H    9.340   3.563  -3.992 1.00 . A A .  33 ARG HB3  1 1 
       10  6015 1 1 33 ARG HD2  H    8.427   0.614  -4.658 1.00 . A A .  33 ARG HD2  1 1 
       10  6016 1 1 33 ARG HD3  H   10.057   1.179  -4.293 1.00 . A A .  33 ARG HD3  1 1 
       10  6017 1 1 33 ARG HE   H    9.429  -0.393  -2.171 1.00 . A A .  33 ARG HE   1 1 
       10  6018 1 1 33 ARG HG2  H    9.238   2.040  -2.128 1.00 . A A .  33 ARG HG2  1 1 
       10  6019 1 1 33 ARG HG3  H    7.603   1.551  -2.580 1.00 . A A .  33 ARG HG3  1 1 
       10  6020 1 1 33 ARG HH11 H    9.409  -0.858  -5.621 1.00 . A A .  33 ARG HH11 1 1 
       10  6021 1 1 33 ARG HH12 H    9.748  -2.555  -5.526 1.00 . A A .  33 ARG HH12 1 1 
       10  6022 1 1 33 ARG HH21 H    9.876  -2.626  -2.032 1.00 . A A .  33 ARG HH21 1 1 
       10  6023 1 1 33 ARG HH22 H   10.012  -3.559  -3.484 1.00 . A A .  33 ARG HH22 1 1 
       10  6024 1 1 33 ARG N    N    6.329   3.851  -2.495 1.00 . A A .  33 ARG N    1 1 
       10  6025 1 1 33 ARG NE   N    9.404  -0.430  -3.150 1.00 . A A .  33 ARG NE   1 1 
       10  6026 1 1 33 ARG NH1  N    9.588  -1.676  -5.075 1.00 . A A .  33 ARG NH1  1 1 
       10  6027 1 1 33 ARG NH2  N    9.854  -2.683  -3.030 1.00 . A A .  33 ARG NH2  1 1 
       10  6028 1 1 33 ARG O    O    8.569   6.400  -3.540 1.00 . A A .  33 ARG O    1 1 
       10  6029 1 1 34 THR C    C    6.111   8.218  -4.278 1.00 . A A .  34 THR C    1 1 
       10  6030 1 1 34 THR CA   C    6.415   7.019  -5.169 1.00 . A A .  34 THR CA   1 1 
       10  6031 1 1 34 THR CB   C    5.293   6.873  -6.214 1.00 . A A .  34 THR CB   1 1 
       10  6032 1 1 34 THR CG2  C    5.541   5.670  -7.111 1.00 . A A .  34 THR CG2  1 1 
       10  6033 1 1 34 THR H    H    5.865   5.122  -4.409 1.00 . A A .  34 THR H    1 1 
       10  6034 1 1 34 THR HA   H    7.344   7.198  -5.692 1.00 . A A .  34 THR HA   1 1 
       10  6035 1 1 34 THR HB   H    5.274   7.763  -6.827 1.00 . A A .  34 THR HB   1 1 
       10  6036 1 1 34 THR HG1  H    3.352   6.521  -6.206 1.00 . A A .  34 THR HG1  1 1 
       10  6037 1 1 34 THR HG21 H    6.597   5.446  -7.127 1.00 . A A .  34 THR HG21 1 1 
       10  6038 1 1 34 THR HG22 H    5.205   5.892  -8.113 1.00 . A A .  34 THR HG22 1 1 
       10  6039 1 1 34 THR HG23 H    4.998   4.818  -6.729 1.00 . A A .  34 THR HG23 1 1 
       10  6040 1 1 34 THR N    N    6.569   5.803  -4.381 1.00 . A A .  34 THR N    1 1 
       10  6041 1 1 34 THR O    O    6.669   9.300  -4.463 1.00 . A A .  34 THR O    1 1 
       10  6042 1 1 34 THR OG1  O    4.028   6.732  -5.557 1.00 . A A .  34 THR OG1  1 1 
       10  6043 1 1 35 HIS C    C    6.020   9.465  -1.488 1.00 . A A .  35 HIS C    1 1 
       10  6044 1 1 35 HIS CA   C    4.847   9.083  -2.386 1.00 . A A .  35 HIS CA   1 1 
       10  6045 1 1 35 HIS CB   C    3.655   8.649  -1.532 1.00 . A A .  35 HIS CB   1 1 
       10  6046 1 1 35 HIS CD2  C    1.546   7.460  -2.460 1.00 . A A .  35 HIS CD2  1 1 
       10  6047 1 1 35 HIS CE1  C    0.716   9.132  -3.610 1.00 . A A .  35 HIS CE1  1 1 
       10  6048 1 1 35 HIS CG   C    2.381   8.514  -2.306 1.00 . A A .  35 HIS CG   1 1 
       10  6049 1 1 35 HIS H    H    4.813   7.134  -3.211 1.00 . A A .  35 HIS H    1 1 
       10  6050 1 1 35 HIS HA   H    4.564   9.945  -2.972 1.00 . A A .  35 HIS HA   1 1 
       10  6051 1 1 35 HIS HB2  H    3.873   7.691  -1.083 1.00 . A A .  35 HIS HB2  1 1 
       10  6052 1 1 35 HIS HB3  H    3.495   9.379  -0.752 1.00 . A A .  35 HIS HB3  1 1 
       10  6053 1 1 35 HIS HD1  H    2.207  10.446  -3.128 1.00 . A A .  35 HIS HD1  1 1 
       10  6054 1 1 35 HIS HD2  H    1.664   6.478  -2.023 1.00 . A A .  35 HIS HD2  1 1 
       10  6055 1 1 35 HIS HE1  H    0.072   9.724  -4.244 1.00 . A A .  35 HIS HE1  1 1 
       10  6056 1 1 35 HIS N    N    5.224   8.018  -3.308 1.00 . A A .  35 HIS N    1 1 
       10  6057 1 1 35 HIS ND1  N    1.833   9.545  -3.040 1.00 . A A .  35 HIS ND1  1 1 
       10  6058 1 1 35 HIS NE2  N    0.519   7.870  -3.275 1.00 . A A .  35 HIS NE2  1 1 
       10  6059 1 1 35 HIS O    O    6.393  10.634  -1.401 1.00 . A A .  35 HIS O    1 1 
       10  6060 1 1 36 SER C    C    9.000   8.966  -0.717 1.00 . A A .  36 SER C    1 1 
       10  6061 1 1 36 SER CA   C    7.723   8.702   0.075 1.00 . A A .  36 SER CA   1 1 
       10  6062 1 1 36 SER CB   C    7.922   7.500   1.000 1.00 . A A .  36 SER CB   1 1 
       10  6063 1 1 36 SER H    H    6.252   7.558  -0.931 1.00 . A A .  36 SER H    1 1 
       10  6064 1 1 36 SER HA   H    7.498   9.572   0.673 1.00 . A A .  36 SER HA   1 1 
       10  6065 1 1 36 SER HB2  H    8.226   6.645   0.416 1.00 . A A .  36 SER HB2  1 1 
       10  6066 1 1 36 SER HB3  H    8.689   7.731   1.726 1.00 . A A .  36 SER HB3  1 1 
       10  6067 1 1 36 SER HG   H    6.307   6.425   1.268 1.00 . A A .  36 SER HG   1 1 
       10  6068 1 1 36 SER N    N    6.596   8.470  -0.820 1.00 . A A .  36 SER N    1 1 
       10  6069 1 1 36 SER O    O    9.374   8.185  -1.592 1.00 . A A .  36 SER O    1 1 
       10  6070 1 1 36 SER OG   O    6.724   7.181   1.687 1.00 . A A .  36 SER OG   1 1 
       10  6071 1 1 37 GLY C    C   11.432  11.775  -0.673 1.00 . A A .  37 GLY C    1 1 
       10  6072 1 1 37 GLY CA   C   10.894  10.421  -1.093 1.00 . A A .  37 GLY CA   1 1 
       10  6073 1 1 37 GLY H    H    9.321  10.658   0.304 1.00 . A A .  37 GLY H    1 1 
       10  6074 1 1 37 GLY HA2  H   11.639   9.668  -0.882 1.00 . A A .  37 GLY HA2  1 1 
       10  6075 1 1 37 GLY HA3  H   10.704  10.437  -2.156 1.00 . A A .  37 GLY HA3  1 1 
       10  6076 1 1 37 GLY N    N    9.666  10.073  -0.403 1.00 . A A .  37 GLY N    1 1 
       10  6077 1 1 37 GLY O    O   11.097  12.795  -1.273 1.00 . A A .  37 GLY O    1 1 
       10  6078 1 1 38 GLU C    C   13.902  12.737   1.929 1.00 . A A .  38 GLU C    1 1 
       10  6079 1 1 38 GLU CA   C   12.848  13.022   0.863 1.00 . A A .  38 GLU CA   1 1 
       10  6080 1 1 38 GLU CB   C   11.757  13.928   1.439 1.00 . A A .  38 GLU CB   1 1 
       10  6081 1 1 38 GLU CD   C   11.041  16.302   1.921 1.00 . A A .  38 GLU CD   1 1 
       10  6082 1 1 38 GLU CG   C   12.200  15.369   1.629 1.00 . A A .  38 GLU CG   1 1 
       10  6083 1 1 38 GLU H    H   12.494  10.936   0.799 1.00 . A A .  38 GLU H    1 1 
       10  6084 1 1 38 GLU HA   H   13.320  13.526   0.033 1.00 . A A .  38 GLU HA   1 1 
       10  6085 1 1 38 GLU HB2  H   10.909  13.919   0.771 1.00 . A A .  38 GLU HB2  1 1 
       10  6086 1 1 38 GLU HB3  H   11.453  13.538   2.399 1.00 . A A .  38 GLU HB3  1 1 
       10  6087 1 1 38 GLU HG2  H   12.894  15.413   2.455 1.00 . A A .  38 GLU HG2  1 1 
       10  6088 1 1 38 GLU HG3  H   12.694  15.702   0.728 1.00 . A A .  38 GLU HG3  1 1 
       10  6089 1 1 38 GLU N    N   12.266  11.783   0.362 1.00 . A A .  38 GLU N    1 1 
       10  6090 1 1 38 GLU O    O   13.589  12.240   3.011 1.00 . A A .  38 GLU O    1 1 
       10  6091 1 1 38 GLU OE1  O   10.171  16.462   1.040 1.00 . A A .  38 GLU OE1  1 1 
       10  6092 1 1 38 GLU OE2  O   11.004  16.872   3.032 1.00 . A A .  38 GLU OE2  1 1 
       10  6093 1 1 39 LYS C    C   17.190  14.038   2.576 1.00 . A A .  39 LYS C    1 1 
       10  6094 1 1 39 LYS CA   C   16.256  12.832   2.543 1.00 . A A .  39 LYS CA   1 1 
       10  6095 1 1 39 LYS CB   C   17.039  11.578   2.148 1.00 . A A .  39 LYS CB   1 1 
       10  6096 1 1 39 LYS CD   C   19.350  10.594   2.129 1.00 . A A .  39 LYS CD   1 1 
       10  6097 1 1 39 LYS CE   C   20.644  10.410   2.908 1.00 . A A .  39 LYS CE   1 1 
       10  6098 1 1 39 LYS CG   C   18.335  11.402   2.921 1.00 . A A .  39 LYS CG   1 1 
       10  6099 1 1 39 LYS H    H   15.341  13.447   0.736 1.00 . A A .  39 LYS H    1 1 
       10  6100 1 1 39 LYS HA   H   15.837  12.689   3.527 1.00 . A A .  39 LYS HA   1 1 
       10  6101 1 1 39 LYS HB2  H   16.419  10.711   2.323 1.00 . A A .  39 LYS HB2  1 1 
       10  6102 1 1 39 LYS HB3  H   17.277  11.634   1.095 1.00 . A A .  39 LYS HB3  1 1 
       10  6103 1 1 39 LYS HD2  H   18.933   9.622   1.911 1.00 . A A .  39 LYS HD2  1 1 
       10  6104 1 1 39 LYS HD3  H   19.567  11.111   1.205 1.00 . A A .  39 LYS HD3  1 1 
       10  6105 1 1 39 LYS HE2  H   21.284  11.260   2.723 1.00 . A A .  39 LYS HE2  1 1 
       10  6106 1 1 39 LYS HE3  H   20.411  10.357   3.961 1.00 . A A .  39 LYS HE3  1 1 
       10  6107 1 1 39 LYS HG2  H   18.752  12.375   3.133 1.00 . A A .  39 LYS HG2  1 1 
       10  6108 1 1 39 LYS HG3  H   18.123  10.888   3.848 1.00 . A A .  39 LYS HG3  1 1 
       10  6109 1 1 39 LYS HZ1  H   20.902   8.743   1.675 1.00 . A A .  39 LYS HZ1  1 1 
       10  6110 1 1 39 LYS HZ2  H   21.346   8.480   3.286 1.00 . A A .  39 LYS HZ2  1 1 
       10  6111 1 1 39 LYS HZ3  H   22.349   9.386   2.270 1.00 . A A .  39 LYS HZ3  1 1 
       10  6112 1 1 39 LYS N    N   15.154  13.053   1.614 1.00 . A A .  39 LYS N    1 1 
       10  6113 1 1 39 LYS NZ   N   21.360   9.168   2.506 1.00 . A A .  39 LYS NZ   1 1 
       10  6114 1 1 39 LYS O    O   17.443  14.685   1.560 1.00 . A A .  39 LYS O    1 1 
       10  6115 1 1 40 PRO C    C   19.991  15.236   3.318 1.00 . A A .  40 PRO C    1 1 
       10  6116 1 1 40 PRO CA   C   18.631  15.476   3.964 1.00 . A A .  40 PRO CA   1 1 
       10  6117 1 1 40 PRO CB   C   18.770  15.564   5.486 1.00 . A A .  40 PRO CB   1 1 
       10  6118 1 1 40 PRO CD   C   17.457  13.620   5.024 1.00 . A A .  40 PRO CD   1 1 
       10  6119 1 1 40 PRO CG   C   18.477  14.186   5.973 1.00 . A A .  40 PRO CG   1 1 
       10  6120 1 1 40 PRO HA   H   18.211  16.397   3.585 1.00 . A A .  40 PRO HA   1 1 
       10  6121 1 1 40 PRO HB2  H   19.775  15.869   5.741 1.00 . A A .  40 PRO HB2  1 1 
       10  6122 1 1 40 PRO HB3  H   18.061  16.279   5.875 1.00 . A A .  40 PRO HB3  1 1 
       10  6123 1 1 40 PRO HD2  H   17.611  12.559   4.893 1.00 . A A .  40 PRO HD2  1 1 
       10  6124 1 1 40 PRO HD3  H   16.458  13.816   5.384 1.00 . A A .  40 PRO HD3  1 1 
       10  6125 1 1 40 PRO HG2  H   19.377  13.591   5.954 1.00 . A A .  40 PRO HG2  1 1 
       10  6126 1 1 40 PRO HG3  H   18.075  14.229   6.974 1.00 . A A .  40 PRO HG3  1 1 
       10  6127 1 1 40 PRO N    N   17.715  14.348   3.771 1.00 . A A .  40 PRO N    1 1 
       10  6128 1 1 40 PRO O    O   20.252  14.160   2.780 1.00 . A A .  40 PRO O    1 1 
       10  6129 1 1 41 SER C    C   23.214  15.750   3.849 1.00 . A A .  41 SER C    1 1 
       10  6130 1 1 41 SER CA   C   22.187  16.145   2.792 1.00 . A A .  41 SER CA   1 1 
       10  6131 1 1 41 SER CB   C   22.587  17.474   2.148 1.00 . A A .  41 SER CB   1 1 
       10  6132 1 1 41 SER H    H   20.587  17.078   3.817 1.00 . A A .  41 SER H    1 1 
       10  6133 1 1 41 SER HA   H   22.159  15.380   2.030 1.00 . A A .  41 SER HA   1 1 
       10  6134 1 1 41 SER HB2  H   21.883  17.718   1.367 1.00 . A A .  41 SER HB2  1 1 
       10  6135 1 1 41 SER HB3  H   22.578  18.251   2.898 1.00 . A A .  41 SER HB3  1 1 
       10  6136 1 1 41 SER HG   H   23.997  16.549   1.150 1.00 . A A .  41 SER HG   1 1 
       10  6137 1 1 41 SER N    N   20.855  16.245   3.375 1.00 . A A .  41 SER N    1 1 
       10  6138 1 1 41 SER O    O   24.062  14.889   3.616 1.00 . A A .  41 SER O    1 1 
       10  6139 1 1 41 SER OG   O   23.885  17.398   1.585 1.00 . A A .  41 SER OG   1 1 
       10  6140 1 1 42 GLY C    C   23.355  15.851   7.411 1.00 . A A .  42 GLY C    1 1 
       10  6141 1 1 42 GLY CA   C   24.058  16.089   6.090 1.00 . A A .  42 GLY CA   1 1 
       10  6142 1 1 42 GLY H    H   22.434  17.064   5.142 1.00 . A A .  42 GLY H    1 1 
       10  6143 1 1 42 GLY HA2  H   24.622  15.206   5.830 1.00 . A A .  42 GLY HA2  1 1 
       10  6144 1 1 42 GLY HA3  H   24.739  16.920   6.202 1.00 . A A .  42 GLY HA3  1 1 
       10  6145 1 1 42 GLY N    N   23.131  16.386   5.013 1.00 . A A .  42 GLY N    1 1 
       10  6146 1 1 42 GLY O    O   22.958  14.732   7.735 1.00 . A A .  42 GLY O    1 1 
       10  6147 1 1 43 PRO C    C   21.036  16.591   9.388 1.00 . A A .  43 PRO C    1 1 
       10  6148 1 1 43 PRO CA   C   22.533  16.851   9.508 1.00 . A A .  43 PRO CA   1 1 
       10  6149 1 1 43 PRO CB   C   22.789  18.234  10.112 1.00 . A A .  43 PRO CB   1 1 
       10  6150 1 1 43 PRO CD   C   23.641  18.288   7.879 1.00 . A A .  43 PRO CD   1 1 
       10  6151 1 1 43 PRO CG   C   22.983  19.130   8.937 1.00 . A A .  43 PRO CG   1 1 
       10  6152 1 1 43 PRO HA   H   22.980  16.094  10.136 1.00 . A A .  43 PRO HA   1 1 
       10  6153 1 1 43 PRO HB2  H   21.936  18.535  10.703 1.00 . A A .  43 PRO HB2  1 1 
       10  6154 1 1 43 PRO HB3  H   23.672  18.202  10.733 1.00 . A A .  43 PRO HB3  1 1 
       10  6155 1 1 43 PRO HD2  H   23.301  18.584   6.897 1.00 . A A .  43 PRO HD2  1 1 
       10  6156 1 1 43 PRO HD3  H   24.716  18.367   7.948 1.00 . A A .  43 PRO HD3  1 1 
       10  6157 1 1 43 PRO HG2  H   22.027  19.491   8.589 1.00 . A A .  43 PRO HG2  1 1 
       10  6158 1 1 43 PRO HG3  H   23.622  19.957   9.209 1.00 . A A .  43 PRO HG3  1 1 
       10  6159 1 1 43 PRO N    N   23.193  16.923   8.201 1.00 . A A .  43 PRO N    1 1 
       10  6160 1 1 43 PRO O    O   20.247  17.520   9.215 1.00 . A A .  43 PRO O    1 1 
       10  6161 1 1 44 SER C    C   18.457  15.449  10.583 1.00 . A A .  44 SER C    1 1 
       10  6162 1 1 44 SER CA   C   19.247  14.940   9.381 1.00 . A A .  44 SER CA   1 1 
       10  6163 1 1 44 SER CB   C   19.117  13.419   9.279 1.00 . A A .  44 SER CB   1 1 
       10  6164 1 1 44 SER H    H   21.327  14.626   9.621 1.00 . A A .  44 SER H    1 1 
       10  6165 1 1 44 SER HA   H   18.845  15.388   8.485 1.00 . A A .  44 SER HA   1 1 
       10  6166 1 1 44 SER HB2  H   19.745  13.060   8.478 1.00 . A A .  44 SER HB2  1 1 
       10  6167 1 1 44 SER HB3  H   19.429  12.970  10.211 1.00 . A A .  44 SER HB3  1 1 
       10  6168 1 1 44 SER HG   H   17.739  12.559   8.183 1.00 . A A .  44 SER HG   1 1 
       10  6169 1 1 44 SER N    N   20.650  15.322   9.483 1.00 . A A .  44 SER N    1 1 
       10  6170 1 1 44 SER O    O   19.007  15.632  11.669 1.00 . A A .  44 SER O    1 1 
       10  6171 1 1 44 SER OG   O   17.778  13.038   9.014 1.00 . A A .  44 SER OG   1 1 
       10  6172 1 1 45 SER C    C   16.173  15.139  12.563 1.00 . A A .  45 SER C    1 1 
       10  6173 1 1 45 SER CA   C   16.297  16.169  11.445 1.00 . A A .  45 SER CA   1 1 
       10  6174 1 1 45 SER CB   C   14.912  16.505  10.889 1.00 . A A .  45 SER CB   1 1 
       10  6175 1 1 45 SER H    H   16.783  15.512   9.491 1.00 . A A .  45 SER H    1 1 
       10  6176 1 1 45 SER HA   H   16.743  17.067  11.846 1.00 . A A .  45 SER HA   1 1 
       10  6177 1 1 45 SER HB2  H   15.014  17.207  10.076 1.00 . A A .  45 SER HB2  1 1 
       10  6178 1 1 45 SER HB3  H   14.442  15.601  10.528 1.00 . A A .  45 SER HB3  1 1 
       10  6179 1 1 45 SER HG   H   13.608  17.825  11.519 1.00 . A A .  45 SER HG   1 1 
       10  6180 1 1 45 SER N    N   17.163  15.677  10.380 1.00 . A A .  45 SER N    1 1 
       10  6181 1 1 45 SER O    O   16.328  15.462  13.740 1.00 . A A .  45 SER O    1 1 
       10  6182 1 1 45 SER OG   O   14.088  17.080  11.889 1.00 . A A .  45 SER OG   1 1 
       10  6183 1 1 46 GLY C    C   15.153  11.574  12.577 1.00 . A A .  46 GLY C    1 1 
       10  6184 1 1 46 GLY CA   C   15.749  12.836  13.168 1.00 . A A .  46 GLY CA   1 1 
       10  6185 1 1 46 GLY H    H   15.777  13.696  11.233 1.00 . A A .  46 GLY H    1 1 
       10  6186 1 1 46 GLY HA2  H   16.722  12.606  13.575 1.00 . A A .  46 GLY HA2  1 1 
       10  6187 1 1 46 GLY HA3  H   15.109  13.183  13.965 1.00 . A A .  46 GLY HA3  1 1 
       10  6188 1 1 46 GLY N    N   15.890  13.895  12.186 1.00 . A A .  46 GLY N    1 1 
       10  6189 1 1 46 GLY O    O   13.952  11.545  12.314 1.00 . A A .  46 GLY O    1 1 
       10  6190 2 2  1 ZN  ZN   ZN  -1.049   6.615  -3.329 1.00 . B A . 201 ZN  ZN   1 1 
       11  6191 1 1  1 GLY C    C  -32.070  -3.192  -0.679 1.00 . A A .   1 GLY C    1 1 
       11  6192 1 1  1 GLY CA   C  -33.516  -2.736  -0.698 1.00 . A A .   1 GLY CA   1 1 
       11  6193 1 1  1 GLY H1   H  -34.110  -4.680  -1.293 1.00 . A A .   1 GLY H1   1 1 
       11  6194 1 1  1 GLY HA2  H  -33.595  -1.848  -1.306 1.00 . A A .   1 GLY HA2  1 1 
       11  6195 1 1  1 GLY HA3  H  -33.819  -2.498   0.312 1.00 . A A .   1 GLY HA3  1 1 
       11  6196 1 1  1 GLY N    N  -34.410  -3.749  -1.228 1.00 . A A .   1 GLY N    1 1 
       11  6197 1 1  1 GLY O    O  -31.515  -3.475   0.382 1.00 . A A .   1 GLY O    1 1 
       11  6198 1 1  2 SER C    C  -29.319  -2.835  -2.986 1.00 . A A .   2 SER C    1 1 
       11  6199 1 1  2 SER CA   C  -30.071  -3.693  -1.973 1.00 . A A .   2 SER CA   1 1 
       11  6200 1 1  2 SER CB   C  -30.003  -5.165  -2.385 1.00 . A A .   2 SER CB   1 1 
       11  6201 1 1  2 SER H    H  -31.955  -3.024  -2.668 1.00 . A A .   2 SER H    1 1 
       11  6202 1 1  2 SER HA   H  -29.606  -3.577  -1.005 1.00 . A A .   2 SER HA   1 1 
       11  6203 1 1  2 SER HB2  H  -28.999  -5.532  -2.235 1.00 . A A .   2 SER HB2  1 1 
       11  6204 1 1  2 SER HB3  H  -30.690  -5.738  -1.779 1.00 . A A .   2 SER HB3  1 1 
       11  6205 1 1  2 SER HG   H  -29.554  -5.311  -4.286 1.00 . A A .   2 SER HG   1 1 
       11  6206 1 1  2 SER N    N  -31.459  -3.264  -1.857 1.00 . A A .   2 SER N    1 1 
       11  6207 1 1  2 SER O    O  -29.909  -2.308  -3.929 1.00 . A A .   2 SER O    1 1 
       11  6208 1 1  2 SER OG   O  -30.349  -5.329  -3.749 1.00 . A A .   2 SER OG   1 1 
       11  6209 1 1  3 SER C    C  -25.991  -2.715  -4.180 1.00 . A A .   3 SER C    1 1 
       11  6210 1 1  3 SER CA   C  -27.179  -1.901  -3.676 1.00 . A A .   3 SER CA   1 1 
       11  6211 1 1  3 SER CB   C  -26.683  -0.645  -2.958 1.00 . A A .   3 SER CB   1 1 
       11  6212 1 1  3 SER H    H  -27.600  -3.144  -2.013 1.00 . A A .   3 SER H    1 1 
       11  6213 1 1  3 SER HA   H  -27.785  -1.608  -4.520 1.00 . A A .   3 SER HA   1 1 
       11  6214 1 1  3 SER HB2  H  -26.355   0.078  -3.688 1.00 . A A .   3 SER HB2  1 1 
       11  6215 1 1  3 SER HB3  H  -27.490  -0.226  -2.373 1.00 . A A .   3 SER HB3  1 1 
       11  6216 1 1  3 SER HG   H  -25.939  -1.295  -1.266 1.00 . A A .   3 SER HG   1 1 
       11  6217 1 1  3 SER N    N  -28.012  -2.699  -2.783 1.00 . A A .   3 SER N    1 1 
       11  6218 1 1  3 SER O    O  -25.474  -3.581  -3.477 1.00 . A A .   3 SER O    1 1 
       11  6219 1 1  3 SER OG   O  -25.601  -0.945  -2.093 1.00 . A A .   3 SER OG   1 1 
       11  6220 1 1  4 GLY C    C  -23.189  -2.288  -6.061 1.00 . A A .   4 GLY C    1 1 
       11  6221 1 1  4 GLY CA   C  -24.440  -3.140  -5.986 1.00 . A A .   4 GLY CA   1 1 
       11  6222 1 1  4 GLY H    H  -26.015  -1.726  -5.921 1.00 . A A .   4 GLY H    1 1 
       11  6223 1 1  4 GLY HA2  H  -24.233  -4.013  -5.385 1.00 . A A .   4 GLY HA2  1 1 
       11  6224 1 1  4 GLY HA3  H  -24.706  -3.457  -6.984 1.00 . A A .   4 GLY HA3  1 1 
       11  6225 1 1  4 GLY N    N  -25.563  -2.428  -5.406 1.00 . A A .   4 GLY N    1 1 
       11  6226 1 1  4 GLY O    O  -22.839  -1.779  -7.126 1.00 . A A .   4 GLY O    1 1 
       11  6227 1 1  5 SER C    C  -20.087  -2.199  -4.547 1.00 . A A .   5 SER C    1 1 
       11  6228 1 1  5 SER CA   C  -21.297  -1.327  -4.867 1.00 . A A .   5 SER CA   1 1 
       11  6229 1 1  5 SER CB   C  -21.439  -0.225  -3.816 1.00 . A A .   5 SER CB   1 1 
       11  6230 1 1  5 SER H    H  -22.843  -2.560  -4.111 1.00 . A A .   5 SER H    1 1 
       11  6231 1 1  5 SER HA   H  -21.152  -0.873  -5.836 1.00 . A A .   5 SER HA   1 1 
       11  6232 1 1  5 SER HB2  H  -20.513   0.326  -3.749 1.00 . A A .   5 SER HB2  1 1 
       11  6233 1 1  5 SER HB3  H  -22.236   0.445  -4.106 1.00 . A A .   5 SER HB3  1 1 
       11  6234 1 1  5 SER HG   H  -20.992  -0.642  -1.955 1.00 . A A .   5 SER HG   1 1 
       11  6235 1 1  5 SER N    N  -22.514  -2.129  -4.927 1.00 . A A .   5 SER N    1 1 
       11  6236 1 1  5 SER O    O  -19.080  -2.167  -5.254 1.00 . A A .   5 SER O    1 1 
       11  6237 1 1  5 SER OG   O  -21.740  -0.769  -2.543 1.00 . A A .   5 SER OG   1 1 
       11  6238 1 1  6 SER C    C  -17.752  -3.202  -3.309 1.00 . A A .   6 SER C    1 1 
       11  6239 1 1  6 SER CA   C  -19.107  -3.855  -3.055 1.00 . A A .   6 SER CA   1 1 
       11  6240 1 1  6 SER CB   C  -19.189  -5.191  -3.797 1.00 . A A .   6 SER CB   1 1 
       11  6241 1 1  6 SER H    H  -21.022  -2.957  -2.950 1.00 . A A .   6 SER H    1 1 
       11  6242 1 1  6 SER HA   H  -19.215  -4.034  -1.996 1.00 . A A .   6 SER HA   1 1 
       11  6243 1 1  6 SER HB2  H  -18.394  -5.837  -3.458 1.00 . A A .   6 SER HB2  1 1 
       11  6244 1 1  6 SER HB3  H  -20.143  -5.655  -3.591 1.00 . A A .   6 SER HB3  1 1 
       11  6245 1 1  6 SER HG   H  -19.596  -5.659  -5.655 1.00 . A A .   6 SER HG   1 1 
       11  6246 1 1  6 SER N    N  -20.194  -2.977  -3.474 1.00 . A A .   6 SER N    1 1 
       11  6247 1 1  6 SER O    O  -16.815  -3.850  -3.773 1.00 . A A .   6 SER O    1 1 
       11  6248 1 1  6 SER OG   O  -19.063  -5.006  -5.196 1.00 . A A .   6 SER OG   1 1 
       11  6249 1 1  7 GLY C    C  -15.197  -2.028  -2.861 1.00 . A A .   7 GLY C    1 1 
       11  6250 1 1  7 GLY CA   C  -16.414  -1.191  -3.202 1.00 . A A .   7 GLY CA   1 1 
       11  6251 1 1  7 GLY H    H  -18.437  -1.446  -2.634 1.00 . A A .   7 GLY H    1 1 
       11  6252 1 1  7 GLY HA2  H  -16.350  -0.886  -4.236 1.00 . A A .   7 GLY HA2  1 1 
       11  6253 1 1  7 GLY HA3  H  -16.417  -0.310  -2.577 1.00 . A A .   7 GLY HA3  1 1 
       11  6254 1 1  7 GLY N    N  -17.657  -1.912  -3.001 1.00 . A A .   7 GLY N    1 1 
       11  6255 1 1  7 GLY O    O  -14.342  -2.267  -3.713 1.00 . A A .   7 GLY O    1 1 
       11  6256 1 1  8 ALA C    C  -14.475  -4.630  -0.622 1.00 . A A .   8 ALA C    1 1 
       11  6257 1 1  8 ALA CA   C  -13.996  -3.286  -1.160 1.00 . A A .   8 ALA CA   1 1 
       11  6258 1 1  8 ALA CB   C  -13.199  -2.545  -0.097 1.00 . A A .   8 ALA CB   1 1 
       11  6259 1 1  8 ALA H    H  -15.830  -2.247  -0.978 1.00 . A A .   8 ALA H    1 1 
       11  6260 1 1  8 ALA HA   H  -13.347  -3.459  -2.006 1.00 . A A .   8 ALA HA   1 1 
       11  6261 1 1  8 ALA HB1  H  -13.013  -1.534  -0.427 1.00 . A A .   8 ALA HB1  1 1 
       11  6262 1 1  8 ALA HB2  H  -13.761  -2.525   0.825 1.00 . A A .   8 ALA HB2  1 1 
       11  6263 1 1  8 ALA HB3  H  -12.258  -3.050   0.065 1.00 . A A .   8 ALA HB3  1 1 
       11  6264 1 1  8 ALA N    N  -15.117  -2.472  -1.611 1.00 . A A .   8 ALA N    1 1 
       11  6265 1 1  8 ALA O    O  -15.205  -4.690   0.366 1.00 . A A .   8 ALA O    1 1 
       11  6266 1 1  9 GLY C    C  -13.573  -7.581   0.249 1.00 . A A .   9 GLY C    1 1 
       11  6267 1 1  9 GLY CA   C  -14.458  -7.037  -0.855 1.00 . A A .   9 GLY CA   1 1 
       11  6268 1 1  9 GLY H    H  -13.478  -5.600  -2.063 1.00 . A A .   9 GLY H    1 1 
       11  6269 1 1  9 GLY HA2  H  -15.477  -6.999  -0.499 1.00 . A A .   9 GLY HA2  1 1 
       11  6270 1 1  9 GLY HA3  H  -14.408  -7.705  -1.703 1.00 . A A .   9 GLY HA3  1 1 
       11  6271 1 1  9 GLY N    N  -14.060  -5.708  -1.281 1.00 . A A .   9 GLY N    1 1 
       11  6272 1 1  9 GLY O    O  -14.008  -7.716   1.392 1.00 . A A .   9 GLY O    1 1 
       11  6273 1 1 10 GLU C    C  -10.043  -7.703   0.791 1.00 . A A .  10 GLU C    1 1 
       11  6274 1 1 10 GLU CA   C  -11.381  -8.432   0.877 1.00 . A A .  10 GLU CA   1 1 
       11  6275 1 1 10 GLU CB   C  -11.173  -9.930   0.647 1.00 . A A .  10 GLU CB   1 1 
       11  6276 1 1 10 GLU CD   C  -10.352 -11.748  -0.903 1.00 . A A .  10 GLU CD   1 1 
       11  6277 1 1 10 GLU CG   C  -10.494 -10.256  -0.672 1.00 . A A .  10 GLU CG   1 1 
       11  6278 1 1 10 GLU H    H  -12.039  -7.766  -1.022 1.00 . A A .  10 GLU H    1 1 
       11  6279 1 1 10 GLU HA   H  -11.796  -8.282   1.862 1.00 . A A .  10 GLU HA   1 1 
       11  6280 1 1 10 GLU HB2  H  -10.566 -10.324   1.449 1.00 . A A .  10 GLU HB2  1 1 
       11  6281 1 1 10 GLU HB3  H  -12.135 -10.421   0.663 1.00 . A A .  10 GLU HB3  1 1 
       11  6282 1 1 10 GLU HG2  H  -11.079  -9.837  -1.477 1.00 . A A .  10 GLU HG2  1 1 
       11  6283 1 1 10 GLU HG3  H   -9.510  -9.811  -0.675 1.00 . A A .  10 GLU HG3  1 1 
       11  6284 1 1 10 GLU N    N  -12.328  -7.896  -0.094 1.00 . A A .  10 GLU N    1 1 
       11  6285 1 1 10 GLU O    O   -8.981  -8.312   0.920 1.00 . A A .  10 GLU O    1 1 
       11  6286 1 1 10 GLU OE1  O  -11.355 -12.472  -0.731 1.00 . A A .  10 GLU OE1  1 1 
       11  6287 1 1 10 GLU OE2  O   -9.239 -12.191  -1.254 1.00 . A A .  10 GLU OE2  1 1 
       11  6288 1 1 11 LYS C    C   -8.885  -4.488   1.532 1.00 . A A .  11 LYS C    1 1 
       11  6289 1 1 11 LYS CA   C   -8.897  -5.580   0.467 1.00 . A A .  11 LYS CA   1 1 
       11  6290 1 1 11 LYS CB   C   -8.799  -4.951  -0.924 1.00 . A A .  11 LYS CB   1 1 
       11  6291 1 1 11 LYS CD   C   -9.127  -6.872  -2.508 1.00 . A A .  11 LYS CD   1 1 
       11  6292 1 1 11 LYS CE   C  -10.003  -6.269  -3.596 1.00 . A A .  11 LYS CE   1 1 
       11  6293 1 1 11 LYS CG   C   -8.145  -5.854  -1.956 1.00 . A A .  11 LYS CG   1 1 
       11  6294 1 1 11 LYS H    H  -10.978  -5.965   0.476 1.00 . A A .  11 LYS H    1 1 
       11  6295 1 1 11 LYS HA   H   -8.046  -6.225   0.622 1.00 . A A .  11 LYS HA   1 1 
       11  6296 1 1 11 LYS HB2  H   -9.794  -4.709  -1.268 1.00 . A A .  11 LYS HB2  1 1 
       11  6297 1 1 11 LYS HB3  H   -8.221  -4.041  -0.855 1.00 . A A .  11 LYS HB3  1 1 
       11  6298 1 1 11 LYS HD2  H   -8.576  -7.702  -2.925 1.00 . A A .  11 LYS HD2  1 1 
       11  6299 1 1 11 LYS HD3  H   -9.758  -7.224  -1.704 1.00 . A A .  11 LYS HD3  1 1 
       11  6300 1 1 11 LYS HE2  H  -10.218  -5.243  -3.339 1.00 . A A .  11 LYS HE2  1 1 
       11  6301 1 1 11 LYS HE3  H   -9.465  -6.301  -4.532 1.00 . A A .  11 LYS HE3  1 1 
       11  6302 1 1 11 LYS HG2  H   -7.775  -5.248  -2.769 1.00 . A A .  11 LYS HG2  1 1 
       11  6303 1 1 11 LYS HG3  H   -7.321  -6.377  -1.491 1.00 . A A .  11 LYS HG3  1 1 
       11  6304 1 1 11 LYS HZ1  H  -11.231  -7.657  -4.560 1.00 . A A .  11 LYS HZ1  1 1 
       11  6305 1 1 11 LYS HZ2  H  -12.067  -6.340  -3.906 1.00 . A A .  11 LYS HZ2  1 1 
       11  6306 1 1 11 LYS HZ3  H  -11.485  -7.561  -2.891 1.00 . A A .  11 LYS HZ3  1 1 
       11  6307 1 1 11 LYS N    N  -10.102  -6.394   0.570 1.00 . A A .  11 LYS N    1 1 
       11  6308 1 1 11 LYS NZ   N  -11.286  -7.009  -3.749 1.00 . A A .  11 LYS NZ   1 1 
       11  6309 1 1 11 LYS O    O   -9.215  -3.330   1.272 1.00 . A A .  11 LYS O    1 1 
       11  6310 1 1 12 PRO C    C   -7.304  -2.910   3.733 1.00 . A A .  12 PRO C    1 1 
       11  6311 1 1 12 PRO CA   C   -8.429  -3.927   3.888 1.00 . A A .  12 PRO CA   1 1 
       11  6312 1 1 12 PRO CB   C   -8.165  -4.839   5.088 1.00 . A A .  12 PRO CB   1 1 
       11  6313 1 1 12 PRO CD   C   -8.088  -6.224   3.141 1.00 . A A .  12 PRO CD   1 1 
       11  6314 1 1 12 PRO CG   C   -7.498  -6.040   4.512 1.00 . A A .  12 PRO CG   1 1 
       11  6315 1 1 12 PRO HA   H   -9.366  -3.408   4.028 1.00 . A A .  12 PRO HA   1 1 
       11  6316 1 1 12 PRO HB2  H   -7.524  -4.331   5.795 1.00 . A A .  12 PRO HB2  1 1 
       11  6317 1 1 12 PRO HB3  H   -9.100  -5.097   5.563 1.00 . A A .  12 PRO HB3  1 1 
       11  6318 1 1 12 PRO HD2  H   -7.345  -6.610   2.459 1.00 . A A .  12 PRO HD2  1 1 
       11  6319 1 1 12 PRO HD3  H   -8.943  -6.883   3.184 1.00 . A A .  12 PRO HD3  1 1 
       11  6320 1 1 12 PRO HG2  H   -6.434  -5.872   4.443 1.00 . A A .  12 PRO HG2  1 1 
       11  6321 1 1 12 PRO HG3  H   -7.703  -6.904   5.127 1.00 . A A .  12 PRO HG3  1 1 
       11  6322 1 1 12 PRO N    N   -8.495  -4.861   2.760 1.00 . A A .  12 PRO N    1 1 
       11  6323 1 1 12 PRO O    O   -7.098  -2.061   4.601 1.00 . A A .  12 PRO O    1 1 
       11  6324 1 1 13 TYR C    C   -5.880  -1.020   1.347 1.00 . A A .  13 TYR C    1 1 
       11  6325 1 1 13 TYR CA   C   -5.473  -2.089   2.357 1.00 . A A .  13 TYR CA   1 1 
       11  6326 1 1 13 TYR CB   C   -4.261  -2.863   1.836 1.00 . A A .  13 TYR CB   1 1 
       11  6327 1 1 13 TYR CD1  C   -4.595  -5.342   2.179 1.00 . A A .  13 TYR CD1  1 1 
       11  6328 1 1 13 TYR CD2  C   -3.162  -4.182   3.689 1.00 . A A .  13 TYR CD2  1 1 
       11  6329 1 1 13 TYR CE1  C   -4.361  -6.523   2.857 1.00 . A A .  13 TYR CE1  1 1 
       11  6330 1 1 13 TYR CE2  C   -2.921  -5.358   4.372 1.00 . A A .  13 TYR CE2  1 1 
       11  6331 1 1 13 TYR CG   C   -4.001  -4.153   2.581 1.00 . A A .  13 TYR CG   1 1 
       11  6332 1 1 13 TYR CZ   C   -3.523  -6.526   3.952 1.00 . A A .  13 TYR CZ   1 1 
       11  6333 1 1 13 TYR H    H   -6.792  -3.698   1.969 1.00 . A A .  13 TYR H    1 1 
       11  6334 1 1 13 TYR HA   H   -5.209  -1.607   3.286 1.00 . A A .  13 TYR HA   1 1 
       11  6335 1 1 13 TYR HB2  H   -4.417  -3.107   0.797 1.00 . A A .  13 TYR HB2  1 1 
       11  6336 1 1 13 TYR HB3  H   -3.381  -2.243   1.928 1.00 . A A .  13 TYR HB3  1 1 
       11  6337 1 1 13 TYR HD1  H   -5.251  -5.337   1.320 1.00 . A A .  13 TYR HD1  1 1 
       11  6338 1 1 13 TYR HD2  H   -2.692  -3.265   4.015 1.00 . A A .  13 TYR HD2  1 1 
       11  6339 1 1 13 TYR HE1  H   -4.832  -7.438   2.528 1.00 . A A .  13 TYR HE1  1 1 
       11  6340 1 1 13 TYR HE2  H   -2.265  -5.360   5.230 1.00 . A A .  13 TYR HE2  1 1 
       11  6341 1 1 13 TYR HH   H   -2.890  -7.502   5.482 1.00 . A A .  13 TYR HH   1 1 
       11  6342 1 1 13 TYR N    N   -6.579  -3.000   2.624 1.00 . A A .  13 TYR N    1 1 
       11  6343 1 1 13 TYR O    O   -6.941  -1.105   0.729 1.00 . A A .  13 TYR O    1 1 
       11  6344 1 1 13 TYR OH   O   -3.287  -7.699   4.631 1.00 . A A .  13 TYR OH   1 1 
       11  6345 1 1 14 GLY C    C   -4.507   2.309   0.535 1.00 . A A .  14 GLY C    1 1 
       11  6346 1 1 14 GLY CA   C   -5.313   1.058   0.248 1.00 . A A .  14 GLY CA   1 1 
       11  6347 1 1 14 GLY H    H   -4.196   0.002   1.704 1.00 . A A .  14 GLY H    1 1 
       11  6348 1 1 14 GLY HA2  H   -5.087   0.718  -0.752 1.00 . A A .  14 GLY HA2  1 1 
       11  6349 1 1 14 GLY HA3  H   -6.364   1.300   0.306 1.00 . A A .  14 GLY HA3  1 1 
       11  6350 1 1 14 GLY N    N   -5.027  -0.013   1.184 1.00 . A A .  14 GLY N    1 1 
       11  6351 1 1 14 GLY O    O   -4.617   2.894   1.612 1.00 . A A .  14 GLY O    1 1 
       11  6352 1 1 15 CYS C    C   -3.689   5.089   0.225 1.00 . A A .  15 CYS C    1 1 
       11  6353 1 1 15 CYS CA   C   -2.862   3.909  -0.278 1.00 . A A .  15 CYS CA   1 1 
       11  6354 1 1 15 CYS CB   C   -2.198   4.268  -1.609 1.00 . A A .  15 CYS CB   1 1 
       11  6355 1 1 15 CYS H    H   -3.649   2.212  -1.269 1.00 . A A .  15 CYS H    1 1 
       11  6356 1 1 15 CYS HA   H   -2.096   3.687   0.448 1.00 . A A .  15 CYS HA   1 1 
       11  6357 1 1 15 CYS HB2  H   -1.566   3.449  -1.919 1.00 . A A .  15 CYS HB2  1 1 
       11  6358 1 1 15 CYS HB3  H   -2.964   4.427  -2.353 1.00 . A A .  15 CYS HB3  1 1 
       11  6359 1 1 15 CYS N    N   -3.693   2.721  -0.432 1.00 . A A .  15 CYS N    1 1 
       11  6360 1 1 15 CYS O    O   -4.482   5.667  -0.518 1.00 . A A .  15 CYS O    1 1 
       11  6361 1 1 15 CYS SG   S   -1.167   5.769  -1.544 1.00 . A A .  15 CYS SG   1 1 
       11  6362 1 1 16 SER C    C   -3.498   7.869   1.869 1.00 . A A .  16 SER C    1 1 
       11  6363 1 1 16 SER CA   C   -4.228   6.549   2.097 1.00 . A A .  16 SER CA   1 1 
       11  6364 1 1 16 SER CB   C   -4.413   6.308   3.597 1.00 . A A .  16 SER CB   1 1 
       11  6365 1 1 16 SER H    H   -2.852   4.941   2.035 1.00 . A A .  16 SER H    1 1 
       11  6366 1 1 16 SER HA   H   -5.198   6.602   1.627 1.00 . A A .  16 SER HA   1 1 
       11  6367 1 1 16 SER HB2  H   -4.850   5.333   3.751 1.00 . A A .  16 SER HB2  1 1 
       11  6368 1 1 16 SER HB3  H   -3.451   6.353   4.087 1.00 . A A .  16 SER HB3  1 1 
       11  6369 1 1 16 SER HG   H   -5.199   8.101   3.666 1.00 . A A .  16 SER HG   1 1 
       11  6370 1 1 16 SER N    N   -3.498   5.441   1.493 1.00 . A A .  16 SER N    1 1 
       11  6371 1 1 16 SER O    O   -3.387   8.694   2.775 1.00 . A A .  16 SER O    1 1 
       11  6372 1 1 16 SER OG   O   -5.264   7.286   4.169 1.00 . A A .  16 SER OG   1 1 
       11  6373 1 1 17 GLU C    C   -2.834   9.891  -0.982 1.00 . A A .  17 GLU C    1 1 
       11  6374 1 1 17 GLU CA   C   -2.281   9.280   0.303 1.00 . A A .  17 GLU CA   1 1 
       11  6375 1 1 17 GLU CB   C   -0.788   8.988   0.140 1.00 . A A .  17 GLU CB   1 1 
       11  6376 1 1 17 GLU CD   C    0.400  10.433   1.837 1.00 . A A .  17 GLU CD   1 1 
       11  6377 1 1 17 GLU CG   C   -0.014   9.028   1.447 1.00 . A A .  17 GLU CG   1 1 
       11  6378 1 1 17 GLU H    H   -3.122   7.366  -0.030 1.00 . A A .  17 GLU H    1 1 
       11  6379 1 1 17 GLU HA   H   -2.415   9.985   1.109 1.00 . A A .  17 GLU HA   1 1 
       11  6380 1 1 17 GLU HB2  H   -0.671   8.006  -0.294 1.00 . A A .  17 GLU HB2  1 1 
       11  6381 1 1 17 GLU HB3  H   -0.361   9.720  -0.529 1.00 . A A .  17 GLU HB3  1 1 
       11  6382 1 1 17 GLU HG2  H   -0.635   8.621   2.231 1.00 . A A .  17 GLU HG2  1 1 
       11  6383 1 1 17 GLU HG3  H    0.875   8.422   1.343 1.00 . A A .  17 GLU HG3  1 1 
       11  6384 1 1 17 GLU N    N   -3.001   8.060   0.650 1.00 . A A .  17 GLU N    1 1 
       11  6385 1 1 17 GLU O    O   -3.205  11.064  -1.015 1.00 . A A .  17 GLU O    1 1 
       11  6386 1 1 17 GLU OE1  O    1.374  10.950   1.252 1.00 . A A .  17 GLU OE1  1 1 
       11  6387 1 1 17 GLU OE2  O   -0.252  11.017   2.729 1.00 . A A .  17 GLU OE2  1 1 
       11  6388 1 1 18 CYS C    C   -4.761   8.940  -3.620 1.00 . A A .  18 CYS C    1 1 
       11  6389 1 1 18 CYS CA   C   -3.391   9.546  -3.326 1.00 . A A .  18 CYS CA   1 1 
       11  6390 1 1 18 CYS CB   C   -2.410   9.182  -4.442 1.00 . A A .  18 CYS CB   1 1 
       11  6391 1 1 18 CYS H    H   -2.575   8.160  -1.950 1.00 . A A .  18 CYS H    1 1 
       11  6392 1 1 18 CYS HA   H   -3.489  10.620  -3.280 1.00 . A A .  18 CYS HA   1 1 
       11  6393 1 1 18 CYS HB2  H   -2.712   9.679  -5.352 1.00 . A A .  18 CYS HB2  1 1 
       11  6394 1 1 18 CYS HB3  H   -1.421   9.517  -4.165 1.00 . A A .  18 CYS HB3  1 1 
       11  6395 1 1 18 CYS N    N   -2.885   9.086  -2.038 1.00 . A A .  18 CYS N    1 1 
       11  6396 1 1 18 CYS O    O   -5.684   9.639  -4.034 1.00 . A A .  18 CYS O    1 1 
       11  6397 1 1 18 CYS SG   S   -2.313   7.397  -4.794 1.00 . A A .  18 CYS SG   1 1 
       11  6398 1 1 19 GLY C    C   -5.994   5.787  -4.602 1.00 . A A .  19 GLY C    1 1 
       11  6399 1 1 19 GLY CA   C   -6.142   6.956  -3.649 1.00 . A A .  19 GLY CA   1 1 
       11  6400 1 1 19 GLY H    H   -4.112   7.127  -3.072 1.00 . A A .  19 GLY H    1 1 
       11  6401 1 1 19 GLY HA2  H   -6.533   6.594  -2.710 1.00 . A A .  19 GLY HA2  1 1 
       11  6402 1 1 19 GLY HA3  H   -6.842   7.662  -4.071 1.00 . A A .  19 GLY HA3  1 1 
       11  6403 1 1 19 GLY N    N   -4.883   7.634  -3.402 1.00 . A A .  19 GLY N    1 1 
       11  6404 1 1 19 GLY O    O   -6.674   5.721  -5.627 1.00 . A A .  19 GLY O    1 1 
       11  6405 1 1 20 LYS C    C   -4.825   2.420  -4.256 1.00 . A A .  20 LYS C    1 1 
       11  6406 1 1 20 LYS CA   C   -4.864   3.689  -5.101 1.00 . A A .  20 LYS CA   1 1 
       11  6407 1 1 20 LYS CB   C   -3.551   3.842  -5.872 1.00 . A A .  20 LYS CB   1 1 
       11  6408 1 1 20 LYS CD   C   -2.349   4.810  -7.853 1.00 . A A .  20 LYS CD   1 1 
       11  6409 1 1 20 LYS CE   C   -2.541   5.295  -9.282 1.00 . A A .  20 LYS CE   1 1 
       11  6410 1 1 20 LYS CG   C   -3.675   4.698  -7.120 1.00 . A A .  20 LYS CG   1 1 
       11  6411 1 1 20 LYS H    H   -4.589   4.970  -3.438 1.00 . A A .  20 LYS H    1 1 
       11  6412 1 1 20 LYS HA   H   -5.679   3.612  -5.805 1.00 . A A .  20 LYS HA   1 1 
       11  6413 1 1 20 LYS HB2  H   -2.817   4.295  -5.222 1.00 . A A .  20 LYS HB2  1 1 
       11  6414 1 1 20 LYS HB3  H   -3.204   2.862  -6.165 1.00 . A A .  20 LYS HB3  1 1 
       11  6415 1 1 20 LYS HD2  H   -1.716   5.512  -7.329 1.00 . A A .  20 LYS HD2  1 1 
       11  6416 1 1 20 LYS HD3  H   -1.874   3.839  -7.872 1.00 . A A .  20 LYS HD3  1 1 
       11  6417 1 1 20 LYS HE2  H   -3.295   4.687  -9.756 1.00 . A A .  20 LYS HE2  1 1 
       11  6418 1 1 20 LYS HE3  H   -2.870   6.324  -9.258 1.00 . A A .  20 LYS HE3  1 1 
       11  6419 1 1 20 LYS HG2  H   -4.402   4.250  -7.782 1.00 . A A .  20 LYS HG2  1 1 
       11  6420 1 1 20 LYS HG3  H   -4.005   5.687  -6.837 1.00 . A A .  20 LYS HG3  1 1 
       11  6421 1 1 20 LYS HZ1  H   -0.478   5.005  -9.442 1.00 . A A .  20 LYS HZ1  1 1 
       11  6422 1 1 20 LYS HZ2  H   -1.104   6.108 -10.562 1.00 . A A .  20 LYS HZ2  1 1 
       11  6423 1 1 20 LYS HZ3  H   -1.354   4.449 -10.778 1.00 . A A .  20 LYS HZ3  1 1 
       11  6424 1 1 20 LYS N    N   -5.101   4.861  -4.267 1.00 . A A .  20 LYS N    1 1 
       11  6425 1 1 20 LYS NZ   N   -1.281   5.208 -10.071 1.00 . A A .  20 LYS NZ   1 1 
       11  6426 1 1 20 LYS O    O   -3.886   2.202  -3.490 1.00 . A A .  20 LYS O    1 1 
       11  6427 1 1 21 ALA C    C   -5.413  -0.834  -4.484 1.00 . A A .  21 ALA C    1 1 
       11  6428 1 1 21 ALA CA   C   -5.929   0.336  -3.653 1.00 . A A .  21 ALA CA   1 1 
       11  6429 1 1 21 ALA CB   C   -7.360   0.079  -3.207 1.00 . A A .  21 ALA CB   1 1 
       11  6430 1 1 21 ALA H    H   -6.567   1.814  -5.027 1.00 . A A .  21 ALA H    1 1 
       11  6431 1 1 21 ALA HA   H   -5.314   0.436  -2.770 1.00 . A A .  21 ALA HA   1 1 
       11  6432 1 1 21 ALA HB1  H   -7.596   0.719  -2.370 1.00 . A A .  21 ALA HB1  1 1 
       11  6433 1 1 21 ALA HB2  H   -8.035   0.291  -4.024 1.00 . A A .  21 ALA HB2  1 1 
       11  6434 1 1 21 ALA HB3  H   -7.465  -0.954  -2.911 1.00 . A A .  21 ALA HB3  1 1 
       11  6435 1 1 21 ALA N    N   -5.849   1.585  -4.401 1.00 . A A .  21 ALA N    1 1 
       11  6436 1 1 21 ALA O    O   -5.636  -0.896  -5.693 1.00 . A A .  21 ALA O    1 1 
       11  6437 1 1 22 PHE C    C   -4.749  -4.217  -3.922 1.00 . A A .  22 PHE C    1 1 
       11  6438 1 1 22 PHE CA   C   -4.175  -2.930  -4.506 1.00 . A A .  22 PHE CA   1 1 
       11  6439 1 1 22 PHE CB   C   -2.649  -2.941  -4.393 1.00 . A A .  22 PHE CB   1 1 
       11  6440 1 1 22 PHE CD1  C   -1.897  -0.553  -4.237 1.00 . A A .  22 PHE CD1  1 1 
       11  6441 1 1 22 PHE CD2  C   -1.479  -1.743  -6.261 1.00 . A A .  22 PHE CD2  1 1 
       11  6442 1 1 22 PHE CE1  C   -1.295   0.572  -4.770 1.00 . A A .  22 PHE CE1  1 1 
       11  6443 1 1 22 PHE CE2  C   -0.876  -0.621  -6.799 1.00 . A A .  22 PHE CE2  1 1 
       11  6444 1 1 22 PHE CG   C   -1.995  -1.721  -4.975 1.00 . A A .  22 PHE CG   1 1 
       11  6445 1 1 22 PHE CZ   C   -0.785   0.538  -6.053 1.00 . A A .  22 PHE CZ   1 1 
       11  6446 1 1 22 PHE H    H   -4.579  -1.656  -2.863 1.00 . A A .  22 PHE H    1 1 
       11  6447 1 1 22 PHE HA   H   -4.450  -2.866  -5.547 1.00 . A A .  22 PHE HA   1 1 
       11  6448 1 1 22 PHE HB2  H   -2.373  -3.000  -3.351 1.00 . A A .  22 PHE HB2  1 1 
       11  6449 1 1 22 PHE HB3  H   -2.264  -3.806  -4.912 1.00 . A A .  22 PHE HB3  1 1 
       11  6450 1 1 22 PHE HD1  H   -2.296  -0.525  -3.233 1.00 . A A .  22 PHE HD1  1 1 
       11  6451 1 1 22 PHE HD2  H   -1.551  -2.648  -6.846 1.00 . A A .  22 PHE HD2  1 1 
       11  6452 1 1 22 PHE HE1  H   -1.226   1.476  -4.184 1.00 . A A .  22 PHE HE1  1 1 
       11  6453 1 1 22 PHE HE2  H   -0.479  -0.650  -7.803 1.00 . A A .  22 PHE HE2  1 1 
       11  6454 1 1 22 PHE HZ   H   -0.315   1.415  -6.471 1.00 . A A .  22 PHE HZ   1 1 
       11  6455 1 1 22 PHE N    N   -4.723  -1.761  -3.827 1.00 . A A .  22 PHE N    1 1 
       11  6456 1 1 22 PHE O    O   -5.333  -4.213  -2.838 1.00 . A A .  22 PHE O    1 1 
       11  6457 1 1 23 SER C    C   -4.378  -7.063  -2.932 1.00 . A A .  23 SER C    1 1 
       11  6458 1 1 23 SER CA   C   -5.084  -6.611  -4.207 1.00 . A A .  23 SER CA   1 1 
       11  6459 1 1 23 SER CB   C   -4.897  -7.658  -5.306 1.00 . A A .  23 SER CB   1 1 
       11  6460 1 1 23 SER H    H   -4.105  -5.255  -5.505 1.00 . A A .  23 SER H    1 1 
       11  6461 1 1 23 SER HA   H   -6.139  -6.503  -4.001 1.00 . A A .  23 SER HA   1 1 
       11  6462 1 1 23 SER HB2  H   -3.895  -7.586  -5.701 1.00 . A A .  23 SER HB2  1 1 
       11  6463 1 1 23 SER HB3  H   -5.050  -8.644  -4.890 1.00 . A A .  23 SER HB3  1 1 
       11  6464 1 1 23 SER HG   H   -5.411  -7.704  -7.196 1.00 . A A .  23 SER HG   1 1 
       11  6465 1 1 23 SER N    N   -4.579  -5.317  -4.649 1.00 . A A .  23 SER N    1 1 
       11  6466 1 1 23 SER O    O   -5.022  -7.422  -1.946 1.00 . A A .  23 SER O    1 1 
       11  6467 1 1 23 SER OG   O   -5.820  -7.460  -6.362 1.00 . A A .  23 SER OG   1 1 
       11  6468 1 1 24 SER C    C   -1.535  -6.259  -1.191 1.00 . A A .  24 SER C    1 1 
       11  6469 1 1 24 SER CA   C   -2.254  -7.454  -1.810 1.00 . A A .  24 SER CA   1 1 
       11  6470 1 1 24 SER CB   C   -1.235  -8.519  -2.221 1.00 . A A .  24 SER CB   1 1 
       11  6471 1 1 24 SER H    H   -2.593  -6.747  -3.776 1.00 . A A .  24 SER H    1 1 
       11  6472 1 1 24 SER HA   H   -2.925  -7.875  -1.076 1.00 . A A .  24 SER HA   1 1 
       11  6473 1 1 24 SER HB2  H   -0.748  -8.907  -1.340 1.00 . A A .  24 SER HB2  1 1 
       11  6474 1 1 24 SER HB3  H   -1.745  -9.322  -2.734 1.00 . A A .  24 SER HB3  1 1 
       11  6475 1 1 24 SER HG   H   -0.388  -8.310  -3.975 1.00 . A A .  24 SER HG   1 1 
       11  6476 1 1 24 SER N    N   -3.049  -7.043  -2.961 1.00 . A A .  24 SER N    1 1 
       11  6477 1 1 24 SER O    O   -1.400  -5.208  -1.818 1.00 . A A .  24 SER O    1 1 
       11  6478 1 1 24 SER OG   O   -0.252  -7.977  -3.085 1.00 . A A .  24 SER OG   1 1 
       11  6479 1 1 25 LYS C    C    0.931  -5.008   0.035 1.00 . A A .  25 LYS C    1 1 
       11  6480 1 1 25 LYS CA   C   -0.369  -5.365   0.749 1.00 . A A .  25 LYS CA   1 1 
       11  6481 1 1 25 LYS CB   C   -0.072  -5.790   2.189 1.00 . A A .  25 LYS CB   1 1 
       11  6482 1 1 25 LYS CD   C    1.580  -7.085   3.570 1.00 . A A .  25 LYS CD   1 1 
       11  6483 1 1 25 LYS CE   C    0.757  -7.585   4.747 1.00 . A A .  25 LYS CE   1 1 
       11  6484 1 1 25 LYS CG   C    0.761  -7.056   2.290 1.00 . A A .  25 LYS CG   1 1 
       11  6485 1 1 25 LYS H    H   -1.213  -7.289   0.492 1.00 . A A .  25 LYS H    1 1 
       11  6486 1 1 25 LYS HA   H   -1.007  -4.495   0.764 1.00 . A A .  25 LYS HA   1 1 
       11  6487 1 1 25 LYS HB2  H    0.461  -4.993   2.685 1.00 . A A .  25 LYS HB2  1 1 
       11  6488 1 1 25 LYS HB3  H   -1.008  -5.959   2.702 1.00 . A A .  25 LYS HB3  1 1 
       11  6489 1 1 25 LYS HD2  H    2.426  -7.742   3.432 1.00 . A A .  25 LYS HD2  1 1 
       11  6490 1 1 25 LYS HD3  H    1.930  -6.085   3.785 1.00 . A A .  25 LYS HD3  1 1 
       11  6491 1 1 25 LYS HE2  H    1.234  -7.271   5.663 1.00 . A A .  25 LYS HE2  1 1 
       11  6492 1 1 25 LYS HE3  H   -0.231  -7.151   4.689 1.00 . A A .  25 LYS HE3  1 1 
       11  6493 1 1 25 LYS HG2  H    0.103  -7.912   2.278 1.00 . A A .  25 LYS HG2  1 1 
       11  6494 1 1 25 LYS HG3  H    1.432  -7.103   1.444 1.00 . A A .  25 LYS HG3  1 1 
       11  6495 1 1 25 LYS HZ1  H    1.484  -9.498   4.328 1.00 . A A .  25 LYS HZ1  1 1 
       11  6496 1 1 25 LYS HZ2  H   -0.197  -9.359   4.195 1.00 . A A .  25 LYS HZ2  1 1 
       11  6497 1 1 25 LYS HZ3  H    0.528  -9.418   5.721 1.00 . A A .  25 LYS HZ3  1 1 
       11  6498 1 1 25 LYS N    N   -1.075  -6.428   0.044 1.00 . A A .  25 LYS N    1 1 
       11  6499 1 1 25 LYS NZ   N    0.635  -9.069   4.748 1.00 . A A .  25 LYS NZ   1 1 
       11  6500 1 1 25 LYS O    O    1.330  -3.844  -0.004 1.00 . A A .  25 LYS O    1 1 
       11  6501 1 1 26 SER C    C    2.674  -4.783  -2.355 1.00 . A A .  26 SER C    1 1 
       11  6502 1 1 26 SER CA   C    2.844  -5.810  -1.240 1.00 . A A .  26 SER CA   1 1 
       11  6503 1 1 26 SER CB   C    3.349  -7.132  -1.821 1.00 . A A .  26 SER CB   1 1 
       11  6504 1 1 26 SER H    H    1.218  -6.923  -0.463 1.00 . A A .  26 SER H    1 1 
       11  6505 1 1 26 SER HA   H    3.568  -5.438  -0.531 1.00 . A A .  26 SER HA   1 1 
       11  6506 1 1 26 SER HB2  H    2.506  -7.735  -2.124 1.00 . A A .  26 SER HB2  1 1 
       11  6507 1 1 26 SER HB3  H    3.973  -6.929  -2.680 1.00 . A A .  26 SER HB3  1 1 
       11  6508 1 1 26 SER HG   H    3.723  -7.731   0.006 1.00 . A A .  26 SER HG   1 1 
       11  6509 1 1 26 SER N    N    1.587  -6.017  -0.529 1.00 . A A .  26 SER N    1 1 
       11  6510 1 1 26 SER O    O    3.359  -3.760  -2.382 1.00 . A A .  26 SER O    1 1 
       11  6511 1 1 26 SER OG   O    4.107  -7.853  -0.866 1.00 . A A .  26 SER OG   1 1 
       11  6512 1 1 27 TYR C    C    1.324  -2.728  -3.910 1.00 . A A .  27 TYR C    1 1 
       11  6513 1 1 27 TYR CA   C    1.497  -4.165  -4.393 1.00 . A A .  27 TYR CA   1 1 
       11  6514 1 1 27 TYR CB   C    0.247  -4.613  -5.154 1.00 . A A .  27 TYR CB   1 1 
       11  6515 1 1 27 TYR CD1  C    1.432  -5.263  -7.287 1.00 . A A .  27 TYR CD1  1 1 
       11  6516 1 1 27 TYR CD2  C   -0.083  -6.828  -6.320 1.00 . A A .  27 TYR CD2  1 1 
       11  6517 1 1 27 TYR CE1  C    1.699  -6.148  -8.313 1.00 . A A .  27 TYR CE1  1 1 
       11  6518 1 1 27 TYR CE2  C    0.179  -7.720  -7.342 1.00 . A A .  27 TYR CE2  1 1 
       11  6519 1 1 27 TYR CG   C    0.537  -5.585  -6.275 1.00 . A A .  27 TYR CG   1 1 
       11  6520 1 1 27 TYR CZ   C    1.070  -7.376  -8.336 1.00 . A A .  27 TYR CZ   1 1 
       11  6521 1 1 27 TYR H    H    1.241  -5.893  -3.198 1.00 . A A .  27 TYR H    1 1 
       11  6522 1 1 27 TYR HA   H    2.347  -4.210  -5.058 1.00 . A A .  27 TYR HA   1 1 
       11  6523 1 1 27 TYR HB2  H   -0.432  -5.093  -4.467 1.00 . A A .  27 TYR HB2  1 1 
       11  6524 1 1 27 TYR HB3  H   -0.234  -3.746  -5.583 1.00 . A A .  27 TYR HB3  1 1 
       11  6525 1 1 27 TYR HD1  H    1.923  -4.301  -7.266 1.00 . A A .  27 TYR HD1  1 1 
       11  6526 1 1 27 TYR HD2  H   -0.781  -7.095  -5.540 1.00 . A A .  27 TYR HD2  1 1 
       11  6527 1 1 27 TYR HE1  H    2.398  -5.879  -9.092 1.00 . A A .  27 TYR HE1  1 1 
       11  6528 1 1 27 TYR HE2  H   -0.314  -8.681  -7.360 1.00 . A A .  27 TYR HE2  1 1 
       11  6529 1 1 27 TYR HH   H    1.788  -9.030  -9.002 1.00 . A A .  27 TYR HH   1 1 
       11  6530 1 1 27 TYR N    N    1.756  -5.063  -3.273 1.00 . A A .  27 TYR N    1 1 
       11  6531 1 1 27 TYR O    O    1.738  -1.781  -4.581 1.00 . A A .  27 TYR O    1 1 
       11  6532 1 1 27 TYR OH   O    1.335  -8.261  -9.356 1.00 . A A .  27 TYR OH   1 1 
       11  6533 1 1 28 LEU C    C    1.786  -0.652  -1.648 1.00 . A A .  28 LEU C    1 1 
       11  6534 1 1 28 LEU CA   C    0.483  -1.252  -2.167 1.00 . A A .  28 LEU CA   1 1 
       11  6535 1 1 28 LEU CB   C   -0.540  -1.337  -1.033 1.00 . A A .  28 LEU CB   1 1 
       11  6536 1 1 28 LEU CD1  C   -1.254   1.064  -0.942 1.00 . A A .  28 LEU CD1  1 1 
       11  6537 1 1 28 LEU CD2  C   -1.526  -0.395   1.071 1.00 . A A .  28 LEU CD2  1 1 
       11  6538 1 1 28 LEU CG   C   -0.669  -0.095  -0.151 1.00 . A A .  28 LEU CG   1 1 
       11  6539 1 1 28 LEU H    H    0.403  -3.365  -2.254 1.00 . A A .  28 LEU H    1 1 
       11  6540 1 1 28 LEU HA   H    0.093  -0.614  -2.946 1.00 . A A .  28 LEU HA   1 1 
       11  6541 1 1 28 LEU HB2  H   -1.506  -1.531  -1.474 1.00 . A A .  28 LEU HB2  1 1 
       11  6542 1 1 28 LEU HB3  H   -0.262  -2.167  -0.400 1.00 . A A .  28 LEU HB3  1 1 
       11  6543 1 1 28 LEU HD11 H   -1.384   1.916  -0.292 1.00 . A A .  28 LEU HD11 1 1 
       11  6544 1 1 28 LEU HD12 H   -2.211   0.774  -1.351 1.00 . A A .  28 LEU HD12 1 1 
       11  6545 1 1 28 LEU HD13 H   -0.584   1.324  -1.748 1.00 . A A .  28 LEU HD13 1 1 
       11  6546 1 1 28 LEU HD21 H   -1.164  -1.291   1.552 1.00 . A A .  28 LEU HD21 1 1 
       11  6547 1 1 28 LEU HD22 H   -2.551  -0.539   0.764 1.00 . A A .  28 LEU HD22 1 1 
       11  6548 1 1 28 LEU HD23 H   -1.470   0.433   1.762 1.00 . A A .  28 LEU HD23 1 1 
       11  6549 1 1 28 LEU HG   H    0.313   0.199   0.193 1.00 . A A .  28 LEU HG   1 1 
       11  6550 1 1 28 LEU N    N    0.711  -2.573  -2.742 1.00 . A A .  28 LEU N    1 1 
       11  6551 1 1 28 LEU O    O    2.075   0.523  -1.877 1.00 . A A .  28 LEU O    1 1 
       11  6552 1 1 29 ILE C    C    4.759  -0.492  -1.499 1.00 . A A .  29 ILE C    1 1 
       11  6553 1 1 29 ILE CA   C    3.842  -1.017  -0.400 1.00 . A A .  29 ILE CA   1 1 
       11  6554 1 1 29 ILE CB   C    4.561  -2.151   0.355 1.00 . A A .  29 ILE CB   1 1 
       11  6555 1 1 29 ILE CD1  C    4.040  -4.030   1.990 1.00 . A A .  29 ILE CD1  1 1 
       11  6556 1 1 29 ILE CG1  C    3.712  -2.625   1.536 1.00 . A A .  29 ILE CG1  1 1 
       11  6557 1 1 29 ILE CG2  C    5.929  -1.685   0.832 1.00 . A A .  29 ILE CG2  1 1 
       11  6558 1 1 29 ILE H    H    2.284  -2.392  -0.799 1.00 . A A .  29 ILE H    1 1 
       11  6559 1 1 29 ILE HA   H    3.640  -0.218   0.298 1.00 . A A .  29 ILE HA   1 1 
       11  6560 1 1 29 ILE HB   H    4.706  -2.973  -0.329 1.00 . A A .  29 ILE HB   1 1 
       11  6561 1 1 29 ILE HD11 H    3.788  -4.139   3.036 1.00 . A A .  29 ILE HD11 1 1 
       11  6562 1 1 29 ILE HD12 H    3.470  -4.739   1.409 1.00 . A A .  29 ILE HD12 1 1 
       11  6563 1 1 29 ILE HD13 H    5.095  -4.216   1.854 1.00 . A A .  29 ILE HD13 1 1 
       11  6564 1 1 29 ILE HG12 H    3.868  -1.962   2.373 1.00 . A A .  29 ILE HG12 1 1 
       11  6565 1 1 29 ILE HG13 H    2.670  -2.602   1.253 1.00 . A A .  29 ILE HG13 1 1 
       11  6566 1 1 29 ILE HG21 H    6.364  -2.441   1.469 1.00 . A A .  29 ILE HG21 1 1 
       11  6567 1 1 29 ILE HG22 H    6.570  -1.522  -0.021 1.00 . A A .  29 ILE HG22 1 1 
       11  6568 1 1 29 ILE HG23 H    5.823  -0.764   1.385 1.00 . A A .  29 ILE HG23 1 1 
       11  6569 1 1 29 ILE N    N    2.569  -1.467  -0.949 1.00 . A A .  29 ILE N    1 1 
       11  6570 1 1 29 ILE O    O    5.291   0.614  -1.401 1.00 . A A .  29 ILE O    1 1 
       11  6571 1 1 30 ILE C    C    5.371   0.448  -4.231 1.00 . A A .  30 ILE C    1 1 
       11  6572 1 1 30 ILE CA   C    5.789  -0.905  -3.664 1.00 . A A .  30 ILE CA   1 1 
       11  6573 1 1 30 ILE CB   C    5.749  -1.955  -4.790 1.00 . A A .  30 ILE CB   1 1 
       11  6574 1 1 30 ILE CD1  C    5.470  -4.476  -5.007 1.00 . A A .  30 ILE CD1  1 1 
       11  6575 1 1 30 ILE CG1  C    6.108  -3.338  -4.241 1.00 . A A .  30 ILE CG1  1 1 
       11  6576 1 1 30 ILE CG2  C    6.696  -1.563  -5.914 1.00 . A A .  30 ILE CG2  1 1 
       11  6577 1 1 30 ILE H    H    4.487  -2.161  -2.565 1.00 . A A .  30 ILE H    1 1 
       11  6578 1 1 30 ILE HA   H    6.804  -0.834  -3.302 1.00 . A A .  30 ILE HA   1 1 
       11  6579 1 1 30 ILE HB   H    4.747  -1.983  -5.190 1.00 . A A .  30 ILE HB   1 1 
       11  6580 1 1 30 ILE HD11 H    5.176  -5.253  -4.316 1.00 . A A .  30 ILE HD11 1 1 
       11  6581 1 1 30 ILE HD12 H    4.598  -4.114  -5.532 1.00 . A A .  30 ILE HD12 1 1 
       11  6582 1 1 30 ILE HD13 H    6.179  -4.875  -5.716 1.00 . A A .  30 ILE HD13 1 1 
       11  6583 1 1 30 ILE HG12 H    7.177  -3.468  -4.284 1.00 . A A .  30 ILE HG12 1 1 
       11  6584 1 1 30 ILE HG13 H    5.781  -3.404  -3.213 1.00 . A A .  30 ILE HG13 1 1 
       11  6585 1 1 30 ILE HG21 H    6.411  -2.076  -6.821 1.00 . A A .  30 ILE HG21 1 1 
       11  6586 1 1 30 ILE HG22 H    6.644  -0.497  -6.073 1.00 . A A .  30 ILE HG22 1 1 
       11  6587 1 1 30 ILE HG23 H    7.705  -1.839  -5.647 1.00 . A A .  30 ILE HG23 1 1 
       11  6588 1 1 30 ILE N    N    4.938  -1.291  -2.545 1.00 . A A .  30 ILE N    1 1 
       11  6589 1 1 30 ILE O    O    6.201   1.202  -4.741 1.00 . A A .  30 ILE O    1 1 
       11  6590 1 1 31 HIS C    C    3.894   3.160  -3.688 1.00 . A A .  31 HIS C    1 1 
       11  6591 1 1 31 HIS CA   C    3.553   2.014  -4.637 1.00 . A A .  31 HIS CA   1 1 
       11  6592 1 1 31 HIS CB   C    2.038   1.922  -4.819 1.00 . A A .  31 HIS CB   1 1 
       11  6593 1 1 31 HIS CD2  C    0.653   4.018  -4.173 1.00 . A A .  31 HIS CD2  1 1 
       11  6594 1 1 31 HIS CE1  C    0.750   5.071  -6.093 1.00 . A A .  31 HIS CE1  1 1 
       11  6595 1 1 31 HIS CG   C    1.376   3.251  -5.021 1.00 . A A .  31 HIS CG   1 1 
       11  6596 1 1 31 HIS H    H    3.469   0.109  -3.718 1.00 . A A .  31 HIS H    1 1 
       11  6597 1 1 31 HIS HA   H    4.011   2.208  -5.595 1.00 . A A .  31 HIS HA   1 1 
       11  6598 1 1 31 HIS HB2  H    1.822   1.310  -5.683 1.00 . A A .  31 HIS HB2  1 1 
       11  6599 1 1 31 HIS HB3  H    1.603   1.464  -3.942 1.00 . A A .  31 HIS HB3  1 1 
       11  6600 1 1 31 HIS HD1  H    1.871   3.640  -7.032 1.00 . A A .  31 HIS HD1  1 1 
       11  6601 1 1 31 HIS HD2  H    0.416   3.788  -3.143 1.00 . A A .  31 HIS HD2  1 1 
       11  6602 1 1 31 HIS HE1  H    0.614   5.812  -6.866 1.00 . A A .  31 HIS HE1  1 1 
       11  6603 1 1 31 HIS N    N    4.081   0.750  -4.136 1.00 . A A .  31 HIS N    1 1 
       11  6604 1 1 31 HIS ND1  N    1.418   3.938  -6.216 1.00 . A A .  31 HIS ND1  1 1 
       11  6605 1 1 31 HIS NE2  N    0.276   5.143  -4.862 1.00 . A A .  31 HIS NE2  1 1 
       11  6606 1 1 31 HIS O    O    4.319   4.230  -4.120 1.00 . A A .  31 HIS O    1 1 
       11  6607 1 1 32 MET C    C    5.420   4.455  -1.524 1.00 . A A .  32 MET C    1 1 
       11  6608 1 1 32 MET CA   C    3.991   3.938  -1.384 1.00 . A A .  32 MET CA   1 1 
       11  6609 1 1 32 MET CB   C    3.779   3.366   0.018 1.00 . A A .  32 MET CB   1 1 
       11  6610 1 1 32 MET CE   C    1.091   5.059   1.827 1.00 . A A .  32 MET CE   1 1 
       11  6611 1 1 32 MET CG   C    2.323   3.071   0.340 1.00 . A A .  32 MET CG   1 1 
       11  6612 1 1 32 MET H    H    3.362   2.052  -2.110 1.00 . A A .  32 MET H    1 1 
       11  6613 1 1 32 MET HA   H    3.308   4.760  -1.535 1.00 . A A .  32 MET HA   1 1 
       11  6614 1 1 32 MET HB2  H    4.338   2.447   0.108 1.00 . A A .  32 MET HB2  1 1 
       11  6615 1 1 32 MET HB3  H    4.148   4.075   0.744 1.00 . A A .  32 MET HB3  1 1 
       11  6616 1 1 32 MET HE1  H    2.065   5.304   2.224 1.00 . A A .  32 MET HE1  1 1 
       11  6617 1 1 32 MET HE2  H    0.457   5.933   1.862 1.00 . A A .  32 MET HE2  1 1 
       11  6618 1 1 32 MET HE3  H    0.649   4.270   2.417 1.00 . A A .  32 MET HE3  1 1 
       11  6619 1 1 32 MET HG2  H    1.975   2.286  -0.315 1.00 . A A .  32 MET HG2  1 1 
       11  6620 1 1 32 MET HG3  H    2.256   2.737   1.365 1.00 . A A .  32 MET HG3  1 1 
       11  6621 1 1 32 MET N    N    3.703   2.926  -2.394 1.00 . A A .  32 MET N    1 1 
       11  6622 1 1 32 MET O    O    5.759   5.519  -1.006 1.00 . A A .  32 MET O    1 1 
       11  6623 1 1 32 MET SD   S    1.259   4.511   0.130 1.00 . A A .  32 MET SD   1 1 
       11  6624 1 1 33 ARG C    C    7.744   5.485  -3.006 1.00 . A A .  33 ARG C    1 1 
       11  6625 1 1 33 ARG CA   C    7.645   4.074  -2.433 1.00 . A A .  33 ARG CA   1 1 
       11  6626 1 1 33 ARG CB   C    8.334   3.082  -3.372 1.00 . A A .  33 ARG CB   1 1 
       11  6627 1 1 33 ARG CD   C    9.488   0.865  -3.641 1.00 . A A .  33 ARG CD   1 1 
       11  6628 1 1 33 ARG CG   C    8.692   1.763  -2.707 1.00 . A A .  33 ARG CG   1 1 
       11  6629 1 1 33 ARG CZ   C   10.800   2.326  -5.121 1.00 . A A .  33 ARG CZ   1 1 
       11  6630 1 1 33 ARG H    H    5.924   2.856  -2.616 1.00 . A A .  33 ARG H    1 1 
       11  6631 1 1 33 ARG HA   H    8.141   4.053  -1.474 1.00 . A A .  33 ARG HA   1 1 
       11  6632 1 1 33 ARG HB2  H    7.676   2.873  -4.202 1.00 . A A .  33 ARG HB2  1 1 
       11  6633 1 1 33 ARG HB3  H    9.242   3.529  -3.746 1.00 . A A .  33 ARG HB3  1 1 
       11  6634 1 1 33 ARG HD2  H    9.729  -0.050  -3.122 1.00 . A A .  33 ARG HD2  1 1 
       11  6635 1 1 33 ARG HD3  H    8.881   0.640  -4.505 1.00 . A A .  33 ARG HD3  1 1 
       11  6636 1 1 33 ARG HE   H   11.545   1.295  -3.585 1.00 . A A .  33 ARG HE   1 1 
       11  6637 1 1 33 ARG HG2  H    9.286   1.964  -1.827 1.00 . A A .  33 ARG HG2  1 1 
       11  6638 1 1 33 ARG HG3  H    7.783   1.255  -2.421 1.00 . A A .  33 ARG HG3  1 1 
       11  6639 1 1 33 ARG HH11 H    8.831   2.218  -5.561 1.00 . A A .  33 ARG HH11 1 1 
       11  6640 1 1 33 ARG HH12 H    9.767   3.244  -6.596 1.00 . A A .  33 ARG HH12 1 1 
       11  6641 1 1 33 ARG HH21 H   12.788   2.644  -4.941 1.00 . A A .  33 ARG HH21 1 1 
       11  6642 1 1 33 ARG HH22 H   12.017   3.485  -6.243 1.00 . A A .  33 ARG HH22 1 1 
       11  6643 1 1 33 ARG N    N    6.253   3.694  -2.227 1.00 . A A .  33 ARG N    1 1 
       11  6644 1 1 33 ARG NE   N   10.727   1.498  -4.085 1.00 . A A .  33 ARG NE   1 1 
       11  6645 1 1 33 ARG NH1  N    9.710   2.620  -5.817 1.00 . A A .  33 ARG NH1  1 1 
       11  6646 1 1 33 ARG NH2  N   11.964   2.863  -5.463 1.00 . A A .  33 ARG NH2  1 1 
       11  6647 1 1 33 ARG O    O    8.709   6.206  -2.748 1.00 . A A .  33 ARG O    1 1 
       11  6648 1 1 34 THR C    C    6.219   8.247  -3.413 1.00 . A A .  34 THR C    1 1 
       11  6649 1 1 34 THR CA   C    6.715   7.196  -4.399 1.00 . A A .  34 THR CA   1 1 
       11  6650 1 1 34 THR CB   C    5.818   7.219  -5.651 1.00 . A A .  34 THR CB   1 1 
       11  6651 1 1 34 THR CG2  C    4.384   6.855  -5.296 1.00 . A A .  34 THR CG2  1 1 
       11  6652 1 1 34 THR H    H    6.001   5.253  -3.956 1.00 . A A .  34 THR H    1 1 
       11  6653 1 1 34 THR HA   H    7.723   7.444  -4.698 1.00 . A A .  34 THR HA   1 1 
       11  6654 1 1 34 THR HB   H    6.194   6.492  -6.357 1.00 . A A .  34 THR HB   1 1 
       11  6655 1 1 34 THR HG1  H    5.354   9.134  -5.712 1.00 . A A .  34 THR HG1  1 1 
       11  6656 1 1 34 THR HG21 H    4.323   6.619  -4.245 1.00 . A A .  34 THR HG21 1 1 
       11  6657 1 1 34 THR HG22 H    4.076   5.998  -5.876 1.00 . A A .  34 THR HG22 1 1 
       11  6658 1 1 34 THR HG23 H    3.736   7.691  -5.516 1.00 . A A .  34 THR HG23 1 1 
       11  6659 1 1 34 THR N    N    6.741   5.873  -3.787 1.00 . A A .  34 THR N    1 1 
       11  6660 1 1 34 THR O    O    6.492   9.438  -3.570 1.00 . A A .  34 THR O    1 1 
       11  6661 1 1 34 THR OG1  O    5.852   8.517  -6.254 1.00 . A A .  34 THR OG1  1 1 
       11  6662 1 1 35 HIS C    C    5.942   8.874  -0.232 1.00 . A A .  35 HIS C    1 1 
       11  6663 1 1 35 HIS CA   C    4.955   8.705  -1.383 1.00 . A A .  35 HIS CA   1 1 
       11  6664 1 1 35 HIS CB   C    3.620   8.180  -0.853 1.00 . A A .  35 HIS CB   1 1 
       11  6665 1 1 35 HIS CD2  C    1.577   7.408  -2.252 1.00 . A A .  35 HIS CD2  1 1 
       11  6666 1 1 35 HIS CE1  C    1.170   9.295  -3.292 1.00 . A A .  35 HIS CE1  1 1 
       11  6667 1 1 35 HIS CG   C    2.494   8.311  -1.831 1.00 . A A .  35 HIS CG   1 1 
       11  6668 1 1 35 HIS H    H    5.304   6.841  -2.325 1.00 . A A .  35 HIS H    1 1 
       11  6669 1 1 35 HIS HA   H    4.795   9.666  -1.847 1.00 . A A .  35 HIS HA   1 1 
       11  6670 1 1 35 HIS HB2  H    3.725   7.133  -0.606 1.00 . A A .  35 HIS HB2  1 1 
       11  6671 1 1 35 HIS HB3  H    3.353   8.729   0.038 1.00 . A A .  35 HIS HB3  1 1 
       11  6672 1 1 35 HIS HD1  H    2.702  10.325  -2.411 1.00 . A A .  35 HIS HD1  1 1 
       11  6673 1 1 35 HIS HD2  H    1.498   6.378  -1.934 1.00 . A A .  35 HIS HD2  1 1 
       11  6674 1 1 35 HIS HE1  H    0.724  10.037  -3.937 1.00 . A A .  35 HIS HE1  1 1 
       11  6675 1 1 35 HIS N    N    5.488   7.801  -2.396 1.00 . A A .  35 HIS N    1 1 
       11  6676 1 1 35 HIS ND1  N    2.212   9.482  -2.502 1.00 . A A .  35 HIS ND1  1 1 
       11  6677 1 1 35 HIS NE2  N    0.766   8.044  -3.159 1.00 . A A .  35 HIS NE2  1 1 
       11  6678 1 1 35 HIS O    O    5.854   8.180   0.781 1.00 . A A .  35 HIS O    1 1 
       11  6679 1 1 36 SER C    C    8.724  11.282   0.272 1.00 . A A .  36 SER C    1 1 
       11  6680 1 1 36 SER CA   C    7.888  10.057   0.628 1.00 . A A .  36 SER CA   1 1 
       11  6681 1 1 36 SER CB   C    8.796   8.837   0.797 1.00 . A A .  36 SER CB   1 1 
       11  6682 1 1 36 SER H    H    6.899  10.320  -1.226 1.00 . A A .  36 SER H    1 1 
       11  6683 1 1 36 SER HA   H    7.374  10.244   1.559 1.00 . A A .  36 SER HA   1 1 
       11  6684 1 1 36 SER HB2  H    9.498   9.022   1.596 1.00 . A A .  36 SER HB2  1 1 
       11  6685 1 1 36 SER HB3  H    8.194   7.974   1.040 1.00 . A A .  36 SER HB3  1 1 
       11  6686 1 1 36 SER HG   H    8.957   8.097  -1.009 1.00 . A A .  36 SER HG   1 1 
       11  6687 1 1 36 SER N    N    6.881   9.800  -0.395 1.00 . A A .  36 SER N    1 1 
       11  6688 1 1 36 SER O    O    9.390  11.315  -0.761 1.00 . A A .  36 SER O    1 1 
       11  6689 1 1 36 SER OG   O    9.519   8.571  -0.392 1.00 . A A .  36 SER OG   1 1 
       11  6690 1 1 37 GLY C    C    9.653  14.314   2.163 1.00 . A A .  37 GLY C    1 1 
       11  6691 1 1 37 GLY CA   C    9.439  13.505   0.899 1.00 . A A .  37 GLY CA   1 1 
       11  6692 1 1 37 GLY H    H    8.134  12.209   1.946 1.00 . A A .  37 GLY H    1 1 
       11  6693 1 1 37 GLY HA2  H   10.402  13.242   0.486 1.00 . A A .  37 GLY HA2  1 1 
       11  6694 1 1 37 GLY HA3  H    8.906  14.113   0.182 1.00 . A A .  37 GLY HA3  1 1 
       11  6695 1 1 37 GLY N    N    8.683  12.291   1.138 1.00 . A A .  37 GLY N    1 1 
       11  6696 1 1 37 GLY O    O    9.176  15.444   2.272 1.00 . A A .  37 GLY O    1 1 
       11  6697 1 1 38 GLU C    C   12.130  14.710   4.532 1.00 . A A .  38 GLU C    1 1 
       11  6698 1 1 38 GLU CA   C   10.641  14.410   4.385 1.00 . A A .  38 GLU CA   1 1 
       11  6699 1 1 38 GLU CB   C   10.164  13.553   5.559 1.00 . A A .  38 GLU CB   1 1 
       11  6700 1 1 38 GLU CD   C   10.642  11.219   4.721 1.00 . A A .  38 GLU CD   1 1 
       11  6701 1 1 38 GLU CG   C   10.971  12.281   5.752 1.00 . A A .  38 GLU CG   1 1 
       11  6702 1 1 38 GLU H    H   10.722  12.833   2.975 1.00 . A A .  38 GLU H    1 1 
       11  6703 1 1 38 GLU HA   H   10.097  15.342   4.387 1.00 . A A .  38 GLU HA   1 1 
       11  6704 1 1 38 GLU HB2  H   10.228  14.137   6.465 1.00 . A A .  38 GLU HB2  1 1 
       11  6705 1 1 38 GLU HB3  H    9.133  13.278   5.392 1.00 . A A .  38 GLU HB3  1 1 
       11  6706 1 1 38 GLU HG2  H   12.021  12.521   5.676 1.00 . A A .  38 GLU HG2  1 1 
       11  6707 1 1 38 GLU HG3  H   10.764  11.884   6.735 1.00 . A A .  38 GLU HG3  1 1 
       11  6708 1 1 38 GLU N    N   10.369  13.735   3.121 1.00 . A A .  38 GLU N    1 1 
       11  6709 1 1 38 GLU O    O   12.977  13.963   4.041 1.00 . A A .  38 GLU O    1 1 
       11  6710 1 1 38 GLU OE1  O    9.453  11.088   4.362 1.00 . A A .  38 GLU OE1  1 1 
       11  6711 1 1 38 GLU OE2  O   11.574  10.518   4.273 1.00 . A A .  38 GLU OE2  1 1 
       11  6712 1 1 39 LYS C    C   13.923  17.291   6.495 1.00 . A A .  39 LYS C    1 1 
       11  6713 1 1 39 LYS CA   C   13.828  16.209   5.424 1.00 . A A .  39 LYS CA   1 1 
       11  6714 1 1 39 LYS CB   C   14.441  16.716   4.117 1.00 . A A .  39 LYS CB   1 1 
       11  6715 1 1 39 LYS CD   C   16.435  16.667   2.590 1.00 . A A .  39 LYS CD   1 1 
       11  6716 1 1 39 LYS CE   C   17.869  16.186   2.430 1.00 . A A .  39 LYS CE   1 1 
       11  6717 1 1 39 LYS CG   C   15.937  16.471   4.012 1.00 . A A .  39 LYS CG   1 1 
       11  6718 1 1 39 LYS H    H   11.722  16.364   5.577 1.00 . A A .  39 LYS H    1 1 
       11  6719 1 1 39 LYS HA   H   14.377  15.341   5.756 1.00 . A A .  39 LYS HA   1 1 
       11  6720 1 1 39 LYS HB2  H   13.957  16.218   3.289 1.00 . A A .  39 LYS HB2  1 1 
       11  6721 1 1 39 LYS HB3  H   14.265  17.779   4.039 1.00 . A A .  39 LYS HB3  1 1 
       11  6722 1 1 39 LYS HD2  H   15.803  16.109   1.915 1.00 . A A .  39 LYS HD2  1 1 
       11  6723 1 1 39 LYS HD3  H   16.388  17.719   2.343 1.00 . A A .  39 LYS HD3  1 1 
       11  6724 1 1 39 LYS HE2  H   18.293  16.643   1.549 1.00 . A A .  39 LYS HE2  1 1 
       11  6725 1 1 39 LYS HE3  H   18.435  16.488   3.299 1.00 . A A .  39 LYS HE3  1 1 
       11  6726 1 1 39 LYS HG2  H   16.452  17.163   4.661 1.00 . A A .  39 LYS HG2  1 1 
       11  6727 1 1 39 LYS HG3  H   16.149  15.458   4.321 1.00 . A A .  39 LYS HG3  1 1 
       11  6728 1 1 39 LYS HZ1  H   17.013  14.281   2.471 1.00 . A A .  39 LYS HZ1  1 1 
       11  6729 1 1 39 LYS HZ2  H   18.627  14.318   2.976 1.00 . A A .  39 LYS HZ2  1 1 
       11  6730 1 1 39 LYS HZ3  H   18.252  14.451   1.332 1.00 . A A .  39 LYS HZ3  1 1 
       11  6731 1 1 39 LYS N    N   12.442  15.809   5.210 1.00 . A A .  39 LYS N    1 1 
       11  6732 1 1 39 LYS NZ   N   17.945  14.705   2.292 1.00 . A A .  39 LYS NZ   1 1 
       11  6733 1 1 39 LYS O    O   13.094  18.198   6.571 1.00 . A A .  39 LYS O    1 1 
       11  6734 1 1 40 PRO C    C   15.614  19.526   7.902 1.00 . A A .  40 PRO C    1 1 
       11  6735 1 1 40 PRO CA   C   15.186  18.159   8.425 1.00 . A A .  40 PRO CA   1 1 
       11  6736 1 1 40 PRO CB   C   16.315  17.519   9.237 1.00 . A A .  40 PRO CB   1 1 
       11  6737 1 1 40 PRO CD   C   15.984  16.140   7.313 1.00 . A A .  40 PRO CD   1 1 
       11  6738 1 1 40 PRO CG   C   17.031  16.645   8.266 1.00 . A A .  40 PRO CG   1 1 
       11  6739 1 1 40 PRO HA   H   14.311  18.271   9.048 1.00 . A A .  40 PRO HA   1 1 
       11  6740 1 1 40 PRO HB2  H   16.963  18.292   9.627 1.00 . A A .  40 PRO HB2  1 1 
       11  6741 1 1 40 PRO HB3  H   15.898  16.946  10.051 1.00 . A A .  40 PRO HB3  1 1 
       11  6742 1 1 40 PRO HD2  H   16.397  16.033   6.321 1.00 . A A .  40 PRO HD2  1 1 
       11  6743 1 1 40 PRO HD3  H   15.580  15.200   7.658 1.00 . A A .  40 PRO HD3  1 1 
       11  6744 1 1 40 PRO HG2  H   17.776  17.218   7.736 1.00 . A A .  40 PRO HG2  1 1 
       11  6745 1 1 40 PRO HG3  H   17.492  15.819   8.788 1.00 . A A .  40 PRO HG3  1 1 
       11  6746 1 1 40 PRO N    N   14.957  17.195   7.344 1.00 . A A .  40 PRO N    1 1 
       11  6747 1 1 40 PRO O    O   15.045  20.551   8.278 1.00 . A A .  40 PRO O    1 1 
       11  6748 1 1 41 SER C    C   17.044  20.745   4.937 1.00 . A A .  41 SER C    1 1 
       11  6749 1 1 41 SER CA   C   17.125  20.776   6.460 1.00 . A A .  41 SER CA   1 1 
       11  6750 1 1 41 SER CB   C   18.571  21.013   6.901 1.00 . A A .  41 SER CB   1 1 
       11  6751 1 1 41 SER H    H   17.032  18.684   6.772 1.00 . A A .  41 SER H    1 1 
       11  6752 1 1 41 SER HA   H   16.510  21.584   6.826 1.00 . A A .  41 SER HA   1 1 
       11  6753 1 1 41 SER HB2  H   18.591  21.239   7.956 1.00 . A A .  41 SER HB2  1 1 
       11  6754 1 1 41 SER HB3  H   19.152  20.121   6.713 1.00 . A A .  41 SER HB3  1 1 
       11  6755 1 1 41 SER HG   H   19.308  22.825   6.793 1.00 . A A .  41 SER HG   1 1 
       11  6756 1 1 41 SER N    N   16.619  19.534   7.032 1.00 . A A .  41 SER N    1 1 
       11  6757 1 1 41 SER O    O   17.327  19.726   4.310 1.00 . A A .  41 SER O    1 1 
       11  6758 1 1 41 SER OG   O   19.150  22.094   6.191 1.00 . A A .  41 SER OG   1 1 
       11  6759 1 1 42 GLY C    C   17.882  22.177   2.230 1.00 . A A .  42 GLY C    1 1 
       11  6760 1 1 42 GLY CA   C   16.543  21.955   2.904 1.00 . A A .  42 GLY CA   1 1 
       11  6761 1 1 42 GLY H    H   16.443  22.654   4.900 1.00 . A A .  42 GLY H    1 1 
       11  6762 1 1 42 GLY HA2  H   16.114  21.035   2.534 1.00 . A A .  42 GLY HA2  1 1 
       11  6763 1 1 42 GLY HA3  H   15.886  22.774   2.652 1.00 . A A .  42 GLY HA3  1 1 
       11  6764 1 1 42 GLY N    N   16.655  21.872   4.349 1.00 . A A .  42 GLY N    1 1 
       11  6765 1 1 42 GLY O    O   18.794  22.780   2.797 1.00 . A A .  42 GLY O    1 1 
       11  6766 1 1 43 PRO C    C   19.504  23.251  -0.230 1.00 . A A .  43 PRO C    1 1 
       11  6767 1 1 43 PRO CA   C   19.251  21.814   0.214 1.00 . A A .  43 PRO CA   1 1 
       11  6768 1 1 43 PRO CB   C   19.005  20.915  -1.000 1.00 . A A .  43 PRO CB   1 1 
       11  6769 1 1 43 PRO CD   C   16.971  20.949   0.255 1.00 . A A .  43 PRO CD   1 1 
       11  6770 1 1 43 PRO CG   C   17.523  20.866  -1.141 1.00 . A A .  43 PRO CG   1 1 
       11  6771 1 1 43 PRO HA   H   20.108  21.452   0.764 1.00 . A A .  43 PRO HA   1 1 
       11  6772 1 1 43 PRO HB2  H   19.471  21.349  -1.873 1.00 . A A .  43 PRO HB2  1 1 
       11  6773 1 1 43 PRO HB3  H   19.416  19.934  -0.816 1.00 . A A .  43 PRO HB3  1 1 
       11  6774 1 1 43 PRO HD2  H   16.040  21.497   0.261 1.00 . A A .  43 PRO HD2  1 1 
       11  6775 1 1 43 PRO HD3  H   16.831  19.960   0.665 1.00 . A A .  43 PRO HD3  1 1 
       11  6776 1 1 43 PRO HG2  H   17.182  21.704  -1.730 1.00 . A A .  43 PRO HG2  1 1 
       11  6777 1 1 43 PRO HG3  H   17.229  19.936  -1.605 1.00 . A A .  43 PRO HG3  1 1 
       11  6778 1 1 43 PRO N    N   18.016  21.680   0.992 1.00 . A A .  43 PRO N    1 1 
       11  6779 1 1 43 PRO O    O   20.594  23.585  -0.692 1.00 . A A .  43 PRO O    1 1 
       11  6780 1 1 44 SER C    C   19.906  26.100   0.033 1.00 . A A .  44 SER C    1 1 
       11  6781 1 1 44 SER CA   C   18.600  25.498  -0.475 1.00 . A A .  44 SER CA   1 1 
       11  6782 1 1 44 SER CB   C   17.412  26.296   0.066 1.00 . A A .  44 SER CB   1 1 
       11  6783 1 1 44 SER H    H   17.644  23.770   0.289 1.00 . A A .  44 SER H    1 1 
       11  6784 1 1 44 SER HA   H   18.592  25.544  -1.554 1.00 . A A .  44 SER HA   1 1 
       11  6785 1 1 44 SER HB2  H   17.493  26.373   1.140 1.00 . A A .  44 SER HB2  1 1 
       11  6786 1 1 44 SER HB3  H   17.419  27.285  -0.368 1.00 . A A .  44 SER HB3  1 1 
       11  6787 1 1 44 SER HG   H   15.645  26.260  -0.779 1.00 . A A .  44 SER HG   1 1 
       11  6788 1 1 44 SER N    N   18.489  24.097  -0.086 1.00 . A A .  44 SER N    1 1 
       11  6789 1 1 44 SER O    O   19.971  26.619   1.148 1.00 . A A .  44 SER O    1 1 
       11  6790 1 1 44 SER OG   O   16.185  25.664  -0.254 1.00 . A A .  44 SER OG   1 1 
       11  6791 1 1 45 SER C    C   22.549  26.308   1.048 1.00 . A A .  45 SER C    1 1 
       11  6792 1 1 45 SER CA   C   22.252  26.562  -0.426 1.00 . A A .  45 SER CA   1 1 
       11  6793 1 1 45 SER CB   C   22.312  28.063  -0.719 1.00 . A A .  45 SER CB   1 1 
       11  6794 1 1 45 SER H    H   20.831  25.602  -1.668 1.00 . A A .  45 SER H    1 1 
       11  6795 1 1 45 SER HA   H   22.996  26.057  -1.024 1.00 . A A .  45 SER HA   1 1 
       11  6796 1 1 45 SER HB2  H   21.847  28.260  -1.673 1.00 . A A .  45 SER HB2  1 1 
       11  6797 1 1 45 SER HB3  H   21.786  28.600   0.056 1.00 . A A .  45 SER HB3  1 1 
       11  6798 1 1 45 SER HG   H   24.206  27.942  -0.230 1.00 . A A .  45 SER HG   1 1 
       11  6799 1 1 45 SER N    N   20.945  26.028  -0.793 1.00 . A A .  45 SER N    1 1 
       11  6800 1 1 45 SER O    O   22.999  27.200   1.765 1.00 . A A .  45 SER O    1 1 
       11  6801 1 1 45 SER OG   O   23.653  28.520  -0.762 1.00 . A A .  45 SER OG   1 1 
       11  6802 1 1 46 GLY C    C   22.403  23.242   3.134 1.00 . A A .  46 GLY C    1 1 
       11  6803 1 1 46 GLY CA   C   22.539  24.730   2.881 1.00 . A A .  46 GLY CA   1 1 
       11  6804 1 1 46 GLY H    H   21.935  24.410   0.876 1.00 . A A .  46 GLY H    1 1 
       11  6805 1 1 46 GLY HA2  H   23.538  25.041   3.148 1.00 . A A .  46 GLY HA2  1 1 
       11  6806 1 1 46 GLY HA3  H   21.830  25.256   3.504 1.00 . A A .  46 GLY HA3  1 1 
       11  6807 1 1 46 GLY N    N   22.293  25.082   1.494 1.00 . A A .  46 GLY N    1 1 
       11  6808 1 1 46 GLY O    O   21.699  22.568   2.383 1.00 . A A .  46 GLY O    1 1 
       11  6809 2 2  1 ZN  ZN   ZN  -0.555   6.460  -3.531 1.00 . B A . 201 ZN  ZN   1 1 
       12  6810 1 1  1 GLY C    C  -18.004  17.391  -5.790 1.00 . A A .   1 GLY C    1 1 
       12  6811 1 1  1 GLY CA   C  -17.284  18.654  -5.361 1.00 . A A .   1 GLY CA   1 1 
       12  6812 1 1  1 GLY H1   H  -18.597  19.568  -3.974 1.00 . A A .   1 GLY H1   1 1 
       12  6813 1 1  1 GLY HA2  H  -16.745  19.054  -6.207 1.00 . A A .   1 GLY HA2  1 1 
       12  6814 1 1  1 GLY HA3  H  -16.578  18.404  -4.583 1.00 . A A .   1 GLY HA3  1 1 
       12  6815 1 1  1 GLY N    N  -18.193  19.668  -4.862 1.00 . A A .   1 GLY N    1 1 
       12  6816 1 1  1 GLY O    O  -19.230  17.372  -5.894 1.00 . A A .   1 GLY O    1 1 
       12  6817 1 1  2 SER C    C  -17.563  13.976  -5.424 1.00 . A A .   2 SER C    1 1 
       12  6818 1 1  2 SER CA   C  -17.812  15.060  -6.468 1.00 . A A .   2 SER CA   1 1 
       12  6819 1 1  2 SER CB   C  -17.221  14.636  -7.813 1.00 . A A .   2 SER CB   1 1 
       12  6820 1 1  2 SER H    H  -16.268  16.410  -5.941 1.00 . A A .   2 SER H    1 1 
       12  6821 1 1  2 SER HA   H  -18.878  15.197  -6.580 1.00 . A A .   2 SER HA   1 1 
       12  6822 1 1  2 SER HB2  H  -17.350  15.434  -8.528 1.00 . A A .   2 SER HB2  1 1 
       12  6823 1 1  2 SER HB3  H  -16.167  14.429  -7.691 1.00 . A A .   2 SER HB3  1 1 
       12  6824 1 1  2 SER HG   H  -17.208  12.891  -8.704 1.00 . A A .   2 SER HG   1 1 
       12  6825 1 1  2 SER N    N  -17.240  16.332  -6.042 1.00 . A A .   2 SER N    1 1 
       12  6826 1 1  2 SER O    O  -16.642  14.079  -4.614 1.00 . A A .   2 SER O    1 1 
       12  6827 1 1  2 SER OG   O  -17.861  13.472  -8.307 1.00 . A A .   2 SER OG   1 1 
       12  6828 1 1  3 SER C    C  -17.049  10.970  -4.838 1.00 . A A .   3 SER C    1 1 
       12  6829 1 1  3 SER CA   C  -18.262  11.833  -4.506 1.00 . A A .   3 SER CA   1 1 
       12  6830 1 1  3 SER CB   C  -19.530  10.976  -4.516 1.00 . A A .   3 SER CB   1 1 
       12  6831 1 1  3 SER H    H  -19.105  12.911  -6.122 1.00 . A A .   3 SER H    1 1 
       12  6832 1 1  3 SER HA   H  -18.131  12.254  -3.521 1.00 . A A .   3 SER HA   1 1 
       12  6833 1 1  3 SER HB2  H  -19.619  10.481  -5.471 1.00 . A A .   3 SER HB2  1 1 
       12  6834 1 1  3 SER HB3  H  -19.466  10.236  -3.731 1.00 . A A .   3 SER HB3  1 1 
       12  6835 1 1  3 SER HG   H  -21.331  11.584  -4.986 1.00 . A A .   3 SER HG   1 1 
       12  6836 1 1  3 SER N    N  -18.390  12.936  -5.451 1.00 . A A .   3 SER N    1 1 
       12  6837 1 1  3 SER O    O  -17.169   9.937  -5.496 1.00 . A A .   3 SER O    1 1 
       12  6838 1 1  3 SER OG   O  -20.684  11.770  -4.303 1.00 . A A .   3 SER OG   1 1 
       12  6839 1 1  4 GLY C    C  -14.673   9.284  -3.998 1.00 . A A .   4 GLY C    1 1 
       12  6840 1 1  4 GLY CA   C  -14.659  10.659  -4.636 1.00 . A A .   4 GLY CA   1 1 
       12  6841 1 1  4 GLY H    H  -15.844  12.233  -3.858 1.00 . A A .   4 GLY H    1 1 
       12  6842 1 1  4 GLY HA2  H  -14.537  10.549  -5.703 1.00 . A A .   4 GLY HA2  1 1 
       12  6843 1 1  4 GLY HA3  H  -13.822  11.217  -4.243 1.00 . A A .   4 GLY HA3  1 1 
       12  6844 1 1  4 GLY N    N  -15.879  11.402  -4.378 1.00 . A A .   4 GLY N    1 1 
       12  6845 1 1  4 GLY O    O  -15.709   8.621  -3.958 1.00 . A A .   4 GLY O    1 1 
       12  6846 1 1  5 SER C    C  -13.260   7.685  -1.353 1.00 . A A .   5 SER C    1 1 
       12  6847 1 1  5 SER CA   C  -13.400   7.545  -2.866 1.00 . A A .   5 SER CA   1 1 
       12  6848 1 1  5 SER CB   C  -12.198   6.787  -3.432 1.00 . A A .   5 SER CB   1 1 
       12  6849 1 1  5 SER H    H  -12.727   9.428  -3.562 1.00 . A A .   5 SER H    1 1 
       12  6850 1 1  5 SER HA   H  -14.300   6.989  -3.082 1.00 . A A .   5 SER HA   1 1 
       12  6851 1 1  5 SER HB2  H  -12.243   6.799  -4.511 1.00 . A A .   5 SER HB2  1 1 
       12  6852 1 1  5 SER HB3  H  -11.287   7.267  -3.105 1.00 . A A .   5 SER HB3  1 1 
       12  6853 1 1  5 SER HG   H  -11.907   5.406  -2.074 1.00 . A A .   5 SER HG   1 1 
       12  6854 1 1  5 SER N    N  -13.518   8.853  -3.500 1.00 . A A .   5 SER N    1 1 
       12  6855 1 1  5 SER O    O  -12.156   7.633  -0.813 1.00 . A A .   5 SER O    1 1 
       12  6856 1 1  5 SER OG   O  -12.189   5.441  -2.990 1.00 . A A .   5 SER OG   1 1 
       12  6857 1 1  6 SER C    C  -14.314   6.657   1.464 1.00 . A A .   6 SER C    1 1 
       12  6858 1 1  6 SER CA   C  -14.394   8.016   0.775 1.00 . A A .   6 SER CA   1 1 
       12  6859 1 1  6 SER CB   C  -15.655   8.756   1.228 1.00 . A A .   6 SER CB   1 1 
       12  6860 1 1  6 SER H    H  -15.239   7.898  -1.162 1.00 . A A .   6 SER H    1 1 
       12  6861 1 1  6 SER HA   H  -13.527   8.598   1.051 1.00 . A A .   6 SER HA   1 1 
       12  6862 1 1  6 SER HB2  H  -15.579   8.981   2.281 1.00 . A A .   6 SER HB2  1 1 
       12  6863 1 1  6 SER HB3  H  -15.748   9.677   0.669 1.00 . A A .   6 SER HB3  1 1 
       12  6864 1 1  6 SER HG   H  -17.593   8.475   1.252 1.00 . A A .   6 SER HG   1 1 
       12  6865 1 1  6 SER N    N  -14.390   7.864  -0.675 1.00 . A A .   6 SER N    1 1 
       12  6866 1 1  6 SER O    O  -15.224   5.836   1.350 1.00 . A A .   6 SER O    1 1 
       12  6867 1 1  6 SER OG   O  -16.813   7.970   1.010 1.00 . A A .   6 SER OG   1 1 
       12  6868 1 1  7 GLY C    C  -12.147   4.205   2.115 1.00 . A A .   7 GLY C    1 1 
       12  6869 1 1  7 GLY CA   C  -13.037   5.167   2.877 1.00 . A A .   7 GLY CA   1 1 
       12  6870 1 1  7 GLY H    H  -12.525   7.119   2.235 1.00 . A A .   7 GLY H    1 1 
       12  6871 1 1  7 GLY HA2  H  -12.596   5.362   3.843 1.00 . A A .   7 GLY HA2  1 1 
       12  6872 1 1  7 GLY HA3  H  -14.004   4.707   3.020 1.00 . A A .   7 GLY HA3  1 1 
       12  6873 1 1  7 GLY N    N  -13.218   6.427   2.180 1.00 . A A .   7 GLY N    1 1 
       12  6874 1 1  7 GLY O    O  -11.089   4.590   1.618 1.00 . A A .   7 GLY O    1 1 
       12  6875 1 1  8 ALA C    C  -12.727   0.869   0.722 1.00 . A A .   8 ALA C    1 1 
       12  6876 1 1  8 ALA CA   C  -11.809   1.931   1.318 1.00 . A A .   8 ALA CA   1 1 
       12  6877 1 1  8 ALA CB   C  -10.795   1.290   2.253 1.00 . A A .   8 ALA CB   1 1 
       12  6878 1 1  8 ALA H    H  -13.427   2.705   2.441 1.00 . A A .   8 ALA H    1 1 
       12  6879 1 1  8 ALA HA   H  -11.268   2.415   0.517 1.00 . A A .   8 ALA HA   1 1 
       12  6880 1 1  8 ALA HB1  H  -11.314   0.766   3.042 1.00 . A A .   8 ALA HB1  1 1 
       12  6881 1 1  8 ALA HB2  H  -10.185   0.593   1.698 1.00 . A A .   8 ALA HB2  1 1 
       12  6882 1 1  8 ALA HB3  H  -10.166   2.056   2.682 1.00 . A A .   8 ALA HB3  1 1 
       12  6883 1 1  8 ALA N    N  -12.575   2.950   2.024 1.00 . A A .   8 ALA N    1 1 
       12  6884 1 1  8 ALA O    O  -13.793   0.581   1.264 1.00 . A A .   8 ALA O    1 1 
       12  6885 1 1  9 GLY C    C  -13.088  -2.047  -0.295 1.00 . A A .   9 GLY C    1 1 
       12  6886 1 1  9 GLY CA   C  -13.103  -0.733  -1.050 1.00 . A A .   9 GLY CA   1 1 
       12  6887 1 1  9 GLY H    H  -11.447   0.560  -0.786 1.00 . A A .   9 GLY H    1 1 
       12  6888 1 1  9 GLY HA2  H  -14.122  -0.385  -1.127 1.00 . A A .   9 GLY HA2  1 1 
       12  6889 1 1  9 GLY HA3  H  -12.713  -0.898  -2.044 1.00 . A A .   9 GLY HA3  1 1 
       12  6890 1 1  9 GLY N    N  -12.306   0.290  -0.399 1.00 . A A .   9 GLY N    1 1 
       12  6891 1 1  9 GLY O    O  -12.900  -2.069   0.921 1.00 . A A .   9 GLY O    1 1 
       12  6892 1 1 10 GLU C    C  -11.890  -5.040  -0.318 1.00 . A A .  10 GLU C    1 1 
       12  6893 1 1 10 GLU CA   C  -13.302  -4.469  -0.405 1.00 . A A .  10 GLU CA   1 1 
       12  6894 1 1 10 GLU CB   C  -14.199  -5.416  -1.205 1.00 . A A .  10 GLU CB   1 1 
       12  6895 1 1 10 GLU CD   C  -16.496  -5.852  -2.161 1.00 . A A .  10 GLU CD   1 1 
       12  6896 1 1 10 GLU CG   C  -15.657  -4.991  -1.237 1.00 . A A .  10 GLU CG   1 1 
       12  6897 1 1 10 GLU H    H  -13.434  -3.063  -1.982 1.00 . A A .  10 GLU H    1 1 
       12  6898 1 1 10 GLU HA   H  -13.699  -4.369   0.594 1.00 . A A .  10 GLU HA   1 1 
       12  6899 1 1 10 GLU HB2  H  -13.836  -5.464  -2.221 1.00 . A A .  10 GLU HB2  1 1 
       12  6900 1 1 10 GLU HB3  H  -14.143  -6.401  -0.765 1.00 . A A .  10 GLU HB3  1 1 
       12  6901 1 1 10 GLU HG2  H  -16.062  -5.062  -0.239 1.00 . A A .  10 GLU HG2  1 1 
       12  6902 1 1 10 GLU HG3  H  -15.713  -3.966  -1.574 1.00 . A A .  10 GLU HG3  1 1 
       12  6903 1 1 10 GLU N    N  -13.290  -3.145  -1.017 1.00 . A A .  10 GLU N    1 1 
       12  6904 1 1 10 GLU O    O  -11.662  -6.212  -0.621 1.00 . A A .  10 GLU O    1 1 
       12  6905 1 1 10 GLU OE1  O  -16.237  -5.838  -3.383 1.00 . A A .  10 GLU OE1  1 1 
       12  6906 1 1 10 GLU OE2  O  -17.411  -6.540  -1.663 1.00 . A A .  10 GLU OE2  1 1 
       12  6907 1 1 11 LYS C    C   -8.914  -4.016   1.471 1.00 . A A .  11 LYS C    1 1 
       12  6908 1 1 11 LYS CA   C   -9.554  -4.625   0.227 1.00 . A A .  11 LYS CA   1 1 
       12  6909 1 1 11 LYS CB   C   -8.760  -4.220  -1.017 1.00 . A A .  11 LYS CB   1 1 
       12  6910 1 1 11 LYS CD   C   -8.618  -4.237  -3.525 1.00 . A A .  11 LYS CD   1 1 
       12  6911 1 1 11 LYS CE   C   -9.540  -4.276  -4.735 1.00 . A A .  11 LYS CE   1 1 
       12  6912 1 1 11 LYS CG   C   -9.281  -4.845  -2.300 1.00 . A A .  11 LYS CG   1 1 
       12  6913 1 1 11 LYS H    H  -11.188  -3.283   0.326 1.00 . A A .  11 LYS H    1 1 
       12  6914 1 1 11 LYS HA   H   -9.539  -5.700   0.319 1.00 . A A .  11 LYS HA   1 1 
       12  6915 1 1 11 LYS HB2  H   -8.801  -3.146  -1.122 1.00 . A A .  11 LYS HB2  1 1 
       12  6916 1 1 11 LYS HB3  H   -7.731  -4.522  -0.887 1.00 . A A .  11 LYS HB3  1 1 
       12  6917 1 1 11 LYS HD2  H   -8.364  -3.209  -3.314 1.00 . A A .  11 LYS HD2  1 1 
       12  6918 1 1 11 LYS HD3  H   -7.719  -4.792  -3.751 1.00 . A A .  11 LYS HD3  1 1 
       12  6919 1 1 11 LYS HE2  H   -9.809  -5.302  -4.933 1.00 . A A .  11 LYS HE2  1 1 
       12  6920 1 1 11 LYS HE3  H  -10.430  -3.707  -4.510 1.00 . A A .  11 LYS HE3  1 1 
       12  6921 1 1 11 LYS HG2  H   -9.076  -5.905  -2.283 1.00 . A A .  11 LYS HG2  1 1 
       12  6922 1 1 11 LYS HG3  H  -10.348  -4.683  -2.362 1.00 . A A .  11 LYS HG3  1 1 
       12  6923 1 1 11 LYS HZ1  H   -7.864  -3.623  -5.798 1.00 . A A .  11 LYS HZ1  1 1 
       12  6924 1 1 11 LYS HZ2  H   -9.275  -2.756  -6.143 1.00 . A A .  11 LYS HZ2  1 1 
       12  6925 1 1 11 LYS HZ3  H   -9.066  -4.313  -6.768 1.00 . A A .  11 LYS HZ3  1 1 
       12  6926 1 1 11 LYS N    N  -10.944  -4.205   0.098 1.00 . A A .  11 LYS N    1 1 
       12  6927 1 1 11 LYS NZ   N   -8.890  -3.702  -5.946 1.00 . A A .  11 LYS NZ   1 1 
       12  6928 1 1 11 LYS O    O   -9.141  -2.854   1.809 1.00 . A A .  11 LYS O    1 1 
       12  6929 1 1 12 PRO C    C   -6.314  -3.352   3.093 1.00 . A A .  12 PRO C    1 1 
       12  6930 1 1 12 PRO CA   C   -7.405  -4.377   3.385 1.00 . A A .  12 PRO CA   1 1 
       12  6931 1 1 12 PRO CB   C   -6.792  -5.669   3.931 1.00 . A A .  12 PRO CB   1 1 
       12  6932 1 1 12 PRO CD   C   -7.780  -6.213   1.824 1.00 . A A .  12 PRO CD   1 1 
       12  6933 1 1 12 PRO CG   C   -6.635  -6.548   2.739 1.00 . A A .  12 PRO CG   1 1 
       12  6934 1 1 12 PRO HA   H   -8.096  -3.970   4.108 1.00 . A A .  12 PRO HA   1 1 
       12  6935 1 1 12 PRO HB2  H   -5.839  -5.451   4.392 1.00 . A A .  12 PRO HB2  1 1 
       12  6936 1 1 12 PRO HB3  H   -7.458  -6.107   4.659 1.00 . A A .  12 PRO HB3  1 1 
       12  6937 1 1 12 PRO HD2  H   -7.474  -6.296   0.791 1.00 . A A .  12 PRO HD2  1 1 
       12  6938 1 1 12 PRO HD3  H   -8.623  -6.859   2.022 1.00 . A A .  12 PRO HD3  1 1 
       12  6939 1 1 12 PRO HG2  H   -5.693  -6.342   2.253 1.00 . A A .  12 PRO HG2  1 1 
       12  6940 1 1 12 PRO HG3  H   -6.685  -7.584   3.038 1.00 . A A .  12 PRO HG3  1 1 
       12  6941 1 1 12 PRO N    N   -8.095  -4.817   2.169 1.00 . A A .  12 PRO N    1 1 
       12  6942 1 1 12 PRO O    O   -6.018  -2.493   3.925 1.00 . A A .  12 PRO O    1 1 
       12  6943 1 1 13 TYR C    C   -5.215  -1.401   0.645 1.00 . A A .  13 TYR C    1 1 
       12  6944 1 1 13 TYR CA   C   -4.661  -2.529   1.509 1.00 . A A .  13 TYR CA   1 1 
       12  6945 1 1 13 TYR CB   C   -3.567  -3.280   0.748 1.00 . A A .  13 TYR CB   1 1 
       12  6946 1 1 13 TYR CD1  C   -2.407  -4.768   2.426 1.00 . A A .  13 TYR CD1  1 1 
       12  6947 1 1 13 TYR CD2  C   -3.791  -5.795   0.779 1.00 . A A .  13 TYR CD2  1 1 
       12  6948 1 1 13 TYR CE1  C   -2.113  -6.008   2.959 1.00 . A A .  13 TYR CE1  1 1 
       12  6949 1 1 13 TYR CE2  C   -3.504  -7.039   1.307 1.00 . A A .  13 TYR CE2  1 1 
       12  6950 1 1 13 TYR CG   C   -3.249  -4.639   1.328 1.00 . A A .  13 TYR CG   1 1 
       12  6951 1 1 13 TYR CZ   C   -2.665  -7.141   2.396 1.00 . A A .  13 TYR CZ   1 1 
       12  6952 1 1 13 TYR H    H   -6.000  -4.153   1.289 1.00 . A A .  13 TYR H    1 1 
       12  6953 1 1 13 TYR HA   H   -4.234  -2.104   2.406 1.00 . A A .  13 TYR HA   1 1 
       12  6954 1 1 13 TYR HB2  H   -3.882  -3.422  -0.274 1.00 . A A .  13 TYR HB2  1 1 
       12  6955 1 1 13 TYR HB3  H   -2.660  -2.692   0.762 1.00 . A A .  13 TYR HB3  1 1 
       12  6956 1 1 13 TYR HD1  H   -1.977  -3.879   2.865 1.00 . A A .  13 TYR HD1  1 1 
       12  6957 1 1 13 TYR HD2  H   -4.449  -5.712  -0.074 1.00 . A A .  13 TYR HD2  1 1 
       12  6958 1 1 13 TYR HE1  H   -1.456  -6.088   3.812 1.00 . A A .  13 TYR HE1  1 1 
       12  6959 1 1 13 TYR HE2  H   -3.935  -7.926   0.866 1.00 . A A .  13 TYR HE2  1 1 
       12  6960 1 1 13 TYR HH   H   -3.185  -8.790   3.236 1.00 . A A .  13 TYR HH   1 1 
       12  6961 1 1 13 TYR N    N   -5.720  -3.447   1.909 1.00 . A A .  13 TYR N    1 1 
       12  6962 1 1 13 TYR O    O   -5.322  -1.532  -0.574 1.00 . A A .  13 TYR O    1 1 
       12  6963 1 1 13 TYR OH   O   -2.376  -8.378   2.925 1.00 . A A .  13 TYR OH   1 1 
       12  6964 1 1 14 GLY C    C   -5.359   2.131   0.862 1.00 . A A .  14 GLY C    1 1 
       12  6965 1 1 14 GLY CA   C   -6.105   0.846   0.562 1.00 . A A .  14 GLY CA   1 1 
       12  6966 1 1 14 GLY H    H   -5.458  -0.242   2.260 1.00 . A A .  14 GLY H    1 1 
       12  6967 1 1 14 GLY HA2  H   -6.044   0.646  -0.497 1.00 . A A .  14 GLY HA2  1 1 
       12  6968 1 1 14 GLY HA3  H   -7.142   0.974   0.835 1.00 . A A .  14 GLY HA3  1 1 
       12  6969 1 1 14 GLY N    N   -5.566  -0.290   1.286 1.00 . A A .  14 GLY N    1 1 
       12  6970 1 1 14 GLY O    O   -5.715   2.863   1.786 1.00 . A A .  14 GLY O    1 1 
       12  6971 1 1 15 CYS C    C   -4.411   4.816   0.557 1.00 . A A .  15 CYS C    1 1 
       12  6972 1 1 15 CYS CA   C   -3.520   3.611   0.267 1.00 . A A .  15 CYS CA   1 1 
       12  6973 1 1 15 CYS CB   C   -2.667   3.880  -0.974 1.00 . A A .  15 CYS CB   1 1 
       12  6974 1 1 15 CYS H    H   -4.086   1.785  -0.641 1.00 . A A .  15 CYS H    1 1 
       12  6975 1 1 15 CYS HA   H   -2.869   3.449   1.113 1.00 . A A .  15 CYS HA   1 1 
       12  6976 1 1 15 CYS HB2  H   -1.814   3.217  -0.965 1.00 . A A .  15 CYS HB2  1 1 
       12  6977 1 1 15 CYS HB3  H   -3.258   3.686  -1.856 1.00 . A A .  15 CYS HB3  1 1 
       12  6978 1 1 15 CYS N    N   -4.320   2.407   0.080 1.00 . A A .  15 CYS N    1 1 
       12  6979 1 1 15 CYS O    O   -5.448   5.002  -0.080 1.00 . A A .  15 CYS O    1 1 
       12  6980 1 1 15 CYS SG   S   -2.040   5.586  -1.089 1.00 . A A .  15 CYS SG   1 1 
       12  6981 1 1 16 SER C    C   -4.142   8.075   1.292 1.00 . A A .  16 SER C    1 1 
       12  6982 1 1 16 SER CA   C   -4.759   6.818   1.898 1.00 . A A .  16 SER CA   1 1 
       12  6983 1 1 16 SER CB   C   -4.819   6.949   3.421 1.00 . A A .  16 SER CB   1 1 
       12  6984 1 1 16 SER H    H   -3.163   5.431   1.993 1.00 . A A .  16 SER H    1 1 
       12  6985 1 1 16 SER HA   H   -5.762   6.703   1.515 1.00 . A A .  16 SER HA   1 1 
       12  6986 1 1 16 SER HB2  H   -5.128   6.007   3.849 1.00 . A A .  16 SER HB2  1 1 
       12  6987 1 1 16 SER HB3  H   -3.841   7.211   3.796 1.00 . A A .  16 SER HB3  1 1 
       12  6988 1 1 16 SER HG   H   -5.643   8.131   4.748 1.00 . A A .  16 SER HG   1 1 
       12  6989 1 1 16 SER N    N   -3.998   5.632   1.521 1.00 . A A .  16 SER N    1 1 
       12  6990 1 1 16 SER O    O   -4.836   9.060   1.041 1.00 . A A .  16 SER O    1 1 
       12  6991 1 1 16 SER OG   O   -5.742   7.951   3.810 1.00 . A A .  16 SER OG   1 1 
       12  6992 1 1 17 GLU C    C   -2.852   9.698  -0.746 1.00 . A A .  17 GLU C    1 1 
       12  6993 1 1 17 GLU CA   C   -2.123   9.167   0.485 1.00 . A A .  17 GLU CA   1 1 
       12  6994 1 1 17 GLU CB   C   -0.694   8.767   0.112 1.00 . A A .  17 GLU CB   1 1 
       12  6995 1 1 17 GLU CD   C   -0.286   8.398   2.577 1.00 . A A .  17 GLU CD   1 1 
       12  6996 1 1 17 GLU CG   C    0.291   8.885   1.262 1.00 . A A .  17 GLU CG   1 1 
       12  6997 1 1 17 GLU H    H   -2.335   7.218   1.282 1.00 . A A .  17 GLU H    1 1 
       12  6998 1 1 17 GLU HA   H   -2.085   9.947   1.230 1.00 . A A .  17 GLU HA   1 1 
       12  6999 1 1 17 GLU HB2  H   -0.698   7.742  -0.229 1.00 . A A .  17 GLU HB2  1 1 
       12  7000 1 1 17 GLU HB3  H   -0.354   9.402  -0.693 1.00 . A A .  17 GLU HB3  1 1 
       12  7001 1 1 17 GLU HG2  H    1.167   8.296   1.031 1.00 . A A .  17 GLU HG2  1 1 
       12  7002 1 1 17 GLU HG3  H    0.574   9.921   1.372 1.00 . A A .  17 GLU HG3  1 1 
       12  7003 1 1 17 GLU N    N   -2.834   8.032   1.060 1.00 . A A .  17 GLU N    1 1 
       12  7004 1 1 17 GLU O    O   -3.016  10.907  -0.911 1.00 . A A .  17 GLU O    1 1 
       12  7005 1 1 17 GLU OE1  O   -0.734   7.233   2.632 1.00 . A A .  17 GLU OE1  1 1 
       12  7006 1 1 17 GLU OE2  O   -0.290   9.181   3.550 1.00 . A A .  17 GLU OE2  1 1 
       12  7007 1 1 18 CYS C    C   -5.291   8.364  -2.967 1.00 . A A .  18 CYS C    1 1 
       12  7008 1 1 18 CYS CA   C   -3.997   9.160  -2.826 1.00 . A A .  18 CYS CA   1 1 
       12  7009 1 1 18 CYS CB   C   -3.109   8.931  -4.050 1.00 . A A .  18 CYS CB   1 1 
       12  7010 1 1 18 CYS H    H   -3.125   7.836  -1.423 1.00 . A A .  18 CYS H    1 1 
       12  7011 1 1 18 CYS HA   H   -4.240  10.209  -2.759 1.00 . A A .  18 CYS HA   1 1 
       12  7012 1 1 18 CYS HB2  H   -3.502   9.499  -4.881 1.00 . A A .  18 CYS HB2  1 1 
       12  7013 1 1 18 CYS HB3  H   -2.109   9.274  -3.829 1.00 . A A .  18 CYS HB3  1 1 
       12  7014 1 1 18 CYS N    N   -3.286   8.786  -1.609 1.00 . A A .  18 CYS N    1 1 
       12  7015 1 1 18 CYS O    O   -6.322   8.902  -3.368 1.00 . A A .  18 CYS O    1 1 
       12  7016 1 1 18 CYS SG   S   -2.997   7.190  -4.573 1.00 . A A .  18 CYS SG   1 1 
       12  7017 1 1 19 GLY C    C   -6.180   5.037  -3.639 1.00 . A A .  19 GLY C    1 1 
       12  7018 1 1 19 GLY CA   C   -6.401   6.229  -2.729 1.00 . A A .  19 GLY CA   1 1 
       12  7019 1 1 19 GLY H    H   -4.378   6.704  -2.319 1.00 . A A .  19 GLY H    1 1 
       12  7020 1 1 19 GLY HA2  H   -6.656   5.873  -1.742 1.00 . A A .  19 GLY HA2  1 1 
       12  7021 1 1 19 GLY HA3  H   -7.224   6.813  -3.113 1.00 . A A .  19 GLY HA3  1 1 
       12  7022 1 1 19 GLY N    N   -5.228   7.078  -2.633 1.00 . A A .  19 GLY N    1 1 
       12  7023 1 1 19 GLY O    O   -7.115   4.551  -4.276 1.00 . A A .  19 GLY O    1 1 
       12  7024 1 1 20 LYS C    C   -4.744   2.116  -3.768 1.00 . A A .  20 LYS C    1 1 
       12  7025 1 1 20 LYS CA   C   -4.598   3.422  -4.542 1.00 . A A .  20 LYS CA   1 1 
       12  7026 1 1 20 LYS CB   C   -3.168   3.559  -5.067 1.00 . A A .  20 LYS CB   1 1 
       12  7027 1 1 20 LYS CD   C   -3.550   3.703  -7.546 1.00 . A A .  20 LYS CD   1 1 
       12  7028 1 1 20 LYS CE   C   -3.840   2.836  -8.762 1.00 . A A .  20 LYS CE   1 1 
       12  7029 1 1 20 LYS CG   C   -2.947   2.890  -6.413 1.00 . A A .  20 LYS CG   1 1 
       12  7030 1 1 20 LYS H    H   -4.237   4.994  -3.171 1.00 . A A .  20 LYS H    1 1 
       12  7031 1 1 20 LYS HA   H   -5.280   3.409  -5.378 1.00 . A A .  20 LYS HA   1 1 
       12  7032 1 1 20 LYS HB2  H   -2.933   4.609  -5.168 1.00 . A A .  20 LYS HB2  1 1 
       12  7033 1 1 20 LYS HB3  H   -2.490   3.115  -4.352 1.00 . A A .  20 LYS HB3  1 1 
       12  7034 1 1 20 LYS HD2  H   -4.474   4.148  -7.207 1.00 . A A .  20 LYS HD2  1 1 
       12  7035 1 1 20 LYS HD3  H   -2.855   4.482  -7.827 1.00 . A A .  20 LYS HD3  1 1 
       12  7036 1 1 20 LYS HE2  H   -3.835   3.461  -9.642 1.00 . A A .  20 LYS HE2  1 1 
       12  7037 1 1 20 LYS HE3  H   -3.065   2.089  -8.847 1.00 . A A .  20 LYS HE3  1 1 
       12  7038 1 1 20 LYS HG2  H   -1.886   2.786  -6.584 1.00 . A A .  20 LYS HG2  1 1 
       12  7039 1 1 20 LYS HG3  H   -3.408   1.913  -6.398 1.00 . A A .  20 LYS HG3  1 1 
       12  7040 1 1 20 LYS HZ1  H   -5.169   1.299  -9.244 1.00 . A A .  20 LYS HZ1  1 1 
       12  7041 1 1 20 LYS HZ2  H   -5.917   2.793  -8.978 1.00 . A A .  20 LYS HZ2  1 1 
       12  7042 1 1 20 LYS HZ3  H   -5.346   1.888  -7.668 1.00 . A A .  20 LYS HZ3  1 1 
       12  7043 1 1 20 LYS N    N   -4.940   4.564  -3.703 1.00 . A A .  20 LYS N    1 1 
       12  7044 1 1 20 LYS NZ   N   -5.160   2.156  -8.656 1.00 . A A .  20 LYS NZ   1 1 
       12  7045 1 1 20 LYS O    O   -3.969   1.835  -2.854 1.00 . A A .  20 LYS O    1 1 
       12  7046 1 1 21 ALA C    C   -5.255  -1.091  -4.200 1.00 . A A .  21 ALA C    1 1 
       12  7047 1 1 21 ALA CA   C   -5.984   0.041  -3.485 1.00 . A A .  21 ALA CA   1 1 
       12  7048 1 1 21 ALA CB   C   -7.477  -0.245  -3.426 1.00 . A A .  21 ALA CB   1 1 
       12  7049 1 1 21 ALA H    H   -6.324   1.598  -4.878 1.00 . A A .  21 ALA H    1 1 
       12  7050 1 1 21 ALA HA   H   -5.615   0.111  -2.472 1.00 . A A .  21 ALA HA   1 1 
       12  7051 1 1 21 ALA HB1  H   -7.979   0.566  -2.918 1.00 . A A .  21 ALA HB1  1 1 
       12  7052 1 1 21 ALA HB2  H   -7.866  -0.336  -4.430 1.00 . A A .  21 ALA HB2  1 1 
       12  7053 1 1 21 ALA HB3  H   -7.646  -1.166  -2.889 1.00 . A A .  21 ALA HB3  1 1 
       12  7054 1 1 21 ALA N    N   -5.740   1.320  -4.142 1.00 . A A .  21 ALA N    1 1 
       12  7055 1 1 21 ALA O    O   -4.893  -0.969  -5.370 1.00 . A A .  21 ALA O    1 1 
       12  7056 1 1 22 PHE C    C   -4.880  -4.646  -3.449 1.00 . A A .  22 PHE C    1 1 
       12  7057 1 1 22 PHE CA   C   -4.354  -3.348  -4.055 1.00 . A A .  22 PHE CA   1 1 
       12  7058 1 1 22 PHE CB   C   -2.846  -3.236  -3.820 1.00 . A A .  22 PHE CB   1 1 
       12  7059 1 1 22 PHE CD1  C   -2.341  -0.783  -3.660 1.00 . A A .  22 PHE CD1  1 1 
       12  7060 1 1 22 PHE CD2  C   -1.589  -1.971  -5.585 1.00 . A A .  22 PHE CD2  1 1 
       12  7061 1 1 22 PHE CE1  C   -1.790   0.382  -4.160 1.00 . A A .  22 PHE CE1  1 1 
       12  7062 1 1 22 PHE CE2  C   -1.035  -0.810  -6.090 1.00 . A A .  22 PHE CE2  1 1 
       12  7063 1 1 22 PHE CG   C   -2.247  -1.971  -4.366 1.00 . A A .  22 PHE CG   1 1 
       12  7064 1 1 22 PHE CZ   C   -1.137   0.369  -5.376 1.00 . A A .  22 PHE CZ   1 1 
       12  7065 1 1 22 PHE H    H   -5.355  -2.231  -2.560 1.00 . A A .  22 PHE H    1 1 
       12  7066 1 1 22 PHE HA   H   -4.544  -3.357  -5.117 1.00 . A A .  22 PHE HA   1 1 
       12  7067 1 1 22 PHE HB2  H   -2.652  -3.263  -2.758 1.00 . A A .  22 PHE HB2  1 1 
       12  7068 1 1 22 PHE HB3  H   -2.353  -4.070  -4.294 1.00 . A A .  22 PHE HB3  1 1 
       12  7069 1 1 22 PHE HD1  H   -2.853  -0.771  -2.708 1.00 . A A .  22 PHE HD1  1 1 
       12  7070 1 1 22 PHE HD2  H   -1.509  -2.892  -6.145 1.00 . A A .  22 PHE HD2  1 1 
       12  7071 1 1 22 PHE HE1  H   -1.872   1.302  -3.599 1.00 . A A .  22 PHE HE1  1 1 
       12  7072 1 1 22 PHE HE2  H   -0.526  -0.823  -7.041 1.00 . A A .  22 PHE HE2  1 1 
       12  7073 1 1 22 PHE HZ   H   -0.706   1.278  -5.768 1.00 . A A .  22 PHE HZ   1 1 
       12  7074 1 1 22 PHE N    N   -5.042  -2.193  -3.489 1.00 . A A .  22 PHE N    1 1 
       12  7075 1 1 22 PHE O    O   -5.816  -4.635  -2.650 1.00 . A A .  22 PHE O    1 1 
       12  7076 1 1 23 SER C    C   -3.658  -7.614  -2.343 1.00 . A A .  23 SER C    1 1 
       12  7077 1 1 23 SER CA   C   -4.680  -7.069  -3.336 1.00 . A A .  23 SER CA   1 1 
       12  7078 1 1 23 SER CB   C   -4.855  -8.051  -4.495 1.00 . A A .  23 SER CB   1 1 
       12  7079 1 1 23 SER H    H   -3.531  -5.705  -4.477 1.00 . A A .  23 SER H    1 1 
       12  7080 1 1 23 SER HA   H   -5.627  -6.949  -2.830 1.00 . A A .  23 SER HA   1 1 
       12  7081 1 1 23 SER HB2  H   -3.913  -8.172  -5.007 1.00 . A A .  23 SER HB2  1 1 
       12  7082 1 1 23 SER HB3  H   -5.180  -9.006  -4.109 1.00 . A A .  23 SER HB3  1 1 
       12  7083 1 1 23 SER HG   H   -5.861  -6.622  -5.382 1.00 . A A .  23 SER HG   1 1 
       12  7084 1 1 23 SER N    N   -4.271  -5.762  -3.837 1.00 . A A .  23 SER N    1 1 
       12  7085 1 1 23 SER O    O   -4.018  -8.201  -1.323 1.00 . A A .  23 SER O    1 1 
       12  7086 1 1 23 SER OG   O   -5.820  -7.581  -5.421 1.00 . A A .  23 SER OG   1 1 
       12  7087 1 1 24 SER C    C   -0.639  -6.726  -1.058 1.00 . A A .  24 SER C    1 1 
       12  7088 1 1 24 SER CA   C   -1.304  -7.890  -1.787 1.00 . A A .  24 SER CA   1 1 
       12  7089 1 1 24 SER CB   C   -0.263  -8.654  -2.608 1.00 . A A .  24 SER CB   1 1 
       12  7090 1 1 24 SER H    H   -2.155  -6.940  -3.477 1.00 . A A .  24 SER H    1 1 
       12  7091 1 1 24 SER HA   H   -1.735  -8.558  -1.057 1.00 . A A .  24 SER HA   1 1 
       12  7092 1 1 24 SER HB2  H    0.214  -7.976  -3.299 1.00 . A A .  24 SER HB2  1 1 
       12  7093 1 1 24 SER HB3  H    0.479  -9.072  -1.943 1.00 . A A .  24 SER HB3  1 1 
       12  7094 1 1 24 SER HG   H   -0.999  -9.427  -4.251 1.00 . A A .  24 SER HG   1 1 
       12  7095 1 1 24 SER N    N   -2.380  -7.415  -2.650 1.00 . A A .  24 SER N    1 1 
       12  7096 1 1 24 SER O    O   -0.756  -5.571  -1.469 1.00 . A A .  24 SER O    1 1 
       12  7097 1 1 24 SER OG   O   -0.865  -9.706  -3.342 1.00 . A A .  24 SER OG   1 1 
       12  7098 1 1 25 LYS C    C    1.986  -5.513   0.087 1.00 . A A .  25 LYS C    1 1 
       12  7099 1 1 25 LYS CA   C    0.746  -6.021   0.815 1.00 . A A .  25 LYS CA   1 1 
       12  7100 1 1 25 LYS CB   C    1.141  -6.586   2.182 1.00 . A A .  25 LYS CB   1 1 
       12  7101 1 1 25 LYS CD   C    3.359  -5.608   2.841 1.00 . A A .  25 LYS CD   1 1 
       12  7102 1 1 25 LYS CE   C    4.047  -6.605   3.760 1.00 . A A .  25 LYS CE   1 1 
       12  7103 1 1 25 LYS CG   C    1.857  -5.583   3.070 1.00 . A A .  25 LYS CG   1 1 
       12  7104 1 1 25 LYS H    H    0.117  -7.977   0.305 1.00 . A A .  25 LYS H    1 1 
       12  7105 1 1 25 LYS HA   H    0.065  -5.197   0.959 1.00 . A A .  25 LYS HA   1 1 
       12  7106 1 1 25 LYS HB2  H    0.248  -6.915   2.693 1.00 . A A .  25 LYS HB2  1 1 
       12  7107 1 1 25 LYS HB3  H    1.793  -7.434   2.033 1.00 . A A .  25 LYS HB3  1 1 
       12  7108 1 1 25 LYS HD2  H    3.553  -5.887   1.816 1.00 . A A .  25 LYS HD2  1 1 
       12  7109 1 1 25 LYS HD3  H    3.759  -4.622   3.029 1.00 . A A .  25 LYS HD3  1 1 
       12  7110 1 1 25 LYS HE2  H    3.555  -6.588   4.721 1.00 . A A .  25 LYS HE2  1 1 
       12  7111 1 1 25 LYS HE3  H    3.961  -7.591   3.329 1.00 . A A .  25 LYS HE3  1 1 
       12  7112 1 1 25 LYS HG2  H    1.487  -4.593   2.851 1.00 . A A .  25 LYS HG2  1 1 
       12  7113 1 1 25 LYS HG3  H    1.656  -5.824   4.105 1.00 . A A .  25 LYS HG3  1 1 
       12  7114 1 1 25 LYS HZ1  H    5.700  -5.345   3.552 1.00 . A A .  25 LYS HZ1  1 1 
       12  7115 1 1 25 LYS HZ2  H    6.079  -6.992   3.468 1.00 . A A .  25 LYS HZ2  1 1 
       12  7116 1 1 25 LYS HZ3  H    5.725  -6.280   4.961 1.00 . A A .  25 LYS HZ3  1 1 
       12  7117 1 1 25 LYS N    N    0.060  -7.038   0.027 1.00 . A A .  25 LYS N    1 1 
       12  7118 1 1 25 LYS NZ   N    5.489  -6.283   3.948 1.00 . A A .  25 LYS NZ   1 1 
       12  7119 1 1 25 LYS O    O    2.336  -4.337   0.183 1.00 . A A .  25 LYS O    1 1 
       12  7120 1 1 26 SER C    C    3.521  -5.074  -2.513 1.00 . A A .  26 SER C    1 1 
       12  7121 1 1 26 SER CA   C    3.849  -6.049  -1.386 1.00 . A A .  26 SER CA   1 1 
       12  7122 1 1 26 SER CB   C    4.512  -7.303  -1.959 1.00 . A A .  26 SER CB   1 1 
       12  7123 1 1 26 SER H    H    2.318  -7.330  -0.680 1.00 . A A .  26 SER H    1 1 
       12  7124 1 1 26 SER HA   H    4.533  -5.572  -0.701 1.00 . A A .  26 SER HA   1 1 
       12  7125 1 1 26 SER HB2  H    3.774  -7.888  -2.487 1.00 . A A .  26 SER HB2  1 1 
       12  7126 1 1 26 SER HB3  H    5.297  -7.012  -2.642 1.00 . A A .  26 SER HB3  1 1 
       12  7127 1 1 26 SER HG   H    4.605  -7.936  -0.108 1.00 . A A .  26 SER HG   1 1 
       12  7128 1 1 26 SER N    N    2.646  -6.407  -0.643 1.00 . A A .  26 SER N    1 1 
       12  7129 1 1 26 SER O    O    4.278  -4.140  -2.781 1.00 . A A .  26 SER O    1 1 
       12  7130 1 1 26 SER OG   O    5.074  -8.098  -0.930 1.00 . A A .  26 SER OG   1 1 
       12  7131 1 1 27 TYR C    C    1.785  -2.999  -3.799 1.00 . A A .  27 TYR C    1 1 
       12  7132 1 1 27 TYR CA   C    1.959  -4.440  -4.268 1.00 . A A .  27 TYR CA   1 1 
       12  7133 1 1 27 TYR CB   C    0.649  -4.957  -4.864 1.00 . A A .  27 TYR CB   1 1 
       12  7134 1 1 27 TYR CD1  C    1.754  -5.864  -6.945 1.00 . A A .  27 TYR CD1  1 1 
       12  7135 1 1 27 TYR CD2  C    0.109  -7.210  -5.866 1.00 . A A .  27 TYR CD2  1 1 
       12  7136 1 1 27 TYR CE1  C    1.933  -6.842  -7.904 1.00 . A A .  27 TYR CE1  1 1 
       12  7137 1 1 27 TYR CE2  C    0.282  -8.194  -6.821 1.00 . A A .  27 TYR CE2  1 1 
       12  7138 1 1 27 TYR CG   C    0.841  -6.030  -5.911 1.00 . A A .  27 TYR CG   1 1 
       12  7139 1 1 27 TYR CZ   C    1.194  -8.005  -7.838 1.00 . A A .  27 TYR CZ   1 1 
       12  7140 1 1 27 TYR H    H    1.826  -6.057  -2.909 1.00 . A A .  27 TYR H    1 1 
       12  7141 1 1 27 TYR HA   H    2.725  -4.469  -5.029 1.00 . A A .  27 TYR HA   1 1 
       12  7142 1 1 27 TYR HB2  H    0.040  -5.370  -4.074 1.00 . A A .  27 TYR HB2  1 1 
       12  7143 1 1 27 TYR HB3  H    0.122  -4.134  -5.325 1.00 . A A .  27 TYR HB3  1 1 
       12  7144 1 1 27 TYR HD1  H    2.331  -4.952  -6.993 1.00 . A A .  27 TYR HD1  1 1 
       12  7145 1 1 27 TYR HD2  H   -0.605  -7.356  -5.069 1.00 . A A .  27 TYR HD2  1 1 
       12  7146 1 1 27 TYR HE1  H    2.647  -6.695  -8.700 1.00 . A A .  27 TYR HE1  1 1 
       12  7147 1 1 27 TYR HE2  H   -0.296  -9.105  -6.769 1.00 . A A .  27 TYR HE2  1 1 
       12  7148 1 1 27 TYR HH   H    0.563  -9.079  -9.302 1.00 . A A .  27 TYR HH   1 1 
       12  7149 1 1 27 TYR N    N    2.388  -5.297  -3.169 1.00 . A A .  27 TYR N    1 1 
       12  7150 1 1 27 TYR O    O    2.248  -2.061  -4.450 1.00 . A A .  27 TYR O    1 1 
       12  7151 1 1 27 TYR OH   O    1.370  -8.983  -8.790 1.00 . A A .  27 TYR OH   1 1 
       12  7152 1 1 28 LEU C    C    2.192  -0.751  -1.915 1.00 . A A .  28 LEU C    1 1 
       12  7153 1 1 28 LEU CA   C    0.878  -1.503  -2.107 1.00 . A A .  28 LEU CA   1 1 
       12  7154 1 1 28 LEU CB   C    0.141  -1.614  -0.771 1.00 . A A .  28 LEU CB   1 1 
       12  7155 1 1 28 LEU CD1  C   -1.080   0.569  -0.614 1.00 . A A .  28 LEU CD1  1 1 
       12  7156 1 1 28 LEU CD2  C   -0.362  -0.611   1.471 1.00 . A A .  28 LEU CD2  1 1 
       12  7157 1 1 28 LEU CG   C   -0.016  -0.314   0.019 1.00 . A A .  28 LEU CG   1 1 
       12  7158 1 1 28 LEU H    H    0.769  -3.615  -2.191 1.00 . A A .  28 LEU H    1 1 
       12  7159 1 1 28 LEU HA   H    0.262  -0.955  -2.804 1.00 . A A .  28 LEU HA   1 1 
       12  7160 1 1 28 LEU HB2  H   -0.846  -2.002  -0.970 1.00 . A A .  28 LEU HB2  1 1 
       12  7161 1 1 28 LEU HB3  H    0.683  -2.315  -0.152 1.00 . A A .  28 LEU HB3  1 1 
       12  7162 1 1 28 LEU HD11 H   -2.040   0.080  -0.549 1.00 . A A .  28 LEU HD11 1 1 
       12  7163 1 1 28 LEU HD12 H   -0.833   0.743  -1.651 1.00 . A A .  28 LEU HD12 1 1 
       12  7164 1 1 28 LEU HD13 H   -1.121   1.514  -0.091 1.00 . A A .  28 LEU HD13 1 1 
       12  7165 1 1 28 LEU HD21 H   -0.172   0.266   2.072 1.00 . A A .  28 LEU HD21 1 1 
       12  7166 1 1 28 LEU HD22 H    0.247  -1.430   1.825 1.00 . A A .  28 LEU HD22 1 1 
       12  7167 1 1 28 LEU HD23 H   -1.405  -0.881   1.545 1.00 . A A .  28 LEU HD23 1 1 
       12  7168 1 1 28 LEU HG   H    0.920   0.226   0.001 1.00 . A A .  28 LEU HG   1 1 
       12  7169 1 1 28 LEU N    N    1.114  -2.829  -2.665 1.00 . A A .  28 LEU N    1 1 
       12  7170 1 1 28 LEU O    O    2.321   0.405  -2.318 1.00 . A A .  28 LEU O    1 1 
       12  7171 1 1 29 ILE C    C    5.020  -0.170  -2.325 1.00 . A A .  29 ILE C    1 1 
       12  7172 1 1 29 ILE CA   C    4.467  -0.812  -1.057 1.00 . A A .  29 ILE CA   1 1 
       12  7173 1 1 29 ILE CB   C    5.480  -1.849  -0.537 1.00 . A A .  29 ILE CB   1 1 
       12  7174 1 1 29 ILE CD1  C    5.609  -3.772   1.125 1.00 . A A .  29 ILE CD1  1 1 
       12  7175 1 1 29 ILE CG1  C    5.017  -2.418   0.806 1.00 . A A .  29 ILE CG1  1 1 
       12  7176 1 1 29 ILE CG2  C    6.860  -1.221  -0.404 1.00 . A A .  29 ILE CG2  1 1 
       12  7177 1 1 29 ILE H    H    2.999  -2.335  -1.001 1.00 . A A .  29 ILE H    1 1 
       12  7178 1 1 29 ILE HA   H    4.345  -0.047  -0.303 1.00 . A A .  29 ILE HA   1 1 
       12  7179 1 1 29 ILE HB   H    5.544  -2.650  -1.257 1.00 . A A .  29 ILE HB   1 1 
       12  7180 1 1 29 ILE HD11 H    4.828  -4.519   1.112 1.00 . A A .  29 ILE HD11 1 1 
       12  7181 1 1 29 ILE HD12 H    6.356  -4.022   0.386 1.00 . A A .  29 ILE HD12 1 1 
       12  7182 1 1 29 ILE HD13 H    6.064  -3.745   2.104 1.00 . A A .  29 ILE HD13 1 1 
       12  7183 1 1 29 ILE HG12 H    5.300  -1.738   1.595 1.00 . A A .  29 ILE HG12 1 1 
       12  7184 1 1 29 ILE HG13 H    3.941  -2.519   0.793 1.00 . A A .  29 ILE HG13 1 1 
       12  7185 1 1 29 ILE HG21 H    7.546  -1.944   0.012 1.00 . A A .  29 ILE HG21 1 1 
       12  7186 1 1 29 ILE HG22 H    7.210  -0.913  -1.378 1.00 . A A .  29 ILE HG22 1 1 
       12  7187 1 1 29 ILE HG23 H    6.804  -0.362   0.247 1.00 . A A .  29 ILE HG23 1 1 
       12  7188 1 1 29 ILE N    N    3.163  -1.416  -1.299 1.00 . A A .  29 ILE N    1 1 
       12  7189 1 1 29 ILE O    O    5.298   1.029  -2.355 1.00 . A A .  29 ILE O    1 1 
       12  7190 1 1 30 ILE C    C    5.016   0.823  -5.042 1.00 . A A .  30 ILE C    1 1 
       12  7191 1 1 30 ILE CA   C    5.690  -0.486  -4.642 1.00 . A A .  30 ILE CA   1 1 
       12  7192 1 1 30 ILE CB   C    5.489  -1.518  -5.767 1.00 . A A .  30 ILE CB   1 1 
       12  7193 1 1 30 ILE CD1  C    5.926  -3.949  -6.381 1.00 . A A .  30 ILE CD1  1 1 
       12  7194 1 1 30 ILE CG1  C    6.263  -2.801  -5.456 1.00 . A A .  30 ILE CG1  1 1 
       12  7195 1 1 30 ILE CG2  C    5.927  -0.938  -7.103 1.00 . A A .  30 ILE CG2  1 1 
       12  7196 1 1 30 ILE H    H    4.934  -1.922  -3.284 1.00 . A A .  30 ILE H    1 1 
       12  7197 1 1 30 ILE HA   H    6.750  -0.311  -4.527 1.00 . A A .  30 ILE HA   1 1 
       12  7198 1 1 30 ILE HB   H    4.436  -1.748  -5.830 1.00 . A A .  30 ILE HB   1 1 
       12  7199 1 1 30 ILE HD11 H    4.867  -3.940  -6.595 1.00 . A A .  30 ILE HD11 1 1 
       12  7200 1 1 30 ILE HD12 H    6.479  -3.843  -7.303 1.00 . A A .  30 ILE HD12 1 1 
       12  7201 1 1 30 ILE HD13 H    6.190  -4.883  -5.908 1.00 . A A .  30 ILE HD13 1 1 
       12  7202 1 1 30 ILE HG12 H    7.320  -2.605  -5.543 1.00 . A A .  30 ILE HG12 1 1 
       12  7203 1 1 30 ILE HG13 H    6.040  -3.111  -4.446 1.00 . A A .  30 ILE HG13 1 1 
       12  7204 1 1 30 ILE HG21 H    6.001  -1.731  -7.833 1.00 . A A .  30 ILE HG21 1 1 
       12  7205 1 1 30 ILE HG22 H    5.202  -0.211  -7.435 1.00 . A A .  30 ILE HG22 1 1 
       12  7206 1 1 30 ILE HG23 H    6.890  -0.462  -6.991 1.00 . A A .  30 ILE HG23 1 1 
       12  7207 1 1 30 ILE N    N    5.174  -0.976  -3.370 1.00 . A A .  30 ILE N    1 1 
       12  7208 1 1 30 ILE O    O    5.576   1.617  -5.797 1.00 . A A .  30 ILE O    1 1 
       12  7209 1 1 31 HIS C    C    3.331   3.335  -3.787 1.00 . A A .  31 HIS C    1 1 
       12  7210 1 1 31 HIS CA   C    3.058   2.255  -4.829 1.00 . A A .  31 HIS CA   1 1 
       12  7211 1 1 31 HIS CB   C    1.561   1.952  -4.888 1.00 . A A .  31 HIS CB   1 1 
       12  7212 1 1 31 HIS CD2  C   -0.021   3.759  -3.909 1.00 . A A .  31 HIS CD2  1 1 
       12  7213 1 1 31 HIS CE1  C   -0.290   4.965  -5.720 1.00 . A A .  31 HIS CE1  1 1 
       12  7214 1 1 31 HIS CG   C    0.702   3.179  -4.895 1.00 . A A .  31 HIS CG   1 1 
       12  7215 1 1 31 HIS H    H    3.415   0.370  -3.933 1.00 . A A .  31 HIS H    1 1 
       12  7216 1 1 31 HIS HA   H    3.382   2.614  -5.795 1.00 . A A .  31 HIS HA   1 1 
       12  7217 1 1 31 HIS HB2  H    1.348   1.394  -5.787 1.00 . A A .  31 HIS HB2  1 1 
       12  7218 1 1 31 HIS HB3  H    1.286   1.359  -4.028 1.00 . A A .  31 HIS HB3  1 1 
       12  7219 1 1 31 HIS HD1  H    0.906   3.797  -6.899 1.00 . A A .  31 HIS HD1  1 1 
       12  7220 1 1 31 HIS HD2  H   -0.105   3.415  -2.887 1.00 . A A .  31 HIS HD2  1 1 
       12  7221 1 1 31 HIS HE1  H   -0.615   5.737  -6.402 1.00 . A A .  31 HIS HE1  1 1 
       12  7222 1 1 31 HIS N    N    3.809   1.041  -4.528 1.00 . A A .  31 HIS N    1 1 
       12  7223 1 1 31 HIS ND1  N    0.511   3.958  -6.017 1.00 . A A .  31 HIS ND1  1 1 
       12  7224 1 1 31 HIS NE2  N   -0.628   4.867  -4.447 1.00 . A A .  31 HIS NE2  1 1 
       12  7225 1 1 31 HIS O    O    3.455   4.513  -4.118 1.00 . A A .  31 HIS O    1 1 
       12  7226 1 1 32 MET C    C    5.128   4.336  -1.461 1.00 . A A .  32 MET C    1 1 
       12  7227 1 1 32 MET CA   C    3.680   3.857  -1.436 1.00 . A A .  32 MET CA   1 1 
       12  7228 1 1 32 MET CB   C    3.371   3.199  -0.089 1.00 . A A .  32 MET CB   1 1 
       12  7229 1 1 32 MET CE   C    0.981   4.970   1.770 1.00 . A A .  32 MET CE   1 1 
       12  7230 1 1 32 MET CG   C    1.892   2.930   0.130 1.00 . A A .  32 MET CG   1 1 
       12  7231 1 1 32 MET H    H    3.314   1.971  -2.324 1.00 . A A .  32 MET H    1 1 
       12  7232 1 1 32 MET HA   H    3.029   4.709  -1.567 1.00 . A A .  32 MET HA   1 1 
       12  7233 1 1 32 MET HB2  H    3.899   2.259  -0.032 1.00 . A A .  32 MET HB2  1 1 
       12  7234 1 1 32 MET HB3  H    3.718   3.847   0.702 1.00 . A A .  32 MET HB3  1 1 
       12  7235 1 1 32 MET HE1  H    0.082   4.669   2.288 1.00 . A A .  32 MET HE1  1 1 
       12  7236 1 1 32 MET HE2  H    1.840   4.520   2.247 1.00 . A A .  32 MET HE2  1 1 
       12  7237 1 1 32 MET HE3  H    1.073   6.045   1.802 1.00 . A A .  32 MET HE3  1 1 
       12  7238 1 1 32 MET HG2  H    1.545   2.251  -0.635 1.00 . A A .  32 MET HG2  1 1 
       12  7239 1 1 32 MET HG3  H    1.764   2.471   1.100 1.00 . A A .  32 MET HG3  1 1 
       12  7240 1 1 32 MET N    N    3.422   2.924  -2.526 1.00 . A A .  32 MET N    1 1 
       12  7241 1 1 32 MET O    O    5.471   5.339  -0.835 1.00 . A A .  32 MET O    1 1 
       12  7242 1 1 32 MET SD   S    0.895   4.430   0.064 1.00 . A A .  32 MET SD   1 1 
       12  7243 1 1 33 ARG C    C    7.554   5.385  -2.818 1.00 . A A .  33 ARG C    1 1 
       12  7244 1 1 33 ARG CA   C    7.385   3.963  -2.293 1.00 . A A .  33 ARG CA   1 1 
       12  7245 1 1 33 ARG CB   C    8.109   2.978  -3.212 1.00 . A A .  33 ARG CB   1 1 
       12  7246 1 1 33 ARG CD   C    8.769   2.349  -5.555 1.00 . A A .  33 ARG CD   1 1 
       12  7247 1 1 33 ARG CG   C    7.946   3.292  -4.691 1.00 . A A .  33 ARG CG   1 1 
       12  7248 1 1 33 ARG CZ   C    9.518   2.244  -7.894 1.00 . A A .  33 ARG CZ   1 1 
       12  7249 1 1 33 ARG H    H    5.640   2.823  -2.665 1.00 . A A .  33 ARG H    1 1 
       12  7250 1 1 33 ARG HA   H    7.816   3.903  -1.305 1.00 . A A .  33 ARG HA   1 1 
       12  7251 1 1 33 ARG HB2  H    9.164   2.994  -2.978 1.00 . A A .  33 ARG HB2  1 1 
       12  7252 1 1 33 ARG HB3  H    7.724   1.986  -3.033 1.00 . A A .  33 ARG HB3  1 1 
       12  7253 1 1 33 ARG HD2  H    9.804   2.420  -5.257 1.00 . A A .  33 ARG HD2  1 1 
       12  7254 1 1 33 ARG HD3  H    8.417   1.340  -5.398 1.00 . A A .  33 ARG HD3  1 1 
       12  7255 1 1 33 ARG HE   H    7.913   3.240  -7.255 1.00 . A A .  33 ARG HE   1 1 
       12  7256 1 1 33 ARG HG2  H    6.905   3.191  -4.958 1.00 . A A .  33 ARG HG2  1 1 
       12  7257 1 1 33 ARG HG3  H    8.270   4.307  -4.871 1.00 . A A .  33 ARG HG3  1 1 
       12  7258 1 1 33 ARG HH11 H   10.667   1.219  -6.586 1.00 . A A .  33 ARG HH11 1 1 
       12  7259 1 1 33 ARG HH12 H   11.184   1.152  -8.238 1.00 . A A .  33 ARG HH12 1 1 
       12  7260 1 1 33 ARG HH21 H    8.584   3.160  -9.434 1.00 . A A .  33 ARG HH21 1 1 
       12  7261 1 1 33 ARG HH22 H    9.999   2.258  -9.857 1.00 . A A .  33 ARG HH22 1 1 
       12  7262 1 1 33 ARG N    N    5.973   3.612  -2.188 1.00 . A A .  33 ARG N    1 1 
       12  7263 1 1 33 ARG NE   N    8.661   2.674  -6.975 1.00 . A A .  33 ARG NE   1 1 
       12  7264 1 1 33 ARG NH1  N   10.541   1.476  -7.544 1.00 . A A .  33 ARG NH1  1 1 
       12  7265 1 1 33 ARG NH2  N    9.353   2.582  -9.166 1.00 . A A .  33 ARG NH2  1 1 
       12  7266 1 1 33 ARG O    O    8.515   6.075  -2.476 1.00 . A A .  33 ARG O    1 1 
       12  7267 1 1 34 THR C    C    5.920   8.158  -3.347 1.00 . A A .  34 THR C    1 1 
       12  7268 1 1 34 THR CA   C    6.660   7.157  -4.227 1.00 . A A .  34 THR CA   1 1 
       12  7269 1 1 34 THR CB   C    6.048   7.183  -5.641 1.00 . A A .  34 THR CB   1 1 
       12  7270 1 1 34 THR CG2  C    4.715   6.450  -5.667 1.00 . A A .  34 THR CG2  1 1 
       12  7271 1 1 34 THR H    H    5.873   5.221  -3.888 1.00 . A A .  34 THR H    1 1 
       12  7272 1 1 34 THR HA   H    7.696   7.453  -4.301 1.00 . A A .  34 THR HA   1 1 
       12  7273 1 1 34 THR HB   H    6.727   6.687  -6.320 1.00 . A A .  34 THR HB   1 1 
       12  7274 1 1 34 THR HG1  H    4.998   8.846  -5.789 1.00 . A A .  34 THR HG1  1 1 
       12  7275 1 1 34 THR HG21 H    4.156   6.689  -4.775 1.00 . A A .  34 THR HG21 1 1 
       12  7276 1 1 34 THR HG22 H    4.890   5.385  -5.708 1.00 . A A .  34 THR HG22 1 1 
       12  7277 1 1 34 THR HG23 H    4.153   6.757  -6.537 1.00 . A A .  34 THR HG23 1 1 
       12  7278 1 1 34 THR N    N    6.614   5.818  -3.653 1.00 . A A .  34 THR N    1 1 
       12  7279 1 1 34 THR O    O    6.010   9.368  -3.557 1.00 . A A .  34 THR O    1 1 
       12  7280 1 1 34 THR OG1  O    5.863   8.536  -6.070 1.00 . A A .  34 THR OG1  1 1 
       12  7281 1 1 35 HIS C    C    5.301   8.928  -0.268 1.00 . A A .  35 HIS C    1 1 
       12  7282 1 1 35 HIS CA   C    4.436   8.497  -1.448 1.00 . A A .  35 HIS CA   1 1 
       12  7283 1 1 35 HIS CB   C    3.193   7.763  -0.943 1.00 . A A .  35 HIS CB   1 1 
       12  7284 1 1 35 HIS CD2  C    1.163   6.958  -2.343 1.00 . A A .  35 HIS CD2  1 1 
       12  7285 1 1 35 HIS CE1  C    0.523   8.903  -3.127 1.00 . A A .  35 HIS CE1  1 1 
       12  7286 1 1 35 HIS CG   C    2.010   7.893  -1.852 1.00 . A A .  35 HIS CG   1 1 
       12  7287 1 1 35 HIS H    H    5.158   6.674  -2.246 1.00 . A A .  35 HIS H    1 1 
       12  7288 1 1 35 HIS HA   H    4.127   9.376  -1.993 1.00 . A A .  35 HIS HA   1 1 
       12  7289 1 1 35 HIS HB2  H    3.420   6.712  -0.843 1.00 . A A .  35 HIS HB2  1 1 
       12  7290 1 1 35 HIS HB3  H    2.916   8.160   0.023 1.00 . A A .  35 HIS HB3  1 1 
       12  7291 1 1 35 HIS HD1  H    1.993   9.973  -2.189 1.00 . A A .  35 HIS HD1  1 1 
       12  7292 1 1 35 HIS HD2  H    1.200   5.895  -2.150 1.00 . A A .  35 HIS HD2  1 1 
       12  7293 1 1 35 HIS HE1  H   -0.026   9.666  -3.657 1.00 . A A .  35 HIS HE1  1 1 
       12  7294 1 1 35 HIS N    N    5.190   7.646  -2.362 1.00 . A A .  35 HIS N    1 1 
       12  7295 1 1 35 HIS ND1  N    1.582   9.101  -2.362 1.00 . A A .  35 HIS ND1  1 1 
       12  7296 1 1 35 HIS NE2  N    0.248   7.611  -3.132 1.00 . A A .  35 HIS NE2  1 1 
       12  7297 1 1 35 HIS O    O    5.334  10.105   0.093 1.00 . A A .  35 HIS O    1 1 
       12  7298 1 1 36 SER C    C    8.279   8.576   1.015 1.00 . A A .  36 SER C    1 1 
       12  7299 1 1 36 SER CA   C    6.861   8.249   1.472 1.00 . A A .  36 SER CA   1 1 
       12  7300 1 1 36 SER CB   C    6.884   7.053   2.426 1.00 . A A .  36 SER CB   1 1 
       12  7301 1 1 36 SER H    H    5.931   7.049  -0.004 1.00 . A A .  36 SER H    1 1 
       12  7302 1 1 36 SER HA   H    6.456   9.104   1.991 1.00 . A A .  36 SER HA   1 1 
       12  7303 1 1 36 SER HB2  H    6.973   6.141   1.855 1.00 . A A .  36 SER HB2  1 1 
       12  7304 1 1 36 SER HB3  H    7.729   7.144   3.093 1.00 . A A .  36 SER HB3  1 1 
       12  7305 1 1 36 SER HG   H    5.871   7.331   4.080 1.00 . A A .  36 SER HG   1 1 
       12  7306 1 1 36 SER N    N    5.999   7.968   0.330 1.00 . A A .  36 SER N    1 1 
       12  7307 1 1 36 SER O    O    8.714   8.148  -0.053 1.00 . A A .  36 SER O    1 1 
       12  7308 1 1 36 SER OG   O    5.697   6.993   3.198 1.00 . A A .  36 SER OG   1 1 
       12  7309 1 1 37 GLY C    C   10.603  11.202   1.639 1.00 . A A .  37 GLY C    1 1 
       12  7310 1 1 37 GLY CA   C   10.358   9.713   1.498 1.00 . A A .  37 GLY CA   1 1 
       12  7311 1 1 37 GLY H    H    8.598   9.653   2.673 1.00 . A A .  37 GLY H    1 1 
       12  7312 1 1 37 GLY HA2  H   11.037   9.184   2.150 1.00 . A A .  37 GLY HA2  1 1 
       12  7313 1 1 37 GLY HA3  H   10.557   9.423   0.476 1.00 . A A .  37 GLY HA3  1 1 
       12  7314 1 1 37 GLY N    N    8.997   9.340   1.834 1.00 . A A .  37 GLY N    1 1 
       12  7315 1 1 37 GLY O    O   10.038  11.849   2.521 1.00 . A A .  37 GLY O    1 1 
       12  7316 1 1 38 GLU C    C   10.763  13.973  -0.015 1.00 . A A .  38 GLU C    1 1 
       12  7317 1 1 38 GLU CA   C   11.768  13.169   0.804 1.00 . A A .  38 GLU CA   1 1 
       12  7318 1 1 38 GLU CB   C   13.183  13.410   0.275 1.00 . A A .  38 GLU CB   1 1 
       12  7319 1 1 38 GLU CD   C   14.756  13.755   2.221 1.00 . A A .  38 GLU CD   1 1 
       12  7320 1 1 38 GLU CG   C   14.271  12.803   1.146 1.00 . A A .  38 GLU CG   1 1 
       12  7321 1 1 38 GLU H    H   11.868  11.179   0.090 1.00 . A A .  38 GLU H    1 1 
       12  7322 1 1 38 GLU HA   H   11.719  13.495   1.832 1.00 . A A .  38 GLU HA   1 1 
       12  7323 1 1 38 GLU HB2  H   13.262  12.982  -0.714 1.00 . A A .  38 GLU HB2  1 1 
       12  7324 1 1 38 GLU HB3  H   13.355  14.474   0.212 1.00 . A A .  38 GLU HB3  1 1 
       12  7325 1 1 38 GLU HG2  H   13.880  11.916   1.622 1.00 . A A .  38 GLU HG2  1 1 
       12  7326 1 1 38 GLU HG3  H   15.108  12.534   0.518 1.00 . A A .  38 GLU HG3  1 1 
       12  7327 1 1 38 GLU N    N   11.449  11.747   0.770 1.00 . A A .  38 GLU N    1 1 
       12  7328 1 1 38 GLU O    O   10.796  13.959  -1.246 1.00 . A A .  38 GLU O    1 1 
       12  7329 1 1 38 GLU OE1  O   13.917  14.234   3.012 1.00 . A A .  38 GLU OE1  1 1 
       12  7330 1 1 38 GLU OE2  O   15.975  14.022   2.271 1.00 . A A .  38 GLU OE2  1 1 
       12  7331 1 1 39 LYS C    C    8.868  16.913   0.547 1.00 . A A .  39 LYS C    1 1 
       12  7332 1 1 39 LYS CA   C    8.854  15.483   0.014 1.00 . A A .  39 LYS CA   1 1 
       12  7333 1 1 39 LYS CB   C    7.469  14.866   0.215 1.00 . A A .  39 LYS CB   1 1 
       12  7334 1 1 39 LYS CD   C    6.588  14.065  -1.997 1.00 . A A .  39 LYS CD   1 1 
       12  7335 1 1 39 LYS CE   C    7.651  14.387  -3.036 1.00 . A A .  39 LYS CE   1 1 
       12  7336 1 1 39 LYS CG   C    6.508  15.143  -0.929 1.00 . A A .  39 LYS CG   1 1 
       12  7337 1 1 39 LYS H    H    9.894  14.644   1.656 1.00 . A A .  39 LYS H    1 1 
       12  7338 1 1 39 LYS HA   H    9.081  15.503  -1.041 1.00 . A A .  39 LYS HA   1 1 
       12  7339 1 1 39 LYS HB2  H    7.576  13.796   0.317 1.00 . A A .  39 LYS HB2  1 1 
       12  7340 1 1 39 LYS HB3  H    7.038  15.264   1.123 1.00 . A A .  39 LYS HB3  1 1 
       12  7341 1 1 39 LYS HD2  H    6.832  13.123  -1.529 1.00 . A A .  39 LYS HD2  1 1 
       12  7342 1 1 39 LYS HD3  H    5.629  13.986  -2.489 1.00 . A A .  39 LYS HD3  1 1 
       12  7343 1 1 39 LYS HE2  H    8.623  14.303  -2.575 1.00 . A A .  39 LYS HE2  1 1 
       12  7344 1 1 39 LYS HE3  H    7.573  13.675  -3.844 1.00 . A A .  39 LYS HE3  1 1 
       12  7345 1 1 39 LYS HG2  H    5.501  15.176  -0.541 1.00 . A A .  39 LYS HG2  1 1 
       12  7346 1 1 39 LYS HG3  H    6.757  16.096  -1.373 1.00 . A A .  39 LYS HG3  1 1 
       12  7347 1 1 39 LYS HZ1  H    8.186  16.403  -3.149 1.00 . A A .  39 LYS HZ1  1 1 
       12  7348 1 1 39 LYS HZ2  H    6.535  16.118  -3.384 1.00 . A A .  39 LYS HZ2  1 1 
       12  7349 1 1 39 LYS HZ3  H    7.639  15.756  -4.613 1.00 . A A .  39 LYS HZ3  1 1 
       12  7350 1 1 39 LYS N    N    9.870  14.673   0.676 1.00 . A A .  39 LYS N    1 1 
       12  7351 1 1 39 LYS NZ   N    7.492  15.763  -3.584 1.00 . A A .  39 LYS NZ   1 1 
       12  7352 1 1 39 LYS O    O    8.058  17.293   1.393 1.00 . A A .  39 LYS O    1 1 
       12  7353 1 1 40 PRO C    C    8.792  19.992  -0.044 1.00 . A A .  40 PRO C    1 1 
       12  7354 1 1 40 PRO CA   C    9.946  19.126   0.449 1.00 . A A .  40 PRO CA   1 1 
       12  7355 1 1 40 PRO CB   C   11.259  19.559  -0.209 1.00 . A A .  40 PRO CB   1 1 
       12  7356 1 1 40 PRO CD   C   10.805  17.339  -0.971 1.00 . A A .  40 PRO CD   1 1 
       12  7357 1 1 40 PRO CG   C   11.411  18.653  -1.381 1.00 . A A .  40 PRO CG   1 1 
       12  7358 1 1 40 PRO HA   H   10.032  19.219   1.522 1.00 . A A .  40 PRO HA   1 1 
       12  7359 1 1 40 PRO HB2  H   11.187  20.593  -0.515 1.00 . A A .  40 PRO HB2  1 1 
       12  7360 1 1 40 PRO HB3  H   12.073  19.440   0.490 1.00 . A A .  40 PRO HB3  1 1 
       12  7361 1 1 40 PRO HD2  H   10.332  16.861  -1.817 1.00 . A A .  40 PRO HD2  1 1 
       12  7362 1 1 40 PRO HD3  H   11.557  16.694  -0.543 1.00 . A A .  40 PRO HD3  1 1 
       12  7363 1 1 40 PRO HG2  H   10.885  19.060  -2.231 1.00 . A A .  40 PRO HG2  1 1 
       12  7364 1 1 40 PRO HG3  H   12.459  18.525  -1.613 1.00 . A A .  40 PRO HG3  1 1 
       12  7365 1 1 40 PRO N    N    9.807  17.725   0.040 1.00 . A A .  40 PRO N    1 1 
       12  7366 1 1 40 PRO O    O    8.778  21.204   0.168 1.00 . A A .  40 PRO O    1 1 
       12  7367 1 1 41 SER C    C    5.570  20.183  -0.175 1.00 . A A .  41 SER C    1 1 
       12  7368 1 1 41 SER CA   C    6.668  20.075  -1.229 1.00 . A A .  41 SER CA   1 1 
       12  7369 1 1 41 SER CB   C    6.128  19.367  -2.473 1.00 . A A .  41 SER CB   1 1 
       12  7370 1 1 41 SER H    H    7.893  18.393  -0.840 1.00 . A A .  41 SER H    1 1 
       12  7371 1 1 41 SER HA   H    6.988  21.070  -1.502 1.00 . A A .  41 SER HA   1 1 
       12  7372 1 1 41 SER HB2  H    6.945  19.148  -3.143 1.00 . A A .  41 SER HB2  1 1 
       12  7373 1 1 41 SER HB3  H    5.646  18.445  -2.179 1.00 . A A .  41 SER HB3  1 1 
       12  7374 1 1 41 SER HG   H    4.546  20.521  -2.525 1.00 . A A .  41 SER HG   1 1 
       12  7375 1 1 41 SER N    N    7.825  19.361  -0.703 1.00 . A A .  41 SER N    1 1 
       12  7376 1 1 41 SER O    O    4.405  19.893  -0.444 1.00 . A A .  41 SER O    1 1 
       12  7377 1 1 41 SER OG   O    5.186  20.178  -3.153 1.00 . A A .  41 SER OG   1 1 
       12  7378 1 1 42 GLY C    C    4.813  19.459   2.893 1.00 . A A .  42 GLY C    1 1 
       12  7379 1 1 42 GLY CA   C    4.990  20.741   2.105 1.00 . A A .  42 GLY CA   1 1 
       12  7380 1 1 42 GLY H    H    6.895  20.819   1.184 1.00 . A A .  42 GLY H    1 1 
       12  7381 1 1 42 GLY HA2  H    5.325  21.520   2.774 1.00 . A A .  42 GLY HA2  1 1 
       12  7382 1 1 42 GLY HA3  H    4.036  21.027   1.686 1.00 . A A .  42 GLY HA3  1 1 
       12  7383 1 1 42 GLY N    N    5.952  20.602   1.027 1.00 . A A .  42 GLY N    1 1 
       12  7384 1 1 42 GLY O    O    3.892  18.678   2.651 1.00 . A A .  42 GLY O    1 1 
       12  7385 1 1 43 PRO C    C    4.493  18.038   5.671 1.00 . A A .  43 PRO C    1 1 
       12  7386 1 1 43 PRO CA   C    5.673  18.028   4.706 1.00 . A A .  43 PRO CA   1 1 
       12  7387 1 1 43 PRO CB   C    6.995  18.095   5.476 1.00 . A A .  43 PRO CB   1 1 
       12  7388 1 1 43 PRO CD   C    6.837  20.112   4.204 1.00 . A A .  43 PRO CD   1 1 
       12  7389 1 1 43 PRO CG   C    7.348  19.542   5.497 1.00 . A A .  43 PRO CG   1 1 
       12  7390 1 1 43 PRO HA   H    5.645  17.125   4.113 1.00 . A A .  43 PRO HA   1 1 
       12  7391 1 1 43 PRO HB2  H    6.851  17.707   6.475 1.00 . A A .  43 PRO HB2  1 1 
       12  7392 1 1 43 PRO HB3  H    7.745  17.513   4.962 1.00 . A A .  43 PRO HB3  1 1 
       12  7393 1 1 43 PRO HD2  H    6.497  21.127   4.347 1.00 . A A .  43 PRO HD2  1 1 
       12  7394 1 1 43 PRO HD3  H    7.604  20.072   3.444 1.00 . A A .  43 PRO HD3  1 1 
       12  7395 1 1 43 PRO HG2  H    6.869  20.024   6.336 1.00 . A A .  43 PRO HG2  1 1 
       12  7396 1 1 43 PRO HG3  H    8.420  19.656   5.559 1.00 . A A .  43 PRO HG3  1 1 
       12  7397 1 1 43 PRO N    N    5.713  19.225   3.860 1.00 . A A .  43 PRO N    1 1 
       12  7398 1 1 43 PRO O    O    4.318  17.112   6.462 1.00 . A A .  43 PRO O    1 1 
       12  7399 1 1 44 SER C    C    1.314  18.510   5.873 1.00 . A A .  44 SER C    1 1 
       12  7400 1 1 44 SER CA   C    2.523  19.223   6.469 1.00 . A A .  44 SER CA   1 1 
       12  7401 1 1 44 SER CB   C    2.195  20.700   6.698 1.00 . A A .  44 SER CB   1 1 
       12  7402 1 1 44 SER H    H    3.878  19.798   4.947 1.00 . A A .  44 SER H    1 1 
       12  7403 1 1 44 SER HA   H    2.764  18.766   7.417 1.00 . A A .  44 SER HA   1 1 
       12  7404 1 1 44 SER HB2  H    3.077  21.211   7.053 1.00 . A A .  44 SER HB2  1 1 
       12  7405 1 1 44 SER HB3  H    1.873  21.143   5.767 1.00 . A A .  44 SER HB3  1 1 
       12  7406 1 1 44 SER HG   H    0.906  21.775   7.708 1.00 . A A .  44 SER HG   1 1 
       12  7407 1 1 44 SER N    N    3.685  19.092   5.599 1.00 . A A .  44 SER N    1 1 
       12  7408 1 1 44 SER O    O    0.292  19.132   5.582 1.00 . A A .  44 SER O    1 1 
       12  7409 1 1 44 SER OG   O    1.163  20.851   7.657 1.00 . A A .  44 SER OG   1 1 
       12  7410 1 1 45 SER C    C   -0.054  16.932   3.758 1.00 . A A .  45 SER C    1 1 
       12  7411 1 1 45 SER CA   C    0.357  16.399   5.127 1.00 . A A .  45 SER CA   1 1 
       12  7412 1 1 45 SER CB   C   -0.849  16.394   6.068 1.00 . A A .  45 SER CB   1 1 
       12  7413 1 1 45 SER H    H    2.277  16.759   5.944 1.00 . A A .  45 SER H    1 1 
       12  7414 1 1 45 SER HA   H    0.718  15.388   5.013 1.00 . A A .  45 SER HA   1 1 
       12  7415 1 1 45 SER HB2  H   -0.513  16.219   7.079 1.00 . A A .  45 SER HB2  1 1 
       12  7416 1 1 45 SER HB3  H   -1.348  17.351   6.015 1.00 . A A .  45 SER HB3  1 1 
       12  7417 1 1 45 SER HG   H   -1.309  14.678   5.242 1.00 . A A .  45 SER HG   1 1 
       12  7418 1 1 45 SER N    N    1.438  17.198   5.693 1.00 . A A .  45 SER N    1 1 
       12  7419 1 1 45 SER O    O   -1.236  17.138   3.489 1.00 . A A .  45 SER O    1 1 
       12  7420 1 1 45 SER OG   O   -1.770  15.378   5.712 1.00 . A A .  45 SER OG   1 1 
       12  7421 1 1 46 GLY C    C   -0.255  16.744   0.773 1.00 . A A .  46 GLY C    1 1 
       12  7422 1 1 46 GLY CA   C    0.655  17.662   1.565 1.00 . A A .  46 GLY CA   1 1 
       12  7423 1 1 46 GLY H    H    1.858  16.972   3.165 1.00 . A A .  46 GLY H    1 1 
       12  7424 1 1 46 GLY HA2  H    0.186  18.630   1.651 1.00 . A A .  46 GLY HA2  1 1 
       12  7425 1 1 46 GLY HA3  H    1.589  17.772   1.032 1.00 . A A .  46 GLY HA3  1 1 
       12  7426 1 1 46 GLY N    N    0.933  17.154   2.895 1.00 . A A .  46 GLY N    1 1 
       12  7427 1 1 46 GLY O    O   -1.198  17.228   0.149 1.00 . A A .  46 GLY O    1 1 
       12  7428 2 2  1 ZN  ZN   ZN  -1.388   6.297  -3.170 1.00 . B A . 201 ZN  ZN   1 1 
       13  7429 1 1  1 GLY C    C  -28.573  -1.714  12.637 1.00 . A A .   1 GLY C    1 1 
       13  7430 1 1  1 GLY CA   C  -28.700  -0.951  13.941 1.00 . A A .   1 GLY CA   1 1 
       13  7431 1 1  1 GLY H1   H  -30.379   0.078  13.162 1.00 . A A .   1 GLY H1   1 1 
       13  7432 1 1  1 GLY HA2  H  -27.748  -0.499  14.176 1.00 . A A .   1 GLY HA2  1 1 
       13  7433 1 1  1 GLY HA3  H  -28.961  -1.645  14.726 1.00 . A A .   1 GLY HA3  1 1 
       13  7434 1 1  1 GLY N    N  -29.711   0.088  13.879 1.00 . A A .   1 GLY N    1 1 
       13  7435 1 1  1 GLY O    O  -29.499  -1.730  11.827 1.00 . A A .   1 GLY O    1 1 
       13  7436 1 1  2 SER C    C  -26.649  -4.504  11.547 1.00 . A A .   2 SER C    1 1 
       13  7437 1 1  2 SER CA   C  -27.175  -3.111  11.216 1.00 . A A .   2 SER CA   1 1 
       13  7438 1 1  2 SER CB   C  -26.175  -2.375  10.322 1.00 . A A .   2 SER CB   1 1 
       13  7439 1 1  2 SER H    H  -26.722  -2.296  13.118 1.00 . A A .   2 SER H    1 1 
       13  7440 1 1  2 SER HA   H  -28.112  -3.208  10.690 1.00 . A A .   2 SER HA   1 1 
       13  7441 1 1  2 SER HB2  H  -25.235  -2.274  10.844 1.00 . A A .   2 SER HB2  1 1 
       13  7442 1 1  2 SER HB3  H  -26.024  -2.942   9.414 1.00 . A A .   2 SER HB3  1 1 
       13  7443 1 1  2 SER HG   H  -27.608  -1.075  10.017 1.00 . A A .   2 SER HG   1 1 
       13  7444 1 1  2 SER N    N  -27.422  -2.347  12.434 1.00 . A A .   2 SER N    1 1 
       13  7445 1 1  2 SER O    O  -25.994  -4.706  12.569 1.00 . A A .   2 SER O    1 1 
       13  7446 1 1  2 SER OG   O  -26.649  -1.084   9.981 1.00 . A A .   2 SER OG   1 1 
       13  7447 1 1  3 SER C    C  -25.684  -7.326   9.682 1.00 . A A .   3 SER C    1 1 
       13  7448 1 1  3 SER CA   C  -26.503  -6.839  10.873 1.00 . A A .   3 SER CA   1 1 
       13  7449 1 1  3 SER CB   C  -27.709  -7.755  11.087 1.00 . A A .   3 SER CB   1 1 
       13  7450 1 1  3 SER H    H  -27.468  -5.239   9.877 1.00 . A A .   3 SER H    1 1 
       13  7451 1 1  3 SER HA   H  -25.882  -6.864  11.756 1.00 . A A .   3 SER HA   1 1 
       13  7452 1 1  3 SER HB2  H  -27.369  -8.774  11.195 1.00 . A A .   3 SER HB2  1 1 
       13  7453 1 1  3 SER HB3  H  -28.233  -7.453  11.982 1.00 . A A .   3 SER HB3  1 1 
       13  7454 1 1  3 SER HG   H  -28.412  -8.399   9.375 1.00 . A A .   3 SER HG   1 1 
       13  7455 1 1  3 SER N    N  -26.942  -5.463  10.674 1.00 . A A .   3 SER N    1 1 
       13  7456 1 1  3 SER O    O  -26.204  -7.479   8.578 1.00 . A A .   3 SER O    1 1 
       13  7457 1 1  3 SER OG   O  -28.603  -7.686   9.989 1.00 . A A .   3 SER OG   1 1 
       13  7458 1 1  4 GLY C    C  -23.375  -7.020   7.738 1.00 . A A .   4 GLY C    1 1 
       13  7459 1 1  4 GLY CA   C  -23.526  -8.036   8.853 1.00 . A A .   4 GLY CA   1 1 
       13  7460 1 1  4 GLY H    H  -24.037  -7.428  10.816 1.00 . A A .   4 GLY H    1 1 
       13  7461 1 1  4 GLY HA2  H  -22.552  -8.247   9.268 1.00 . A A .   4 GLY HA2  1 1 
       13  7462 1 1  4 GLY HA3  H  -23.936  -8.946   8.441 1.00 . A A .   4 GLY HA3  1 1 
       13  7463 1 1  4 GLY N    N  -24.398  -7.568   9.915 1.00 . A A .   4 GLY N    1 1 
       13  7464 1 1  4 GLY O    O  -24.229  -6.924   6.856 1.00 . A A .   4 GLY O    1 1 
       13  7465 1 1  5 SER C    C  -20.641  -5.416   6.158 1.00 . A A .   5 SER C    1 1 
       13  7466 1 1  5 SER CA   C  -22.029  -5.240   6.765 1.00 . A A .   5 SER CA   1 1 
       13  7467 1 1  5 SER CB   C  -22.158  -3.842   7.373 1.00 . A A .   5 SER CB   1 1 
       13  7468 1 1  5 SER H    H  -21.643  -6.382   8.506 1.00 . A A .   5 SER H    1 1 
       13  7469 1 1  5 SER HA   H  -22.768  -5.354   5.985 1.00 . A A .   5 SER HA   1 1 
       13  7470 1 1  5 SER HB2  H  -21.881  -3.104   6.636 1.00 . A A .   5 SER HB2  1 1 
       13  7471 1 1  5 SER HB3  H  -23.182  -3.679   7.679 1.00 . A A .   5 SER HB3  1 1 
       13  7472 1 1  5 SER HG   H  -21.561  -4.343   9.170 1.00 . A A .   5 SER HG   1 1 
       13  7473 1 1  5 SER N    N  -22.287  -6.258   7.777 1.00 . A A .   5 SER N    1 1 
       13  7474 1 1  5 SER O    O  -19.631  -5.342   6.858 1.00 . A A .   5 SER O    1 1 
       13  7475 1 1  5 SER OG   O  -21.316  -3.698   8.503 1.00 . A A .   5 SER OG   1 1 
       13  7476 1 1  6 SER C    C  -18.592  -7.060   4.689 1.00 . A A .   6 SER C    1 1 
       13  7477 1 1  6 SER CA   C  -19.336  -5.842   4.148 1.00 . A A .   6 SER CA   1 1 
       13  7478 1 1  6 SER CB   C  -18.460  -4.595   4.280 1.00 . A A .   6 SER CB   1 1 
       13  7479 1 1  6 SER H    H  -21.439  -5.699   4.347 1.00 . A A .   6 SER H    1 1 
       13  7480 1 1  6 SER HA   H  -19.559  -6.006   3.104 1.00 . A A .   6 SER HA   1 1 
       13  7481 1 1  6 SER HB2  H  -19.080  -3.714   4.209 1.00 . A A .   6 SER HB2  1 1 
       13  7482 1 1  6 SER HB3  H  -17.962  -4.608   5.239 1.00 . A A .   6 SER HB3  1 1 
       13  7483 1 1  6 SER HG   H  -16.636  -4.290   3.634 1.00 . A A .   6 SER HG   1 1 
       13  7484 1 1  6 SER N    N  -20.599  -5.651   4.850 1.00 . A A .   6 SER N    1 1 
       13  7485 1 1  6 SER O    O  -17.379  -7.022   4.886 1.00 . A A .   6 SER O    1 1 
       13  7486 1 1  6 SER OG   O  -17.481  -4.548   3.258 1.00 . A A .   6 SER OG   1 1 
       13  7487 1 1  7 GLY C    C  -17.601  -9.070   6.420 1.00 . A A .   7 GLY C    1 1 
       13  7488 1 1  7 GLY CA   C  -18.726  -9.353   5.444 1.00 . A A .   7 GLY CA   1 1 
       13  7489 1 1  7 GLY H    H  -20.295  -8.111   4.752 1.00 . A A .   7 GLY H    1 1 
       13  7490 1 1  7 GLY HA2  H  -19.485  -9.936   5.944 1.00 . A A .   7 GLY HA2  1 1 
       13  7491 1 1  7 GLY HA3  H  -18.333  -9.926   4.617 1.00 . A A .   7 GLY HA3  1 1 
       13  7492 1 1  7 GLY N    N  -19.331  -8.139   4.928 1.00 . A A .   7 GLY N    1 1 
       13  7493 1 1  7 GLY O    O  -17.694  -8.153   7.236 1.00 . A A .   7 GLY O    1 1 
       13  7494 1 1  8 ALA C    C  -14.500  -8.544   6.751 1.00 . A A .   8 ALA C    1 1 
       13  7495 1 1  8 ALA CA   C  -15.389  -9.690   7.221 1.00 . A A .   8 ALA CA   1 1 
       13  7496 1 1  8 ALA CB   C  -14.589 -10.982   7.302 1.00 . A A .   8 ALA CB   1 1 
       13  7497 1 1  8 ALA H    H  -16.521 -10.574   5.667 1.00 . A A .   8 ALA H    1 1 
       13  7498 1 1  8 ALA HA   H  -15.760  -9.462   8.210 1.00 . A A .   8 ALA HA   1 1 
       13  7499 1 1  8 ALA HB1  H  -14.789 -11.584   6.429 1.00 . A A .   8 ALA HB1  1 1 
       13  7500 1 1  8 ALA HB2  H  -13.535 -10.749   7.346 1.00 . A A .   8 ALA HB2  1 1 
       13  7501 1 1  8 ALA HB3  H  -14.875 -11.527   8.189 1.00 . A A .   8 ALA HB3  1 1 
       13  7502 1 1  8 ALA N    N  -16.536  -9.860   6.338 1.00 . A A .   8 ALA N    1 1 
       13  7503 1 1  8 ALA O    O  -14.071  -7.711   7.548 1.00 . A A .   8 ALA O    1 1 
       13  7504 1 1  9 GLY C    C  -12.170  -8.009   4.182 1.00 . A A .   9 GLY C    1 1 
       13  7505 1 1  9 GLY CA   C  -13.388  -7.460   4.897 1.00 . A A .   9 GLY CA   1 1 
       13  7506 1 1  9 GLY H    H  -14.596  -9.199   4.862 1.00 . A A .   9 GLY H    1 1 
       13  7507 1 1  9 GLY HA2  H  -13.972  -6.879   4.199 1.00 . A A .   9 GLY HA2  1 1 
       13  7508 1 1  9 GLY HA3  H  -13.060  -6.816   5.700 1.00 . A A .   9 GLY HA3  1 1 
       13  7509 1 1  9 GLY N    N  -14.226  -8.508   5.450 1.00 . A A .   9 GLY N    1 1 
       13  7510 1 1  9 GLY O    O  -11.193  -8.402   4.819 1.00 . A A .   9 GLY O    1 1 
       13  7511 1 1 10 GLU C    C  -10.466  -7.420   1.255 1.00 . A A .  10 GLU C    1 1 
       13  7512 1 1 10 GLU CA   C  -11.121  -8.544   2.052 1.00 . A A .  10 GLU CA   1 1 
       13  7513 1 1 10 GLU CB   C  -11.610  -9.640   1.102 1.00 . A A .  10 GLU CB   1 1 
       13  7514 1 1 10 GLU CD   C  -10.815 -11.617   2.457 1.00 . A A .  10 GLU CD   1 1 
       13  7515 1 1 10 GLU CG   C  -11.998 -10.928   1.807 1.00 . A A .  10 GLU CG   1 1 
       13  7516 1 1 10 GLU H    H  -13.034  -7.710   2.403 1.00 . A A .  10 GLU H    1 1 
       13  7517 1 1 10 GLU HA   H  -10.390  -8.965   2.725 1.00 . A A .  10 GLU HA   1 1 
       13  7518 1 1 10 GLU HB2  H  -12.472  -9.274   0.563 1.00 . A A .  10 GLU HB2  1 1 
       13  7519 1 1 10 GLU HB3  H  -10.824  -9.863   0.396 1.00 . A A .  10 GLU HB3  1 1 
       13  7520 1 1 10 GLU HG2  H  -12.727 -10.700   2.571 1.00 . A A .  10 GLU HG2  1 1 
       13  7521 1 1 10 GLU HG3  H  -12.435 -11.601   1.084 1.00 . A A .  10 GLU HG3  1 1 
       13  7522 1 1 10 GLU N    N  -12.228  -8.037   2.854 1.00 . A A .  10 GLU N    1 1 
       13  7523 1 1 10 GLU O    O  -11.134  -6.483   0.817 1.00 . A A .  10 GLU O    1 1 
       13  7524 1 1 10 GLU OE1  O   -9.780 -11.788   1.779 1.00 . A A .  10 GLU OE1  1 1 
       13  7525 1 1 10 GLU OE2  O  -10.923 -11.985   3.646 1.00 . A A .  10 GLU OE2  1 1 
       13  7526 1 1 11 LYS C    C   -8.644  -5.121   0.905 1.00 . A A .  11 LYS C    1 1 
       13  7527 1 1 11 LYS CA   C   -8.406  -6.513   0.328 1.00 . A A .  11 LYS CA   1 1 
       13  7528 1 1 11 LYS CB   C   -8.805  -6.539  -1.149 1.00 . A A .  11 LYS CB   1 1 
       13  7529 1 1 11 LYS CD   C   -9.164  -8.085  -3.096 1.00 . A A .  11 LYS CD   1 1 
       13  7530 1 1 11 LYS CE   C  -10.322  -8.992  -2.710 1.00 . A A .  11 LYS CE   1 1 
       13  7531 1 1 11 LYS CG   C   -8.290  -7.757  -1.897 1.00 . A A .  11 LYS CG   1 1 
       13  7532 1 1 11 LYS H    H   -8.676  -8.290   1.446 1.00 . A A .  11 LYS H    1 1 
       13  7533 1 1 11 LYS HA   H   -7.356  -6.749   0.412 1.00 . A A .  11 LYS HA   1 1 
       13  7534 1 1 11 LYS HB2  H   -9.883  -6.529  -1.218 1.00 . A A .  11 LYS HB2  1 1 
       13  7535 1 1 11 LYS HB3  H   -8.414  -5.655  -1.631 1.00 . A A .  11 LYS HB3  1 1 
       13  7536 1 1 11 LYS HD2  H   -9.560  -7.167  -3.504 1.00 . A A .  11 LYS HD2  1 1 
       13  7537 1 1 11 LYS HD3  H   -8.561  -8.583  -3.843 1.00 . A A .  11 LYS HD3  1 1 
       13  7538 1 1 11 LYS HE2  H  -10.617  -9.566  -3.575 1.00 . A A .  11 LYS HE2  1 1 
       13  7539 1 1 11 LYS HE3  H   -9.993  -9.661  -1.929 1.00 . A A .  11 LYS HE3  1 1 
       13  7540 1 1 11 LYS HG2  H   -7.286  -7.559  -2.240 1.00 . A A .  11 LYS HG2  1 1 
       13  7541 1 1 11 LYS HG3  H   -8.283  -8.604  -1.225 1.00 . A A .  11 LYS HG3  1 1 
       13  7542 1 1 11 LYS HZ1  H  -12.378  -8.697  -2.485 1.00 . A A .  11 LYS HZ1  1 1 
       13  7543 1 1 11 LYS HZ2  H  -11.493  -7.264  -2.641 1.00 . A A .  11 LYS HZ2  1 1 
       13  7544 1 1 11 LYS HZ3  H  -11.458  -8.125  -1.186 1.00 . A A .  11 LYS HZ3  1 1 
       13  7545 1 1 11 LYS N    N   -9.154  -7.519   1.072 1.00 . A A .  11 LYS N    1 1 
       13  7546 1 1 11 LYS NZ   N  -11.495  -8.215  -2.221 1.00 . A A .  11 LYS NZ   1 1 
       13  7547 1 1 11 LYS O    O   -8.870  -4.152   0.180 1.00 . A A .  11 LYS O    1 1 
       13  7548 1 1 12 PRO C    C   -7.648  -2.770   2.726 1.00 . A A .  12 PRO C    1 1 
       13  7549 1 1 12 PRO CA   C   -8.798  -3.747   2.945 1.00 . A A .  12 PRO CA   1 1 
       13  7550 1 1 12 PRO CB   C   -8.873  -4.165   4.416 1.00 . A A .  12 PRO CB   1 1 
       13  7551 1 1 12 PRO CD   C   -8.328  -6.130   3.168 1.00 . A A .  12 PRO CD   1 1 
       13  7552 1 1 12 PRO CG   C   -8.107  -5.441   4.486 1.00 . A A .  12 PRO CG   1 1 
       13  7553 1 1 12 PRO HA   H   -9.727  -3.279   2.655 1.00 . A A .  12 PRO HA   1 1 
       13  7554 1 1 12 PRO HB2  H   -8.424  -3.399   5.033 1.00 . A A .  12 PRO HB2  1 1 
       13  7555 1 1 12 PRO HB3  H   -9.904  -4.307   4.702 1.00 . A A .  12 PRO HB3  1 1 
       13  7556 1 1 12 PRO HD2  H   -7.444  -6.675   2.874 1.00 . A A .  12 PRO HD2  1 1 
       13  7557 1 1 12 PRO HD3  H   -9.180  -6.792   3.227 1.00 . A A .  12 PRO HD3  1 1 
       13  7558 1 1 12 PRO HG2  H   -7.058  -5.232   4.629 1.00 . A A .  12 PRO HG2  1 1 
       13  7559 1 1 12 PRO HG3  H   -8.484  -6.050   5.295 1.00 . A A .  12 PRO HG3  1 1 
       13  7560 1 1 12 PRO N    N   -8.593  -5.017   2.241 1.00 . A A .  12 PRO N    1 1 
       13  7561 1 1 12 PRO O    O   -7.662  -1.654   3.245 1.00 . A A .  12 PRO O    1 1 
       13  7562 1 1 13 TYR C    C   -5.867  -1.218   0.728 1.00 . A A .  13 TYR C    1 1 
       13  7563 1 1 13 TYR CA   C   -5.495  -2.360   1.669 1.00 . A A .  13 TYR CA   1 1 
       13  7564 1 1 13 TYR CB   C   -4.374  -3.198   1.054 1.00 . A A .  13 TYR CB   1 1 
       13  7565 1 1 13 TYR CD1  C   -3.506  -4.623   2.950 1.00 . A A .  13 TYR CD1  1 1 
       13  7566 1 1 13 TYR CD2  C   -4.652  -5.706   1.162 1.00 . A A .  13 TYR CD2  1 1 
       13  7567 1 1 13 TYR CE1  C   -3.320  -5.841   3.574 1.00 . A A .  13 TYR CE1  1 1 
       13  7568 1 1 13 TYR CE2  C   -4.472  -6.928   1.780 1.00 . A A .  13 TYR CE2  1 1 
       13  7569 1 1 13 TYR CG   C   -4.173  -4.533   1.735 1.00 . A A .  13 TYR CG   1 1 
       13  7570 1 1 13 TYR CZ   C   -3.805  -6.991   2.986 1.00 . A A .  13 TYR CZ   1 1 
       13  7571 1 1 13 TYR H    H   -6.700  -4.097   1.570 1.00 . A A .  13 TYR H    1 1 
       13  7572 1 1 13 TYR HA   H   -5.149  -1.943   2.604 1.00 . A A .  13 TYR HA   1 1 
       13  7573 1 1 13 TYR HB2  H   -4.602  -3.386   0.017 1.00 . A A .  13 TYR HB2  1 1 
       13  7574 1 1 13 TYR HB3  H   -3.446  -2.649   1.120 1.00 . A A .  13 TYR HB3  1 1 
       13  7575 1 1 13 TYR HD1  H   -3.127  -3.721   3.408 1.00 . A A .  13 TYR HD1  1 1 
       13  7576 1 1 13 TYR HD2  H   -5.175  -5.653   0.218 1.00 . A A .  13 TYR HD2  1 1 
       13  7577 1 1 13 TYR HE1  H   -2.798  -5.891   4.518 1.00 . A A .  13 TYR HE1  1 1 
       13  7578 1 1 13 TYR HE2  H   -4.852  -7.828   1.320 1.00 . A A .  13 TYR HE2  1 1 
       13  7579 1 1 13 TYR HH   H   -3.363  -8.064   4.518 1.00 . A A .  13 TYR HH   1 1 
       13  7580 1 1 13 TYR N    N   -6.655  -3.197   1.955 1.00 . A A .  13 TYR N    1 1 
       13  7581 1 1 13 TYR O    O   -6.856  -1.295   0.000 1.00 . A A .  13 TYR O    1 1 
       13  7582 1 1 13 TYR OH   O   -3.623  -8.206   3.605 1.00 . A A .  13 TYR OH   1 1 
       13  7583 1 1 14 GLY C    C   -4.478   2.188   0.261 1.00 . A A .  14 GLY C    1 1 
       13  7584 1 1 14 GLY CA   C   -5.324   0.986  -0.107 1.00 . A A .  14 GLY CA   1 1 
       13  7585 1 1 14 GLY H    H   -4.290  -0.152   1.350 1.00 . A A .  14 GLY H    1 1 
       13  7586 1 1 14 GLY HA2  H   -5.115   0.711  -1.130 1.00 . A A .  14 GLY HA2  1 1 
       13  7587 1 1 14 GLY HA3  H   -6.367   1.254  -0.022 1.00 . A A .  14 GLY HA3  1 1 
       13  7588 1 1 14 GLY N    N   -5.064  -0.158   0.749 1.00 . A A .  14 GLY N    1 1 
       13  7589 1 1 14 GLY O    O   -4.304   2.498   1.440 1.00 . A A .  14 GLY O    1 1 
       13  7590 1 1 15 CYS C    C   -3.951   5.221  -0.039 1.00 . A A .  15 CYS C    1 1 
       13  7591 1 1 15 CYS CA   C   -3.114   4.043  -0.529 1.00 . A A .  15 CYS CA   1 1 
       13  7592 1 1 15 CYS CB   C   -2.381   4.425  -1.816 1.00 . A A .  15 CYS CB   1 1 
       13  7593 1 1 15 CYS H    H   -4.123   2.573  -1.669 1.00 . A A .  15 CYS H    1 1 
       13  7594 1 1 15 CYS HA   H   -2.386   3.796   0.229 1.00 . A A .  15 CYS HA   1 1 
       13  7595 1 1 15 CYS HB2  H   -1.651   3.662  -2.045 1.00 . A A .  15 CYS HB2  1 1 
       13  7596 1 1 15 CYS HB3  H   -3.096   4.486  -2.624 1.00 . A A .  15 CYS HB3  1 1 
       13  7597 1 1 15 CYS N    N   -3.948   2.869  -0.750 1.00 . A A .  15 CYS N    1 1 
       13  7598 1 1 15 CYS O    O   -4.671   5.850  -0.815 1.00 . A A .  15 CYS O    1 1 
       13  7599 1 1 15 CYS SG   S   -1.504   6.019  -1.729 1.00 . A A .  15 CYS SG   1 1 
       13  7600 1 1 16 SER C    C   -3.836   7.927   1.719 1.00 . A A .  16 SER C    1 1 
       13  7601 1 1 16 SER CA   C   -4.602   6.614   1.848 1.00 . A A .  16 SER CA   1 1 
       13  7602 1 1 16 SER CB   C   -4.894   6.323   3.321 1.00 . A A .  16 SER CB   1 1 
       13  7603 1 1 16 SER H    H   -3.261   4.976   1.821 1.00 . A A .  16 SER H    1 1 
       13  7604 1 1 16 SER HA   H   -5.538   6.703   1.316 1.00 . A A .  16 SER HA   1 1 
       13  7605 1 1 16 SER HB2  H   -5.056   5.264   3.451 1.00 . A A .  16 SER HB2  1 1 
       13  7606 1 1 16 SER HB3  H   -4.050   6.634   3.920 1.00 . A A .  16 SER HB3  1 1 
       13  7607 1 1 16 SER HG   H   -6.168   7.808   3.226 1.00 . A A .  16 SER HG   1 1 
       13  7608 1 1 16 SER N    N   -3.852   5.514   1.254 1.00 . A A .  16 SER N    1 1 
       13  7609 1 1 16 SER O    O   -3.847   8.756   2.629 1.00 . A A .  16 SER O    1 1 
       13  7610 1 1 16 SER OG   O   -6.047   7.020   3.760 1.00 . A A .  16 SER OG   1 1 
       13  7611 1 1 17 GLU C    C   -2.875  10.017  -0.939 1.00 . A A .  17 GLU C    1 1 
       13  7612 1 1 17 GLU CA   C   -2.400   9.320   0.333 1.00 . A A .  17 GLU CA   1 1 
       13  7613 1 1 17 GLU CB   C   -0.911   8.988   0.220 1.00 . A A .  17 GLU CB   1 1 
       13  7614 1 1 17 GLU CD   C    0.302  11.040   1.058 1.00 . A A .  17 GLU CD   1 1 
       13  7615 1 1 17 GLU CG   C   -0.047  10.183  -0.144 1.00 . A A .  17 GLU CG   1 1 
       13  7616 1 1 17 GLU H    H   -3.203   7.411  -0.107 1.00 . A A .  17 GLU H    1 1 
       13  7617 1 1 17 GLU HA   H   -2.549   9.985   1.170 1.00 . A A .  17 GLU HA   1 1 
       13  7618 1 1 17 GLU HB2  H   -0.569   8.597   1.167 1.00 . A A .  17 GLU HB2  1 1 
       13  7619 1 1 17 GLU HB3  H   -0.780   8.232  -0.540 1.00 . A A .  17 GLU HB3  1 1 
       13  7620 1 1 17 GLU HG2  H    0.870   9.827  -0.590 1.00 . A A .  17 GLU HG2  1 1 
       13  7621 1 1 17 GLU HG3  H   -0.580  10.793  -0.859 1.00 . A A .  17 GLU HG3  1 1 
       13  7622 1 1 17 GLU N    N   -3.173   8.109   0.581 1.00 . A A .  17 GLU N    1 1 
       13  7623 1 1 17 GLU O    O   -3.296  11.174  -0.907 1.00 . A A .  17 GLU O    1 1 
       13  7624 1 1 17 GLU OE1  O    0.496  10.472   2.153 1.00 . A A .  17 GLU OE1  1 1 
       13  7625 1 1 17 GLU OE2  O    0.379  12.276   0.904 1.00 . A A .  17 GLU OE2  1 1 
       13  7626 1 1 18 CYS C    C   -4.622   9.362  -3.712 1.00 . A A .  18 CYS C    1 1 
       13  7627 1 1 18 CYS CA   C   -3.225   9.853  -3.342 1.00 . A A .  18 CYS CA   1 1 
       13  7628 1 1 18 CYS CB   C   -2.229   9.465  -4.437 1.00 . A A .  18 CYS CB   1 1 
       13  7629 1 1 18 CYS H    H   -2.460   8.387  -2.021 1.00 . A A .  18 CYS H    1 1 
       13  7630 1 1 18 CYS HA   H   -3.247  10.929  -3.253 1.00 . A A .  18 CYS HA   1 1 
       13  7631 1 1 18 CYS HB2  H   -2.450  10.032  -5.330 1.00 . A A .  18 CYS HB2  1 1 
       13  7632 1 1 18 CYS HB3  H   -1.230   9.702  -4.104 1.00 . A A .  18 CYS HB3  1 1 
       13  7633 1 1 18 CYS N    N   -2.804   9.305  -2.058 1.00 . A A .  18 CYS N    1 1 
       13  7634 1 1 18 CYS O    O   -5.458  10.132  -4.182 1.00 . A A .  18 CYS O    1 1 
       13  7635 1 1 18 CYS SG   S   -2.264   7.699  -4.881 1.00 . A A .  18 CYS SG   1 1 
       13  7636 1 1 19 GLY C    C   -6.053   6.266  -4.684 1.00 . A A .  19 GLY C    1 1 
       13  7637 1 1 19 GLY CA   C   -6.162   7.500  -3.811 1.00 . A A .  19 GLY CA   1 1 
       13  7638 1 1 19 GLY H    H   -4.161   7.506  -3.118 1.00 . A A .  19 GLY H    1 1 
       13  7639 1 1 19 GLY HA2  H   -6.660   7.235  -2.890 1.00 . A A .  19 GLY HA2  1 1 
       13  7640 1 1 19 GLY HA3  H   -6.754   8.242  -4.327 1.00 . A A .  19 GLY HA3  1 1 
       13  7641 1 1 19 GLY N    N   -4.866   8.073  -3.495 1.00 . A A .  19 GLY N    1 1 
       13  7642 1 1 19 GLY O    O   -6.816   6.101  -5.637 1.00 . A A .  19 GLY O    1 1 
       13  7643 1 1 20 LYS C    C   -5.287   2.947  -4.303 1.00 . A A .  20 LYS C    1 1 
       13  7644 1 1 20 LYS CA   C   -4.894   4.171  -5.124 1.00 . A A .  20 LYS CA   1 1 
       13  7645 1 1 20 LYS CB   C   -3.431   4.058  -5.559 1.00 . A A .  20 LYS CB   1 1 
       13  7646 1 1 20 LYS CD   C   -2.023   3.732  -7.613 1.00 . A A .  20 LYS CD   1 1 
       13  7647 1 1 20 LYS CE   C   -2.390   4.837  -8.592 1.00 . A A .  20 LYS CE   1 1 
       13  7648 1 1 20 LYS CG   C   -3.236   3.254  -6.833 1.00 . A A .  20 LYS CG   1 1 
       13  7649 1 1 20 LYS H    H   -4.525   5.584  -3.591 1.00 . A A .  20 LYS H    1 1 
       13  7650 1 1 20 LYS HA   H   -5.520   4.217  -6.002 1.00 . A A .  20 LYS HA   1 1 
       13  7651 1 1 20 LYS HB2  H   -3.039   5.051  -5.721 1.00 . A A .  20 LYS HB2  1 1 
       13  7652 1 1 20 LYS HB3  H   -2.869   3.583  -4.769 1.00 . A A .  20 LYS HB3  1 1 
       13  7653 1 1 20 LYS HD2  H   -1.286   4.110  -6.921 1.00 . A A .  20 LYS HD2  1 1 
       13  7654 1 1 20 LYS HD3  H   -1.609   2.899  -8.163 1.00 . A A .  20 LYS HD3  1 1 
       13  7655 1 1 20 LYS HE2  H   -1.702   4.807  -9.423 1.00 . A A .  20 LYS HE2  1 1 
       13  7656 1 1 20 LYS HE3  H   -3.394   4.664  -8.950 1.00 . A A .  20 LYS HE3  1 1 
       13  7657 1 1 20 LYS HG2  H   -3.098   2.215  -6.574 1.00 . A A .  20 LYS HG2  1 1 
       13  7658 1 1 20 LYS HG3  H   -4.116   3.359  -7.452 1.00 . A A .  20 LYS HG3  1 1 
       13  7659 1 1 20 LYS HZ1  H   -1.429   6.294  -7.443 1.00 . A A .  20 LYS HZ1  1 1 
       13  7660 1 1 20 LYS HZ2  H   -3.114   6.300  -7.289 1.00 . A A .  20 LYS HZ2  1 1 
       13  7661 1 1 20 LYS HZ3  H   -2.391   6.924  -8.684 1.00 . A A .  20 LYS HZ3  1 1 
       13  7662 1 1 20 LYS N    N   -5.102   5.397  -4.362 1.00 . A A .  20 LYS N    1 1 
       13  7663 1 1 20 LYS NZ   N   -2.326   6.183  -7.958 1.00 . A A .  20 LYS NZ   1 1 
       13  7664 1 1 20 LYS O    O   -5.204   2.959  -3.075 1.00 . A A .  20 LYS O    1 1 
       13  7665 1 1 21 ALA C    C   -5.366  -0.541  -4.890 1.00 . A A .  21 ALA C    1 1 
       13  7666 1 1 21 ALA CA   C   -6.116   0.660  -4.323 1.00 . A A .  21 ALA CA   1 1 
       13  7667 1 1 21 ALA CB   C   -7.618   0.455  -4.454 1.00 . A A .  21 ALA CB   1 1 
       13  7668 1 1 21 ALA H    H   -5.759   1.944  -5.966 1.00 . A A .  21 ALA H    1 1 
       13  7669 1 1 21 ALA HA   H   -5.881   0.756  -3.273 1.00 . A A .  21 ALA HA   1 1 
       13  7670 1 1 21 ALA HB1  H   -8.095   0.674  -3.510 1.00 . A A .  21 ALA HB1  1 1 
       13  7671 1 1 21 ALA HB2  H   -8.006   1.116  -5.215 1.00 . A A .  21 ALA HB2  1 1 
       13  7672 1 1 21 ALA HB3  H   -7.819  -0.569  -4.730 1.00 . A A .  21 ALA HB3  1 1 
       13  7673 1 1 21 ALA N    N   -5.714   1.892  -4.989 1.00 . A A .  21 ALA N    1 1 
       13  7674 1 1 21 ALA O    O   -4.904  -0.514  -6.031 1.00 . A A .  21 ALA O    1 1 
       13  7675 1 1 22 PHE C    C   -5.241  -4.046  -3.958 1.00 . A A .  22 PHE C    1 1 
       13  7676 1 1 22 PHE CA   C   -4.550  -2.801  -4.507 1.00 . A A .  22 PHE CA   1 1 
       13  7677 1 1 22 PHE CB   C   -3.093  -2.766  -4.040 1.00 . A A .  22 PHE CB   1 1 
       13  7678 1 1 22 PHE CD1  C   -2.617  -0.344  -3.589 1.00 . A A .  22 PHE CD1  1 1 
       13  7679 1 1 22 PHE CD2  C   -1.513  -1.393  -5.423 1.00 . A A .  22 PHE CD2  1 1 
       13  7680 1 1 22 PHE CE1  C   -1.974   0.846  -3.878 1.00 . A A .  22 PHE CE1  1 1 
       13  7681 1 1 22 PHE CE2  C   -0.867  -0.207  -5.717 1.00 . A A .  22 PHE CE2  1 1 
       13  7682 1 1 22 PHE CG   C   -2.393  -1.475  -4.357 1.00 . A A .  22 PHE CG   1 1 
       13  7683 1 1 22 PHE CZ   C   -1.099   0.914  -4.944 1.00 . A A .  22 PHE CZ   1 1 
       13  7684 1 1 22 PHE H    H   -5.636  -1.552  -3.187 1.00 . A A .  22 PHE H    1 1 
       13  7685 1 1 22 PHE HA   H   -4.572  -2.837  -5.585 1.00 . A A .  22 PHE HA   1 1 
       13  7686 1 1 22 PHE HB2  H   -3.062  -2.905  -2.970 1.00 . A A .  22 PHE HB2  1 1 
       13  7687 1 1 22 PHE HB3  H   -2.550  -3.566  -4.519 1.00 . A A .  22 PHE HB3  1 1 
       13  7688 1 1 22 PHE HD1  H   -3.302  -0.396  -2.755 1.00 . A A .  22 PHE HD1  1 1 
       13  7689 1 1 22 PHE HD2  H   -1.331  -2.269  -6.030 1.00 . A A .  22 PHE HD2  1 1 
       13  7690 1 1 22 PHE HE1  H   -2.158   1.720  -3.271 1.00 . A A .  22 PHE HE1  1 1 
       13  7691 1 1 22 PHE HE2  H   -0.183  -0.156  -6.551 1.00 . A A .  22 PHE HE2  1 1 
       13  7692 1 1 22 PHE HZ   H   -0.595   1.842  -5.171 1.00 . A A .  22 PHE HZ   1 1 
       13  7693 1 1 22 PHE N    N   -5.246  -1.592  -4.086 1.00 . A A .  22 PHE N    1 1 
       13  7694 1 1 22 PHE O    O   -6.221  -3.950  -3.220 1.00 . A A .  22 PHE O    1 1 
       13  7695 1 1 23 SER C    C   -4.505  -7.039  -2.695 1.00 . A A .  23 SER C    1 1 
       13  7696 1 1 23 SER CA   C   -5.293  -6.478  -3.875 1.00 . A A .  23 SER CA   1 1 
       13  7697 1 1 23 SER CB   C   -5.308  -7.492  -5.021 1.00 . A A .  23 SER CB   1 1 
       13  7698 1 1 23 SER H    H   -3.942  -5.225  -4.917 1.00 . A A .  23 SER H    1 1 
       13  7699 1 1 23 SER HA   H   -6.308  -6.291  -3.559 1.00 . A A .  23 SER HA   1 1 
       13  7700 1 1 23 SER HB2  H   -5.810  -8.391  -4.696 1.00 . A A .  23 SER HB2  1 1 
       13  7701 1 1 23 SER HB3  H   -5.835  -7.071  -5.864 1.00 . A A .  23 SER HB3  1 1 
       13  7702 1 1 23 SER HG   H   -3.409  -7.078  -5.266 1.00 . A A .  23 SER HG   1 1 
       13  7703 1 1 23 SER N    N   -4.724  -5.214  -4.326 1.00 . A A .  23 SER N    1 1 
       13  7704 1 1 23 SER O    O   -5.082  -7.553  -1.737 1.00 . A A .  23 SER O    1 1 
       13  7705 1 1 23 SER OG   O   -3.991  -7.825  -5.425 1.00 . A A .  23 SER OG   1 1 
       13  7706 1 1 24 SER C    C   -1.500  -6.301  -1.097 1.00 . A A .  24 SER C    1 1 
       13  7707 1 1 24 SER CA   C   -2.313  -7.435  -1.714 1.00 . A A .  24 SER CA   1 1 
       13  7708 1 1 24 SER CB   C   -1.373  -8.511  -2.261 1.00 . A A .  24 SER CB   1 1 
       13  7709 1 1 24 SER H    H   -2.781  -6.516  -3.563 1.00 . A A .  24 SER H    1 1 
       13  7710 1 1 24 SER HA   H   -2.939  -7.871  -0.949 1.00 . A A .  24 SER HA   1 1 
       13  7711 1 1 24 SER HB2  H   -1.930  -9.182  -2.898 1.00 . A A .  24 SER HB2  1 1 
       13  7712 1 1 24 SER HB3  H   -0.587  -8.041  -2.833 1.00 . A A .  24 SER HB3  1 1 
       13  7713 1 1 24 SER HG   H   -0.003  -9.708  -1.534 1.00 . A A .  24 SER HG   1 1 
       13  7714 1 1 24 SER N    N   -3.182  -6.936  -2.773 1.00 . A A .  24 SER N    1 1 
       13  7715 1 1 24 SER O    O   -1.382  -5.220  -1.675 1.00 . A A .  24 SER O    1 1 
       13  7716 1 1 24 SER OG   O   -0.789  -9.261  -1.210 1.00 . A A .  24 SER OG   1 1 
       13  7717 1 1 25 LYS C    C    1.129  -5.234  -0.006 1.00 . A A .  25 LYS C    1 1 
       13  7718 1 1 25 LYS CA   C   -0.139  -5.557   0.778 1.00 . A A .  25 LYS CA   1 1 
       13  7719 1 1 25 LYS CB   C    0.228  -6.054   2.178 1.00 . A A .  25 LYS CB   1 1 
       13  7720 1 1 25 LYS CD   C    1.754  -5.694   4.140 1.00 . A A .  25 LYS CD   1 1 
       13  7721 1 1 25 LYS CE   C    0.867  -5.928   5.353 1.00 . A A .  25 LYS CE   1 1 
       13  7722 1 1 25 LYS CG   C    0.986  -5.033   3.008 1.00 . A A .  25 LYS CG   1 1 
       13  7723 1 1 25 LYS H    H   -1.072  -7.435   0.492 1.00 . A A .  25 LYS H    1 1 
       13  7724 1 1 25 LYS HA   H   -0.730  -4.658   0.868 1.00 . A A .  25 LYS HA   1 1 
       13  7725 1 1 25 LYS HB2  H   -0.680  -6.313   2.704 1.00 . A A .  25 LYS HB2  1 1 
       13  7726 1 1 25 LYS HB3  H    0.842  -6.938   2.084 1.00 . A A .  25 LYS HB3  1 1 
       13  7727 1 1 25 LYS HD2  H    2.136  -6.644   3.798 1.00 . A A .  25 LYS HD2  1 1 
       13  7728 1 1 25 LYS HD3  H    2.578  -5.054   4.426 1.00 . A A .  25 LYS HD3  1 1 
       13  7729 1 1 25 LYS HE2  H    0.700  -4.984   5.849 1.00 . A A .  25 LYS HE2  1 1 
       13  7730 1 1 25 LYS HE3  H   -0.077  -6.332   5.019 1.00 . A A .  25 LYS HE3  1 1 
       13  7731 1 1 25 LYS HG2  H    1.684  -4.511   2.370 1.00 . A A .  25 LYS HG2  1 1 
       13  7732 1 1 25 LYS HG3  H    0.281  -4.328   3.426 1.00 . A A .  25 LYS HG3  1 1 
       13  7733 1 1 25 LYS HZ1  H    1.948  -7.658   5.806 1.00 . A A .  25 LYS HZ1  1 1 
       13  7734 1 1 25 LYS HZ2  H    0.758  -7.275   6.946 1.00 . A A .  25 LYS HZ2  1 1 
       13  7735 1 1 25 LYS HZ3  H    2.198  -6.389   6.896 1.00 . A A .  25 LYS HZ3  1 1 
       13  7736 1 1 25 LYS N    N   -0.942  -6.554   0.081 1.00 . A A .  25 LYS N    1 1 
       13  7737 1 1 25 LYS NZ   N    1.487  -6.879   6.318 1.00 . A A .  25 LYS NZ   1 1 
       13  7738 1 1 25 LYS O    O    1.437  -4.068  -0.253 1.00 . A A .  25 LYS O    1 1 
       13  7739 1 1 26 SER C    C    2.936  -5.017  -2.212 1.00 . A A .  26 SER C    1 1 
       13  7740 1 1 26 SER CA   C    3.095  -6.101  -1.149 1.00 . A A .  26 SER CA   1 1 
       13  7741 1 1 26 SER CB   C    3.505  -7.420  -1.807 1.00 . A A .  26 SER CB   1 1 
       13  7742 1 1 26 SER H    H    1.561  -7.180  -0.167 1.00 . A A .  26 SER H    1 1 
       13  7743 1 1 26 SER HA   H    3.867  -5.799  -0.457 1.00 . A A .  26 SER HA   1 1 
       13  7744 1 1 26 SER HB2  H    2.681  -7.800  -2.391 1.00 . A A .  26 SER HB2  1 1 
       13  7745 1 1 26 SER HB3  H    4.354  -7.248  -2.453 1.00 . A A .  26 SER HB3  1 1 
       13  7746 1 1 26 SER HG   H    4.605  -8.066  -0.321 1.00 . A A .  26 SER HG   1 1 
       13  7747 1 1 26 SER N    N    1.860  -6.274  -0.395 1.00 . A A .  26 SER N    1 1 
       13  7748 1 1 26 SER O    O    3.725  -4.074  -2.276 1.00 . A A .  26 SER O    1 1 
       13  7749 1 1 26 SER OG   O    3.860  -8.387  -0.834 1.00 . A A .  26 SER OG   1 1 
       13  7750 1 1 27 TYR C    C    1.514  -2.785  -3.539 1.00 . A A .  27 TYR C    1 1 
       13  7751 1 1 27 TYR CA   C    1.647  -4.196  -4.105 1.00 . A A .  27 TYR CA   1 1 
       13  7752 1 1 27 TYR CB   C    0.374  -4.575  -4.864 1.00 . A A .  27 TYR CB   1 1 
       13  7753 1 1 27 TYR CD1  C    1.544  -5.386  -6.950 1.00 . A A .  27 TYR CD1  1 1 
       13  7754 1 1 27 TYR CD2  C   -0.127  -6.783  -5.982 1.00 . A A .  27 TYR CD2  1 1 
       13  7755 1 1 27 TYR CE1  C    1.753  -6.319  -7.947 1.00 . A A .  27 TYR CE1  1 1 
       13  7756 1 1 27 TYR CE2  C    0.077  -7.722  -6.974 1.00 . A A .  27 TYR CE2  1 1 
       13  7757 1 1 27 TYR CG   C    0.601  -5.600  -5.952 1.00 . A A .  27 TYR CG   1 1 
       13  7758 1 1 27 TYR CZ   C    1.018  -7.486  -7.955 1.00 . A A .  27 TYR CZ   1 1 
       13  7759 1 1 27 TYR H    H    1.316  -5.933  -2.943 1.00 . A A .  27 TYR H    1 1 
       13  7760 1 1 27 TYR HA   H    2.483  -4.220  -4.789 1.00 . A A .  27 TYR HA   1 1 
       13  7761 1 1 27 TYR HB2  H   -0.342  -4.984  -4.169 1.00 . A A .  27 TYR HB2  1 1 
       13  7762 1 1 27 TYR HB3  H   -0.041  -3.690  -5.323 1.00 . A A .  27 TYR HB3  1 1 
       13  7763 1 1 27 TYR HD1  H    2.119  -4.471  -6.941 1.00 . A A .  27 TYR HD1  1 1 
       13  7764 1 1 27 TYR HD2  H   -0.864  -6.966  -5.213 1.00 . A A .  27 TYR HD2  1 1 
       13  7765 1 1 27 TYR HE1  H    2.490  -6.134  -8.714 1.00 . A A .  27 TYR HE1  1 1 
       13  7766 1 1 27 TYR HE2  H   -0.499  -8.636  -6.981 1.00 . A A .  27 TYR HE2  1 1 
       13  7767 1 1 27 TYR HH   H    0.439  -8.961  -9.042 1.00 . A A .  27 TYR HH   1 1 
       13  7768 1 1 27 TYR N    N    1.910  -5.160  -3.043 1.00 . A A .  27 TYR N    1 1 
       13  7769 1 1 27 TYR O    O    2.112  -1.838  -4.052 1.00 . A A .  27 TYR O    1 1 
       13  7770 1 1 27 TYR OH   O    1.224  -8.418  -8.945 1.00 . A A .  27 TYR OH   1 1 
       13  7771 1 1 28 LEU C    C    1.839  -0.742  -1.403 1.00 . A A .  28 LEU C    1 1 
       13  7772 1 1 28 LEU CA   C    0.514  -1.358  -1.840 1.00 . A A .  28 LEU CA   1 1 
       13  7773 1 1 28 LEU CB   C   -0.414  -1.509  -0.633 1.00 . A A .  28 LEU CB   1 1 
       13  7774 1 1 28 LEU CD1  C   -1.139   0.882  -0.427 1.00 . A A .  28 LEU CD1  1 1 
       13  7775 1 1 28 LEU CD2  C   -1.303  -0.646   1.546 1.00 . A A .  28 LEU CD2  1 1 
       13  7776 1 1 28 LEU CG   C   -0.508  -0.298   0.296 1.00 . A A .  28 LEU CG   1 1 
       13  7777 1 1 28 LEU H    H    0.277  -3.443  -2.114 1.00 . A A .  28 LEU H    1 1 
       13  7778 1 1 28 LEU HA   H    0.048  -0.705  -2.563 1.00 . A A .  28 LEU HA   1 1 
       13  7779 1 1 28 LEU HB2  H   -1.406  -1.720  -1.002 1.00 . A A .  28 LEU HB2  1 1 
       13  7780 1 1 28 LEU HB3  H   -0.063  -2.348  -0.050 1.00 . A A .  28 LEU HB3  1 1 
       13  7781 1 1 28 LEU HD11 H   -0.683   1.799  -0.085 1.00 . A A .  28 LEU HD11 1 1 
       13  7782 1 1 28 LEU HD12 H   -2.198   0.907  -0.219 1.00 . A A .  28 LEU HD12 1 1 
       13  7783 1 1 28 LEU HD13 H   -0.983   0.777  -1.491 1.00 . A A .  28 LEU HD13 1 1 
       13  7784 1 1 28 LEU HD21 H   -2.329  -0.848   1.276 1.00 . A A .  28 LEU HD21 1 1 
       13  7785 1 1 28 LEU HD22 H   -1.269   0.184   2.236 1.00 . A A .  28 LEU HD22 1 1 
       13  7786 1 1 28 LEU HD23 H   -0.874  -1.520   2.014 1.00 . A A .  28 LEU HD23 1 1 
       13  7787 1 1 28 LEU HG   H    0.488  -0.008   0.602 1.00 . A A .  28 LEU HG   1 1 
       13  7788 1 1 28 LEU N    N    0.726  -2.653  -2.478 1.00 . A A .  28 LEU N    1 1 
       13  7789 1 1 28 LEU O    O    2.067   0.455  -1.582 1.00 . A A .  28 LEU O    1 1 
       13  7790 1 1 29 ILE C    C    4.832  -0.535  -1.528 1.00 . A A .  29 ILE C    1 1 
       13  7791 1 1 29 ILE CA   C    4.014  -1.104  -0.374 1.00 . A A .  29 ILE CA   1 1 
       13  7792 1 1 29 ILE CB   C    4.811  -2.239   0.295 1.00 . A A .  29 ILE CB   1 1 
       13  7793 1 1 29 ILE CD1  C    4.308  -4.314   1.681 1.00 . A A .  29 ILE CD1  1 1 
       13  7794 1 1 29 ILE CG1  C    4.005  -2.851   1.442 1.00 . A A .  29 ILE CG1  1 1 
       13  7795 1 1 29 ILE CG2  C    6.149  -1.720   0.799 1.00 . A A .  29 ILE CG2  1 1 
       13  7796 1 1 29 ILE H    H    2.470  -2.511  -0.718 1.00 . A A .  29 ILE H    1 1 
       13  7797 1 1 29 ILE HA   H    3.852  -0.325   0.357 1.00 . A A .  29 ILE HA   1 1 
       13  7798 1 1 29 ILE HB   H    5.003  -2.999  -0.447 1.00 . A A .  29 ILE HB   1 1 
       13  7799 1 1 29 ILE HD11 H    3.453  -4.910   1.397 1.00 . A A .  29 ILE HD11 1 1 
       13  7800 1 1 29 ILE HD12 H    5.162  -4.606   1.087 1.00 . A A .  29 ILE HD12 1 1 
       13  7801 1 1 29 ILE HD13 H    4.525  -4.471   2.727 1.00 . A A .  29 ILE HD13 1 1 
       13  7802 1 1 29 ILE HG12 H    4.221  -2.315   2.352 1.00 . A A .  29 ILE HG12 1 1 
       13  7803 1 1 29 ILE HG13 H    2.951  -2.763   1.218 1.00 . A A .  29 ILE HG13 1 1 
       13  7804 1 1 29 ILE HG21 H    6.381  -0.786   0.309 1.00 . A A .  29 ILE HG21 1 1 
       13  7805 1 1 29 ILE HG22 H    6.095  -1.562   1.866 1.00 . A A .  29 ILE HG22 1 1 
       13  7806 1 1 29 ILE HG23 H    6.921  -2.443   0.581 1.00 . A A .  29 ILE HG23 1 1 
       13  7807 1 1 29 ILE N    N    2.710  -1.568  -0.833 1.00 . A A .  29 ILE N    1 1 
       13  7808 1 1 29 ILE O    O    5.182   0.646  -1.530 1.00 . A A .  29 ILE O    1 1 
       13  7809 1 1 30 ILE C    C    5.439   0.400  -4.178 1.00 . A A .  30 ILE C    1 1 
       13  7810 1 1 30 ILE CA   C    5.905  -0.961  -3.670 1.00 . A A .  30 ILE CA   1 1 
       13  7811 1 1 30 ILE CB   C    5.803  -1.986  -4.815 1.00 . A A .  30 ILE CB   1 1 
       13  7812 1 1 30 ILE CD1  C    5.775  -4.507  -5.160 1.00 . A A .  30 ILE CD1  1 1 
       13  7813 1 1 30 ILE CG1  C    6.323  -3.350  -4.355 1.00 . A A .  30 ILE CG1  1 1 
       13  7814 1 1 30 ILE CG2  C    6.577  -1.500  -6.031 1.00 . A A .  30 ILE CG2  1 1 
       13  7815 1 1 30 ILE H    H    4.822  -2.309  -2.449 1.00 . A A .  30 ILE H    1 1 
       13  7816 1 1 30 ILE HA   H    6.940  -0.887  -3.370 1.00 . A A .  30 ILE HA   1 1 
       13  7817 1 1 30 ILE HB   H    4.764  -2.079  -5.093 1.00 . A A .  30 ILE HB   1 1 
       13  7818 1 1 30 ILE HD11 H    5.552  -4.174  -6.163 1.00 . A A .  30 ILE HD11 1 1 
       13  7819 1 1 30 ILE HD12 H    6.509  -5.298  -5.199 1.00 . A A .  30 ILE HD12 1 1 
       13  7820 1 1 30 ILE HD13 H    4.873  -4.875  -4.694 1.00 . A A .  30 ILE HD13 1 1 
       13  7821 1 1 30 ILE HG12 H    7.398  -3.366  -4.441 1.00 . A A .  30 ILE HG12 1 1 
       13  7822 1 1 30 ILE HG13 H    6.046  -3.502  -3.322 1.00 . A A .  30 ILE HG13 1 1 
       13  7823 1 1 30 ILE HG21 H    6.305  -2.094  -6.891 1.00 . A A .  30 ILE HG21 1 1 
       13  7824 1 1 30 ILE HG22 H    6.338  -0.464  -6.219 1.00 . A A .  30 ILE HG22 1 1 
       13  7825 1 1 30 ILE HG23 H    7.636  -1.598  -5.846 1.00 . A A .  30 ILE HG23 1 1 
       13  7826 1 1 30 ILE N    N    5.130  -1.381  -2.508 1.00 . A A .  30 ILE N    1 1 
       13  7827 1 1 30 ILE O    O    6.228   1.175  -4.718 1.00 . A A .  30 ILE O    1 1 
       13  7828 1 1 31 HIS C    C    3.979   3.083  -3.490 1.00 . A A .  31 HIS C    1 1 
       13  7829 1 1 31 HIS CA   C    3.583   1.953  -4.437 1.00 . A A .  31 HIS CA   1 1 
       13  7830 1 1 31 HIS CB   C    2.059   1.851  -4.517 1.00 . A A .  31 HIS CB   1 1 
       13  7831 1 1 31 HIS CD2  C    0.743   3.984  -3.851 1.00 . A A .  31 HIS CD2  1 1 
       13  7832 1 1 31 HIS CE1  C    0.651   4.934  -5.825 1.00 . A A .  31 HIS CE1  1 1 
       13  7833 1 1 31 HIS CG   C    1.381   3.170  -4.724 1.00 . A A .  31 HIS CG   1 1 
       13  7834 1 1 31 HIS H    H    3.575   0.026  -3.561 1.00 . A A .  31 HIS H    1 1 
       13  7835 1 1 31 HIS HA   H    3.973   2.170  -5.419 1.00 . A A .  31 HIS HA   1 1 
       13  7836 1 1 31 HIS HB2  H    1.792   1.207  -5.342 1.00 . A A .  31 HIS HB2  1 1 
       13  7837 1 1 31 HIS HB3  H    1.684   1.424  -3.598 1.00 . A A .  31 HIS HB3  1 1 
       13  7838 1 1 31 HIS HD1  H    1.677   3.450  -6.791 1.00 . A A .  31 HIS HD1  1 1 
       13  7839 1 1 31 HIS HD2  H    0.607   3.810  -2.793 1.00 . A A .  31 HIS HD2  1 1 
       13  7840 1 1 31 HIS HE1  H    0.440   5.633  -6.620 1.00 . A A .  31 HIS HE1  1 1 
       13  7841 1 1 31 HIS N    N    4.153   0.684  -3.998 1.00 . A A .  31 HIS N    1 1 
       13  7842 1 1 31 HIS ND1  N    1.305   3.793  -5.952 1.00 . A A .  31 HIS ND1  1 1 
       13  7843 1 1 31 HIS NE2  N    0.299   5.073  -4.560 1.00 . A A .  31 HIS NE2  1 1 
       13  7844 1 1 31 HIS O    O    4.393   4.155  -3.928 1.00 . A A .  31 HIS O    1 1 
       13  7845 1 1 32 MET C    C    5.580   4.409  -1.445 1.00 . A A .  32 MET C    1 1 
       13  7846 1 1 32 MET CA   C    4.193   3.829  -1.184 1.00 . A A .  32 MET CA   1 1 
       13  7847 1 1 32 MET CB   C    4.141   3.211   0.214 1.00 . A A .  32 MET CB   1 1 
       13  7848 1 1 32 MET CE   C    1.402   5.673   0.700 1.00 . A A .  32 MET CE   1 1 
       13  7849 1 1 32 MET CG   C    2.761   3.263   0.850 1.00 . A A .  32 MET CG   1 1 
       13  7850 1 1 32 MET H    H    3.513   1.959  -1.903 1.00 . A A .  32 MET H    1 1 
       13  7851 1 1 32 MET HA   H    3.467   4.626  -1.243 1.00 . A A .  32 MET HA   1 1 
       13  7852 1 1 32 MET HB2  H    4.445   2.177   0.150 1.00 . A A .  32 MET HB2  1 1 
       13  7853 1 1 32 MET HB3  H    4.829   3.741   0.856 1.00 . A A .  32 MET HB3  1 1 
       13  7854 1 1 32 MET HE1  H    0.994   6.528   1.220 1.00 . A A .  32 MET HE1  1 1 
       13  7855 1 1 32 MET HE2  H    1.960   6.009  -0.162 1.00 . A A .  32 MET HE2  1 1 
       13  7856 1 1 32 MET HE3  H    0.598   5.028   0.380 1.00 . A A .  32 MET HE3  1 1 
       13  7857 1 1 32 MET HG2  H    2.017   3.208   0.070 1.00 . A A .  32 MET HG2  1 1 
       13  7858 1 1 32 MET HG3  H    2.652   2.414   1.508 1.00 . A A .  32 MET HG3  1 1 
       13  7859 1 1 32 MET N    N    3.848   2.833  -2.191 1.00 . A A .  32 MET N    1 1 
       13  7860 1 1 32 MET O    O    5.868   5.546  -1.072 1.00 . A A .  32 MET O    1 1 
       13  7861 1 1 32 MET SD   S    2.490   4.771   1.801 1.00 . A A .  32 MET SD   1 1 
       13  7862 1 1 33 ARG C    C    7.799   5.489  -2.913 1.00 . A A .  33 ARG C    1 1 
       13  7863 1 1 33 ARG CA   C    7.792   4.054  -2.396 1.00 . A A .  33 ARG CA   1 1 
       13  7864 1 1 33 ARG CB   C    8.425   3.124  -3.433 1.00 . A A .  33 ARG CB   1 1 
       13  7865 1 1 33 ARG CD   C    9.652   1.620  -1.837 1.00 . A A .  33 ARG CD   1 1 
       13  7866 1 1 33 ARG CG   C    8.609   1.698  -2.940 1.00 . A A .  33 ARG CG   1 1 
       13  7867 1 1 33 ARG CZ   C   11.915   2.511  -1.477 1.00 . A A .  33 ARG CZ   1 1 
       13  7868 1 1 33 ARG H    H    6.147   2.723  -2.359 1.00 . A A .  33 ARG H    1 1 
       13  7869 1 1 33 ARG HA   H    8.370   4.009  -1.485 1.00 . A A .  33 ARG HA   1 1 
       13  7870 1 1 33 ARG HB2  H    7.794   3.100  -4.310 1.00 . A A .  33 ARG HB2  1 1 
       13  7871 1 1 33 ARG HB3  H    9.393   3.515  -3.706 1.00 . A A .  33 ARG HB3  1 1 
       13  7872 1 1 33 ARG HD2  H    9.335   2.244  -1.015 1.00 . A A .  33 ARG HD2  1 1 
       13  7873 1 1 33 ARG HD3  H    9.728   0.596  -1.503 1.00 . A A .  33 ARG HD3  1 1 
       13  7874 1 1 33 ARG HE   H   11.147   2.036  -3.255 1.00 . A A .  33 ARG HE   1 1 
       13  7875 1 1 33 ARG HG2  H    7.667   1.335  -2.555 1.00 . A A .  33 ARG HG2  1 1 
       13  7876 1 1 33 ARG HG3  H    8.924   1.079  -3.767 1.00 . A A .  33 ARG HG3  1 1 
       13  7877 1 1 33 ARG HH11 H   10.819   2.271   0.203 1.00 . A A .  33 ARG HH11 1 1 
       13  7878 1 1 33 ARG HH12 H   12.416   2.898   0.442 1.00 . A A .  33 ARG HH12 1 1 
       13  7879 1 1 33 ARG HH21 H   13.251   2.862  -2.953 1.00 . A A .  33 ARG HH21 1 1 
       13  7880 1 1 33 ARG HH22 H   13.798   3.235  -1.353 1.00 . A A .  33 ARG HH22 1 1 
       13  7881 1 1 33 ARG N    N    6.435   3.619  -2.087 1.00 . A A .  33 ARG N    1 1 
       13  7882 1 1 33 ARG NE   N   10.965   2.068  -2.293 1.00 . A A .  33 ARG NE   1 1 
       13  7883 1 1 33 ARG NH1  N   11.699   2.565  -0.170 1.00 . A A .  33 ARG NH1  1 1 
       13  7884 1 1 33 ARG NH2  N   13.084   2.902  -1.968 1.00 . A A .  33 ARG NH2  1 1 
       13  7885 1 1 33 ARG O    O    8.679   6.280  -2.571 1.00 . A A .  33 ARG O    1 1 
       13  7886 1 1 34 THR C    C    6.327   8.178  -3.238 1.00 . A A .  34 THR C    1 1 
       13  7887 1 1 34 THR CA   C    6.705   7.158  -4.306 1.00 . A A .  34 THR CA   1 1 
       13  7888 1 1 34 THR CB   C    5.662   7.208  -5.439 1.00 . A A .  34 THR CB   1 1 
       13  7889 1 1 34 THR CG2  C    4.254   7.323  -4.873 1.00 . A A .  34 THR CG2  1 1 
       13  7890 1 1 34 THR H    H    6.141   5.145  -3.975 1.00 . A A .  34 THR H    1 1 
       13  7891 1 1 34 THR HA   H    7.667   7.424  -4.719 1.00 . A A .  34 THR HA   1 1 
       13  7892 1 1 34 THR HB   H    5.730   6.293  -6.011 1.00 . A A .  34 THR HB   1 1 
       13  7893 1 1 34 THR HG1  H    6.864   8.531  -6.272 1.00 . A A .  34 THR HG1  1 1 
       13  7894 1 1 34 THR HG21 H    4.163   8.247  -4.322 1.00 . A A .  34 THR HG21 1 1 
       13  7895 1 1 34 THR HG22 H    4.061   6.490  -4.214 1.00 . A A .  34 THR HG22 1 1 
       13  7896 1 1 34 THR HG23 H    3.539   7.315  -5.683 1.00 . A A .  34 THR HG23 1 1 
       13  7897 1 1 34 THR N    N    6.812   5.820  -3.740 1.00 . A A .  34 THR N    1 1 
       13  7898 1 1 34 THR O    O    6.916   9.257  -3.159 1.00 . A A .  34 THR O    1 1 
       13  7899 1 1 34 THR OG1  O    5.928   8.319  -6.301 1.00 . A A .  34 THR OG1  1 1 
       13  7900 1 1 35 HIS C    C    5.876   8.725  -0.191 1.00 . A A .  35 HIS C    1 1 
       13  7901 1 1 35 HIS CA   C    4.885   8.716  -1.351 1.00 . A A .  35 HIS CA   1 1 
       13  7902 1 1 35 HIS CB   C    3.505   8.284  -0.855 1.00 . A A .  35 HIS CB   1 1 
       13  7903 1 1 35 HIS CD2  C    1.566   7.491  -2.384 1.00 . A A .  35 HIS CD2  1 1 
       13  7904 1 1 35 HIS CE1  C    1.157   9.392  -3.395 1.00 . A A .  35 HIS CE1  1 1 
       13  7905 1 1 35 HIS CG   C    2.430   8.408  -1.890 1.00 . A A .  35 HIS CG   1 1 
       13  7906 1 1 35 HIS H    H    4.910   6.958  -2.530 1.00 . A A .  35 HIS H    1 1 
       13  7907 1 1 35 HIS HA   H    4.816   9.714  -1.757 1.00 . A A .  35 HIS HA   1 1 
       13  7908 1 1 35 HIS HB2  H    3.549   7.250  -0.546 1.00 . A A .  35 HIS HB2  1 1 
       13  7909 1 1 35 HIS HB3  H    3.226   8.896  -0.009 1.00 . A A .  35 HIS HB3  1 1 
       13  7910 1 1 35 HIS HD1  H    2.607  10.443  -2.405 1.00 . A A .  35 HIS HD1  1 1 
       13  7911 1 1 35 HIS HD2  H    1.501   6.450  -2.097 1.00 . A A .  35 HIS HD2  1 1 
       13  7912 1 1 35 HIS HE1  H    0.724  10.138  -4.044 1.00 . A A .  35 HIS HE1  1 1 
       13  7913 1 1 35 HIS N    N    5.341   7.830  -2.417 1.00 . A A .  35 HIS N    1 1 
       13  7914 1 1 35 HIS ND1  N    2.149   9.589  -2.545 1.00 . A A .  35 HIS ND1  1 1 
       13  7915 1 1 35 HIS NE2  N    0.786   8.127  -3.317 1.00 . A A .  35 HIS NE2  1 1 
       13  7916 1 1 35 HIS O    O    6.557   9.723   0.048 1.00 . A A .  35 HIS O    1 1 
       13  7917 1 1 36 SER C    C    8.132   6.754   1.268 1.00 . A A .  36 SER C    1 1 
       13  7918 1 1 36 SER CA   C    6.856   7.490   1.663 1.00 . A A .  36 SER CA   1 1 
       13  7919 1 1 36 SER CB   C    6.167   6.756   2.815 1.00 . A A .  36 SER CB   1 1 
       13  7920 1 1 36 SER H    H    5.383   6.848   0.285 1.00 . A A .  36 SER H    1 1 
       13  7921 1 1 36 SER HA   H    7.114   8.488   1.987 1.00 . A A .  36 SER HA   1 1 
       13  7922 1 1 36 SER HB2  H    5.111   6.981   2.802 1.00 . A A .  36 SER HB2  1 1 
       13  7923 1 1 36 SER HB3  H    6.310   5.692   2.698 1.00 . A A .  36 SER HB3  1 1 
       13  7924 1 1 36 SER HG   H    6.750   8.112   4.104 1.00 . A A .  36 SER HG   1 1 
       13  7925 1 1 36 SER N    N    5.951   7.609   0.526 1.00 . A A .  36 SER N    1 1 
       13  7926 1 1 36 SER O    O    8.200   5.528   1.329 1.00 . A A .  36 SER O    1 1 
       13  7927 1 1 36 SER OG   O    6.702   7.154   4.066 1.00 . A A .  36 SER OG   1 1 
       13  7928 1 1 37 GLY C    C   11.529   7.935   0.385 1.00 . A A .  37 GLY C    1 1 
       13  7929 1 1 37 GLY CA   C   10.406   6.919   0.462 1.00 . A A .  37 GLY CA   1 1 
       13  7930 1 1 37 GLY H    H    9.034   8.488   0.834 1.00 . A A .  37 GLY H    1 1 
       13  7931 1 1 37 GLY HA2  H   10.674   6.156   1.177 1.00 . A A .  37 GLY HA2  1 1 
       13  7932 1 1 37 GLY HA3  H   10.283   6.461  -0.509 1.00 . A A .  37 GLY HA3  1 1 
       13  7933 1 1 37 GLY N    N    9.145   7.515   0.862 1.00 . A A .  37 GLY N    1 1 
       13  7934 1 1 37 GLY O    O   12.274   7.972  -0.593 1.00 . A A .  37 GLY O    1 1 
       13  7935 1 1 38 GLU C    C   13.690   9.496   2.572 1.00 . A A .  38 GLU C    1 1 
       13  7936 1 1 38 GLU CA   C   12.686   9.786   1.460 1.00 . A A .  38 GLU CA   1 1 
       13  7937 1 1 38 GLU CB   C   12.063  11.168   1.668 1.00 . A A .  38 GLU CB   1 1 
       13  7938 1 1 38 GLU CD   C   12.114  13.544   0.812 1.00 . A A .  38 GLU CD   1 1 
       13  7939 1 1 38 GLU CG   C   12.924  12.308   1.151 1.00 . A A .  38 GLU CG   1 1 
       13  7940 1 1 38 GLU H    H   11.023   8.685   2.168 1.00 . A A .  38 GLU H    1 1 
       13  7941 1 1 38 GLU HA   H   13.203   9.773   0.513 1.00 . A A .  38 GLU HA   1 1 
       13  7942 1 1 38 GLU HB2  H   11.112  11.202   1.157 1.00 . A A .  38 GLU HB2  1 1 
       13  7943 1 1 38 GLU HB3  H   11.899  11.320   2.725 1.00 . A A .  38 GLU HB3  1 1 
       13  7944 1 1 38 GLU HG2  H   13.649  12.568   1.908 1.00 . A A .  38 GLU HG2  1 1 
       13  7945 1 1 38 GLU HG3  H   13.439  11.978   0.260 1.00 . A A .  38 GLU HG3  1 1 
       13  7946 1 1 38 GLU N    N   11.648   8.763   1.418 1.00 . A A .  38 GLU N    1 1 
       13  7947 1 1 38 GLU O    O   13.577  10.023   3.680 1.00 . A A .  38 GLU O    1 1 
       13  7948 1 1 38 GLU OE1  O   11.305  13.974   1.661 1.00 . A A .  38 GLU OE1  1 1 
       13  7949 1 1 38 GLU OE2  O   12.288  14.082  -0.302 1.00 . A A .  38 GLU OE2  1 1 
       13  7950 1 1 39 LYS C    C   17.076   8.255   2.589 1.00 . A A .  39 LYS C    1 1 
       13  7951 1 1 39 LYS CA   C   15.698   8.294   3.241 1.00 . A A .  39 LYS CA   1 1 
       13  7952 1 1 39 LYS CB   C   15.380   6.934   3.868 1.00 . A A .  39 LYS CB   1 1 
       13  7953 1 1 39 LYS CD   C   16.256   4.754   4.756 1.00 . A A .  39 LYS CD   1 1 
       13  7954 1 1 39 LYS CE   C   15.675   4.768   6.162 1.00 . A A .  39 LYS CE   1 1 
       13  7955 1 1 39 LYS CG   C   16.614   6.154   4.288 1.00 . A A .  39 LYS CG   1 1 
       13  7956 1 1 39 LYS H    H   14.709   8.267   1.370 1.00 . A A .  39 LYS H    1 1 
       13  7957 1 1 39 LYS HA   H   15.701   9.046   4.016 1.00 . A A .  39 LYS HA   1 1 
       13  7958 1 1 39 LYS HB2  H   14.763   7.089   4.741 1.00 . A A .  39 LYS HB2  1 1 
       13  7959 1 1 39 LYS HB3  H   14.831   6.340   3.151 1.00 . A A .  39 LYS HB3  1 1 
       13  7960 1 1 39 LYS HD2  H   15.525   4.333   4.081 1.00 . A A .  39 LYS HD2  1 1 
       13  7961 1 1 39 LYS HD3  H   17.148   4.143   4.751 1.00 . A A .  39 LYS HD3  1 1 
       13  7962 1 1 39 LYS HE2  H   16.420   5.150   6.842 1.00 . A A .  39 LYS HE2  1 1 
       13  7963 1 1 39 LYS HE3  H   14.811   5.416   6.174 1.00 . A A .  39 LYS HE3  1 1 
       13  7964 1 1 39 LYS HG2  H   17.286   6.080   3.446 1.00 . A A .  39 LYS HG2  1 1 
       13  7965 1 1 39 LYS HG3  H   17.103   6.680   5.096 1.00 . A A .  39 LYS HG3  1 1 
       13  7966 1 1 39 LYS HZ1  H   15.929   2.696   6.238 1.00 . A A .  39 LYS HZ1  1 1 
       13  7967 1 1 39 LYS HZ2  H   14.311   3.189   6.256 1.00 . A A .  39 LYS HZ2  1 1 
       13  7968 1 1 39 LYS HZ3  H   15.261   3.356   7.645 1.00 . A A .  39 LYS HZ3  1 1 
       13  7969 1 1 39 LYS N    N   14.672   8.655   2.270 1.00 . A A .  39 LYS N    1 1 
       13  7970 1 1 39 LYS NZ   N   15.266   3.407   6.606 1.00 . A A .  39 LYS NZ   1 1 
       13  7971 1 1 39 LYS O    O   17.241   7.795   1.459 1.00 . A A .  39 LYS O    1 1 
       13  7972 1 1 40 PRO C    C   20.085   7.383   2.736 1.00 . A A .  40 PRO C    1 1 
       13  7973 1 1 40 PRO CA   C   19.472   8.777   2.828 1.00 . A A .  40 PRO CA   1 1 
       13  7974 1 1 40 PRO CB   C   20.202   9.613   3.882 1.00 . A A .  40 PRO CB   1 1 
       13  7975 1 1 40 PRO CD   C   17.966   9.310   4.670 1.00 . A A .  40 PRO CD   1 1 
       13  7976 1 1 40 PRO CG   C   19.394   9.449   5.122 1.00 . A A .  40 PRO CG   1 1 
       13  7977 1 1 40 PRO HA   H   19.543   9.264   1.867 1.00 . A A .  40 PRO HA   1 1 
       13  7978 1 1 40 PRO HB2  H   21.207   9.236   4.011 1.00 . A A .  40 PRO HB2  1 1 
       13  7979 1 1 40 PRO HB3  H   20.237  10.645   3.567 1.00 . A A .  40 PRO HB3  1 1 
       13  7980 1 1 40 PRO HD2  H   17.428   8.636   5.321 1.00 . A A .  40 PRO HD2  1 1 
       13  7981 1 1 40 PRO HD3  H   17.483  10.276   4.642 1.00 . A A .  40 PRO HD3  1 1 
       13  7982 1 1 40 PRO HG2  H   19.708   8.562   5.651 1.00 . A A .  40 PRO HG2  1 1 
       13  7983 1 1 40 PRO HG3  H   19.504  10.321   5.750 1.00 . A A .  40 PRO HG3  1 1 
       13  7984 1 1 40 PRO N    N   18.090   8.746   3.316 1.00 . A A .  40 PRO N    1 1 
       13  7985 1 1 40 PRO O    O   19.747   6.493   3.515 1.00 . A A .  40 PRO O    1 1 
       13  7986 1 1 41 SER C    C   23.135   6.012   1.899 1.00 . A A .  41 SER C    1 1 
       13  7987 1 1 41 SER CA   C   21.646   5.915   1.581 1.00 . A A .  41 SER CA   1 1 
       13  7988 1 1 41 SER CB   C   21.450   5.432   0.143 1.00 . A A .  41 SER CB   1 1 
       13  7989 1 1 41 SER H    H   21.216   7.950   1.187 1.00 . A A .  41 SER H    1 1 
       13  7990 1 1 41 SER HA   H   21.192   5.204   2.256 1.00 . A A .  41 SER HA   1 1 
       13  7991 1 1 41 SER HB2  H   20.396   5.416  -0.088 1.00 . A A .  41 SER HB2  1 1 
       13  7992 1 1 41 SER HB3  H   21.956   6.107  -0.532 1.00 . A A .  41 SER HB3  1 1 
       13  7993 1 1 41 SER HG   H   22.685   4.154  -0.681 1.00 . A A .  41 SER HG   1 1 
       13  7994 1 1 41 SER N    N   20.989   7.201   1.778 1.00 . A A .  41 SER N    1 1 
       13  7995 1 1 41 SER O    O   23.968   6.112   0.999 1.00 . A A .  41 SER O    1 1 
       13  7996 1 1 41 SER OG   O   21.977   4.128  -0.034 1.00 . A A .  41 SER OG   1 1 
       13  7997 1 1 42 GLY C    C   25.656   7.021   2.740 1.00 . A A .  42 GLY C    1 1 
       13  7998 1 1 42 GLY CA   C   24.851   6.068   3.602 1.00 . A A .  42 GLY CA   1 1 
       13  7999 1 1 42 GLY H    H   22.756   5.902   3.861 1.00 . A A .  42 GLY H    1 1 
       13  8000 1 1 42 GLY HA2  H   24.889   6.406   4.627 1.00 . A A .  42 GLY HA2  1 1 
       13  8001 1 1 42 GLY HA3  H   25.294   5.085   3.541 1.00 . A A .  42 GLY HA3  1 1 
       13  8002 1 1 42 GLY N    N   23.463   5.982   3.187 1.00 . A A .  42 GLY N    1 1 
       13  8003 1 1 42 GLY O    O   26.399   6.610   1.850 1.00 . A A .  42 GLY O    1 1 
       13  8004 1 1 43 PRO C    C   27.716   9.378   2.550 1.00 . A A .  43 PRO C    1 1 
       13  8005 1 1 43 PRO CA   C   26.220   9.370   2.254 1.00 . A A .  43 PRO CA   1 1 
       13  8006 1 1 43 PRO CB   C   25.571  10.666   2.747 1.00 . A A .  43 PRO CB   1 1 
       13  8007 1 1 43 PRO CD   C   24.640   8.891   4.050 1.00 . A A .  43 PRO CD   1 1 
       13  8008 1 1 43 PRO CG   C   25.050  10.337   4.103 1.00 . A A .  43 PRO CG   1 1 
       13  8009 1 1 43 PRO HA   H   26.065   9.270   1.190 1.00 . A A .  43 PRO HA   1 1 
       13  8010 1 1 43 PRO HB2  H   26.314  11.450   2.788 1.00 . A A .  43 PRO HB2  1 1 
       13  8011 1 1 43 PRO HB3  H   24.774  10.951   2.077 1.00 . A A .  43 PRO HB3  1 1 
       13  8012 1 1 43 PRO HD2  H   24.822   8.412   5.000 1.00 . A A .  43 PRO HD2  1 1 
       13  8013 1 1 43 PRO HD3  H   23.600   8.803   3.774 1.00 . A A .  43 PRO HD3  1 1 
       13  8014 1 1 43 PRO HG2  H   25.825  10.480   4.840 1.00 . A A .  43 PRO HG2  1 1 
       13  8015 1 1 43 PRO HG3  H   24.196  10.959   4.329 1.00 . A A .  43 PRO HG3  1 1 
       13  8016 1 1 43 PRO N    N   25.509   8.329   3.003 1.00 . A A .  43 PRO N    1 1 
       13  8017 1 1 43 PRO O    O   28.183  10.114   3.419 1.00 . A A .  43 PRO O    1 1 
       13  8018 1 1 44 SER C    C   30.645   8.883   0.740 1.00 . A A .  44 SER C    1 1 
       13  8019 1 1 44 SER CA   C   29.906   8.464   2.008 1.00 . A A .  44 SER CA   1 1 
       13  8020 1 1 44 SER CB   C   30.303   7.039   2.396 1.00 . A A .  44 SER CB   1 1 
       13  8021 1 1 44 SER H    H   28.032   7.992   1.143 1.00 . A A .  44 SER H    1 1 
       13  8022 1 1 44 SER HA   H   30.179   9.135   2.808 1.00 . A A .  44 SER HA   1 1 
       13  8023 1 1 44 SER HB2  H   29.707   6.336   1.834 1.00 . A A .  44 SER HB2  1 1 
       13  8024 1 1 44 SER HB3  H   31.349   6.885   2.170 1.00 . A A .  44 SER HB3  1 1 
       13  8025 1 1 44 SER HG   H   29.165   6.913   3.985 1.00 . A A .  44 SER HG   1 1 
       13  8026 1 1 44 SER N    N   28.463   8.554   1.821 1.00 . A A .  44 SER N    1 1 
       13  8027 1 1 44 SER O    O   30.054   8.971  -0.336 1.00 . A A .  44 SER O    1 1 
       13  8028 1 1 44 SER OG   O   30.097   6.810   3.779 1.00 . A A .  44 SER OG   1 1 
       13  8029 1 1 45 SER C    C   34.152   8.927  -0.177 1.00 . A A .  45 SER C    1 1 
       13  8030 1 1 45 SER CA   C   32.762   9.553  -0.256 1.00 . A A .  45 SER CA   1 1 
       13  8031 1 1 45 SER CB   C   32.879  11.078  -0.298 1.00 . A A .  45 SER CB   1 1 
       13  8032 1 1 45 SER H    H   32.356   9.051   1.761 1.00 . A A .  45 SER H    1 1 
       13  8033 1 1 45 SER HA   H   32.277   9.212  -1.158 1.00 . A A .  45 SER HA   1 1 
       13  8034 1 1 45 SER HB2  H   31.892  11.513  -0.263 1.00 . A A .  45 SER HB2  1 1 
       13  8035 1 1 45 SER HB3  H   33.452  11.416   0.553 1.00 . A A .  45 SER HB3  1 1 
       13  8036 1 1 45 SER HG   H   32.866  11.739  -2.142 1.00 . A A .  45 SER HG   1 1 
       13  8037 1 1 45 SER N    N   31.942   9.140   0.877 1.00 . A A .  45 SER N    1 1 
       13  8038 1 1 45 SER O    O   34.694   8.727   0.908 1.00 . A A .  45 SER O    1 1 
       13  8039 1 1 45 SER OG   O   33.525  11.507  -1.484 1.00 . A A .  45 SER OG   1 1 
       13  8040 1 1 46 GLY C    C   36.820   8.416  -2.620 1.00 . A A .  46 GLY C    1 1 
       13  8041 1 1 46 GLY CA   C   36.043   8.021  -1.380 1.00 . A A .  46 GLY CA   1 1 
       13  8042 1 1 46 GLY H    H   34.242   8.803  -2.174 1.00 . A A .  46 GLY H    1 1 
       13  8043 1 1 46 GLY HA2  H   36.596   8.332  -0.507 1.00 . A A .  46 GLY HA2  1 1 
       13  8044 1 1 46 GLY HA3  H   35.938   6.946  -1.363 1.00 . A A .  46 GLY HA3  1 1 
       13  8045 1 1 46 GLY N    N   34.722   8.621  -1.339 1.00 . A A .  46 GLY N    1 1 
       13  8046 1 1 46 GLY O    O   36.280   8.322  -3.721 1.00 . A A .  46 GLY O    1 1 
       13  8047 2 2  1 ZN  ZN   ZN  -0.551   6.631  -3.707 1.00 . B A . 201 ZN  ZN   1 1 
       14  8048 1 1  1 GLY C    C  -25.421   4.444  -3.437 1.00 . A A .   1 GLY C    1 1 
       14  8049 1 1  1 GLY CA   C  -25.245   5.861  -3.946 1.00 . A A .   1 GLY CA   1 1 
       14  8050 1 1  1 GLY H1   H  -26.974   7.060  -4.174 1.00 . A A .   1 GLY H1   1 1 
       14  8051 1 1  1 GLY HA2  H  -25.213   5.844  -5.025 1.00 . A A .   1 GLY HA2  1 1 
       14  8052 1 1  1 GLY HA3  H  -24.308   6.249  -3.574 1.00 . A A .   1 GLY HA3  1 1 
       14  8053 1 1  1 GLY N    N  -26.318   6.741  -3.521 1.00 . A A .   1 GLY N    1 1 
       14  8054 1 1  1 GLY O    O  -26.332   3.733  -3.863 1.00 . A A .   1 GLY O    1 1 
       14  8055 1 1  2 SER C    C  -24.464   1.632  -3.057 1.00 . A A .   2 SER C    1 1 
       14  8056 1 1  2 SER CA   C  -24.607   2.686  -1.963 1.00 . A A .   2 SER CA   1 1 
       14  8057 1 1  2 SER CB   C  -25.925   2.483  -1.212 1.00 . A A .   2 SER CB   1 1 
       14  8058 1 1  2 SER H    H  -23.843   4.643  -2.226 1.00 . A A .   2 SER H    1 1 
       14  8059 1 1  2 SER HA   H  -23.787   2.581  -1.268 1.00 . A A .   2 SER HA   1 1 
       14  8060 1 1  2 SER HB2  H  -26.732   2.916  -1.784 1.00 . A A .   2 SER HB2  1 1 
       14  8061 1 1  2 SER HB3  H  -26.102   1.426  -1.082 1.00 . A A .   2 SER HB3  1 1 
       14  8062 1 1  2 SER HG   H  -26.363   3.933   0.030 1.00 . A A .   2 SER HG   1 1 
       14  8063 1 1  2 SER N    N  -24.547   4.030  -2.526 1.00 . A A .   2 SER N    1 1 
       14  8064 1 1  2 SER O    O  -25.184   0.634  -3.070 1.00 . A A .   2 SER O    1 1 
       14  8065 1 1  2 SER OG   O  -25.886   3.101   0.062 1.00 . A A .   2 SER OG   1 1 
       14  8066 1 1  3 SER C    C  -22.385  -0.209  -4.635 1.00 . A A .   3 SER C    1 1 
       14  8067 1 1  3 SER CA   C  -23.293   0.936  -5.074 1.00 . A A .   3 SER CA   1 1 
       14  8068 1 1  3 SER CB   C  -22.669   1.671  -6.262 1.00 . A A .   3 SER CB   1 1 
       14  8069 1 1  3 SER H    H  -22.987   2.677  -3.908 1.00 . A A .   3 SER H    1 1 
       14  8070 1 1  3 SER HA   H  -24.247   0.528  -5.374 1.00 . A A .   3 SER HA   1 1 
       14  8071 1 1  3 SER HB2  H  -23.276   2.527  -6.512 1.00 . A A .   3 SER HB2  1 1 
       14  8072 1 1  3 SER HB3  H  -21.674   1.999  -5.996 1.00 . A A .   3 SER HB3  1 1 
       14  8073 1 1  3 SER HG   H  -22.542  -0.090  -7.110 1.00 . A A .   3 SER HG   1 1 
       14  8074 1 1  3 SER N    N  -23.529   1.863  -3.973 1.00 . A A .   3 SER N    1 1 
       14  8075 1 1  3 SER O    O  -21.312   0.015  -4.075 1.00 . A A .   3 SER O    1 1 
       14  8076 1 1  3 SER OG   O  -22.582   0.825  -7.396 1.00 . A A .   3 SER OG   1 1 
       14  8077 1 1  4 GLY C    C  -21.137  -3.076  -5.640 1.00 . A A .   4 GLY C    1 1 
       14  8078 1 1  4 GLY CA   C  -22.039  -2.599  -4.519 1.00 . A A .   4 GLY CA   1 1 
       14  8079 1 1  4 GLY H    H  -23.687  -1.555  -5.343 1.00 . A A .   4 GLY H    1 1 
       14  8080 1 1  4 GLY HA2  H  -21.431  -2.349  -3.663 1.00 . A A .   4 GLY HA2  1 1 
       14  8081 1 1  4 GLY HA3  H  -22.711  -3.400  -4.248 1.00 . A A .   4 GLY HA3  1 1 
       14  8082 1 1  4 GLY N    N  -22.823  -1.437  -4.894 1.00 . A A .   4 GLY N    1 1 
       14  8083 1 1  4 GLY O    O  -21.244  -4.217  -6.089 1.00 . A A .   4 GLY O    1 1 
       14  8084 1 1  5 SER C    C  -18.670  -3.890  -6.927 1.00 . A A .   5 SER C    1 1 
       14  8085 1 1  5 SER CA   C  -19.327  -2.536  -7.175 1.00 . A A .   5 SER CA   1 1 
       14  8086 1 1  5 SER CB   C  -18.254  -1.454  -7.314 1.00 . A A .   5 SER CB   1 1 
       14  8087 1 1  5 SER H    H  -20.211  -1.305  -5.696 1.00 . A A .   5 SER H    1 1 
       14  8088 1 1  5 SER HA   H  -19.895  -2.587  -8.091 1.00 . A A .   5 SER HA   1 1 
       14  8089 1 1  5 SER HB2  H  -17.855  -1.219  -6.340 1.00 . A A .   5 SER HB2  1 1 
       14  8090 1 1  5 SER HB3  H  -17.461  -1.817  -7.951 1.00 . A A .   5 SER HB3  1 1 
       14  8091 1 1  5 SER HG   H  -19.214   0.250  -7.198 1.00 . A A .   5 SER HG   1 1 
       14  8092 1 1  5 SER N    N  -20.247  -2.200  -6.095 1.00 . A A .   5 SER N    1 1 
       14  8093 1 1  5 SER O    O  -18.590  -4.728  -7.825 1.00 . A A .   5 SER O    1 1 
       14  8094 1 1  5 SER OG   O  -18.792  -0.273  -7.884 1.00 . A A .   5 SER OG   1 1 
       14  8095 1 1  6 SER C    C  -18.543  -6.322  -4.715 1.00 . A A .   6 SER C    1 1 
       14  8096 1 1  6 SER CA   C  -17.545  -5.347  -5.334 1.00 . A A .   6 SER CA   1 1 
       14  8097 1 1  6 SER CB   C  -16.401  -5.081  -4.354 1.00 . A A .   6 SER CB   1 1 
       14  8098 1 1  6 SER H    H  -18.293  -3.390  -5.028 1.00 . A A .   6 SER H    1 1 
       14  8099 1 1  6 SER HA   H  -17.142  -5.787  -6.234 1.00 . A A .   6 SER HA   1 1 
       14  8100 1 1  6 SER HB2  H  -16.764  -4.473  -3.538 1.00 . A A .   6 SER HB2  1 1 
       14  8101 1 1  6 SER HB3  H  -16.036  -6.021  -3.967 1.00 . A A .   6 SER HB3  1 1 
       14  8102 1 1  6 SER HG   H  -14.683  -4.141  -4.333 1.00 . A A .   6 SER HG   1 1 
       14  8103 1 1  6 SER N    N  -18.200  -4.097  -5.701 1.00 . A A .   6 SER N    1 1 
       14  8104 1 1  6 SER O    O  -19.589  -5.918  -4.208 1.00 . A A .   6 SER O    1 1 
       14  8105 1 1  6 SER OG   O  -15.333  -4.401  -4.990 1.00 . A A .   6 SER OG   1 1 
       14  8106 1 1  7 GLY C    C  -18.933  -8.759  -2.702 1.00 . A A .   7 GLY C    1 1 
       14  8107 1 1  7 GLY CA   C  -19.088  -8.621  -4.204 1.00 . A A .   7 GLY CA   1 1 
       14  8108 1 1  7 GLY H    H  -17.365  -7.872  -5.179 1.00 . A A .   7 GLY H    1 1 
       14  8109 1 1  7 GLY HA2  H  -20.112  -8.359  -4.427 1.00 . A A .   7 GLY HA2  1 1 
       14  8110 1 1  7 GLY HA3  H  -18.862  -9.571  -4.666 1.00 . A A .   7 GLY HA3  1 1 
       14  8111 1 1  7 GLY N    N  -18.212  -7.608  -4.762 1.00 . A A .   7 GLY N    1 1 
       14  8112 1 1  7 GLY O    O  -19.844  -8.428  -1.944 1.00 . A A .   7 GLY O    1 1 
       14  8113 1 1  8 ALA C    C  -17.176  -8.099  -0.181 1.00 . A A .   8 ALA C    1 1 
       14  8114 1 1  8 ALA CA   C  -17.504  -9.429  -0.850 1.00 . A A .   8 ALA CA   1 1 
       14  8115 1 1  8 ALA CB   C  -16.363 -10.416  -0.652 1.00 . A A .   8 ALA CB   1 1 
       14  8116 1 1  8 ALA H    H  -17.087  -9.494  -2.924 1.00 . A A .   8 ALA H    1 1 
       14  8117 1 1  8 ALA HA   H  -18.390  -9.844  -0.391 1.00 . A A .   8 ALA HA   1 1 
       14  8118 1 1  8 ALA HB1  H  -16.227 -10.994  -1.554 1.00 . A A .   8 ALA HB1  1 1 
       14  8119 1 1  8 ALA HB2  H  -15.454  -9.875  -0.431 1.00 . A A .   8 ALA HB2  1 1 
       14  8120 1 1  8 ALA HB3  H  -16.598 -11.078   0.168 1.00 . A A .   8 ALA HB3  1 1 
       14  8121 1 1  8 ALA N    N  -17.775  -9.249  -2.271 1.00 . A A .   8 ALA N    1 1 
       14  8122 1 1  8 ALA O    O  -17.668  -7.803   0.907 1.00 . A A .   8 ALA O    1 1 
       14  8123 1 1  9 GLY C    C  -14.679  -5.478  -0.896 1.00 . A A .   9 GLY C    1 1 
       14  8124 1 1  9 GLY CA   C  -15.963  -6.010  -0.291 1.00 . A A .   9 GLY CA   1 1 
       14  8125 1 1  9 GLY H    H  -15.980  -7.588  -1.703 1.00 . A A .   9 GLY H    1 1 
       14  8126 1 1  9 GLY HA2  H  -16.757  -5.304  -0.480 1.00 . A A .   9 GLY HA2  1 1 
       14  8127 1 1  9 GLY HA3  H  -15.829  -6.110   0.776 1.00 . A A .   9 GLY HA3  1 1 
       14  8128 1 1  9 GLY N    N  -16.342  -7.299  -0.839 1.00 . A A .   9 GLY N    1 1 
       14  8129 1 1  9 GLY O    O  -14.518  -5.470  -2.116 1.00 . A A .   9 GLY O    1 1 
       14  8130 1 1 10 GLU C    C  -11.346  -4.963   0.394 1.00 . A A .  10 GLU C    1 1 
       14  8131 1 1 10 GLU CA   C  -12.490  -4.492  -0.500 1.00 . A A .  10 GLU CA   1 1 
       14  8132 1 1 10 GLU CB   C  -12.536  -2.962  -0.525 1.00 . A A .  10 GLU CB   1 1 
       14  8133 1 1 10 GLU CD   C  -11.070  -2.662  -2.560 1.00 . A A .  10 GLU CD   1 1 
       14  8134 1 1 10 GLU CG   C  -11.282  -2.324  -1.097 1.00 . A A .  10 GLU CG   1 1 
       14  8135 1 1 10 GLU H    H  -13.952  -5.063   0.920 1.00 . A A .  10 GLU H    1 1 
       14  8136 1 1 10 GLU HA   H  -12.319  -4.853  -1.503 1.00 . A A .  10 GLU HA   1 1 
       14  8137 1 1 10 GLU HB2  H  -13.380  -2.649  -1.122 1.00 . A A .  10 GLU HB2  1 1 
       14  8138 1 1 10 GLU HB3  H  -12.669  -2.603   0.485 1.00 . A A .  10 GLU HB3  1 1 
       14  8139 1 1 10 GLU HG2  H  -11.362  -1.252  -0.999 1.00 . A A .  10 GLU HG2  1 1 
       14  8140 1 1 10 GLU HG3  H  -10.427  -2.673  -0.535 1.00 . A A .  10 GLU HG3  1 1 
       14  8141 1 1 10 GLU N    N  -13.765  -5.031  -0.042 1.00 . A A .  10 GLU N    1 1 
       14  8142 1 1 10 GLU O    O  -11.509  -5.104   1.606 1.00 . A A .  10 GLU O    1 1 
       14  8143 1 1 10 GLU OE1  O  -12.032  -2.522  -3.345 1.00 . A A .  10 GLU OE1  1 1 
       14  8144 1 1 10 GLU OE2  O   -9.945  -3.067  -2.920 1.00 . A A .  10 GLU OE2  1 1 
       14  8145 1 1 11 LYS C    C   -8.712  -4.723   1.691 1.00 . A A .  11 LYS C    1 1 
       14  8146 1 1 11 LYS CA   C   -9.018  -5.659   0.526 1.00 . A A .  11 LYS CA   1 1 
       14  8147 1 1 11 LYS CB   C   -7.805  -5.746  -0.404 1.00 . A A .  11 LYS CB   1 1 
       14  8148 1 1 11 LYS CD   C   -8.449  -7.151  -2.384 1.00 . A A .  11 LYS CD   1 1 
       14  8149 1 1 11 LYS CE   C   -8.631  -8.583  -2.864 1.00 . A A .  11 LYS CE   1 1 
       14  8150 1 1 11 LYS CG   C   -7.658  -7.094  -1.088 1.00 . A A .  11 LYS CG   1 1 
       14  8151 1 1 11 LYS H    H  -10.122  -5.074  -1.183 1.00 . A A .  11 LYS H    1 1 
       14  8152 1 1 11 LYS HA   H   -9.232  -6.642   0.916 1.00 . A A .  11 LYS HA   1 1 
       14  8153 1 1 11 LYS HB2  H   -7.896  -4.986  -1.167 1.00 . A A .  11 LYS HB2  1 1 
       14  8154 1 1 11 LYS HB3  H   -6.911  -5.559   0.173 1.00 . A A .  11 LYS HB3  1 1 
       14  8155 1 1 11 LYS HD2  H   -9.422  -6.712  -2.222 1.00 . A A .  11 LYS HD2  1 1 
       14  8156 1 1 11 LYS HD3  H   -7.921  -6.590  -3.143 1.00 . A A .  11 LYS HD3  1 1 
       14  8157 1 1 11 LYS HE2  H   -7.771  -8.863  -3.453 1.00 . A A .  11 LYS HE2  1 1 
       14  8158 1 1 11 LYS HE3  H   -8.704  -9.230  -2.003 1.00 . A A .  11 LYS HE3  1 1 
       14  8159 1 1 11 LYS HG2  H   -6.615  -7.264  -1.308 1.00 . A A .  11 LYS HG2  1 1 
       14  8160 1 1 11 LYS HG3  H   -8.018  -7.866  -0.423 1.00 . A A .  11 LYS HG3  1 1 
       14  8161 1 1 11 LYS HZ1  H   -9.874  -9.680  -4.135 1.00 . A A .  11 LYS HZ1  1 1 
       14  8162 1 1 11 LYS HZ2  H   -9.878  -8.016  -4.441 1.00 . A A .  11 LYS HZ2  1 1 
       14  8163 1 1 11 LYS HZ3  H  -10.705  -8.631  -3.100 1.00 . A A .  11 LYS HZ3  1 1 
       14  8164 1 1 11 LYS N    N  -10.190  -5.205  -0.213 1.00 . A A .  11 LYS N    1 1 
       14  8165 1 1 11 LYS NZ   N   -9.858  -8.738  -3.693 1.00 . A A .  11 LYS NZ   1 1 
       14  8166 1 1 11 LYS O    O   -9.111  -3.559   1.704 1.00 . A A .  11 LYS O    1 1 
       14  8167 1 1 12 PRO C    C   -6.583  -3.387   3.565 1.00 . A A .  12 PRO C    1 1 
       14  8168 1 1 12 PRO CA   C   -7.611  -4.468   3.880 1.00 . A A .  12 PRO CA   1 1 
       14  8169 1 1 12 PRO CB   C   -7.009  -5.522   4.814 1.00 . A A .  12 PRO CB   1 1 
       14  8170 1 1 12 PRO CD   C   -7.478  -6.623   2.744 1.00 . A A .  12 PRO CD   1 1 
       14  8171 1 1 12 PRO CG   C   -6.524  -6.599   3.907 1.00 . A A .  12 PRO CG   1 1 
       14  8172 1 1 12 PRO HA   H   -8.473  -4.018   4.350 1.00 . A A .  12 PRO HA   1 1 
       14  8173 1 1 12 PRO HB2  H   -6.198  -5.085   5.378 1.00 . A A .  12 PRO HB2  1 1 
       14  8174 1 1 12 PRO HB3  H   -7.769  -5.886   5.488 1.00 . A A .  12 PRO HB3  1 1 
       14  8175 1 1 12 PRO HD2  H   -6.957  -6.875   1.833 1.00 . A A .  12 PRO HD2  1 1 
       14  8176 1 1 12 PRO HD3  H   -8.281  -7.322   2.928 1.00 . A A .  12 PRO HD3  1 1 
       14  8177 1 1 12 PRO HG2  H   -5.525  -6.372   3.567 1.00 . A A .  12 PRO HG2  1 1 
       14  8178 1 1 12 PRO HG3  H   -6.540  -7.548   4.423 1.00 . A A .  12 PRO HG3  1 1 
       14  8179 1 1 12 PRO N    N   -7.987  -5.242   2.693 1.00 . A A .  12 PRO N    1 1 
       14  8180 1 1 12 PRO O    O   -6.594  -2.313   4.167 1.00 . A A .  12 PRO O    1 1 
       14  8181 1 1 13 TYR C    C   -5.199  -1.724   1.211 1.00 . A A .  13 TYR C    1 1 
       14  8182 1 1 13 TYR CA   C   -4.662  -2.728   2.226 1.00 . A A .  13 TYR CA   1 1 
       14  8183 1 1 13 TYR CB   C   -3.459  -3.469   1.639 1.00 . A A .  13 TYR CB   1 1 
       14  8184 1 1 13 TYR CD1  C   -2.308  -4.633   3.562 1.00 . A A .  13 TYR CD1  1 1 
       14  8185 1 1 13 TYR CD2  C   -3.493  -5.970   1.985 1.00 . A A .  13 TYR CD2  1 1 
       14  8186 1 1 13 TYR CE1  C   -1.958  -5.767   4.269 1.00 . A A .  13 TYR CE1  1 1 
       14  8187 1 1 13 TYR CE2  C   -3.150  -7.110   2.686 1.00 . A A .  13 TYR CE2  1 1 
       14  8188 1 1 13 TYR CG   C   -3.079  -4.714   2.409 1.00 . A A .  13 TYR CG   1 1 
       14  8189 1 1 13 TYR CZ   C   -2.382  -7.003   3.827 1.00 . A A .  13 TYR CZ   1 1 
       14  8190 1 1 13 TYR H    H   -5.740  -4.549   2.175 1.00 . A A .  13 TYR H    1 1 
       14  8191 1 1 13 TYR HA   H   -4.347  -2.195   3.111 1.00 . A A .  13 TYR HA   1 1 
       14  8192 1 1 13 TYR HB2  H   -3.685  -3.764   0.626 1.00 . A A .  13 TYR HB2  1 1 
       14  8193 1 1 13 TYR HB3  H   -2.605  -2.808   1.634 1.00 . A A .  13 TYR HB3  1 1 
       14  8194 1 1 13 TYR HD1  H   -1.978  -3.662   3.905 1.00 . A A .  13 TYR HD1  1 1 
       14  8195 1 1 13 TYR HD2  H   -4.095  -6.051   1.091 1.00 . A A .  13 TYR HD2  1 1 
       14  8196 1 1 13 TYR HE1  H   -1.357  -5.683   5.162 1.00 . A A .  13 TYR HE1  1 1 
       14  8197 1 1 13 TYR HE2  H   -3.481  -8.078   2.341 1.00 . A A .  13 TYR HE2  1 1 
       14  8198 1 1 13 TYR HH   H   -1.287  -8.559   4.104 1.00 . A A .  13 TYR HH   1 1 
       14  8199 1 1 13 TYR N    N   -5.697  -3.676   2.619 1.00 . A A .  13 TYR N    1 1 
       14  8200 1 1 13 TYR O    O   -6.054  -2.052   0.388 1.00 . A A .  13 TYR O    1 1 
       14  8201 1 1 13 TYR OH   O   -2.037  -8.135   4.529 1.00 . A A .  13 TYR OH   1 1 
       14  8202 1 1 14 GLY C    C   -4.499   1.883   0.655 1.00 . A A .  14 GLY C    1 1 
       14  8203 1 1 14 GLY CA   C   -5.129   0.537   0.357 1.00 . A A .  14 GLY CA   1 1 
       14  8204 1 1 14 GLY H    H   -4.011  -0.293   1.952 1.00 . A A .  14 GLY H    1 1 
       14  8205 1 1 14 GLY HA2  H   -4.869   0.245  -0.649 1.00 . A A .  14 GLY HA2  1 1 
       14  8206 1 1 14 GLY HA3  H   -6.203   0.632   0.427 1.00 . A A .  14 GLY HA3  1 1 
       14  8207 1 1 14 GLY N    N   -4.690  -0.497   1.275 1.00 . A A .  14 GLY N    1 1 
       14  8208 1 1 14 GLY O    O   -4.622   2.402   1.765 1.00 . A A .  14 GLY O    1 1 
       14  8209 1 1 15 CYS C    C   -4.182   4.827   0.175 1.00 . A A .  15 CYS C    1 1 
       14  8210 1 1 15 CYS CA   C   -3.166   3.743  -0.175 1.00 . A A .  15 CYS CA   1 1 
       14  8211 1 1 15 CYS CB   C   -2.418   4.123  -1.454 1.00 . A A .  15 CYS CB   1 1 
       14  8212 1 1 15 CYS H    H   -3.757   1.987  -1.199 1.00 . A A .  15 CYS H    1 1 
       14  8213 1 1 15 CYS HA   H   -2.457   3.657   0.634 1.00 . A A .  15 CYS HA   1 1 
       14  8214 1 1 15 CYS HB2  H   -1.510   3.542  -1.517 1.00 . A A .  15 CYS HB2  1 1 
       14  8215 1 1 15 CYS HB3  H   -3.042   3.898  -2.307 1.00 . A A .  15 CYS HB3  1 1 
       14  8216 1 1 15 CYS N    N   -3.820   2.450  -0.336 1.00 . A A .  15 CYS N    1 1 
       14  8217 1 1 15 CYS O    O   -5.269   4.881  -0.400 1.00 . A A .  15 CYS O    1 1 
       14  8218 1 1 15 CYS SG   S   -1.957   5.882  -1.551 1.00 . A A .  15 CYS SG   1 1 
       14  8219 1 1 16 SER C    C   -4.217   8.110   1.005 1.00 . A A .  16 SER C    1 1 
       14  8220 1 1 16 SER CA   C   -4.699   6.768   1.549 1.00 . A A .  16 SER CA   1 1 
       14  8221 1 1 16 SER CB   C   -4.771   6.820   3.076 1.00 . A A .  16 SER CB   1 1 
       14  8222 1 1 16 SER H    H   -2.938   5.592   1.540 1.00 . A A .  16 SER H    1 1 
       14  8223 1 1 16 SER HA   H   -5.685   6.568   1.157 1.00 . A A .  16 SER HA   1 1 
       14  8224 1 1 16 SER HB2  H   -5.053   5.849   3.454 1.00 . A A .  16 SER HB2  1 1 
       14  8225 1 1 16 SER HB3  H   -3.802   7.092   3.470 1.00 . A A .  16 SER HB3  1 1 
       14  8226 1 1 16 SER HG   H   -5.787   8.482   2.864 1.00 . A A .  16 SER HG   1 1 
       14  8227 1 1 16 SER N    N   -3.819   5.688   1.120 1.00 . A A .  16 SER N    1 1 
       14  8228 1 1 16 SER O    O   -5.019   8.996   0.712 1.00 . A A .  16 SER O    1 1 
       14  8229 1 1 16 SER OG   O   -5.724   7.774   3.510 1.00 . A A .  16 SER OG   1 1 
       14  8230 1 1 17 GLU C    C   -3.075   9.988  -0.856 1.00 . A A .  17 GLU C    1 1 
       14  8231 1 1 17 GLU CA   C   -2.313   9.483   0.366 1.00 . A A .  17 GLU CA   1 1 
       14  8232 1 1 17 GLU CB   C   -0.842   9.262   0.007 1.00 . A A .  17 GLU CB   1 1 
       14  8233 1 1 17 GLU CD   C    0.357  10.852   1.561 1.00 . A A .  17 GLU CD   1 1 
       14  8234 1 1 17 GLU CG   C    0.101   9.405   1.190 1.00 . A A .  17 GLU CG   1 1 
       14  8235 1 1 17 GLU H    H   -2.314   7.507   1.124 1.00 . A A .  17 GLU H    1 1 
       14  8236 1 1 17 GLU HA   H   -2.375  10.226   1.146 1.00 . A A .  17 GLU HA   1 1 
       14  8237 1 1 17 GLU HB2  H   -0.728   8.268  -0.400 1.00 . A A .  17 GLU HB2  1 1 
       14  8238 1 1 17 GLU HB3  H   -0.555   9.984  -0.744 1.00 . A A .  17 GLU HB3  1 1 
       14  8239 1 1 17 GLU HG2  H   -0.331   8.902   2.042 1.00 . A A .  17 GLU HG2  1 1 
       14  8240 1 1 17 GLU HG3  H    1.044   8.941   0.940 1.00 . A A .  17 GLU HG3  1 1 
       14  8241 1 1 17 GLU N    N   -2.902   8.250   0.873 1.00 . A A .  17 GLU N    1 1 
       14  8242 1 1 17 GLU O    O   -3.500  11.143  -0.903 1.00 . A A .  17 GLU O    1 1 
       14  8243 1 1 17 GLU OE1  O    1.272  11.464   0.973 1.00 . A A .  17 GLU OE1  1 1 
       14  8244 1 1 17 GLU OE2  O   -0.360  11.374   2.442 1.00 . A A .  17 GLU OE2  1 1 
       14  8245 1 1 18 CYS C    C   -5.262   8.694  -3.180 1.00 . A A .  18 CYS C    1 1 
       14  8246 1 1 18 CYS CA   C   -3.953   9.470  -3.066 1.00 . A A .  18 CYS CA   1 1 
       14  8247 1 1 18 CYS CB   C   -3.076   9.193  -4.288 1.00 . A A .  18 CYS CB   1 1 
       14  8248 1 1 18 CYS H    H   -2.881   8.208  -1.747 1.00 . A A .  18 CYS H    1 1 
       14  8249 1 1 18 CYS HA   H   -4.177  10.525  -3.026 1.00 . A A .  18 CYS HA   1 1 
       14  8250 1 1 18 CYS HB2  H   -3.436   9.781  -5.121 1.00 . A A .  18 CYS HB2  1 1 
       14  8251 1 1 18 CYS HB3  H   -2.059   9.481  -4.065 1.00 . A A .  18 CYS HB3  1 1 
       14  8252 1 1 18 CYS N    N   -3.244   9.115  -1.843 1.00 . A A .  18 CYS N    1 1 
       14  8253 1 1 18 CYS O    O   -6.270   9.221  -3.649 1.00 . A A .  18 CYS O    1 1 
       14  8254 1 1 18 CYS SG   S   -3.057   7.448  -4.811 1.00 . A A .  18 CYS SG   1 1 
       14  8255 1 1 19 GLY C    C   -6.315   5.506  -3.843 1.00 . A A .  19 GLY C    1 1 
       14  8256 1 1 19 GLY CA   C   -6.429   6.608  -2.809 1.00 . A A .  19 GLY CA   1 1 
       14  8257 1 1 19 GLY H    H   -4.406   7.069  -2.383 1.00 . A A .  19 GLY H    1 1 
       14  8258 1 1 19 GLY HA2  H   -6.595   6.163  -1.840 1.00 . A A .  19 GLY HA2  1 1 
       14  8259 1 1 19 GLY HA3  H   -7.275   7.232  -3.057 1.00 . A A .  19 GLY HA3  1 1 
       14  8260 1 1 19 GLY N    N   -5.239   7.437  -2.747 1.00 . A A .  19 GLY N    1 1 
       14  8261 1 1 19 GLY O    O   -7.123   5.426  -4.768 1.00 . A A .  19 GLY O    1 1 
       14  8262 1 1 20 LYS C    C   -5.049   2.218  -3.876 1.00 . A A .  20 LYS C    1 1 
       14  8263 1 1 20 LYS CA   C   -5.088   3.551  -4.617 1.00 . A A .  20 LYS CA   1 1 
       14  8264 1 1 20 LYS CB   C   -3.782   3.757  -5.388 1.00 . A A .  20 LYS CB   1 1 
       14  8265 1 1 20 LYS CD   C   -2.784   3.601  -7.687 1.00 . A A .  20 LYS CD   1 1 
       14  8266 1 1 20 LYS CE   C   -2.113   2.571  -8.582 1.00 . A A .  20 LYS CE   1 1 
       14  8267 1 1 20 LYS CG   C   -3.696   2.942  -6.666 1.00 . A A .  20 LYS CG   1 1 
       14  8268 1 1 20 LYS H    H   -4.695   4.770  -2.931 1.00 . A A .  20 LYS H    1 1 
       14  8269 1 1 20 LYS HA   H   -5.910   3.537  -5.315 1.00 . A A .  20 LYS HA   1 1 
       14  8270 1 1 20 LYS HB2  H   -3.691   4.802  -5.644 1.00 . A A .  20 LYS HB2  1 1 
       14  8271 1 1 20 LYS HB3  H   -2.955   3.478  -4.751 1.00 . A A .  20 LYS HB3  1 1 
       14  8272 1 1 20 LYS HD2  H   -3.369   4.269  -8.302 1.00 . A A .  20 LYS HD2  1 1 
       14  8273 1 1 20 LYS HD3  H   -2.022   4.163  -7.166 1.00 . A A .  20 LYS HD3  1 1 
       14  8274 1 1 20 LYS HE2  H   -1.149   2.950  -8.887 1.00 . A A .  20 LYS HE2  1 1 
       14  8275 1 1 20 LYS HE3  H   -1.979   1.658  -8.021 1.00 . A A .  20 LYS HE3  1 1 
       14  8276 1 1 20 LYS HG2  H   -3.308   1.962  -6.433 1.00 . A A .  20 LYS HG2  1 1 
       14  8277 1 1 20 LYS HG3  H   -4.686   2.848  -7.090 1.00 . A A .  20 LYS HG3  1 1 
       14  8278 1 1 20 LYS HZ1  H   -2.769   3.013 -10.516 1.00 . A A .  20 LYS HZ1  1 1 
       14  8279 1 1 20 LYS HZ2  H   -3.935   2.255  -9.553 1.00 . A A .  20 LYS HZ2  1 1 
       14  8280 1 1 20 LYS HZ3  H   -2.653   1.356 -10.194 1.00 . A A .  20 LYS HZ3  1 1 
       14  8281 1 1 20 LYS N    N   -5.307   4.654  -3.689 1.00 . A A .  20 LYS N    1 1 
       14  8282 1 1 20 LYS NZ   N   -2.924   2.278  -9.797 1.00 . A A .  20 LYS NZ   1 1 
       14  8283 1 1 20 LYS O    O   -4.169   1.982  -3.049 1.00 . A A .  20 LYS O    1 1 
       14  8284 1 1 21 ALA C    C   -5.387  -1.022  -4.397 1.00 . A A .  21 ALA C    1 1 
       14  8285 1 1 21 ALA CA   C   -6.079   0.038  -3.547 1.00 . A A .  21 ALA CA   1 1 
       14  8286 1 1 21 ALA CB   C   -7.530  -0.348  -3.297 1.00 . A A .  21 ALA CB   1 1 
       14  8287 1 1 21 ALA H    H   -6.680   1.594  -4.849 1.00 . A A .  21 ALA H    1 1 
       14  8288 1 1 21 ALA HA   H   -5.579   0.101  -2.591 1.00 . A A .  21 ALA HA   1 1 
       14  8289 1 1 21 ALA HB1  H   -8.008   0.418  -2.704 1.00 . A A .  21 ALA HB1  1 1 
       14  8290 1 1 21 ALA HB2  H   -8.044  -0.446  -4.242 1.00 . A A .  21 ALA HB2  1 1 
       14  8291 1 1 21 ALA HB3  H   -7.565  -1.288  -2.768 1.00 . A A .  21 ALA HB3  1 1 
       14  8292 1 1 21 ALA N    N   -6.007   1.349  -4.181 1.00 . A A .  21 ALA N    1 1 
       14  8293 1 1 21 ALA O    O   -5.226  -0.854  -5.606 1.00 . A A .  21 ALA O    1 1 
       14  8294 1 1 22 PHE C    C   -4.837  -4.555  -4.001 1.00 . A A .  22 PHE C    1 1 
       14  8295 1 1 22 PHE CA   C   -4.302  -3.200  -4.456 1.00 . A A .  22 PHE CA   1 1 
       14  8296 1 1 22 PHE CB   C   -2.793  -3.128  -4.215 1.00 . A A .  22 PHE CB   1 1 
       14  8297 1 1 22 PHE CD1  C   -2.185  -0.697  -4.082 1.00 . A A .  22 PHE CD1  1 1 
       14  8298 1 1 22 PHE CD2  C   -1.524  -1.926  -6.015 1.00 . A A .  22 PHE CD2  1 1 
       14  8299 1 1 22 PHE CE1  C   -1.598   0.442  -4.600 1.00 . A A .  22 PHE CE1  1 1 
       14  8300 1 1 22 PHE CE2  C   -0.934  -0.790  -6.538 1.00 . A A .  22 PHE CE2  1 1 
       14  8301 1 1 22 PHE CG   C   -2.154  -1.892  -4.782 1.00 . A A .  22 PHE CG   1 1 
       14  8302 1 1 22 PHE CZ   C   -0.973   0.395  -5.831 1.00 . A A .  22 PHE CZ   1 1 
       14  8303 1 1 22 PHE H    H   -5.136  -2.189  -2.793 1.00 . A A .  22 PHE H    1 1 
       14  8304 1 1 22 PHE HA   H   -4.496  -3.086  -5.511 1.00 . A A .  22 PHE HA   1 1 
       14  8305 1 1 22 PHE HB2  H   -2.604  -3.140  -3.152 1.00 . A A .  22 PHE HB2  1 1 
       14  8306 1 1 22 PHE HB3  H   -2.322  -3.985  -4.671 1.00 . A A .  22 PHE HB3  1 1 
       14  8307 1 1 22 PHE HD1  H   -2.674  -0.659  -3.118 1.00 . A A .  22 PHE HD1  1 1 
       14  8308 1 1 22 PHE HD2  H   -1.494  -2.852  -6.570 1.00 . A A .  22 PHE HD2  1 1 
       14  8309 1 1 22 PHE HE1  H   -1.630   1.367  -4.044 1.00 . A A .  22 PHE HE1  1 1 
       14  8310 1 1 22 PHE HE2  H   -0.447  -0.829  -7.501 1.00 . A A .  22 PHE HE2  1 1 
       14  8311 1 1 22 PHE HZ   H   -0.513   1.283  -6.237 1.00 . A A .  22 PHE HZ   1 1 
       14  8312 1 1 22 PHE N    N   -4.979  -2.113  -3.758 1.00 . A A .  22 PHE N    1 1 
       14  8313 1 1 22 PHE O    O   -5.643  -4.637  -3.074 1.00 . A A .  22 PHE O    1 1 
       14  8314 1 1 23 SER C    C   -4.069  -7.494  -3.107 1.00 . A A .  23 SER C    1 1 
       14  8315 1 1 23 SER CA   C   -4.818  -6.967  -4.327 1.00 . A A .  23 SER CA   1 1 
       14  8316 1 1 23 SER CB   C   -4.600  -7.903  -5.517 1.00 . A A .  23 SER CB   1 1 
       14  8317 1 1 23 SER H    H   -3.741  -5.486  -5.390 1.00 . A A .  23 SER H    1 1 
       14  8318 1 1 23 SER HA   H   -5.872  -6.929  -4.099 1.00 . A A .  23 SER HA   1 1 
       14  8319 1 1 23 SER HB2  H   -5.041  -8.865  -5.301 1.00 . A A .  23 SER HB2  1 1 
       14  8320 1 1 23 SER HB3  H   -5.069  -7.481  -6.394 1.00 . A A .  23 SER HB3  1 1 
       14  8321 1 1 23 SER HG   H   -2.948  -8.955  -5.485 1.00 . A A .  23 SER HG   1 1 
       14  8322 1 1 23 SER N    N   -4.383  -5.616  -4.660 1.00 . A A .  23 SER N    1 1 
       14  8323 1 1 23 SER O    O   -4.664  -8.087  -2.208 1.00 . A A .  23 SER O    1 1 
       14  8324 1 1 23 SER OG   O   -3.219  -8.083  -5.779 1.00 . A A .  23 SER OG   1 1 
       14  8325 1 1 24 SER C    C   -1.204  -6.554  -1.321 1.00 . A A .  24 SER C    1 1 
       14  8326 1 1 24 SER CA   C   -1.925  -7.728  -1.977 1.00 . A A .  24 SER CA   1 1 
       14  8327 1 1 24 SER CB   C   -0.905  -8.757  -2.468 1.00 . A A .  24 SER CB   1 1 
       14  8328 1 1 24 SER H    H   -2.341  -6.794  -3.832 1.00 . A A .  24 SER H    1 1 
       14  8329 1 1 24 SER HA   H   -2.570  -8.193  -1.247 1.00 . A A .  24 SER HA   1 1 
       14  8330 1 1 24 SER HB2  H   -0.434  -8.392  -3.368 1.00 . A A .  24 SER HB2  1 1 
       14  8331 1 1 24 SER HB3  H   -0.156  -8.909  -1.705 1.00 . A A .  24 SER HB3  1 1 
       14  8332 1 1 24 SER HG   H   -1.716 -10.457  -1.928 1.00 . A A .  24 SER HG   1 1 
       14  8333 1 1 24 SER N    N   -2.758  -7.273  -3.084 1.00 . A A .  24 SER N    1 1 
       14  8334 1 1 24 SER O    O   -1.186  -5.445  -1.855 1.00 . A A .  24 SER O    1 1 
       14  8335 1 1 24 SER OG   O   -1.529  -9.998  -2.750 1.00 . A A .  24 SER OG   1 1 
       14  8336 1 1 25 LYS C    C    1.335  -5.307  -0.213 1.00 . A A .  25 LYS C    1 1 
       14  8337 1 1 25 LYS CA   C    0.112  -5.773   0.571 1.00 . A A .  25 LYS CA   1 1 
       14  8338 1 1 25 LYS CB   C    0.543  -6.297   1.943 1.00 . A A .  25 LYS CB   1 1 
       14  8339 1 1 25 LYS CD   C    2.244  -6.095   3.780 1.00 . A A .  25 LYS CD   1 1 
       14  8340 1 1 25 LYS CE   C    3.364  -6.956   3.215 1.00 . A A .  25 LYS CE   1 1 
       14  8341 1 1 25 LYS CG   C    1.492  -5.367   2.679 1.00 . A A .  25 LYS CG   1 1 
       14  8342 1 1 25 LYS H    H   -0.661  -7.712   0.216 1.00 . A A .  25 LYS H    1 1 
       14  8343 1 1 25 LYS HA   H   -0.554  -4.935   0.708 1.00 . A A .  25 LYS HA   1 1 
       14  8344 1 1 25 LYS HB2  H   -0.337  -6.437   2.554 1.00 . A A .  25 LYS HB2  1 1 
       14  8345 1 1 25 LYS HB3  H    1.035  -7.250   1.813 1.00 . A A .  25 LYS HB3  1 1 
       14  8346 1 1 25 LYS HD2  H    2.671  -5.367   4.455 1.00 . A A .  25 LYS HD2  1 1 
       14  8347 1 1 25 LYS HD3  H    1.553  -6.726   4.320 1.00 . A A .  25 LYS HD3  1 1 
       14  8348 1 1 25 LYS HE2  H    3.014  -7.431   2.312 1.00 . A A .  25 LYS HE2  1 1 
       14  8349 1 1 25 LYS HE3  H    4.207  -6.322   2.985 1.00 . A A .  25 LYS HE3  1 1 
       14  8350 1 1 25 LYS HG2  H    2.206  -4.965   1.975 1.00 . A A .  25 LYS HG2  1 1 
       14  8351 1 1 25 LYS HG3  H    0.923  -4.559   3.117 1.00 . A A .  25 LYS HG3  1 1 
       14  8352 1 1 25 LYS HZ1  H    4.814  -7.919   4.370 1.00 . A A .  25 LYS HZ1  1 1 
       14  8353 1 1 25 LYS HZ2  H    3.606  -8.951   3.786 1.00 . A A .  25 LYS HZ2  1 1 
       14  8354 1 1 25 LYS HZ3  H    3.276  -7.905   5.074 1.00 . A A .  25 LYS HZ3  1 1 
       14  8355 1 1 25 LYS N    N   -0.612  -6.807  -0.159 1.00 . A A .  25 LYS N    1 1 
       14  8356 1 1 25 LYS NZ   N    3.795  -8.006   4.179 1.00 . A A .  25 LYS NZ   1 1 
       14  8357 1 1 25 LYS O    O    1.482  -4.120  -0.503 1.00 . A A .  25 LYS O    1 1 
       14  8358 1 1 26 SER C    C    3.137  -4.886  -2.375 1.00 . A A .  26 SER C    1 1 
       14  8359 1 1 26 SER CA   C    3.419  -5.934  -1.304 1.00 . A A .  26 SER CA   1 1 
       14  8360 1 1 26 SER CB   C    3.988  -7.199  -1.949 1.00 . A A .  26 SER CB   1 1 
       14  8361 1 1 26 SER H    H    2.034  -7.178  -0.294 1.00 . A A .  26 SER H    1 1 
       14  8362 1 1 26 SER HA   H    4.144  -5.537  -0.609 1.00 . A A .  26 SER HA   1 1 
       14  8363 1 1 26 SER HB2  H    3.198  -7.726  -2.462 1.00 . A A .  26 SER HB2  1 1 
       14  8364 1 1 26 SER HB3  H    4.756  -6.924  -2.657 1.00 . A A .  26 SER HB3  1 1 
       14  8365 1 1 26 SER HG   H    5.032  -7.538  -0.326 1.00 . A A .  26 SER HG   1 1 
       14  8366 1 1 26 SER N    N    2.208  -6.249  -0.554 1.00 . A A .  26 SER N    1 1 
       14  8367 1 1 26 SER O    O    3.868  -3.904  -2.507 1.00 . A A .  26 SER O    1 1 
       14  8368 1 1 26 SER OG   O    4.552  -8.059  -0.974 1.00 . A A .  26 SER OG   1 1 
       14  8369 1 1 27 TYR C    C    1.579  -2.752  -3.669 1.00 . A A .  27 TYR C    1 1 
       14  8370 1 1 27 TYR CA   C    1.693  -4.177  -4.202 1.00 . A A .  27 TYR CA   1 1 
       14  8371 1 1 27 TYR CB   C    0.367  -4.606  -4.831 1.00 . A A .  27 TYR CB   1 1 
       14  8372 1 1 27 TYR CD1  C    1.298  -5.498  -7.003 1.00 . A A .  27 TYR CD1  1 1 
       14  8373 1 1 27 TYR CD2  C   -0.129  -6.916  -5.724 1.00 . A A .  27 TYR CD2  1 1 
       14  8374 1 1 27 TYR CE1  C    1.434  -6.489  -7.956 1.00 . A A .  27 TYR CE1  1 1 
       14  8375 1 1 27 TYR CE2  C    0.003  -7.912  -6.671 1.00 . A A .  27 TYR CE2  1 1 
       14  8376 1 1 27 TYR CG   C    0.514  -5.693  -5.872 1.00 . A A .  27 TYR CG   1 1 
       14  8377 1 1 27 TYR CZ   C    0.785  -7.694  -7.786 1.00 . A A .  27 TYR CZ   1 1 
       14  8378 1 1 27 TYR H    H    1.528  -5.902  -2.986 1.00 . A A .  27 TYR H    1 1 
       14  8379 1 1 27 TYR HA   H    2.465  -4.206  -4.957 1.00 . A A .  27 TYR HA   1 1 
       14  8380 1 1 27 TYR HB2  H   -0.288  -4.976  -4.057 1.00 . A A .  27 TYR HB2  1 1 
       14  8381 1 1 27 TYR HB3  H   -0.091  -3.751  -5.307 1.00 . A A .  27 TYR HB3  1 1 
       14  8382 1 1 27 TYR HD1  H    1.805  -4.554  -7.132 1.00 . A A .  27 TYR HD1  1 1 
       14  8383 1 1 27 TYR HD2  H   -0.742  -7.084  -4.850 1.00 . A A .  27 TYR HD2  1 1 
       14  8384 1 1 27 TYR HE1  H    2.048  -6.318  -8.829 1.00 . A A .  27 TYR HE1  1 1 
       14  8385 1 1 27 TYR HE2  H   -0.506  -8.856  -6.539 1.00 . A A .  27 TYR HE2  1 1 
       14  8386 1 1 27 TYR HH   H    1.694  -9.214  -8.533 1.00 . A A .  27 TYR HH   1 1 
       14  8387 1 1 27 TYR N    N    2.072  -5.101  -3.139 1.00 . A A .  27 TYR N    1 1 
       14  8388 1 1 27 TYR O    O    2.004  -1.797  -4.320 1.00 . A A .  27 TYR O    1 1 
       14  8389 1 1 27 TYR OH   O    0.920  -8.683  -8.733 1.00 . A A .  27 TYR OH   1 1 
       14  8390 1 1 28 LEU C    C    2.182  -0.666  -1.560 1.00 . A A .  28 LEU C    1 1 
       14  8391 1 1 28 LEU CA   C    0.831  -1.309  -1.857 1.00 . A A .  28 LEU CA   1 1 
       14  8392 1 1 28 LEU CB   C    0.020  -1.439  -0.566 1.00 . A A .  28 LEU CB   1 1 
       14  8393 1 1 28 LEU CD1  C   -1.056   0.825  -0.585 1.00 . A A .  28 LEU CD1  1 1 
       14  8394 1 1 28 LEU CD2  C   -0.854  -0.443   1.562 1.00 . A A .  28 LEU CD2  1 1 
       14  8395 1 1 28 LEU CG   C   -0.204  -0.146   0.218 1.00 . A A .  28 LEU CG   1 1 
       14  8396 1 1 28 LEU H    H    0.683  -3.414  -2.009 1.00 . A A .  28 LEU H    1 1 
       14  8397 1 1 28 LEU HA   H    0.292  -0.680  -2.550 1.00 . A A .  28 LEU HA   1 1 
       14  8398 1 1 28 LEU HB2  H   -0.947  -1.842  -0.823 1.00 . A A .  28 LEU HB2  1 1 
       14  8399 1 1 28 LEU HB3  H    0.538  -2.134   0.080 1.00 . A A .  28 LEU HB3  1 1 
       14  8400 1 1 28 LEU HD11 H   -2.097   0.558  -0.485 1.00 . A A .  28 LEU HD11 1 1 
       14  8401 1 1 28 LEU HD12 H   -0.770   0.779  -1.625 1.00 . A A .  28 LEU HD12 1 1 
       14  8402 1 1 28 LEU HD13 H   -0.904   1.829  -0.214 1.00 . A A .  28 LEU HD13 1 1 
       14  8403 1 1 28 LEU HD21 H   -0.369   0.137   2.333 1.00 . A A .  28 LEU HD21 1 1 
       14  8404 1 1 28 LEU HD22 H   -0.753  -1.495   1.785 1.00 . A A .  28 LEU HD22 1 1 
       14  8405 1 1 28 LEU HD23 H   -1.902  -0.183   1.520 1.00 . A A .  28 LEU HD23 1 1 
       14  8406 1 1 28 LEU HG   H    0.752   0.325   0.405 1.00 . A A .  28 LEU HG   1 1 
       14  8407 1 1 28 LEU N    N    1.002  -2.617  -2.480 1.00 . A A .  28 LEU N    1 1 
       14  8408 1 1 28 LEU O    O    2.407   0.503  -1.875 1.00 . A A .  28 LEU O    1 1 
       14  8409 1 1 29 ILE C    C    5.101  -0.355  -1.842 1.00 . A A .  29 ILE C    1 1 
       14  8410 1 1 29 ILE CA   C    4.408  -0.946  -0.619 1.00 . A A .  29 ILE CA   1 1 
       14  8411 1 1 29 ILE CB   C    5.291  -2.063  -0.033 1.00 . A A .  29 ILE CB   1 1 
       14  8412 1 1 29 ILE CD1  C    5.283  -3.926   1.702 1.00 . A A .  29 ILE CD1  1 1 
       14  8413 1 1 29 ILE CG1  C    4.659  -2.627   1.242 1.00 . A A .  29 ILE CG1  1 1 
       14  8414 1 1 29 ILE CG2  C    6.691  -1.538   0.251 1.00 . A A .  29 ILE CG2  1 1 
       14  8415 1 1 29 ILE H    H    2.840  -2.362  -0.730 1.00 . A A .  29 ILE H    1 1 
       14  8416 1 1 29 ILE HA   H    4.298  -0.173   0.128 1.00 . A A .  29 ILE HA   1 1 
       14  8417 1 1 29 ILE HB   H    5.370  -2.851  -0.766 1.00 . A A .  29 ILE HB   1 1 
       14  8418 1 1 29 ILE HD11 H    6.239  -3.722   2.165 1.00 . A A .  29 ILE HD11 1 1 
       14  8419 1 1 29 ILE HD12 H    4.633  -4.405   2.418 1.00 . A A .  29 ILE HD12 1 1 
       14  8420 1 1 29 ILE HD13 H    5.428  -4.577   0.853 1.00 . A A .  29 ILE HD13 1 1 
       14  8421 1 1 29 ILE HG12 H    4.766  -1.908   2.038 1.00 . A A .  29 ILE HG12 1 1 
       14  8422 1 1 29 ILE HG13 H    3.609  -2.808   1.064 1.00 . A A .  29 ILE HG13 1 1 
       14  8423 1 1 29 ILE HG21 H    7.421  -2.249  -0.106 1.00 . A A .  29 ILE HG21 1 1 
       14  8424 1 1 29 ILE HG22 H    6.830  -0.595  -0.255 1.00 . A A .  29 ILE HG22 1 1 
       14  8425 1 1 29 ILE HG23 H    6.814  -1.398   1.314 1.00 . A A .  29 ILE HG23 1 1 
       14  8426 1 1 29 ILE N    N    3.078  -1.439  -0.955 1.00 . A A .  29 ILE N    1 1 
       14  8427 1 1 29 ILE O    O    5.737   0.697  -1.760 1.00 . A A .  29 ILE O    1 1 
       14  8428 1 1 30 ILE C    C    5.017   0.775  -4.639 1.00 . A A .  30 ILE C    1 1 
       14  8429 1 1 30 ILE CA   C    5.582  -0.577  -4.216 1.00 . A A .  30 ILE CA   1 1 
       14  8430 1 1 30 ILE CB   C    5.369  -1.589  -5.357 1.00 . A A .  30 ILE CB   1 1 
       14  8431 1 1 30 ILE CD1  C    5.117  -4.103  -5.665 1.00 . A A .  30 ILE CD1  1 1 
       14  8432 1 1 30 ILE CG1  C    5.811  -2.986  -4.918 1.00 . A A .  30 ILE CG1  1 1 
       14  8433 1 1 30 ILE CG2  C    6.129  -1.153  -6.601 1.00 . A A .  30 ILE CG2  1 1 
       14  8434 1 1 30 ILE H    H    4.452  -1.867  -2.977 1.00 . A A .  30 ILE H    1 1 
       14  8435 1 1 30 ILE HA   H    6.644  -0.474  -4.047 1.00 . A A .  30 ILE HA   1 1 
       14  8436 1 1 30 ILE HB   H    4.317  -1.611  -5.597 1.00 . A A .  30 ILE HB   1 1 
       14  8437 1 1 30 ILE HD11 H    4.335  -3.689  -6.285 1.00 . A A .  30 ILE HD11 1 1 
       14  8438 1 1 30 ILE HD12 H    5.833  -4.619  -6.288 1.00 . A A .  30 ILE HD12 1 1 
       14  8439 1 1 30 ILE HD13 H    4.687  -4.797  -4.959 1.00 . A A .  30 ILE HD13 1 1 
       14  8440 1 1 30 ILE HG12 H    6.873  -3.089  -5.080 1.00 . A A .  30 ILE HG12 1 1 
       14  8441 1 1 30 ILE HG13 H    5.599  -3.108  -3.865 1.00 . A A .  30 ILE HG13 1 1 
       14  8442 1 1 30 ILE HG21 H    5.890  -0.125  -6.827 1.00 . A A .  30 ILE HG21 1 1 
       14  8443 1 1 30 ILE HG22 H    7.190  -1.245  -6.424 1.00 . A A .  30 ILE HG22 1 1 
       14  8444 1 1 30 ILE HG23 H    5.847  -1.780  -7.434 1.00 . A A .  30 ILE HG23 1 1 
       14  8445 1 1 30 ILE N    N    4.971  -1.036  -2.975 1.00 . A A .  30 ILE N    1 1 
       14  8446 1 1 30 ILE O    O    5.660   1.526  -5.374 1.00 . A A .  30 ILE O    1 1 
       14  8447 1 1 31 HIS C    C    3.396   3.377  -3.399 1.00 . A A .  31 HIS C    1 1 
       14  8448 1 1 31 HIS CA   C    3.161   2.344  -4.497 1.00 . A A .  31 HIS CA   1 1 
       14  8449 1 1 31 HIS CB   C    1.661   2.131  -4.701 1.00 . A A .  31 HIS CB   1 1 
       14  8450 1 1 31 HIS CD2  C    0.228   4.202  -4.077 1.00 . A A .  31 HIS CD2  1 1 
       14  8451 1 1 31 HIS CE1  C    0.055   5.086  -6.075 1.00 . A A .  31 HIS CE1  1 1 
       14  8452 1 1 31 HIS CG   C    0.902   3.401  -4.935 1.00 . A A .  31 HIS CG   1 1 
       14  8453 1 1 31 HIS H    H    3.350   0.441  -3.588 1.00 . A A .  31 HIS H    1 1 
       14  8454 1 1 31 HIS HA   H    3.592   2.710  -5.416 1.00 . A A .  31 HIS HA   1 1 
       14  8455 1 1 31 HIS HB2  H    1.508   1.491  -5.557 1.00 . A A .  31 HIS HB2  1 1 
       14  8456 1 1 31 HIS HB3  H    1.249   1.655  -3.823 1.00 . A A .  31 HIS HB3  1 1 
       14  8457 1 1 31 HIS HD1  H    1.154   3.638  -7.014 1.00 . A A .  31 HIS HD1  1 1 
       14  8458 1 1 31 HIS HD2  H    0.118   4.051  -3.012 1.00 . A A .  31 HIS HD2  1 1 
       14  8459 1 1 31 HIS HE1  H   -0.207   5.748  -6.887 1.00 . A A .  31 HIS HE1  1 1 
       14  8460 1 1 31 HIS N    N    3.812   1.080  -4.169 1.00 . A A .  31 HIS N    1 1 
       14  8461 1 1 31 HIS ND1  N    0.774   3.982  -6.179 1.00 . A A .  31 HIS ND1  1 1 
       14  8462 1 1 31 HIS NE2  N   -0.289   5.241  -4.810 1.00 . A A .  31 HIS NE2  1 1 
       14  8463 1 1 31 HIS O    O    3.331   4.581  -3.642 1.00 . A A .  31 HIS O    1 1 
       14  8464 1 1 32 MET C    C    5.374   4.213  -1.009 1.00 . A A .  32 MET C    1 1 
       14  8465 1 1 32 MET CA   C    3.912   3.779  -1.054 1.00 . A A .  32 MET CA   1 1 
       14  8466 1 1 32 MET CB   C    3.535   3.080   0.253 1.00 . A A .  32 MET CB   1 1 
       14  8467 1 1 32 MET CE   C    1.287   5.154   1.769 1.00 . A A .  32 MET CE   1 1 
       14  8468 1 1 32 MET CG   C    2.039   2.857   0.413 1.00 . A A .  32 MET CG   1 1 
       14  8469 1 1 32 MET H    H    3.706   1.926  -2.057 1.00 . A A .  32 MET H    1 1 
       14  8470 1 1 32 MET HA   H    3.293   4.654  -1.176 1.00 . A A .  32 MET HA   1 1 
       14  8471 1 1 32 MET HB2  H    4.026   2.119   0.288 1.00 . A A .  32 MET HB2  1 1 
       14  8472 1 1 32 MET HB3  H    3.877   3.681   1.081 1.00 . A A .  32 MET HB3  1 1 
       14  8473 1 1 32 MET HE1  H    0.512   4.812   2.440 1.00 . A A .  32 MET HE1  1 1 
       14  8474 1 1 32 MET HE2  H    2.254   4.898   2.176 1.00 . A A .  32 MET HE2  1 1 
       14  8475 1 1 32 MET HE3  H    1.216   6.225   1.654 1.00 . A A .  32 MET HE3  1 1 
       14  8476 1 1 32 MET HG2  H    1.718   2.126  -0.313 1.00 . A A .  32 MET HG2  1 1 
       14  8477 1 1 32 MET HG3  H    1.850   2.481   1.407 1.00 . A A .  32 MET HG3  1 1 
       14  8478 1 1 32 MET N    N    3.668   2.897  -2.190 1.00 . A A .  32 MET N    1 1 
       14  8479 1 1 32 MET O    O    5.750   5.077  -0.216 1.00 . A A .  32 MET O    1 1 
       14  8480 1 1 32 MET SD   S    1.083   4.367   0.173 1.00 . A A .  32 MET SD   1 1 
       14  8481 1 1 33 ARG C    C    7.846   5.230  -2.686 1.00 . A A .  33 ARG C    1 1 
       14  8482 1 1 33 ARG CA   C    7.614   3.932  -1.918 1.00 . A A .  33 ARG CA   1 1 
       14  8483 1 1 33 ARG CB   C    8.394   2.792  -2.575 1.00 . A A .  33 ARG CB   1 1 
       14  8484 1 1 33 ARG CD   C    8.456   1.227  -4.541 1.00 . A A .  33 ARG CD   1 1 
       14  8485 1 1 33 ARG CG   C    8.093   2.622  -4.055 1.00 . A A .  33 ARG CG   1 1 
       14  8486 1 1 33 ARG CZ   C   10.534   0.032  -5.087 1.00 . A A .  33 ARG CZ   1 1 
       14  8487 1 1 33 ARG H    H    5.834   2.928  -2.470 1.00 . A A .  33 ARG H    1 1 
       14  8488 1 1 33 ARG HA   H    7.965   4.059  -0.905 1.00 . A A .  33 ARG HA   1 1 
       14  8489 1 1 33 ARG HB2  H    9.451   2.983  -2.464 1.00 . A A .  33 ARG HB2  1 1 
       14  8490 1 1 33 ARG HB3  H    8.149   1.868  -2.072 1.00 . A A .  33 ARG HB3  1 1 
       14  8491 1 1 33 ARG HD2  H    8.339   0.534  -3.721 1.00 . A A .  33 ARG HD2  1 1 
       14  8492 1 1 33 ARG HD3  H    7.785   0.954  -5.341 1.00 . A A .  33 ARG HD3  1 1 
       14  8493 1 1 33 ARG HE   H   10.248   1.992  -5.328 1.00 . A A .  33 ARG HE   1 1 
       14  8494 1 1 33 ARG HG2  H    7.038   2.786  -4.220 1.00 . A A .  33 ARG HG2  1 1 
       14  8495 1 1 33 ARG HG3  H    8.664   3.348  -4.614 1.00 . A A .  33 ARG HG3  1 1 
       14  8496 1 1 33 ARG HH11 H    9.055  -1.128  -4.345 1.00 . A A .  33 ARG HH11 1 1 
       14  8497 1 1 33 ARG HH12 H   10.525  -1.958  -4.734 1.00 . A A .  33 ARG HH12 1 1 
       14  8498 1 1 33 ARG HH21 H   12.189   0.910  -5.844 1.00 . A A .  33 ARG HH21 1 1 
       14  8499 1 1 33 ARG HH22 H   12.308  -0.797  -5.586 1.00 . A A .  33 ARG HH22 1 1 
       14  8500 1 1 33 ARG N    N    6.193   3.609  -1.863 1.00 . A A .  33 ARG N    1 1 
       14  8501 1 1 33 ARG NE   N    9.830   1.158  -5.029 1.00 . A A .  33 ARG NE   1 1 
       14  8502 1 1 33 ARG NH1  N    9.994  -1.112  -4.689 1.00 . A A .  33 ARG NH1  1 1 
       14  8503 1 1 33 ARG NH2  N   11.779   0.050  -5.543 1.00 . A A .  33 ARG NH2  1 1 
       14  8504 1 1 33 ARG O    O    8.895   5.862  -2.556 1.00 . A A .  33 ARG O    1 1 
       14  8505 1 1 34 THR C    C    6.316   8.020  -3.553 1.00 . A A .  34 THR C    1 1 
       14  8506 1 1 34 THR CA   C    6.958   6.843  -4.278 1.00 . A A .  34 THR CA   1 1 
       14  8507 1 1 34 THR CB   C    6.289   6.675  -5.655 1.00 . A A .  34 THR CB   1 1 
       14  8508 1 1 34 THR CG2  C    4.868   6.151  -5.506 1.00 . A A .  34 THR CG2  1 1 
       14  8509 1 1 34 THR H    H    6.050   5.075  -3.549 1.00 . A A .  34 THR H    1 1 
       14  8510 1 1 34 THR HA   H    8.006   7.056  -4.434 1.00 . A A .  34 THR HA   1 1 
       14  8511 1 1 34 THR HB   H    6.861   5.963  -6.232 1.00 . A A .  34 THR HB   1 1 
       14  8512 1 1 34 THR HG1  H    6.437   7.783  -7.280 1.00 . A A .  34 THR HG1  1 1 
       14  8513 1 1 34 THR HG21 H    4.323   6.780  -4.818 1.00 . A A .  34 THR HG21 1 1 
       14  8514 1 1 34 THR HG22 H    4.896   5.141  -5.124 1.00 . A A .  34 THR HG22 1 1 
       14  8515 1 1 34 THR HG23 H    4.379   6.160  -6.468 1.00 . A A .  34 THR HG23 1 1 
       14  8516 1 1 34 THR N    N    6.861   5.622  -3.488 1.00 . A A .  34 THR N    1 1 
       14  8517 1 1 34 THR O    O    6.808   9.147  -3.620 1.00 . A A .  34 THR O    1 1 
       14  8518 1 1 34 THR OG1  O    6.270   7.929  -6.346 1.00 . A A .  34 THR OG1  1 1 
       14  8519 1 1 35 HIS C    C    5.426   9.455  -1.099 1.00 . A A .  35 HIS C    1 1 
       14  8520 1 1 35 HIS CA   C    4.506   8.790  -2.119 1.00 . A A .  35 HIS CA   1 1 
       14  8521 1 1 35 HIS CB   C    3.285   8.199  -1.413 1.00 . A A .  35 HIS CB   1 1 
       14  8522 1 1 35 HIS CD2  C    1.134   7.265  -2.521 1.00 . A A .  35 HIS CD2  1 1 
       14  8523 1 1 35 HIS CE1  C    0.484   9.089  -3.548 1.00 . A A .  35 HIS CE1  1 1 
       14  8524 1 1 35 HIS CG   C    2.039   8.232  -2.243 1.00 . A A .  35 HIS CG   1 1 
       14  8525 1 1 35 HIS H    H    4.872   6.834  -2.842 1.00 . A A .  35 HIS H    1 1 
       14  8526 1 1 35 HIS HA   H    4.176   9.535  -2.827 1.00 . A A .  35 HIS HA   1 1 
       14  8527 1 1 35 HIS HB2  H    3.487   7.169  -1.160 1.00 . A A .  35 HIS HB2  1 1 
       14  8528 1 1 35 HIS HB3  H    3.096   8.757  -0.507 1.00 . A A .  35 HIS HB3  1 1 
       14  8529 1 1 35 HIS HD1  H    2.048  10.235  -2.896 1.00 . A A .  35 HIS HD1  1 1 
       14  8530 1 1 35 HIS HD2  H    1.159   6.243  -2.169 1.00 . A A .  35 HIS HD2  1 1 
       14  8531 1 1 35 HIS HE1  H   -0.084   9.782  -4.150 1.00 . A A .  35 HIS HE1  1 1 
       14  8532 1 1 35 HIS N    N    5.215   7.752  -2.858 1.00 . A A .  35 HIS N    1 1 
       14  8533 1 1 35 HIS ND1  N    1.604   9.362  -2.903 1.00 . A A .  35 HIS ND1  1 1 
       14  8534 1 1 35 HIS NE2  N    0.178   7.822  -3.334 1.00 . A A .  35 HIS NE2  1 1 
       14  8535 1 1 35 HIS O    O    5.462   9.062   0.067 1.00 . A A .  35 HIS O    1 1 
       14  8536 1 1 36 SER C    C    6.331  11.969   0.388 1.00 . A A .  36 SER C    1 1 
       14  8537 1 1 36 SER CA   C    7.090  11.179  -0.674 1.00 . A A .  36 SER CA   1 1 
       14  8538 1 1 36 SER CB   C    7.973  12.122  -1.494 1.00 . A A .  36 SER CB   1 1 
       14  8539 1 1 36 SER H    H    6.093  10.729  -2.487 1.00 . A A .  36 SER H    1 1 
       14  8540 1 1 36 SER HA   H    7.717  10.449  -0.184 1.00 . A A .  36 SER HA   1 1 
       14  8541 1 1 36 SER HB2  H    7.353  12.866  -1.972 1.00 . A A .  36 SER HB2  1 1 
       14  8542 1 1 36 SER HB3  H    8.681  12.609  -0.839 1.00 . A A .  36 SER HB3  1 1 
       14  8543 1 1 36 SER HG   H    9.108  12.037  -3.088 1.00 . A A .  36 SER HG   1 1 
       14  8544 1 1 36 SER N    N    6.167  10.463  -1.547 1.00 . A A .  36 SER N    1 1 
       14  8545 1 1 36 SER O    O    5.442  12.759   0.073 1.00 . A A .  36 SER O    1 1 
       14  8546 1 1 36 SER OG   O    8.686  11.413  -2.493 1.00 . A A .  36 SER OG   1 1 
       14  8547 1 1 37 GLY C    C    6.210  11.742   4.069 1.00 . A A .  37 GLY C    1 1 
       14  8548 1 1 37 GLY CA   C    6.034  12.448   2.739 1.00 . A A .  37 GLY CA   1 1 
       14  8549 1 1 37 GLY H    H    7.406  11.108   1.841 1.00 . A A .  37 GLY H    1 1 
       14  8550 1 1 37 GLY HA2  H    6.446  13.443   2.814 1.00 . A A .  37 GLY HA2  1 1 
       14  8551 1 1 37 GLY HA3  H    4.979  12.521   2.521 1.00 . A A .  37 GLY HA3  1 1 
       14  8552 1 1 37 GLY N    N    6.690  11.750   1.649 1.00 . A A .  37 GLY N    1 1 
       14  8553 1 1 37 GLY O    O    5.237  11.490   4.779 1.00 . A A .  37 GLY O    1 1 
       14  8554 1 1 38 GLU C    C    7.391  11.610   6.856 1.00 . A A .  38 GLU C    1 1 
       14  8555 1 1 38 GLU CA   C    7.754  10.736   5.659 1.00 . A A .  38 GLU CA   1 1 
       14  8556 1 1 38 GLU CB   C    9.236  10.360   5.719 1.00 . A A .  38 GLU CB   1 1 
       14  8557 1 1 38 GLU CD   C   11.059   8.813   4.904 1.00 . A A .  38 GLU CD   1 1 
       14  8558 1 1 38 GLU CG   C    9.638   9.304   4.704 1.00 . A A .  38 GLU CG   1 1 
       14  8559 1 1 38 GLU H    H    8.189  11.647   3.798 1.00 . A A .  38 GLU H    1 1 
       14  8560 1 1 38 GLU HA   H    7.162   9.834   5.694 1.00 . A A .  38 GLU HA   1 1 
       14  8561 1 1 38 GLU HB2  H    9.828  11.246   5.541 1.00 . A A .  38 GLU HB2  1 1 
       14  8562 1 1 38 GLU HB3  H    9.459   9.983   6.707 1.00 . A A .  38 GLU HB3  1 1 
       14  8563 1 1 38 GLU HG2  H    8.967   8.462   4.793 1.00 . A A .  38 GLU HG2  1 1 
       14  8564 1 1 38 GLU HG3  H    9.554   9.725   3.713 1.00 . A A .  38 GLU HG3  1 1 
       14  8565 1 1 38 GLU N    N    7.455  11.420   4.406 1.00 . A A .  38 GLU N    1 1 
       14  8566 1 1 38 GLU O    O    7.920  12.709   7.020 1.00 . A A .  38 GLU O    1 1 
       14  8567 1 1 38 GLU OE1  O   11.970   9.660   5.013 1.00 . A A .  38 GLU OE1  1 1 
       14  8568 1 1 38 GLU OE2  O   11.259   7.581   4.950 1.00 . A A .  38 GLU OE2  1 1 
       14  8569 1 1 39 LYS C    C    5.194  10.962   9.777 1.00 . A A .  39 LYS C    1 1 
       14  8570 1 1 39 LYS CA   C    6.047  11.846   8.872 1.00 . A A .  39 LYS CA   1 1 
       14  8571 1 1 39 LYS CB   C    5.256  13.090   8.464 1.00 . A A .  39 LYS CB   1 1 
       14  8572 1 1 39 LYS CD   C    3.019  13.978   7.742 1.00 . A A .  39 LYS CD   1 1 
       14  8573 1 1 39 LYS CE   C    3.268  14.857   6.526 1.00 . A A .  39 LYS CE   1 1 
       14  8574 1 1 39 LYS CG   C    3.948  12.775   7.759 1.00 . A A .  39 LYS CG   1 1 
       14  8575 1 1 39 LYS H    H    6.097  10.231   7.505 1.00 . A A .  39 LYS H    1 1 
       14  8576 1 1 39 LYS HA   H    6.928  12.153   9.416 1.00 . A A .  39 LYS HA   1 1 
       14  8577 1 1 39 LYS HB2  H    5.034  13.668   9.349 1.00 . A A .  39 LYS HB2  1 1 
       14  8578 1 1 39 LYS HB3  H    5.864  13.687   7.798 1.00 . A A .  39 LYS HB3  1 1 
       14  8579 1 1 39 LYS HD2  H    1.996  13.632   7.719 1.00 . A A .  39 LYS HD2  1 1 
       14  8580 1 1 39 LYS HD3  H    3.184  14.561   8.637 1.00 . A A .  39 LYS HD3  1 1 
       14  8581 1 1 39 LYS HE2  H    3.611  14.235   5.713 1.00 . A A .  39 LYS HE2  1 1 
       14  8582 1 1 39 LYS HE3  H    2.341  15.335   6.248 1.00 . A A .  39 LYS HE3  1 1 
       14  8583 1 1 39 LYS HG2  H    4.158  12.482   6.741 1.00 . A A .  39 LYS HG2  1 1 
       14  8584 1 1 39 LYS HG3  H    3.458  11.961   8.276 1.00 . A A .  39 LYS HG3  1 1 
       14  8585 1 1 39 LYS HZ1  H    4.977  15.560   7.502 1.00 . A A .  39 LYS HZ1  1 1 
       14  8586 1 1 39 LYS HZ2  H    3.833  16.762   7.168 1.00 . A A .  39 LYS HZ2  1 1 
       14  8587 1 1 39 LYS HZ3  H    4.799  16.145   5.924 1.00 . A A .  39 LYS HZ3  1 1 
       14  8588 1 1 39 LYS N    N    6.483  11.113   7.689 1.00 . A A .  39 LYS N    1 1 
       14  8589 1 1 39 LYS NZ   N    4.291  15.904   6.799 1.00 . A A .  39 LYS NZ   1 1 
       14  8590 1 1 39 LYS O    O    4.416  10.128   9.314 1.00 . A A .  39 LYS O    1 1 
       14  8591 1 1 40 PRO C    C    3.110  10.738  12.109 1.00 . A A .  40 PRO C    1 1 
       14  8592 1 1 40 PRO CA   C    4.591  10.378  12.093 1.00 . A A .  40 PRO CA   1 1 
       14  8593 1 1 40 PRO CB   C    5.251  10.772  13.417 1.00 . A A .  40 PRO CB   1 1 
       14  8594 1 1 40 PRO CD   C    6.252  12.124  11.719 1.00 . A A .  40 PRO CD   1 1 
       14  8595 1 1 40 PRO CG   C    5.834  12.119  13.163 1.00 . A A .  40 PRO CG   1 1 
       14  8596 1 1 40 PRO HA   H    4.700   9.315  11.937 1.00 . A A .  40 PRO HA   1 1 
       14  8597 1 1 40 PRO HB2  H    4.505  10.804  14.198 1.00 . A A .  40 PRO HB2  1 1 
       14  8598 1 1 40 PRO HB3  H    6.016  10.053  13.670 1.00 . A A .  40 PRO HB3  1 1 
       14  8599 1 1 40 PRO HD2  H    6.115  13.106  11.290 1.00 . A A .  40 PRO HD2  1 1 
       14  8600 1 1 40 PRO HD3  H    7.280  11.808  11.622 1.00 . A A .  40 PRO HD3  1 1 
       14  8601 1 1 40 PRO HG2  H    5.090  12.881  13.341 1.00 . A A .  40 PRO HG2  1 1 
       14  8602 1 1 40 PRO HG3  H    6.692  12.274  13.801 1.00 . A A .  40 PRO HG3  1 1 
       14  8603 1 1 40 PRO N    N    5.342  11.148  11.097 1.00 . A A .  40 PRO N    1 1 
       14  8604 1 1 40 PRO O    O    2.730  11.827  12.540 1.00 . A A .  40 PRO O    1 1 
       14  8605 1 1 41 SER C    C    0.150   9.396  12.793 1.00 . A A .  41 SER C    1 1 
       14  8606 1 1 41 SER CA   C    0.836  10.040  11.592 1.00 . A A .  41 SER CA   1 1 
       14  8607 1 1 41 SER CB   C    0.251   9.478  10.295 1.00 . A A .  41 SER CB   1 1 
       14  8608 1 1 41 SER H    H    2.640   8.969  11.305 1.00 . A A .  41 SER H    1 1 
       14  8609 1 1 41 SER HA   H    0.664  11.105  11.623 1.00 . A A .  41 SER HA   1 1 
       14  8610 1 1 41 SER HB2  H   -0.810   9.674  10.267 1.00 . A A .  41 SER HB2  1 1 
       14  8611 1 1 41 SER HB3  H    0.727   9.957   9.451 1.00 . A A .  41 SER HB3  1 1 
       14  8612 1 1 41 SER HG   H    1.209   7.831  10.751 1.00 . A A .  41 SER HG   1 1 
       14  8613 1 1 41 SER N    N    2.276   9.817  11.635 1.00 . A A .  41 SER N    1 1 
       14  8614 1 1 41 SER O    O   -0.289   8.248  12.730 1.00 . A A .  41 SER O    1 1 
       14  8615 1 1 41 SER OG   O    0.459   8.079  10.205 1.00 . A A .  41 SER OG   1 1 
       14  8616 1 1 42 GLY C    C    0.435   9.105  16.095 1.00 . A A .  42 GLY C    1 1 
       14  8617 1 1 42 GLY CA   C   -0.570   9.631  15.089 1.00 . A A .  42 GLY CA   1 1 
       14  8618 1 1 42 GLY H    H    0.431  11.053  13.881 1.00 . A A .  42 GLY H    1 1 
       14  8619 1 1 42 GLY HA2  H   -1.142  10.423  15.549 1.00 . A A .  42 GLY HA2  1 1 
       14  8620 1 1 42 GLY HA3  H   -1.240   8.829  14.815 1.00 . A A .  42 GLY HA3  1 1 
       14  8621 1 1 42 GLY N    N    0.062  10.144  13.889 1.00 . A A .  42 GLY N    1 1 
       14  8622 1 1 42 GLY O    O    1.600   8.870  15.775 1.00 . A A .  42 GLY O    1 1 
       14  8623 1 1 43 PRO C    C    1.215   6.946  18.232 1.00 . A A .  43 PRO C    1 1 
       14  8624 1 1 43 PRO CA   C    0.837   8.411  18.425 1.00 . A A .  43 PRO CA   1 1 
       14  8625 1 1 43 PRO CB   C   -0.035   8.578  19.671 1.00 . A A .  43 PRO CB   1 1 
       14  8626 1 1 43 PRO CD   C   -1.393   9.172  17.796 1.00 . A A .  43 PRO CD   1 1 
       14  8627 1 1 43 PRO CG   C   -1.435   8.545  19.162 1.00 . A A .  43 PRO CG   1 1 
       14  8628 1 1 43 PRO HA   H    1.735   9.003  18.529 1.00 . A A .  43 PRO HA   1 1 
       14  8629 1 1 43 PRO HB2  H    0.155   7.766  20.359 1.00 . A A .  43 PRO HB2  1 1 
       14  8630 1 1 43 PRO HB3  H    0.188   9.521  20.148 1.00 . A A .  43 PRO HB3  1 1 
       14  8631 1 1 43 PRO HD2  H   -2.110   8.698  17.141 1.00 . A A .  43 PRO HD2  1 1 
       14  8632 1 1 43 PRO HD3  H   -1.584  10.233  17.862 1.00 . A A .  43 PRO HD3  1 1 
       14  8633 1 1 43 PRO HG2  H   -1.777   7.523  19.095 1.00 . A A .  43 PRO HG2  1 1 
       14  8634 1 1 43 PRO HG3  H   -2.077   9.115  19.816 1.00 . A A .  43 PRO HG3  1 1 
       14  8635 1 1 43 PRO N    N   -0.016   8.913  17.343 1.00 . A A .  43 PRO N    1 1 
       14  8636 1 1 43 PRO O    O    1.920   6.364  19.055 1.00 . A A .  43 PRO O    1 1 
       14  8637 1 1 44 SER C    C    2.430   4.579  17.305 1.00 . A A .  44 SER C    1 1 
       14  8638 1 1 44 SER CA   C    1.028   4.959  16.839 1.00 . A A .  44 SER CA   1 1 
       14  8639 1 1 44 SER CB   C    0.888   4.697  15.338 1.00 . A A .  44 SER CB   1 1 
       14  8640 1 1 44 SER H    H    0.185   6.874  16.520 1.00 . A A .  44 SER H    1 1 
       14  8641 1 1 44 SER HA   H    0.309   4.352  17.370 1.00 . A A .  44 SER HA   1 1 
       14  8642 1 1 44 SER HB2  H    0.138   5.357  14.929 1.00 . A A .  44 SER HB2  1 1 
       14  8643 1 1 44 SER HB3  H    1.836   4.885  14.854 1.00 . A A .  44 SER HB3  1 1 
       14  8644 1 1 44 SER HG   H   -0.375   3.204  15.442 1.00 . A A .  44 SER HG   1 1 
       14  8645 1 1 44 SER N    N    0.742   6.357  17.138 1.00 . A A .  44 SER N    1 1 
       14  8646 1 1 44 SER O    O    3.425   4.966  16.692 1.00 . A A .  44 SER O    1 1 
       14  8647 1 1 44 SER OG   O    0.504   3.357  15.087 1.00 . A A .  44 SER OG   1 1 
       14  8648 1 1 45 SER C    C    3.574   2.423  20.106 1.00 . A A .  45 SER C    1 1 
       14  8649 1 1 45 SER CA   C    3.780   3.390  18.945 1.00 . A A .  45 SER CA   1 1 
       14  8650 1 1 45 SER CB   C    4.590   4.601  19.412 1.00 . A A .  45 SER CB   1 1 
       14  8651 1 1 45 SER H    H    1.671   3.543  18.837 1.00 . A A .  45 SER H    1 1 
       14  8652 1 1 45 SER HA   H    4.325   2.884  18.162 1.00 . A A .  45 SER HA   1 1 
       14  8653 1 1 45 SER HB2  H    5.506   4.263  19.871 1.00 . A A .  45 SER HB2  1 1 
       14  8654 1 1 45 SER HB3  H    4.822   5.225  18.562 1.00 . A A .  45 SER HB3  1 1 
       14  8655 1 1 45 SER HG   H    4.066   5.061  21.243 1.00 . A A .  45 SER HG   1 1 
       14  8656 1 1 45 SER N    N    2.500   3.819  18.393 1.00 . A A .  45 SER N    1 1 
       14  8657 1 1 45 SER O    O    2.449   2.198  20.549 1.00 . A A .  45 SER O    1 1 
       14  8658 1 1 45 SER OG   O    3.862   5.367  20.356 1.00 . A A .  45 SER OG   1 1 
       14  8659 1 1 46 GLY C    C    4.867  -0.512  21.272 1.00 . A A .  46 GLY C    1 1 
       14  8660 1 1 46 GLY CA   C    4.591   0.915  21.700 1.00 . A A .  46 GLY CA   1 1 
       14  8661 1 1 46 GLY H    H    5.542   2.070  20.202 1.00 . A A .  46 GLY H    1 1 
       14  8662 1 1 46 GLY HA2  H    5.311   1.200  22.453 1.00 . A A .  46 GLY HA2  1 1 
       14  8663 1 1 46 GLY HA3  H    3.600   0.965  22.128 1.00 . A A .  46 GLY HA3  1 1 
       14  8664 1 1 46 GLY N    N    4.671   1.852  20.595 1.00 . A A .  46 GLY N    1 1 
       14  8665 1 1 46 GLY O    O    4.740  -0.817  20.087 1.00 . A A .  46 GLY O    1 1 
       14  8666 2 2  1 ZN  ZN   ZN  -1.293   6.509  -3.597 1.00 . B A . 201 ZN  ZN   1 1 
       15  8667 1 1  1 GLY C    C  -25.777   0.663   8.325 1.00 . A A .   1 GLY C    1 1 
       15  8668 1 1  1 GLY CA   C  -26.289   2.051   8.653 1.00 . A A .   1 GLY CA   1 1 
       15  8669 1 1  1 GLY H1   H  -28.192   1.549   7.872 1.00 . A A .   1 GLY H1   1 1 
       15  8670 1 1  1 GLY HA2  H  -25.792   2.768   8.017 1.00 . A A .   1 GLY HA2  1 1 
       15  8671 1 1  1 GLY HA3  H  -26.053   2.275   9.683 1.00 . A A .   1 GLY HA3  1 1 
       15  8672 1 1  1 GLY N    N  -27.723   2.173   8.465 1.00 . A A .   1 GLY N    1 1 
       15  8673 1 1  1 GLY O    O  -26.214   0.047   7.352 1.00 . A A .   1 GLY O    1 1 
       15  8674 1 1  2 SER C    C  -24.945  -2.189   9.817 1.00 . A A .   2 SER C    1 1 
       15  8675 1 1  2 SER CA   C  -24.271  -1.153   8.924 1.00 . A A .   2 SER CA   1 1 
       15  8676 1 1  2 SER CB   C  -22.766  -1.127   9.200 1.00 . A A .   2 SER CB   1 1 
       15  8677 1 1  2 SER H    H  -24.540   0.710   9.895 1.00 . A A .   2 SER H    1 1 
       15  8678 1 1  2 SER HA   H  -24.434  -1.423   7.891 1.00 . A A .   2 SER HA   1 1 
       15  8679 1 1  2 SER HB2  H  -22.553  -0.380   9.949 1.00 . A A .   2 SER HB2  1 1 
       15  8680 1 1  2 SER HB3  H  -22.452  -2.096   9.558 1.00 . A A .   2 SER HB3  1 1 
       15  8681 1 1  2 SER HG   H  -22.253   0.076   7.741 1.00 . A A .   2 SER HG   1 1 
       15  8682 1 1  2 SER N    N  -24.847   0.170   9.136 1.00 . A A .   2 SER N    1 1 
       15  8683 1 1  2 SER O    O  -25.258  -1.917  10.976 1.00 . A A .   2 SER O    1 1 
       15  8684 1 1  2 SER OG   O  -22.037  -0.815   8.025 1.00 . A A .   2 SER OG   1 1 
       15  8685 1 1  3 SER C    C  -24.856  -5.637  10.187 1.00 . A A .   3 SER C    1 1 
       15  8686 1 1  3 SER CA   C  -25.807  -4.457  10.012 1.00 . A A .   3 SER CA   1 1 
       15  8687 1 1  3 SER CB   C  -27.079  -4.915   9.296 1.00 . A A .   3 SER CB   1 1 
       15  8688 1 1  3 SER H    H  -24.894  -3.536   8.339 1.00 . A A .   3 SER H    1 1 
       15  8689 1 1  3 SER HA   H  -26.071  -4.075  10.987 1.00 . A A .   3 SER HA   1 1 
       15  8690 1 1  3 SER HB2  H  -26.815  -5.368   8.353 1.00 . A A .   3 SER HB2  1 1 
       15  8691 1 1  3 SER HB3  H  -27.596  -5.638   9.911 1.00 . A A .   3 SER HB3  1 1 
       15  8692 1 1  3 SER HG   H  -28.833  -4.042   9.348 1.00 . A A .   3 SER HG   1 1 
       15  8693 1 1  3 SER N    N  -25.167  -3.380   9.268 1.00 . A A .   3 SER N    1 1 
       15  8694 1 1  3 SER O    O  -24.640  -6.115  11.300 1.00 . A A .   3 SER O    1 1 
       15  8695 1 1  3 SER OG   O  -27.947  -3.821   9.050 1.00 . A A .   3 SER OG   1 1 
       15  8696 1 1  4 GLY C    C  -22.213  -7.066   8.161 1.00 . A A .   4 GLY C    1 1 
       15  8697 1 1  4 GLY CA   C  -23.370  -7.223   9.128 1.00 . A A .   4 GLY CA   1 1 
       15  8698 1 1  4 GLY H    H  -24.501  -5.682   8.217 1.00 . A A .   4 GLY H    1 1 
       15  8699 1 1  4 GLY HA2  H  -22.979  -7.309  10.131 1.00 . A A .   4 GLY HA2  1 1 
       15  8700 1 1  4 GLY HA3  H  -23.907  -8.128   8.883 1.00 . A A .   4 GLY HA3  1 1 
       15  8701 1 1  4 GLY N    N  -24.291  -6.103   9.077 1.00 . A A .   4 GLY N    1 1 
       15  8702 1 1  4 GLY O    O  -21.440  -6.113   8.256 1.00 . A A .   4 GLY O    1 1 
       15  8703 1 1  5 SER C    C  -21.573  -7.770   4.838 1.00 . A A .   5 SER C    1 1 
       15  8704 1 1  5 SER CA   C  -21.016  -7.971   6.244 1.00 . A A .   5 SER CA   1 1 
       15  8705 1 1  5 SER CB   C  -20.201  -9.264   6.301 1.00 . A A .   5 SER CB   1 1 
       15  8706 1 1  5 SER H    H  -22.738  -8.742   7.205 1.00 . A A .   5 SER H    1 1 
       15  8707 1 1  5 SER HA   H  -20.372  -7.138   6.486 1.00 . A A .   5 SER HA   1 1 
       15  8708 1 1  5 SER HB2  H  -19.707  -9.333   7.259 1.00 . A A .   5 SER HB2  1 1 
       15  8709 1 1  5 SER HB3  H  -20.862 -10.109   6.176 1.00 . A A .   5 SER HB3  1 1 
       15  8710 1 1  5 SER HG   H  -19.634  -9.539   4.446 1.00 . A A .   5 SER HG   1 1 
       15  8711 1 1  5 SER N    N  -22.091  -8.006   7.229 1.00 . A A .   5 SER N    1 1 
       15  8712 1 1  5 SER O    O  -22.268  -8.634   4.305 1.00 . A A .   5 SER O    1 1 
       15  8713 1 1  5 SER OG   O  -19.221  -9.295   5.278 1.00 . A A .   5 SER OG   1 1 
       15  8714 1 1  6 SER C    C  -20.875  -6.991   1.846 1.00 . A A .   6 SER C    1 1 
       15  8715 1 1  6 SER CA   C  -21.735  -6.304   2.902 1.00 . A A .   6 SER CA   1 1 
       15  8716 1 1  6 SER CB   C  -21.724  -4.790   2.679 1.00 . A A .   6 SER CB   1 1 
       15  8717 1 1  6 SER H    H  -20.705  -5.972   4.721 1.00 . A A .   6 SER H    1 1 
       15  8718 1 1  6 SER HA   H  -22.749  -6.664   2.813 1.00 . A A .   6 SER HA   1 1 
       15  8719 1 1  6 SER HB2  H  -22.385  -4.319   3.391 1.00 . A A .   6 SER HB2  1 1 
       15  8720 1 1  6 SER HB3  H  -20.719  -4.417   2.819 1.00 . A A .   6 SER HB3  1 1 
       15  8721 1 1  6 SER HG   H  -22.245  -3.511   1.290 1.00 . A A .   6 SER HG   1 1 
       15  8722 1 1  6 SER N    N  -21.263  -6.622   4.244 1.00 . A A .   6 SER N    1 1 
       15  8723 1 1  6 SER O    O  -21.384  -7.704   0.982 1.00 . A A .   6 SER O    1 1 
       15  8724 1 1  6 SER OG   O  -22.155  -4.464   1.370 1.00 . A A .   6 SER OG   1 1 
       15  8725 1 1  7 GLY C    C  -18.159  -8.734   1.421 1.00 . A A .   7 GLY C    1 1 
       15  8726 1 1  7 GLY CA   C  -18.654  -7.375   0.969 1.00 . A A .   7 GLY CA   1 1 
       15  8727 1 1  7 GLY H    H  -19.216  -6.193   2.633 1.00 . A A .   7 GLY H    1 1 
       15  8728 1 1  7 GLY HA2  H  -19.162  -7.485   0.022 1.00 . A A .   7 GLY HA2  1 1 
       15  8729 1 1  7 GLY HA3  H  -17.805  -6.721   0.836 1.00 . A A .   7 GLY HA3  1 1 
       15  8730 1 1  7 GLY N    N  -19.566  -6.770   1.923 1.00 . A A .   7 GLY N    1 1 
       15  8731 1 1  7 GLY O    O  -17.456  -8.843   2.425 1.00 . A A .   7 GLY O    1 1 
       15  8732 1 1  8 ALA C    C  -16.679 -11.160   1.523 1.00 . A A .   8 ALA C    1 1 
       15  8733 1 1  8 ALA CA   C  -18.114 -11.132   1.010 1.00 . A A .   8 ALA CA   1 1 
       15  8734 1 1  8 ALA CB   C  -18.261 -12.038  -0.204 1.00 . A A .   8 ALA CB   1 1 
       15  8735 1 1  8 ALA H    H  -19.088  -9.623  -0.109 1.00 . A A .   8 ALA H    1 1 
       15  8736 1 1  8 ALA HA   H  -18.771 -11.500   1.785 1.00 . A A .   8 ALA HA   1 1 
       15  8737 1 1  8 ALA HB1  H  -17.686 -11.636  -1.024 1.00 . A A .   8 ALA HB1  1 1 
       15  8738 1 1  8 ALA HB2  H  -17.899 -13.026   0.040 1.00 . A A .   8 ALA HB2  1 1 
       15  8739 1 1  8 ALA HB3  H  -19.301 -12.095  -0.487 1.00 . A A .   8 ALA HB3  1 1 
       15  8740 1 1  8 ALA N    N  -18.527  -9.773   0.680 1.00 . A A .   8 ALA N    1 1 
       15  8741 1 1  8 ALA O    O  -16.396 -11.735   2.574 1.00 . A A .   8 ALA O    1 1 
       15  8742 1 1  9 GLY C    C  -13.644  -9.304   0.604 1.00 . A A .   9 GLY C    1 1 
       15  8743 1 1  9 GLY CA   C  -14.379 -10.502   1.171 1.00 . A A .   9 GLY CA   1 1 
       15  8744 1 1  9 GLY H    H  -16.058 -10.094  -0.053 1.00 . A A .   9 GLY H    1 1 
       15  8745 1 1  9 GLY HA2  H  -14.322 -10.470   2.248 1.00 . A A .   9 GLY HA2  1 1 
       15  8746 1 1  9 GLY HA3  H  -13.896 -11.404   0.821 1.00 . A A .   9 GLY HA3  1 1 
       15  8747 1 1  9 GLY N    N  -15.775 -10.536   0.775 1.00 . A A .   9 GLY N    1 1 
       15  8748 1 1  9 GLY O    O  -13.608  -9.107  -0.610 1.00 . A A .   9 GLY O    1 1 
       15  8749 1 1 10 GLU C    C  -10.984  -7.217   1.791 1.00 . A A .  10 GLU C    1 1 
       15  8750 1 1 10 GLU CA   C  -12.324  -7.312   1.066 1.00 . A A .  10 GLU CA   1 1 
       15  8751 1 1 10 GLU CB   C  -13.150  -6.053   1.333 1.00 . A A .  10 GLU CB   1 1 
       15  8752 1 1 10 GLU CD   C  -12.095  -5.300   3.501 1.00 . A A .  10 GLU CD   1 1 
       15  8753 1 1 10 GLU CG   C  -13.362  -5.764   2.809 1.00 . A A .  10 GLU CG   1 1 
       15  8754 1 1 10 GLU H    H  -13.123  -8.709   2.441 1.00 . A A .  10 GLU H    1 1 
       15  8755 1 1 10 GLU HA   H  -12.140  -7.393   0.006 1.00 . A A .  10 GLU HA   1 1 
       15  8756 1 1 10 GLU HB2  H  -12.647  -5.206   0.890 1.00 . A A .  10 GLU HB2  1 1 
       15  8757 1 1 10 GLU HB3  H  -14.119  -6.168   0.868 1.00 . A A .  10 GLU HB3  1 1 
       15  8758 1 1 10 GLU HG2  H  -14.111  -4.993   2.909 1.00 . A A .  10 GLU HG2  1 1 
       15  8759 1 1 10 GLU HG3  H  -13.709  -6.666   3.293 1.00 . A A .  10 GLU HG3  1 1 
       15  8760 1 1 10 GLU N    N  -13.059  -8.499   1.486 1.00 . A A .  10 GLU N    1 1 
       15  8761 1 1 10 GLU O    O  -10.754  -7.901   2.788 1.00 . A A .  10 GLU O    1 1 
       15  8762 1 1 10 GLU OE1  O  -11.334  -4.525   2.885 1.00 . A A .  10 GLU OE1  1 1 
       15  8763 1 1 10 GLU OE2  O  -11.864  -5.712   4.656 1.00 . A A .  10 GLU OE2  1 1 
       15  8764 1 1 11 LYS C    C   -8.570  -4.720   2.278 1.00 . A A .  11 LYS C    1 1 
       15  8765 1 1 11 LYS CA   C   -8.785  -6.177   1.878 1.00 . A A .  11 LYS CA   1 1 
       15  8766 1 1 11 LYS CB   C   -7.692  -6.614   0.900 1.00 . A A .  11 LYS CB   1 1 
       15  8767 1 1 11 LYS CD   C   -8.618  -8.619  -0.297 1.00 . A A .  11 LYS CD   1 1 
       15  8768 1 1 11 LYS CE   C   -8.227  -8.227  -1.713 1.00 . A A .  11 LYS CE   1 1 
       15  8769 1 1 11 LYS CG   C   -7.605  -8.120   0.719 1.00 . A A .  11 LYS CG   1 1 
       15  8770 1 1 11 LYS H    H  -10.343  -5.846   0.484 1.00 . A A .  11 LYS H    1 1 
       15  8771 1 1 11 LYS HA   H   -8.731  -6.792   2.763 1.00 . A A .  11 LYS HA   1 1 
       15  8772 1 1 11 LYS HB2  H   -7.889  -6.168  -0.064 1.00 . A A .  11 LYS HB2  1 1 
       15  8773 1 1 11 LYS HB3  H   -6.738  -6.261   1.263 1.00 . A A .  11 LYS HB3  1 1 
       15  8774 1 1 11 LYS HD2  H   -8.675  -9.696  -0.236 1.00 . A A .  11 LYS HD2  1 1 
       15  8775 1 1 11 LYS HD3  H   -9.585  -8.192  -0.068 1.00 . A A .  11 LYS HD3  1 1 
       15  8776 1 1 11 LYS HE2  H   -8.418  -7.174  -1.847 1.00 . A A .  11 LYS HE2  1 1 
       15  8777 1 1 11 LYS HE3  H   -7.173  -8.421  -1.848 1.00 . A A .  11 LYS HE3  1 1 
       15  8778 1 1 11 LYS HG2  H   -6.613  -8.376   0.378 1.00 . A A .  11 LYS HG2  1 1 
       15  8779 1 1 11 LYS HG3  H   -7.795  -8.599   1.670 1.00 . A A .  11 LYS HG3  1 1 
       15  8780 1 1 11 LYS HZ1  H  -10.015  -8.912  -2.549 1.00 . A A .  11 LYS HZ1  1 1 
       15  8781 1 1 11 LYS HZ2  H   -8.727  -9.998  -2.701 1.00 . A A .  11 LYS HZ2  1 1 
       15  8782 1 1 11 LYS HZ3  H   -8.794  -8.623  -3.684 1.00 . A A .  11 LYS HZ3  1 1 
       15  8783 1 1 11 LYS N    N  -10.102  -6.364   1.281 1.00 . A A .  11 LYS N    1 1 
       15  8784 1 1 11 LYS NZ   N   -8.995  -8.994  -2.733 1.00 . A A .  11 LYS NZ   1 1 
       15  8785 1 1 11 LYS O    O   -9.017  -3.794   1.601 1.00 . A A .  11 LYS O    1 1 
       15  8786 1 1 12 PRO C    C   -6.584  -2.417   3.040 1.00 . A A .  12 PRO C    1 1 
       15  8787 1 1 12 PRO CA   C   -7.579  -3.170   3.916 1.00 . A A .  12 PRO CA   1 1 
       15  8788 1 1 12 PRO CB   C   -6.977  -3.441   5.297 1.00 . A A .  12 PRO CB   1 1 
       15  8789 1 1 12 PRO CD   C   -7.307  -5.569   4.259 1.00 . A A .  12 PRO CD   1 1 
       15  8790 1 1 12 PRO CG   C   -6.408  -4.815   5.199 1.00 . A A .  12 PRO CG   1 1 
       15  8791 1 1 12 PRO HA   H   -8.479  -2.582   4.023 1.00 . A A .  12 PRO HA   1 1 
       15  8792 1 1 12 PRO HB2  H   -6.210  -2.709   5.508 1.00 . A A .  12 PRO HB2  1 1 
       15  8793 1 1 12 PRO HB3  H   -7.750  -3.387   6.048 1.00 . A A .  12 PRO HB3  1 1 
       15  8794 1 1 12 PRO HD2  H   -6.736  -6.275   3.675 1.00 . A A .  12 PRO HD2  1 1 
       15  8795 1 1 12 PRO HD3  H   -8.088  -6.075   4.808 1.00 . A A .  12 PRO HD3  1 1 
       15  8796 1 1 12 PRO HG2  H   -5.405  -4.769   4.803 1.00 . A A .  12 PRO HG2  1 1 
       15  8797 1 1 12 PRO HG3  H   -6.408  -5.282   6.172 1.00 . A A .  12 PRO HG3  1 1 
       15  8798 1 1 12 PRO N    N   -7.870  -4.511   3.402 1.00 . A A .  12 PRO N    1 1 
       15  8799 1 1 12 PRO O    O   -6.637  -1.191   2.935 1.00 . A A .  12 PRO O    1 1 
       15  8800 1 1 13 TYR C    C   -5.261  -1.415   0.728 1.00 . A A .  13 TYR C    1 1 
       15  8801 1 1 13 TYR CA   C   -4.668  -2.559   1.545 1.00 . A A .  13 TYR CA   1 1 
       15  8802 1 1 13 TYR CB   C   -4.078  -3.616   0.610 1.00 . A A .  13 TYR CB   1 1 
       15  8803 1 1 13 TYR CD1  C   -3.457  -5.152   2.516 1.00 . A A .  13 TYR CD1  1 1 
       15  8804 1 1 13 TYR CD2  C   -4.389  -6.121   0.548 1.00 . A A .  13 TYR CD2  1 1 
       15  8805 1 1 13 TYR CE1  C   -3.359  -6.404   3.092 1.00 . A A .  13 TYR CE1  1 1 
       15  8806 1 1 13 TYR CE2  C   -4.296  -7.376   1.116 1.00 . A A .  13 TYR CE2  1 1 
       15  8807 1 1 13 TYR CG   C   -3.972  -4.988   1.236 1.00 . A A .  13 TYR CG   1 1 
       15  8808 1 1 13 TYR CZ   C   -3.780  -7.513   2.388 1.00 . A A .  13 TYR CZ   1 1 
       15  8809 1 1 13 TYR H    H   -5.686  -4.130   2.534 1.00 . A A .  13 TYR H    1 1 
       15  8810 1 1 13 TYR HA   H   -3.882  -2.168   2.173 1.00 . A A .  13 TYR HA   1 1 
       15  8811 1 1 13 TYR HB2  H   -4.700  -3.699  -0.267 1.00 . A A .  13 TYR HB2  1 1 
       15  8812 1 1 13 TYR HB3  H   -3.085  -3.309   0.313 1.00 . A A .  13 TYR HB3  1 1 
       15  8813 1 1 13 TYR HD1  H   -3.129  -4.281   3.065 1.00 . A A .  13 TYR HD1  1 1 
       15  8814 1 1 13 TYR HD2  H   -4.793  -6.011  -0.448 1.00 . A A .  13 TYR HD2  1 1 
       15  8815 1 1 13 TYR HE1  H   -2.955  -6.510   4.088 1.00 . A A .  13 TYR HE1  1 1 
       15  8816 1 1 13 TYR HE2  H   -4.625  -8.245   0.565 1.00 . A A .  13 TYR HE2  1 1 
       15  8817 1 1 13 TYR HH   H   -2.801  -9.110   2.819 1.00 . A A .  13 TYR HH   1 1 
       15  8818 1 1 13 TYR N    N   -5.677  -3.157   2.411 1.00 . A A .  13 TYR N    1 1 
       15  8819 1 1 13 TYR O    O   -6.035  -1.637  -0.202 1.00 . A A .  13 TYR O    1 1 
       15  8820 1 1 13 TYR OH   O   -3.684  -8.761   2.958 1.00 . A A .  13 TYR OH   1 1 
       15  8821 1 1 14 GLY C    C   -4.568   2.217   0.640 1.00 . A A .  14 GLY C    1 1 
       15  8822 1 1 14 GLY CA   C   -5.393   0.973   0.374 1.00 . A A .  14 GLY CA   1 1 
       15  8823 1 1 14 GLY H    H   -4.270  -0.072   1.834 1.00 . A A .  14 GLY H    1 1 
       15  8824 1 1 14 GLY HA2  H   -5.383   0.767  -0.685 1.00 . A A .  14 GLY HA2  1 1 
       15  8825 1 1 14 GLY HA3  H   -6.411   1.158   0.685 1.00 . A A .  14 GLY HA3  1 1 
       15  8826 1 1 14 GLY N    N   -4.890  -0.189   1.084 1.00 . A A .  14 GLY N    1 1 
       15  8827 1 1 14 GLY O    O   -4.421   2.641   1.787 1.00 . A A .  14 GLY O    1 1 
       15  8828 1 1 15 CYS C    C   -4.058   5.199   0.121 1.00 . A A .  15 CYS C    1 1 
       15  8829 1 1 15 CYS CA   C   -3.208   4.004  -0.300 1.00 . A A .  15 CYS CA   1 1 
       15  8830 1 1 15 CYS CB   C   -2.504   4.305  -1.624 1.00 . A A .  15 CYS CB   1 1 
       15  8831 1 1 15 CYS H    H   -4.177   2.418  -1.311 1.00 . A A .  15 CYS H    1 1 
       15  8832 1 1 15 CYS HA   H   -2.463   3.822   0.460 1.00 . A A .  15 CYS HA   1 1 
       15  8833 1 1 15 CYS HB2  H   -1.818   3.501  -1.849 1.00 . A A .  15 CYS HB2  1 1 
       15  8834 1 1 15 CYS HB3  H   -3.243   4.370  -2.409 1.00 . A A .  15 CYS HB3  1 1 
       15  8835 1 1 15 CYS N    N   -4.025   2.803  -0.422 1.00 . A A .  15 CYS N    1 1 
       15  8836 1 1 15 CYS O    O   -4.777   5.779  -0.692 1.00 . A A .  15 CYS O    1 1 
       15  8837 1 1 15 CYS SG   S   -1.554   5.859  -1.625 1.00 . A A .  15 CYS SG   1 1 
       15  8838 1 1 16 SER C    C   -3.969   7.995   1.743 1.00 . A A .  16 SER C    1 1 
       15  8839 1 1 16 SER CA   C   -4.731   6.686   1.927 1.00 . A A .  16 SER CA   1 1 
       15  8840 1 1 16 SER CB   C   -5.041   6.466   3.409 1.00 . A A .  16 SER CB   1 1 
       15  8841 1 1 16 SER H    H   -3.377   5.060   1.996 1.00 . A A .  16 SER H    1 1 
       15  8842 1 1 16 SER HA   H   -5.660   6.744   1.379 1.00 . A A .  16 SER HA   1 1 
       15  8843 1 1 16 SER HB2  H   -5.538   5.516   3.533 1.00 . A A .  16 SER HB2  1 1 
       15  8844 1 1 16 SER HB3  H   -4.117   6.466   3.970 1.00 . A A .  16 SER HB3  1 1 
       15  8845 1 1 16 SER HG   H   -5.633   8.330   3.518 1.00 . A A .  16 SER HG   1 1 
       15  8846 1 1 16 SER N    N   -3.968   5.562   1.397 1.00 . A A .  16 SER N    1 1 
       15  8847 1 1 16 SER O    O   -3.984   8.861   2.617 1.00 . A A .  16 SER O    1 1 
       15  8848 1 1 16 SER OG   O   -5.881   7.491   3.912 1.00 . A A .  16 SER OG   1 1 
       15  8849 1 1 17 GLU C    C   -3.037   9.997  -0.976 1.00 . A A .  17 GLU C    1 1 
       15  8850 1 1 17 GLU CA   C   -2.534   9.332   0.302 1.00 . A A .  17 GLU CA   1 1 
       15  8851 1 1 17 GLU CB   C   -1.049   8.993   0.164 1.00 . A A .  17 GLU CB   1 1 
       15  8852 1 1 17 GLU CD   C    0.069  11.160   0.824 1.00 . A A .  17 GLU CD   1 1 
       15  8853 1 1 17 GLU CG   C   -0.196  10.166  -0.290 1.00 . A A .  17 GLU CG   1 1 
       15  8854 1 1 17 GLU H    H   -3.330   7.404  -0.057 1.00 . A A .  17 GLU H    1 1 
       15  8855 1 1 17 GLU HA   H   -2.661  10.019   1.125 1.00 . A A .  17 GLU HA   1 1 
       15  8856 1 1 17 GLU HB2  H   -0.678   8.653   1.120 1.00 . A A .  17 GLU HB2  1 1 
       15  8857 1 1 17 GLU HB3  H   -0.940   8.196  -0.557 1.00 . A A .  17 GLU HB3  1 1 
       15  8858 1 1 17 GLU HG2  H    0.750   9.789  -0.648 1.00 . A A .  17 GLU HG2  1 1 
       15  8859 1 1 17 GLU HG3  H   -0.707  10.676  -1.094 1.00 . A A .  17 GLU HG3  1 1 
       15  8860 1 1 17 GLU N    N   -3.303   8.130   0.600 1.00 . A A .  17 GLU N    1 1 
       15  8861 1 1 17 GLU O    O   -3.466  11.151  -0.962 1.00 . A A .  17 GLU O    1 1 
       15  8862 1 1 17 GLU OE1  O   -0.878  11.867   1.226 1.00 . A A .  17 GLU OE1  1 1 
       15  8863 1 1 17 GLU OE2  O    1.224  11.230   1.293 1.00 . A A .  17 GLU OE2  1 1 
       15  8864 1 1 18 CYS C    C   -4.759   9.150  -3.772 1.00 . A A .  18 CYS C    1 1 
       15  8865 1 1 18 CYS CA   C   -3.428   9.776  -3.368 1.00 . A A .  18 CYS CA   1 1 
       15  8866 1 1 18 CYS CB   C   -2.376   9.502  -4.445 1.00 . A A .  18 CYS CB   1 1 
       15  8867 1 1 18 CYS H    H   -2.627   8.346  -2.028 1.00 . A A .  18 CYS H    1 1 
       15  8868 1 1 18 CYS HA   H   -3.560  10.843  -3.271 1.00 . A A .  18 CYS HA   1 1 
       15  8869 1 1 18 CYS HB2  H   -2.664  10.007  -5.356 1.00 . A A .  18 CYS HB2  1 1 
       15  8870 1 1 18 CYS HB3  H   -1.423   9.886  -4.112 1.00 . A A .  18 CYS HB3  1 1 
       15  8871 1 1 18 CYS N    N   -2.980   9.260  -2.081 1.00 . A A .  18 CYS N    1 1 
       15  8872 1 1 18 CYS O    O   -5.661   9.837  -4.250 1.00 . A A .  18 CYS O    1 1 
       15  8873 1 1 18 CYS SG   S   -2.157   7.736  -4.838 1.00 . A A .  18 CYS SG   1 1 
       15  8874 1 1 19 GLY C    C   -5.858   5.986  -4.872 1.00 . A A .  19 GLY C    1 1 
       15  8875 1 1 19 GLY CA   C   -6.100   7.143  -3.923 1.00 . A A .  19 GLY CA   1 1 
       15  8876 1 1 19 GLY H    H   -4.123   7.343  -3.190 1.00 . A A .  19 GLY H    1 1 
       15  8877 1 1 19 GLY HA2  H   -6.555   6.765  -3.020 1.00 . A A .  19 GLY HA2  1 1 
       15  8878 1 1 19 GLY HA3  H   -6.777   7.842  -4.392 1.00 . A A .  19 GLY HA3  1 1 
       15  8879 1 1 19 GLY N    N   -4.875   7.840  -3.575 1.00 . A A .  19 GLY N    1 1 
       15  8880 1 1 19 GLY O    O   -6.455   5.919  -5.947 1.00 . A A .  19 GLY O    1 1 
       15  8881 1 1 20 LYS C    C   -4.776   2.623  -4.491 1.00 . A A .  20 LYS C    1 1 
       15  8882 1 1 20 LYS CA   C   -4.658   3.911  -5.299 1.00 . A A .  20 LYS CA   1 1 
       15  8883 1 1 20 LYS CB   C   -3.244   4.040  -5.870 1.00 . A A .  20 LYS CB   1 1 
       15  8884 1 1 20 LYS CD   C   -1.626   3.415  -7.686 1.00 . A A .  20 LYS CD   1 1 
       15  8885 1 1 20 LYS CE   C   -1.616   4.700  -8.499 1.00 . A A .  20 LYS CE   1 1 
       15  8886 1 1 20 LYS CG   C   -2.992   3.152  -7.076 1.00 . A A .  20 LYS CG   1 1 
       15  8887 1 1 20 LYS H    H   -4.535   5.180  -3.609 1.00 . A A .  20 LYS H    1 1 
       15  8888 1 1 20 LYS HA   H   -5.365   3.877  -6.114 1.00 . A A .  20 LYS HA   1 1 
       15  8889 1 1 20 LYS HB2  H   -3.080   5.066  -6.164 1.00 . A A .  20 LYS HB2  1 1 
       15  8890 1 1 20 LYS HB3  H   -2.533   3.776  -5.100 1.00 . A A .  20 LYS HB3  1 1 
       15  8891 1 1 20 LYS HD2  H   -0.897   3.498  -6.894 1.00 . A A .  20 LYS HD2  1 1 
       15  8892 1 1 20 LYS HD3  H   -1.365   2.589  -8.333 1.00 . A A .  20 LYS HD3  1 1 
       15  8893 1 1 20 LYS HE2  H   -2.426   4.667  -9.211 1.00 . A A .  20 LYS HE2  1 1 
       15  8894 1 1 20 LYS HE3  H   -1.761   5.535  -7.829 1.00 . A A .  20 LYS HE3  1 1 
       15  8895 1 1 20 LYS HG2  H   -3.044   2.118  -6.768 1.00 . A A .  20 LYS HG2  1 1 
       15  8896 1 1 20 LYS HG3  H   -3.752   3.346  -7.819 1.00 . A A .  20 LYS HG3  1 1 
       15  8897 1 1 20 LYS HZ1  H    0.282   4.058  -9.088 1.00 . A A .  20 LYS HZ1  1 1 
       15  8898 1 1 20 LYS HZ2  H    0.158   5.733  -8.886 1.00 . A A .  20 LYS HZ2  1 1 
       15  8899 1 1 20 LYS HZ3  H   -0.516   4.994 -10.250 1.00 . A A .  20 LYS HZ3  1 1 
       15  8900 1 1 20 LYS N    N   -4.979   5.072  -4.476 1.00 . A A .  20 LYS N    1 1 
       15  8901 1 1 20 LYS NZ   N   -0.333   4.884  -9.232 1.00 . A A .  20 LYS NZ   1 1 
       15  8902 1 1 20 LYS O    O   -4.059   2.426  -3.510 1.00 . A A .  20 LYS O    1 1 
       15  8903 1 1 21 ALA C    C   -5.261  -0.674  -5.004 1.00 . A A .  21 ALA C    1 1 
       15  8904 1 1 21 ALA CA   C   -5.893   0.477  -4.227 1.00 . A A .  21 ALA CA   1 1 
       15  8905 1 1 21 ALA CB   C   -7.380   0.225  -4.024 1.00 . A A .  21 ALA CB   1 1 
       15  8906 1 1 21 ALA H    H   -6.226   1.961  -5.698 1.00 . A A .  21 ALA H    1 1 
       15  8907 1 1 21 ALA HA   H   -5.427   0.540  -3.254 1.00 . A A .  21 ALA HA   1 1 
       15  8908 1 1 21 ALA HB1  H   -7.907   0.422  -4.945 1.00 . A A .  21 ALA HB1  1 1 
       15  8909 1 1 21 ALA HB2  H   -7.533  -0.804  -3.734 1.00 . A A .  21 ALA HB2  1 1 
       15  8910 1 1 21 ALA HB3  H   -7.752   0.877  -3.248 1.00 . A A .  21 ALA HB3  1 1 
       15  8911 1 1 21 ALA N    N   -5.684   1.748  -4.910 1.00 . A A .  21 ALA N    1 1 
       15  8912 1 1 21 ALA O    O   -5.037  -0.573  -6.210 1.00 . A A .  21 ALA O    1 1 
       15  8913 1 1 22 PHE C    C   -5.029  -4.220  -4.437 1.00 . A A .  22 PHE C    1 1 
       15  8914 1 1 22 PHE CA   C   -4.367  -2.936  -4.928 1.00 . A A .  22 PHE CA   1 1 
       15  8915 1 1 22 PHE CB   C   -2.866  -2.977  -4.631 1.00 . A A .  22 PHE CB   1 1 
       15  8916 1 1 22 PHE CD1  C   -2.270  -0.564  -4.285 1.00 . A A .  22 PHE CD1  1 1 
       15  8917 1 1 22 PHE CD2  C   -1.333  -1.706  -6.156 1.00 . A A .  22 PHE CD2  1 1 
       15  8918 1 1 22 PHE CE1  C   -1.605   0.591  -4.651 1.00 . A A .  22 PHE CE1  1 1 
       15  8919 1 1 22 PHE CE2  C   -0.664  -0.554  -6.527 1.00 . A A .  22 PHE CE2  1 1 
       15  8920 1 1 22 PHE CG   C   -2.142  -1.724  -5.032 1.00 . A A .  22 PHE CG   1 1 
       15  8921 1 1 22 PHE CZ   C   -0.801   0.596  -5.774 1.00 . A A .  22 PHE CZ   1 1 
       15  8922 1 1 22 PHE H    H   -5.177  -1.787  -3.345 1.00 . A A .  22 PHE H    1 1 
       15  8923 1 1 22 PHE HA   H   -4.512  -2.855  -5.994 1.00 . A A .  22 PHE HA   1 1 
       15  8924 1 1 22 PHE HB2  H   -2.720  -3.119  -3.570 1.00 . A A .  22 PHE HB2  1 1 
       15  8925 1 1 22 PHE HB3  H   -2.423  -3.803  -5.165 1.00 . A A .  22 PHE HB3  1 1 
       15  8926 1 1 22 PHE HD1  H   -2.899  -0.567  -3.406 1.00 . A A .  22 PHE HD1  1 1 
       15  8927 1 1 22 PHE HD2  H   -1.225  -2.604  -6.747 1.00 . A A .  22 PHE HD2  1 1 
       15  8928 1 1 22 PHE HE1  H   -1.714   1.488  -4.060 1.00 . A A .  22 PHE HE1  1 1 
       15  8929 1 1 22 PHE HE2  H   -0.037  -0.553  -7.406 1.00 . A A .  22 PHE HE2  1 1 
       15  8930 1 1 22 PHE HZ   H   -0.280   1.496  -6.062 1.00 . A A .  22 PHE HZ   1 1 
       15  8931 1 1 22 PHE N    N   -4.975  -1.767  -4.304 1.00 . A A .  22 PHE N    1 1 
       15  8932 1 1 22 PHE O    O   -5.866  -4.194  -3.535 1.00 . A A .  22 PHE O    1 1 
       15  8933 1 1 23 SER C    C   -4.407  -7.268  -3.530 1.00 . A A .  23 SER C    1 1 
       15  8934 1 1 23 SER CA   C   -5.206  -6.637  -4.666 1.00 . A A .  23 SER CA   1 1 
       15  8935 1 1 23 SER CB   C   -5.223  -7.575  -5.874 1.00 . A A .  23 SER CB   1 1 
       15  8936 1 1 23 SER H    H   -3.976  -5.299  -5.750 1.00 . A A .  23 SER H    1 1 
       15  8937 1 1 23 SER HA   H   -6.220  -6.477  -4.331 1.00 . A A .  23 SER HA   1 1 
       15  8938 1 1 23 SER HB2  H   -5.892  -7.181  -6.624 1.00 . A A .  23 SER HB2  1 1 
       15  8939 1 1 23 SER HB3  H   -4.226  -7.648  -6.284 1.00 . A A .  23 SER HB3  1 1 
       15  8940 1 1 23 SER HG   H   -6.424  -8.800  -4.927 1.00 . A A .  23 SER HG   1 1 
       15  8941 1 1 23 SER N    N   -4.647  -5.343  -5.038 1.00 . A A .  23 SER N    1 1 
       15  8942 1 1 23 SER O    O   -4.975  -7.853  -2.607 1.00 . A A .  23 SER O    1 1 
       15  8943 1 1 23 SER OG   O   -5.663  -8.872  -5.507 1.00 . A A .  23 SER OG   1 1 
       15  8944 1 1 24 SER C    C   -1.594  -6.600  -1.729 1.00 . A A .  24 SER C    1 1 
       15  8945 1 1 24 SER CA   C   -2.207  -7.704  -2.584 1.00 . A A .  24 SER CA   1 1 
       15  8946 1 1 24 SER CB   C   -1.100  -8.535  -3.236 1.00 . A A .  24 SER CB   1 1 
       15  8947 1 1 24 SER H    H   -2.693  -6.666  -4.364 1.00 . A A .  24 SER H    1 1 
       15  8948 1 1 24 SER HA   H   -2.801  -8.346  -1.951 1.00 . A A .  24 SER HA   1 1 
       15  8949 1 1 24 SER HB2  H   -0.566  -7.923  -3.947 1.00 . A A .  24 SER HB2  1 1 
       15  8950 1 1 24 SER HB3  H   -0.417  -8.880  -2.473 1.00 . A A .  24 SER HB3  1 1 
       15  8951 1 1 24 SER HG   H   -0.922 -10.243  -4.178 1.00 . A A .  24 SER HG   1 1 
       15  8952 1 1 24 SER N    N   -3.086  -7.144  -3.604 1.00 . A A .  24 SER N    1 1 
       15  8953 1 1 24 SER O    O   -1.577  -5.432  -2.119 1.00 . A A .  24 SER O    1 1 
       15  8954 1 1 24 SER OG   O   -1.636  -9.659  -3.911 1.00 . A A .  24 SER OG   1 1 
       15  8955 1 1 25 LYS C    C    0.825  -5.472  -0.230 1.00 . A A .  25 LYS C    1 1 
       15  8956 1 1 25 LYS CA   C   -0.473  -6.021   0.353 1.00 . A A .  25 LYS CA   1 1 
       15  8957 1 1 25 LYS CB   C   -0.198  -6.681   1.707 1.00 . A A .  25 LYS CB   1 1 
       15  8958 1 1 25 LYS CD   C    0.410  -6.110   4.076 1.00 . A A .  25 LYS CD   1 1 
       15  8959 1 1 25 LYS CE   C    1.032  -7.409   4.564 1.00 . A A .  25 LYS CE   1 1 
       15  8960 1 1 25 LYS CG   C    0.712  -5.864   2.607 1.00 . A A .  25 LYS CG   1 1 
       15  8961 1 1 25 LYS H    H   -1.132  -7.923  -0.303 1.00 . A A .  25 LYS H    1 1 
       15  8962 1 1 25 LYS HA   H   -1.164  -5.204   0.495 1.00 . A A .  25 LYS HA   1 1 
       15  8963 1 1 25 LYS HB2  H   -1.137  -6.830   2.218 1.00 . A A .  25 LYS HB2  1 1 
       15  8964 1 1 25 LYS HB3  H    0.267  -7.642   1.537 1.00 . A A .  25 LYS HB3  1 1 
       15  8965 1 1 25 LYS HD2  H    0.808  -5.292   4.659 1.00 . A A .  25 LYS HD2  1 1 
       15  8966 1 1 25 LYS HD3  H   -0.662  -6.161   4.210 1.00 . A A .  25 LYS HD3  1 1 
       15  8967 1 1 25 LYS HE2  H    0.681  -7.607   5.565 1.00 . A A .  25 LYS HE2  1 1 
       15  8968 1 1 25 LYS HE3  H    0.721  -8.210   3.909 1.00 . A A .  25 LYS HE3  1 1 
       15  8969 1 1 25 LYS HG2  H    1.738  -6.138   2.412 1.00 . A A .  25 LYS HG2  1 1 
       15  8970 1 1 25 LYS HG3  H    0.571  -4.815   2.391 1.00 . A A .  25 LYS HG3  1 1 
       15  8971 1 1 25 LYS HZ1  H    2.878  -7.196   3.610 1.00 . A A .  25 LYS HZ1  1 1 
       15  8972 1 1 25 LYS HZ2  H    2.914  -8.228   4.950 1.00 . A A .  25 LYS HZ2  1 1 
       15  8973 1 1 25 LYS HZ3  H    2.837  -6.554   5.174 1.00 . A A .  25 LYS HZ3  1 1 
       15  8974 1 1 25 LYS N    N   -1.089  -6.977  -0.559 1.00 . A A .  25 LYS N    1 1 
       15  8975 1 1 25 LYS NZ   N    2.519  -7.342   4.575 1.00 . A A .  25 LYS NZ   1 1 
       15  8976 1 1 25 LYS O    O    0.986  -4.260  -0.377 1.00 . A A .  25 LYS O    1 1 
       15  8977 1 1 26 SER C    C    2.854  -4.858  -2.150 1.00 . A A .  26 SER C    1 1 
       15  8978 1 1 26 SER CA   C    3.031  -5.975  -1.126 1.00 . A A .  26 SER CA   1 1 
       15  8979 1 1 26 SER CB   C    3.717  -7.176  -1.779 1.00 . A A .  26 SER CB   1 1 
       15  8980 1 1 26 SER H    H    1.559  -7.322  -0.419 1.00 . A A .  26 SER H    1 1 
       15  8981 1 1 26 SER HA   H    3.651  -5.612  -0.319 1.00 . A A .  26 SER HA   1 1 
       15  8982 1 1 26 SER HB2  H    3.033  -7.647  -2.469 1.00 . A A .  26 SER HB2  1 1 
       15  8983 1 1 26 SER HB3  H    4.594  -6.841  -2.313 1.00 . A A .  26 SER HB3  1 1 
       15  8984 1 1 26 SER HG   H    3.517  -8.882  -0.835 1.00 . A A .  26 SER HG   1 1 
       15  8985 1 1 26 SER N    N    1.747  -6.370  -0.561 1.00 . A A .  26 SER N    1 1 
       15  8986 1 1 26 SER O    O    3.504  -3.816  -2.068 1.00 . A A .  26 SER O    1 1 
       15  8987 1 1 26 SER OG   O    4.112  -8.129  -0.806 1.00 . A A .  26 SER OG   1 1 
       15  8988 1 1 27 TYR C    C    1.558  -2.702  -3.561 1.00 . A A .  27 TYR C    1 1 
       15  8989 1 1 27 TYR CA   C    1.706  -4.099  -4.157 1.00 . A A .  27 TYR CA   1 1 
       15  8990 1 1 27 TYR CB   C    0.442  -4.471  -4.933 1.00 . A A .  27 TYR CB   1 1 
       15  8991 1 1 27 TYR CD1  C    1.750  -5.313  -6.922 1.00 . A A .  27 TYR CD1  1 1 
       15  8992 1 1 27 TYR CD2  C   -0.150  -6.566  -6.213 1.00 . A A .  27 TYR CD2  1 1 
       15  8993 1 1 27 TYR CE1  C    1.975  -6.220  -7.939 1.00 . A A .  27 TYR CE1  1 1 
       15  8994 1 1 27 TYR CE2  C    0.069  -7.480  -7.226 1.00 . A A .  27 TYR CE2  1 1 
       15  8995 1 1 27 TYR CG   C    0.685  -5.468  -6.044 1.00 . A A .  27 TYR CG   1 1 
       15  8996 1 1 27 TYR CZ   C    1.132  -7.302  -8.087 1.00 . A A .  27 TYR CZ   1 1 
       15  8997 1 1 27 TYR H    H    1.481  -5.933  -3.127 1.00 . A A .  27 TYR H    1 1 
       15  8998 1 1 27 TYR HA   H    2.547  -4.101  -4.835 1.00 . A A .  27 TYR HA   1 1 
       15  8999 1 1 27 TYR HB2  H   -0.276  -4.903  -4.253 1.00 . A A .  27 TYR HB2  1 1 
       15  9000 1 1 27 TYR HB3  H    0.022  -3.579  -5.374 1.00 . A A .  27 TYR HB3  1 1 
       15  9001 1 1 27 TYR HD1  H    2.408  -4.464  -6.804 1.00 . A A .  27 TYR HD1  1 1 
       15  9002 1 1 27 TYR HD2  H   -0.982  -6.702  -5.538 1.00 . A A .  27 TYR HD2  1 1 
       15  9003 1 1 27 TYR HE1  H    2.808  -6.082  -8.613 1.00 . A A .  27 TYR HE1  1 1 
       15  9004 1 1 27 TYR HE2  H   -0.591  -8.327  -7.342 1.00 . A A .  27 TYR HE2  1 1 
       15  9005 1 1 27 TYR HH   H    0.909  -9.034  -8.890 1.00 . A A .  27 TYR HH   1 1 
       15  9006 1 1 27 TYR N    N    1.969  -5.084  -3.114 1.00 . A A .  27 TYR N    1 1 
       15  9007 1 1 27 TYR O    O    2.202  -1.752  -4.008 1.00 . A A .  27 TYR O    1 1 
       15  9008 1 1 27 TYR OH   O    1.354  -8.210  -9.097 1.00 . A A .  27 TYR OH   1 1 
       15  9009 1 1 28 LEU C    C    1.776  -0.713  -1.369 1.00 . A A .  28 LEU C    1 1 
       15  9010 1 1 28 LEU CA   C    0.470  -1.305  -1.891 1.00 . A A .  28 LEU CA   1 1 
       15  9011 1 1 28 LEU CB   C   -0.521  -1.476  -0.738 1.00 . A A .  28 LEU CB   1 1 
       15  9012 1 1 28 LEU CD1  C   -1.489   0.836  -0.681 1.00 . A A .  28 LEU CD1  1 1 
       15  9013 1 1 28 LEU CD2  C   -1.572  -0.602   1.363 1.00 . A A .  28 LEU CD2  1 1 
       15  9014 1 1 28 LEU CG   C   -0.771  -0.237   0.122 1.00 . A A .  28 LEU CG   1 1 
       15  9015 1 1 28 LEU H    H    0.220  -3.377  -2.238 1.00 . A A .  28 LEU H    1 1 
       15  9016 1 1 28 LEU HA   H    0.049  -0.629  -2.620 1.00 . A A .  28 LEU HA   1 1 
       15  9017 1 1 28 LEU HB2  H   -1.467  -1.782  -1.159 1.00 . A A .  28 LEU HB2  1 1 
       15  9018 1 1 28 LEU HB3  H   -0.146  -2.258  -0.094 1.00 . A A .  28 LEU HB3  1 1 
       15  9019 1 1 28 LEU HD11 H   -1.692   1.685  -0.047 1.00 . A A .  28 LEU HD11 1 1 
       15  9020 1 1 28 LEU HD12 H   -2.419   0.439  -1.061 1.00 . A A .  28 LEU HD12 1 1 
       15  9021 1 1 28 LEU HD13 H   -0.865   1.144  -1.508 1.00 . A A .  28 LEU HD13 1 1 
       15  9022 1 1 28 LEU HD21 H   -0.936  -0.539   2.234 1.00 . A A .  28 LEU HD21 1 1 
       15  9023 1 1 28 LEU HD22 H   -1.949  -1.609   1.265 1.00 . A A .  28 LEU HD22 1 1 
       15  9024 1 1 28 LEU HD23 H   -2.401   0.083   1.471 1.00 . A A .  28 LEU HD23 1 1 
       15  9025 1 1 28 LEU HG   H    0.179   0.168   0.444 1.00 . A A .  28 LEU HG   1 1 
       15  9026 1 1 28 LEU N    N    0.704  -2.585  -2.550 1.00 . A A .  28 LEU N    1 1 
       15  9027 1 1 28 LEU O    O    2.069   0.461  -1.593 1.00 . A A .  28 LEU O    1 1 
       15  9028 1 1 29 ILE C    C    4.720  -0.493  -1.211 1.00 . A A .  29 ILE C    1 1 
       15  9029 1 1 29 ILE CA   C    3.832  -1.094  -0.126 1.00 . A A .  29 ILE CA   1 1 
       15  9030 1 1 29 ILE CB   C    4.584  -2.255   0.551 1.00 . A A .  29 ILE CB   1 1 
       15  9031 1 1 29 ILE CD1  C    4.162  -4.222   2.111 1.00 . A A .  29 ILE CD1  1 1 
       15  9032 1 1 29 ILE CG1  C    3.758  -2.821   1.708 1.00 . A A .  29 ILE CG1  1 1 
       15  9033 1 1 29 ILE CG2  C    5.945  -1.787   1.045 1.00 . A A .  29 ILE CG2  1 1 
       15  9034 1 1 29 ILE H    H    2.267  -2.460  -0.531 1.00 . A A .  29 ILE H    1 1 
       15  9035 1 1 29 ILE HA   H    3.630  -0.339   0.619 1.00 . A A .  29 ILE HA   1 1 
       15  9036 1 1 29 ILE HB   H    4.741  -3.030  -0.183 1.00 . A A .  29 ILE HB   1 1 
       15  9037 1 1 29 ILE HD11 H    4.818  -4.174   2.969 1.00 . A A .  29 ILE HD11 1 1 
       15  9038 1 1 29 ILE HD12 H    3.280  -4.792   2.364 1.00 . A A .  29 ILE HD12 1 1 
       15  9039 1 1 29 ILE HD13 H    4.677  -4.698   1.291 1.00 . A A .  29 ILE HD13 1 1 
       15  9040 1 1 29 ILE HG12 H    3.872  -2.182   2.570 1.00 . A A .  29 ILE HG12 1 1 
       15  9041 1 1 29 ILE HG13 H    2.717  -2.845   1.419 1.00 . A A .  29 ILE HG13 1 1 
       15  9042 1 1 29 ILE HG21 H    6.530  -1.435   0.208 1.00 . A A .  29 ILE HG21 1 1 
       15  9043 1 1 29 ILE HG22 H    5.814  -0.985   1.755 1.00 . A A .  29 ILE HG22 1 1 
       15  9044 1 1 29 ILE HG23 H    6.458  -2.610   1.521 1.00 . A A .  29 ILE HG23 1 1 
       15  9045 1 1 29 ILE N    N    2.556  -1.535  -0.676 1.00 . A A .  29 ILE N    1 1 
       15  9046 1 1 29 ILE O    O    5.123   0.667  -1.124 1.00 . A A .  29 ILE O    1 1 
       15  9047 1 1 30 ILE C    C    5.417   0.542  -3.827 1.00 . A A .  30 ILE C    1 1 
       15  9048 1 1 30 ILE CA   C    5.855  -0.834  -3.336 1.00 . A A .  30 ILE CA   1 1 
       15  9049 1 1 30 ILE CB   C    5.818  -1.823  -4.515 1.00 . A A .  30 ILE CB   1 1 
       15  9050 1 1 30 ILE CD1  C    5.659  -4.342  -4.842 1.00 . A A .  30 ILE CD1  1 1 
       15  9051 1 1 30 ILE CG1  C    6.287  -3.208  -4.063 1.00 . A A .  30 ILE CG1  1 1 
       15  9052 1 1 30 ILE CG2  C    6.680  -1.314  -5.661 1.00 . A A .  30 ILE CG2  1 1 
       15  9053 1 1 30 ILE H    H    4.666  -2.203  -2.245 1.00 . A A .  30 ILE H    1 1 
       15  9054 1 1 30 ILE HA   H    6.872  -0.770  -2.977 1.00 . A A .  30 ILE HA   1 1 
       15  9055 1 1 30 ILE HB   H    4.800  -1.893  -4.866 1.00 . A A .  30 ILE HB   1 1 
       15  9056 1 1 30 ILE HD11 H    4.633  -4.468  -4.529 1.00 . A A .  30 ILE HD11 1 1 
       15  9057 1 1 30 ILE HD12 H    5.688  -4.115  -5.897 1.00 . A A .  30 ILE HD12 1 1 
       15  9058 1 1 30 ILE HD13 H    6.206  -5.254  -4.654 1.00 . A A .  30 ILE HD13 1 1 
       15  9059 1 1 30 ILE HG12 H    7.357  -3.275  -4.184 1.00 . A A .  30 ILE HG12 1 1 
       15  9060 1 1 30 ILE HG13 H    6.037  -3.341  -3.020 1.00 . A A .  30 ILE HG13 1 1 
       15  9061 1 1 30 ILE HG21 H    7.690  -1.675  -5.539 1.00 . A A .  30 ILE HG21 1 1 
       15  9062 1 1 30 ILE HG22 H    6.281  -1.672  -6.598 1.00 . A A .  30 ILE HG22 1 1 
       15  9063 1 1 30 ILE HG23 H    6.681  -0.234  -5.659 1.00 . A A .  30 ILE HG23 1 1 
       15  9064 1 1 30 ILE N    N    5.018  -1.289  -2.232 1.00 . A A .  30 ILE N    1 1 
       15  9065 1 1 30 ILE O    O    6.248   1.386  -4.164 1.00 . A A .  30 ILE O    1 1 
       15  9066 1 1 31 HIS C    C    3.907   3.153  -3.329 1.00 . A A .  31 HIS C    1 1 
       15  9067 1 1 31 HIS CA   C    3.558   2.037  -4.309 1.00 . A A .  31 HIS CA   1 1 
       15  9068 1 1 31 HIS CB   C    2.040   1.937  -4.466 1.00 . A A .  31 HIS CB   1 1 
       15  9069 1 1 31 HIS CD2  C    0.750   4.074  -3.763 1.00 . A A .  31 HIS CD2  1 1 
       15  9070 1 1 31 HIS CE1  C    0.634   5.039  -5.728 1.00 . A A .  31 HIS CE1  1 1 
       15  9071 1 1 31 HIS CG   C    1.368   3.262  -4.653 1.00 . A A .  31 HIS CG   1 1 
       15  9072 1 1 31 HIS H    H    3.495   0.051  -3.580 1.00 . A A .  31 HIS H    1 1 
       15  9073 1 1 31 HIS HA   H    3.995   2.269  -5.269 1.00 . A A .  31 HIS HA   1 1 
       15  9074 1 1 31 HIS HB2  H    1.814   1.326  -5.328 1.00 . A A .  31 HIS HB2  1 1 
       15  9075 1 1 31 HIS HB3  H    1.623   1.473  -3.584 1.00 . A A .  31 HIS HB3  1 1 
       15  9076 1 1 31 HIS HD1  H    1.633   3.556  -6.722 1.00 . A A .  31 HIS HD1  1 1 
       15  9077 1 1 31 HIS HD2  H    0.630   3.893  -2.704 1.00 . A A .  31 HIS HD2  1 1 
       15  9078 1 1 31 HIS HE1  H    0.416   5.747  -6.514 1.00 . A A .  31 HIS HE1  1 1 
       15  9079 1 1 31 HIS N    N    4.107   0.762  -3.862 1.00 . A A .  31 HIS N    1 1 
       15  9080 1 1 31 HIS ND1  N    1.278   3.895  -5.874 1.00 . A A .  31 HIS ND1  1 1 
       15  9081 1 1 31 HIS NE2  N    0.303   5.172  -4.457 1.00 . A A .  31 HIS NE2  1 1 
       15  9082 1 1 31 HIS O    O    4.346   4.230  -3.730 1.00 . A A .  31 HIS O    1 1 
       15  9083 1 1 32 MET C    C    5.406   4.439  -1.178 1.00 . A A .  32 MET C    1 1 
       15  9084 1 1 32 MET CA   C    4.001   3.869  -1.005 1.00 . A A .  32 MET CA   1 1 
       15  9085 1 1 32 MET CB   C    3.862   3.236   0.381 1.00 . A A .  32 MET CB   1 1 
       15  9086 1 1 32 MET CE   C    0.598   5.368   1.223 1.00 . A A .  32 MET CE   1 1 
       15  9087 1 1 32 MET CG   C    2.458   3.331   0.955 1.00 . A A .  32 MET CG   1 1 
       15  9088 1 1 32 MET H    H    3.355   2.010  -1.783 1.00 . A A .  32 MET H    1 1 
       15  9089 1 1 32 MET HA   H    3.286   4.672  -1.097 1.00 . A A .  32 MET HA   1 1 
       15  9090 1 1 32 MET HB2  H    4.131   2.192   0.315 1.00 . A A .  32 MET HB2  1 1 
       15  9091 1 1 32 MET HB3  H    4.540   3.732   1.060 1.00 . A A .  32 MET HB3  1 1 
       15  9092 1 1 32 MET HE1  H   -0.070   4.520   1.198 1.00 . A A .  32 MET HE1  1 1 
       15  9093 1 1 32 MET HE2  H    0.180   6.138   1.854 1.00 . A A .  32 MET HE2  1 1 
       15  9094 1 1 32 MET HE3  H    0.728   5.754   0.223 1.00 . A A .  32 MET HE3  1 1 
       15  9095 1 1 32 MET HG2  H    1.747   3.287   0.143 1.00 . A A .  32 MET HG2  1 1 
       15  9096 1 1 32 MET HG3  H    2.298   2.493   1.617 1.00 . A A .  32 MET HG3  1 1 
       15  9097 1 1 32 MET N    N    3.707   2.887  -2.042 1.00 . A A .  32 MET N    1 1 
       15  9098 1 1 32 MET O    O    5.693   5.552  -0.737 1.00 . A A .  32 MET O    1 1 
       15  9099 1 1 32 MET SD   S    2.186   4.857   1.875 1.00 . A A .  32 MET SD   1 1 
       15  9100 1 1 33 ARG C    C    7.689   5.438  -2.777 1.00 . A A .  33 ARG C    1 1 
       15  9101 1 1 33 ARG CA   C    7.651   4.097  -2.051 1.00 . A A .  33 ARG CA   1 1 
       15  9102 1 1 33 ARG CB   C    8.407   3.044  -2.864 1.00 . A A .  33 ARG CB   1 1 
       15  9103 1 1 33 ARG CD   C    9.395   0.735  -2.960 1.00 . A A .  33 ARG CD   1 1 
       15  9104 1 1 33 ARG CG   C    8.610   1.732  -2.123 1.00 . A A .  33 ARG CG   1 1 
       15  9105 1 1 33 ARG CZ   C   10.132  -0.911  -1.289 1.00 . A A .  33 ARG CZ   1 1 
       15  9106 1 1 33 ARG H    H    5.988   2.791  -2.149 1.00 . A A .  33 ARG H    1 1 
       15  9107 1 1 33 ARG HA   H    8.129   4.207  -1.089 1.00 . A A .  33 ARG HA   1 1 
       15  9108 1 1 33 ARG HB2  H    7.853   2.838  -3.768 1.00 . A A .  33 ARG HB2  1 1 
       15  9109 1 1 33 ARG HB3  H    9.377   3.437  -3.127 1.00 . A A .  33 ARG HB3  1 1 
       15  9110 1 1 33 ARG HD2  H    8.944   0.672  -3.939 1.00 . A A .  33 ARG HD2  1 1 
       15  9111 1 1 33 ARG HD3  H   10.412   1.087  -3.055 1.00 . A A .  33 ARG HD3  1 1 
       15  9112 1 1 33 ARG HE   H    8.850  -1.286  -2.771 1.00 . A A .  33 ARG HE   1 1 
       15  9113 1 1 33 ARG HG2  H    9.154   1.926  -1.210 1.00 . A A .  33 ARG HG2  1 1 
       15  9114 1 1 33 ARG HG3  H    7.645   1.310  -1.887 1.00 . A A .  33 ARG HG3  1 1 
       15  9115 1 1 33 ARG HH11 H   10.929   0.933  -1.075 1.00 . A A .  33 ARG HH11 1 1 
       15  9116 1 1 33 ARG HH12 H   11.439  -0.237   0.097 1.00 . A A .  33 ARG HH12 1 1 
       15  9117 1 1 33 ARG HH21 H    9.515  -2.835  -1.234 1.00 . A A .  33 ARG HH21 1 1 
       15  9118 1 1 33 ARG HH22 H   10.635  -2.380   0.005 1.00 . A A .  33 ARG HH22 1 1 
       15  9119 1 1 33 ARG N    N    6.277   3.669  -1.822 1.00 . A A .  33 ARG N    1 1 
       15  9120 1 1 33 ARG NE   N    9.408  -0.595  -2.358 1.00 . A A .  33 ARG NE   1 1 
       15  9121 1 1 33 ARG NH1  N   10.897   0.003  -0.708 1.00 . A A .  33 ARG NH1  1 1 
       15  9122 1 1 33 ARG NH2  N   10.091  -2.144  -0.799 1.00 . A A .  33 ARG NH2  1 1 
       15  9123 1 1 33 ARG O    O    8.562   6.269  -2.525 1.00 . A A .  33 ARG O    1 1 
       15  9124 1 1 34 THR C    C    6.320   8.064  -3.542 1.00 . A A .  34 THR C    1 1 
       15  9125 1 1 34 THR CA   C    6.660   6.883  -4.443 1.00 . A A .  34 THR CA   1 1 
       15  9126 1 1 34 THR CB   C    5.609   6.788  -5.566 1.00 . A A .  34 THR CB   1 1 
       15  9127 1 1 34 THR CG2  C    5.942   5.655  -6.525 1.00 . A A .  34 THR CG2  1 1 
       15  9128 1 1 34 THR H    H    6.068   4.944  -3.836 1.00 . A A .  34 THR H    1 1 
       15  9129 1 1 34 THR HA   H    7.626   7.055  -4.897 1.00 . A A .  34 THR HA   1 1 
       15  9130 1 1 34 THR HB   H    5.609   7.718  -6.117 1.00 . A A .  34 THR HB   1 1 
       15  9131 1 1 34 THR HG1  H    3.644   6.683  -5.687 1.00 . A A .  34 THR HG1  1 1 
       15  9132 1 1 34 THR HG21 H    6.489   6.048  -7.369 1.00 . A A .  34 THR HG21 1 1 
       15  9133 1 1 34 THR HG22 H    5.028   5.196  -6.870 1.00 . A A .  34 THR HG22 1 1 
       15  9134 1 1 34 THR HG23 H    6.545   4.919  -6.016 1.00 . A A .  34 THR HG23 1 1 
       15  9135 1 1 34 THR N    N    6.735   5.644  -3.680 1.00 . A A .  34 THR N    1 1 
       15  9136 1 1 34 THR O    O    6.889   9.147  -3.679 1.00 . A A .  34 THR O    1 1 
       15  9137 1 1 34 THR OG1  O    4.309   6.578  -5.003 1.00 . A A .  34 THR OG1  1 1 
       15  9138 1 1 35 HIS C    C    6.033   9.127  -0.621 1.00 . A A .  35 HIS C    1 1 
       15  9139 1 1 35 HIS CA   C    4.972   8.897  -1.694 1.00 . A A .  35 HIS CA   1 1 
       15  9140 1 1 35 HIS CB   C    3.640   8.530  -1.039 1.00 . A A .  35 HIS CB   1 1 
       15  9141 1 1 35 HIS CD2  C    1.595   7.587  -2.327 1.00 . A A .  35 HIS CD2  1 1 
       15  9142 1 1 35 HIS CE1  C    1.070   9.390  -3.458 1.00 . A A .  35 HIS CE1  1 1 
       15  9143 1 1 35 HIS CG   C    2.480   8.553  -1.987 1.00 . A A .  35 HIS CG   1 1 
       15  9144 1 1 35 HIS H    H    4.970   6.965  -2.559 1.00 . A A .  35 HIS H    1 1 
       15  9145 1 1 35 HIS HA   H    4.846   9.808  -2.259 1.00 . A A .  35 HIS HA   1 1 
       15  9146 1 1 35 HIS HB2  H    3.711   7.534  -0.627 1.00 . A A .  35 HIS HB2  1 1 
       15  9147 1 1 35 HIS HB3  H    3.432   9.230  -0.243 1.00 . A A .  35 HIS HB3  1 1 
       15  9148 1 1 35 HIS HD1  H    2.577  10.538  -2.686 1.00 . A A .  35 HIS HD1  1 1 
       15  9149 1 1 35 HIS HD2  H    1.573   6.575  -1.949 1.00 . A A .  35 HIS HD2  1 1 
       15  9150 1 1 35 HIS HE1  H    0.571  10.073  -4.130 1.00 . A A .  35 HIS HE1  1 1 
       15  9151 1 1 35 HIS N    N    5.387   7.849  -2.619 1.00 . A A .  35 HIS N    1 1 
       15  9152 1 1 35 HIS ND1  N    2.125   9.670  -2.714 1.00 . A A .  35 HIS ND1  1 1 
       15  9153 1 1 35 HIS NE2  N    0.729   8.132  -3.242 1.00 . A A .  35 HIS NE2  1 1 
       15  9154 1 1 35 HIS O    O    6.536  10.238  -0.460 1.00 . A A .  35 HIS O    1 1 
       15  9155 1 1 36 SER C    C    8.756   8.388   0.589 1.00 . A A .  36 SER C    1 1 
       15  9156 1 1 36 SER CA   C    7.364   8.156   1.170 1.00 . A A .  36 SER CA   1 1 
       15  9157 1 1 36 SER CB   C    7.358   6.878   2.012 1.00 . A A .  36 SER CB   1 1 
       15  9158 1 1 36 SER H    H    5.930   7.209  -0.066 1.00 . A A .  36 SER H    1 1 
       15  9159 1 1 36 SER HA   H    7.105   8.993   1.801 1.00 . A A .  36 SER HA   1 1 
       15  9160 1 1 36 SER HB2  H    7.254   6.022   1.362 1.00 . A A .  36 SER HB2  1 1 
       15  9161 1 1 36 SER HB3  H    8.287   6.805   2.558 1.00 . A A .  36 SER HB3  1 1 
       15  9162 1 1 36 SER HG   H    5.723   6.119   2.779 1.00 . A A .  36 SER HG   1 1 
       15  9163 1 1 36 SER N    N    6.367   8.068   0.110 1.00 . A A .  36 SER N    1 1 
       15  9164 1 1 36 SER O    O    9.017   8.074  -0.571 1.00 . A A .  36 SER O    1 1 
       15  9165 1 1 36 SER OG   O    6.284   6.882   2.937 1.00 . A A .  36 SER OG   1 1 
       15  9166 1 1 37 GLY C    C   11.806   9.991   1.975 1.00 . A A .  37 GLY C    1 1 
       15  9167 1 1 37 GLY CA   C   11.000   9.209   0.957 1.00 . A A .  37 GLY CA   1 1 
       15  9168 1 1 37 GLY H    H    9.382   9.172   2.322 1.00 . A A .  37 GLY H    1 1 
       15  9169 1 1 37 GLY HA2  H   11.496   8.269   0.766 1.00 . A A .  37 GLY HA2  1 1 
       15  9170 1 1 37 GLY HA3  H   10.957   9.775   0.038 1.00 . A A .  37 GLY HA3  1 1 
       15  9171 1 1 37 GLY N    N    9.646   8.942   1.406 1.00 . A A .  37 GLY N    1 1 
       15  9172 1 1 37 GLY O    O   12.505   9.408   2.803 1.00 . A A .  37 GLY O    1 1 
       15  9173 1 1 38 GLU C    C   11.482  12.861   3.811 1.00 . A A .  38 GLU C    1 1 
       15  9174 1 1 38 GLU CA   C   12.437  12.178   2.836 1.00 . A A .  38 GLU CA   1 1 
       15  9175 1 1 38 GLU CB   C   13.234  13.232   2.064 1.00 . A A .  38 GLU CB   1 1 
       15  9176 1 1 38 GLU CD   C   15.465  13.892   1.081 1.00 . A A .  38 GLU CD   1 1 
       15  9177 1 1 38 GLU CG   C   14.629  12.774   1.672 1.00 . A A .  38 GLU CG   1 1 
       15  9178 1 1 38 GLU H    H   11.135  11.722   1.231 1.00 . A A .  38 GLU H    1 1 
       15  9179 1 1 38 GLU HA   H   13.123  11.561   3.396 1.00 . A A .  38 GLU HA   1 1 
       15  9180 1 1 38 GLU HB2  H   12.694  13.485   1.163 1.00 . A A .  38 GLU HB2  1 1 
       15  9181 1 1 38 GLU HB3  H   13.327  14.116   2.677 1.00 . A A .  38 GLU HB3  1 1 
       15  9182 1 1 38 GLU HG2  H   15.130  12.397   2.551 1.00 . A A .  38 GLU HG2  1 1 
       15  9183 1 1 38 GLU HG3  H   14.542  11.983   0.942 1.00 . A A .  38 GLU HG3  1 1 
       15  9184 1 1 38 GLU N    N   11.709  11.316   1.913 1.00 . A A .  38 GLU N    1 1 
       15  9185 1 1 38 GLU O    O   10.893  13.896   3.500 1.00 . A A .  38 GLU O    1 1 
       15  9186 1 1 38 GLU OE1  O   15.039  14.478   0.064 1.00 . A A .  38 GLU OE1  1 1 
       15  9187 1 1 38 GLU OE2  O   16.546  14.181   1.635 1.00 . A A .  38 GLU OE2  1 1 
       15  9188 1 1 39 LYS C    C   10.487  14.347   6.004 1.00 . A A .  39 LYS C    1 1 
       15  9189 1 1 39 LYS CA   C   10.450  12.822   6.016 1.00 . A A .  39 LYS CA   1 1 
       15  9190 1 1 39 LYS CB   C   10.852  12.302   7.398 1.00 . A A .  39 LYS CB   1 1 
       15  9191 1 1 39 LYS CD   C    9.393  13.506   9.051 1.00 . A A .  39 LYS CD   1 1 
       15  9192 1 1 39 LYS CE   C    7.963  13.562   9.566 1.00 . A A .  39 LYS CE   1 1 
       15  9193 1 1 39 LYS CG   C    9.687  12.182   8.365 1.00 . A A .  39 LYS CG   1 1 
       15  9194 1 1 39 LYS H    H   11.829  11.448   5.183 1.00 . A A .  39 LYS H    1 1 
       15  9195 1 1 39 LYS HA   H    9.445  12.496   5.796 1.00 . A A .  39 LYS HA   1 1 
       15  9196 1 1 39 LYS HB2  H   11.302  11.326   7.286 1.00 . A A .  39 LYS HB2  1 1 
       15  9197 1 1 39 LYS HB3  H   11.580  12.977   7.826 1.00 . A A .  39 LYS HB3  1 1 
       15  9198 1 1 39 LYS HD2  H   10.069  13.628   9.885 1.00 . A A .  39 LYS HD2  1 1 
       15  9199 1 1 39 LYS HD3  H    9.543  14.309   8.343 1.00 . A A .  39 LYS HD3  1 1 
       15  9200 1 1 39 LYS HE2  H    7.652  14.594   9.614 1.00 . A A .  39 LYS HE2  1 1 
       15  9201 1 1 39 LYS HE3  H    7.326  13.024   8.879 1.00 . A A .  39 LYS HE3  1 1 
       15  9202 1 1 39 LYS HG2  H    8.809  11.869   7.820 1.00 . A A .  39 LYS HG2  1 1 
       15  9203 1 1 39 LYS HG3  H    9.929  11.444   9.116 1.00 . A A .  39 LYS HG3  1 1 
       15  9204 1 1 39 LYS HZ1  H    7.359  13.615  11.565 1.00 . A A .  39 LYS HZ1  1 1 
       15  9205 1 1 39 LYS HZ2  H    8.780  12.735  11.302 1.00 . A A .  39 LYS HZ2  1 1 
       15  9206 1 1 39 LYS HZ3  H    7.284  12.075  10.868 1.00 . A A .  39 LYS HZ3  1 1 
       15  9207 1 1 39 LYS N    N   11.333  12.272   4.993 1.00 . A A .  39 LYS N    1 1 
       15  9208 1 1 39 LYS NZ   N    7.838  12.954  10.920 1.00 . A A .  39 LYS NZ   1 1 
       15  9209 1 1 39 LYS O    O   11.545  14.965   5.881 1.00 . A A .  39 LYS O    1 1 
       15  9210 1 1 40 PRO C    C    9.760  17.054   7.409 1.00 . A A .  40 PRO C    1 1 
       15  9211 1 1 40 PRO CA   C    9.178  16.429   6.146 1.00 . A A .  40 PRO CA   1 1 
       15  9212 1 1 40 PRO CB   C    7.665  16.653   6.087 1.00 . A A .  40 PRO CB   1 1 
       15  9213 1 1 40 PRO CD   C    8.006  14.295   6.287 1.00 . A A .  40 PRO CD   1 1 
       15  9214 1 1 40 PRO CG   C    7.076  15.414   6.668 1.00 . A A .  40 PRO CG   1 1 
       15  9215 1 1 40 PRO HA   H    9.644  16.874   5.279 1.00 . A A .  40 PRO HA   1 1 
       15  9216 1 1 40 PRO HB2  H    7.405  17.526   6.668 1.00 . A A .  40 PRO HB2  1 1 
       15  9217 1 1 40 PRO HB3  H    7.358  16.792   5.061 1.00 . A A .  40 PRO HB3  1 1 
       15  9218 1 1 40 PRO HD2  H    8.045  13.553   7.071 1.00 . A A .  40 PRO HD2  1 1 
       15  9219 1 1 40 PRO HD3  H    7.695  13.847   5.355 1.00 . A A .  40 PRO HD3  1 1 
       15  9220 1 1 40 PRO HG2  H    7.018  15.504   7.742 1.00 . A A .  40 PRO HG2  1 1 
       15  9221 1 1 40 PRO HG3  H    6.095  15.244   6.250 1.00 . A A .  40 PRO HG3  1 1 
       15  9222 1 1 40 PRO N    N    9.307  14.969   6.136 1.00 . A A .  40 PRO N    1 1 
       15  9223 1 1 40 PRO O    O    9.525  16.571   8.517 1.00 . A A .  40 PRO O    1 1 
       15  9224 1 1 41 SER C    C   12.112  17.901   9.093 1.00 . A A .  41 SER C    1 1 
       15  9225 1 1 41 SER CA   C   11.137  18.820   8.363 1.00 . A A .  41 SER CA   1 1 
       15  9226 1 1 41 SER CB   C   10.065  19.319   9.333 1.00 . A A .  41 SER CB   1 1 
       15  9227 1 1 41 SER H    H   10.669  18.469   6.328 1.00 . A A .  41 SER H    1 1 
       15  9228 1 1 41 SER HA   H   11.682  19.668   7.975 1.00 . A A .  41 SER HA   1 1 
       15  9229 1 1 41 SER HB2  H    9.408  18.502   9.591 1.00 . A A .  41 SER HB2  1 1 
       15  9230 1 1 41 SER HB3  H   10.540  19.696  10.227 1.00 . A A .  41 SER HB3  1 1 
       15  9231 1 1 41 SER HG   H    9.407  21.163   9.262 1.00 . A A .  41 SER HG   1 1 
       15  9232 1 1 41 SER N    N   10.519  18.131   7.236 1.00 . A A .  41 SER N    1 1 
       15  9233 1 1 41 SER O    O   12.180  17.900  10.322 1.00 . A A .  41 SER O    1 1 
       15  9234 1 1 41 SER OG   O    9.295  20.358   8.752 1.00 . A A .  41 SER OG   1 1 
       15  9235 1 1 42 GLY C    C   15.087  16.910   9.380 1.00 . A A .  42 GLY C    1 1 
       15  9236 1 1 42 GLY CA   C   13.827  16.206   8.917 1.00 . A A .  42 GLY CA   1 1 
       15  9237 1 1 42 GLY H    H   12.768  17.162   7.352 1.00 . A A .  42 GLY H    1 1 
       15  9238 1 1 42 GLY HA2  H   13.369  15.716   9.763 1.00 . A A .  42 GLY HA2  1 1 
       15  9239 1 1 42 GLY HA3  H   14.095  15.460   8.183 1.00 . A A .  42 GLY HA3  1 1 
       15  9240 1 1 42 GLY N    N   12.866  17.119   8.327 1.00 . A A .  42 GLY N    1 1 
       15  9241 1 1 42 GLY O    O   15.108  18.125   9.578 1.00 . A A .  42 GLY O    1 1 
       15  9242 1 1 43 PRO C    C   18.129  17.531   8.942 1.00 . A A .  43 PRO C    1 1 
       15  9243 1 1 43 PRO CA   C   17.458  16.673  10.008 1.00 . A A .  43 PRO CA   1 1 
       15  9244 1 1 43 PRO CB   C   18.287  15.416  10.284 1.00 . A A .  43 PRO CB   1 1 
       15  9245 1 1 43 PRO CD   C   16.215  14.681   9.345 1.00 . A A .  43 PRO CD   1 1 
       15  9246 1 1 43 PRO CG   C   17.684  14.366   9.416 1.00 . A A .  43 PRO CG   1 1 
       15  9247 1 1 43 PRO HA   H   17.355  17.245  10.919 1.00 . A A .  43 PRO HA   1 1 
       15  9248 1 1 43 PRO HB2  H   19.320  15.600  10.023 1.00 . A A .  43 PRO HB2  1 1 
       15  9249 1 1 43 PRO HB3  H   18.215  15.155  11.329 1.00 . A A .  43 PRO HB3  1 1 
       15  9250 1 1 43 PRO HD2  H   15.821  14.423   8.374 1.00 . A A .  43 PRO HD2  1 1 
       15  9251 1 1 43 PRO HD3  H   15.679  14.159  10.123 1.00 . A A .  43 PRO HD3  1 1 
       15  9252 1 1 43 PRO HG2  H   18.124  14.405   8.432 1.00 . A A .  43 PRO HG2  1 1 
       15  9253 1 1 43 PRO HG3  H   17.837  13.393   9.859 1.00 . A A .  43 PRO HG3  1 1 
       15  9254 1 1 43 PRO N    N   16.168  16.137   9.562 1.00 . A A .  43 PRO N    1 1 
       15  9255 1 1 43 PRO O    O   18.828  18.495   9.257 1.00 . A A .  43 PRO O    1 1 
       15  9256 1 1 44 SER C    C   17.597  17.852   5.338 1.00 . A A .  44 SER C    1 1 
       15  9257 1 1 44 SER CA   C   18.500  17.913   6.567 1.00 . A A .  44 SER CA   1 1 
       15  9258 1 1 44 SER CB   C   19.881  17.349   6.227 1.00 . A A .  44 SER CB   1 1 
       15  9259 1 1 44 SER H    H   17.346  16.398   7.493 1.00 . A A .  44 SER H    1 1 
       15  9260 1 1 44 SER HA   H   18.606  18.943   6.871 1.00 . A A .  44 SER HA   1 1 
       15  9261 1 1 44 SER HB2  H   20.467  17.271   7.130 1.00 . A A .  44 SER HB2  1 1 
       15  9262 1 1 44 SER HB3  H   19.768  16.370   5.785 1.00 . A A .  44 SER HB3  1 1 
       15  9263 1 1 44 SER HG   H   20.702  17.717   4.487 1.00 . A A .  44 SER HG   1 1 
       15  9264 1 1 44 SER N    N   17.913  17.176   7.680 1.00 . A A .  44 SER N    1 1 
       15  9265 1 1 44 SER O    O   17.521  16.827   4.660 1.00 . A A .  44 SER O    1 1 
       15  9266 1 1 44 SER OG   O   20.563  18.188   5.312 1.00 . A A .  44 SER OG   1 1 
       15  9267 1 1 45 SER C    C   16.648  19.817   2.772 1.00 . A A .  45 SER C    1 1 
       15  9268 1 1 45 SER CA   C   16.013  19.030   3.914 1.00 . A A .  45 SER CA   1 1 
       15  9269 1 1 45 SER CB   C   14.689  19.679   4.321 1.00 . A A .  45 SER CB   1 1 
       15  9270 1 1 45 SER H    H   17.018  19.742   5.637 1.00 . A A .  45 SER H    1 1 
       15  9271 1 1 45 SER HA   H   15.822  18.022   3.578 1.00 . A A .  45 SER HA   1 1 
       15  9272 1 1 45 SER HB2  H   13.956  19.511   3.548 1.00 . A A .  45 SER HB2  1 1 
       15  9273 1 1 45 SER HB3  H   14.345  19.239   5.246 1.00 . A A .  45 SER HB3  1 1 
       15  9274 1 1 45 SER HG   H   14.062  21.530   4.185 1.00 . A A .  45 SER HG   1 1 
       15  9275 1 1 45 SER N    N   16.914  18.957   5.058 1.00 . A A .  45 SER N    1 1 
       15  9276 1 1 45 SER O    O   17.193  20.901   2.977 1.00 . A A .  45 SER O    1 1 
       15  9277 1 1 45 SER OG   O   14.842  21.075   4.510 1.00 . A A .  45 SER OG   1 1 
       15  9278 1 1 46 GLY C    C   16.119  20.181  -0.678 1.00 . A A .  46 GLY C    1 1 
       15  9279 1 1 46 GLY CA   C   17.145  19.924   0.408 1.00 . A A .  46 GLY CA   1 1 
       15  9280 1 1 46 GLY H    H   16.127  18.395   1.462 1.00 . A A .  46 GLY H    1 1 
       15  9281 1 1 46 GLY HA2  H   17.569  20.867   0.718 1.00 . A A .  46 GLY HA2  1 1 
       15  9282 1 1 46 GLY HA3  H   17.931  19.303   0.004 1.00 . A A .  46 GLY HA3  1 1 
       15  9283 1 1 46 GLY N    N   16.574  19.262   1.566 1.00 . A A .  46 GLY N    1 1 
       15  9284 1 1 46 GLY O    O   15.363  19.271  -1.016 1.00 . A A .  46 GLY O    1 1 
       15  9285 2 2  1 ZN  ZN   ZN  -0.653   6.605  -3.497 1.00 . B A . 201 ZN  ZN   1 1 
       16  9286 1 1  1 GLY C    C  -30.932   4.588  -5.087 1.00 . A A .   1 GLY C    1 1 
       16  9287 1 1  1 GLY CA   C  -31.572   5.408  -3.984 1.00 . A A .   1 GLY CA   1 1 
       16  9288 1 1  1 GLY H1   H  -31.317   7.209  -5.067 1.00 . A A .   1 GLY H1   1 1 
       16  9289 1 1  1 GLY HA2  H  -30.895   5.454  -3.144 1.00 . A A .   1 GLY HA2  1 1 
       16  9290 1 1  1 GLY HA3  H  -32.484   4.920  -3.672 1.00 . A A .   1 GLY HA3  1 1 
       16  9291 1 1  1 GLY N    N  -31.887   6.760  -4.409 1.00 . A A .   1 GLY N    1 1 
       16  9292 1 1  1 GLY O    O  -29.707   4.541  -5.203 1.00 . A A .   1 GLY O    1 1 
       16  9293 1 1  2 SER C    C  -30.025   2.336  -6.571 1.00 . A A .   2 SER C    1 1 
       16  9294 1 1  2 SER CA   C  -31.269   3.112  -6.993 1.00 . A A .   2 SER CA   1 1 
       16  9295 1 1  2 SER CB   C  -30.952   3.980  -8.213 1.00 . A A .   2 SER CB   1 1 
       16  9296 1 1  2 SER H    H  -32.728   4.016  -5.754 1.00 . A A .   2 SER H    1 1 
       16  9297 1 1  2 SER HA   H  -32.046   2.410  -7.254 1.00 . A A .   2 SER HA   1 1 
       16  9298 1 1  2 SER HB2  H  -30.885   3.354  -9.089 1.00 . A A .   2 SER HB2  1 1 
       16  9299 1 1  2 SER HB3  H  -31.741   4.706  -8.349 1.00 . A A .   2 SER HB3  1 1 
       16  9300 1 1  2 SER HG   H  -29.897   5.576  -7.793 1.00 . A A .   2 SER HG   1 1 
       16  9301 1 1  2 SER N    N  -31.761   3.939  -5.898 1.00 . A A .   2 SER N    1 1 
       16  9302 1 1  2 SER O    O  -29.061   2.226  -7.329 1.00 . A A .   2 SER O    1 1 
       16  9303 1 1  2 SER OG   O  -29.724   4.666  -8.046 1.00 . A A .   2 SER OG   1 1 
       16  9304 1 1  3 SER C    C  -29.060  -0.441  -5.185 1.00 . A A .   3 SER C    1 1 
       16  9305 1 1  3 SER CA   C  -28.929   1.036  -4.829 1.00 . A A .   3 SER CA   1 1 
       16  9306 1 1  3 SER CB   C  -28.839   1.201  -3.311 1.00 . A A .   3 SER CB   1 1 
       16  9307 1 1  3 SER H    H  -30.851   1.922  -4.798 1.00 . A A .   3 SER H    1 1 
       16  9308 1 1  3 SER HA   H  -28.026   1.424  -5.278 1.00 . A A .   3 SER HA   1 1 
       16  9309 1 1  3 SER HB2  H  -29.103   2.213  -3.044 1.00 . A A .   3 SER HB2  1 1 
       16  9310 1 1  3 SER HB3  H  -29.524   0.513  -2.836 1.00 . A A .   3 SER HB3  1 1 
       16  9311 1 1  3 SER HG   H  -27.342   1.481  -2.078 1.00 . A A .   3 SER HG   1 1 
       16  9312 1 1  3 SER N    N  -30.054   1.800  -5.355 1.00 . A A .   3 SER N    1 1 
       16  9313 1 1  3 SER O    O  -30.165  -0.978  -5.257 1.00 . A A .   3 SER O    1 1 
       16  9314 1 1  3 SER OG   O  -27.527   0.934  -2.845 1.00 . A A .   3 SER OG   1 1 
       16  9315 1 1  4 GLY C    C  -27.718  -3.397  -4.549 1.00 . A A .   4 GLY C    1 1 
       16  9316 1 1  4 GLY CA   C  -27.932  -2.503  -5.754 1.00 . A A .   4 GLY CA   1 1 
       16  9317 1 1  4 GLY H    H  -27.071  -0.614  -5.337 1.00 . A A .   4 GLY H    1 1 
       16  9318 1 1  4 GLY HA2  H  -28.882  -2.745  -6.206 1.00 . A A .   4 GLY HA2  1 1 
       16  9319 1 1  4 GLY HA3  H  -27.145  -2.690  -6.471 1.00 . A A .   4 GLY HA3  1 1 
       16  9320 1 1  4 GLY N    N  -27.923  -1.093  -5.408 1.00 . A A .   4 GLY N    1 1 
       16  9321 1 1  4 GLY O    O  -27.176  -2.963  -3.533 1.00 . A A .   4 GLY O    1 1 
       16  9322 1 1  5 SER C    C  -26.742  -6.443  -3.741 1.00 . A A .   5 SER C    1 1 
       16  9323 1 1  5 SER CA   C  -28.006  -5.607  -3.569 1.00 . A A .   5 SER CA   1 1 
       16  9324 1 1  5 SER CB   C  -29.231  -6.521  -3.502 1.00 . A A .   5 SER CB   1 1 
       16  9325 1 1  5 SER H    H  -28.573  -4.937  -5.496 1.00 . A A .   5 SER H    1 1 
       16  9326 1 1  5 SER HA   H  -27.932  -5.050  -2.647 1.00 . A A .   5 SER HA   1 1 
       16  9327 1 1  5 SER HB2  H  -29.072  -7.276  -2.747 1.00 . A A .   5 SER HB2  1 1 
       16  9328 1 1  5 SER HB3  H  -30.101  -5.934  -3.247 1.00 . A A .   5 SER HB3  1 1 
       16  9329 1 1  5 SER HG   H  -28.618  -7.397  -5.144 1.00 . A A .   5 SER HG   1 1 
       16  9330 1 1  5 SER N    N  -28.148  -4.650  -4.661 1.00 . A A .   5 SER N    1 1 
       16  9331 1 1  5 SER O    O  -26.782  -7.542  -4.294 1.00 . A A .   5 SER O    1 1 
       16  9332 1 1  5 SER OG   O  -29.459  -7.160  -4.746 1.00 . A A .   5 SER OG   1 1 
       16  9333 1 1  6 SER C    C  -23.454  -6.293  -2.167 1.00 . A A .   6 SER C    1 1 
       16  9334 1 1  6 SER CA   C  -24.342  -6.609  -3.366 1.00 . A A .   6 SER CA   1 1 
       16  9335 1 1  6 SER CB   C  -23.628  -6.218  -4.662 1.00 . A A .   6 SER CB   1 1 
       16  9336 1 1  6 SER H    H  -25.653  -5.034  -2.833 1.00 . A A .   6 SER H    1 1 
       16  9337 1 1  6 SER HA   H  -24.542  -7.670  -3.382 1.00 . A A .   6 SER HA   1 1 
       16  9338 1 1  6 SER HB2  H  -24.341  -6.203  -5.472 1.00 . A A .   6 SER HB2  1 1 
       16  9339 1 1  6 SER HB3  H  -23.193  -5.236  -4.547 1.00 . A A .   6 SER HB3  1 1 
       16  9340 1 1  6 SER HG   H  -22.462  -7.157  -5.925 1.00 . A A .   6 SER HG   1 1 
       16  9341 1 1  6 SER N    N  -25.620  -5.914  -3.263 1.00 . A A .   6 SER N    1 1 
       16  9342 1 1  6 SER O    O  -23.290  -5.134  -1.790 1.00 . A A .   6 SER O    1 1 
       16  9343 1 1  6 SER OG   O  -22.599  -7.140  -4.975 1.00 . A A .   6 SER OG   1 1 
       16  9344 1 1  7 GLY C    C  -20.704  -7.898  -0.556 1.00 . A A .   7 GLY C    1 1 
       16  9345 1 1  7 GLY CA   C  -22.016  -7.149  -0.422 1.00 . A A .   7 GLY CA   1 1 
       16  9346 1 1  7 GLY H    H  -23.047  -8.238  -1.917 1.00 . A A .   7 GLY H    1 1 
       16  9347 1 1  7 GLY HA2  H  -21.808  -6.096  -0.308 1.00 . A A .   7 GLY HA2  1 1 
       16  9348 1 1  7 GLY HA3  H  -22.529  -7.502   0.461 1.00 . A A .   7 GLY HA3  1 1 
       16  9349 1 1  7 GLY N    N  -22.881  -7.335  -1.572 1.00 . A A .   7 GLY N    1 1 
       16  9350 1 1  7 GLY O    O  -20.662  -8.994  -1.113 1.00 . A A .   7 GLY O    1 1 
       16  9351 1 1  8 ALA C    C  -17.309  -7.164   0.754 1.00 . A A .   8 ALA C    1 1 
       16  9352 1 1  8 ALA CA   C  -18.312  -7.921  -0.110 1.00 . A A .   8 ALA CA   1 1 
       16  9353 1 1  8 ALA CB   C  -17.829  -7.983  -1.552 1.00 . A A .   8 ALA CB   1 1 
       16  9354 1 1  8 ALA H    H  -19.729  -6.429   0.387 1.00 . A A .   8 ALA H    1 1 
       16  9355 1 1  8 ALA HA   H  -18.399  -8.933   0.259 1.00 . A A .   8 ALA HA   1 1 
       16  9356 1 1  8 ALA HB1  H  -18.374  -8.752  -2.080 1.00 . A A .   8 ALA HB1  1 1 
       16  9357 1 1  8 ALA HB2  H  -17.998  -7.029  -2.029 1.00 . A A .   8 ALA HB2  1 1 
       16  9358 1 1  8 ALA HB3  H  -16.774  -8.213  -1.568 1.00 . A A .   8 ALA HB3  1 1 
       16  9359 1 1  8 ALA N    N  -19.631  -7.303  -0.045 1.00 . A A .   8 ALA N    1 1 
       16  9360 1 1  8 ALA O    O  -17.406  -5.949   0.915 1.00 . A A .   8 ALA O    1 1 
       16  9361 1 1  9 GLY C    C  -14.056  -6.975   1.397 1.00 . A A .   9 GLY C    1 1 
       16  9362 1 1  9 GLY CA   C  -15.337  -7.273   2.150 1.00 . A A .   9 GLY CA   1 1 
       16  9363 1 1  9 GLY H    H  -16.317  -8.859   1.145 1.00 . A A .   9 GLY H    1 1 
       16  9364 1 1  9 GLY HA2  H  -15.733  -6.350   2.546 1.00 . A A .   9 GLY HA2  1 1 
       16  9365 1 1  9 GLY HA3  H  -15.112  -7.938   2.971 1.00 . A A .   9 GLY HA3  1 1 
       16  9366 1 1  9 GLY N    N  -16.344  -7.893   1.308 1.00 . A A .   9 GLY N    1 1 
       16  9367 1 1  9 GLY O    O  -13.221  -7.859   1.207 1.00 . A A .   9 GLY O    1 1 
       16  9368 1 1 10 GLU C    C  -11.449  -5.586   1.037 1.00 . A A .  10 GLU C    1 1 
       16  9369 1 1 10 GLU CA   C  -12.713  -5.316   0.227 1.00 . A A .  10 GLU CA   1 1 
       16  9370 1 1 10 GLU CB   C  -12.796  -3.831  -0.131 1.00 . A A .  10 GLU CB   1 1 
       16  9371 1 1 10 GLU CD   C  -13.365  -2.304  -2.061 1.00 . A A .  10 GLU CD   1 1 
       16  9372 1 1 10 GLU CG   C  -13.763  -3.530  -1.263 1.00 . A A .  10 GLU CG   1 1 
       16  9373 1 1 10 GLU H    H  -14.603  -5.068   1.148 1.00 . A A .  10 GLU H    1 1 
       16  9374 1 1 10 GLU HA   H  -12.673  -5.894  -0.684 1.00 . A A .  10 GLU HA   1 1 
       16  9375 1 1 10 GLU HB2  H  -13.113  -3.280   0.742 1.00 . A A .  10 GLU HB2  1 1 
       16  9376 1 1 10 GLU HB3  H  -11.814  -3.489  -0.424 1.00 . A A .  10 GLU HB3  1 1 
       16  9377 1 1 10 GLU HG2  H  -13.793  -4.380  -1.929 1.00 . A A .  10 GLU HG2  1 1 
       16  9378 1 1 10 GLU HG3  H  -14.746  -3.367  -0.846 1.00 . A A .  10 GLU HG3  1 1 
       16  9379 1 1 10 GLU N    N  -13.902  -5.727   0.966 1.00 . A A .  10 GLU N    1 1 
       16  9380 1 1 10 GLU O    O  -11.510  -5.841   2.240 1.00 . A A .  10 GLU O    1 1 
       16  9381 1 1 10 GLU OE1  O  -12.154  -2.129  -2.313 1.00 . A A .  10 GLU OE1  1 1 
       16  9382 1 1 10 GLU OE2  O  -14.262  -1.520  -2.434 1.00 . A A .  10 GLU OE2  1 1 
       16  9383 1 1 11 LYS C    C   -8.734  -4.687   2.063 1.00 . A A .  11 LYS C    1 1 
       16  9384 1 1 11 LYS CA   C   -9.021  -5.766   1.024 1.00 . A A .  11 LYS CA   1 1 
       16  9385 1 1 11 LYS CB   C   -7.894  -5.804  -0.012 1.00 . A A .  11 LYS CB   1 1 
       16  9386 1 1 11 LYS CD   C   -8.588  -7.536  -1.694 1.00 . A A .  11 LYS CD   1 1 
       16  9387 1 1 11 LYS CE   C   -8.714  -9.040  -1.879 1.00 . A A .  11 LYS CE   1 1 
       16  9388 1 1 11 LYS CG   C   -7.627  -7.192  -0.568 1.00 . A A .  11 LYS CG   1 1 
       16  9389 1 1 11 LYS H    H  -10.317  -5.321  -0.590 1.00 . A A .  11 LYS H    1 1 
       16  9390 1 1 11 LYS HA   H   -9.075  -6.722   1.521 1.00 . A A .  11 LYS HA   1 1 
       16  9391 1 1 11 LYS HB2  H   -8.155  -5.154  -0.833 1.00 . A A .  11 LYS HB2  1 1 
       16  9392 1 1 11 LYS HB3  H   -6.986  -5.443   0.449 1.00 . A A .  11 LYS HB3  1 1 
       16  9393 1 1 11 LYS HD2  H   -9.561  -7.130  -1.462 1.00 . A A .  11 LYS HD2  1 1 
       16  9394 1 1 11 LYS HD3  H   -8.223  -7.098  -2.613 1.00 . A A .  11 LYS HD3  1 1 
       16  9395 1 1 11 LYS HE2  H   -9.187  -9.235  -2.829 1.00 . A A .  11 LYS HE2  1 1 
       16  9396 1 1 11 LYS HE3  H   -7.725  -9.475  -1.874 1.00 . A A .  11 LYS HE3  1 1 
       16  9397 1 1 11 LYS HG2  H   -6.617  -7.230  -0.947 1.00 . A A .  11 LYS HG2  1 1 
       16  9398 1 1 11 LYS HG3  H   -7.743  -7.917   0.226 1.00 . A A .  11 LYS HG3  1 1 
       16  9399 1 1 11 LYS HZ1  H   -8.928 -10.298  -0.225 1.00 . A A .  11 LYS HZ1  1 1 
       16  9400 1 1 11 LYS HZ2  H  -10.302 -10.219  -1.208 1.00 . A A .  11 LYS HZ2  1 1 
       16  9401 1 1 11 LYS HZ3  H   -9.923  -8.931  -0.179 1.00 . A A .  11 LYS HZ3  1 1 
       16  9402 1 1 11 LYS N    N  -10.302  -5.529   0.368 1.00 . A A .  11 LYS N    1 1 
       16  9403 1 1 11 LYS NZ   N   -9.523  -9.666  -0.797 1.00 . A A .  11 LYS NZ   1 1 
       16  9404 1 1 11 LYS O    O   -9.083  -3.519   1.893 1.00 . A A .  11 LYS O    1 1 
       16  9405 1 1 12 PRO C    C   -6.644  -3.176   3.847 1.00 . A A .  12 PRO C    1 1 
       16  9406 1 1 12 PRO CA   C   -7.731  -4.166   4.252 1.00 . A A .  12 PRO CA   1 1 
       16  9407 1 1 12 PRO CB   C   -7.220  -5.098   5.354 1.00 . A A .  12 PRO CB   1 1 
       16  9408 1 1 12 PRO CD   C   -7.634  -6.462   3.434 1.00 . A A .  12 PRO CD   1 1 
       16  9409 1 1 12 PRO CG   C   -6.738  -6.309   4.632 1.00 . A A .  12 PRO CG   1 1 
       16  9410 1 1 12 PRO HA   H   -8.595  -3.625   4.608 1.00 . A A .  12 PRO HA   1 1 
       16  9411 1 1 12 PRO HB2  H   -6.420  -4.615   5.896 1.00 . A A .  12 PRO HB2  1 1 
       16  9412 1 1 12 PRO HB3  H   -8.027  -5.338   6.030 1.00 . A A .  12 PRO HB3  1 1 
       16  9413 1 1 12 PRO HD2  H   -7.080  -6.858   2.597 1.00 . A A .  12 PRO HD2  1 1 
       16  9414 1 1 12 PRO HD3  H   -8.473  -7.100   3.670 1.00 . A A .  12 PRO HD3  1 1 
       16  9415 1 1 12 PRO HG2  H   -5.715  -6.167   4.320 1.00 . A A .  12 PRO HG2  1 1 
       16  9416 1 1 12 PRO HG3  H   -6.819  -7.175   5.273 1.00 . A A .  12 PRO HG3  1 1 
       16  9417 1 1 12 PRO N    N   -8.081  -5.085   3.165 1.00 . A A .  12 PRO N    1 1 
       16  9418 1 1 12 PRO O    O   -6.322  -2.252   4.595 1.00 . A A .  12 PRO O    1 1 
       16  9419 1 1 13 TYR C    C   -5.610  -1.410   1.259 1.00 . A A .  13 TYR C    1 1 
       16  9420 1 1 13 TYR CA   C   -5.030  -2.499   2.157 1.00 . A A .  13 TYR CA   1 1 
       16  9421 1 1 13 TYR CB   C   -3.989  -3.311   1.385 1.00 . A A .  13 TYR CB   1 1 
       16  9422 1 1 13 TYR CD1  C   -3.024  -4.761   3.214 1.00 . A A .  13 TYR CD1  1 1 
       16  9423 1 1 13 TYR CD2  C   -4.088  -5.834   1.370 1.00 . A A .  13 TYR CD2  1 1 
       16  9424 1 1 13 TYR CE1  C   -2.753  -5.992   3.779 1.00 . A A .  13 TYR CE1  1 1 
       16  9425 1 1 13 TYR CE2  C   -3.822  -7.069   1.929 1.00 . A A .  13 TYR CE2  1 1 
       16  9426 1 1 13 TYR CG   C   -3.694  -4.660   2.001 1.00 . A A .  13 TYR CG   1 1 
       16  9427 1 1 13 TYR CZ   C   -3.154  -7.143   3.134 1.00 . A A .  13 TYR CZ   1 1 
       16  9428 1 1 13 TYR H    H   -6.381  -4.128   2.109 1.00 . A A .  13 TYR H    1 1 
       16  9429 1 1 13 TYR HA   H   -4.552  -2.033   3.006 1.00 . A A .  13 TYR HA   1 1 
       16  9430 1 1 13 TYR HB2  H   -4.344  -3.477   0.379 1.00 . A A .  13 TYR HB2  1 1 
       16  9431 1 1 13 TYR HB3  H   -3.064  -2.755   1.347 1.00 . A A .  13 TYR HB3  1 1 
       16  9432 1 1 13 TYR HD1  H   -2.712  -3.857   3.717 1.00 . A A .  13 TYR HD1  1 1 
       16  9433 1 1 13 TYR HD2  H   -4.611  -5.774   0.427 1.00 . A A .  13 TYR HD2  1 1 
       16  9434 1 1 13 TYR HE1  H   -2.230  -6.049   4.723 1.00 . A A .  13 TYR HE1  1 1 
       16  9435 1 1 13 TYR HE2  H   -4.135  -7.971   1.424 1.00 . A A .  13 TYR HE2  1 1 
       16  9436 1 1 13 TYR HH   H   -3.605  -8.976   3.497 1.00 . A A .  13 TYR HH   1 1 
       16  9437 1 1 13 TYR N    N   -6.082  -3.374   2.660 1.00 . A A .  13 TYR N    1 1 
       16  9438 1 1 13 TYR O    O   -6.662  -1.590   0.647 1.00 . A A .  13 TYR O    1 1 
       16  9439 1 1 13 TYR OH   O   -2.886  -8.370   3.695 1.00 . A A .  13 TYR OH   1 1 
       16  9440 1 1 14 GLY C    C   -4.569   2.088   0.584 1.00 . A A .  14 GLY C    1 1 
       16  9441 1 1 14 GLY CA   C   -5.374   0.822   0.361 1.00 . A A .  14 GLY CA   1 1 
       16  9442 1 1 14 GLY H    H   -4.082  -0.193   1.697 1.00 . A A .  14 GLY H    1 1 
       16  9443 1 1 14 GLY HA2  H   -5.297   0.537  -0.677 1.00 . A A .  14 GLY HA2  1 1 
       16  9444 1 1 14 GLY HA3  H   -6.410   1.023   0.594 1.00 . A A .  14 GLY HA3  1 1 
       16  9445 1 1 14 GLY N    N   -4.914  -0.280   1.186 1.00 . A A .  14 GLY N    1 1 
       16  9446 1 1 14 GLY O    O   -4.629   2.690   1.656 1.00 . A A .  14 GLY O    1 1 
       16  9447 1 1 15 CYS C    C   -3.805   4.872   0.180 1.00 . A A .  15 CYS C    1 1 
       16  9448 1 1 15 CYS CA   C   -2.990   3.692  -0.342 1.00 . A A .  15 CYS CA   1 1 
       16  9449 1 1 15 CYS CB   C   -2.399   4.033  -1.712 1.00 . A A .  15 CYS CB   1 1 
       16  9450 1 1 15 CYS H    H   -3.807   1.969  -1.262 1.00 . A A .  15 CYS H    1 1 
       16  9451 1 1 15 CYS HA   H   -2.185   3.493   0.348 1.00 . A A .  15 CYS HA   1 1 
       16  9452 1 1 15 CYS HB2  H   -1.641   3.305  -1.959 1.00 . A A .  15 CYS HB2  1 1 
       16  9453 1 1 15 CYS HB3  H   -3.183   3.995  -2.454 1.00 . A A .  15 CYS HB3  1 1 
       16  9454 1 1 15 CYS N    N   -3.813   2.492  -0.432 1.00 . A A .  15 CYS N    1 1 
       16  9455 1 1 15 CYS O    O   -4.558   5.499  -0.565 1.00 . A A .  15 CYS O    1 1 
       16  9456 1 1 15 CYS SG   S   -1.631   5.683  -1.800 1.00 . A A .  15 CYS SG   1 1 
       16  9457 1 1 16 SER C    C   -3.656   7.596   1.848 1.00 . A A .  16 SER C    1 1 
       16  9458 1 1 16 SER CA   C   -4.372   6.271   2.090 1.00 . A A .  16 SER CA   1 1 
       16  9459 1 1 16 SER CB   C   -4.520   6.026   3.593 1.00 . A A .  16 SER CB   1 1 
       16  9460 1 1 16 SER H    H   -3.033   4.632   2.009 1.00 . A A .  16 SER H    1 1 
       16  9461 1 1 16 SER HA   H   -5.353   6.318   1.643 1.00 . A A .  16 SER HA   1 1 
       16  9462 1 1 16 SER HB2  H   -4.930   6.908   4.060 1.00 . A A .  16 SER HB2  1 1 
       16  9463 1 1 16 SER HB3  H   -5.185   5.190   3.754 1.00 . A A .  16 SER HB3  1 1 
       16  9464 1 1 16 SER HG   H   -3.395   5.133   4.925 1.00 . A A .  16 SER HG   1 1 
       16  9465 1 1 16 SER N    N   -3.648   5.169   1.466 1.00 . A A .  16 SER N    1 1 
       16  9466 1 1 16 SER O    O   -3.574   8.441   2.739 1.00 . A A .  16 SER O    1 1 
       16  9467 1 1 16 SER OG   O   -3.267   5.734   4.188 1.00 . A A .  16 SER OG   1 1 
       16  9468 1 1 17 GLU C    C   -3.055   9.642  -0.956 1.00 . A A .  17 GLU C    1 1 
       16  9469 1 1 17 GLU CA   C   -2.430   8.992   0.275 1.00 . A A .  17 GLU CA   1 1 
       16  9470 1 1 17 GLU CB   C   -0.953   8.692   0.013 1.00 . A A .  17 GLU CB   1 1 
       16  9471 1 1 17 GLU CD   C    0.449  10.620   0.849 1.00 . A A .  17 GLU CD   1 1 
       16  9472 1 1 17 GLU CG   C   -0.140   9.920  -0.360 1.00 . A A .  17 GLU CG   1 1 
       16  9473 1 1 17 GLU H    H   -3.238   7.060  -0.033 1.00 . A A .  17 GLU H    1 1 
       16  9474 1 1 17 GLU HA   H   -2.507   9.677   1.107 1.00 . A A .  17 GLU HA   1 1 
       16  9475 1 1 17 GLU HB2  H   -0.523   8.257   0.903 1.00 . A A .  17 GLU HB2  1 1 
       16  9476 1 1 17 GLU HB3  H   -0.882   7.980  -0.796 1.00 . A A .  17 GLU HB3  1 1 
       16  9477 1 1 17 GLU HG2  H    0.668   9.618  -1.010 1.00 . A A .  17 GLU HG2  1 1 
       16  9478 1 1 17 GLU HG3  H   -0.780  10.615  -0.884 1.00 . A A .  17 GLU HG3  1 1 
       16  9479 1 1 17 GLU N    N   -3.140   7.770   0.635 1.00 . A A .  17 GLU N    1 1 
       16  9480 1 1 17 GLU O    O   -3.438  10.812  -0.928 1.00 . A A .  17 GLU O    1 1 
       16  9481 1 1 17 GLU OE1  O    0.828   9.920   1.812 1.00 . A A .  17 GLU OE1  1 1 
       16  9482 1 1 17 GLU OE2  O    0.530  11.866   0.834 1.00 . A A .  17 GLU OE2  1 1 
       16  9483 1 1 18 CYS C    C   -5.080   8.715  -3.555 1.00 . A A .  18 CYS C    1 1 
       16  9484 1 1 18 CYS CA   C   -3.732   9.374  -3.278 1.00 . A A .  18 CYS CA   1 1 
       16  9485 1 1 18 CYS CB   C   -2.778   9.119  -4.447 1.00 . A A .  18 CYS CB   1 1 
       16  9486 1 1 18 CYS H    H   -2.832   7.949  -1.997 1.00 . A A .  18 CYS H    1 1 
       16  9487 1 1 18 CYS HA   H   -3.881  10.437  -3.172 1.00 . A A .  18 CYS HA   1 1 
       16  9488 1 1 18 CYS HB2  H   -3.079   9.729  -5.286 1.00 . A A .  18 CYS HB2  1 1 
       16  9489 1 1 18 CYS HB3  H   -1.776   9.393  -4.150 1.00 . A A .  18 CYS HB3  1 1 
       16  9490 1 1 18 CYS N    N   -3.155   8.875  -2.036 1.00 . A A .  18 CYS N    1 1 
       16  9491 1 1 18 CYS O    O   -6.034   9.375  -3.965 1.00 . A A .  18 CYS O    1 1 
       16  9492 1 1 18 CYS SG   S   -2.737   7.386  -5.009 1.00 . A A .  18 CYS SG   1 1 
       16  9493 1 1 19 GLY C    C   -6.197   5.494  -4.482 1.00 . A A .  19 GLY C    1 1 
       16  9494 1 1 19 GLY CA   C   -6.386   6.680  -3.557 1.00 . A A .  19 GLY CA   1 1 
       16  9495 1 1 19 GLY H    H   -4.359   6.931  -3.000 1.00 . A A .  19 GLY H    1 1 
       16  9496 1 1 19 GLY HA2  H   -6.766   6.327  -2.610 1.00 . A A .  19 GLY HA2  1 1 
       16  9497 1 1 19 GLY HA3  H   -7.110   7.351  -3.996 1.00 . A A .  19 GLY HA3  1 1 
       16  9498 1 1 19 GLY N    N   -5.152   7.407  -3.327 1.00 . A A .  19 GLY N    1 1 
       16  9499 1 1 19 GLY O    O   -7.020   5.247  -5.365 1.00 . A A .  19 GLY O    1 1 
       16  9500 1 1 20 LYS C    C   -4.863   2.312  -4.274 1.00 . A A .  20 LYS C    1 1 
       16  9501 1 1 20 LYS CA   C   -4.813   3.590  -5.105 1.00 . A A .  20 LYS CA   1 1 
       16  9502 1 1 20 LYS CB   C   -3.436   3.735  -5.755 1.00 . A A .  20 LYS CB   1 1 
       16  9503 1 1 20 LYS CD   C   -2.038   3.418  -7.818 1.00 . A A .  20 LYS CD   1 1 
       16  9504 1 1 20 LYS CE   C   -2.016   2.880  -9.241 1.00 . A A .  20 LYS CE   1 1 
       16  9505 1 1 20 LYS CG   C   -3.319   3.034  -7.097 1.00 . A A .  20 LYS CG   1 1 
       16  9506 1 1 20 LYS H    H   -4.491   5.004  -3.563 1.00 . A A .  20 LYS H    1 1 
       16  9507 1 1 20 LYS HA   H   -5.563   3.531  -5.880 1.00 . A A .  20 LYS HA   1 1 
       16  9508 1 1 20 LYS HB2  H   -3.229   4.785  -5.902 1.00 . A A .  20 LYS HB2  1 1 
       16  9509 1 1 20 LYS HB3  H   -2.692   3.321  -5.090 1.00 . A A .  20 LYS HB3  1 1 
       16  9510 1 1 20 LYS HD2  H   -1.963   4.495  -7.852 1.00 . A A .  20 LYS HD2  1 1 
       16  9511 1 1 20 LYS HD3  H   -1.195   3.013  -7.276 1.00 . A A .  20 LYS HD3  1 1 
       16  9512 1 1 20 LYS HE2  H   -2.590   1.967  -9.275 1.00 . A A .  20 LYS HE2  1 1 
       16  9513 1 1 20 LYS HE3  H   -2.465   3.612  -9.895 1.00 . A A .  20 LYS HE3  1 1 
       16  9514 1 1 20 LYS HG2  H   -3.323   1.966  -6.937 1.00 . A A .  20 LYS HG2  1 1 
       16  9515 1 1 20 LYS HG3  H   -4.164   3.310  -7.712 1.00 . A A .  20 LYS HG3  1 1 
       16  9516 1 1 20 LYS HZ1  H   -0.064   3.472  -9.693 1.00 . A A .  20 LYS HZ1  1 1 
       16  9517 1 1 20 LYS HZ2  H   -0.648   2.226 -10.677 1.00 . A A .  20 LYS HZ2  1 1 
       16  9518 1 1 20 LYS HZ3  H   -0.179   1.897  -9.085 1.00 . A A .  20 LYS HZ3  1 1 
       16  9519 1 1 20 LYS N    N   -5.110   4.757  -4.282 1.00 . A A .  20 LYS N    1 1 
       16  9520 1 1 20 LYS NZ   N   -0.630   2.599  -9.706 1.00 . A A .  20 LYS NZ   1 1 
       16  9521 1 1 20 LYS O    O   -4.084   2.139  -3.337 1.00 . A A .  20 LYS O    1 1 
       16  9522 1 1 21 ALA C    C   -5.254  -0.983  -4.671 1.00 . A A .  21 ALA C    1 1 
       16  9523 1 1 21 ALA CA   C   -5.931   0.155  -3.914 1.00 . A A .  21 ALA CA   1 1 
       16  9524 1 1 21 ALA CB   C   -7.403  -0.157  -3.694 1.00 . A A .  21 ALA CB   1 1 
       16  9525 1 1 21 ALA H    H   -6.374   1.614  -5.382 1.00 . A A .  21 ALA H    1 1 
       16  9526 1 1 21 ALA HA   H   -5.461   0.260  -2.947 1.00 . A A .  21 ALA HA   1 1 
       16  9527 1 1 21 ALA HB1  H   -7.502  -1.141  -3.260 1.00 . A A .  21 ALA HB1  1 1 
       16  9528 1 1 21 ALA HB2  H   -7.829   0.576  -3.025 1.00 . A A .  21 ALA HB2  1 1 
       16  9529 1 1 21 ALA HB3  H   -7.923  -0.127  -4.640 1.00 . A A .  21 ALA HB3  1 1 
       16  9530 1 1 21 ALA N    N   -5.783   1.419  -4.626 1.00 . A A .  21 ALA N    1 1 
       16  9531 1 1 21 ALA O    O   -5.215  -0.987  -5.902 1.00 . A A .  21 ALA O    1 1 
       16  9532 1 1 22 PHE C    C   -4.554  -4.400  -3.931 1.00 . A A .  22 PHE C    1 1 
       16  9533 1 1 22 PHE CA   C   -4.046  -3.091  -4.529 1.00 . A A .  22 PHE CA   1 1 
       16  9534 1 1 22 PHE CB   C   -2.533  -2.979  -4.328 1.00 . A A .  22 PHE CB   1 1 
       16  9535 1 1 22 PHE CD1  C   -1.966  -0.579  -3.867 1.00 . A A .  22 PHE CD1  1 1 
       16  9536 1 1 22 PHE CD2  C   -1.445  -1.474  -6.015 1.00 . A A .  22 PHE CD2  1 1 
       16  9537 1 1 22 PHE CE1  C   -1.448   0.645  -4.247 1.00 . A A .  22 PHE CE1  1 1 
       16  9538 1 1 22 PHE CE2  C   -0.926  -0.253  -6.401 1.00 . A A .  22 PHE CE2  1 1 
       16  9539 1 1 22 PHE CG   C   -1.970  -1.651  -4.745 1.00 . A A .  22 PHE CG   1 1 
       16  9540 1 1 22 PHE CZ   C   -0.928   0.809  -5.516 1.00 . A A .  22 PHE CZ   1 1 
       16  9541 1 1 22 PHE H    H   -4.786  -1.889  -2.951 1.00 . A A .  22 PHE H    1 1 
       16  9542 1 1 22 PHE HA   H   -4.262  -3.085  -5.586 1.00 . A A .  22 PHE HA   1 1 
       16  9543 1 1 22 PHE HB2  H   -2.305  -3.122  -3.282 1.00 . A A .  22 PHE HB2  1 1 
       16  9544 1 1 22 PHE HB3  H   -2.043  -3.746  -4.908 1.00 . A A .  22 PHE HB3  1 1 
       16  9545 1 1 22 PHE HD1  H   -2.373  -0.705  -2.873 1.00 . A A .  22 PHE HD1  1 1 
       16  9546 1 1 22 PHE HD2  H   -1.443  -2.302  -6.708 1.00 . A A .  22 PHE HD2  1 1 
       16  9547 1 1 22 PHE HE1  H   -1.452   1.472  -3.553 1.00 . A A .  22 PHE HE1  1 1 
       16  9548 1 1 22 PHE HE2  H   -0.520  -0.127  -7.394 1.00 . A A .  22 PHE HE2  1 1 
       16  9549 1 1 22 PHE HZ   H   -0.522   1.763  -5.815 1.00 . A A .  22 PHE HZ   1 1 
       16  9550 1 1 22 PHE N    N   -4.723  -1.948  -3.928 1.00 . A A .  22 PHE N    1 1 
       16  9551 1 1 22 PHE O    O   -4.778  -4.498  -2.725 1.00 . A A .  22 PHE O    1 1 
       16  9552 1 1 23 SER C    C   -4.352  -7.254  -3.214 1.00 . A A .  23 SER C    1 1 
       16  9553 1 1 23 SER CA   C   -5.220  -6.705  -4.343 1.00 . A A .  23 SER CA   1 1 
       16  9554 1 1 23 SER CB   C   -5.239  -7.690  -5.513 1.00 . A A .  23 SER CB   1 1 
       16  9555 1 1 23 SER H    H   -4.538  -5.263  -5.735 1.00 . A A .  23 SER H    1 1 
       16  9556 1 1 23 SER HA   H   -6.228  -6.575  -3.975 1.00 . A A .  23 SER HA   1 1 
       16  9557 1 1 23 SER HB2  H   -4.232  -7.841  -5.869 1.00 . A A .  23 SER HB2  1 1 
       16  9558 1 1 23 SER HB3  H   -5.649  -8.632  -5.180 1.00 . A A .  23 SER HB3  1 1 
       16  9559 1 1 23 SER HG   H   -6.069  -6.240  -6.537 1.00 . A A .  23 SER HG   1 1 
       16  9560 1 1 23 SER N    N   -4.734  -5.403  -4.784 1.00 . A A .  23 SER N    1 1 
       16  9561 1 1 23 SER O    O   -4.862  -7.761  -2.215 1.00 . A A .  23 SER O    1 1 
       16  9562 1 1 23 SER OG   O   -6.032  -7.199  -6.580 1.00 . A A .  23 SER OG   1 1 
       16  9563 1 1 24 SER C    C   -1.519  -6.485  -1.570 1.00 . A A .  24 SER C    1 1 
       16  9564 1 1 24 SER CA   C   -2.098  -7.640  -2.382 1.00 . A A .  24 SER CA   1 1 
       16  9565 1 1 24 SER CB   C   -0.968  -8.423  -3.053 1.00 . A A .  24 SER CB   1 1 
       16  9566 1 1 24 SER H    H   -2.693  -6.737  -4.202 1.00 . A A .  24 SER H    1 1 
       16  9567 1 1 24 SER HA   H   -2.635  -8.299  -1.716 1.00 . A A .  24 SER HA   1 1 
       16  9568 1 1 24 SER HB2  H   -0.607  -7.871  -3.907 1.00 . A A .  24 SER HB2  1 1 
       16  9569 1 1 24 SER HB3  H   -0.161  -8.562  -2.347 1.00 . A A .  24 SER HB3  1 1 
       16  9570 1 1 24 SER HG   H   -2.111 -10.007  -2.903 1.00 . A A .  24 SER HG   1 1 
       16  9571 1 1 24 SER N    N   -3.038  -7.150  -3.383 1.00 . A A .  24 SER N    1 1 
       16  9572 1 1 24 SER O    O   -1.678  -5.318  -1.927 1.00 . A A .  24 SER O    1 1 
       16  9573 1 1 24 SER OG   O   -1.418  -9.695  -3.489 1.00 . A A .  24 SER OG   1 1 
       16  9574 1 1 25 LYS C    C    1.101  -5.351  -0.170 1.00 . A A .  25 LYS C    1 1 
       16  9575 1 1 25 LYS CA   C   -0.240  -5.814   0.390 1.00 . A A .  25 LYS CA   1 1 
       16  9576 1 1 25 LYS CB   C   -0.050  -6.372   1.802 1.00 . A A .  25 LYS CB   1 1 
       16  9577 1 1 25 LYS CD   C    1.699  -4.987   2.956 1.00 . A A .  25 LYS CD   1 1 
       16  9578 1 1 25 LYS CE   C    2.011  -4.206   4.223 1.00 . A A .  25 LYS CE   1 1 
       16  9579 1 1 25 LYS CG   C    0.217  -5.303   2.848 1.00 . A A .  25 LYS CG   1 1 
       16  9580 1 1 25 LYS H    H   -0.752  -7.768  -0.242 1.00 . A A .  25 LYS H    1 1 
       16  9581 1 1 25 LYS HA   H   -0.910  -4.968   0.433 1.00 . A A .  25 LYS HA   1 1 
       16  9582 1 1 25 LYS HB2  H   -0.942  -6.910   2.086 1.00 . A A .  25 LYS HB2  1 1 
       16  9583 1 1 25 LYS HB3  H    0.786  -7.056   1.795 1.00 . A A .  25 LYS HB3  1 1 
       16  9584 1 1 25 LYS HD2  H    2.256  -5.912   2.969 1.00 . A A .  25 LYS HD2  1 1 
       16  9585 1 1 25 LYS HD3  H    1.996  -4.398   2.099 1.00 . A A .  25 LYS HD3  1 1 
       16  9586 1 1 25 LYS HE2  H    2.945  -3.682   4.087 1.00 . A A .  25 LYS HE2  1 1 
       16  9587 1 1 25 LYS HE3  H    1.219  -3.492   4.395 1.00 . A A .  25 LYS HE3  1 1 
       16  9588 1 1 25 LYS HG2  H   -0.313  -4.404   2.573 1.00 . A A .  25 LYS HG2  1 1 
       16  9589 1 1 25 LYS HG3  H   -0.138  -5.655   3.806 1.00 . A A .  25 LYS HG3  1 1 
       16  9590 1 1 25 LYS HZ1  H    1.279  -5.009   6.008 1.00 . A A .  25 LYS HZ1  1 1 
       16  9591 1 1 25 LYS HZ2  H    2.962  -4.841   5.971 1.00 . A A .  25 LYS HZ2  1 1 
       16  9592 1 1 25 LYS HZ3  H    2.218  -6.088   5.105 1.00 . A A .  25 LYS HZ3  1 1 
       16  9593 1 1 25 LYS N    N   -0.845  -6.820  -0.475 1.00 . A A .  25 LYS N    1 1 
       16  9594 1 1 25 LYS NZ   N    2.125  -5.099   5.410 1.00 . A A .  25 LYS NZ   1 1 
       16  9595 1 1 25 LYS O    O    1.352  -4.152  -0.293 1.00 . A A .  25 LYS O    1 1 
       16  9596 1 1 26 SER C    C    3.176  -4.919  -2.130 1.00 . A A .  26 SER C    1 1 
       16  9597 1 1 26 SER CA   C    3.274  -5.998  -1.056 1.00 . A A .  26 SER CA   1 1 
       16  9598 1 1 26 SER CB   C    3.917  -7.258  -1.639 1.00 . A A .  26 SER CB   1 1 
       16  9599 1 1 26 SER H    H    1.698  -7.246  -0.389 1.00 . A A .  26 SER H    1 1 
       16  9600 1 1 26 SER HA   H    3.889  -5.631  -0.248 1.00 . A A .  26 SER HA   1 1 
       16  9601 1 1 26 SER HB2  H    3.314  -7.620  -2.458 1.00 . A A .  26 SER HB2  1 1 
       16  9602 1 1 26 SER HB3  H    4.907  -7.019  -1.999 1.00 . A A .  26 SER HB3  1 1 
       16  9603 1 1 26 SER HG   H    3.142  -8.516  -0.353 1.00 . A A .  26 SER HG   1 1 
       16  9604 1 1 26 SER N    N    1.957  -6.308  -0.511 1.00 . A A .  26 SER N    1 1 
       16  9605 1 1 26 SER O    O    3.884  -3.912  -2.080 1.00 . A A .  26 SER O    1 1 
       16  9606 1 1 26 SER OG   O    4.020  -8.278  -0.661 1.00 . A A .  26 SER OG   1 1 
       16  9607 1 1 27 TYR C    C    1.920  -2.770  -3.648 1.00 . A A .  27 TYR C    1 1 
       16  9608 1 1 27 TYR CA   C    2.106  -4.184  -4.188 1.00 . A A .  27 TYR CA   1 1 
       16  9609 1 1 27 TYR CB   C    0.897  -4.581  -5.036 1.00 . A A .  27 TYR CB   1 1 
       16  9610 1 1 27 TYR CD1  C    1.346  -2.867  -6.835 1.00 . A A .  27 TYR CD1  1 1 
       16  9611 1 1 27 TYR CD2  C    0.790  -5.084  -7.509 1.00 . A A .  27 TYR CD2  1 1 
       16  9612 1 1 27 TYR CE1  C    1.453  -2.486  -8.158 1.00 . A A .  27 TYR CE1  1 1 
       16  9613 1 1 27 TYR CE2  C    0.896  -4.713  -8.835 1.00 . A A .  27 TYR CE2  1 1 
       16  9614 1 1 27 TYR CG   C    1.013  -4.170  -6.486 1.00 . A A .  27 TYR CG   1 1 
       16  9615 1 1 27 TYR CZ   C    1.227  -3.413  -9.155 1.00 . A A .  27 TYR CZ   1 1 
       16  9616 1 1 27 TYR H    H    1.761  -5.957  -3.085 1.00 . A A .  27 TYR H    1 1 
       16  9617 1 1 27 TYR HA   H    2.991  -4.208  -4.807 1.00 . A A .  27 TYR HA   1 1 
       16  9618 1 1 27 TYR HB2  H    0.780  -5.654  -5.005 1.00 . A A .  27 TYR HB2  1 1 
       16  9619 1 1 27 TYR HB3  H    0.011  -4.116  -4.629 1.00 . A A .  27 TYR HB3  1 1 
       16  9620 1 1 27 TYR HD1  H    1.523  -2.143  -6.052 1.00 . A A .  27 TYR HD1  1 1 
       16  9621 1 1 27 TYR HD2  H    0.531  -6.102  -7.255 1.00 . A A .  27 TYR HD2  1 1 
       16  9622 1 1 27 TYR HE1  H    1.712  -1.468  -8.409 1.00 . A A .  27 TYR HE1  1 1 
       16  9623 1 1 27 TYR HE2  H    0.719  -5.438  -9.616 1.00 . A A .  27 TYR HE2  1 1 
       16  9624 1 1 27 TYR HH   H    0.671  -2.372 -10.672 1.00 . A A .  27 TYR HH   1 1 
       16  9625 1 1 27 TYR N    N    2.295  -5.136  -3.100 1.00 . A A .  27 TYR N    1 1 
       16  9626 1 1 27 TYR O    O    2.621  -1.841  -4.052 1.00 . A A .  27 TYR O    1 1 
       16  9627 1 1 27 TYR OH   O    1.334  -3.038 -10.474 1.00 . A A .  27 TYR OH   1 1 
       16  9628 1 1 28 LEU C    C    1.980  -0.635  -1.677 1.00 . A A .  28 LEU C    1 1 
       16  9629 1 1 28 LEU CA   C    0.692  -1.312  -2.134 1.00 . A A .  28 LEU CA   1 1 
       16  9630 1 1 28 LEU CB   C   -0.264  -1.468  -0.950 1.00 . A A .  28 LEU CB   1 1 
       16  9631 1 1 28 LEU CD1  C   -1.029   0.912  -0.762 1.00 . A A .  28 LEU CD1  1 1 
       16  9632 1 1 28 LEU CD2  C   -1.198  -0.613   1.214 1.00 . A A .  28 LEU CD2  1 1 
       16  9633 1 1 28 LEU CG   C   -0.391  -0.256  -0.026 1.00 . A A .  28 LEU CG   1 1 
       16  9634 1 1 28 LEU H    H    0.445  -3.390  -2.450 1.00 . A A .  28 LEU H    1 1 
       16  9635 1 1 28 LEU HA   H    0.223  -0.696  -2.886 1.00 . A A .  28 LEU HA   1 1 
       16  9636 1 1 28 LEU HB2  H   -1.245  -1.687  -1.343 1.00 . A A .  28 LEU HB2  1 1 
       16  9637 1 1 28 LEU HB3  H    0.079  -2.303  -0.356 1.00 . A A .  28 LEU HB3  1 1 
       16  9638 1 1 28 LEU HD11 H   -0.837   1.826  -0.221 1.00 . A A .  28 LEU HD11 1 1 
       16  9639 1 1 28 LEU HD12 H   -2.095   0.753  -0.833 1.00 . A A .  28 LEU HD12 1 1 
       16  9640 1 1 28 LEU HD13 H   -0.609   0.984  -1.754 1.00 . A A .  28 LEU HD13 1 1 
       16  9641 1 1 28 LEU HD21 H   -0.881   0.005   2.040 1.00 . A A .  28 LEU HD21 1 1 
       16  9642 1 1 28 LEU HD22 H   -1.039  -1.653   1.459 1.00 . A A .  28 LEU HD22 1 1 
       16  9643 1 1 28 LEU HD23 H   -2.248  -0.446   1.020 1.00 . A A .  28 LEU HD23 1 1 
       16  9644 1 1 28 LEU HG   H    0.596   0.050   0.293 1.00 . A A .  28 LEU HG   1 1 
       16  9645 1 1 28 LEU N    N    0.971  -2.613  -2.732 1.00 . A A .  28 LEU N    1 1 
       16  9646 1 1 28 LEU O    O    2.191   0.552  -1.927 1.00 . A A .  28 LEU O    1 1 
       16  9647 1 1 29 ILE C    C    4.934  -0.286  -1.658 1.00 . A A .  29 ILE C    1 1 
       16  9648 1 1 29 ILE CA   C    4.106  -0.872  -0.519 1.00 . A A .  29 ILE CA   1 1 
       16  9649 1 1 29 ILE CB   C    4.931  -1.961   0.192 1.00 . A A .  29 ILE CB   1 1 
       16  9650 1 1 29 ILE CD1  C    4.722  -3.847   1.889 1.00 . A A .  29 ILE CD1  1 1 
       16  9651 1 1 29 ILE CG1  C    4.130  -2.564   1.349 1.00 . A A .  29 ILE CG1  1 1 
       16  9652 1 1 29 ILE CG2  C    6.246  -1.386   0.694 1.00 . A A .  29 ILE CG2  1 1 
       16  9653 1 1 29 ILE H    H    2.612  -2.336  -0.839 1.00 . A A .  29 ILE H    1 1 
       16  9654 1 1 29 ILE HA   H    3.890  -0.089   0.194 1.00 . A A .  29 ILE HA   1 1 
       16  9655 1 1 29 ILE HB   H    5.154  -2.737  -0.524 1.00 . A A .  29 ILE HB   1 1 
       16  9656 1 1 29 ILE HD11 H    5.064  -4.459   1.067 1.00 . A A .  29 ILE HD11 1 1 
       16  9657 1 1 29 ILE HD12 H    5.556  -3.615   2.535 1.00 . A A .  29 ILE HD12 1 1 
       16  9658 1 1 29 ILE HD13 H    3.970  -4.383   2.448 1.00 . A A .  29 ILE HD13 1 1 
       16  9659 1 1 29 ILE HG12 H    4.088  -1.852   2.158 1.00 . A A .  29 ILE HG12 1 1 
       16  9660 1 1 29 ILE HG13 H    3.127  -2.777   1.009 1.00 . A A .  29 ILE HG13 1 1 
       16  9661 1 1 29 ILE HG21 H    6.510  -0.521   0.104 1.00 . A A .  29 ILE HG21 1 1 
       16  9662 1 1 29 ILE HG22 H    6.140  -1.095   1.729 1.00 . A A .  29 ILE HG22 1 1 
       16  9663 1 1 29 ILE HG23 H    7.022  -2.132   0.607 1.00 . A A .  29 ILE HG23 1 1 
       16  9664 1 1 29 ILE N    N    2.837  -1.398  -1.008 1.00 . A A .  29 ILE N    1 1 
       16  9665 1 1 29 ILE O    O    5.328   0.880  -1.616 1.00 . A A .  29 ILE O    1 1 
       16  9666 1 1 30 ILE C    C    5.441   0.658  -4.376 1.00 . A A .  30 ILE C    1 1 
       16  9667 1 1 30 ILE CA   C    5.969  -0.663  -3.827 1.00 . A A .  30 ILE CA   1 1 
       16  9668 1 1 30 ILE CB   C    5.953  -1.716  -4.951 1.00 . A A .  30 ILE CB   1 1 
       16  9669 1 1 30 ILE CD1  C    5.920  -4.251  -5.170 1.00 . A A .  30 ILE CD1  1 1 
       16  9670 1 1 30 ILE CG1  C    6.479  -3.056  -4.431 1.00 . A A .  30 ILE CG1  1 1 
       16  9671 1 1 30 ILE CG2  C    6.781  -1.239  -6.135 1.00 . A A .  30 ILE CG2  1 1 
       16  9672 1 1 30 ILE H    H    4.849  -2.019  -2.650 1.00 . A A .  30 ILE H    1 1 
       16  9673 1 1 30 ILE HA   H    6.991  -0.524  -3.505 1.00 . A A .  30 ILE HA   1 1 
       16  9674 1 1 30 ILE HB   H    4.934  -1.841  -5.282 1.00 . A A .  30 ILE HB   1 1 
       16  9675 1 1 30 ILE HD11 H    5.466  -4.931  -4.463 1.00 . A A .  30 ILE HD11 1 1 
       16  9676 1 1 30 ILE HD12 H    5.175  -3.921  -5.879 1.00 . A A .  30 ILE HD12 1 1 
       16  9677 1 1 30 ILE HD13 H    6.718  -4.757  -5.693 1.00 . A A .  30 ILE HD13 1 1 
       16  9678 1 1 30 ILE HG12 H    7.553  -3.077  -4.531 1.00 . A A .  30 ILE HG12 1 1 
       16  9679 1 1 30 ILE HG13 H    6.217  -3.156  -3.388 1.00 . A A .  30 ILE HG13 1 1 
       16  9680 1 1 30 ILE HG21 H    7.829  -1.259  -5.873 1.00 . A A .  30 ILE HG21 1 1 
       16  9681 1 1 30 ILE HG22 H    6.610  -1.890  -6.979 1.00 . A A .  30 ILE HG22 1 1 
       16  9682 1 1 30 ILE HG23 H    6.494  -0.231  -6.393 1.00 . A A .  30 ILE HG23 1 1 
       16  9683 1 1 30 ILE N    N    5.191  -1.101  -2.675 1.00 . A A .  30 ILE N    1 1 
       16  9684 1 1 30 ILE O    O    6.190   1.447  -4.954 1.00 . A A .  30 ILE O    1 1 
       16  9685 1 1 31 HIS C    C    3.835   3.290  -3.736 1.00 . A A .  31 HIS C    1 1 
       16  9686 1 1 31 HIS CA   C    3.518   2.122  -4.665 1.00 . A A .  31 HIS CA   1 1 
       16  9687 1 1 31 HIS CB   C    2.004   1.937  -4.771 1.00 . A A .  31 HIS CB   1 1 
       16  9688 1 1 31 HIS CD2  C    0.613   4.061  -4.242 1.00 . A A .  31 HIS CD2  1 1 
       16  9689 1 1 31 HIS CE1  C    0.433   4.844  -6.282 1.00 . A A .  31 HIS CE1  1 1 
       16  9690 1 1 31 HIS CG   C    1.264   3.206  -5.064 1.00 . A A .  31 HIS CG   1 1 
       16  9691 1 1 31 HIS H    H    3.601   0.228  -3.723 1.00 . A A .  31 HIS H    1 1 
       16  9692 1 1 31 HIS HA   H    3.914   2.341  -5.645 1.00 . A A .  31 HIS HA   1 1 
       16  9693 1 1 31 HIS HB2  H    1.788   1.237  -5.565 1.00 . A A .  31 HIS HB2  1 1 
       16  9694 1 1 31 HIS HB3  H    1.630   1.542  -3.838 1.00 . A A .  31 HIS HB3  1 1 
       16  9695 1 1 31 HIS HD1  H    1.497   3.330  -7.155 1.00 . A A .  31 HIS HD1  1 1 
       16  9696 1 1 31 HIS HD2  H    0.511   3.968  -3.170 1.00 . A A .  31 HIS HD2  1 1 
       16  9697 1 1 31 HIS HE1  H    0.173   5.468  -7.124 1.00 . A A .  31 HIS HE1  1 1 
       16  9698 1 1 31 HIS N    N    4.146   0.895  -4.190 1.00 . A A .  31 HIS N    1 1 
       16  9699 1 1 31 HIS ND1  N    1.132   3.724  -6.336 1.00 . A A .  31 HIS ND1  1 1 
       16  9700 1 1 31 HIS NE2  N    0.106   5.071  -5.023 1.00 . A A .  31 HIS NE2  1 1 
       16  9701 1 1 31 HIS O    O    4.219   4.369  -4.188 1.00 . A A .  31 HIS O    1 1 
       16  9702 1 1 32 MET C    C    5.385   4.584  -1.541 1.00 . A A .  32 MET C    1 1 
       16  9703 1 1 32 MET CA   C    3.942   4.101  -1.444 1.00 . A A .  32 MET CA   1 1 
       16  9704 1 1 32 MET CB   C    3.662   3.571  -0.036 1.00 . A A .  32 MET CB   1 1 
       16  9705 1 1 32 MET CE   C    1.064   5.456   1.646 1.00 . A A .  32 MET CE   1 1 
       16  9706 1 1 32 MET CG   C    2.186   3.344   0.246 1.00 . A A .  32 MET CG   1 1 
       16  9707 1 1 32 MET H    H    3.363   2.186  -2.136 1.00 . A A .  32 MET H    1 1 
       16  9708 1 1 32 MET HA   H    3.282   4.931  -1.643 1.00 . A A .  32 MET HA   1 1 
       16  9709 1 1 32 MET HB2  H    4.180   2.632   0.093 1.00 . A A .  32 MET HB2  1 1 
       16  9710 1 1 32 MET HB3  H    4.038   4.282   0.685 1.00 . A A .  32 MET HB3  1 1 
       16  9711 1 1 32 MET HE1  H    1.940   5.166   2.208 1.00 . A A .  32 MET HE1  1 1 
       16  9712 1 1 32 MET HE2  H    0.995   6.534   1.619 1.00 . A A .  32 MET HE2  1 1 
       16  9713 1 1 32 MET HE3  H    0.182   5.051   2.119 1.00 . A A .  32 MET HE3  1 1 
       16  9714 1 1 32 MET HG2  H    1.825   2.561  -0.404 1.00 . A A .  32 MET HG2  1 1 
       16  9715 1 1 32 MET HG3  H    2.074   3.034   1.275 1.00 . A A .  32 MET HG3  1 1 
       16  9716 1 1 32 MET N    N    3.672   3.067  -2.436 1.00 . A A .  32 MET N    1 1 
       16  9717 1 1 32 MET O    O    5.716   5.677  -1.080 1.00 . A A .  32 MET O    1 1 
       16  9718 1 1 32 MET SD   S    1.191   4.823  -0.024 1.00 . A A .  32 MET SD   1 1 
       16  9719 1 1 33 ARG C    C    7.810   5.570  -2.698 1.00 . A A .  33 ARG C    1 1 
       16  9720 1 1 33 ARG CA   C    7.648   4.107  -2.297 1.00 . A A .  33 ARG CA   1 1 
       16  9721 1 1 33 ARG CB   C    8.303   3.205  -3.345 1.00 . A A .  33 ARG CB   1 1 
       16  9722 1 1 33 ARG CD   C    9.539   1.058  -3.768 1.00 . A A .  33 ARG CD   1 1 
       16  9723 1 1 33 ARG CG   C    8.577   1.795  -2.849 1.00 . A A .  33 ARG CG   1 1 
       16  9724 1 1 33 ARG CZ   C    9.876   0.856  -6.195 1.00 . A A .  33 ARG CZ   1 1 
       16  9725 1 1 33 ARG H    H    5.916   2.905  -2.488 1.00 . A A .  33 ARG H    1 1 
       16  9726 1 1 33 ARG HA   H    8.135   3.951  -1.346 1.00 . A A .  33 ARG HA   1 1 
       16  9727 1 1 33 ARG HB2  H    7.652   3.139  -4.205 1.00 . A A .  33 ARG HB2  1 1 
       16  9728 1 1 33 ARG HB3  H    9.241   3.646  -3.647 1.00 . A A .  33 ARG HB3  1 1 
       16  9729 1 1 33 ARG HD2  H   10.502   1.544  -3.724 1.00 . A A .  33 ARG HD2  1 1 
       16  9730 1 1 33 ARG HD3  H    9.635   0.039  -3.424 1.00 . A A .  33 ARG HD3  1 1 
       16  9731 1 1 33 ARG HE   H    8.120   1.197  -5.312 1.00 . A A .  33 ARG HE   1 1 
       16  9732 1 1 33 ARG HG2  H    9.011   1.848  -1.861 1.00 . A A .  33 ARG HG2  1 1 
       16  9733 1 1 33 ARG HG3  H    7.646   1.250  -2.806 1.00 . A A .  33 ARG HG3  1 1 
       16  9734 1 1 33 ARG HH11 H   11.550   0.648  -5.084 1.00 . A A .  33 ARG HH11 1 1 
       16  9735 1 1 33 ARG HH12 H   11.774   0.508  -6.796 1.00 . A A .  33 ARG HH12 1 1 
       16  9736 1 1 33 ARG HH21 H    8.401   1.014  -7.568 1.00 . A A .  33 ARG HH21 1 1 
       16  9737 1 1 33 ARG HH22 H    9.982   0.717  -8.208 1.00 . A A .  33 ARG HH22 1 1 
       16  9738 1 1 33 ARG N    N    6.240   3.763  -2.142 1.00 . A A .  33 ARG N    1 1 
       16  9739 1 1 33 ARG NE   N    9.075   1.050  -5.153 1.00 . A A .  33 ARG NE   1 1 
       16  9740 1 1 33 ARG NH1  N   11.173   0.655  -6.010 1.00 . A A .  33 ARG NH1  1 1 
       16  9741 1 1 33 ARG NH2  N    9.379   0.863  -7.425 1.00 . A A .  33 ARG NH2  1 1 
       16  9742 1 1 33 ARG O    O    8.730   6.252  -2.246 1.00 . A A .  33 ARG O    1 1 
       16  9743 1 1 34 THR C    C    6.238   8.358  -3.040 1.00 . A A .  34 THR C    1 1 
       16  9744 1 1 34 THR CA   C    6.951   7.429  -4.015 1.00 . A A .  34 THR CA   1 1 
       16  9745 1 1 34 THR CB   C    6.310   7.574  -5.408 1.00 . A A .  34 THR CB   1 1 
       16  9746 1 1 34 THR CG2  C    4.799   7.421  -5.327 1.00 . A A .  34 THR CG2  1 1 
       16  9747 1 1 34 THR H    H    6.199   5.455  -3.877 1.00 . A A .  34 THR H    1 1 
       16  9748 1 1 34 THR HA   H    7.988   7.724  -4.086 1.00 . A A .  34 THR HA   1 1 
       16  9749 1 1 34 THR HB   H    6.702   6.798  -6.051 1.00 . A A .  34 THR HB   1 1 
       16  9750 1 1 34 THR HG1  H    6.526   9.531  -5.297 1.00 . A A .  34 THR HG1  1 1 
       16  9751 1 1 34 THR HG21 H    4.369   7.574  -6.305 1.00 . A A .  34 THR HG21 1 1 
       16  9752 1 1 34 THR HG22 H    4.399   8.152  -4.640 1.00 . A A .  34 THR HG22 1 1 
       16  9753 1 1 34 THR HG23 H    4.556   6.428  -4.978 1.00 . A A .  34 THR HG23 1 1 
       16  9754 1 1 34 THR N    N    6.909   6.047  -3.552 1.00 . A A .  34 THR N    1 1 
       16  9755 1 1 34 THR O    O    6.687   9.477  -2.792 1.00 . A A .  34 THR O    1 1 
       16  9756 1 1 34 THR OG1  O    6.636   8.851  -5.967 1.00 . A A .  34 THR OG1  1 1 
       16  9757 1 1 35 HIS C    C    5.148   8.938  -0.268 1.00 . A A .  35 HIS C    1 1 
       16  9758 1 1 35 HIS CA   C    4.347   8.678  -1.540 1.00 . A A .  35 HIS CA   1 1 
       16  9759 1 1 35 HIS CB   C    3.040   7.962  -1.197 1.00 . A A .  35 HIS CB   1 1 
       16  9760 1 1 35 HIS CD2  C    1.096   7.164  -2.716 1.00 . A A .  35 HIS CD2  1 1 
       16  9761 1 1 35 HIS CE1  C    0.825   9.001  -3.882 1.00 . A A .  35 HIS CE1  1 1 
       16  9762 1 1 35 HIS CG   C    2.000   8.066  -2.269 1.00 . A A .  35 HIS CG   1 1 
       16  9763 1 1 35 HIS H    H    4.815   6.989  -2.728 1.00 . A A .  35 HIS H    1 1 
       16  9764 1 1 35 HIS HA   H    4.117   9.624  -2.006 1.00 . A A .  35 HIS HA   1 1 
       16  9765 1 1 35 HIS HB2  H    3.244   6.914  -1.034 1.00 . A A .  35 HIS HB2  1 1 
       16  9766 1 1 35 HIS HB3  H    2.630   8.389  -0.293 1.00 . A A .  35 HIS HB3  1 1 
       16  9767 1 1 35 HIS HD1  H    2.310  10.042  -2.934 1.00 . A A .  35 HIS HD1  1 1 
       16  9768 1 1 35 HIS HD2  H    0.963   6.155  -2.353 1.00 . A A .  35 HIS HD2  1 1 
       16  9769 1 1 35 HIS HE1  H    0.453   9.717  -4.599 1.00 . A A .  35 HIS HE1  1 1 
       16  9770 1 1 35 HIS N    N    5.123   7.888  -2.490 1.00 . A A .  35 HIS N    1 1 
       16  9771 1 1 35 HIS ND1  N    1.806   9.206  -3.020 1.00 . A A .  35 HIS ND1  1 1 
       16  9772 1 1 35 HIS NE2  N    0.378   7.769  -3.718 1.00 . A A .  35 HIS NE2  1 1 
       16  9773 1 1 35 HIS O    O    5.015   8.215   0.719 1.00 . A A .  35 HIS O    1 1 
       16  9774 1 1 36 SER C    C    6.173  11.467   1.643 1.00 . A A .  36 SER C    1 1 
       16  9775 1 1 36 SER CA   C    6.805  10.327   0.849 1.00 . A A .  36 SER CA   1 1 
       16  9776 1 1 36 SER CB   C    8.209  10.727   0.391 1.00 . A A .  36 SER CB   1 1 
       16  9777 1 1 36 SER H    H    6.041  10.513  -1.117 1.00 . A A .  36 SER H    1 1 
       16  9778 1 1 36 SER HA   H    6.878   9.458   1.485 1.00 . A A .  36 SER HA   1 1 
       16  9779 1 1 36 SER HB2  H    8.753  11.141   1.226 1.00 . A A .  36 SER HB2  1 1 
       16  9780 1 1 36 SER HB3  H    8.727   9.854   0.021 1.00 . A A .  36 SER HB3  1 1 
       16  9781 1 1 36 SER HG   H    7.410  12.285  -0.488 1.00 . A A .  36 SER HG   1 1 
       16  9782 1 1 36 SER N    N    5.980   9.974  -0.300 1.00 . A A .  36 SER N    1 1 
       16  9783 1 1 36 SER O    O    6.376  11.584   2.851 1.00 . A A .  36 SER O    1 1 
       16  9784 1 1 36 SER OG   O    8.152  11.696  -0.642 1.00 . A A .  36 SER OG   1 1 
       16  9785 1 1 37 GLY C    C    5.719  14.253   2.435 1.00 . A A .  37 GLY C    1 1 
       16  9786 1 1 37 GLY CA   C    4.755  13.425   1.610 1.00 . A A .  37 GLY CA   1 1 
       16  9787 1 1 37 GLY H    H    5.280  12.163  -0.008 1.00 . A A .  37 GLY H    1 1 
       16  9788 1 1 37 GLY HA2  H    4.306  14.057   0.858 1.00 . A A .  37 GLY HA2  1 1 
       16  9789 1 1 37 GLY HA3  H    3.978  13.046   2.258 1.00 . A A .  37 GLY HA3  1 1 
       16  9790 1 1 37 GLY N    N    5.405  12.305   0.954 1.00 . A A .  37 GLY N    1 1 
       16  9791 1 1 37 GLY O    O    5.669  14.232   3.665 1.00 . A A .  37 GLY O    1 1 
       16  9792 1 1 38 GLU C    C    6.967  17.153   2.853 1.00 . A A .  38 GLU C    1 1 
       16  9793 1 1 38 GLU CA   C    7.582  15.819   2.439 1.00 . A A .  38 GLU CA   1 1 
       16  9794 1 1 38 GLU CB   C    8.792  16.062   1.535 1.00 . A A .  38 GLU CB   1 1 
       16  9795 1 1 38 GLU CD   C    9.707  17.706  -0.151 1.00 . A A .  38 GLU CD   1 1 
       16  9796 1 1 38 GLU CG   C    8.489  16.946   0.337 1.00 . A A .  38 GLU CG   1 1 
       16  9797 1 1 38 GLU H    H    6.590  14.957   0.779 1.00 . A A .  38 GLU H    1 1 
       16  9798 1 1 38 GLU HA   H    7.906  15.295   3.325 1.00 . A A .  38 GLU HA   1 1 
       16  9799 1 1 38 GLU HB2  H    9.572  16.533   2.115 1.00 . A A .  38 GLU HB2  1 1 
       16  9800 1 1 38 GLU HB3  H    9.151  15.111   1.171 1.00 . A A .  38 GLU HB3  1 1 
       16  9801 1 1 38 GLU HG2  H    8.124  16.326  -0.469 1.00 . A A .  38 GLU HG2  1 1 
       16  9802 1 1 38 GLU HG3  H    7.726  17.658   0.615 1.00 . A A .  38 GLU HG3  1 1 
       16  9803 1 1 38 GLU N    N    6.600  14.983   1.758 1.00 . A A .  38 GLU N    1 1 
       16  9804 1 1 38 GLU O    O    7.594  17.949   3.551 1.00 . A A .  38 GLU O    1 1 
       16  9805 1 1 38 GLU OE1  O   10.355  18.382   0.675 1.00 . A A .  38 GLU OE1  1 1 
       16  9806 1 1 38 GLU OE2  O   10.012  17.624  -1.360 1.00 . A A .  38 GLU OE2  1 1 
       16  9807 1 1 39 LYS C    C    3.565  18.349   3.061 1.00 . A A .  39 LYS C    1 1 
       16  9808 1 1 39 LYS CA   C    5.031  18.625   2.742 1.00 . A A .  39 LYS CA   1 1 
       16  9809 1 1 39 LYS CB   C    5.134  19.615   1.580 1.00 . A A .  39 LYS CB   1 1 
       16  9810 1 1 39 LYS CD   C    5.791  21.701   2.814 1.00 . A A .  39 LYS CD   1 1 
       16  9811 1 1 39 LYS CE   C    6.947  22.224   1.976 1.00 . A A .  39 LYS CE   1 1 
       16  9812 1 1 39 LYS CG   C    4.734  21.032   1.951 1.00 . A A .  39 LYS CG   1 1 
       16  9813 1 1 39 LYS H    H    5.285  16.715   1.864 1.00 . A A .  39 LYS H    1 1 
       16  9814 1 1 39 LYS HA   H    5.502  19.055   3.613 1.00 . A A .  39 LYS HA   1 1 
       16  9815 1 1 39 LYS HB2  H    6.154  19.631   1.225 1.00 . A A .  39 LYS HB2  1 1 
       16  9816 1 1 39 LYS HB3  H    4.489  19.279   0.779 1.00 . A A .  39 LYS HB3  1 1 
       16  9817 1 1 39 LYS HD2  H    5.341  22.529   3.342 1.00 . A A .  39 LYS HD2  1 1 
       16  9818 1 1 39 LYS HD3  H    6.170  20.981   3.526 1.00 . A A .  39 LYS HD3  1 1 
       16  9819 1 1 39 LYS HE2  H    7.264  21.445   1.299 1.00 . A A .  39 LYS HE2  1 1 
       16  9820 1 1 39 LYS HE3  H    6.606  23.077   1.408 1.00 . A A .  39 LYS HE3  1 1 
       16  9821 1 1 39 LYS HG2  H    4.606  21.609   1.047 1.00 . A A .  39 LYS HG2  1 1 
       16  9822 1 1 39 LYS HG3  H    3.802  21.003   2.497 1.00 . A A .  39 LYS HG3  1 1 
       16  9823 1 1 39 LYS HZ1  H    8.011  23.632   3.092 1.00 . A A .  39 LYS HZ1  1 1 
       16  9824 1 1 39 LYS HZ2  H    8.992  22.510   2.292 1.00 . A A .  39 LYS HZ2  1 1 
       16  9825 1 1 39 LYS HZ3  H    8.141  22.052   3.681 1.00 . A A .  39 LYS HZ3  1 1 
       16  9826 1 1 39 LYS N    N    5.734  17.389   2.418 1.00 . A A .  39 LYS N    1 1 
       16  9827 1 1 39 LYS NZ   N    8.104  22.633   2.819 1.00 . A A .  39 LYS NZ   1 1 
       16  9828 1 1 39 LYS O    O    2.890  17.581   2.377 1.00 . A A .  39 LYS O    1 1 
       16  9829 1 1 40 PRO C    C    0.682  19.467   3.582 1.00 . A A .  40 PRO C    1 1 
       16  9830 1 1 40 PRO CA   C    1.668  18.833   4.557 1.00 . A A .  40 PRO CA   1 1 
       16  9831 1 1 40 PRO CB   C    1.629  19.559   5.904 1.00 . A A .  40 PRO CB   1 1 
       16  9832 1 1 40 PRO CD   C    3.807  19.923   4.986 1.00 . A A .  40 PRO CD   1 1 
       16  9833 1 1 40 PRO CG   C    2.734  20.557   5.828 1.00 . A A .  40 PRO CG   1 1 
       16  9834 1 1 40 PRO HA   H    1.413  17.793   4.700 1.00 . A A .  40 PRO HA   1 1 
       16  9835 1 1 40 PRO HB2  H    0.669  20.040   6.029 1.00 . A A .  40 PRO HB2  1 1 
       16  9836 1 1 40 PRO HB3  H    1.791  18.852   6.703 1.00 . A A .  40 PRO HB3  1 1 
       16  9837 1 1 40 PRO HD2  H    4.315  20.671   4.396 1.00 . A A .  40 PRO HD2  1 1 
       16  9838 1 1 40 PRO HD3  H    4.510  19.390   5.610 1.00 . A A .  40 PRO HD3  1 1 
       16  9839 1 1 40 PRO HG2  H    2.378  21.463   5.362 1.00 . A A .  40 PRO HG2  1 1 
       16  9840 1 1 40 PRO HG3  H    3.109  20.764   6.819 1.00 . A A .  40 PRO HG3  1 1 
       16  9841 1 1 40 PRO N    N    3.059  18.992   4.125 1.00 . A A .  40 PRO N    1 1 
       16  9842 1 1 40 PRO O    O   -0.526  19.469   3.819 1.00 . A A .  40 PRO O    1 1 
       16  9843 1 1 41 SER C    C   -0.302  19.602   0.585 1.00 . A A .  41 SER C    1 1 
       16  9844 1 1 41 SER CA   C    0.370  20.644   1.474 1.00 . A A .  41 SER CA   1 1 
       16  9845 1 1 41 SER CB   C    1.208  21.597   0.619 1.00 . A A .  41 SER CB   1 1 
       16  9846 1 1 41 SER H    H    2.175  19.970   2.352 1.00 . A A .  41 SER H    1 1 
       16  9847 1 1 41 SER HA   H   -0.394  21.210   1.986 1.00 . A A .  41 SER HA   1 1 
       16  9848 1 1 41 SER HB2  H    1.512  22.441   1.218 1.00 . A A .  41 SER HB2  1 1 
       16  9849 1 1 41 SER HB3  H    2.084  21.076   0.258 1.00 . A A .  41 SER HB3  1 1 
       16  9850 1 1 41 SER HG   H    1.009  22.672  -1.006 1.00 . A A .  41 SER HG   1 1 
       16  9851 1 1 41 SER N    N    1.205  20.004   2.484 1.00 . A A .  41 SER N    1 1 
       16  9852 1 1 41 SER O    O    0.337  18.658   0.123 1.00 . A A .  41 SER O    1 1 
       16  9853 1 1 41 SER OG   O    0.467  22.069  -0.493 1.00 . A A .  41 SER OG   1 1 
       16  9854 1 1 42 GLY C    C   -3.129  19.548  -1.571 1.00 . A A .  42 GLY C    1 1 
       16  9855 1 1 42 GLY CA   C   -2.337  18.851  -0.483 1.00 . A A .  42 GLY CA   1 1 
       16  9856 1 1 42 GLY H    H   -2.057  20.553   0.745 1.00 . A A .  42 GLY H    1 1 
       16  9857 1 1 42 GLY HA2  H   -1.641  18.165  -0.942 1.00 . A A .  42 GLY HA2  1 1 
       16  9858 1 1 42 GLY HA3  H   -3.020  18.292   0.140 1.00 . A A .  42 GLY HA3  1 1 
       16  9859 1 1 42 GLY N    N   -1.599  19.782   0.350 1.00 . A A .  42 GLY N    1 1 
       16  9860 1 1 42 GLY O    O   -3.332  20.762  -1.540 1.00 . A A .  42 GLY O    1 1 
       16  9861 1 1 43 PRO C    C   -5.764  19.755  -3.260 1.00 . A A .  43 PRO C    1 1 
       16  9862 1 1 43 PRO CA   C   -4.371  19.302  -3.685 1.00 . A A .  43 PRO CA   1 1 
       16  9863 1 1 43 PRO CB   C   -4.466  18.112  -4.644 1.00 . A A .  43 PRO CB   1 1 
       16  9864 1 1 43 PRO CD   C   -3.387  17.317  -2.664 1.00 . A A .  43 PRO CD   1 1 
       16  9865 1 1 43 PRO CG   C   -4.317  16.912  -3.774 1.00 . A A .  43 PRO CG   1 1 
       16  9866 1 1 43 PRO HA   H   -3.861  20.119  -4.172 1.00 . A A .  43 PRO HA   1 1 
       16  9867 1 1 43 PRO HB2  H   -5.425  18.124  -5.142 1.00 . A A .  43 PRO HB2  1 1 
       16  9868 1 1 43 PRO HB3  H   -3.674  18.170  -5.375 1.00 . A A .  43 PRO HB3  1 1 
       16  9869 1 1 43 PRO HD2  H   -3.661  16.824  -1.743 1.00 . A A .  43 PRO HD2  1 1 
       16  9870 1 1 43 PRO HD3  H   -2.364  17.089  -2.927 1.00 . A A .  43 PRO HD3  1 1 
       16  9871 1 1 43 PRO HG2  H   -5.278  16.627  -3.373 1.00 . A A .  43 PRO HG2  1 1 
       16  9872 1 1 43 PRO HG3  H   -3.890  16.098  -4.342 1.00 . A A .  43 PRO HG3  1 1 
       16  9873 1 1 43 PRO N    N   -3.591  18.772  -2.563 1.00 . A A .  43 PRO N    1 1 
       16  9874 1 1 43 PRO O    O   -6.532  20.275  -4.069 1.00 . A A .  43 PRO O    1 1 
       16  9875 1 1 44 SER C    C   -8.480  19.017  -1.975 1.00 . A A .  44 SER C    1 1 
       16  9876 1 1 44 SER CA   C   -7.385  19.941  -1.453 1.00 . A A .  44 SER CA   1 1 
       16  9877 1 1 44 SER CB   C   -7.703  21.390  -1.828 1.00 . A A .  44 SER CB   1 1 
       16  9878 1 1 44 SER H    H   -5.427  19.136  -1.389 1.00 . A A .  44 SER H    1 1 
       16  9879 1 1 44 SER HA   H   -7.341  19.857  -0.378 1.00 . A A .  44 SER HA   1 1 
       16  9880 1 1 44 SER HB2  H   -6.792  21.969  -1.821 1.00 . A A .  44 SER HB2  1 1 
       16  9881 1 1 44 SER HB3  H   -8.140  21.416  -2.816 1.00 . A A .  44 SER HB3  1 1 
       16  9882 1 1 44 SER HG   H   -9.399  21.412  -0.847 1.00 . A A .  44 SER HG   1 1 
       16  9883 1 1 44 SER N    N   -6.083  19.555  -1.985 1.00 . A A .  44 SER N    1 1 
       16  9884 1 1 44 SER O    O   -9.585  19.460  -2.288 1.00 . A A .  44 SER O    1 1 
       16  9885 1 1 44 SER OG   O   -8.616  21.965  -0.909 1.00 . A A .  44 SER OG   1 1 
       16  9886 1 1 45 SER C    C   -9.813  17.234  -3.821 1.00 . A A .  45 SER C    1 1 
       16  9887 1 1 45 SER CA   C   -9.120  16.741  -2.554 1.00 . A A .  45 SER CA   1 1 
       16  9888 1 1 45 SER CB   C  -10.161  16.432  -1.477 1.00 . A A .  45 SER CB   1 1 
       16  9889 1 1 45 SER H    H   -7.267  17.437  -1.802 1.00 . A A .  45 SER H    1 1 
       16  9890 1 1 45 SER HA   H   -8.575  15.838  -2.785 1.00 . A A .  45 SER HA   1 1 
       16  9891 1 1 45 SER HB2  H   -9.685  16.434  -0.508 1.00 . A A .  45 SER HB2  1 1 
       16  9892 1 1 45 SER HB3  H  -10.934  17.187  -1.500 1.00 . A A .  45 SER HB3  1 1 
       16  9893 1 1 45 SER HG   H  -10.850  14.708  -0.850 1.00 . A A .  45 SER HG   1 1 
       16  9894 1 1 45 SER N    N   -8.165  17.729  -2.067 1.00 . A A .  45 SER N    1 1 
       16  9895 1 1 45 SER O    O  -11.013  17.032  -4.004 1.00 . A A .  45 SER O    1 1 
       16  9896 1 1 45 SER OG   O  -10.756  15.163  -1.690 1.00 . A A .  45 SER OG   1 1 
       16  9897 1 1 46 GLY C    C  -10.488  19.607  -5.712 1.00 . A A .  46 GLY C    1 1 
       16  9898 1 1 46 GLY CA   C   -9.603  18.395  -5.931 1.00 . A A .  46 GLY CA   1 1 
       16  9899 1 1 46 GLY H    H   -8.097  18.014  -4.493 1.00 . A A .  46 GLY H    1 1 
       16  9900 1 1 46 GLY HA2  H   -8.794  18.669  -6.591 1.00 . A A .  46 GLY HA2  1 1 
       16  9901 1 1 46 GLY HA3  H  -10.188  17.617  -6.399 1.00 . A A .  46 GLY HA3  1 1 
       16  9902 1 1 46 GLY N    N   -9.047  17.883  -4.693 1.00 . A A .  46 GLY N    1 1 
       16  9903 1 1 46 GLY O    O   -9.970  20.719  -5.631 1.00 . A A .  46 GLY O    1 1 
       16  9904 2 2  1 ZN  ZN   ZN  -1.042   6.282  -4.038 1.00 . B A . 201 ZN  ZN   1 1 
       17  9905 1 1  1 GLY C    C  -32.350  -0.368  13.527 1.00 . A A .   1 GLY C    1 1 
       17  9906 1 1  1 GLY CA   C  -32.658  -1.464  14.528 1.00 . A A .   1 GLY CA   1 1 
       17  9907 1 1  1 GLY H1   H  -33.530  -2.631  12.991 1.00 . A A .   1 GLY H1   1 1 
       17  9908 1 1  1 GLY HA2  H  -33.404  -1.105  15.221 1.00 . A A .   1 GLY HA2  1 1 
       17  9909 1 1  1 GLY HA3  H  -31.756  -1.699  15.074 1.00 . A A .   1 GLY HA3  1 1 
       17  9910 1 1  1 GLY N    N  -33.150  -2.673  13.894 1.00 . A A .   1 GLY N    1 1 
       17  9911 1 1  1 GLY O    O  -33.259   0.207  12.927 1.00 . A A .   1 GLY O    1 1 
       17  9912 1 1  2 SER C    C  -29.267   0.640  11.833 1.00 . A A .   2 SER C    1 1 
       17  9913 1 1  2 SER CA   C  -30.641   0.960  12.414 1.00 . A A .   2 SER CA   1 1 
       17  9914 1 1  2 SER CB   C  -30.607   2.320  13.114 1.00 . A A .   2 SER CB   1 1 
       17  9915 1 1  2 SER H    H  -30.388  -0.572  13.853 1.00 . A A .   2 SER H    1 1 
       17  9916 1 1  2 SER HA   H  -31.360   0.997  11.609 1.00 . A A .   2 SER HA   1 1 
       17  9917 1 1  2 SER HB2  H  -31.593   2.556  13.485 1.00 . A A .   2 SER HB2  1 1 
       17  9918 1 1  2 SER HB3  H  -29.912   2.280  13.940 1.00 . A A .   2 SER HB3  1 1 
       17  9919 1 1  2 SER HG   H  -29.628   2.969  11.546 1.00 . A A .   2 SER HG   1 1 
       17  9920 1 1  2 SER N    N  -31.066  -0.078  13.345 1.00 . A A .   2 SER N    1 1 
       17  9921 1 1  2 SER O    O  -28.287   0.505  12.566 1.00 . A A .   2 SER O    1 1 
       17  9922 1 1  2 SER OG   O  -30.198   3.343  12.222 1.00 . A A .   2 SER OG   1 1 
       17  9923 1 1  3 SER C    C  -27.736   1.143   8.641 1.00 . A A .   3 SER C    1 1 
       17  9924 1 1  3 SER CA   C  -27.952   0.212   9.830 1.00 . A A .   3 SER CA   1 1 
       17  9925 1 1  3 SER CB   C  -27.947  -1.244   9.360 1.00 . A A .   3 SER CB   1 1 
       17  9926 1 1  3 SER H    H  -30.020   0.639   9.981 1.00 . A A .   3 SER H    1 1 
       17  9927 1 1  3 SER HA   H  -27.147   0.356  10.536 1.00 . A A .   3 SER HA   1 1 
       17  9928 1 1  3 SER HB2  H  -28.333  -1.875  10.146 1.00 . A A .   3 SER HB2  1 1 
       17  9929 1 1  3 SER HB3  H  -28.572  -1.338   8.483 1.00 . A A .   3 SER HB3  1 1 
       17  9930 1 1  3 SER HG   H  -26.338  -2.314   9.681 1.00 . A A .   3 SER HG   1 1 
       17  9931 1 1  3 SER N    N  -29.204   0.520  10.511 1.00 . A A .   3 SER N    1 1 
       17  9932 1 1  3 SER O    O  -28.613   1.931   8.288 1.00 . A A .   3 SER O    1 1 
       17  9933 1 1  3 SER OG   O  -26.636  -1.671   9.034 1.00 . A A .   3 SER OG   1 1 
       17  9934 1 1  4 GLY C    C  -24.770   2.196   6.779 1.00 . A A .   4 GLY C    1 1 
       17  9935 1 1  4 GLY CA   C  -26.249   1.885   6.884 1.00 . A A .   4 GLY CA   1 1 
       17  9936 1 1  4 GLY H    H  -25.899   0.400   8.352 1.00 . A A .   4 GLY H    1 1 
       17  9937 1 1  4 GLY HA2  H  -26.565   1.380   5.984 1.00 . A A .   4 GLY HA2  1 1 
       17  9938 1 1  4 GLY HA3  H  -26.795   2.813   6.974 1.00 . A A .   4 GLY HA3  1 1 
       17  9939 1 1  4 GLY N    N  -26.561   1.046   8.027 1.00 . A A .   4 GLY N    1 1 
       17  9940 1 1  4 GLY O    O  -24.266   3.088   7.462 1.00 . A A .   4 GLY O    1 1 
       17  9941 1 1  5 SER C    C  -22.137   0.881   4.520 1.00 . A A .   5 SER C    1 1 
       17  9942 1 1  5 SER CA   C  -22.638   1.656   5.736 1.00 . A A .   5 SER CA   1 1 
       17  9943 1 1  5 SER CB   C  -21.873   1.217   6.985 1.00 . A A .   5 SER CB   1 1 
       17  9944 1 1  5 SER H    H  -24.529   0.761   5.408 1.00 . A A .   5 SER H    1 1 
       17  9945 1 1  5 SER HA   H  -22.468   2.710   5.571 1.00 . A A .   5 SER HA   1 1 
       17  9946 1 1  5 SER HB2  H  -20.816   1.375   6.832 1.00 . A A .   5 SER HB2  1 1 
       17  9947 1 1  5 SER HB3  H  -22.206   1.801   7.831 1.00 . A A .   5 SER HB3  1 1 
       17  9948 1 1  5 SER HG   H  -22.982  -0.275   7.605 1.00 . A A .   5 SER HG   1 1 
       17  9949 1 1  5 SER N    N  -24.070   1.458   5.923 1.00 . A A .   5 SER N    1 1 
       17  9950 1 1  5 SER O    O  -22.899   0.166   3.869 1.00 . A A .   5 SER O    1 1 
       17  9951 1 1  5 SER OG   O  -22.093  -0.156   7.262 1.00 . A A .   5 SER OG   1 1 
       17  9952 1 1  6 SER C    C  -19.275  -0.732   3.548 1.00 . A A .   6 SER C    1 1 
       17  9953 1 1  6 SER CA   C  -20.247   0.348   3.082 1.00 . A A .   6 SER CA   1 1 
       17  9954 1 1  6 SER CB   C  -19.521   1.352   2.185 1.00 . A A .   6 SER CB   1 1 
       17  9955 1 1  6 SER H    H  -20.295   1.614   4.778 1.00 . A A .   6 SER H    1 1 
       17  9956 1 1  6 SER HA   H  -21.040  -0.118   2.517 1.00 . A A .   6 SER HA   1 1 
       17  9957 1 1  6 SER HB2  H  -18.802   1.902   2.774 1.00 . A A .   6 SER HB2  1 1 
       17  9958 1 1  6 SER HB3  H  -19.009   0.821   1.396 1.00 . A A .   6 SER HB3  1 1 
       17  9959 1 1  6 SER HG   H  -21.138   1.786   1.168 1.00 . A A .   6 SER HG   1 1 
       17  9960 1 1  6 SER N    N  -20.851   1.030   4.221 1.00 . A A .   6 SER N    1 1 
       17  9961 1 1  6 SER O    O  -18.848  -0.743   4.701 1.00 . A A .   6 SER O    1 1 
       17  9962 1 1  6 SER OG   O  -20.432   2.269   1.604 1.00 . A A .   6 SER OG   1 1 
       17  9963 1 1  7 GLY C    C  -18.061  -3.852   1.979 1.00 . A A .   7 GLY C    1 1 
       17  9964 1 1  7 GLY CA   C  -18.010  -2.711   2.976 1.00 . A A .   7 GLY CA   1 1 
       17  9965 1 1  7 GLY H    H  -19.301  -1.581   1.735 1.00 . A A .   7 GLY H    1 1 
       17  9966 1 1  7 GLY HA2  H  -17.006  -2.315   3.002 1.00 . A A .   7 GLY HA2  1 1 
       17  9967 1 1  7 GLY HA3  H  -18.262  -3.093   3.954 1.00 . A A .   7 GLY HA3  1 1 
       17  9968 1 1  7 GLY N    N  -18.929  -1.640   2.640 1.00 . A A .   7 GLY N    1 1 
       17  9969 1 1  7 GLY O    O  -19.085  -4.521   1.842 1.00 . A A .   7 GLY O    1 1 
       17  9970 1 1  8 ALA C    C  -15.442  -5.633   0.123 1.00 . A A .   8 ALA C    1 1 
       17  9971 1 1  8 ALA CA   C  -16.876  -5.143   0.290 1.00 . A A .   8 ALA CA   1 1 
       17  9972 1 1  8 ALA CB   C  -17.432  -4.668  -1.044 1.00 . A A .   8 ALA CB   1 1 
       17  9973 1 1  8 ALA H    H  -16.169  -3.508   1.433 1.00 . A A .   8 ALA H    1 1 
       17  9974 1 1  8 ALA HA   H  -17.489  -5.963   0.636 1.00 . A A .   8 ALA HA   1 1 
       17  9975 1 1  8 ALA HB1  H  -16.887  -5.138  -1.849 1.00 . A A .   8 ALA HB1  1 1 
       17  9976 1 1  8 ALA HB2  H  -18.477  -4.934  -1.113 1.00 . A A .   8 ALA HB2  1 1 
       17  9977 1 1  8 ALA HB3  H  -17.327  -3.595  -1.116 1.00 . A A .   8 ALA HB3  1 1 
       17  9978 1 1  8 ALA N    N  -16.953  -4.075   1.279 1.00 . A A .   8 ALA N    1 1 
       17  9979 1 1  8 ALA O    O  -14.492  -4.867   0.273 1.00 . A A .   8 ALA O    1 1 
       17  9980 1 1  9 GLY C    C  -13.121  -7.391   0.882 1.00 . A A .   9 GLY C    1 1 
       17  9981 1 1  9 GLY CA   C  -13.971  -7.489  -0.369 1.00 . A A .   9 GLY CA   1 1 
       17  9982 1 1  9 GLY H    H  -16.087  -7.482  -0.295 1.00 . A A .   9 GLY H    1 1 
       17  9983 1 1  9 GLY HA2  H  -14.074  -8.528  -0.641 1.00 . A A .   9 GLY HA2  1 1 
       17  9984 1 1  9 GLY HA3  H  -13.472  -6.965  -1.171 1.00 . A A .   9 GLY HA3  1 1 
       17  9985 1 1  9 GLY N    N  -15.293  -6.918  -0.188 1.00 . A A .   9 GLY N    1 1 
       17  9986 1 1  9 GLY O    O  -13.074  -6.344   1.527 1.00 . A A .   9 GLY O    1 1 
       17  9987 1 1 10 GLU C    C  -10.226  -7.923   2.111 1.00 . A A .  10 GLU C    1 1 
       17  9988 1 1 10 GLU CA   C  -11.599  -8.518   2.410 1.00 . A A .  10 GLU CA   1 1 
       17  9989 1 1 10 GLU CB   C  -11.445  -9.954   2.915 1.00 . A A .  10 GLU CB   1 1 
       17  9990 1 1 10 GLU CD   C  -12.189  -9.810   5.325 1.00 . A A .  10 GLU CD   1 1 
       17  9991 1 1 10 GLU CG   C  -11.031 -10.045   4.375 1.00 . A A .  10 GLU CG   1 1 
       17  9992 1 1 10 GLU H    H  -12.527  -9.289   0.671 1.00 . A A .  10 GLU H    1 1 
       17  9993 1 1 10 GLU HA   H  -12.075  -7.926   3.177 1.00 . A A .  10 GLU HA   1 1 
       17  9994 1 1 10 GLU HB2  H  -12.388 -10.467   2.797 1.00 . A A .  10 GLU HB2  1 1 
       17  9995 1 1 10 GLU HB3  H  -10.696 -10.454   2.319 1.00 . A A .  10 GLU HB3  1 1 
       17  9996 1 1 10 GLU HG2  H  -10.627 -11.029   4.560 1.00 . A A .  10 GLU HG2  1 1 
       17  9997 1 1 10 GLU HG3  H  -10.270  -9.303   4.567 1.00 . A A .  10 GLU HG3  1 1 
       17  9998 1 1 10 GLU N    N  -12.449  -8.485   1.226 1.00 . A A .  10 GLU N    1 1 
       17  9999 1 1 10 GLU O    O   -9.196  -8.501   2.459 1.00 . A A .  10 GLU O    1 1 
       17 10000 1 1 10 GLU OE1  O  -13.083 -10.679   5.397 1.00 . A A .  10 GLU OE1  1 1 
       17 10001 1 1 10 GLU OE2  O  -12.202  -8.757   5.997 1.00 . A A .  10 GLU OE2  1 1 
       17 10002 1 1 11 LYS C    C   -8.926  -4.690   1.722 1.00 . A A .  11 LYS C    1 1 
       17 10003 1 1 11 LYS CA   C   -8.974  -6.088   1.114 1.00 . A A .  11 LYS CA   1 1 
       17 10004 1 1 11 LYS CB   C   -8.824  -6.000  -0.406 1.00 . A A .  11 LYS CB   1 1 
       17 10005 1 1 11 LYS CD   C   -9.652  -4.681  -2.377 1.00 . A A .  11 LYS CD   1 1 
       17 10006 1 1 11 LYS CE   C   -9.014  -3.335  -2.073 1.00 . A A .  11 LYS CE   1 1 
       17 10007 1 1 11 LYS CG   C  -10.039  -5.415  -1.104 1.00 . A A .  11 LYS CG   1 1 
       17 10008 1 1 11 LYS H    H  -11.072  -6.352   1.210 1.00 . A A .  11 LYS H    1 1 
       17 10009 1 1 11 LYS HA   H   -8.158  -6.670   1.515 1.00 . A A .  11 LYS HA   1 1 
       17 10010 1 1 11 LYS HB2  H   -7.970  -5.381  -0.637 1.00 . A A .  11 LYS HB2  1 1 
       17 10011 1 1 11 LYS HB3  H   -8.654  -6.993  -0.797 1.00 . A A .  11 LYS HB3  1 1 
       17 10012 1 1 11 LYS HD2  H   -8.946  -5.284  -2.929 1.00 . A A .  11 LYS HD2  1 1 
       17 10013 1 1 11 LYS HD3  H  -10.538  -4.523  -2.975 1.00 . A A .  11 LYS HD3  1 1 
       17 10014 1 1 11 LYS HE2  H   -8.436  -3.422  -1.165 1.00 . A A .  11 LYS HE2  1 1 
       17 10015 1 1 11 LYS HE3  H   -8.361  -3.068  -2.891 1.00 . A A .  11 LYS HE3  1 1 
       17 10016 1 1 11 LYS HG2  H  -10.720  -6.215  -1.356 1.00 . A A .  11 LYS HG2  1 1 
       17 10017 1 1 11 LYS HG3  H  -10.528  -4.721  -0.435 1.00 . A A .  11 LYS HG3  1 1 
       17 10018 1 1 11 LYS HZ1  H   -9.880  -1.767  -0.997 1.00 . A A .  11 LYS HZ1  1 1 
       17 10019 1 1 11 LYS HZ2  H  -10.989  -2.678  -1.894 1.00 . A A .  11 LYS HZ2  1 1 
       17 10020 1 1 11 LYS HZ3  H   -9.970  -1.578  -2.676 1.00 . A A .  11 LYS HZ3  1 1 
       17 10021 1 1 11 LYS N    N  -10.219  -6.764   1.461 1.00 . A A .  11 LYS N    1 1 
       17 10022 1 1 11 LYS NZ   N  -10.034  -2.265  -1.898 1.00 . A A .  11 LYS NZ   1 1 
       17 10023 1 1 11 LYS O    O   -9.195  -3.689   1.058 1.00 . A A .  11 LYS O    1 1 
       17 10024 1 1 12 PRO C    C   -7.305  -2.497   3.270 1.00 . A A .  12 PRO C    1 1 
       17 10025 1 1 12 PRO CA   C   -8.482  -3.346   3.739 1.00 . A A .  12 PRO CA   1 1 
       17 10026 1 1 12 PRO CB   C   -8.281  -3.781   5.193 1.00 . A A .  12 PRO CB   1 1 
       17 10027 1 1 12 PRO CD   C   -8.241  -5.770   3.868 1.00 . A A .  12 PRO CD   1 1 
       17 10028 1 1 12 PRO CG   C   -7.665  -5.134   5.103 1.00 . A A .  12 PRO CG   1 1 
       17 10029 1 1 12 PRO HA   H   -9.394  -2.774   3.655 1.00 . A A .  12 PRO HA   1 1 
       17 10030 1 1 12 PRO HB2  H   -7.628  -3.081   5.694 1.00 . A A .  12 PRO HB2  1 1 
       17 10031 1 1 12 PRO HB3  H   -9.236  -3.815   5.697 1.00 . A A .  12 PRO HB3  1 1 
       17 10032 1 1 12 PRO HD2  H   -7.507  -6.403   3.391 1.00 . A A .  12 PRO HD2  1 1 
       17 10033 1 1 12 PRO HD3  H   -9.128  -6.336   4.114 1.00 . A A .  12 PRO HD3  1 1 
       17 10034 1 1 12 PRO HG2  H   -6.593  -5.044   5.013 1.00 . A A .  12 PRO HG2  1 1 
       17 10035 1 1 12 PRO HG3  H   -7.922  -5.713   5.977 1.00 . A A .  12 PRO HG3  1 1 
       17 10036 1 1 12 PRO N    N   -8.575  -4.617   3.015 1.00 . A A .  12 PRO N    1 1 
       17 10037 1 1 12 PRO O    O   -7.051  -1.420   3.811 1.00 . A A .  12 PRO O    1 1 
       17 10038 1 1 13 TYR C    C   -5.878  -1.232   0.696 1.00 . A A .  13 TYR C    1 1 
       17 10039 1 1 13 TYR CA   C   -5.441  -2.273   1.723 1.00 . A A .  13 TYR CA   1 1 
       17 10040 1 1 13 TYR CB   C   -4.459  -3.256   1.082 1.00 . A A .  13 TYR CB   1 1 
       17 10041 1 1 13 TYR CD1  C   -3.533  -4.563   3.034 1.00 . A A .  13 TYR CD1  1 1 
       17 10042 1 1 13 TYR CD2  C   -4.877  -5.720   1.442 1.00 . A A .  13 TYR CD2  1 1 
       17 10043 1 1 13 TYR CE1  C   -3.371  -5.730   3.754 1.00 . A A .  13 TYR CE1  1 1 
       17 10044 1 1 13 TYR CE2  C   -4.722  -6.892   2.157 1.00 . A A .  13 TYR CE2  1 1 
       17 10045 1 1 13 TYR CG   C   -4.286  -4.536   1.867 1.00 . A A .  13 TYR CG   1 1 
       17 10046 1 1 13 TYR CZ   C   -3.967  -6.893   3.311 1.00 . A A .  13 TYR CZ   1 1 
       17 10047 1 1 13 TYR H    H   -6.844  -3.850   1.874 1.00 . A A .  13 TYR H    1 1 
       17 10048 1 1 13 TYR HA   H   -4.949  -1.770   2.542 1.00 . A A .  13 TYR HA   1 1 
       17 10049 1 1 13 TYR HB2  H   -4.813  -3.517   0.097 1.00 . A A .  13 TYR HB2  1 1 
       17 10050 1 1 13 TYR HB3  H   -3.491  -2.784   0.999 1.00 . A A .  13 TYR HB3  1 1 
       17 10051 1 1 13 TYR HD1  H   -3.067  -3.650   3.379 1.00 . A A .  13 TYR HD1  1 1 
       17 10052 1 1 13 TYR HD2  H   -5.467  -5.717   0.537 1.00 . A A .  13 TYR HD2  1 1 
       17 10053 1 1 13 TYR HE1  H   -2.781  -5.731   4.659 1.00 . A A .  13 TYR HE1  1 1 
       17 10054 1 1 13 TYR HE2  H   -5.188  -7.803   1.810 1.00 . A A .  13 TYR HE2  1 1 
       17 10055 1 1 13 TYR HH   H   -4.527  -8.661   3.817 1.00 . A A .  13 TYR HH   1 1 
       17 10056 1 1 13 TYR N    N   -6.592  -2.987   2.263 1.00 . A A .  13 TYR N    1 1 
       17 10057 1 1 13 TYR O    O   -6.746  -1.491  -0.136 1.00 . A A .  13 TYR O    1 1 
       17 10058 1 1 13 TYR OH   O   -3.810  -8.058   4.027 1.00 . A A .  13 TYR OH   1 1 
       17 10059 1 1 14 GLY C    C   -4.938   2.324   0.190 1.00 . A A .  14 GLY C    1 1 
       17 10060 1 1 14 GLY CA   C   -5.606   1.011  -0.165 1.00 . A A .  14 GLY CA   1 1 
       17 10061 1 1 14 GLY H    H   -4.584   0.097   1.448 1.00 . A A .  14 GLY H    1 1 
       17 10062 1 1 14 GLY HA2  H   -5.298   0.719  -1.158 1.00 . A A .  14 GLY HA2  1 1 
       17 10063 1 1 14 GLY HA3  H   -6.677   1.152  -0.158 1.00 . A A .  14 GLY HA3  1 1 
       17 10064 1 1 14 GLY N    N   -5.268  -0.052   0.763 1.00 . A A .  14 GLY N    1 1 
       17 10065 1 1 14 GLY O    O   -5.353   3.008   1.126 1.00 . A A .  14 GLY O    1 1 
       17 10066 1 1 15 CYS C    C   -4.130   5.089  -0.143 1.00 . A A .  15 CYS C    1 1 
       17 10067 1 1 15 CYS CA   C   -3.169   3.917  -0.318 1.00 . A A .  15 CYS CA   1 1 
       17 10068 1 1 15 CYS CB   C   -2.207   4.200  -1.474 1.00 . A A .  15 CYS CB   1 1 
       17 10069 1 1 15 CYS H    H   -3.614   2.091  -1.291 1.00 . A A .  15 CYS H    1 1 
       17 10070 1 1 15 CYS HA   H   -2.599   3.796   0.591 1.00 . A A .  15 CYS HA   1 1 
       17 10071 1 1 15 CYS HB2  H   -1.424   3.456  -1.471 1.00 . A A .  15 CYS HB2  1 1 
       17 10072 1 1 15 CYS HB3  H   -2.749   4.141  -2.406 1.00 . A A .  15 CYS HB3  1 1 
       17 10073 1 1 15 CYS N    N   -3.898   2.678  -0.559 1.00 . A A .  15 CYS N    1 1 
       17 10074 1 1 15 CYS O    O   -4.996   5.326  -0.985 1.00 . A A .  15 CYS O    1 1 
       17 10075 1 1 15 CYS SG   S   -1.413   5.838  -1.396 1.00 . A A .  15 CYS SG   1 1 
       17 10076 1 1 16 SER C    C   -4.153   8.266   0.819 1.00 . A A .  16 SER C    1 1 
       17 10077 1 1 16 SER CA   C   -4.826   6.965   1.244 1.00 . A A .  16 SER CA   1 1 
       17 10078 1 1 16 SER CB   C   -5.162   7.015   2.736 1.00 . A A .  16 SER CB   1 1 
       17 10079 1 1 16 SER H    H   -3.262   5.580   1.590 1.00 . A A .  16 SER H    1 1 
       17 10080 1 1 16 SER HA   H   -5.740   6.845   0.682 1.00 . A A .  16 SER HA   1 1 
       17 10081 1 1 16 SER HB2  H   -4.247   7.019   3.309 1.00 . A A .  16 SER HB2  1 1 
       17 10082 1 1 16 SER HB3  H   -5.721   7.915   2.946 1.00 . A A .  16 SER HB3  1 1 
       17 10083 1 1 16 SER HG   H   -6.214   5.995   4.036 1.00 . A A .  16 SER HG   1 1 
       17 10084 1 1 16 SER N    N   -3.971   5.819   0.956 1.00 . A A .  16 SER N    1 1 
       17 10085 1 1 16 SER O    O   -4.822   9.235   0.463 1.00 . A A .  16 SER O    1 1 
       17 10086 1 1 16 SER OG   O   -5.938   5.894   3.122 1.00 . A A .  16 SER OG   1 1 
       17 10087 1 1 17 GLU C    C   -2.569  10.035  -0.841 1.00 . A A .  17 GLU C    1 1 
       17 10088 1 1 17 GLU CA   C   -2.060   9.460   0.477 1.00 . A A .  17 GLU CA   1 1 
       17 10089 1 1 17 GLU CB   C   -0.574   9.117   0.357 1.00 . A A .  17 GLU CB   1 1 
       17 10090 1 1 17 GLU CD   C    1.587   8.682   1.591 1.00 . A A .  17 GLU CD   1 1 
       17 10091 1 1 17 GLU CG   C    0.196   9.282   1.657 1.00 . A A .  17 GLU CG   1 1 
       17 10092 1 1 17 GLU H    H   -2.347   7.474   1.150 1.00 . A A .  17 GLU H    1 1 
       17 10093 1 1 17 GLU HA   H   -2.187  10.201   1.252 1.00 . A A .  17 GLU HA   1 1 
       17 10094 1 1 17 GLU HB2  H   -0.478   8.091   0.033 1.00 . A A .  17 GLU HB2  1 1 
       17 10095 1 1 17 GLU HB3  H   -0.127   9.762  -0.385 1.00 . A A .  17 GLU HB3  1 1 
       17 10096 1 1 17 GLU HG2  H    0.285  10.335   1.876 1.00 . A A .  17 GLU HG2  1 1 
       17 10097 1 1 17 GLU HG3  H   -0.353   8.796   2.450 1.00 . A A .  17 GLU HG3  1 1 
       17 10098 1 1 17 GLU N    N   -2.824   8.278   0.858 1.00 . A A .  17 GLU N    1 1 
       17 10099 1 1 17 GLU O    O   -2.733  11.248  -0.981 1.00 . A A .  17 GLU O    1 1 
       17 10100 1 1 17 GLU OE1  O    1.748   7.624   0.948 1.00 . A A .  17 GLU OE1  1 1 
       17 10101 1 1 17 GLU OE2  O    2.515   9.271   2.183 1.00 . A A .  17 GLU OE2  1 1 
       17 10102 1 1 18 CYS C    C   -4.620   8.879  -3.453 1.00 . A A .  18 CYS C    1 1 
       17 10103 1 1 18 CYS CA   C   -3.305   9.575  -3.116 1.00 . A A .  18 CYS CA   1 1 
       17 10104 1 1 18 CYS CB   C   -2.263   9.270  -4.194 1.00 . A A .  18 CYS CB   1 1 
       17 10105 1 1 18 CYS H    H   -2.665   8.203  -1.636 1.00 . A A .  18 CYS H    1 1 
       17 10106 1 1 18 CYS HA   H   -3.474  10.640  -3.082 1.00 . A A .  18 CYS HA   1 1 
       17 10107 1 1 18 CYS HB2  H   -2.521   9.807  -5.095 1.00 . A A .  18 CYS HB2  1 1 
       17 10108 1 1 18 CYS HB3  H   -1.293   9.600  -3.850 1.00 . A A .  18 CYS HB3  1 1 
       17 10109 1 1 18 CYS N    N   -2.816   9.157  -1.807 1.00 . A A .  18 CYS N    1 1 
       17 10110 1 1 18 CYS O    O   -5.507   9.469  -4.067 1.00 . A A .  18 CYS O    1 1 
       17 10111 1 1 18 CYS SG   S   -2.129   7.505  -4.621 1.00 . A A .  18 CYS SG   1 1 
       17 10112 1 1 19 GLY C    C   -5.724   5.747  -4.315 1.00 . A A .  19 GLY C    1 1 
       17 10113 1 1 19 GLY CA   C   -5.947   6.862  -3.313 1.00 . A A .  19 GLY CA   1 1 
       17 10114 1 1 19 GLY H    H   -3.997   7.199  -2.559 1.00 . A A .  19 GLY H    1 1 
       17 10115 1 1 19 GLY HA2  H   -6.303   6.435  -2.388 1.00 . A A .  19 GLY HA2  1 1 
       17 10116 1 1 19 GLY HA3  H   -6.699   7.533  -3.701 1.00 . A A .  19 GLY HA3  1 1 
       17 10117 1 1 19 GLY N    N   -4.738   7.618  -3.045 1.00 . A A .  19 GLY N    1 1 
       17 10118 1 1 19 GLY O    O   -6.515   5.566  -5.241 1.00 . A A .  19 GLY O    1 1 
       17 10119 1 1 20 LYS C    C   -4.465   2.553  -4.315 1.00 . A A .  20 LYS C    1 1 
       17 10120 1 1 20 LYS CA   C   -4.315   3.893  -5.027 1.00 . A A .  20 LYS CA   1 1 
       17 10121 1 1 20 LYS CB   C   -2.888   4.045  -5.557 1.00 . A A .  20 LYS CB   1 1 
       17 10122 1 1 20 LYS CD   C   -2.925   3.888  -8.064 1.00 . A A .  20 LYS CD   1 1 
       17 10123 1 1 20 LYS CE   C   -2.502   3.070  -9.274 1.00 . A A .  20 LYS CE   1 1 
       17 10124 1 1 20 LYS CG   C   -2.591   3.173  -6.765 1.00 . A A .  20 LYS CG   1 1 
       17 10125 1 1 20 LYS H    H   -4.049   5.190  -3.375 1.00 . A A .  20 LYS H    1 1 
       17 10126 1 1 20 LYS HA   H   -5.004   3.925  -5.858 1.00 . A A .  20 LYS HA   1 1 
       17 10127 1 1 20 LYS HB2  H   -2.727   5.076  -5.835 1.00 . A A .  20 LYS HB2  1 1 
       17 10128 1 1 20 LYS HB3  H   -2.195   3.781  -4.771 1.00 . A A .  20 LYS HB3  1 1 
       17 10129 1 1 20 LYS HD2  H   -3.991   4.053  -8.110 1.00 . A A .  20 LYS HD2  1 1 
       17 10130 1 1 20 LYS HD3  H   -2.410   4.838  -8.084 1.00 . A A .  20 LYS HD3  1 1 
       17 10131 1 1 20 LYS HE2  H   -2.694   2.027  -9.073 1.00 . A A .  20 LYS HE2  1 1 
       17 10132 1 1 20 LYS HE3  H   -3.086   3.385 -10.127 1.00 . A A .  20 LYS HE3  1 1 
       17 10133 1 1 20 LYS HG2  H   -1.542   2.919  -6.766 1.00 . A A .  20 LYS HG2  1 1 
       17 10134 1 1 20 LYS HG3  H   -3.182   2.270  -6.699 1.00 . A A .  20 LYS HG3  1 1 
       17 10135 1 1 20 LYS HZ1  H   -0.489   3.131  -8.721 1.00 . A A .  20 LYS HZ1  1 1 
       17 10136 1 1 20 LYS HZ2  H   -0.888   4.196  -9.974 1.00 . A A .  20 LYS HZ2  1 1 
       17 10137 1 1 20 LYS HZ3  H   -0.752   2.539 -10.284 1.00 . A A .  20 LYS HZ3  1 1 
       17 10138 1 1 20 LYS N    N   -4.642   4.997  -4.132 1.00 . A A .  20 LYS N    1 1 
       17 10139 1 1 20 LYS NZ   N   -1.056   3.246  -9.585 1.00 . A A .  20 LYS NZ   1 1 
       17 10140 1 1 20 LYS O    O   -3.736   2.258  -3.368 1.00 . A A .  20 LYS O    1 1 
       17 10141 1 1 21 ALA C    C   -4.915  -0.658  -4.952 1.00 . A A .  21 ALA C    1 1 
       17 10142 1 1 21 ALA CA   C   -5.655   0.434  -4.187 1.00 . A A .  21 ALA CA   1 1 
       17 10143 1 1 21 ALA CB   C   -7.147   0.138  -4.153 1.00 . A A .  21 ALA CB   1 1 
       17 10144 1 1 21 ALA H    H   -5.962   2.036  -5.535 1.00 . A A .  21 ALA H    1 1 
       17 10145 1 1 21 ALA HA   H   -5.294   0.455  -3.169 1.00 . A A .  21 ALA HA   1 1 
       17 10146 1 1 21 ALA HB1  H   -7.605   0.494  -5.063 1.00 . A A .  21 ALA HB1  1 1 
       17 10147 1 1 21 ALA HB2  H   -7.300  -0.928  -4.065 1.00 . A A .  21 ALA HB2  1 1 
       17 10148 1 1 21 ALA HB3  H   -7.593   0.637  -3.306 1.00 . A A .  21 ALA HB3  1 1 
       17 10149 1 1 21 ALA N    N   -5.413   1.745  -4.778 1.00 . A A .  21 ALA N    1 1 
       17 10150 1 1 21 ALA O    O   -4.412  -0.428  -6.052 1.00 . A A .  21 ALA O    1 1 
       17 10151 1 1 22 PHE C    C   -4.779  -4.298  -4.534 1.00 . A A .  22 PHE C    1 1 
       17 10152 1 1 22 PHE CA   C   -4.169  -2.975  -4.987 1.00 . A A .  22 PHE CA   1 1 
       17 10153 1 1 22 PHE CB   C   -2.677  -2.947  -4.651 1.00 . A A .  22 PHE CB   1 1 
       17 10154 1 1 22 PHE CD1  C   -2.026  -0.541  -4.357 1.00 . A A .  22 PHE CD1  1 1 
       17 10155 1 1 22 PHE CD2  C   -1.283  -1.685  -6.313 1.00 . A A .  22 PHE CD2  1 1 
       17 10156 1 1 22 PHE CE1  C   -1.386   0.608  -4.781 1.00 . A A .  22 PHE CE1  1 1 
       17 10157 1 1 22 PHE CE2  C   -0.641  -0.538  -6.742 1.00 . A A .  22 PHE CE2  1 1 
       17 10158 1 1 22 PHE CG   C   -1.981  -1.699  -5.116 1.00 . A A .  22 PHE CG   1 1 
       17 10159 1 1 22 PHE CZ   C   -0.694   0.610  -5.976 1.00 . A A .  22 PHE CZ   1 1 
       17 10160 1 1 22 PHE H    H   -5.270  -1.969  -3.484 1.00 . A A .  22 PHE H    1 1 
       17 10161 1 1 22 PHE HA   H   -4.291  -2.883  -6.055 1.00 . A A .  22 PHE HA   1 1 
       17 10162 1 1 22 PHE HB2  H   -2.555  -3.015  -3.581 1.00 . A A .  22 PHE HB2  1 1 
       17 10163 1 1 22 PHE HB3  H   -2.194  -3.791  -5.119 1.00 . A A .  22 PHE HB3  1 1 
       17 10164 1 1 22 PHE HD1  H   -2.568  -0.542  -3.421 1.00 . A A .  22 PHE HD1  1 1 
       17 10165 1 1 22 PHE HD2  H   -1.242  -2.581  -6.914 1.00 . A A .  22 PHE HD2  1 1 
       17 10166 1 1 22 PHE HE1  H   -1.430   1.504  -4.179 1.00 . A A .  22 PHE HE1  1 1 
       17 10167 1 1 22 PHE HE2  H   -0.101  -0.540  -7.677 1.00 . A A .  22 PHE HE2  1 1 
       17 10168 1 1 22 PHE HZ   H   -0.193   1.506  -6.309 1.00 . A A .  22 PHE HZ   1 1 
       17 10169 1 1 22 PHE N    N   -4.850  -1.847  -4.362 1.00 . A A .  22 PHE N    1 1 
       17 10170 1 1 22 PHE O    O   -5.718  -4.320  -3.738 1.00 . A A .  22 PHE O    1 1 
       17 10171 1 1 23 SER C    C   -4.239  -7.144  -3.318 1.00 . A A .  23 SER C    1 1 
       17 10172 1 1 23 SER CA   C   -4.733  -6.726  -4.700 1.00 . A A .  23 SER CA   1 1 
       17 10173 1 1 23 SER CB   C   -4.285  -7.749  -5.745 1.00 . A A .  23 SER CB   1 1 
       17 10174 1 1 23 SER H    H   -3.493  -5.315  -5.677 1.00 . A A .  23 SER H    1 1 
       17 10175 1 1 23 SER HA   H   -5.811  -6.686  -4.687 1.00 . A A .  23 SER HA   1 1 
       17 10176 1 1 23 SER HB2  H   -4.427  -7.338  -6.732 1.00 . A A .  23 SER HB2  1 1 
       17 10177 1 1 23 SER HB3  H   -3.239  -7.977  -5.596 1.00 . A A .  23 SER HB3  1 1 
       17 10178 1 1 23 SER HG   H   -5.180  -9.313  -6.513 1.00 . A A .  23 SER HG   1 1 
       17 10179 1 1 23 SER N    N   -4.239  -5.398  -5.047 1.00 . A A .  23 SER N    1 1 
       17 10180 1 1 23 SER O    O   -5.029  -7.523  -2.453 1.00 . A A .  23 SER O    1 1 
       17 10181 1 1 23 SER OG   O   -5.033  -8.948  -5.638 1.00 . A A .  23 SER OG   1 1 
       17 10182 1 1 24 SER C    C   -1.608  -6.257  -1.211 1.00 . A A .  24 SER C    1 1 
       17 10183 1 1 24 SER CA   C   -2.326  -7.446  -1.843 1.00 . A A .  24 SER CA   1 1 
       17 10184 1 1 24 SER CB   C   -1.345  -8.603  -2.038 1.00 . A A .  24 SER CB   1 1 
       17 10185 1 1 24 SER H    H   -2.349  -6.761  -3.847 1.00 . A A .  24 SER H    1 1 
       17 10186 1 1 24 SER HA   H   -3.119  -7.764  -1.183 1.00 . A A .  24 SER HA   1 1 
       17 10187 1 1 24 SER HB2  H   -1.030  -8.971  -1.073 1.00 . A A .  24 SER HB2  1 1 
       17 10188 1 1 24 SER HB3  H   -1.834  -9.398  -2.583 1.00 . A A .  24 SER HB3  1 1 
       17 10189 1 1 24 SER HG   H    0.096  -7.337  -2.433 1.00 . A A .  24 SER HG   1 1 
       17 10190 1 1 24 SER N    N   -2.927  -7.071  -3.118 1.00 . A A .  24 SER N    1 1 
       17 10191 1 1 24 SER O    O   -1.481  -5.196  -1.823 1.00 . A A .  24 SER O    1 1 
       17 10192 1 1 24 SER OG   O   -0.202  -8.187  -2.764 1.00 . A A .  24 SER OG   1 1 
       17 10193 1 1 25 LYS C    C    0.884  -5.050   0.047 1.00 . A A .  25 LYS C    1 1 
       17 10194 1 1 25 LYS CA   C   -0.434  -5.387   0.736 1.00 . A A .  25 LYS CA   1 1 
       17 10195 1 1 25 LYS CB   C   -0.171  -5.813   2.182 1.00 . A A .  25 LYS CB   1 1 
       17 10196 1 1 25 LYS CD   C    1.410  -7.118   3.633 1.00 . A A .  25 LYS CD   1 1 
       17 10197 1 1 25 LYS CE   C    0.465  -7.455   4.776 1.00 . A A .  25 LYS CE   1 1 
       17 10198 1 1 25 LYS CG   C    0.679  -7.066   2.302 1.00 . A A .  25 LYS CG   1 1 
       17 10199 1 1 25 LYS H    H   -1.273  -7.310   0.455 1.00 . A A .  25 LYS H    1 1 
       17 10200 1 1 25 LYS HA   H   -1.061  -4.509   0.737 1.00 . A A .  25 LYS HA   1 1 
       17 10201 1 1 25 LYS HB2  H    0.335  -5.009   2.695 1.00 . A A .  25 LYS HB2  1 1 
       17 10202 1 1 25 LYS HB3  H   -1.119  -5.998   2.668 1.00 . A A .  25 LYS HB3  1 1 
       17 10203 1 1 25 LYS HD2  H    2.179  -7.875   3.582 1.00 . A A .  25 LYS HD2  1 1 
       17 10204 1 1 25 LYS HD3  H    1.862  -6.155   3.823 1.00 . A A .  25 LYS HD3  1 1 
       17 10205 1 1 25 LYS HE2  H   -0.324  -6.719   4.803 1.00 . A A .  25 LYS HE2  1 1 
       17 10206 1 1 25 LYS HE3  H    0.039  -8.432   4.598 1.00 . A A .  25 LYS HE3  1 1 
       17 10207 1 1 25 LYS HG2  H    0.040  -7.933   2.221 1.00 . A A .  25 LYS HG2  1 1 
       17 10208 1 1 25 LYS HG3  H    1.405  -7.076   1.502 1.00 . A A .  25 LYS HG3  1 1 
       17 10209 1 1 25 LYS HZ1  H    0.482  -7.312   6.860 1.00 . A A .  25 LYS HZ1  1 1 
       17 10210 1 1 25 LYS HZ2  H    1.879  -6.707   6.120 1.00 . A A .  25 LYS HZ2  1 1 
       17 10211 1 1 25 LYS HZ3  H    1.639  -8.378   6.237 1.00 . A A .  25 LYS HZ3  1 1 
       17 10212 1 1 25 LYS N    N   -1.141  -6.442   0.019 1.00 . A A .  25 LYS N    1 1 
       17 10213 1 1 25 LYS NZ   N    1.165  -7.464   6.090 1.00 . A A .  25 LYS NZ   1 1 
       17 10214 1 1 25 LYS O    O    1.311  -3.895   0.034 1.00 . A A .  25 LYS O    1 1 
       17 10215 1 1 26 SER C    C    2.658  -4.849  -2.336 1.00 . A A .  26 SER C    1 1 
       17 10216 1 1 26 SER CA   C    2.795  -5.875  -1.215 1.00 . A A .  26 SER CA   1 1 
       17 10217 1 1 26 SER CB   C    3.294  -7.205  -1.784 1.00 . A A .  26 SER CB   1 1 
       17 10218 1 1 26 SER H    H    1.133  -6.962  -0.481 1.00 . A A .  26 SER H    1 1 
       17 10219 1 1 26 SER HA   H    3.512  -5.509  -0.495 1.00 . A A .  26 SER HA   1 1 
       17 10220 1 1 26 SER HB2  H    2.505  -7.667  -2.357 1.00 . A A .  26 SER HB2  1 1 
       17 10221 1 1 26 SER HB3  H    4.145  -7.022  -2.424 1.00 . A A .  26 SER HB3  1 1 
       17 10222 1 1 26 SER HG   H    4.586  -8.380  -0.896 1.00 . A A .  26 SER HG   1 1 
       17 10223 1 1 26 SER N    N    1.524  -6.064  -0.526 1.00 . A A .  26 SER N    1 1 
       17 10224 1 1 26 SER O    O    3.400  -3.868  -2.389 1.00 . A A .  26 SER O    1 1 
       17 10225 1 1 26 SER OG   O    3.684  -8.088  -0.746 1.00 . A A .  26 SER OG   1 1 
       17 10226 1 1 27 TYR C    C    1.304  -2.744  -3.870 1.00 . A A .  27 TYR C    1 1 
       17 10227 1 1 27 TYR CA   C    1.469  -4.182  -4.352 1.00 . A A .  27 TYR CA   1 1 
       17 10228 1 1 27 TYR CB   C    0.227  -4.617  -5.131 1.00 . A A .  27 TYR CB   1 1 
       17 10229 1 1 27 TYR CD1  C    1.397  -5.307  -7.260 1.00 . A A .  27 TYR CD1  1 1 
       17 10230 1 1 27 TYR CD2  C   -0.082  -6.868  -6.234 1.00 . A A .  27 TYR CD2  1 1 
       17 10231 1 1 27 TYR CE1  C    1.666  -6.215  -8.265 1.00 . A A .  27 TYR CE1  1 1 
       17 10232 1 1 27 TYR CE2  C    0.182  -7.783  -7.234 1.00 . A A .  27 TYR CE2  1 1 
       17 10233 1 1 27 TYR CG   C    0.519  -5.615  -6.229 1.00 . A A .  27 TYR CG   1 1 
       17 10234 1 1 27 TYR CZ   C    1.057  -7.452  -8.247 1.00 . A A .  27 TYR CZ   1 1 
       17 10235 1 1 27 TYR H    H    1.144  -5.883  -3.134 1.00 . A A .  27 TYR H    1 1 
       17 10236 1 1 27 TYR HA   H    2.328  -4.235  -5.005 1.00 . A A .  27 TYR HA   1 1 
       17 10237 1 1 27 TYR HB2  H   -0.477  -5.071  -4.451 1.00 . A A .  27 TYR HB2  1 1 
       17 10238 1 1 27 TYR HB3  H   -0.227  -3.748  -5.585 1.00 . A A .  27 TYR HB3  1 1 
       17 10239 1 1 27 TYR HD1  H    1.874  -4.337  -7.271 1.00 . A A .  27 TYR HD1  1 1 
       17 10240 1 1 27 TYR HD2  H   -0.767  -7.124  -5.438 1.00 . A A .  27 TYR HD2  1 1 
       17 10241 1 1 27 TYR HE1  H    2.352  -5.956  -9.059 1.00 . A A .  27 TYR HE1  1 1 
       17 10242 1 1 27 TYR HE2  H   -0.295  -8.752  -7.220 1.00 . A A .  27 TYR HE2  1 1 
       17 10243 1 1 27 TYR HH   H    0.498  -8.661  -9.634 1.00 . A A .  27 TYR HH   1 1 
       17 10244 1 1 27 TYR N    N    1.704  -5.084  -3.230 1.00 . A A .  27 TYR N    1 1 
       17 10245 1 1 27 TYR O    O    1.747  -1.802  -4.528 1.00 . A A .  27 TYR O    1 1 
       17 10246 1 1 27 TYR OH   O    1.323  -8.361  -9.246 1.00 . A A .  27 TYR OH   1 1 
       17 10247 1 1 28 LEU C    C    1.730  -0.693  -1.564 1.00 . A A .  28 LEU C    1 1 
       17 10248 1 1 28 LEU CA   C    0.439  -1.261  -2.145 1.00 . A A .  28 LEU CA   1 1 
       17 10249 1 1 28 LEU CB   C   -0.636  -1.329  -1.059 1.00 . A A .  28 LEU CB   1 1 
       17 10250 1 1 28 LEU CD1  C   -1.156   1.117  -0.884 1.00 . A A .  28 LEU CD1  1 1 
       17 10251 1 1 28 LEU CD2  C   -1.675  -0.409   1.029 1.00 . A A .  28 LEU CD2  1 1 
       17 10252 1 1 28 LEU CG   C   -0.720  -0.124  -0.121 1.00 . A A .  28 LEU CG   1 1 
       17 10253 1 1 28 LEU H    H    0.334  -3.372  -2.239 1.00 . A A .  28 LEU H    1 1 
       17 10254 1 1 28 LEU HA   H    0.099  -0.610  -2.937 1.00 . A A .  28 LEU HA   1 1 
       17 10255 1 1 28 LEU HB2  H   -1.592  -1.435  -1.547 1.00 . A A .  28 LEU HB2  1 1 
       17 10256 1 1 28 LEU HB3  H   -0.442  -2.206  -0.457 1.00 . A A .  28 LEU HB3  1 1 
       17 10257 1 1 28 LEU HD11 H   -0.301   1.754  -1.053 1.00 . A A .  28 LEU HD11 1 1 
       17 10258 1 1 28 LEU HD12 H   -1.896   1.652  -0.307 1.00 . A A .  28 LEU HD12 1 1 
       17 10259 1 1 28 LEU HD13 H   -1.581   0.825  -1.833 1.00 . A A .  28 LEU HD13 1 1 
       17 10260 1 1 28 LEU HD21 H   -1.803   0.485   1.620 1.00 . A A .  28 LEU HD21 1 1 
       17 10261 1 1 28 LEU HD22 H   -1.269  -1.196   1.647 1.00 . A A .  28 LEU HD22 1 1 
       17 10262 1 1 28 LEU HD23 H   -2.632  -0.720   0.633 1.00 . A A .  28 LEU HD23 1 1 
       17 10263 1 1 28 LEU HG   H    0.259   0.068   0.297 1.00 . A A .  28 LEU HG   1 1 
       17 10264 1 1 28 LEU N    N    0.664  -2.584  -2.718 1.00 . A A .  28 LEU N    1 1 
       17 10265 1 1 28 LEU O    O    2.040   0.485  -1.747 1.00 . A A .  28 LEU O    1 1 
       17 10266 1 1 29 ILE C    C    4.701  -0.579  -1.311 1.00 . A A .  29 ILE C    1 1 
       17 10267 1 1 29 ILE CA   C    3.739  -1.121  -0.259 1.00 . A A .  29 ILE CA   1 1 
       17 10268 1 1 29 ILE CB   C    4.416  -2.284   0.490 1.00 . A A .  29 ILE CB   1 1 
       17 10269 1 1 29 ILE CD1  C    3.739  -4.202   2.019 1.00 . A A .  29 ILE CD1  1 1 
       17 10270 1 1 29 ILE CG1  C    3.540  -2.747   1.655 1.00 . A A .  29 ILE CG1  1 1 
       17 10271 1 1 29 ILE CG2  C    5.791  -1.863   0.988 1.00 . A A .  29 ILE CG2  1 1 
       17 10272 1 1 29 ILE H    H    2.180  -2.464  -0.753 1.00 . A A .  29 ILE H    1 1 
       17 10273 1 1 29 ILE HA   H    3.522  -0.338   0.453 1.00 . A A .  29 ILE HA   1 1 
       17 10274 1 1 29 ILE HB   H    4.545  -3.102  -0.202 1.00 . A A .  29 ILE HB   1 1 
       17 10275 1 1 29 ILE HD11 H    3.418  -4.365   3.038 1.00 . A A .  29 ILE HD11 1 1 
       17 10276 1 1 29 ILE HD12 H    3.155  -4.823   1.355 1.00 . A A .  29 ILE HD12 1 1 
       17 10277 1 1 29 ILE HD13 H    4.784  -4.457   1.927 1.00 . A A .  29 ILE HD13 1 1 
       17 10278 1 1 29 ILE HG12 H    3.767  -2.154   2.527 1.00 . A A .  29 ILE HG12 1 1 
       17 10279 1 1 29 ILE HG13 H    2.501  -2.610   1.392 1.00 . A A .  29 ILE HG13 1 1 
       17 10280 1 1 29 ILE HG21 H    5.702  -0.956   1.567 1.00 . A A .  29 ILE HG21 1 1 
       17 10281 1 1 29 ILE HG22 H    6.203  -2.646   1.607 1.00 . A A .  29 ILE HG22 1 1 
       17 10282 1 1 29 ILE HG23 H    6.442  -1.691   0.144 1.00 . A A .  29 ILE HG23 1 1 
       17 10283 1 1 29 ILE N    N    2.480  -1.538  -0.864 1.00 . A A .  29 ILE N    1 1 
       17 10284 1 1 29 ILE O    O    5.275   0.498  -1.145 1.00 . A A .  29 ILE O    1 1 
       17 10285 1 1 30 ILE C    C    5.376   0.448  -4.016 1.00 . A A .  30 ILE C    1 1 
       17 10286 1 1 30 ILE CA   C    5.761  -0.924  -3.473 1.00 . A A .  30 ILE CA   1 1 
       17 10287 1 1 30 ILE CB   C    5.747  -1.943  -4.628 1.00 . A A .  30 ILE CB   1 1 
       17 10288 1 1 30 ILE CD1  C    5.759  -4.447  -5.087 1.00 . A A .  30 ILE CD1  1 1 
       17 10289 1 1 30 ILE CG1  C    6.089  -3.341  -4.108 1.00 . A A .  30 ILE CG1  1 1 
       17 10290 1 1 30 ILE CG2  C    6.723  -1.524  -5.717 1.00 . A A .  30 ILE CG2  1 1 
       17 10291 1 1 30 ILE H    H    4.385  -2.179  -2.467 1.00 . A A .  30 ILE H    1 1 
       17 10292 1 1 30 ILE HA   H    6.765  -0.874  -3.076 1.00 . A A .  30 ILE HA   1 1 
       17 10293 1 1 30 ILE HB   H    4.755  -1.957  -5.053 1.00 . A A .  30 ILE HB   1 1 
       17 10294 1 1 30 ILE HD11 H    6.614  -4.632  -5.721 1.00 . A A .  30 ILE HD11 1 1 
       17 10295 1 1 30 ILE HD12 H    5.515  -5.348  -4.544 1.00 . A A .  30 ILE HD12 1 1 
       17 10296 1 1 30 ILE HD13 H    4.918  -4.152  -5.695 1.00 . A A .  30 ILE HD13 1 1 
       17 10297 1 1 30 ILE HG12 H    7.145  -3.391  -3.895 1.00 . A A .  30 ILE HG12 1 1 
       17 10298 1 1 30 ILE HG13 H    5.533  -3.525  -3.200 1.00 . A A .  30 ILE HG13 1 1 
       17 10299 1 1 30 ILE HG21 H    6.744  -0.446  -5.785 1.00 . A A .  30 ILE HG21 1 1 
       17 10300 1 1 30 ILE HG22 H    7.710  -1.887  -5.474 1.00 . A A .  30 ILE HG22 1 1 
       17 10301 1 1 30 ILE HG23 H    6.409  -1.938  -6.662 1.00 . A A .  30 ILE HG23 1 1 
       17 10302 1 1 30 ILE N    N    4.871  -1.331  -2.393 1.00 . A A .  30 ILE N    1 1 
       17 10303 1 1 30 ILE O    O    6.237   1.236  -4.409 1.00 . A A .  30 ILE O    1 1 
       17 10304 1 1 31 HIS C    C    3.926   3.135  -3.558 1.00 . A A .  31 HIS C    1 1 
       17 10305 1 1 31 HIS CA   C    3.578   2.007  -4.525 1.00 . A A .  31 HIS CA   1 1 
       17 10306 1 1 31 HIS CB   C    2.064   1.943  -4.729 1.00 . A A .  31 HIS CB   1 1 
       17 10307 1 1 31 HIS CD2  C    0.907   4.106  -3.884 1.00 . A A .  31 HIS CD2  1 1 
       17 10308 1 1 31 HIS CE1  C    0.640   5.103  -5.818 1.00 . A A .  31 HIS CE1  1 1 
       17 10309 1 1 31 HIS CG   C    1.417   3.290  -4.836 1.00 . A A .  31 HIS CG   1 1 
       17 10310 1 1 31 HIS H    H    3.440   0.060  -3.707 1.00 . A A .  31 HIS H    1 1 
       17 10311 1 1 31 HIS HA   H    4.052   2.205  -5.474 1.00 . A A .  31 HIS HA   1 1 
       17 10312 1 1 31 HIS HB2  H    1.852   1.400  -5.638 1.00 . A A .  31 HIS HB2  1 1 
       17 10313 1 1 31 HIS HB3  H    1.616   1.425  -3.893 1.00 . A A .  31 HIS HB3  1 1 
       17 10314 1 1 31 HIS HD1  H    1.500   3.607  -6.918 1.00 . A A .  31 HIS HD1  1 1 
       17 10315 1 1 31 HIS HD2  H    0.879   3.913  -2.821 1.00 . A A .  31 HIS HD2  1 1 
       17 10316 1 1 31 HIS HE1  H    0.371   5.828  -6.572 1.00 . A A .  31 HIS HE1  1 1 
       17 10317 1 1 31 HIS N    N    4.077   0.728  -4.033 1.00 . A A .  31 HIS N    1 1 
       17 10318 1 1 31 HIS ND1  N    1.233   3.943  -6.037 1.00 . A A .  31 HIS ND1  1 1 
       17 10319 1 1 31 HIS NE2  N    0.431   5.226  -4.520 1.00 . A A .  31 HIS NE2  1 1 
       17 10320 1 1 31 HIS O    O    4.310   4.227  -3.976 1.00 . A A .  31 HIS O    1 1 
       17 10321 1 1 32 MET C    C    5.498   4.409  -1.416 1.00 . A A .  32 MET C    1 1 
       17 10322 1 1 32 MET CA   C    4.088   3.854  -1.239 1.00 . A A .  32 MET CA   1 1 
       17 10323 1 1 32 MET CB   C    3.941   3.240   0.154 1.00 . A A .  32 MET CB   1 1 
       17 10324 1 1 32 MET CE   C    1.110   4.820   1.818 1.00 . A A .  32 MET CE   1 1 
       17 10325 1 1 32 MET CG   C    2.515   2.834   0.491 1.00 . A A .  32 MET CG   1 1 
       17 10326 1 1 32 MET H    H    3.478   1.973  -1.993 1.00 . A A .  32 MET H    1 1 
       17 10327 1 1 32 MET HA   H    3.380   4.663  -1.343 1.00 . A A .  32 MET HA   1 1 
       17 10328 1 1 32 MET HB2  H    4.566   2.362   0.216 1.00 . A A .  32 MET HB2  1 1 
       17 10329 1 1 32 MET HB3  H    4.270   3.959   0.889 1.00 . A A .  32 MET HB3  1 1 
       17 10330 1 1 32 MET HE1  H    1.839   5.599   1.987 1.00 . A A .  32 MET HE1  1 1 
       17 10331 1 1 32 MET HE2  H    0.116   5.231   1.913 1.00 . A A .  32 MET HE2  1 1 
       17 10332 1 1 32 MET HE3  H    1.246   4.035   2.547 1.00 . A A .  32 MET HE3  1 1 
       17 10333 1 1 32 MET HG2  H    2.249   1.974  -0.105 1.00 . A A .  32 MET HG2  1 1 
       17 10334 1 1 32 MET HG3  H    2.469   2.571   1.538 1.00 . A A .  32 MET HG3  1 1 
       17 10335 1 1 32 MET N    N    3.788   2.862  -2.265 1.00 . A A .  32 MET N    1 1 
       17 10336 1 1 32 MET O    O    5.838   5.455  -0.862 1.00 . A A .  32 MET O    1 1 
       17 10337 1 1 32 MET SD   S    1.324   4.149   0.171 1.00 . A A .  32 MET SD   1 1 
       17 10338 1 1 33 ARG C    C    7.728   5.539  -3.008 1.00 . A A .  33 ARG C    1 1 
       17 10339 1 1 33 ARG CA   C    7.688   4.124  -2.438 1.00 . A A .  33 ARG CA   1 1 
       17 10340 1 1 33 ARG CB   C    8.376   3.155  -3.401 1.00 . A A .  33 ARG CB   1 1 
       17 10341 1 1 33 ARG CD   C    9.657   1.655  -1.845 1.00 . A A .  33 ARG CD   1 1 
       17 10342 1 1 33 ARG CG   C    8.519   1.746  -2.849 1.00 . A A .  33 ARG CG   1 1 
       17 10343 1 1 33 ARG CZ   C   11.358   0.419  -3.119 1.00 . A A .  33 ARG CZ   1 1 
       17 10344 1 1 33 ARG H    H    5.986   2.877  -2.604 1.00 . A A .  33 ARG H    1 1 
       17 10345 1 1 33 ARG HA   H    8.214   4.114  -1.495 1.00 . A A .  33 ARG HA   1 1 
       17 10346 1 1 33 ARG HB2  H    7.800   3.104  -4.314 1.00 . A A .  33 ARG HB2  1 1 
       17 10347 1 1 33 ARG HB3  H    9.362   3.532  -3.629 1.00 . A A .  33 ARG HB3  1 1 
       17 10348 1 1 33 ARG HD2  H    9.659   2.550  -1.240 1.00 . A A .  33 ARG HD2  1 1 
       17 10349 1 1 33 ARG HD3  H    9.493   0.795  -1.213 1.00 . A A .  33 ARG HD3  1 1 
       17 10350 1 1 33 ARG HE   H   11.557   2.296  -2.475 1.00 . A A .  33 ARG HE   1 1 
       17 10351 1 1 33 ARG HG2  H    7.598   1.466  -2.360 1.00 . A A .  33 ARG HG2  1 1 
       17 10352 1 1 33 ARG HG3  H    8.716   1.068  -3.666 1.00 . A A .  33 ARG HG3  1 1 
       17 10353 1 1 33 ARG HH11 H    9.664  -0.613  -2.739 1.00 . A A .  33 ARG HH11 1 1 
       17 10354 1 1 33 ARG HH12 H   10.871  -1.473  -3.637 1.00 . A A .  33 ARG HH12 1 1 
       17 10355 1 1 33 ARG HH21 H   13.154   1.175  -3.656 1.00 . A A .  33 ARG HH21 1 1 
       17 10356 1 1 33 ARG HH22 H   12.856  -0.455  -4.157 1.00 . A A .  33 ARG HH22 1 1 
       17 10357 1 1 33 ARG N    N    6.315   3.703  -2.190 1.00 . A A .  33 ARG N    1 1 
       17 10358 1 1 33 ARG NE   N   10.956   1.523  -2.499 1.00 . A A .  33 ARG NE   1 1 
       17 10359 1 1 33 ARG NH1  N   10.566  -0.643  -3.169 1.00 . A A .  33 ARG NH1  1 1 
       17 10360 1 1 33 ARG NH2  N   12.554   0.376  -3.691 1.00 . A A .  33 ARG NH2  1 1 
       17 10361 1 1 33 ARG O    O    8.671   6.293  -2.763 1.00 . A A .  33 ARG O    1 1 
       17 10362 1 1 34 THR C    C    6.165   8.260  -3.360 1.00 . A A .  34 THR C    1 1 
       17 10363 1 1 34 THR CA   C    6.616   7.217  -4.376 1.00 . A A .  34 THR CA   1 1 
       17 10364 1 1 34 THR CB   C    5.644   7.227  -5.571 1.00 . A A .  34 THR CB   1 1 
       17 10365 1 1 34 THR CG2  C    4.211   7.014  -5.106 1.00 . A A .  34 THR CG2  1 1 
       17 10366 1 1 34 THR H    H    5.977   5.249  -3.928 1.00 . A A .  34 THR H    1 1 
       17 10367 1 1 34 THR HA   H    7.599   7.480  -4.736 1.00 . A A .  34 THR HA   1 1 
       17 10368 1 1 34 THR HB   H    5.913   6.424  -6.242 1.00 . A A .  34 THR HB   1 1 
       17 10369 1 1 34 THR HG1  H    6.620   8.842  -6.146 1.00 . A A .  34 THR HG1  1 1 
       17 10370 1 1 34 THR HG21 H    3.927   5.987  -5.279 1.00 . A A .  34 THR HG21 1 1 
       17 10371 1 1 34 THR HG22 H    3.552   7.667  -5.658 1.00 . A A .  34 THR HG22 1 1 
       17 10372 1 1 34 THR HG23 H    4.139   7.235  -4.052 1.00 . A A .  34 THR HG23 1 1 
       17 10373 1 1 34 THR N    N    6.698   5.894  -3.770 1.00 . A A .  34 THR N    1 1 
       17 10374 1 1 34 THR O    O    6.360   9.460  -3.559 1.00 . A A .  34 THR O    1 1 
       17 10375 1 1 34 THR OG1  O    5.743   8.472  -6.272 1.00 . A A .  34 THR OG1  1 1 
       17 10376 1 1 35 HIS C    C    6.138   8.863  -0.133 1.00 . A A .  35 HIS C    1 1 
       17 10377 1 1 35 HIS CA   C    5.083   8.690  -1.222 1.00 . A A .  35 HIS CA   1 1 
       17 10378 1 1 35 HIS CB   C    3.789   8.151  -0.613 1.00 . A A .  35 HIS CB   1 1 
       17 10379 1 1 35 HIS CD2  C    1.633   7.354  -1.813 1.00 . A A .  35 HIS CD2  1 1 
       17 10380 1 1 35 HIS CE1  C    1.237   9.159  -2.993 1.00 . A A .  35 HIS CE1  1 1 
       17 10381 1 1 35 HIS CG   C    2.609   8.247  -1.531 1.00 . A A .  35 HIS CG   1 1 
       17 10382 1 1 35 HIS H    H    5.434   6.830  -2.169 1.00 . A A .  35 HIS H    1 1 
       17 10383 1 1 35 HIS HA   H    4.886   9.652  -1.670 1.00 . A A .  35 HIS HA   1 1 
       17 10384 1 1 35 HIS HB2  H    3.926   7.110  -0.357 1.00 . A A .  35 HIS HB2  1 1 
       17 10385 1 1 35 HIS HB3  H    3.560   8.710   0.283 1.00 . A A .  35 HIS HB3  1 1 
       17 10386 1 1 35 HIS HD1  H    2.862  10.191  -2.302 1.00 . A A .  35 HIS HD1  1 1 
       17 10387 1 1 35 HIS HD2  H    1.532   6.360  -1.399 1.00 . A A .  35 HIS HD2  1 1 
       17 10388 1 1 35 HIS HE1  H    0.781   9.861  -3.675 1.00 . A A .  35 HIS HE1  1 1 
       17 10389 1 1 35 HIS N    N    5.561   7.796  -2.270 1.00 . A A .  35 HIS N    1 1 
       17 10390 1 1 35 HIS ND1  N    2.334   9.367  -2.287 1.00 . A A .  35 HIS ND1  1 1 
       17 10391 1 1 35 HIS NE2  N    0.792   7.945  -2.725 1.00 . A A .  35 HIS NE2  1 1 
       17 10392 1 1 35 HIS O    O    6.669   9.957   0.063 1.00 . A A .  35 HIS O    1 1 
       17 10393 1 1 36 SER C    C    8.556   8.779   1.311 1.00 . A A .  36 SER C    1 1 
       17 10394 1 1 36 SER CA   C    7.425   7.810   1.644 1.00 . A A .  36 SER CA   1 1 
       17 10395 1 1 36 SER CB   C    7.993   6.410   1.887 1.00 . A A .  36 SER CB   1 1 
       17 10396 1 1 36 SER H    H    5.980   6.934   0.368 1.00 . A A .  36 SER H    1 1 
       17 10397 1 1 36 SER HA   H    6.930   8.149   2.542 1.00 . A A .  36 SER HA   1 1 
       17 10398 1 1 36 SER HB2  H    8.836   6.477   2.557 1.00 . A A .  36 SER HB2  1 1 
       17 10399 1 1 36 SER HB3  H    7.229   5.787   2.329 1.00 . A A .  36 SER HB3  1 1 
       17 10400 1 1 36 SER HG   H    7.869   6.128  -0.048 1.00 . A A .  36 SER HG   1 1 
       17 10401 1 1 36 SER N    N    6.437   7.777   0.572 1.00 . A A .  36 SER N    1 1 
       17 10402 1 1 36 SER O    O    9.001   9.548   2.162 1.00 . A A .  36 SER O    1 1 
       17 10403 1 1 36 SER OG   O    8.421   5.816   0.673 1.00 . A A .  36 SER OG   1 1 
       17 10404 1 1 37 GLY C    C    9.626  10.665  -1.344 1.00 . A A .  37 GLY C    1 1 
       17 10405 1 1 37 GLY CA   C   10.093   9.611  -0.360 1.00 . A A .  37 GLY CA   1 1 
       17 10406 1 1 37 GLY H    H    8.625   8.100  -0.571 1.00 . A A .  37 GLY H    1 1 
       17 10407 1 1 37 GLY HA2  H   10.506  10.103   0.508 1.00 . A A .  37 GLY HA2  1 1 
       17 10408 1 1 37 GLY HA3  H   10.864   9.017  -0.826 1.00 . A A .  37 GLY HA3  1 1 
       17 10409 1 1 37 GLY N    N    9.018   8.734   0.065 1.00 . A A .  37 GLY N    1 1 
       17 10410 1 1 37 GLY O    O    8.959  10.351  -2.330 1.00 . A A .  37 GLY O    1 1 
       17 10411 1 1 38 GLU C    C   10.525  14.213  -1.771 1.00 . A A .  38 GLU C    1 1 
       17 10412 1 1 38 GLU CA   C    9.586  13.023  -1.946 1.00 . A A .  38 GLU CA   1 1 
       17 10413 1 1 38 GLU CB   C    8.146  13.448  -1.653 1.00 . A A .  38 GLU CB   1 1 
       17 10414 1 1 38 GLU CD   C    6.507  14.313   0.065 1.00 . A A .  38 GLU CD   1 1 
       17 10415 1 1 38 GLU CG   C    7.876  13.709  -0.180 1.00 . A A .  38 GLU CG   1 1 
       17 10416 1 1 38 GLU H    H   10.509  12.107  -0.276 1.00 . A A .  38 GLU H    1 1 
       17 10417 1 1 38 GLU HA   H    9.648  12.679  -2.968 1.00 . A A .  38 GLU HA   1 1 
       17 10418 1 1 38 GLU HB2  H    7.931  14.353  -2.203 1.00 . A A .  38 GLU HB2  1 1 
       17 10419 1 1 38 GLU HB3  H    7.478  12.668  -1.986 1.00 . A A .  38 GLU HB3  1 1 
       17 10420 1 1 38 GLU HG2  H    7.941  12.774   0.356 1.00 . A A .  38 GLU HG2  1 1 
       17 10421 1 1 38 GLU HG3  H    8.626  14.390   0.195 1.00 . A A .  38 GLU HG3  1 1 
       17 10422 1 1 38 GLU N    N    9.976  11.920  -1.077 1.00 . A A .  38 GLU N    1 1 
       17 10423 1 1 38 GLU O    O   10.610  14.798  -0.691 1.00 . A A .  38 GLU O    1 1 
       17 10424 1 1 38 GLU OE1  O    5.566  13.970  -0.682 1.00 . A A .  38 GLU OE1  1 1 
       17 10425 1 1 38 GLU OE2  O    6.376  15.127   1.002 1.00 . A A .  38 GLU OE2  1 1 
       17 10426 1 1 39 LYS C    C   11.420  17.009  -2.665 1.00 . A A .  39 LYS C    1 1 
       17 10427 1 1 39 LYS CA   C   12.164  15.685  -2.807 1.00 . A A .  39 LYS CA   1 1 
       17 10428 1 1 39 LYS CB   C   13.018  15.701  -4.076 1.00 . A A .  39 LYS CB   1 1 
       17 10429 1 1 39 LYS CD   C   11.484  15.142  -5.985 1.00 . A A .  39 LYS CD   1 1 
       17 10430 1 1 39 LYS CE   C   10.045  15.112  -5.493 1.00 . A A .  39 LYS CE   1 1 
       17 10431 1 1 39 LYS CG   C   12.285  16.234  -5.296 1.00 . A A .  39 LYS CG   1 1 
       17 10432 1 1 39 LYS H    H   11.119  14.060  -3.673 1.00 . A A .  39 LYS H    1 1 
       17 10433 1 1 39 LYS HA   H   12.808  15.554  -1.951 1.00 . A A .  39 LYS HA   1 1 
       17 10434 1 1 39 LYS HB2  H   13.885  16.322  -3.904 1.00 . A A .  39 LYS HB2  1 1 
       17 10435 1 1 39 LYS HB3  H   13.344  14.693  -4.290 1.00 . A A .  39 LYS HB3  1 1 
       17 10436 1 1 39 LYS HD2  H   11.485  15.324  -7.050 1.00 . A A .  39 LYS HD2  1 1 
       17 10437 1 1 39 LYS HD3  H   11.945  14.186  -5.781 1.00 . A A .  39 LYS HD3  1 1 
       17 10438 1 1 39 LYS HE2  H   10.017  15.479  -4.479 1.00 . A A .  39 LYS HE2  1 1 
       17 10439 1 1 39 LYS HE3  H    9.449  15.755  -6.125 1.00 . A A .  39 LYS HE3  1 1 
       17 10440 1 1 39 LYS HG2  H   11.612  17.019  -4.986 1.00 . A A .  39 LYS HG2  1 1 
       17 10441 1 1 39 LYS HG3  H   13.008  16.632  -5.994 1.00 . A A .  39 LYS HG3  1 1 
       17 10442 1 1 39 LYS HZ1  H   10.231  13.034  -5.402 1.00 . A A .  39 LYS HZ1  1 1 
       17 10443 1 1 39 LYS HZ2  H    9.007  13.567  -6.441 1.00 . A A .  39 LYS HZ2  1 1 
       17 10444 1 1 39 LYS HZ3  H    8.777  13.620  -4.767 1.00 . A A .  39 LYS HZ3  1 1 
       17 10445 1 1 39 LYS N    N   11.230  14.565  -2.840 1.00 . A A .  39 LYS N    1 1 
       17 10446 1 1 39 LYS NZ   N    9.475  13.737  -5.528 1.00 . A A .  39 LYS NZ   1 1 
       17 10447 1 1 39 LYS O    O   10.267  17.148  -3.073 1.00 . A A .  39 LYS O    1 1 
       17 10448 1 1 40 PRO C    C   11.337  20.103  -3.173 1.00 . A A .  40 PRO C    1 1 
       17 10449 1 1 40 PRO CA   C   11.516  19.338  -1.866 1.00 . A A .  40 PRO CA   1 1 
       17 10450 1 1 40 PRO CB   C   12.546  20.037  -0.975 1.00 . A A .  40 PRO CB   1 1 
       17 10451 1 1 40 PRO CD   C   13.471  17.912  -1.562 1.00 . A A .  40 PRO CD   1 1 
       17 10452 1 1 40 PRO CG   C   13.832  19.342  -1.265 1.00 . A A .  40 PRO CG   1 1 
       17 10453 1 1 40 PRO HA   H   10.569  19.284  -1.350 1.00 . A A .  40 PRO HA   1 1 
       17 10454 1 1 40 PRO HB2  H   12.596  21.085  -1.232 1.00 . A A .  40 PRO HB2  1 1 
       17 10455 1 1 40 PRO HB3  H   12.264  19.928   0.061 1.00 . A A .  40 PRO HB3  1 1 
       17 10456 1 1 40 PRO HD2  H   14.134  17.504  -2.312 1.00 . A A .  40 PRO HD2  1 1 
       17 10457 1 1 40 PRO HD3  H   13.507  17.319  -0.661 1.00 . A A .  40 PRO HD3  1 1 
       17 10458 1 1 40 PRO HG2  H   14.309  19.794  -2.121 1.00 . A A .  40 PRO HG2  1 1 
       17 10459 1 1 40 PRO HG3  H   14.479  19.393  -0.402 1.00 . A A .  40 PRO HG3  1 1 
       17 10460 1 1 40 PRO N    N   12.094  18.007  -2.074 1.00 . A A .  40 PRO N    1 1 
       17 10461 1 1 40 PRO O    O   12.192  20.901  -3.559 1.00 . A A .  40 PRO O    1 1 
       17 10462 1 1 41 SER C    C    8.677  21.376  -5.007 1.00 . A A .  41 SER C    1 1 
       17 10463 1 1 41 SER CA   C    9.933  20.516  -5.118 1.00 . A A .  41 SER CA   1 1 
       17 10464 1 1 41 SER CB   C    9.759  19.482  -6.231 1.00 . A A .  41 SER CB   1 1 
       17 10465 1 1 41 SER H    H    9.579  19.207  -3.492 1.00 . A A .  41 SER H    1 1 
       17 10466 1 1 41 SER HA   H   10.771  21.153  -5.357 1.00 . A A .  41 SER HA   1 1 
       17 10467 1 1 41 SER HB2  H    9.531  19.987  -7.157 1.00 . A A .  41 SER HB2  1 1 
       17 10468 1 1 41 SER HB3  H   10.676  18.921  -6.344 1.00 . A A .  41 SER HB3  1 1 
       17 10469 1 1 41 SER HG   H    8.265  18.322  -6.743 1.00 . A A .  41 SER HG   1 1 
       17 10470 1 1 41 SER N    N   10.222  19.854  -3.851 1.00 . A A .  41 SER N    1 1 
       17 10471 1 1 41 SER O    O    7.776  21.289  -5.840 1.00 . A A .  41 SER O    1 1 
       17 10472 1 1 41 SER OG   O    8.707  18.581  -5.931 1.00 . A A .  41 SER OG   1 1 
       17 10473 1 1 42 GLY C    C    7.785  24.524  -4.066 1.00 . A A .  42 GLY C    1 1 
       17 10474 1 1 42 GLY CA   C    7.477  23.071  -3.767 1.00 . A A .  42 GLY CA   1 1 
       17 10475 1 1 42 GLY H    H    9.374  22.233  -3.337 1.00 . A A .  42 GLY H    1 1 
       17 10476 1 1 42 GLY HA2  H    6.676  22.743  -4.413 1.00 . A A .  42 GLY HA2  1 1 
       17 10477 1 1 42 GLY HA3  H    7.155  22.987  -2.740 1.00 . A A .  42 GLY HA3  1 1 
       17 10478 1 1 42 GLY N    N    8.626  22.207  -3.970 1.00 . A A .  42 GLY N    1 1 
       17 10479 1 1 42 GLY O    O    8.088  25.314  -3.171 1.00 . A A .  42 GLY O    1 1 
       17 10480 1 1 43 PRO C    C    6.902  27.246  -5.350 1.00 . A A .  43 PRO C    1 1 
       17 10481 1 1 43 PRO CA   C    7.983  26.267  -5.797 1.00 . A A .  43 PRO CA   1 1 
       17 10482 1 1 43 PRO CB   C    7.999  26.149  -7.323 1.00 . A A .  43 PRO CB   1 1 
       17 10483 1 1 43 PRO CD   C    7.357  24.009  -6.472 1.00 . A A .  43 PRO CD   1 1 
       17 10484 1 1 43 PRO CG   C    7.152  24.959  -7.619 1.00 . A A .  43 PRO CG   1 1 
       17 10485 1 1 43 PRO HA   H    8.946  26.613  -5.451 1.00 . A A .  43 PRO HA   1 1 
       17 10486 1 1 43 PRO HB2  H    7.587  27.047  -7.760 1.00 . A A .  43 PRO HB2  1 1 
       17 10487 1 1 43 PRO HB3  H    9.013  26.007  -7.666 1.00 . A A .  43 PRO HB3  1 1 
       17 10488 1 1 43 PRO HD2  H    6.446  23.468  -6.263 1.00 . A A .  43 PRO HD2  1 1 
       17 10489 1 1 43 PRO HD3  H    8.163  23.323  -6.690 1.00 . A A .  43 PRO HD3  1 1 
       17 10490 1 1 43 PRO HG2  H    6.115  25.253  -7.682 1.00 . A A .  43 PRO HG2  1 1 
       17 10491 1 1 43 PRO HG3  H    7.471  24.504  -8.545 1.00 . A A .  43 PRO HG3  1 1 
       17 10492 1 1 43 PRO N    N    7.712  24.897  -5.353 1.00 . A A .  43 PRO N    1 1 
       17 10493 1 1 43 PRO O    O    5.732  26.884  -5.237 1.00 . A A .  43 PRO O    1 1 
       17 10494 1 1 44 SER C    C    5.249  29.705  -5.678 1.00 . A A .  44 SER C    1 1 
       17 10495 1 1 44 SER CA   C    6.369  29.518  -4.659 1.00 . A A .  44 SER CA   1 1 
       17 10496 1 1 44 SER CB   C    7.103  30.843  -4.442 1.00 . A A .  44 SER CB   1 1 
       17 10497 1 1 44 SER H    H    8.251  28.715  -5.205 1.00 . A A .  44 SER H    1 1 
       17 10498 1 1 44 SER HA   H    5.938  29.198  -3.722 1.00 . A A .  44 SER HA   1 1 
       17 10499 1 1 44 SER HB2  H    7.911  30.925  -5.154 1.00 . A A .  44 SER HB2  1 1 
       17 10500 1 1 44 SER HB3  H    6.413  31.661  -4.585 1.00 . A A .  44 SER HB3  1 1 
       17 10501 1 1 44 SER HG   H    7.277  31.688  -2.683 1.00 . A A .  44 SER HG   1 1 
       17 10502 1 1 44 SER N    N    7.303  28.488  -5.097 1.00 . A A .  44 SER N    1 1 
       17 10503 1 1 44 SER O    O    4.077  29.480  -5.377 1.00 . A A .  44 SER O    1 1 
       17 10504 1 1 44 SER OG   O    7.639  30.921  -3.133 1.00 . A A .  44 SER OG   1 1 
       17 10505 1 1 45 SER C    C    4.839  29.332  -9.079 1.00 . A A .  45 SER C    1 1 
       17 10506 1 1 45 SER CA   C    4.647  30.339  -7.949 1.00 . A A .  45 SER CA   1 1 
       17 10507 1 1 45 SER CB   C    4.770  31.764  -8.494 1.00 . A A .  45 SER CB   1 1 
       17 10508 1 1 45 SER H    H    6.570  30.280  -7.065 1.00 . A A .  45 SER H    1 1 
       17 10509 1 1 45 SER HA   H    3.661  30.208  -7.529 1.00 . A A .  45 SER HA   1 1 
       17 10510 1 1 45 SER HB2  H    4.401  32.461  -7.758 1.00 . A A .  45 SER HB2  1 1 
       17 10511 1 1 45 SER HB3  H    5.809  31.977  -8.703 1.00 . A A .  45 SER HB3  1 1 
       17 10512 1 1 45 SER HG   H    3.303  31.284  -9.700 1.00 . A A .  45 SER HG   1 1 
       17 10513 1 1 45 SER N    N    5.620  30.118  -6.886 1.00 . A A .  45 SER N    1 1 
       17 10514 1 1 45 SER O    O    5.966  29.011  -9.454 1.00 . A A .  45 SER O    1 1 
       17 10515 1 1 45 SER OG   O    4.022  31.920  -9.687 1.00 . A A .  45 SER OG   1 1 
       17 10516 1 1 46 GLY C    C    3.401  28.470 -12.035 1.00 . A A .  46 GLY C    1 1 
       17 10517 1 1 46 GLY CA   C    3.795  27.872 -10.699 1.00 . A A .  46 GLY CA   1 1 
       17 10518 1 1 46 GLY H    H    2.857  29.130  -9.278 1.00 . A A .  46 GLY H    1 1 
       17 10519 1 1 46 GLY HA2  H    4.804  27.495 -10.769 1.00 . A A .  46 GLY HA2  1 1 
       17 10520 1 1 46 GLY HA3  H    3.129  27.051 -10.475 1.00 . A A .  46 GLY HA3  1 1 
       17 10521 1 1 46 GLY N    N    3.729  28.837  -9.618 1.00 . A A .  46 GLY N    1 1 
       17 10522 1 1 46 GLY O    O    3.637  29.657 -12.253 1.00 . A A .  46 GLY O    1 1 
       17 10523 2 2  1 ZN  ZN   ZN  -0.472   6.522  -3.449 1.00 . B A . 201 ZN  ZN   1 1 
       18 10524 1 1  1 GLY C    C  -23.964   8.365  -7.480 1.00 . A A .   1 GLY C    1 1 
       18 10525 1 1  1 GLY CA   C  -22.961   9.229  -8.218 1.00 . A A .   1 GLY CA   1 1 
       18 10526 1 1  1 GLY H1   H  -22.522  10.892  -6.982 1.00 . A A .   1 GLY H1   1 1 
       18 10527 1 1  1 GLY HA2  H  -23.171   9.183  -9.276 1.00 . A A .   1 GLY HA2  1 1 
       18 10528 1 1  1 GLY HA3  H  -21.969   8.839  -8.040 1.00 . A A .   1 GLY HA3  1 1 
       18 10529 1 1  1 GLY N    N  -23.003  10.615  -7.791 1.00 . A A .   1 GLY N    1 1 
       18 10530 1 1  1 GLY O    O  -25.173   8.513  -7.660 1.00 . A A .   1 GLY O    1 1 
       18 10531 1 1  2 SER C    C  -24.983   5.533  -6.796 1.00 . A A .   2 SER C    1 1 
       18 10532 1 1  2 SER CA   C  -24.324   6.563  -5.883 1.00 . A A .   2 SER CA   1 1 
       18 10533 1 1  2 SER CB   C  -25.395   7.362  -5.140 1.00 . A A .   2 SER CB   1 1 
       18 10534 1 1  2 SER H    H  -22.490   7.388  -6.546 1.00 . A A .   2 SER H    1 1 
       18 10535 1 1  2 SER HA   H  -23.708   6.045  -5.163 1.00 . A A .   2 SER HA   1 1 
       18 10536 1 1  2 SER HB2  H  -26.259   7.480  -5.776 1.00 . A A .   2 SER HB2  1 1 
       18 10537 1 1  2 SER HB3  H  -25.679   6.831  -4.242 1.00 . A A .   2 SER HB3  1 1 
       18 10538 1 1  2 SER HG   H  -24.510   8.604  -3.910 1.00 . A A .   2 SER HG   1 1 
       18 10539 1 1  2 SER N    N  -23.463   7.458  -6.647 1.00 . A A .   2 SER N    1 1 
       18 10540 1 1  2 SER O    O  -26.200   5.348  -6.764 1.00 . A A .   2 SER O    1 1 
       18 10541 1 1  2 SER OG   O  -24.915   8.646  -4.779 1.00 . A A .   2 SER OG   1 1 
       18 10542 1 1  3 SER C    C  -25.210   2.646  -7.779 1.00 . A A .   3 SER C    1 1 
       18 10543 1 1  3 SER CA   C  -24.674   3.858  -8.535 1.00 . A A .   3 SER CA   1 1 
       18 10544 1 1  3 SER CB   C  -23.569   3.424  -9.500 1.00 . A A .   3 SER CB   1 1 
       18 10545 1 1  3 SER H    H  -23.210   5.060  -7.589 1.00 . A A .   3 SER H    1 1 
       18 10546 1 1  3 SER HA   H  -25.481   4.301  -9.101 1.00 . A A .   3 SER HA   1 1 
       18 10547 1 1  3 SER HB2  H  -23.345   4.236 -10.176 1.00 . A A .   3 SER HB2  1 1 
       18 10548 1 1  3 SER HB3  H  -22.683   3.170  -8.937 1.00 . A A .   3 SER HB3  1 1 
       18 10549 1 1  3 SER HG   H  -24.120   2.559 -11.169 1.00 . A A .   3 SER HG   1 1 
       18 10550 1 1  3 SER N    N  -24.171   4.867  -7.610 1.00 . A A .   3 SER N    1 1 
       18 10551 1 1  3 SER O    O  -26.390   2.312  -7.876 1.00 . A A .   3 SER O    1 1 
       18 10552 1 1  3 SER OG   O  -23.969   2.296 -10.259 1.00 . A A .   3 SER OG   1 1 
       18 10553 1 1  4 GLY C    C  -23.681  -0.266  -6.274 1.00 . A A .   4 GLY C    1 1 
       18 10554 1 1  4 GLY CA   C  -24.734   0.823  -6.264 1.00 . A A .   4 GLY CA   1 1 
       18 10555 1 1  4 GLY H    H  -23.404   2.303  -6.987 1.00 . A A .   4 GLY H    1 1 
       18 10556 1 1  4 GLY HA2  H  -24.921   1.120  -5.243 1.00 . A A .   4 GLY HA2  1 1 
       18 10557 1 1  4 GLY HA3  H  -25.647   0.429  -6.686 1.00 . A A .   4 GLY HA3  1 1 
       18 10558 1 1  4 GLY N    N  -24.332   1.991  -7.026 1.00 . A A .   4 GLY N    1 1 
       18 10559 1 1  4 GLY O    O  -23.032  -0.502  -7.293 1.00 . A A .   4 GLY O    1 1 
       18 10560 1 1  5 SER C    C  -23.009  -3.083  -4.060 1.00 . A A .   5 SER C    1 1 
       18 10561 1 1  5 SER CA   C  -22.522  -1.998  -5.016 1.00 . A A .   5 SER CA   1 1 
       18 10562 1 1  5 SER CB   C  -21.186  -1.434  -4.527 1.00 . A A .   5 SER CB   1 1 
       18 10563 1 1  5 SER H    H  -24.057  -0.696  -4.358 1.00 . A A .   5 SER H    1 1 
       18 10564 1 1  5 SER HA   H  -22.383  -2.433  -5.994 1.00 . A A .   5 SER HA   1 1 
       18 10565 1 1  5 SER HB2  H  -21.371  -0.620  -3.843 1.00 . A A .   5 SER HB2  1 1 
       18 10566 1 1  5 SER HB3  H  -20.634  -2.213  -4.020 1.00 . A A .   5 SER HB3  1 1 
       18 10567 1 1  5 SER HG   H  -19.826  -1.650  -5.920 1.00 . A A .   5 SER HG   1 1 
       18 10568 1 1  5 SER N    N  -23.509  -0.931  -5.136 1.00 . A A .   5 SER N    1 1 
       18 10569 1 1  5 SER O    O  -23.918  -2.859  -3.261 1.00 . A A .   5 SER O    1 1 
       18 10570 1 1  5 SER OG   O  -20.409  -0.954  -5.610 1.00 . A A .   5 SER OG   1 1 
       18 10571 1 1  6 SER C    C  -21.571  -5.872  -2.488 1.00 . A A .   6 SER C    1 1 
       18 10572 1 1  6 SER CA   C  -22.769  -5.382  -3.295 1.00 . A A .   6 SER CA   1 1 
       18 10573 1 1  6 SER CB   C  -23.333  -6.526  -4.138 1.00 . A A .   6 SER CB   1 1 
       18 10574 1 1  6 SER H    H  -21.679  -4.376  -4.806 1.00 . A A .   6 SER H    1 1 
       18 10575 1 1  6 SER HA   H  -23.532  -5.039  -2.612 1.00 . A A .   6 SER HA   1 1 
       18 10576 1 1  6 SER HB2  H  -24.201  -6.179  -4.678 1.00 . A A .   6 SER HB2  1 1 
       18 10577 1 1  6 SER HB3  H  -22.581  -6.857  -4.840 1.00 . A A .   6 SER HB3  1 1 
       18 10578 1 1  6 SER HG   H  -23.063  -7.741  -2.625 1.00 . A A .   6 SER HG   1 1 
       18 10579 1 1  6 SER N    N  -22.397  -4.260  -4.148 1.00 . A A .   6 SER N    1 1 
       18 10580 1 1  6 SER O    O  -20.422  -5.679  -2.883 1.00 . A A .   6 SER O    1 1 
       18 10581 1 1  6 SER OG   O  -23.711  -7.623  -3.323 1.00 . A A .   6 SER OG   1 1 
       18 10582 1 1  7 GLY C    C  -19.842  -5.923  -0.042 1.00 . A A .   7 GLY C    1 1 
       18 10583 1 1  7 GLY CA   C  -20.784  -7.016  -0.508 1.00 . A A .   7 GLY CA   1 1 
       18 10584 1 1  7 GLY H    H  -22.784  -6.632  -1.089 1.00 . A A .   7 GLY H    1 1 
       18 10585 1 1  7 GLY HA2  H  -21.223  -7.492   0.356 1.00 . A A .   7 GLY HA2  1 1 
       18 10586 1 1  7 GLY HA3  H  -20.219  -7.750  -1.063 1.00 . A A .   7 GLY HA3  1 1 
       18 10587 1 1  7 GLY N    N  -21.849  -6.507  -1.353 1.00 . A A .   7 GLY N    1 1 
       18 10588 1 1  7 GLY O    O  -18.701  -5.844  -0.494 1.00 . A A .   7 GLY O    1 1 
       18 10589 1 1  8 ALA C    C  -18.330  -4.514   2.193 1.00 . A A .   8 ALA C    1 1 
       18 10590 1 1  8 ALA CA   C  -19.514  -3.985   1.392 1.00 . A A .   8 ALA CA   1 1 
       18 10591 1 1  8 ALA CB   C  -20.368  -3.065   2.252 1.00 . A A .   8 ALA CB   1 1 
       18 10592 1 1  8 ALA H    H  -21.240  -5.192   1.186 1.00 . A A .   8 ALA H    1 1 
       18 10593 1 1  8 ALA HA   H  -19.142  -3.411   0.555 1.00 . A A .   8 ALA HA   1 1 
       18 10594 1 1  8 ALA HB1  H  -21.183  -2.674   1.662 1.00 . A A .   8 ALA HB1  1 1 
       18 10595 1 1  8 ALA HB2  H  -20.764  -3.622   3.089 1.00 . A A .   8 ALA HB2  1 1 
       18 10596 1 1  8 ALA HB3  H  -19.763  -2.249   2.617 1.00 . A A .   8 ALA HB3  1 1 
       18 10597 1 1  8 ALA N    N  -20.322  -5.077   0.864 1.00 . A A .   8 ALA N    1 1 
       18 10598 1 1  8 ALA O    O  -18.466  -4.856   3.367 1.00 . A A .   8 ALA O    1 1 
       18 10599 1 1  9 GLY C    C  -14.724  -4.872   1.392 1.00 . A A .   9 GLY C    1 1 
       18 10600 1 1  9 GLY CA   C  -15.977  -5.071   2.220 1.00 . A A .   9 GLY CA   1 1 
       18 10601 1 1  9 GLY H    H  -17.119  -4.294   0.615 1.00 . A A .   9 GLY H    1 1 
       18 10602 1 1  9 GLY HA2  H  -15.863  -4.547   3.158 1.00 . A A .   9 GLY HA2  1 1 
       18 10603 1 1  9 GLY HA3  H  -16.099  -6.125   2.421 1.00 . A A .   9 GLY HA3  1 1 
       18 10604 1 1  9 GLY N    N  -17.168  -4.580   1.551 1.00 . A A .   9 GLY N    1 1 
       18 10605 1 1  9 GLY O    O  -14.135  -5.837   0.906 1.00 . A A .   9 GLY O    1 1 
       18 10606 1 1 10 GLU C    C  -11.886  -3.950   1.058 1.00 . A A .  10 GLU C    1 1 
       18 10607 1 1 10 GLU CA   C  -13.125  -3.297   0.451 1.00 . A A .  10 GLU CA   1 1 
       18 10608 1 1 10 GLU CB   C  -12.931  -1.781   0.376 1.00 . A A .  10 GLU CB   1 1 
       18 10609 1 1 10 GLU CD   C  -14.124  -0.834   2.391 1.00 . A A .  10 GLU CD   1 1 
       18 10610 1 1 10 GLU CG   C  -12.786  -1.117   1.735 1.00 . A A .  10 GLU CG   1 1 
       18 10611 1 1 10 GLU H    H  -14.828  -2.891   1.641 1.00 . A A .  10 GLU H    1 1 
       18 10612 1 1 10 GLU HA   H  -13.268  -3.682  -0.547 1.00 . A A .  10 GLU HA   1 1 
       18 10613 1 1 10 GLU HB2  H  -12.042  -1.572  -0.201 1.00 . A A .  10 GLU HB2  1 1 
       18 10614 1 1 10 GLU HB3  H  -13.783  -1.346  -0.125 1.00 . A A .  10 GLU HB3  1 1 
       18 10615 1 1 10 GLU HG2  H  -12.218  -1.769   2.381 1.00 . A A .  10 GLU HG2  1 1 
       18 10616 1 1 10 GLU HG3  H  -12.257  -0.184   1.611 1.00 . A A .  10 GLU HG3  1 1 
       18 10617 1 1 10 GLU N    N  -14.316  -3.617   1.229 1.00 . A A .  10 GLU N    1 1 
       18 10618 1 1 10 GLU O    O  -11.798  -4.131   2.272 1.00 . A A .  10 GLU O    1 1 
       18 10619 1 1 10 GLU OE1  O  -15.108  -0.604   1.657 1.00 . A A .  10 GLU OE1  1 1 
       18 10620 1 1 10 GLU OE2  O  -14.186  -0.841   3.638 1.00 . A A .  10 GLU OE2  1 1 
       18 10621 1 1 11 LYS C    C   -8.903  -3.996   1.555 1.00 . A A .  11 LYS C    1 1 
       18 10622 1 1 11 LYS CA   C   -9.697  -4.934   0.652 1.00 . A A .  11 LYS CA   1 1 
       18 10623 1 1 11 LYS CB   C   -8.844  -5.346  -0.550 1.00 . A A .  11 LYS CB   1 1 
       18 10624 1 1 11 LYS CD   C   -9.709  -7.682  -0.870 1.00 . A A .  11 LYS CD   1 1 
       18 10625 1 1 11 LYS CE   C  -10.520  -8.607  -1.764 1.00 . A A .  11 LYS CE   1 1 
       18 10626 1 1 11 LYS CG   C   -9.547  -6.306  -1.494 1.00 . A A .  11 LYS CG   1 1 
       18 10627 1 1 11 LYS H    H  -11.061  -4.131  -0.754 1.00 . A A .  11 LYS H    1 1 
       18 10628 1 1 11 LYS HA   H   -9.962  -5.816   1.214 1.00 . A A .  11 LYS HA   1 1 
       18 106