NMR Restraints Grid

Result table
 (Save to zip file containing files for each block)

image mrblock_id pdb_id bmrb_id cing stage program type subtype item_count
472085 2kzn 17008 cing 4-filtered-FRED STAR entry full 1231


data_FRED_restraints_with_modified_coordinates_PDB_code_2kzn

# This FRED archive file contains, for PDB entry <2kzn>:
# 
# - Coordinates and sequence information from the PDB mmCIF file
# - NMR restraints from the PDB MR file
# 
# In this file, the coordinates and NMR restraints share the same atom names,
# and in this way can differ from the data deposited at the wwPDB. To achieve
# this aim, the NMR restraints were parsed from their original format files, and
# the coordinates and NMR restraints information were subsequently harmonized.
# 
# Due to the complexity of this harmonization process and the filtering process
# used in creating these files, the NMR restraints information in these files
# may differ significantly from that in the originally deposited file. Other 
# modifications could have occurred to the NMR restraints information, or data 
# could have been lost because of parsing or conversion errors. The PDB file 
# remains the authoritative reference for the atomic coordinates and the 
# originally deposited restraints files remain the primary reference for these 
# data.
# 
# This file is generated at the BioMagResBank (BMRB) in collaboration with the 
# PDBe (formerly MSD) group at the European Bioinformatics Institute (EBI) and 
# the CMBI/IMM group at the Radboud University of Nijmegen.
# 
# Several software packages were used to produce this file:
# 
# - Wattos (BMRB and CMBI/IMM).
# - FormatConverter and NMRStarExport (PDBe).
# - CCPN framework (http://www.ccpn.ac.uk/).
# 
# More information about this process can be found in the references below.
# Please cite the original reference for this PDB entry.
# 
# JF Doreleijers, A Nederveen, W Vranken, J Lin, AM Bonvin, R Kaptein, JL
# Markley, and EL Ulrich (2005). BioMagResBank databases DOCR and FRED
# containing converted and filtered sets of experimental NMR restraints and
# coordinates from over 500 protein PDB structures. J. Biomol. NMR 32, 1-12.
# 
# WF Vranken, W Boucher, TJ Stevens, RH Fogh, A Pajon, M Llinas, EL Ulrich, JL
# Markley, J Ionides, ED Laue (2005). The CCPN data model for NMR spectroscopy:
# development of a software pipeline. Proteins 59, 687-696. 
# 
# JF Doreleijers, WF Vranken, C Schulte, J Lin, JR Wedell, CJ Penkett, GW Vuister, 
# G Vriend, JL Markley, and EL Ulrich (2009). The NMR Restraints Grid at BMRB for 
# 5,266 Protein and Nucleic Acid PDB Entries. J Biomol. NMR 45, 389?396.




save_Conversion_project_for_entry_Name_1
    _Study_list.Sf_category  study_list
    _Study_list.Entry_ID     1
    _Study_list.ID           1

    loop_
       _Study.ID
       _Study.Name
       _Study.Type
       _Study.Details
       _Study.Entry_ID
       _Study.Study_list_ID

       1 "Conversion project for entry 1" NMR . 1 1 
    stop_

save_


save_originalConstraints_1
    _Entry.Sf_category          entry_information
    _Entry.ID                   1
    _Entry.Title                "Data for entry 1"
    _Entry.NMR_STAR_version     3.1.0.8
    _Entry.Experimental_method  NMR
    _Entry.Details              .

save_


save_assembly_2kzn
    _Assembly.Sf_category           assembly
    _Assembly.Entry_ID              1
    _Assembly.ID                    1
    _Assembly.Name                  2kzn
    _Assembly.Number_of_components  1
    _Assembly.Organic_ligands       .
    _Assembly.Metal_ions            .
    _Assembly.Paramagnetic          .
    _Assembly.Thiol_state           "all free"
    _Assembly.Molecular_mass        17104.90

    loop_
       _Entity_assembly.ID
       _Entity_assembly.Entity_assembly_name
       _Entity_assembly.Entity_ID
       _Entity_assembly.Entity_label
       _Entity_assembly.Asym_ID
       _Entity_assembly.Details
       _Entity_assembly.Entry_ID
       _Entity_assembly.Assembly_ID

       1 . 1 $Peptide_methionine_sulfoxide_reductase_msrB A . 1 1 
    stop_

save_


save_Peptide_methionine_sulfoxide_reductase_msrB
    _Entity.Sf_category                  entity
    _Entity.Entry_ID                     1
    _Entity.ID                           1
    _Entity.Name                         "Peptide methionine sulfoxide reductase msrB"
    _Entity.Type                         polymer
    _Entity.Polymer_type                 polypeptide(L)
    _Entity.Polymer_seq_one_letter_code  MAYNKEEKIKSLNRMQYEVTQNNGTEPPFQNEYWDHKEEGLYVDIVSGKPLFTSKDKFDSQCGWPSFTKPIEEEVEEKLDTSHGMIRTEVRSRTADSHLGHVFNDGPGPNGLRYCINSAALRFVPKHKLKEEGYESYLHLFNKLEHHHHHH
    _Entity.Number_of_monomers           151

    loop_
       _Entity_comp_index.ID
       _Entity_comp_index.Comp_ID
       _Entity_comp_index.Comp_label
       _Entity_comp_index.Entry_ID
       _Entity_comp_index.Entity_ID

         1 MET . 1 1 
         2 ALA . 1 1 
         3 TYR . 1 1 
         4 ASN . 1 1 
         5 LYS . 1 1 
         6 GLU . 1 1 
         7 GLU . 1 1 
         8 LYS . 1 1 
         9 ILE . 1 1 
        10 LYS . 1 1 
        11 SER . 1 1 
        12 LEU . 1 1 
        13 ASN . 1 1 
        14 ARG . 1 1 
        15 MET . 1 1 
        16 GLN . 1 1 
        17 TYR . 1 1 
        18 GLU . 1 1 
        19 VAL . 1 1 
        20 THR . 1 1 
        21 GLN . 1 1 
        22 ASN . 1 1 
        23 ASN . 1 1 
        24 GLY . 1 1 
        25 THR . 1 1 
        26 GLU . 1 1 
        27 PRO . 1 1 
        28 PRO . 1 1 
        29 PHE . 1 1 
        30 GLN . 1 1 
        31 ASN . 1 1 
        32 GLU . 1 1 
        33 TYR . 1 1 
        34 TRP . 1 1 
        35 ASP . 1 1 
        36 HIS . 1 1 
        37 LYS . 1 1 
        38 GLU . 1 1 
        39 GLU . 1 1 
        40 GLY . 1 1 
        41 LEU . 1 1 
        42 TYR . 1 1 
        43 VAL . 1 1 
        44 ASP . 1 1 
        45 ILE . 1 1 
        46 VAL . 1 1 
        47 SER . 1 1 
        48 GLY . 1 1 
        49 LYS . 1 1 
        50 PRO . 1 1 
        51 LEU . 1 1 
        52 PHE . 1 1 
        53 THR . 1 1 
        54 SER . 1 1 
        55 LYS . 1 1 
        56 ASP . 1 1 
        57 LYS . 1 1 
        58 PHE . 1 1 
        59 ASP . 1 1 
        60 SER . 1 1 
        61 GLN . 1 1 
        62 CYS . 1 1 
        63 GLY . 1 1 
        64 TRP . 1 1 
        65 PRO . 1 1 
        66 SER . 1 1 
        67 PHE . 1 1 
        68 THR . 1 1 
        69 LYS . 1 1 
        70 PRO . 1 1 
        71 ILE . 1 1 
        72 GLU . 1 1 
        73 GLU . 1 1 
        74 GLU . 1 1 
        75 VAL . 1 1 
        76 GLU . 1 1 
        77 GLU . 1 1 
        78 LYS . 1 1 
        79 LEU . 1 1 
        80 ASP . 1 1 
        81 THR . 1 1 
        82 SER . 1 1 
        83 HIS . 1 1 
        84 GLY . 1 1 
        85 MET . 1 1 
        86 ILE . 1 1 
        87 ARG . 1 1 
        88 THR . 1 1 
        89 GLU . 1 1 
        90 VAL . 1 1 
        91 ARG . 1 1 
        92 SER . 1 1 
        93 ARG . 1 1 
        94 THR . 1 1 
        95 ALA . 1 1 
        96 ASP . 1 1 
        97 SER . 1 1 
        98 HIS . 1 1 
        99 LEU . 1 1 
       100 GLY . 1 1 
       101 HIS . 1 1 
       102 VAL . 1 1 
       103 PHE . 1 1 
       104 ASN . 1 1 
       105 ASP . 1 1 
       106 GLY . 1 1 
       107 PRO . 1 1 
       108 GLY . 1 1 
       109 PRO . 1 1 
       110 ASN . 1 1 
       111 GLY . 1 1 
       112 LEU . 1 1 
       113 ARG . 1 1 
       114 TYR . 1 1 
       115 CYS . 1 1 
       116 ILE . 1 1 
       117 ASN . 1 1 
       118 SER . 1 1 
       119 ALA . 1 1 
       120 ALA . 1 1 
       121 LEU . 1 1 
       122 ARG . 1 1 
       123 PHE . 1 1 
       124 VAL . 1 1 
       125 PRO . 1 1 
       126 LYS . 1 1 
       127 HIS . 1 1 
       128 LYS . 1 1 
       129 LEU . 1 1 
       130 LYS . 1 1 
       131 GLU . 1 1 
       132 GLU . 1 1 
       133 GLY . 1 1 
       134 TYR . 1 1 
       135 GLU . 1 1 
       136 SER . 1 1 
       137 TYR . 1 1 
       138 LEU . 1 1 
       139 HIS . 1 1 
       140 LEU . 1 1 
       141 PHE . 1 1 
       142 ASN . 1 1 
       143 LYS . 1 1 
       144 LEU . 1 1 
       145 GLU . 1 1 
       146 HIS . 1 1 
       147 HIS . 1 1 
       148 HIS . 1 1 
       149 HIS . 1 1 
       150 HIS . 1 1 
       151 HIS . 1 1 
    stop_

    loop_
       _Entity_poly_seq.Mon_ID
       _Entity_poly_seq.Num
       _Entity_poly_seq.Comp_index_ID
       _Entity_poly_seq.Entry_ID
       _Entity_poly_seq.Entity_ID

       MET   1   1 1 1 
       ALA   2   2 1 1 
       TYR   3   3 1 1 
       ASN   4   4 1 1 
       LYS   5   5 1 1 
       GLU   6   6 1 1 
       GLU   7   7 1 1 
       LYS   8   8 1 1 
       ILE   9   9 1 1 
       LYS  10  10 1 1 
       SER  11  11 1 1 
       LEU  12  12 1 1 
       ASN  13  13 1 1 
       ARG  14  14 1 1 
       MET  15  15 1 1 
       GLN  16  16 1 1 
       TYR  17  17 1 1 
       GLU  18  18 1 1 
       VAL  19  19 1 1 
       THR  20  20 1 1 
       GLN  21  21 1 1 
       ASN  22  22 1 1 
       ASN  23  23 1 1 
       GLY  24  24 1 1 
       THR  25  25 1 1 
       GLU  26  26 1 1 
       PRO  27  27 1 1 
       PRO  28  28 1 1 
       PHE  29  29 1 1 
       GLN  30  30 1 1 
       ASN  31  31 1 1 
       GLU  32  32 1 1 
       TYR  33  33 1 1 
       TRP  34  34 1 1 
       ASP  35  35 1 1 
       HIS  36  36 1 1 
       LYS  37  37 1 1 
       GLU  38  38 1 1 
       GLU  39  39 1 1 
       GLY  40  40 1 1 
       LEU  41  41 1 1 
       TYR  42  42 1 1 
       VAL  43  43 1 1 
       ASP  44  44 1 1 
       ILE  45  45 1 1 
       VAL  46  46 1 1 
       SER  47  47 1 1 
       GLY  48  48 1 1 
       LYS  49  49 1 1 
       PRO  50  50 1 1 
       LEU  51  51 1 1 
       PHE  52  52 1 1 
       THR  53  53 1 1 
       SER  54  54 1 1 
       LYS  55  55 1 1 
       ASP  56  56 1 1 
       LYS  57  57 1 1 
       PHE  58  58 1 1 
       ASP  59  59 1 1 
       SER  60  60 1 1 
       GLN  61  61 1 1 
       CYS  62  62 1 1 
       GLY  63  63 1 1 
       TRP  64  64 1 1 
       PRO  65  65 1 1 
       SER  66  66 1 1 
       PHE  67  67 1 1 
       THR  68  68 1 1 
       LYS  69  69 1 1 
       PRO  70  70 1 1 
       ILE  71  71 1 1 
       GLU  72  72 1 1 
       GLU  73  73 1 1 
       GLU  74  74 1 1 
       VAL  75  75 1 1 
       GLU  76  76 1 1 
       GLU  77  77 1 1 
       LYS  78  78 1 1 
       LEU  79  79 1 1 
       ASP  80  80 1 1 
       THR  81  81 1 1 
       SER  82  82 1 1 
       HIS  83  83 1 1 
       GLY  84  84 1 1 
       MET  85  85 1 1 
       ILE  86  86 1 1 
       ARG  87  87 1 1 
       THR  88  88 1 1 
       GLU  89  89 1 1 
       VAL  90  90 1 1 
       ARG  91  91 1 1 
       SER  92  92 1 1 
       ARG  93  93 1 1 
       THR  94  94 1 1 
       ALA  95  95 1 1 
       ASP  96  96 1 1 
       SER  97  97 1 1 
       HIS  98  98 1 1 
       LEU  99  99 1 1 
       GLY 100 100 1 1 
       HIS 101 101 1 1 
       VAL 102 102 1 1 
       PHE 103 103 1 1 
       ASN 104 104 1 1 
       ASP 105 105 1 1 
       GLY 106 106 1 1 
       PRO 107 107 1 1 
       GLY 108 108 1 1 
       PRO 109 109 1 1 
       ASN 110 110 1 1 
       GLY 111 111 1 1 
       LEU 112 112 1 1 
       ARG 113 113 1 1 
       TYR 114 114 1 1 
       CYS 115 115 1 1 
       ILE 116 116 1 1 
       ASN 117 117 1 1 
       SER 118 118 1 1 
       ALA 119 119 1 1 
       ALA 120 120 1 1 
       LEU 121 121 1 1 
       ARG 122 122 1 1 
       PHE 123 123 1 1 
       VAL 124 124 1 1 
       PRO 125 125 1 1 
       LYS 126 126 1 1 
       HIS 127 127 1 1 
       LYS 128 128 1 1 
       LEU 129 129 1 1 
       LYS 130 130 1 1 
       GLU 131 131 1 1 
       GLU 132 132 1 1 
       GLY 133 133 1 1 
       TYR 134 134 1 1 
       GLU 135 135 1 1 
       SER 136 136 1 1 
       TYR 137 137 1 1 
       LEU 138 138 1 1 
       HIS 139 139 1 1 
       LEU 140 140 1 1 
       PHE 141 141 1 1 
       ASN 142 142 1 1 
       LYS 143 143 1 1 
       LEU 144 144 1 1 
       GLU 145 145 1 1 
       HIS 146 146 1 1 
       HIS 147 147 1 1 
       HIS 148 148 1 1 
       HIS 149 149 1 1 
       HIS 150 150 1 1 
       HIS 151 151 1 1 
    stop_

save_


save_CNS/XPLOR_distance_constraints_2_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  1
    _Distance_constraint_list.Constraint_type     NOE
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

         1 1 . . . 1 1 
         2 1 . . . 1 1 
         3 1 . . . 1 1 
         4 1 . . . 1 1 
         5 1 . . . 1 1 
         6 1 . . . 1 1 
         7 1 . . . 1 1 
         8 1 . . . 1 1 
         9 1 . . . 1 1 
        10 1 . . . 1 1 
        11 1 . . . 1 1 
        12 1 . . . 1 1 
        13 1 . . . 1 1 
        14 1 . . . 1 1 
        15 1 . . . 1 1 
        16 1 . . . 1 1 
        17 1 . . . 1 1 
        18 1 . . . 1 1 
        19 1 . . . 1 1 
        20 1 . . . 1 1 
        21 1 . . . 1 1 
        22 1 . . . 1 1 
        23 1 . . . 1 1 
        24 1 . . . 1 1 
        25 1 . . . 1 1 
        26 1 . . . 1 1 
        27 1 . . . 1 1 
        28 1 . . . 1 1 
        29 1 . . . 1 1 
        30 1 . . . 1 1 
        31 1 . . . 1 1 
        32 1 . . . 1 1 
        33 1 . . . 1 1 
        34 1 . . . 1 1 
        35 1 . . . 1 1 
        36 1 . . . 1 1 
        37 1 . . . 1 1 
        38 1 . . . 1 1 
        39 1 . . . 1 1 
        40 1 . . . 1 1 
        41 1 . . . 1 1 
        42 1 . . . 1 1 
        43 1 . . . 1 1 
        44 1 . . . 1 1 
        45 1 . . . 1 1 
        46 1 . . . 1 1 
        47 1 . . . 1 1 
        48 1 . . . 1 1 
        49 1 . . . 1 1 
        50 1 . . . 1 1 
        51 1 . . . 1 1 
        52 1 . . . 1 1 
        53 1 . . . 1 1 
        54 1 . . . 1 1 
        55 1 . . . 1 1 
        56 1 . . . 1 1 
        57 1 . . . 1 1 
        58 1 . . . 1 1 
        59 1 . . . 1 1 
        60 1 . . . 1 1 
        61 1 . . . 1 1 
        62 1 . . . 1 1 
        63 1 . . . 1 1 
        64 1 . . . 1 1 
        65 1 . . . 1 1 
        66 1 . . . 1 1 
        67 1 . . . 1 1 
        68 1 . . . 1 1 
        69 1 . . . 1 1 
        70 1 . . . 1 1 
        71 1 . . . 1 1 
        72 1 . . . 1 1 
        73 1 . . . 1 1 
        74 1 . . . 1 1 
        75 1 . . . 1 1 
        76 1 . . . 1 1 
        77 1 . . . 1 1 
        78 1 . . . 1 1 
        79 1 . . . 1 1 
        80 1 . . . 1 1 
        81 1 . . . 1 1 
        82 1 . . . 1 1 
        83 1 . . . 1 1 
        84 1 . . . 1 1 
        85 1 . . . 1 1 
        86 1 . . . 1 1 
        87 1 . . . 1 1 
        88 1 . . . 1 1 
        89 1 . . . 1 1 
        90 1 . . . 1 1 
        91 1 . . . 1 1 
        92 1 . . . 1 1 
        93 1 . . . 1 1 
        94 1 . . . 1 1 
        95 1 . . . 1 1 
        96 1 . . . 1 1 
        97 1 . . . 1 1 
        98 1 . . . 1 1 
        99 1 . . . 1 1 
       100 1 . . . 1 1 
       101 1 . . . 1 1 
       102 1 . . . 1 1 
       103 1 . . . 1 1 
       104 1 . . . 1 1 
       105 1 . . . 1 1 
       106 1 . . . 1 1 
       107 1 . . . 1 1 
       108 1 . . . 1 1 
       109 1 . . . 1 1 
       110 1 . . . 1 1 
       111 1 . . . 1 1 
       112 1 . . . 1 1 
       113 1 . . . 1 1 
       114 1 . . . 1 1 
       115 1 . . . 1 1 
       116 1 . . . 1 1 
       117 1 . . . 1 1 
       118 1 . . . 1 1 
       119 1 . . . 1 1 
       120 1 . . . 1 1 
       121 1 . . . 1 1 
       122 1 . . . 1 1 
       123 1 . . . 1 1 
       124 1 . . . 1 1 
       125 1 . . . 1 1 
       126 1 . . . 1 1 
       127 1 . . . 1 1 
       128 1 . . . 1 1 
       129 1 . . . 1 1 
       130 1 . . . 1 1 
       131 1 . . . 1 1 
       132 1 . . . 1 1 
       133 1 . . . 1 1 
       134 1 . . . 1 1 
       135 1 . . . 1 1 
       136 1 . . . 1 1 
       137 1 . . . 1 1 
       138 1 . . . 1 1 
       139 1 . . . 1 1 
       140 1 . . . 1 1 
       141 1 . . . 1 1 
       142 1 . . . 1 1 
       143 1 . . . 1 1 
       144 1 . . . 1 1 
       145 1 . . . 1 1 
       146 1 . . . 1 1 
       147 1 . . . 1 1 
       148 1 . . . 1 1 
       149 1 . . . 1 1 
       150 1 . . . 1 1 
       151 1 . . . 1 1 
       152 1 . . . 1 1 
       153 1 . . . 1 1 
       154 1 . . . 1 1 
       155 1 . . . 1 1 
       156 1 . . . 1 1 
       157 1 . . . 1 1 
       158 1 . . . 1 1 
       159 1 . . . 1 1 
       160 1 . . . 1 1 
       161 1 . . . 1 1 
       162 1 . . . 1 1 
       163 1 . . . 1 1 
       164 1 . . . 1 1 
       165 1 . . . 1 1 
       166 1 . . . 1 1 
       167 1 . . . 1 1 
       168 1 . . . 1 1 
       169 1 . . . 1 1 
       170 1 . . . 1 1 
       171 1 . . . 1 1 
       172 1 . . . 1 1 
       173 1 . . . 1 1 
       174 1 . . . 1 1 
       175 1 . . . 1 1 
       176 1 . . . 1 1 
       177 1 . . . 1 1 
       178 1 . . . 1 1 
       179 1 . . . 1 1 
       180 1 . . . 1 1 
       181 1 . . . 1 1 
       182 1 . . . 1 1 
       183 1 . . . 1 1 
       184 1 . . . 1 1 
       185 1 . . . 1 1 
       186 1 . . . 1 1 
       187 1 . . . 1 1 
       188 1 . . . 1 1 
       189 1 . . . 1 1 
       190 1 . . . 1 1 
       191 1 . . . 1 1 
       192 1 . . . 1 1 
       193 1 . . . 1 1 
       194 1 . . . 1 1 
       195 1 . . . 1 1 
       196 1 . . . 1 1 
       197 1 . . . 1 1 
       198 1 . . . 1 1 
       199 1 . . . 1 1 
       200 1 . . . 1 1 
       201 1 . . . 1 1 
       202 1 . . . 1 1 
       203 1 . . . 1 1 
       204 1 . . . 1 1 
       205 1 . . . 1 1 
       206 1 . . . 1 1 
       207 1 . . . 1 1 
       208 1 . . . 1 1 
       209 1 . . . 1 1 
       210 1 . . . 1 1 
       211 1 . . . 1 1 
       212 1 . . . 1 1 
       213 1 . . . 1 1 
       214 1 . . . 1 1 
       215 1 . . . 1 1 
       216 1 . . . 1 1 
       217 1 . . . 1 1 
       218 1 . . . 1 1 
       219 1 . . . 1 1 
       220 1 . . . 1 1 
       221 1 . . . 1 1 
       222 1 . . . 1 1 
       223 1 . . . 1 1 
       224 1 . . . 1 1 
       225 1 . . . 1 1 
       226 1 . . . 1 1 
       227 1 . . . 1 1 
       228 1 . . . 1 1 
       229 1 . . . 1 1 
       230 1 . . . 1 1 
       231 1 . . . 1 1 
       232 1 . . . 1 1 
       233 1 . . . 1 1 
       234 1 . . . 1 1 
       235 1 . . . 1 1 
       236 1 . . . 1 1 
       237 1 . . . 1 1 
       238 1 . . . 1 1 
       239 1 . . . 1 1 
       240 1 . . . 1 1 
       241 1 . . . 1 1 
       242 1 . . . 1 1 
       243 1 . . . 1 1 
       244 1 . . . 1 1 
       245 1 . . . 1 1 
       246 1 . . . 1 1 
       247 1 . . . 1 1 
       248 1 . . . 1 1 
       249 1 . . . 1 1 
       250 1 . . . 1 1 
       251 1 . . . 1 1 
       252 1 . . . 1 1 
       253 1 . . . 1 1 
       254 1 . . . 1 1 
       255 1 . . . 1 1 
       256 1 . . . 1 1 
       257 1 . . . 1 1 
       258 1 . . . 1 1 
       259 1 . . . 1 1 
       260 1 . . . 1 1 
       261 1 . . . 1 1 
       262 1 . . . 1 1 
       263 1 . . . 1 1 
       264 1 . . . 1 1 
       265 1 . . . 1 1 
       266 1 . . . 1 1 
       267 1 . . . 1 1 
       268 1 . . . 1 1 
       269 1 . . . 1 1 
       270 1 . . . 1 1 
       271 1 . . . 1 1 
       272 1 . . . 1 1 
       273 1 . . . 1 1 
       274 1 . . . 1 1 
       275 1 . . . 1 1 
       276 1 . . . 1 1 
       277 1 . . . 1 1 
       278 1 . . . 1 1 
       279 1 . . . 1 1 
       280 1 . . . 1 1 
       281 1 . . . 1 1 
       282 1 . . . 1 1 
       283 1 . . . 1 1 
       284 1 . . . 1 1 
       285 1 . . . 1 1 
       286 1 . . . 1 1 
       287 1 . . . 1 1 
       288 1 . . . 1 1 
       289 1 . . . 1 1 
       290 1 . . . 1 1 
       291 1 . . . 1 1 
       292 1 . . . 1 1 
       293 1 . . . 1 1 
       294 1 . . . 1 1 
       295 1 . . . 1 1 
       296 1 . . . 1 1 
       297 1 . . . 1 1 
       298 1 . . . 1 1 
       299 1 . . . 1 1 
       300 1 . . . 1 1 
       301 1 . . . 1 1 
       302 1 . . . 1 1 
       303 1 . . . 1 1 
       304 1 . . . 1 1 
       305 1 . . . 1 1 
       306 1 . . . 1 1 
       307 1 . . . 1 1 
       308 1 . . . 1 1 
       309 1 . . . 1 1 
       310 1 . . . 1 1 
       311 1 . . . 1 1 
       312 1 . . . 1 1 
       313 1 . . . 1 1 
       314 1 . . . 1 1 
       315 1 . . . 1 1 
       316 1 . . . 1 1 
       317 1 . . . 1 1 
       318 1 . . . 1 1 
       319 1 . . . 1 1 
       320 1 . . . 1 1 
       321 1 . . . 1 1 
       322 1 . . . 1 1 
       323 1 . . . 1 1 
       324 1 . . . 1 1 
       325 1 . . . 1 1 
       326 1 . . . 1 1 
       327 1 . . . 1 1 
       328 1 . . . 1 1 
       329 1 . . . 1 1 
       330 1 . . . 1 1 
       331 1 . . . 1 1 
       332 1 . . . 1 1 
       333 1 . . . 1 1 
       334 1 . . . 1 1 
       335 1 . . . 1 1 
       336 1 . . . 1 1 
       337 1 . . . 1 1 
       338 1 . . . 1 1 
       339 1 . . . 1 1 
       340 1 . . . 1 1 
       341 1 . . . 1 1 
       342 1 . . . 1 1 
       343 1 . . . 1 1 
       344 1 . . . 1 1 
       345 1 . . . 1 1 
       346 1 . . . 1 1 
       347 1 . . . 1 1 
       348 1 . . . 1 1 
       349 1 . . . 1 1 
       350 1 . . . 1 1 
       351 1 . . . 1 1 
       352 1 . . . 1 1 
       353 1 . . . 1 1 
       354 1 . . . 1 1 
       355 1 . . . 1 1 
       356 1 . . . 1 1 
       357 1 . . . 1 1 
       358 1 . . . 1 1 
       359 1 . . . 1 1 
       360 1 . . . 1 1 
       361 1 . . . 1 1 
       362 1 . . . 1 1 
       363 1 . . . 1 1 
       364 1 . . . 1 1 
       365 1 . . . 1 1 
       366 1 . . . 1 1 
       367 1 . . . 1 1 
       368 1 . . . 1 1 
       369 1 . . . 1 1 
       370 1 . . . 1 1 
       371 1 . . . 1 1 
       372 1 . . . 1 1 
       373 1 . . . 1 1 
       374 1 . . . 1 1 
       375 1 . . . 1 1 
       376 1 . . . 1 1 
       377 1 . . . 1 1 
       378 1 . . . 1 1 
       379 1 . . . 1 1 
       380 1 . . . 1 1 
       381 1 . . . 1 1 
       382 1 . . . 1 1 
       383 1 . . . 1 1 
       384 1 . . . 1 1 
       385 1 . . . 1 1 
       386 1 . . . 1 1 
       387 1 . . . 1 1 
       388 1 . . . 1 1 
       389 1 . . . 1 1 
       390 1 . . . 1 1 
       391 1 . . . 1 1 
       392 1 . . . 1 1 
       393 1 . . . 1 1 
       394 1 . . . 1 1 
       395 1 . . . 1 1 
       396 1 . . . 1 1 
       397 1 . . . 1 1 
       398 1 . . . 1 1 
       399 1 . . . 1 1 
       400 1 . . . 1 1 
       401 1 . . . 1 1 
       402 1 . . . 1 1 
       403 1 . . . 1 1 
       404 1 . . . 1 1 
       405 1 . . . 1 1 
       406 1 . . . 1 1 
       407 1 . . . 1 1 
       408 1 . . . 1 1 
       409 1 . . . 1 1 
       410 1 . . . 1 1 
       411 1 . . . 1 1 
       412 1 . . . 1 1 
       413 1 . . . 1 1 
       414 1 . . . 1 1 
       415 1 . . . 1 1 
       416 1 . . . 1 1 
       417 1 . . . 1 1 
       418 1 . . . 1 1 
       419 1 . . . 1 1 
       420 1 . . . 1 1 
       421 1 . . . 1 1 
       422 1 . . . 1 1 
       423 1 . . . 1 1 
       424 1 . . . 1 1 
       425 1 . . . 1 1 
       426 1 . . . 1 1 
       427 1 . . . 1 1 
       428 1 . . . 1 1 
       429 1 . . . 1 1 
       430 1 . . . 1 1 
       431 1 . . . 1 1 
       432 1 . . . 1 1 
       433 1 . . . 1 1 
       434 1 . . . 1 1 
       435 1 . . . 1 1 
       436 1 . . . 1 1 
       437 1 . . . 1 1 
       438 1 . . . 1 1 
       439 1 . . . 1 1 
       440 1 . . . 1 1 
       441 1 . . . 1 1 
       442 1 . . . 1 1 
       443 1 . . . 1 1 
       444 1 . . . 1 1 
       445 1 . . . 1 1 
       446 1 . . . 1 1 
       447 1 . . . 1 1 
       448 1 . . . 1 1 
       449 1 . . . 1 1 
       450 1 . . . 1 1 
       451 1 . . . 1 1 
       452 1 . . . 1 1 
       453 1 . . . 1 1 
       454 1 . . . 1 1 
       455 1 . . . 1 1 
       456 1 . . . 1 1 
       457 1 . . . 1 1 
       458 1 . . . 1 1 
       459 1 . . . 1 1 
       460 1 . . . 1 1 
       461 1 . . . 1 1 
       462 1 . . . 1 1 
       463 1 . . . 1 1 
       464 1 . . . 1 1 
       465 1 . . . 1 1 
       466 1 . . . 1 1 
       467 1 . . . 1 1 
       468 1 . . . 1 1 
       469 1 . . . 1 1 
       470 1 . . . 1 1 
       471 1 . . . 1 1 
       472 1 . . . 1 1 
       473 1 . . . 1 1 
       474 1 . . . 1 1 
       475 1 . . . 1 1 
       476 1 . . . 1 1 
       477 1 . . . 1 1 
       478 1 . . . 1 1 
       479 1 . . . 1 1 
       480 1 . . . 1 1 
       481 1 . . . 1 1 
       482 1 . . . 1 1 
       483 1 . . . 1 1 
       484 1 . . . 1 1 
       485 1 . . . 1 1 
       486 1 . . . 1 1 
       487 1 . . . 1 1 
       488 1 . . . 1 1 
       489 1 . . . 1 1 
       490 1 . . . 1 1 
       491 1 . . . 1 1 
       492 1 . . . 1 1 
       493 1 . . . 1 1 
       494 1 . . . 1 1 
       495 1 . . . 1 1 
       496 1 . . . 1 1 
       497 1 . . . 1 1 
       498 1 . . . 1 1 
       499 1 . . . 1 1 
       500 1 . . . 1 1 
       501 1 . . . 1 1 
       502 1 . . . 1 1 
       503 1 . . . 1 1 
       504 1 . . . 1 1 
       505 1 . . . 1 1 
       506 1 . . . 1 1 
       507 1 . . . 1 1 
       508 1 . . . 1 1 
       509 1 . . . 1 1 
       510 1 . . . 1 1 
       511 1 . . . 1 1 
       512 1 . . . 1 1 
       513 1 . . . 1 1 
       514 1 . . . 1 1 
       515 1 . . . 1 1 
       516 1 . . . 1 1 
       517 1 . . . 1 1 
       518 1 . . . 1 1 
       519 1 . . . 1 1 
       520 1 . . . 1 1 
       521 1 . . . 1 1 
       522 1 . . . 1 1 
       523 1 . . . 1 1 
       524 1 . . . 1 1 
       525 1 . . . 1 1 
       526 1 . . . 1 1 
       527 1 . . . 1 1 
       528 1 . . . 1 1 
       529 1 . . . 1 1 
       530 1 . . . 1 1 
       531 1 . . . 1 1 
       532 1 . . . 1 1 
       533 1 . . . 1 1 
       534 1 . . . 1 1 
       535 1 . . . 1 1 
       536 1 . . . 1 1 
       537 1 . . . 1 1 
       538 1 . . . 1 1 
       539 1 . . . 1 1 
       540 1 . . . 1 1 
       541 1 . . . 1 1 
       542 1 . . . 1 1 
       543 1 . . . 1 1 
       544 1 . . . 1 1 
       545 1 . . . 1 1 
       546 1 . . . 1 1 
       547 1 . . . 1 1 
       548 1 . . . 1 1 
       549 1 . . . 1 1 
       550 1 . . . 1 1 
       551 1 . . . 1 1 
       552 1 . . . 1 1 
       553 1 . . . 1 1 
       554 1 . . . 1 1 
       555 1 . . . 1 1 
       556 1 . . . 1 1 
       557 1 . . . 1 1 
       558 1 . . . 1 1 
       559 1 . . . 1 1 
       560 1 . . . 1 1 
       561 1 . . . 1 1 
       562 1 . . . 1 1 
       563 1 . . . 1 1 
       564 1 . . . 1 1 
       565 1 . . . 1 1 
       566 1 . . . 1 1 
       567 1 . . . 1 1 
       568 1 . . . 1 1 
       569 1 . . . 1 1 
       570 1 . . . 1 1 
       571 1 . . . 1 1 
       572 1 . . . 1 1 
       573 1 . . . 1 1 
       574 1 . . . 1 1 
       575 1 . . . 1 1 
       576 1 . . . 1 1 
       577 1 . . . 1 1 
       578 1 . . . 1 1 
       579 1 . . . 1 1 
       580 1 . . . 1 1 
       581 1 . . . 1 1 
       582 1 . . . 1 1 
       583 1 . . . 1 1 
       584 1 . . . 1 1 
       585 1 . . . 1 1 
       586 1 . . . 1 1 
       587 1 . . . 1 1 
       588 1 . . . 1 1 
       589 1 . . . 1 1 
       590 1 . . . 1 1 
       591 1 . . . 1 1 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

         1 1 1 1 1   5 LYS H    .   5 . HN   1 1 
         1 1 2 1 1   6 GLU H    .   6 . HN   1 1 
         2 1 1 1 1   5 LYS H    .   5 . HN   1 1 
         2 1 2 1 1   7 GLU H    .   7 . HN   1 1 
         3 1 1 1 1   6 GLU H    .   6 . HN   1 1 
         3 1 2 1 1   7 GLU H    .   7 . HN   1 1 
         4 1 1 1 1   6 GLU H    .   6 . HN   1 1 
         4 1 2 1 1   8 LYS H    .   8 . HN   1 1 
         5 1 1 1 1   6 GLU H    .   6 . HN   1 1 
         5 1 2 1 1   9 ILE H    .   9 . HN   1 1 
         6 1 1 1 1   7 GLU H    .   7 . HN   1 1 
         6 1 2 1 1   8 LYS H    .   8 . HN   1 1 
         7 1 1 1 1   7 GLU H    .   7 . HN   1 1 
         7 1 2 1 1   9 ILE H    .   9 . HN   1 1 
         8 1 1 1 1   8 LYS H    .   8 . HN   1 1 
         8 1 2 1 1   9 ILE H    .   9 . HN   1 1 
         9 1 1 1 1   8 LYS H    .   8 . HN   1 1 
         9 1 2 1 1   9 ILE MD   .   9 . HD1* 1 1 
        10 1 1 1 1   8 LYS H    .   8 . HN   1 1 
        10 1 2 1 1  10 LYS H    .  10 . HN   1 1 
        11 1 1 1 1   8 LYS H    .   8 . HN   1 1 
        11 1 2 1 1  11 SER H    .  11 . HN   1 1 
        12 1 1 1 1   9 ILE H    .   9 . HN   1 1 
        12 1 2 1 1   9 ILE MD   .   9 . HD1* 1 1 
        13 1 1 1 1   9 ILE H    .   9 . HN   1 1 
        13 1 2 1 1  10 LYS H    .  10 . HN   1 1 
        14 1 1 1 1   9 ILE H    .   9 . HN   1 1 
        14 1 2 1 1  11 SER H    .  11 . HN   1 1 
        15 1 1 1 1   9 ILE H    .   9 . HN   1 1 
        15 1 2 1 1  12 LEU H    .  12 . HN   1 1 
        16 1 1 1 1   9 ILE H    .   9 . HN   1 1 
        16 1 2 1 1  12 LEU MD2  .  12 . HD2* 1 1 
        17 1 1 1 1   9 ILE MD   .   9 . HD1* 1 1 
        17 1 2 1 1  10 LYS H    .  10 . HN   1 1 
        18 1 1 1 1   9 ILE MD   .   9 . HD1* 1 1 
        18 1 2 1 1  12 LEU MD2  .  12 . HD2* 1 1 
        19 1 1 1 1   9 ILE MD   .   9 . HD1* 1 1 
        19 1 2 1 1  13 ASN HD21 .  13 . HD21 1 1 
        20 1 1 1 1   9 ILE MD   .   9 . HD1* 1 1 
        20 1 2 1 1  13 ASN HD22 .  13 . HD22 1 1 
        21 1 1 1 1   9 ILE MD   .   9 . HD1* 1 1 
        21 1 2 1 1  46 VAL MG1  .  46 . HG1* 1 1 
        22 1 1 1 1   9 ILE MD   .   9 . HD1* 1 1 
        22 1 2 1 1  46 VAL MG2  .  46 . HG2* 1 1 
        23 1 1 1 1  10 LYS H    .  10 . HN   1 1 
        23 1 2 1 1  11 SER H    .  11 . HN   1 1 
        24 1 1 1 1  10 LYS H    .  10 . HN   1 1 
        24 1 2 1 1  12 LEU H    .  12 . HN   1 1 
        25 1 1 1 1  10 LYS H    .  10 . HN   1 1 
        25 1 2 1 1  12 LEU MD2  .  12 . HD2* 1 1 
        26 1 1 1 1  10 LYS H    .  10 . HN   1 1 
        26 1 2 1 1  13 ASN H    .  13 . HN   1 1 
        27 1 1 1 1  11 SER H    .  11 . HN   1 1 
        27 1 2 1 1  12 LEU H    .  12 . HN   1 1 
        28 1 1 1 1  11 SER H    .  11 . HN   1 1 
        28 1 2 1 1  12 LEU MD2  .  12 . HD2* 1 1 
        29 1 1 1 1  11 SER H    .  11 . HN   1 1 
        29 1 2 1 1  13 ASN H    .  13 . HN   1 1 
        30 1 1 1 1  12 LEU H    .  12 . HN   1 1 
        30 1 2 1 1  12 LEU MD1  .  12 . HD1* 1 1 
        31 1 1 1 1  12 LEU H    .  12 . HN   1 1 
        31 1 2 1 1  12 LEU MD2  .  12 . HD2* 1 1 
        32 1 1 1 1  12 LEU H    .  12 . HN   1 1 
        32 1 2 1 1  13 ASN H    .  13 . HN   1 1 
        33 1 1 1 1  12 LEU H    .  12 . HN   1 1 
        33 1 2 1 1  14 ARG H    .  14 . HN   1 1 
        34 1 1 1 1  12 LEU MD1  .  12 . HD1* 1 1 
        34 1 2 1 1  13 ASN H    .  13 . HN   1 1 
        35 1 1 1 1  12 LEU MD1  .  12 . HD1* 1 1 
        35 1 2 1 1  13 ASN HD21 .  13 . HD21 1 1 
        36 1 1 1 1  12 LEU MD1  .  12 . HD1* 1 1 
        36 1 2 1 1  13 ASN HD22 .  13 . HD22 1 1 
        37 1 1 1 1  12 LEU MD1  .  12 . HD1* 1 1 
        37 1 2 1 1  14 ARG H    .  14 . HN   1 1 
        38 1 1 1 1  12 LEU MD1  .  12 . HD1* 1 1 
        38 1 2 1 1  15 MET H    .  15 . HN   1 1 
        39 1 1 1 1  12 LEU MD1  .  12 . HD1* 1 1 
        39 1 2 1 1  16 GLN H    .  16 . HN   1 1 
        40 1 1 1 1  12 LEU MD1  .  12 . HD1* 1 1 
        40 1 2 1 1  17 TYR H    .  17 . HN   1 1 
        41 1 1 1 1  12 LEU MD1  .  12 . HD1* 1 1 
        41 1 2 1 1  46 VAL H    .  46 . HN   1 1 
        42 1 1 1 1  12 LEU MD1  .  12 . HD1* 1 1 
        42 1 2 1 1  46 VAL MG1  .  46 . HG1* 1 1 
        43 1 1 1 1  12 LEU MD1  .  12 . HD1* 1 1 
        43 1 2 1 1  46 VAL MG2  .  46 . HG2* 1 1 
        44 1 1 1 1  12 LEU MD2  .  12 . HD2* 1 1 
        44 1 2 1 1  13 ASN H    .  13 . HN   1 1 
        45 1 1 1 1  12 LEU MD2  .  12 . HD2* 1 1 
        45 1 2 1 1  13 ASN HD21 .  13 . HD21 1 1 
        46 1 1 1 1  12 LEU MD2  .  12 . HD2* 1 1 
        46 1 2 1 1  13 ASN HD22 .  13 . HD22 1 1 
        47 1 1 1 1  12 LEU MD2  .  12 . HD2* 1 1 
        47 1 2 1 1  16 GLN HE21 .  16 . HE21 1 1 
        48 1 1 1 1  12 LEU MD2  .  12 . HD2* 1 1 
        48 1 2 1 1  45 ILE H    .  45 . HN   1 1 
        49 1 1 1 1  12 LEU MD2  .  12 . HD2* 1 1 
        49 1 2 1 1  45 ILE MD   .  45 . HD1* 1 1 
        50 1 1 1 1  12 LEU MD2  .  12 . HD2* 1 1 
        50 1 2 1 1  46 VAL H    .  46 . HN   1 1 
        51 1 1 1 1  12 LEU MD2  .  12 . HD2* 1 1 
        51 1 2 1 1  46 VAL MG1  .  46 . HG1* 1 1 
        52 1 1 1 1  12 LEU MD2  .  12 . HD2* 1 1 
        52 1 2 1 1  46 VAL MG2  .  46 . HG2* 1 1 
        53 1 1 1 1  12 LEU MD2  .  12 . HD2* 1 1 
        53 1 2 1 1  47 SER H    .  47 . HN   1 1 
        54 1 1 1 1  13 ASN H    .  13 . HN   1 1 
        54 1 2 1 1  13 ASN HD21 .  13 . HD21 1 1 
        55 1 1 1 1  13 ASN H    .  13 . HN   1 1 
        55 1 2 1 1  14 ARG H    .  14 . HN   1 1 
        56 1 1 1 1  13 ASN HD21 .  13 . HD21 1 1 
        56 1 2 1 1  46 VAL MG1  .  46 . HG1* 1 1 
        57 1 1 1 1  13 ASN HD22 .  13 . HD22 1 1 
        57 1 2 1 1  46 VAL MG1  .  46 . HG1* 1 1 
        58 1 1 1 1  13 ASN HD22 .  13 . HD22 1 1 
        58 1 2 1 1  46 VAL MG2  .  46 . HG2* 1 1 
        59 1 1 1 1  14 ARG H    .  14 . HN   1 1 
        59 1 2 1 1  15 MET H    .  15 . HN   1 1 
        60 1 1 1 1  14 ARG H    .  14 . HN   1 1 
        60 1 2 1 1  16 GLN H    .  16 . HN   1 1 
        61 1 1 1 1  14 ARG H    .  14 . HN   1 1 
        61 1 2 1 1  17 TYR H    .  17 . HN   1 1 
        62 1 1 1 1  15 MET H    .  15 . HN   1 1 
        62 1 2 1 1  16 GLN H    .  16 . HN   1 1 
        63 1 1 1 1  15 MET H    .  15 . HN   1 1 
        63 1 2 1 1  17 TYR H    .  17 . HN   1 1 
        64 1 1 1 1  15 MET H    .  15 . HN   1 1 
        64 1 2 1 1  18 GLU H    .  18 . HN   1 1 
        65 1 1 1 1  15 MET H    .  15 . HN   1 1 
        65 1 2 1 1  19 VAL MG2  .  19 . HG2* 1 1 
        66 1 1 1 1  16 GLN H    .  16 . HN   1 1 
        66 1 2 1 1  17 TYR H    .  17 . HN   1 1 
        67 1 1 1 1  16 GLN H    .  16 . HN   1 1 
        67 1 2 1 1  18 GLU H    .  18 . HN   1 1 
        68 1 1 1 1  16 GLN H    .  16 . HN   1 1 
        68 1 2 1 1  19 VAL H    .  19 . HN   1 1 
        69 1 1 1 1  16 GLN H    .  16 . HN   1 1 
        69 1 2 1 1  19 VAL MG2  .  19 . HG2* 1 1 
        70 1 1 1 1  16 GLN H    .  16 . HN   1 1 
        70 1 2 1 1  46 VAL MG1  .  46 . HG1* 1 1 
        71 1 1 1 1  16 GLN QE   .  16 . HE*  1 1 
        71 1 2 1 1  45 ILE MD   .  45 . HD1* 1 1 
        72 1 1 1 1  16 GLN QE   .  16 . HE*  1 1 
        72 1 2 1 1  46 VAL H    .  46 . HN   1 1 
        73 1 1 1 1  16 GLN HE21 .  16 . HE21 1 1 
        73 1 2 1 1  45 ILE MD   .  45 . HD1* 1 1 
        74 1 1 1 1  16 GLN HE21 .  16 . HE21 1 1 
        74 1 2 1 1  46 VAL H    .  46 . HN   1 1 
        75 1 1 1 1  16 GLN HE21 .  16 . HE21 1 1 
        75 1 2 1 1  46 VAL MG1  .  46 . HG1* 1 1 
        76 1 1 1 1  16 GLN HE22 .  16 . HE22 1 1 
        76 1 2 1 1  45 ILE MD   .  45 . HD1* 1 1 
        77 1 1 1 1  16 GLN HE22 .  16 . HE22 1 1 
        77 1 2 1 1  46 VAL H    .  46 . HN   1 1 
        78 1 1 1 1  16 GLN HE22 .  16 . HE22 1 1 
        78 1 2 1 1  46 VAL MG1  .  46 . HG1* 1 1 
        79 1 1 1 1  17 TYR H    .  17 . HN   1 1 
        79 1 2 1 1  18 GLU H    .  18 . HN   1 1 
        80 1 1 1 1  17 TYR H    .  17 . HN   1 1 
        80 1 2 1 1  19 VAL H    .  19 . HN   1 1 
        81 1 1 1 1  17 TYR H    .  17 . HN   1 1 
        81 1 2 1 1  20 THR H    .  20 . HN   1 1 
        82 1 1 1 1  17 TYR H    .  17 . HN   1 1 
        82 1 2 1 1  46 VAL MG1  .  46 . HG1* 1 1 
        83 1 1 1 1  18 GLU H    .  18 . HN   1 1 
        83 1 2 1 1  19 VAL H    .  19 . HN   1 1 
        84 1 1 1 1  18 GLU H    .  18 . HN   1 1 
        84 1 2 1 1  19 VAL MG2  .  19 . HG2* 1 1 
        85 1 1 1 1  18 GLU H    .  18 . HN   1 1 
        85 1 2 1 1  20 THR H    .  20 . HN   1 1 
        86 1 1 1 1  19 VAL H    .  19 . HN   1 1 
        86 1 2 1 1  19 VAL MG1  .  19 . HG1* 1 1 
        87 1 1 1 1  19 VAL H    .  19 . HN   1 1 
        87 1 2 1 1  19 VAL MG2  .  19 . HG2* 1 1 
        88 1 1 1 1  19 VAL H    .  19 . HN   1 1 
        88 1 2 1 1  20 THR H    .  20 . HN   1 1 
        89 1 1 1 1  19 VAL H    .  19 . HN   1 1 
        89 1 2 1 1  21 GLN H    .  21 . HN   1 1 
        90 1 1 1 1  19 VAL MG1  .  19 . HG1* 1 1 
        90 1 2 1 1  20 THR H    .  20 . HN   1 1 
        91 1 1 1 1  19 VAL MG1  .  19 . HG1* 1 1 
        91 1 2 1 1  22 ASN H    .  22 . HN   1 1 
        92 1 1 1 1  19 VAL MG1  .  19 . HG1* 1 1 
        92 1 2 1 1  23 ASN H    .  23 . HN   1 1 
        93 1 1 1 1  19 VAL MG1  .  19 . HG1* 1 1 
        93 1 2 1 1  24 GLY H    .  24 . HN   1 1 
        94 1 1 1 1  19 VAL MG1  .  19 . HG1* 1 1 
        94 1 2 1 1  25 THR H    .  25 . HN   1 1 
        95 1 1 1 1  19 VAL MG1  .  19 . HG1* 1 1 
        95 1 2 1 1  26 GLU H    .  26 . HN   1 1 
        96 1 1 1 1  19 VAL MG1  .  19 . HG1* 1 1 
        96 1 2 1 1 117 ASN H    . 117 . HN   1 1 
        97 1 1 1 1  19 VAL MG1  .  19 . HG1* 1 1 
        97 1 2 1 1 117 ASN HD21 . 117 . HD21 1 1 
        98 1 1 1 1  19 VAL MG1  .  19 . HG1* 1 1 
        98 1 2 1 1 117 ASN HD22 . 117 . HD22 1 1 
        99 1 1 1 1  19 VAL MG1  .  19 . HG1* 1 1 
        99 1 2 1 1 119 ALA H    . 119 . HN   1 1 
       100 1 1 1 1  19 VAL MG1  .  19 . HG1* 1 1 
       100 1 2 1 1 120 ALA H    . 120 . HN   1 1 
       101 1 1 1 1  19 VAL MG2  .  19 . HG2* 1 1 
       101 1 2 1 1  20 THR H    .  20 . HN   1 1 
       102 1 1 1 1  19 VAL MG2  .  19 . HG2* 1 1 
       102 1 2 1 1  24 GLY H    .  24 . HN   1 1 
       103 1 1 1 1  19 VAL MG2  .  19 . HG2* 1 1 
       103 1 2 1 1  25 THR H    .  25 . HN   1 1 
       104 1 1 1 1  19 VAL MG2  .  19 . HG2* 1 1 
       104 1 2 1 1  26 GLU H    .  26 . HN   1 1 
       105 1 1 1 1  19 VAL MG2  .  19 . HG2* 1 1 
       105 1 2 1 1  64 TRP HE1  .  64 . HE1  1 1 
       106 1 1 1 1  19 VAL MG2  .  19 . HG2* 1 1 
       106 1 2 1 1 120 ALA H    . 120 . HN   1 1 
       107 1 1 1 1  20 THR H    .  20 . HN   1 1 
       107 1 2 1 1  21 GLN H    .  21 . HN   1 1 
       108 1 1 1 1  20 THR H    .  20 . HN   1 1 
       108 1 2 1 1  22 ASN H    .  22 . HN   1 1 
       109 1 1 1 1  20 THR H    .  20 . HN   1 1 
       109 1 2 1 1  23 ASN H    .  23 . HN   1 1 
       110 1 1 1 1  21 GLN H    .  21 . HN   1 1 
       110 1 2 1 1  22 ASN H    .  22 . HN   1 1 
       111 1 1 1 1  21 GLN H    .  21 . HN   1 1 
       111 1 2 1 1  23 ASN H    .  23 . HN   1 1 
       112 1 1 1 1  21 GLN H    .  21 . HN   1 1 
       112 1 2 1 1  24 GLY H    .  24 . HN   1 1 
       113 1 1 1 1  22 ASN H    .  22 . HN   1 1 
       113 1 2 1 1  22 ASN QD   .  22 . HD2* 1 1 
       114 1 1 1 1  22 ASN H    .  22 . HN   1 1 
       114 1 2 1 1  23 ASN H    .  23 . HN   1 1 
       115 1 1 1 1  22 ASN H    .  22 . HN   1 1 
       115 1 2 1 1  24 GLY H    .  24 . HN   1 1 
       116 1 1 1 1  22 ASN QD   .  22 . HD2* 1 1 
       116 1 2 1 1  23 ASN H    .  23 . HN   1 1 
       117 1 1 1 1  22 ASN QD   .  22 . HD2* 1 1 
       117 1 2 1 1  24 GLY H    .  24 . HN   1 1 
       118 1 1 1 1  22 ASN HD21 .  22 . HD21 1 1 
       118 1 2 1 1  24 GLY H    .  24 . HN   1 1 
       119 1 1 1 1  22 ASN HD22 .  22 . HD22 1 1 
       119 1 2 1 1  24 GLY H    .  24 . HN   1 1 
       120 1 1 1 1  23 ASN H    .  23 . HN   1 1 
       120 1 2 1 1  24 GLY H    .  24 . HN   1 1 
       121 1 1 1 1  24 GLY H    .  24 . HN   1 1 
       121 1 2 1 1  25 THR H    .  25 . HN   1 1 
       122 1 1 1 1  25 THR H    .  25 . HN   1 1 
       122 1 2 1 1  26 GLU H    .  26 . HN   1 1 
       123 1 1 1 1  26 GLU H    .  26 . HN   1 1 
       123 1 2 1 1  64 TRP HE1  .  64 . HE1  1 1 
       124 1 1 1 1  29 PHE H    .  29 . HN   1 1 
       124 1 2 1 1  30 GLN H    .  30 . HN   1 1 
       125 1 1 1 1  29 PHE H    .  29 . HN   1 1 
       125 1 2 1 1  31 ASN H    .  31 . HN   1 1 
       126 1 1 1 1  30 GLN H    .  30 . HN   1 1 
       126 1 2 1 1  31 ASN H    .  31 . HN   1 1 
       127 1 1 1 1  30 GLN H    .  30 . HN   1 1 
       127 1 2 1 1  34 TRP HE1  .  34 . HE1  1 1 
       128 1 1 1 1  31 ASN H    .  31 . HN   1 1 
       128 1 2 1 1  32 GLU H    .  32 . HN   1 1 
       129 1 1 1 1  31 ASN H    .  31 . HN   1 1 
       129 1 2 1 1  34 TRP H    .  34 . HN   1 1 
       130 1 1 1 1  31 ASN H    .  31 . HN   1 1 
       130 1 2 1 1  34 TRP HE1  .  34 . HE1  1 1 
       131 1 1 1 1  32 GLU H    .  32 . HN   1 1 
       131 1 2 1 1  33 TYR H    .  33 . HN   1 1 
       132 1 1 1 1  32 GLU H    .  32 . HN   1 1 
       132 1 2 1 1  34 TRP H    .  34 . HN   1 1 
       133 1 1 1 1  33 TYR H    .  33 . HN   1 1 
       133 1 2 1 1  34 TRP H    .  34 . HN   1 1 
       134 1 1 1 1  33 TYR H    .  33 . HN   1 1 
       134 1 2 1 1  36 HIS H    .  36 . HN   1 1 
       135 1 1 1 1  34 TRP H    .  34 . HN   1 1 
       135 1 2 1 1  35 ASP H    .  35 . HN   1 1 
       136 1 1 1 1  34 TRP H    .  34 . HN   1 1 
       136 1 2 1 1  36 HIS H    .  36 . HN   1 1 
       137 1 1 1 1  35 ASP H    .  35 . HN   1 1 
       137 1 2 1 1  36 HIS H    .  36 . HN   1 1 
       138 1 1 1 1  37 LYS H    .  37 . HN   1 1 
       138 1 2 1 1  38 GLU H    .  38 . HN   1 1 
       139 1 1 1 1  39 GLU H    .  39 . HN   1 1 
       139 1 2 1 1  40 GLY H    .  40 . HN   1 1 
       140 1 1 1 1  40 GLY H    .  40 . HN   1 1 
       140 1 2 1 1  41 LEU H    .  41 . HN   1 1 
       141 1 1 1 1  40 GLY H    .  40 . HN   1 1 
       141 1 2 1 1  54 SER H    .  54 . HN   1 1 
       142 1 1 1 1  40 GLY H    .  40 . HN   1 1 
       142 1 2 1 1  55 LYS H    .  55 . HN   1 1 
       143 1 1 1 1  41 LEU H    .  41 . HN   1 1 
       143 1 2 1 1  41 LEU MD1  .  41 . HD1* 1 1 
       144 1 1 1 1  41 LEU H    .  41 . HN   1 1 
       144 1 2 1 1  41 LEU MD2  .  41 . HD2* 1 1 
       145 1 1 1 1  41 LEU H    .  41 . HN   1 1 
       145 1 2 1 1  42 TYR H    .  42 . HN   1 1 
       146 1 1 1 1  41 LEU H    .  41 . HN   1 1 
       146 1 2 1 1  43 VAL MG1  .  43 . HG1* 1 1 
       147 1 1 1 1  41 LEU H    .  41 . HN   1 1 
       147 1 2 1 1 124 VAL H    . 124 . HN   1 1 
       148 1 1 1 1  41 LEU H    .  41 . HN   1 1 
       148 1 2 1 1 124 VAL MG1  . 124 . HG1* 1 1 
       149 1 1 1 1  41 LEU H    .  41 . HN   1 1 
       149 1 2 1 1 124 VAL MG2  . 124 . HG2* 1 1 
       150 1 1 1 1  41 LEU H    .  41 . HN   1 1 
       150 1 2 1 1 126 LYS H    . 126 . HN   1 1 
       151 1 1 1 1  41 LEU H    .  41 . HN   1 1 
       151 1 2 1 1 129 LEU MD1  . 129 . HD1* 1 1 
       152 1 1 1 1  41 LEU H    .  41 . HN   1 1 
       152 1 2 1 1 129 LEU MD2  . 129 . HD2* 1 1 
       153 1 1 1 1  41 LEU MD1  .  41 . HD1* 1 1 
       153 1 2 1 1  42 TYR H    .  42 . HN   1 1 
       154 1 1 1 1  41 LEU MD1  .  41 . HD1* 1 1 
       154 1 2 1 1  43 VAL MG1  .  43 . HG1* 1 1 
       155 1 1 1 1  41 LEU MD1  .  41 . HD1* 1 1 
       155 1 2 1 1  43 VAL MG2  .  43 . HG2* 1 1 
       156 1 1 1 1  41 LEU MD1  .  41 . HD1* 1 1 
       156 1 2 1 1  51 LEU H    .  51 . HN   1 1 
       157 1 1 1 1  41 LEU MD1  .  41 . HD1* 1 1 
       157 1 2 1 1  52 PHE H    .  52 . HN   1 1 
       158 1 1 1 1  41 LEU MD1  .  41 . HD1* 1 1 
       158 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
       159 1 1 1 1  41 LEU MD1  .  41 . HD1* 1 1 
       159 1 2 1 1 124 VAL H    . 124 . HN   1 1 
       160 1 1 1 1  41 LEU MD1  .  41 . HD1* 1 1 
       160 1 2 1 1 124 VAL MG1  . 124 . HG1* 1 1 
       161 1 1 1 1  41 LEU MD1  .  41 . HD1* 1 1 
       161 1 2 1 1 124 VAL MG2  . 124 . HG2* 1 1 
       162 1 1 1 1  41 LEU MD1  .  41 . HD1* 1 1 
       162 1 2 1 1 129 LEU MD1  . 129 . HD1* 1 1 
       163 1 1 1 1  41 LEU MD1  .  41 . HD1* 1 1 
       163 1 2 1 1 129 LEU MD2  . 129 . HD2* 1 1 
       164 1 1 1 1  41 LEU MD1  .  41 . HD1* 1 1 
       164 1 2 1 1 137 TYR H    . 137 . HN   1 1 
       165 1 1 1 1  41 LEU MD1  .  41 . HD1* 1 1 
       165 1 2 1 1 138 LEU MD1  . 138 . HD1* 1 1 
       166 1 1 1 1  41 LEU MD1  .  41 . HD1* 1 1 
       166 1 2 1 1 140 LEU H    . 140 . HN   1 1 
       167 1 1 1 1  41 LEU MD1  .  41 . HD1* 1 1 
       167 1 2 1 1 140 LEU MD1  . 140 . HD1* 1 1 
       168 1 1 1 1  41 LEU MD1  .  41 . HD1* 1 1 
       168 1 2 1 1 141 PHE H    . 141 . HN   1 1 
       169 1 1 1 1  41 LEU MD2  .  41 . HD2* 1 1 
       169 1 2 1 1  42 TYR H    .  42 . HN   1 1 
       170 1 1 1 1  41 LEU MD2  .  41 . HD2* 1 1 
       170 1 2 1 1  43 VAL MG1  .  43 . HG1* 1 1 
       171 1 1 1 1  41 LEU MD2  .  41 . HD2* 1 1 
       171 1 2 1 1  51 LEU H    .  51 . HN   1 1 
       172 1 1 1 1  41 LEU MD2  .  41 . HD2* 1 1 
       172 1 2 1 1  52 PHE H    .  52 . HN   1 1 
       173 1 1 1 1  41 LEU MD2  .  41 . HD2* 1 1 
       173 1 2 1 1  54 SER H    .  54 . HN   1 1 
       174 1 1 1 1  41 LEU MD2  .  41 . HD2* 1 1 
       174 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
       175 1 1 1 1  41 LEU MD2  .  41 . HD2* 1 1 
       175 1 2 1 1 129 LEU MD1  . 129 . HD1* 1 1 
       176 1 1 1 1  41 LEU MD2  .  41 . HD2* 1 1 
       176 1 2 1 1 129 LEU MD2  . 129 . HD2* 1 1 
       177 1 1 1 1  41 LEU MD2  .  41 . HD2* 1 1 
       177 1 2 1 1 138 LEU MD1  . 138 . HD1* 1 1 
       178 1 1 1 1  41 LEU MD2  .  41 . HD2* 1 1 
       178 1 2 1 1 140 LEU MD1  . 140 . HD1* 1 1 
       179 1 1 1 1  42 TYR H    .  42 . HN   1 1 
       179 1 2 1 1  43 VAL MG1  .  43 . HG1* 1 1 
       180 1 1 1 1  42 TYR H    .  42 . HN   1 1 
       180 1 2 1 1  51 LEU H    .  51 . HN   1 1 
       181 1 1 1 1  42 TYR H    .  42 . HN   1 1 
       181 1 2 1 1  52 PHE H    .  52 . HN   1 1 
       182 1 1 1 1  42 TYR H    .  42 . HN   1 1 
       182 1 2 1 1  54 SER H    .  54 . HN   1 1 
       183 1 1 1 1  42 TYR H    .  42 . HN   1 1 
       183 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
       184 1 1 1 1  42 TYR H    .  42 . HN   1 1 
       184 1 2 1 1 124 VAL H    . 124 . HN   1 1 
       185 1 1 1 1  42 TYR H    .  42 . HN   1 1 
       185 1 2 1 1 124 VAL MG2  . 124 . HG2* 1 1 
       186 1 1 1 1  43 VAL H    .  43 . HN   1 1 
       186 1 2 1 1  43 VAL MG1  .  43 . HG1* 1 1 
       187 1 1 1 1  43 VAL H    .  43 . HN   1 1 
       187 1 2 1 1  43 VAL MG2  .  43 . HG2* 1 1 
       188 1 1 1 1  43 VAL H    .  43 . HN   1 1 
       188 1 2 1 1  44 ASP H    .  44 . HN   1 1 
       189 1 1 1 1  43 VAL H    .  43 . HN   1 1 
       189 1 2 1 1  51 LEU H    .  51 . HN   1 1 
       190 1 1 1 1  43 VAL H    .  43 . HN   1 1 
       190 1 2 1 1 121 LEU MD1  . 121 . HD1* 1 1 
       191 1 1 1 1  43 VAL H    .  43 . HN   1 1 
       191 1 2 1 1 121 LEU MD2  . 121 . HD2* 1 1 
       192 1 1 1 1  43 VAL H    .  43 . HN   1 1 
       192 1 2 1 1 122 ARG H    . 122 . HN   1 1 
       193 1 1 1 1  43 VAL H    .  43 . HN   1 1 
       193 1 2 1 1 124 VAL H    . 124 . HN   1 1 
       194 1 1 1 1  43 VAL H    .  43 . HN   1 1 
       194 1 2 1 1 124 VAL MG2  . 124 . HG2* 1 1 
       195 1 1 1 1  43 VAL MG1  .  43 . HG1* 1 1 
       195 1 2 1 1  44 ASP H    .  44 . HN   1 1 
       196 1 1 1 1  43 VAL MG1  .  43 . HG1* 1 1 
       196 1 2 1 1  49 LYS H    .  49 . HN   1 1 
       197 1 1 1 1  43 VAL MG1  .  43 . HG1* 1 1 
       197 1 2 1 1  51 LEU H    .  51 . HN   1 1 
       198 1 1 1 1  43 VAL MG1  .  43 . HG1* 1 1 
       198 1 2 1 1  52 PHE H    .  52 . HN   1 1 
       199 1 1 1 1  43 VAL MG1  .  43 . HG1* 1 1 
       199 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
       200 1 1 1 1  43 VAL MG1  .  43 . HG1* 1 1 
       200 1 2 1 1 124 VAL H    . 124 . HN   1 1 
       201 1 1 1 1  43 VAL MG1  .  43 . HG1* 1 1 
       201 1 2 1 1 124 VAL MG1  . 124 . HG1* 1 1 
       202 1 1 1 1  43 VAL MG1  .  43 . HG1* 1 1 
       202 1 2 1 1 124 VAL MG2  . 124 . HG2* 1 1 
       203 1 1 1 1  43 VAL MG1  .  43 . HG1* 1 1 
       203 1 2 1 1 129 LEU MD1  . 129 . HD1* 1 1 
       204 1 1 1 1  43 VAL MG1  .  43 . HG1* 1 1 
       204 1 2 1 1 129 LEU MD2  . 129 . HD2* 1 1 
       205 1 1 1 1  43 VAL MG2  .  43 . HG2* 1 1 
       205 1 2 1 1  44 ASP H    .  44 . HN   1 1 
       206 1 1 1 1  43 VAL MG2  .  43 . HG2* 1 1 
       206 1 2 1 1  45 ILE H    .  45 . HN   1 1 
       207 1 1 1 1  43 VAL MG2  .  43 . HG2* 1 1 
       207 1 2 1 1  45 ILE MD   .  45 . HD1* 1 1 
       208 1 1 1 1  43 VAL MG2  .  43 . HG2* 1 1 
       208 1 2 1 1  48 GLY H    .  48 . HN   1 1 
       209 1 1 1 1  43 VAL MG2  .  43 . HG2* 1 1 
       209 1 2 1 1  49 LYS H    .  49 . HN   1 1 
       210 1 1 1 1  43 VAL MG2  .  43 . HG2* 1 1 
       210 1 2 1 1  51 LEU H    .  51 . HN   1 1 
       211 1 1 1 1  43 VAL MG2  .  43 . HG2* 1 1 
       211 1 2 1 1 122 ARG H    . 122 . HN   1 1 
       212 1 1 1 1  43 VAL MG2  .  43 . HG2* 1 1 
       212 1 2 1 1 123 PHE H    . 123 . HN   1 1 
       213 1 1 1 1  43 VAL MG2  .  43 . HG2* 1 1 
       213 1 2 1 1 124 VAL MG2  . 124 . HG2* 1 1 
       214 1 1 1 1  44 ASP H    .  44 . HN   1 1 
       214 1 2 1 1  45 ILE H    .  45 . HN   1 1 
       215 1 1 1 1  44 ASP H    .  44 . HN   1 1 
       215 1 2 1 1  46 VAL H    .  46 . HN   1 1 
       216 1 1 1 1  44 ASP H    .  44 . HN   1 1 
       216 1 2 1 1  46 VAL MG2  .  46 . HG2* 1 1 
       217 1 1 1 1  44 ASP H    .  44 . HN   1 1 
       217 1 2 1 1  48 GLY H    .  48 . HN   1 1 
       218 1 1 1 1  44 ASP H    .  44 . HN   1 1 
       218 1 2 1 1  49 LYS H    .  49 . HN   1 1 
       219 1 1 1 1  44 ASP H    .  44 . HN   1 1 
       219 1 2 1 1  51 LEU H    .  51 . HN   1 1 
       220 1 1 1 1  44 ASP H    .  44 . HN   1 1 
       220 1 2 1 1  51 LEU MD1  .  51 . HD1* 1 1 
       221 1 1 1 1  44 ASP H    .  44 . HN   1 1 
       221 1 2 1 1  51 LEU MD2  .  51 . HD2* 1 1 
       222 1 1 1 1  44 ASP H    .  44 . HN   1 1 
       222 1 2 1 1  99 LEU QD   .  99 . HD2* 1 1 
       223 1 1 1 1  44 ASP H    .  44 . HN   1 1 
       223 1 2 1 1 121 LEU MD2  . 121 . HD2* 1 1 
       224 1 1 1 1  44 ASP H    .  44 . HN   1 1 
       224 1 2 1 1 122 ARG H    . 122 . HN   1 1 
       225 1 1 1 1  45 ILE H    .  45 . HN   1 1 
       225 1 2 1 1  45 ILE MD   .  45 . HD1* 1 1 
       226 1 1 1 1  45 ILE H    .  45 . HN   1 1 
       226 1 2 1 1  46 VAL H    .  46 . HN   1 1 
       227 1 1 1 1  45 ILE H    .  45 . HN   1 1 
       227 1 2 1 1  46 VAL MG1  .  46 . HG1* 1 1 
       228 1 1 1 1  45 ILE H    .  45 . HN   1 1 
       228 1 2 1 1  46 VAL MG2  .  46 . HG2* 1 1 
       229 1 1 1 1  45 ILE H    .  45 . HN   1 1 
       229 1 2 1 1  47 SER H    .  47 . HN   1 1 
       230 1 1 1 1  45 ILE H    .  45 . HN   1 1 
       230 1 2 1 1  48 GLY H    .  48 . HN   1 1 
       231 1 1 1 1  45 ILE H    .  45 . HN   1 1 
       231 1 2 1 1 121 LEU MD2  . 121 . HD2* 1 1 
       232 1 1 1 1  45 ILE H    .  45 . HN   1 1 
       232 1 2 1 1 122 ARG H    . 122 . HN   1 1 
       233 1 1 1 1  45 ILE MD   .  45 . HD1* 1 1 
       233 1 2 1 1  46 VAL H    .  46 . HN   1 1 
       234 1 1 1 1  45 ILE MD   .  45 . HD1* 1 1 
       234 1 2 1 1 121 LEU H    . 121 . HN   1 1 
       235 1 1 1 1  45 ILE MD   .  45 . HD1* 1 1 
       235 1 2 1 1 122 ARG H    . 122 . HN   1 1 
       236 1 1 1 1  46 VAL H    .  46 . HN   1 1 
       236 1 2 1 1  46 VAL MG1  .  46 . HG1* 1 1 
       237 1 1 1 1  46 VAL H    .  46 . HN   1 1 
       237 1 2 1 1  46 VAL MG2  .  46 . HG2* 1 1 
       238 1 1 1 1  46 VAL H    .  46 . HN   1 1 
       238 1 2 1 1  47 SER H    .  47 . HN   1 1 
       239 1 1 1 1  46 VAL H    .  46 . HN   1 1 
       239 1 2 1 1  48 GLY H    .  48 . HN   1 1 
       240 1 1 1 1  46 VAL H    .  46 . HN   1 1 
       240 1 2 1 1  49 LYS H    .  49 . HN   1 1 
       241 1 1 1 1  46 VAL MG1  .  46 . HG1* 1 1 
       241 1 2 1 1  47 SER H    .  47 . HN   1 1 
       242 1 1 1 1  46 VAL MG1  .  46 . HG1* 1 1 
       242 1 2 1 1  48 GLY H    .  48 . HN   1 1 
       243 1 1 1 1  46 VAL MG2  .  46 . HG2* 1 1 
       243 1 2 1 1  47 SER H    .  47 . HN   1 1 
       244 1 1 1 1  46 VAL MG2  .  46 . HG2* 1 1 
       244 1 2 1 1  48 GLY H    .  48 . HN   1 1 
       245 1 1 1 1  46 VAL MG2  .  46 . HG2* 1 1 
       245 1 2 1 1  49 LYS H    .  49 . HN   1 1 
       246 1 1 1 1  46 VAL MG2  .  46 . HG2* 1 1 
       246 1 2 1 1  51 LEU MD1  .  51 . HD1* 1 1 
       247 1 1 1 1  46 VAL MG2  .  46 . HG2* 1 1 
       247 1 2 1 1  97 SER H    .  97 . HN   1 1 
       248 1 1 1 1  46 VAL MG2  .  46 . HG2* 1 1 
       248 1 2 1 1  98 HIS H    .  98 . HN   1 1 
       249 1 1 1 1  46 VAL MG2  .  46 . HG2* 1 1 
       249 1 2 1 1  99 LEU QD   .  99 . HD2* 1 1 
       250 1 1 1 1  47 SER H    .  47 . HN   1 1 
       250 1 2 1 1  48 GLY H    .  48 . HN   1 1 
       251 1 1 1 1  47 SER H    .  47 . HN   1 1 
       251 1 2 1 1  49 LYS H    .  49 . HN   1 1 
       252 1 1 1 1  47 SER HG   .  47 . HG   1 1 
       252 1 2 1 1  49 LYS H    .  49 . HN   1 1 
       253 1 1 1 1  48 GLY H    .  48 . HN   1 1 
       253 1 2 1 1  49 LYS H    .  49 . HN   1 1 
       254 1 1 1 1  49 LYS H    .  49 . HN   1 1 
       254 1 2 1 1  51 LEU MD1  .  51 . HD1* 1 1 
       255 1 1 1 1  49 LYS H    .  49 . HN   1 1 
       255 1 2 1 1  51 LEU MD2  .  51 . HD2* 1 1 
       256 1 1 1 1  51 LEU H    .  51 . HN   1 1 
       256 1 2 1 1  51 LEU MD1  .  51 . HD1* 1 1 
       257 1 1 1 1  51 LEU H    .  51 . HN   1 1 
       257 1 2 1 1  51 LEU MD2  .  51 . HD2* 1 1 
       258 1 1 1 1  51 LEU H    .  51 . HN   1 1 
       258 1 2 1 1  52 PHE H    .  52 . HN   1 1 
       259 1 1 1 1  51 LEU H    .  51 . HN   1 1 
       259 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
       260 1 1 1 1  51 LEU MD1  .  51 . HD1* 1 1 
       260 1 2 1 1  52 PHE H    .  52 . HN   1 1 
       261 1 1 1 1  51 LEU MD1  .  51 . HD1* 1 1 
       261 1 2 1 1  75 VAL MG2  .  75 . HG2* 1 1 
       262 1 1 1 1  51 LEU MD1  .  51 . HD1* 1 1 
       262 1 2 1 1  99 LEU H    .  99 . HN   1 1 
       263 1 1 1 1  51 LEU MD1  .  51 . HD1* 1 1 
       263 1 2 1 1  99 LEU QD   .  99 . HD2* 1 1 
       264 1 1 1 1  51 LEU MD1  .  51 . HD1* 1 1 
       264 1 2 1 1 116 ILE MD   . 116 . HD1* 1 1 
       265 1 1 1 1  51 LEU MD1  .  51 . HD1* 1 1 
       265 1 2 1 1 121 LEU MD1  . 121 . HD1* 1 1 
       266 1 1 1 1  51 LEU MD1  .  51 . HD1* 1 1 
       266 1 2 1 1 121 LEU MD2  . 121 . HD2* 1 1 
       267 1 1 1 1  51 LEU MD2  .  51 . HD2* 1 1 
       267 1 2 1 1  52 PHE H    .  52 . HN   1 1 
       268 1 1 1 1  51 LEU MD2  .  51 . HD2* 1 1 
       268 1 2 1 1  71 ILE H    .  71 . HN   1 1 
       269 1 1 1 1  51 LEU MD2  .  51 . HD2* 1 1 
       269 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
       270 1 1 1 1  51 LEU MD2  .  51 . HD2* 1 1 
       270 1 2 1 1  74 GLU H    .  74 . HN   1 1 
       271 1 1 1 1  51 LEU MD2  .  51 . HD2* 1 1 
       271 1 2 1 1  75 VAL H    .  75 . HN   1 1 
       272 1 1 1 1  51 LEU MD2  .  51 . HD2* 1 1 
       272 1 2 1 1  75 VAL MG1  .  75 . HG1* 1 1 
       273 1 1 1 1  51 LEU MD2  .  51 . HD2* 1 1 
       273 1 2 1 1  75 VAL MG2  .  75 . HG2* 1 1 
       274 1 1 1 1  51 LEU MD2  .  51 . HD2* 1 1 
       274 1 2 1 1  99 LEU QD   .  99 . HD2* 1 1 
       275 1 1 1 1  51 LEU MD2  .  51 . HD2* 1 1 
       275 1 2 1 1 121 LEU MD2  . 121 . HD2* 1 1 
       276 1 1 1 1  52 PHE H    .  52 . HN   1 1 
       276 1 2 1 1  71 ILE H    .  71 . HN   1 1 
       277 1 1 1 1  52 PHE H    .  52 . HN   1 1 
       277 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
       278 1 1 1 1  53 THR H    .  53 . HN   1 1 
       278 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
       279 1 1 1 1  54 SER H    .  54 . HN   1 1 
       279 1 2 1 1  55 LYS H    .  55 . HN   1 1 
       280 1 1 1 1  54 SER H    .  54 . HN   1 1 
       280 1 2 1 1  56 ASP H    .  56 . HN   1 1 
       281 1 1 1 1  54 SER H    .  54 . HN   1 1 
       281 1 2 1 1  57 LYS H    .  57 . HN   1 1 
       282 1 1 1 1  54 SER HG   .  54 . HG   1 1 
       282 1 2 1 1  55 LYS H    .  55 . HN   1 1 
       283 1 1 1 1  54 SER HG   .  54 . HG   1 1 
       283 1 2 1 1  56 ASP H    .  56 . HN   1 1 
       284 1 1 1 1  54 SER HG   .  54 . HG   1 1 
       284 1 2 1 1  57 LYS H    .  57 . HN   1 1 
       285 1 1 1 1  55 LYS H    .  55 . HN   1 1 
       285 1 2 1 1  56 ASP H    .  56 . HN   1 1 
       286 1 1 1 1  55 LYS H    .  55 . HN   1 1 
       286 1 2 1 1  57 LYS H    .  57 . HN   1 1 
       287 1 1 1 1  56 ASP H    .  56 . HN   1 1 
       287 1 2 1 1  57 LYS H    .  57 . HN   1 1 
       288 1 1 1 1  63 GLY H    .  63 . HN   1 1 
       288 1 2 1 1  64 TRP H    .  64 . HN   1 1 
       289 1 1 1 1  67 PHE H    .  67 . HN   1 1 
       289 1 2 1 1 114 TYR H    . 114 . HN   1 1 
       290 1 1 1 1  68 THR H    .  68 . HN   1 1 
       290 1 2 1 1  69 LYS H    .  69 . HN   1 1 
       291 1 1 1 1  71 ILE H    .  71 . HN   1 1 
       291 1 2 1 1  71 ILE MD   .  71 . HD1* 1 1 
       292 1 1 1 1  71 ILE H    .  71 . HN   1 1 
       292 1 2 1 1  72 GLU H    .  72 . HN   1 1 
       293 1 1 1 1  71 ILE H    .  71 . HN   1 1 
       293 1 2 1 1  73 GLU H    .  73 . HN   1 1 
       294 1 1 1 1  71 ILE H    .  71 . HN   1 1 
       294 1 2 1 1  74 GLU H    .  74 . HN   1 1 
       295 1 1 1 1  71 ILE H    .  71 . HN   1 1 
       295 1 2 1 1  75 VAL MG1  .  75 . HG1* 1 1 
       296 1 1 1 1  71 ILE H    .  71 . HN   1 1 
       296 1 2 1 1  75 VAL MG2  .  75 . HG2* 1 1 
       297 1 1 1 1  71 ILE MD   .  71 . HD1* 1 1 
       297 1 2 1 1 140 LEU MD1  . 140 . HD1* 1 1 
       298 1 1 1 1  71 ILE MD   .  71 . HD1* 1 1 
       298 1 2 1 1 140 LEU MD2  . 140 . HD2* 1 1 
       299 1 1 1 1  72 GLU H    .  72 . HN   1 1 
       299 1 2 1 1  73 GLU H    .  73 . HN   1 1 
       300 1 1 1 1  73 GLU H    .  73 . HN   1 1 
       300 1 2 1 1  74 GLU H    .  74 . HN   1 1 
       301 1 1 1 1  73 GLU H    .  73 . HN   1 1 
       301 1 2 1 1  75 VAL H    .  75 . HN   1 1 
       302 1 1 1 1  73 GLU H    .  73 . HN   1 1 
       302 1 2 1 1  75 VAL MG2  .  75 . HG2* 1 1 
       303 1 1 1 1  74 GLU H    .  74 . HN   1 1 
       303 1 2 1 1  75 VAL H    .  75 . HN   1 1 
       304 1 1 1 1  74 GLU H    .  74 . HN   1 1 
       304 1 2 1 1  75 VAL MG1  .  75 . HG1* 1 1 
       305 1 1 1 1  74 GLU H    .  74 . HN   1 1 
       305 1 2 1 1  75 VAL MG2  .  75 . HG2* 1 1 
       306 1 1 1 1  75 VAL H    .  75 . HN   1 1 
       306 1 2 1 1  75 VAL MG1  .  75 . HG1* 1 1 
       307 1 1 1 1  75 VAL H    .  75 . HN   1 1 
       307 1 2 1 1  75 VAL MG2  .  75 . HG2* 1 1 
       308 1 1 1 1  75 VAL H    .  75 . HN   1 1 
       308 1 2 1 1  76 GLU H    .  76 . HN   1 1 
       309 1 1 1 1  75 VAL H    .  75 . HN   1 1 
       309 1 2 1 1  99 LEU QD   .  99 . HD1* 1 1 
       310 1 1 1 1  75 VAL MG1  .  75 . HG1* 1 1 
       310 1 2 1 1  76 GLU H    .  76 . HN   1 1 
       311 1 1 1 1  75 VAL MG1  .  75 . HG1* 1 1 
       311 1 2 1 1  77 GLU H    .  77 . HN   1 1 
       312 1 1 1 1  75 VAL MG1  .  75 . HG1* 1 1 
       312 1 2 1 1  90 VAL MG1  .  90 . HG1* 1 1 
       313 1 1 1 1  75 VAL MG1  .  75 . HG1* 1 1 
       313 1 2 1 1  90 VAL MG2  .  90 . HG2* 1 1 
       314 1 1 1 1  75 VAL MG1  .  75 . HG1* 1 1 
       314 1 2 1 1  91 ARG H    .  91 . HN   1 1 
       315 1 1 1 1  75 VAL MG1  .  75 . HG1* 1 1 
       315 1 2 1 1  99 LEU QD   .  99 . HD1* 1 1 
       316 1 1 1 1  75 VAL MG1  .  75 . HG1* 1 1 
       316 1 2 1 1 102 VAL MG2  . 102 . HG2* 1 1 
       317 1 1 1 1  75 VAL MG2  .  75 . HG2* 1 1 
       317 1 2 1 1  76 GLU H    .  76 . HN   1 1 
       318 1 1 1 1  75 VAL MG2  .  75 . HG2* 1 1 
       318 1 2 1 1  90 VAL MG1  .  90 . HG1* 1 1 
       319 1 1 1 1  75 VAL MG2  .  75 . HG2* 1 1 
       319 1 2 1 1  90 VAL MG2  .  90 . HG2* 1 1 
       320 1 1 1 1  75 VAL MG2  .  75 . HG2* 1 1 
       320 1 2 1 1  99 LEU QD   .  99 . HD1* 1 1 
       321 1 1 1 1  76 GLU H    .  76 . HN   1 1 
       321 1 2 1 1  77 GLU H    .  77 . HN   1 1 
       322 1 1 1 1  76 GLU H    .  76 . HN   1 1 
       322 1 2 1 1  90 VAL MG1  .  90 . HG1* 1 1 
       323 1 1 1 1  76 GLU H    .  76 . HN   1 1 
       323 1 2 1 1  90 VAL MG2  .  90 . HG2* 1 1 
       324 1 1 1 1  76 GLU H    .  76 . HN   1 1 
       324 1 2 1 1  91 ARG H    .  91 . HN   1 1 
       325 1 1 1 1  76 GLU H    .  76 . HN   1 1 
       325 1 2 1 1  99 LEU QD   .  99 . HD1* 1 1 
       326 1 1 1 1  77 GLU H    .  77 . HN   1 1 
       326 1 2 1 1  78 LYS H    .  78 . HN   1 1 
       327 1 1 1 1  77 GLU H    .  77 . HN   1 1 
       327 1 2 1 1  90 VAL MG1  .  90 . HG1* 1 1 
       328 1 1 1 1  77 GLU H    .  77 . HN   1 1 
       328 1 2 1 1  91 ARG H    .  91 . HN   1 1 
       329 1 1 1 1  78 LYS H    .  78 . HN   1 1 
       329 1 2 1 1  79 LEU H    .  79 . HN   1 1 
       330 1 1 1 1  78 LYS H    .  78 . HN   1 1 
       330 1 2 1 1  89 GLU H    .  89 . HN   1 1 
       331 1 1 1 1  78 LYS H    .  78 . HN   1 1 
       331 1 2 1 1  90 VAL H    .  90 . HN   1 1 
       332 1 1 1 1  78 LYS H    .  78 . HN   1 1 
       332 1 2 1 1  90 VAL MG1  .  90 . HG1* 1 1 
       333 1 1 1 1  78 LYS H    .  78 . HN   1 1 
       333 1 2 1 1  90 VAL MG2  .  90 . HG2* 1 1 
       334 1 1 1 1  78 LYS H    .  78 . HN   1 1 
       334 1 2 1 1  91 ARG H    .  91 . HN   1 1 
       335 1 1 1 1  78 LYS H    .  78 . HN   1 1 
       335 1 2 1 1 102 VAL MG1  . 102 . HG1* 1 1 
       336 1 1 1 1  78 LYS H    .  78 . HN   1 1 
       336 1 2 1 1 102 VAL MG2  . 102 . HG2* 1 1 
       337 1 1 1 1  79 LEU H    .  79 . HN   1 1 
       337 1 2 1 1  79 LEU MD1  .  79 . HD1* 1 1 
       338 1 1 1 1  79 LEU H    .  79 . HN   1 1 
       338 1 2 1 1  79 LEU MD2  .  79 . HD2* 1 1 
       339 1 1 1 1  79 LEU H    .  79 . HN   1 1 
       339 1 2 1 1  80 ASP H    .  80 . HN   1 1 
       340 1 1 1 1  79 LEU H    .  79 . HN   1 1 
       340 1 2 1 1  89 GLU H    .  89 . HN   1 1 
       341 1 1 1 1  79 LEU MD1  .  79 . HD1* 1 1 
       341 1 2 1 1  80 ASP H    .  80 . HN   1 1 
       342 1 1 1 1  79 LEU MD1  .  79 . HD1* 1 1 
       342 1 2 1 1  86 ILE MD   .  86 . HD1* 1 1 
       343 1 1 1 1  79 LEU MD1  .  79 . HD1* 1 1 
       343 1 2 1 1  87 ARG H    .  87 . HN   1 1 
       344 1 1 1 1  79 LEU MD1  .  79 . HD1* 1 1 
       344 1 2 1 1  88 THR H    .  88 . HN   1 1 
       345 1 1 1 1  79 LEU MD1  .  79 . HD1* 1 1 
       345 1 2 1 1  89 GLU H    .  89 . HN   1 1 
       346 1 1 1 1  79 LEU MD2  .  79 . HD2* 1 1 
       346 1 2 1 1  80 ASP H    .  80 . HN   1 1 
       347 1 1 1 1  79 LEU MD2  .  79 . HD2* 1 1 
       347 1 2 1 1  86 ILE MD   .  86 . HD1* 1 1 
       348 1 1 1 1  79 LEU MD2  .  79 . HD2* 1 1 
       348 1 2 1 1  87 ARG H    .  87 . HN   1 1 
       349 1 1 1 1  80 ASP H    .  80 . HN   1 1 
       349 1 2 1 1  81 THR H    .  81 . HN   1 1 
       350 1 1 1 1  80 ASP H    .  80 . HN   1 1 
       350 1 2 1 1  86 ILE MD   .  86 . HD1* 1 1 
       351 1 1 1 1  80 ASP H    .  80 . HN   1 1 
       351 1 2 1 1  87 ARG H    .  87 . HN   1 1 
       352 1 1 1 1  80 ASP H    .  80 . HN   1 1 
       352 1 2 1 1  88 THR H    .  88 . HN   1 1 
       353 1 1 1 1  80 ASP H    .  80 . HN   1 1 
       353 1 2 1 1  89 GLU H    .  89 . HN   1 1 
       354 1 1 1 1  81 THR H    .  81 . HN   1 1 
       354 1 2 1 1  82 SER H    .  82 . HN   1 1 
       355 1 1 1 1  82 SER H    .  82 . HN   1 1 
       355 1 2 1 1  83 HIS H    .  83 . HN   1 1 
       356 1 1 1 1  83 HIS H    .  83 . HN   1 1 
       356 1 2 1 1  84 GLY H    .  84 . HN   1 1 
       357 1 1 1 1  83 HIS H    .  83 . HN   1 1 
       357 1 2 1 1  85 MET H    .  85 . HN   1 1 
       358 1 1 1 1  84 GLY H    .  84 . HN   1 1 
       358 1 2 1 1  85 MET H    .  85 . HN   1 1 
       359 1 1 1 1  85 MET H    .  85 . HN   1 1 
       359 1 2 1 1  86 ILE H    .  86 . HN   1 1 
       360 1 1 1 1  86 ILE H    .  86 . HN   1 1 
       360 1 2 1 1  86 ILE MD   .  86 . HD1* 1 1 
       361 1 1 1 1  86 ILE H    .  86 . HN   1 1 
       361 1 2 1 1  87 ARG H    .  87 . HN   1 1 
       362 1 1 1 1  86 ILE MD   .  86 . HD1* 1 1 
       362 1 2 1 1  87 ARG H    .  87 . HN   1 1 
       363 1 1 1 1  87 ARG H    .  87 . HN   1 1 
       363 1 2 1 1  88 THR H    .  88 . HN   1 1 
       364 1 1 1 1  88 THR H    .  88 . HN   1 1 
       364 1 2 1 1  89 GLU H    .  89 . HN   1 1 
       365 1 1 1 1  88 THR H    .  88 . HN   1 1 
       365 1 2 1 1 102 VAL H    . 102 . HN   1 1 
       366 1 1 1 1  88 THR H    .  88 . HN   1 1 
       366 1 2 1 1 102 VAL MG1  . 102 . HG1* 1 1 
       367 1 1 1 1  88 THR H    .  88 . HN   1 1 
       367 1 2 1 1 102 VAL MG2  . 102 . HG2* 1 1 
       368 1 1 1 1  88 THR H    .  88 . HN   1 1 
       368 1 2 1 1 112 LEU QD   . 112 . HD2* 1 1 
       369 1 1 1 1  89 GLU H    .  89 . HN   1 1 
       369 1 2 1 1  90 VAL H    .  90 . HN   1 1 
       370 1 1 1 1  89 GLU H    .  89 . HN   1 1 
       370 1 2 1 1  90 VAL MG1  .  90 . HG1* 1 1 
       371 1 1 1 1  89 GLU H    .  89 . HN   1 1 
       371 1 2 1 1 102 VAL H    . 102 . HN   1 1 
       372 1 1 1 1  89 GLU H    .  89 . HN   1 1 
       372 1 2 1 1 102 VAL MG1  . 102 . HG1* 1 1 
       373 1 1 1 1  89 GLU H    .  89 . HN   1 1 
       373 1 2 1 1 102 VAL MG2  . 102 . HG2* 1 1 
       374 1 1 1 1  90 VAL H    .  90 . HN   1 1 
       374 1 2 1 1  90 VAL MG1  .  90 . HG1* 1 1 
       375 1 1 1 1  90 VAL H    .  90 . HN   1 1 
       375 1 2 1 1  90 VAL MG2  .  90 . HG2* 1 1 
       376 1 1 1 1  90 VAL H    .  90 . HN   1 1 
       376 1 2 1 1  91 ARG H    .  91 . HN   1 1 
       377 1 1 1 1  90 VAL H    .  90 . HN   1 1 
       377 1 2 1 1  99 LEU QD   .  99 . HD1* 1 1 
       378 1 1 1 1  90 VAL H    .  90 . HN   1 1 
       378 1 2 1 1 100 GLY H    . 100 . HN   1 1 
       379 1 1 1 1  90 VAL H    .  90 . HN   1 1 
       379 1 2 1 1 101 HIS H    . 101 . HN   1 1 
       380 1 1 1 1  90 VAL H    .  90 . HN   1 1 
       380 1 2 1 1 102 VAL H    . 102 . HN   1 1 
       381 1 1 1 1  90 VAL H    .  90 . HN   1 1 
       381 1 2 1 1 102 VAL MG1  . 102 . HG1* 1 1 
       382 1 1 1 1  90 VAL H    .  90 . HN   1 1 
       382 1 2 1 1 102 VAL MG2  . 102 . HG2* 1 1 
       383 1 1 1 1  90 VAL H    .  90 . HN   1 1 
       383 1 2 1 1 116 ILE MD   . 116 . HD1* 1 1 
       384 1 1 1 1  90 VAL MG1  .  90 . HG1* 1 1 
       384 1 2 1 1  91 ARG H    .  91 . HN   1 1 
       385 1 1 1 1  90 VAL MG1  .  90 . HG1* 1 1 
       385 1 2 1 1  99 LEU QD   .  99 . HD1* 1 1 
       386 1 1 1 1  90 VAL MG1  .  90 . HG1* 1 1 
       386 1 2 1 1 100 GLY H    . 100 . HN   1 1 
       387 1 1 1 1  90 VAL MG1  .  90 . HG1* 1 1 
       387 1 2 1 1 102 VAL H    . 102 . HN   1 1 
       388 1 1 1 1  90 VAL MG1  .  90 . HG1* 1 1 
       388 1 2 1 1 102 VAL MG1  . 102 . HG1* 1 1 
       389 1 1 1 1  90 VAL MG1  .  90 . HG1* 1 1 
       389 1 2 1 1 102 VAL MG2  . 102 . HG2* 1 1 
       390 1 1 1 1  90 VAL MG1  .  90 . HG1* 1 1 
       390 1 2 1 1 112 LEU QD   . 112 . HD1* 1 1 
       391 1 1 1 1  90 VAL MG1  .  90 . HG1* 1 1 
       391 1 2 1 1 115 CYS H    . 115 . HN   1 1 
       392 1 1 1 1  90 VAL MG1  .  90 . HG1* 1 1 
       392 1 2 1 1 116 ILE MD   . 116 . HD1* 1 1 
       393 1 1 1 1  90 VAL MG2  .  90 . HG2* 1 1 
       393 1 2 1 1  91 ARG H    .  91 . HN   1 1 
       394 1 1 1 1  90 VAL MG2  .  90 . HG2* 1 1 
       394 1 2 1 1  99 LEU H    .  99 . HN   1 1 
       395 1 1 1 1  90 VAL MG2  .  90 . HG2* 1 1 
       395 1 2 1 1  99 LEU QD   .  99 . HD1* 1 1 
       396 1 1 1 1  90 VAL MG2  .  90 . HG2* 1 1 
       396 1 2 1 1 100 GLY H    . 100 . HN   1 1 
       397 1 1 1 1  90 VAL MG2  .  90 . HG2* 1 1 
       397 1 2 1 1 101 HIS H    . 101 . HN   1 1 
       398 1 1 1 1  90 VAL MG2  .  90 . HG2* 1 1 
       398 1 2 1 1 102 VAL H    . 102 . HN   1 1 
       399 1 1 1 1  90 VAL MG2  .  90 . HG2* 1 1 
       399 1 2 1 1 102 VAL MG1  . 102 . HG1* 1 1 
       400 1 1 1 1  90 VAL MG2  .  90 . HG2* 1 1 
       400 1 2 1 1 102 VAL MG2  . 102 . HG2* 1 1 
       401 1 1 1 1  90 VAL MG2  .  90 . HG2* 1 1 
       401 1 2 1 1 115 CYS H    . 115 . HN   1 1 
       402 1 1 1 1  90 VAL MG2  .  90 . HG2* 1 1 
       402 1 2 1 1 116 ILE MD   . 116 . HD1* 1 1 
       403 1 1 1 1  91 ARG H    .  91 . HN   1 1 
       403 1 2 1 1  92 SER H    .  92 . HN   1 1 
       404 1 1 1 1  91 ARG H    .  91 . HN   1 1 
       404 1 2 1 1  99 LEU QD   .  99 . HD1* 1 1 
       405 1 1 1 1  92 SER H    .  92 . HN   1 1 
       405 1 2 1 1  96 ASP H    .  96 . HN   1 1 
       406 1 1 1 1  92 SER H    .  92 . HN   1 1 
       406 1 2 1 1  97 SER H    .  97 . HN   1 1 
       407 1 1 1 1  92 SER H    .  92 . HN   1 1 
       407 1 2 1 1  98 HIS H    .  98 . HN   1 1 
       408 1 1 1 1  92 SER H    .  92 . HN   1 1 
       408 1 2 1 1  99 LEU H    .  99 . HN   1 1 
       409 1 1 1 1  92 SER H    .  92 . HN   1 1 
       409 1 2 1 1  99 LEU QD   .  99 . HD1* 1 1 
       410 1 1 1 1  95 ALA H    .  95 . HN   1 1 
       410 1 2 1 1  96 ASP H    .  96 . HN   1 1 
       411 1 1 1 1  96 ASP H    .  96 . HN   1 1 
       411 1 2 1 1  97 SER H    .  97 . HN   1 1 
       412 1 1 1 1  97 SER H    .  97 . HN   1 1 
       412 1 2 1 1  98 HIS H    .  98 . HN   1 1 
       413 1 1 1 1  98 HIS H    .  98 . HN   1 1 
       413 1 2 1 1  99 LEU H    .  99 . HN   1 1 
       414 1 1 1 1  98 HIS H    .  98 . HN   1 1 
       414 1 2 1 1  99 LEU QD   .  99 . HD2* 1 1 
       415 1 1 1 1  99 LEU H    .  99 . HN   1 1 
       415 1 2 1 1  99 LEU QD   .  99 . HD2* 1 1 
       416 1 1 1 1  99 LEU H    .  99 . HN   1 1 
       416 1 2 1 1 100 GLY H    . 100 . HN   1 1 
       417 1 1 1 1  99 LEU H    .  99 . HN   1 1 
       417 1 2 1 1 116 ILE MD   . 116 . HD1* 1 1 
       418 1 1 1 1  99 LEU QD   .  99 . HD1* 1 1 
       418 1 2 1 1 100 GLY H    . 100 . HN   1 1 
       419 1 1 1 1  99 LEU QD   .  99 . HD2* 1 1 
       419 1 2 1 1 116 ILE MD   . 116 . HD1* 1 1 
       420 1 1 1 1  99 LEU QD   .  99 . HD2* 1 1 
       420 1 2 1 1 121 LEU MD2  . 121 . HD2* 1 1 
       421 1 1 1 1 100 GLY H    . 100 . HN   1 1 
       421 1 2 1 1 101 HIS H    . 101 . HN   1 1 
       422 1 1 1 1 100 GLY H    . 100 . HN   1 1 
       422 1 2 1 1 116 ILE MD   . 116 . HD1* 1 1 
       423 1 1 1 1 101 HIS H    . 101 . HN   1 1 
       423 1 2 1 1 102 VAL H    . 102 . HN   1 1 
       424 1 1 1 1 101 HIS H    . 101 . HN   1 1 
       424 1 2 1 1 102 VAL MG1  . 102 . HG1* 1 1 
       425 1 1 1 1 101 HIS H    . 101 . HN   1 1 
       425 1 2 1 1 115 CYS H    . 115 . HN   1 1 
       426 1 1 1 1 101 HIS H    . 101 . HN   1 1 
       426 1 2 1 1 116 ILE MD   . 116 . HD1* 1 1 
       427 1 1 1 1 101 HIS H    . 101 . HN   1 1 
       427 1 2 1 1 117 ASN H    . 117 . HN   1 1 
       428 1 1 1 1 102 VAL H    . 102 . HN   1 1 
       428 1 2 1 1 102 VAL MG1  . 102 . HG1* 1 1 
       429 1 1 1 1 102 VAL H    . 102 . HN   1 1 
       429 1 2 1 1 102 VAL MG2  . 102 . HG2* 1 1 
       430 1 1 1 1 102 VAL H    . 102 . HN   1 1 
       430 1 2 1 1 103 PHE H    . 103 . HN   1 1 
       431 1 1 1 1 102 VAL H    . 102 . HN   1 1 
       431 1 2 1 1 112 LEU QD   . 112 . HD2* 1 1 
       432 1 1 1 1 102 VAL MG1  . 102 . HG1* 1 1 
       432 1 2 1 1 103 PHE H    . 103 . HN   1 1 
       433 1 1 1 1 102 VAL MG1  . 102 . HG1* 1 1 
       433 1 2 1 1 112 LEU QD   . 112 . HD1* 1 1 
       434 1 1 1 1 102 VAL MG1  . 102 . HG1* 1 1 
       434 1 2 1 1 113 ARG H    . 113 . HN   1 1 
       435 1 1 1 1 102 VAL MG1  . 102 . HG1* 1 1 
       435 1 2 1 1 115 CYS H    . 115 . HN   1 1 
       436 1 1 1 1 102 VAL MG2  . 102 . HG2* 1 1 
       436 1 2 1 1 103 PHE H    . 103 . HN   1 1 
       437 1 1 1 1 102 VAL MG2  . 102 . HG2* 1 1 
       437 1 2 1 1 112 LEU QD   . 112 . HD1* 1 1 
       438 1 1 1 1 102 VAL MG2  . 102 . HG2* 1 1 
       438 1 2 1 1 113 ARG H    . 113 . HN   1 1 
       439 1 1 1 1 102 VAL MG2  . 102 . HG2* 1 1 
       439 1 2 1 1 114 TYR H    . 114 . HN   1 1 
       440 1 1 1 1 102 VAL MG2  . 102 . HG2* 1 1 
       440 1 2 1 1 115 CYS H    . 115 . HN   1 1 
       441 1 1 1 1 103 PHE H    . 103 . HN   1 1 
       441 1 2 1 1 105 ASP H    . 105 . HN   1 1 
       442 1 1 1 1 103 PHE H    . 103 . HN   1 1 
       442 1 2 1 1 106 GLY H    . 106 . HN   1 1 
       443 1 1 1 1 103 PHE H    . 103 . HN   1 1 
       443 1 2 1 1 112 LEU QD   . 112 . HD2* 1 1 
       444 1 1 1 1 103 PHE H    . 103 . HN   1 1 
       444 1 2 1 1 113 ARG H    . 113 . HN   1 1 
       445 1 1 1 1 103 PHE H    . 103 . HN   1 1 
       445 1 2 1 1 114 TYR H    . 114 . HN   1 1 
       446 1 1 1 1 103 PHE H    . 103 . HN   1 1 
       446 1 2 1 1 115 CYS H    . 115 . HN   1 1 
       447 1 1 1 1 104 ASN H    . 104 . HN   1 1 
       447 1 2 1 1 105 ASP H    . 105 . HN   1 1 
       448 1 1 1 1 104 ASN H    . 104 . HN   1 1 
       448 1 2 1 1 106 GLY H    . 106 . HN   1 1 
       449 1 1 1 1 104 ASN H    . 104 . HN   1 1 
       449 1 2 1 1 112 LEU QD   . 112 . HD2* 1 1 
       450 1 1 1 1 104 ASN H    . 104 . HN   1 1 
       450 1 2 1 1 113 ARG H    . 113 . HN   1 1 
       451 1 1 1 1 104 ASN QD   . 104 . HD2* 1 1 
       451 1 2 1 1 112 LEU QD   . 112 . HD1* 1 1 
       452 1 1 1 1 104 ASN HD21 . 104 . HD21 1 1 
       452 1 2 1 1 112 LEU QD   . 112 . HD2* 1 1 
       453 1 1 1 1 104 ASN HD22 . 104 . HD22 1 1 
       453 1 2 1 1 112 LEU QD   . 112 . HD2* 1 1 
       454 1 1 1 1 105 ASP H    . 105 . HN   1 1 
       454 1 2 1 1 106 GLY H    . 106 . HN   1 1 
       455 1 1 1 1 105 ASP H    . 105 . HN   1 1 
       455 1 2 1 1 112 LEU QD   . 112 . HD2* 1 1 
       456 1 1 1 1 105 ASP H    . 105 . HN   1 1 
       456 1 2 1 1 113 ARG H    . 113 . HN   1 1 
       457 1 1 1 1 106 GLY H    . 106 . HN   1 1 
       457 1 2 1 1 112 LEU QD   . 112 . HD2* 1 1 
       458 1 1 1 1 106 GLY H    . 106 . HN   1 1 
       458 1 2 1 1 113 ARG H    . 113 . HN   1 1 
       459 1 1 1 1 108 GLY H    . 108 . HN   1 1 
       459 1 2 1 1 111 GLY H    . 111 . HN   1 1 
       460 1 1 1 1 108 GLY H    . 108 . HN   1 1 
       460 1 2 1 1 112 LEU H    . 112 . HN   1 1 
       461 1 1 1 1 110 ASN H    . 110 . HN   1 1 
       461 1 2 1 1 111 GLY H    . 111 . HN   1 1 
       462 1 1 1 1 110 ASN QD   . 110 . HD2* 1 1 
       462 1 2 1 1 112 LEU H    . 112 . HN   1 1 
       463 1 1 1 1 110 ASN QD   . 110 . HD2* 1 1 
       463 1 2 1 1 112 LEU QD   . 112 . HD1* 1 1 
       464 1 1 1 1 110 ASN HD21 . 110 . HD21 1 1 
       464 1 2 1 1 112 LEU H    . 112 . HN   1 1 
       465 1 1 1 1 110 ASN HD21 . 110 . HD21 1 1 
       465 1 2 1 1 112 LEU QD   . 112 . HD1* 1 1 
       466 1 1 1 1 110 ASN HD22 . 110 . HD22 1 1 
       466 1 2 1 1 112 LEU H    . 112 . HN   1 1 
       467 1 1 1 1 110 ASN HD22 . 110 . HD22 1 1 
       467 1 2 1 1 112 LEU QD   . 112 . HD1* 1 1 
       468 1 1 1 1 111 GLY H    . 111 . HN   1 1 
       468 1 2 1 1 112 LEU H    . 112 . HN   1 1 
       469 1 1 1 1 111 GLY H    . 111 . HN   1 1 
       469 1 2 1 1 112 LEU QD   . 112 . HD2* 1 1 
       470 1 1 1 1 112 LEU H    . 112 . HN   1 1 
       470 1 2 1 1 112 LEU QD   . 112 . HD1* 1 1 
       471 1 1 1 1 112 LEU H    . 112 . HN   1 1 
       471 1 2 1 1 113 ARG H    . 113 . HN   1 1 
       472 1 1 1 1 112 LEU QD   . 112 . HD1* 1 1 
       472 1 2 1 1 113 ARG H    . 113 . HN   1 1 
       473 1 1 1 1 113 ARG H    . 113 . HN   1 1 
       473 1 2 1 1 114 TYR H    . 114 . HN   1 1 
       474 1 1 1 1 114 TYR H    . 114 . HN   1 1 
       474 1 2 1 1 115 CYS H    . 115 . HN   1 1 
       475 1 1 1 1 115 CYS H    . 115 . HN   1 1 
       475 1 2 1 1 116 ILE H    . 116 . HN   1 1 
       476 1 1 1 1 115 CYS H    . 115 . HN   1 1 
       476 1 2 1 1 116 ILE MD   . 116 . HD1* 1 1 
       477 1 1 1 1 116 ILE H    . 116 . HN   1 1 
       477 1 2 1 1 116 ILE MD   . 116 . HD1* 1 1 
       478 1 1 1 1 116 ILE H    . 116 . HN   1 1 
       478 1 2 1 1 121 LEU MD1  . 121 . HD1* 1 1 
       479 1 1 1 1 116 ILE MD   . 116 . HD1* 1 1 
       479 1 2 1 1 117 ASN H    . 117 . HN   1 1 
       480 1 1 1 1 116 ILE MD   . 116 . HD1* 1 1 
       480 1 2 1 1 121 LEU MD2  . 121 . HD2* 1 1 
       481 1 1 1 1 117 ASN H    . 117 . HN   1 1 
       481 1 2 1 1 117 ASN HD21 . 117 . HD21 1 1 
       482 1 1 1 1 117 ASN H    . 117 . HN   1 1 
       482 1 2 1 1 117 ASN QD   . 117 . HD2* 1 1 
       483 1 1 1 1 117 ASN H    . 117 . HN   1 1 
       483 1 2 1 1 117 ASN HD22 . 117 . HD22 1 1 
       484 1 1 1 1 117 ASN H    . 117 . HN   1 1 
       484 1 2 1 1 121 LEU MD1  . 121 . HD1* 1 1 
       485 1 1 1 1 117 ASN H    . 117 . HN   1 1 
       485 1 2 1 1 121 LEU MD2  . 121 . HD2* 1 1 
       486 1 1 1 1 118 SER H    . 118 . HN   1 1 
       486 1 2 1 1 119 ALA H    . 119 . HN   1 1 
       487 1 1 1 1 118 SER H    . 118 . HN   1 1 
       487 1 2 1 1 120 ALA H    . 120 . HN   1 1 
       488 1 1 1 1 118 SER HG   . 118 . HG   1 1 
       488 1 2 1 1 119 ALA H    . 119 . HN   1 1 
       489 1 1 1 1 119 ALA H    . 119 . HN   1 1 
       489 1 2 1 1 120 ALA H    . 120 . HN   1 1 
       490 1 1 1 1 119 ALA H    . 119 . HN   1 1 
       490 1 2 1 1 121 LEU H    . 121 . HN   1 1 
       491 1 1 1 1 120 ALA H    . 120 . HN   1 1 
       491 1 2 1 1 121 LEU H    . 121 . HN   1 1 
       492 1 1 1 1 120 ALA H    . 120 . HN   1 1 
       492 1 2 1 1 121 LEU MD1  . 121 . HD1* 1 1 
       493 1 1 1 1 120 ALA H    . 120 . HN   1 1 
       493 1 2 1 1 121 LEU MD2  . 121 . HD2* 1 1 
       494 1 1 1 1 121 LEU H    . 121 . HN   1 1 
       494 1 2 1 1 121 LEU MD1  . 121 . HD1* 1 1 
       495 1 1 1 1 121 LEU H    . 121 . HN   1 1 
       495 1 2 1 1 121 LEU MD2  . 121 . HD2* 1 1 
       496 1 1 1 1 121 LEU H    . 121 . HN   1 1 
       496 1 2 1 1 122 ARG H    . 122 . HN   1 1 
       497 1 1 1 1 121 LEU MD1  . 121 . HD1* 1 1 
       497 1 2 1 1 122 ARG H    . 122 . HN   1 1 
       498 1 1 1 1 121 LEU MD2  . 121 . HD2* 1 1 
       498 1 2 1 1 122 ARG H    . 122 . HN   1 1 
       499 1 1 1 1 122 ARG H    . 122 . HN   1 1 
       499 1 2 1 1 123 PHE H    . 123 . HN   1 1 
       500 1 1 1 1 122 ARG H    . 122 . HN   1 1 
       500 1 2 1 1 124 VAL MG2  . 124 . HG2* 1 1 
       501 1 1 1 1 123 PHE H    . 123 . HN   1 1 
       501 1 2 1 1 124 VAL H    . 124 . HN   1 1 
       502 1 1 1 1 123 PHE H    . 123 . HN   1 1 
       502 1 2 1 1 124 VAL MG2  . 124 . HG2* 1 1 
       503 1 1 1 1 124 VAL H    . 124 . HN   1 1 
       503 1 2 1 1 124 VAL MG1  . 124 . HG1* 1 1 
       504 1 1 1 1 124 VAL H    . 124 . HN   1 1 
       504 1 2 1 1 124 VAL MG2  . 124 . HG2* 1 1 
       505 1 1 1 1 124 VAL H    . 124 . HN   1 1 
       505 1 2 1 1 129 LEU MD1  . 129 . HD1* 1 1 
       506 1 1 1 1 124 VAL H    . 124 . HN   1 1 
       506 1 2 1 1 129 LEU MD2  . 129 . HD2* 1 1 
       507 1 1 1 1 124 VAL MG1  . 124 . HG1* 1 1 
       507 1 2 1 1 127 HIS H    . 127 . HN   1 1 
       508 1 1 1 1 124 VAL MG1  . 124 . HG1* 1 1 
       508 1 2 1 1 128 LYS H    . 128 . HN   1 1 
       509 1 1 1 1 124 VAL MG1  . 124 . HG1* 1 1 
       509 1 2 1 1 129 LEU H    . 129 . HN   1 1 
       510 1 1 1 1 124 VAL MG1  . 124 . HG1* 1 1 
       510 1 2 1 1 129 LEU MD1  . 129 . HD1* 1 1 
       511 1 1 1 1 124 VAL MG1  . 124 . HG1* 1 1 
       511 1 2 1 1 129 LEU MD2  . 129 . HD2* 1 1 
       512 1 1 1 1 124 VAL MG1  . 124 . HG1* 1 1 
       512 1 2 1 1 131 GLU H    . 131 . HN   1 1 
       513 1 1 1 1 124 VAL MG1  . 124 . HG1* 1 1 
       513 1 2 1 1 132 GLU H    . 132 . HN   1 1 
       514 1 1 1 1 124 VAL MG1  . 124 . HG1* 1 1 
       514 1 2 1 1 138 LEU MD1  . 138 . HD1* 1 1 
       515 1 1 1 1 124 VAL MG2  . 124 . HG2* 1 1 
       515 1 2 1 1 129 LEU MD2  . 129 . HD2* 1 1 
       516 1 1 1 1 126 LYS H    . 126 . HN   1 1 
       516 1 2 1 1 127 HIS H    . 127 . HN   1 1 
       517 1 1 1 1 126 LYS H    . 126 . HN   1 1 
       517 1 2 1 1 128 LYS H    . 128 . HN   1 1 
       518 1 1 1 1 126 LYS H    . 126 . HN   1 1 
       518 1 2 1 1 129 LEU H    . 129 . HN   1 1 
       519 1 1 1 1 126 LYS H    . 126 . HN   1 1 
       519 1 2 1 1 129 LEU MD1  . 129 . HD1* 1 1 
       520 1 1 1 1 126 LYS H    . 126 . HN   1 1 
       520 1 2 1 1 129 LEU MD2  . 129 . HD2* 1 1 
       521 1 1 1 1 127 HIS H    . 127 . HN   1 1 
       521 1 2 1 1 128 LYS H    . 128 . HN   1 1 
       522 1 1 1 1 127 HIS H    . 127 . HN   1 1 
       522 1 2 1 1 129 LEU H    . 129 . HN   1 1 
       523 1 1 1 1 127 HIS H    . 127 . HN   1 1 
       523 1 2 1 1 129 LEU MD1  . 129 . HD1* 1 1 
       524 1 1 1 1 127 HIS H    . 127 . HN   1 1 
       524 1 2 1 1 129 LEU MD2  . 129 . HD2* 1 1 
       525 1 1 1 1 128 LYS H    . 128 . HN   1 1 
       525 1 2 1 1 129 LEU H    . 129 . HN   1 1 
       526 1 1 1 1 128 LYS H    . 128 . HN   1 1 
       526 1 2 1 1 129 LEU MD1  . 129 . HD1* 1 1 
       527 1 1 1 1 128 LYS H    . 128 . HN   1 1 
       527 1 2 1 1 129 LEU MD2  . 129 . HD2* 1 1 
       528 1 1 1 1 128 LYS H    . 128 . HN   1 1 
       528 1 2 1 1 130 LYS H    . 130 . HN   1 1 
       529 1 1 1 1 129 LEU H    . 129 . HN   1 1 
       529 1 2 1 1 129 LEU MD1  . 129 . HD1* 1 1 
       530 1 1 1 1 129 LEU H    . 129 . HN   1 1 
       530 1 2 1 1 129 LEU MD2  . 129 . HD2* 1 1 
       531 1 1 1 1 129 LEU H    . 129 . HN   1 1 
       531 1 2 1 1 130 LYS H    . 130 . HN   1 1 
       532 1 1 1 1 129 LEU H    . 129 . HN   1 1 
       532 1 2 1 1 131 GLU H    . 131 . HN   1 1 
       533 1 1 1 1 129 LEU H    . 129 . HN   1 1 
       533 1 2 1 1 132 GLU H    . 132 . HN   1 1 
       534 1 1 1 1 129 LEU H    . 129 . HN   1 1 
       534 1 2 1 1 138 LEU MD1  . 138 . HD1* 1 1 
       535 1 1 1 1 129 LEU H    . 129 . HN   1 1 
       535 1 2 1 1 138 LEU MD2  . 138 . HD2* 1 1 
       536 1 1 1 1 129 LEU MD1  . 129 . HD1* 1 1 
       536 1 2 1 1 130 LYS H    . 130 . HN   1 1 
       537 1 1 1 1 129 LEU MD1  . 129 . HD1* 1 1 
       537 1 2 1 1 134 TYR H    . 134 . HN   1 1 
       538 1 1 1 1 129 LEU MD1  . 129 . HD1* 1 1 
       538 1 2 1 1 137 TYR H    . 137 . HN   1 1 
       539 1 1 1 1 129 LEU MD1  . 129 . HD1* 1 1 
       539 1 2 1 1 138 LEU H    . 138 . HN   1 1 
       540 1 1 1 1 129 LEU MD1  . 129 . HD1* 1 1 
       540 1 2 1 1 138 LEU MD1  . 138 . HD1* 1 1 
       541 1 1 1 1 129 LEU MD1  . 129 . HD1* 1 1 
       541 1 2 1 1 138 LEU MD2  . 138 . HD2* 1 1 
       542 1 1 1 1 129 LEU MD2  . 129 . HD2* 1 1 
       542 1 2 1 1 130 LYS H    . 130 . HN   1 1 
       543 1 1 1 1 129 LEU MD2  . 129 . HD2* 1 1 
       543 1 2 1 1 131 GLU H    . 131 . HN   1 1 
       544 1 1 1 1 129 LEU MD2  . 129 . HD2* 1 1 
       544 1 2 1 1 132 GLU H    . 132 . HN   1 1 
       545 1 1 1 1 129 LEU MD2  . 129 . HD2* 1 1 
       545 1 2 1 1 134 TYR H    . 134 . HN   1 1 
       546 1 1 1 1 129 LEU MD2  . 129 . HD2* 1 1 
       546 1 2 1 1 137 TYR H    . 137 . HN   1 1 
       547 1 1 1 1 129 LEU MD2  . 129 . HD2* 1 1 
       547 1 2 1 1 138 LEU H    . 138 . HN   1 1 
       548 1 1 1 1 129 LEU MD2  . 129 . HD2* 1 1 
       548 1 2 1 1 138 LEU MD1  . 138 . HD1* 1 1 
       549 1 1 1 1 129 LEU MD2  . 129 . HD2* 1 1 
       549 1 2 1 1 138 LEU MD2  . 138 . HD2* 1 1 
       550 1 1 1 1 130 LYS H    . 130 . HN   1 1 
       550 1 2 1 1 131 GLU H    . 131 . HN   1 1 
       551 1 1 1 1 130 LYS H    . 130 . HN   1 1 
       551 1 2 1 1 132 GLU H    . 132 . HN   1 1 
       552 1 1 1 1 130 LYS H    . 130 . HN   1 1 
       552 1 2 1 1 133 GLY H    . 133 . HN   1 1 
       553 1 1 1 1 130 LYS H    . 130 . HN   1 1 
       553 1 2 1 1 134 TYR H    . 134 . HN   1 1 
       554 1 1 1 1 130 LYS H    . 130 . HN   1 1 
       554 1 2 1 1 138 LEU MD1  . 138 . HD1* 1 1 
       555 1 1 1 1 130 LYS H    . 130 . HN   1 1 
       555 1 2 1 1 138 LEU MD2  . 138 . HD2* 1 1 
       556 1 1 1 1 131 GLU H    . 131 . HN   1 1 
       556 1 2 1 1 132 GLU H    . 132 . HN   1 1 
       557 1 1 1 1 131 GLU H    . 131 . HN   1 1 
       557 1 2 1 1 133 GLY H    . 133 . HN   1 1 
       558 1 1 1 1 131 GLU H    . 131 . HN   1 1 
       558 1 2 1 1 134 TYR H    . 134 . HN   1 1 
       559 1 1 1 1 132 GLU H    . 132 . HN   1 1 
       559 1 2 1 1 133 GLY H    . 133 . HN   1 1 
       560 1 1 1 1 132 GLU H    . 132 . HN   1 1 
       560 1 2 1 1 134 TYR H    . 134 . HN   1 1 
       561 1 1 1 1 132 GLU H    . 132 . HN   1 1 
       561 1 2 1 1 138 LEU MD1  . 138 . HD1* 1 1 
       562 1 1 1 1 133 GLY H    . 133 . HN   1 1 
       562 1 2 1 1 134 TYR H    . 134 . HN   1 1 
       563 1 1 1 1 133 GLY H    . 133 . HN   1 1 
       563 1 2 1 1 135 GLU H    . 135 . HN   1 1 
       564 1 1 1 1 134 TYR H    . 134 . HN   1 1 
       564 1 2 1 1 135 GLU H    . 135 . HN   1 1 
       565 1 1 1 1 134 TYR H    . 134 . HN   1 1 
       565 1 2 1 1 138 LEU MD1  . 138 . HD1* 1 1 
       566 1 1 1 1 134 TYR H    . 134 . HN   1 1 
       566 1 2 1 1 138 LEU MD2  . 138 . HD2* 1 1 
       567 1 1 1 1 135 GLU H    . 135 . HN   1 1 
       567 1 2 1 1 137 TYR H    . 137 . HN   1 1 
       568 1 1 1 1 135 GLU H    . 135 . HN   1 1 
       568 1 2 1 1 138 LEU H    . 138 . HN   1 1 
       569 1 1 1 1 135 GLU H    . 135 . HN   1 1 
       569 1 2 1 1 138 LEU MD1  . 138 . HD1* 1 1 
       570 1 1 1 1 135 GLU H    . 135 . HN   1 1 
       570 1 2 1 1 138 LEU MD2  . 138 . HD2* 1 1 
       571 1 1 1 1 137 TYR H    . 137 . HN   1 1 
       571 1 2 1 1 138 LEU H    . 138 . HN   1 1 
       572 1 1 1 1 137 TYR H    . 137 . HN   1 1 
       572 1 2 1 1 138 LEU MD1  . 138 . HD1* 1 1 
       573 1 1 1 1 138 LEU H    . 138 . HN   1 1 
       573 1 2 1 1 138 LEU MD1  . 138 . HD1* 1 1 
       574 1 1 1 1 138 LEU H    . 138 . HN   1 1 
       574 1 2 1 1 138 LEU MD2  . 138 . HD2* 1 1 
       575 1 1 1 1 138 LEU H    . 138 . HN   1 1 
       575 1 2 1 1 140 LEU H    . 140 . HN   1 1 
       576 1 1 1 1 138 LEU MD1  . 138 . HD1* 1 1 
       576 1 2 1 1 140 LEU H    . 140 . HN   1 1 
       577 1 1 1 1 138 LEU MD1  . 138 . HD1* 1 1 
       577 1 2 1 1 141 PHE H    . 141 . HN   1 1 
       578 1 1 1 1 140 LEU H    . 140 . HN   1 1 
       578 1 2 1 1 140 LEU MD1  . 140 . HD1* 1 1 
       579 1 1 1 1 140 LEU H    . 140 . HN   1 1 
       579 1 2 1 1 140 LEU MD2  . 140 . HD2* 1 1 
       580 1 1 1 1 140 LEU H    . 140 . HN   1 1 
       580 1 2 1 1 141 PHE H    . 141 . HN   1 1 
       581 1 1 1 1 140 LEU H    . 140 . HN   1 1 
       581 1 2 1 1 142 ASN H    . 142 . HN   1 1 
       582 1 1 1 1 140 LEU MD1  . 140 . HD1* 1 1 
       582 1 2 1 1 141 PHE H    . 141 . HN   1 1 
       583 1 1 1 1 140 LEU MD2  . 140 . HD2* 1 1 
       583 1 2 1 1 141 PHE H    . 141 . HN   1 1 
       584 1 1 1 1 141 PHE H    . 141 . HN   1 1 
       584 1 2 1 1 142 ASN H    . 142 . HN   1 1 
       585 1 1 1 1 142 ASN H    . 142 . HN   1 1 
       585 1 2 1 1 142 ASN QD   . 142 . HD2* 1 1 
       586 1 1 1 1 142 ASN QD   . 142 . HD2* 1 1 
       586 1 2 1 1 144 LEU QD   . 144 . HD*  1 1 
       587 1 1 1 1 144 LEU H    . 144 . HN   1 1 
       587 1 2 1 1 144 LEU QD   . 144 . HD*  1 1 
       588 1 1 1 1 144 LEU H    . 144 . HN   1 1 
       588 1 2 1 1 145 GLU H    . 145 . HN   1 1 
       589 1 1 1 1 144 LEU QD   . 144 . HD*  1 1 
       589 1 2 1 1 145 GLU H    . 145 . HN   1 1 
       590 1 1 1 1 144 LEU MD1  . 144 . HD1* 1 1 
       590 1 2 1 1 145 GLU H    . 145 . HN   1 1 
       591 1 1 1 1 144 LEU MD2  . 144 . HD2* 1 1 
       591 1 2 1 1 145 GLU H    . 145 . HN   1 1 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

         1 1 . . . . . 3.91 1.8 3.91 1 1 
         2 1 . . . . . 4.57 1.8 4.57 1 1 
         3 1 . . . . . 3.33 1.8 3.33 1 1 
         4 1 . . . . . 4.19 1.8 4.19 1 1 
         5 1 . . . . . 5.05 1.8 5.05 1 1 
         6 1 . . . . . 3.28 1.8 3.28 1 1 
         7 1 . . . . . 4.47 1.8 4.47 1 1 
         8 1 . . . . . 3.26 1.8 3.26 1 1 
         9 1 . . . . . 5.27 1.8 5.27 1 1 
        10 1 . . . . . 4.25 1.8 4.25 1 1 
        11 1 . . . . . 5.65 1.8 5.65 1 1 
        12 1 . . . . . 3.66 1.8 3.66 1 1 
        13 1 . . . . . 3.31 1.8 3.31 1 1 
        14 1 . . . . . 4.86 1.8 4.86 1 1 
        15 1 . . . . . 4.94 1.8 4.94 1 1 
        16 1 . . . . . 4.56 1.8 4.56 1 1 
        17 1 . . . . . 4.67 1.8 4.67 1 1 
        18 1 . . . . . 4.42 1.8 4.42 1 1 
        19 1 . . . . . 3.71 1.8 3.71 1 1 
        20 1 . . . . . 3.85 1.8 3.85 1 1 
        21 1 . . . . . 4.36 1.8 4.36 1 1 
        22 1 . . . . . 5.46 1.8 5.46 1 1 
        23 1 . . . . . 3.53 1.8 3.53 1 1 
        24 1 . . . . . 4.17 1.8 4.17 1 1 
        25 1 . . . . . 5.93 1.8 5.93 1 1 
        26 1 . . . . . 5.05 1.8 5.05 1 1 
        27 1 . . . . . 3.14 1.8 3.14 1 1 
        28 1 . . . . .  6.0 1.8  6.0 1 1 
        29 1 . . . . . 5.61 1.8 5.61 1 1 
        30 1 . . . . . 4.45 1.8 4.45 1 1 
        31 1 . . . . . 4.44 1.8 4.44 1 1 
        32 1 . . . . . 4.46 1.8 4.46 1 1 
        33 1 . . . . . 5.26 1.8 5.26 1 1 
        34 1 . . . . . 5.04 1.8 5.04 1 1 
        35 1 . . . . . 4.62 1.8 4.62 1 1 
        36 1 . . . . . 5.86 1.8 5.86 1 1 
        37 1 . . . . .  6.0 1.8  6.0 1 1 
        38 1 . . . . .  6.0 1.8  6.0 1 1 
        39 1 . . . . . 4.51 1.8 4.51 1 1 
        40 1 . . . . .  6.0 1.8  6.0 1 1 
        41 1 . . . . . 5.37 1.8 5.37 1 1 
        42 1 . . . . . 5.21 1.8 5.21 1 1 
        43 1 . . . . . 5.58 1.8 5.58 1 1 
        44 1 . . . . . 4.22 1.8 4.22 1 1 
        45 1 . . . . . 4.51 1.8 4.51 1 1 
        46 1 . . . . . 4.73 1.8 4.73 1 1 
        47 1 . . . . .  6.0 1.8  6.0 1 1 
        48 1 . . . . . 5.44 1.8 5.44 1 1 
        49 1 . . . . .    . 1.8  4.0 1 1 
        50 1 . . . . .  4.4 1.8  4.4 1 1 
        51 1 . . . . .  3.2 1.8  3.2 1 1 
        52 1 . . . . . 4.77 1.8 4.77 1 1 
        53 1 . . . . . 5.41 1.8 5.41 1 1 
        54 1 . . . . . 3.93 1.8 3.93 1 1 
        55 1 . . . . . 3.71 1.8 3.71 1 1 
        56 1 . . . . . 4.02 1.8 4.02 1 1 
        57 1 . . . . . 4.49 1.8 4.49 1 1 
        58 1 . . . . . 5.05 1.8 5.05 1 1 
        59 1 . . . . . 3.84 1.8 3.84 1 1 
        60 1 . . . . . 4.85 1.8 4.85 1 1 
        61 1 . . . . . 4.72 1.8 4.72 1 1 
        62 1 . . . . . 3.29 1.8 3.29 1 1 
        63 1 . . . . . 4.19 1.8 4.19 1 1 
        64 1 . . . . . 4.66 1.8 4.66 1 1 
        65 1 . . . . . 5.74 1.8 5.74 1 1 
        66 1 . . . . . 3.51 1.8 3.51 1 1 
        67 1 . . . . . 4.52 1.8 4.52 1 1 
        68 1 . . . . . 4.83 1.8 4.83 1 1 
        69 1 . . . . . 4.84 1.8 4.84 1 1 
        70 1 . . . . . 5.09 1.8 5.09 1 1 
        71 1 . . . . . 3.42 1.8 3.42 1 1 
        72 1 . . . . . 3.88 1.8 3.88 1 1 
        73 1 . . . . . 4.11 1.8 4.11 1 1 
        74 1 . . . . . 4.62 1.8 4.62 1 1 
        75 1 . . . . .  4.6 1.8  4.6 1 1 
        76 1 . . . . . 4.11 1.8 4.11 1 1 
        77 1 . . . . . 4.62 1.8 4.62 1 1 
        78 1 . . . . .  4.6 1.8  4.6 1 1 
        79 1 . . . . . 3.35 1.8 3.35 1 1 
        80 1 . . . . . 3.94 1.8 3.94 1 1 
        81 1 . . . . .  5.1 1.8  5.1 1 1 
        82 1 . . . . . 4.95 1.8 4.95 1 1 
        83 1 . . . . . 3.38 1.8 3.38 1 1 
        84 1 . . . . . 4.96 1.8 4.96 1 1 
        85 1 . . . . . 4.65 1.8 4.65 1 1 
        86 1 . . . . .  3.8 1.8  3.8 1 1 
        87 1 . . . . . 2.82 1.8 2.82 1 1 
        88 1 . . . . . 3.75 1.8 3.75 1 1 
        89 1 . . . . . 3.71 1.8 3.71 1 1 
        90 1 . . . . . 3.69 1.8 3.69 1 1 
        91 1 . . . . . 5.13 1.8 5.13 1 1 
        92 1 . . . . . 4.29 1.8 4.29 1 1 
        93 1 . . . . .  3.8 1.8  3.8 1 1 
        94 1 . . . . . 4.87 1.8 4.87 1 1 
        95 1 . . . . . 4.38 1.8 4.38 1 1 
        96 1 . . . . . 4.48 1.8 4.48 1 1 
        97 1 . . . . . 4.23 1.8 4.23 1 1 
        98 1 . . . . . 4.23 1.8 4.23 1 1 
        99 1 . . . . .  4.2 1.8  4.2 1 1 
       100 1 . . . . . 4.09 1.8 4.09 1 1 
       101 1 . . . . . 3.89 1.8 3.89 1 1 
       102 1 . . . . . 4.38 1.8 4.38 1 1 
       103 1 . . . . . 4.86 1.8 4.86 1 1 
       104 1 . . . . . 3.75 1.8 3.75 1 1 
       105 1 . . . . . 5.57 1.8 5.57 1 1 
       106 1 . . . . . 4.86 1.8 4.86 1 1 
       107 1 . . . . . 4.04 1.8 4.04 1 1 
       108 1 . . . . . 4.77 1.8 4.77 1 1 
       109 1 . . . . . 4.77 1.8 4.77 1 1 
       110 1 . . . . . 3.31 1.8 3.31 1 1 
       111 1 . . . . . 3.71 1.8 3.71 1 1 
       112 1 . . . . .  4.8 1.8  4.8 1 1 
       113 1 . . . . . 4.64 1.8 4.64 1 1 
       114 1 . . . . . 3.47 1.8 3.47 1 1 
       115 1 . . . . . 3.72 1.8 3.72 1 1 
       116 1 . . . . . 5.39 1.8 5.39 1 1 
       117 1 . . . . . 5.27 1.8 5.27 1 1 
       118 1 . . . . .  6.0 1.8  6.0 1 1 
       119 1 . . . . .  6.0 1.8  6.0 1 1 
       120 1 . . . . .  3.4 1.8  3.4 1 1 
       121 1 . . . . . 4.76 1.8 4.76 1 1 
       122 1 . . . . . 4.49 1.8 4.49 1 1 
       123 1 . . . . . 4.95 1.8 4.95 1 1 
       124 1 . . . . . 4.45 1.8 4.45 1 1 
       125 1 . . . . . 4.68 1.8 4.68 1 1 
       126 1 . . . . . 3.63 1.8 3.63 1 1 
       127 1 . . . . . 4.74 1.8 4.74 1 1 
       128 1 . . . . .  4.6 1.8  4.6 1 1 
       129 1 . . . . . 5.03 1.8 5.03 1 1 
       130 1 . . . . . 4.36 1.8 4.36 1 1 
       131 1 . . . . . 4.34 1.8 4.34 1 1 
       132 1 . . . . . 4.55 1.8 4.55 1 1 
       133 1 . . . . . 4.13 1.8 4.13 1 1 
       134 1 . . . . .  6.0 1.8  6.0 1 1 
       135 1 . . . . . 4.21 1.8 4.21 1 1 
       136 1 . . . . . 4.67 1.8 4.67 1 1 
       137 1 . . . . . 3.79 1.8 3.79 1 1 
       138 1 . . . . . 3.78 1.8 3.78 1 1 
       139 1 . . . . . 4.74 1.8 4.74 1 1 
       140 1 . . . . .  4.5 1.8  4.5 1 1 
       141 1 . . . . .    . 1.8  4.0 1 1 
       142 1 . . . . . 4.98 1.8 4.98 1 1 
       143 1 . . . . . 4.22 1.8 4.22 1 1 
       144 1 . . . . . 4.29 1.8 4.29 1 1 
       145 1 . . . . . 4.82 1.8 4.82 1 1 
       146 1 . . . . . 5.41 1.8 5.41 1 1 
       147 1 . . . . . 3.03 1.8 3.03 1 1 
       148 1 . . . . . 4.95 1.8 4.95 1 1 
       149 1 . . . . . 4.56 1.8 4.56 1 1 
       150 1 . . . . .  5.2 1.8  5.2 1 1 
       151 1 . . . . . 3.52 1.8 3.52 1 1 
       152 1 . . . . . 3.92 1.8 3.92 1 1 
       153 1 . . . . . 4.45 1.8 4.45 1 1 
       154 1 . . . . . 3.47 1.8 3.47 1 1 
       155 1 . . . . . 5.33 1.8 5.33 1 1 
       156 1 . . . . . 5.28 1.8 5.28 1 1 
       157 1 . . . . . 5.52 1.8 5.52 1 1 
       158 1 . . . . .    . 1.8  4.0 1 1 
       159 1 . . . . . 5.44 1.8 5.44 1 1 
       160 1 . . . . . 4.91 1.8 4.91 1 1 
       161 1 . . . . . 4.79 1.8 4.79 1 1 
       162 1 . . . . . 3.12 1.8 3.12 1 1 
       163 1 . . . . . 3.06 1.8 3.06 1 1 
       164 1 . . . . . 4.63 1.8 4.63 1 1 
       165 1 . . . . . 3.57 1.8 3.57 1 1 
       166 1 . . . . . 5.87 1.8 5.87 1 1 
       167 1 . . . . .    . 1.8  4.0 1 1 
       168 1 . . . . . 5.77 1.8 5.77 1 1 
       169 1 . . . . . 3.14 1.8 3.14 1 1 
       170 1 . . . . . 4.03 1.8 4.03 1 1 
       171 1 . . . . .    . 1.8  4.5 1 1 
       172 1 . . . . . 3.93 1.8 3.93 1 1 
       173 1 . . . . . 3.68 1.8 3.68 1 1 
       174 1 . . . . . 3.72 1.8 3.72 1 1 
       175 1 . . . . . 3.91 1.8 3.91 1 1 
       176 1 . . . . . 4.38 1.8 4.38 1 1 
       177 1 . . . . . 5.19 1.8 5.19 1 1 
       178 1 . . . . .    . 1.8  4.0 1 1 
       179 1 . . . . . 3.73 1.8 3.73 1 1 
       180 1 . . . . . 4.66 1.8 4.66 1 1 
       181 1 . . . . . 3.66 1.8 3.66 1 1 
       182 1 . . . . . 4.44 1.8 4.44 1 1 
       183 1 . . . . . 5.65 1.8 5.65 1 1 
       184 1 . . . . . 5.27 1.8 5.27 1 1 
       185 1 . . . . . 5.69 1.8 5.69 1 1 
       186 1 . . . . . 2.91 1.8 2.91 1 1 
       187 1 . . . . . 2.94 1.8 2.94 1 1 
       188 1 . . . . .  4.6 1.8  4.6 1 1 
       189 1 . . . . . 5.46 1.8 5.46 1 1 
       190 1 . . . . . 5.22 1.8 5.22 1 1 
       191 1 . . . . . 4.92 1.8 4.92 1 1 
       192 1 . . . . .  3.0 1.8  3.0 1 1 
       193 1 . . . . . 4.96 1.8 4.96 1 1 
       194 1 . . . . . 3.97 1.8 3.97 1 1 
       195 1 . . . . . 4.07 1.8 4.07 1 1 
       196 1 . . . . . 5.09 1.8 5.09 1 1 
       197 1 . . . . . 3.67 1.8 3.67 1 1 
       198 1 . . . . . 4.12 1.8 4.12 1 1 
       199 1 . . . . . 4.64 1.8 4.64 1 1 
       200 1 . . . . . 4.46 1.8 4.46 1 1 
       201 1 . . . . . 4.37 1.8 4.37 1 1 
       202 1 . . . . . 2.88 1.8 2.88 1 1 
       203 1 . . . . .  6.0 1.8  6.0 1 1 
       204 1 . . . . . 4.12 1.8 4.12 1 1 
       205 1 . . . . . 3.62 1.8 3.62 1 1 
       206 1 . . . . . 4.12 1.8 4.12 1 1 
       207 1 . . . . . 4.96 1.8 4.96 1 1 
       208 1 . . . . . 4.42 1.8 4.42 1 1 
       209 1 . . . . . 4.13 1.8 4.13 1 1 
       210 1 . . . . .  5.2 1.8  5.2 1 1 
       211 1 . . . . . 3.41 1.8 3.41 1 1 
       212 1 . . . . .  5.1 1.8  5.1 1 1 
       213 1 . . . . . 3.11 1.8 3.11 1 1 
       214 1 . . . . . 4.88 1.8 4.88 1 1 
       215 1 . . . . . 5.55 1.8 5.55 1 1 
       216 1 . . . . . 4.68 1.8 4.68 1 1 
       217 1 . . . . . 4.74 1.8 4.74 1 1 
       218 1 . . . . . 3.88 1.8 3.88 1 1 
       219 1 . . . . . 4.87 1.8 4.87 1 1 
       220 1 . . . . . 3.39 1.8 3.39 1 1 
       221 1 . . . . . 4.42 1.8 4.42 1 1 
       222 1 . . . . . 5.79 1.8 5.79 1 1 
       223 1 . . . . . 4.75 1.8 4.75 1 1 
       224 1 . . . . . 5.17 1.8 5.17 1 1 
       225 1 . . . . . 4.19 1.8 4.19 1 1 
       226 1 . . . . . 3.83 1.8 3.83 1 1 
       227 1 . . . . . 5.76 1.8 5.76 1 1 
       228 1 . . . . .  4.0 1.8  4.0 1 1 
       229 1 . . . . . 4.78 1.8 4.78 1 1 
       230 1 . . . . . 5.02 1.8 5.02 1 1 
       231 1 . . . . . 4.67 1.8 4.67 1 1 
       232 1 . . . . . 4.24 1.8 4.24 1 1 
       233 1 . . . . . 4.69 1.8 4.69 1 1 
       234 1 . . . . . 4.89 1.8 4.89 1 1 
       235 1 . . . . . 4.71 1.8 4.71 1 1 
       236 1 . . . . . 3.06 1.8 3.06 1 1 
       237 1 . . . . . 3.33 1.8 3.33 1 1 
       238 1 . . . . .  4.0 1.8  4.0 1 1 
       239 1 . . . . . 3.94 1.8 3.94 1 1 
       240 1 . . . . .  6.0 1.8  6.0 1 1 
       241 1 . . . . . 4.17 1.8 4.17 1 1 
       242 1 . . . . . 5.43 1.8 5.43 1 1 
       243 1 . . . . .  3.7 1.8  3.7 1 1 
       244 1 . . . . . 3.79 1.8 3.79 1 1 
       245 1 . . . . .  4.8 1.8  4.8 1 1 
       246 1 . . . . . 4.67 1.8 4.67 1 1 
       247 1 . . . . . 5.96 1.8 5.96 1 1 
       248 1 . . . . . 4.84 1.8 4.84 1 1 
       249 1 . . . . . 4.67 1.8 4.67 1 1 
       250 1 . . . . . 3.59 1.8 3.59 1 1 
       251 1 . . . . . 4.09 1.8 4.09 1 1 
       252 1 . . . . .  4.7 1.8  4.7 1 1 
       253 1 . . . . . 3.67 1.8 3.67 1 1 
       254 1 . . . . . 5.73 1.8 5.73 1 1 
       255 1 . . . . . 5.27 1.8 5.27 1 1 
       256 1 . . . . . 4.37 1.8 4.37 1 1 
       257 1 . . . . . 3.86 1.8 3.86 1 1 
       258 1 . . . . . 3.22 1.8 3.22 1 1 
       259 1 . . . . .  3.6 1.8  3.6 1 1 
       260 1 . . . . .  4.8 1.8  4.8 1 1 
       261 1 . . . . . 3.98 1.8 3.98 1 1 
       262 1 . . . . . 5.78 1.8 5.78 1 1 
       263 1 . . . . . 2.76 1.8 2.76 1 1 
       264 1 . . . . . 4.51 1.8 4.51 1 1 
       265 1 . . . . . 4.66 1.8 4.66 1 1 
       266 1 . . . . . 3.24 1.8 3.24 1 1 
       267 1 . . . . . 4.74 1.8 4.74 1 1 
       268 1 . . . . . 5.02 1.8 5.02 1 1 
       269 1 . . . . . 4.35 1.8 4.35 1 1 
       270 1 . . . . . 4.72 1.8 4.72 1 1 
       271 1 . . . . . 5.65 1.8 5.65 1 1 
       272 1 . . . . . 4.74 1.8 4.74 1 1 
       273 1 . . . . . 2.92 1.8 2.92 1 1 
       274 1 . . . . . 2.52 1.8 2.52 1 1 
       275 1 . . . . . 5.51 1.8 5.51 1 1 
       276 1 . . . . . 5.08 1.8 5.08 1 1 
       277 1 . . . . . 3.54 1.8 3.54 1 1 
       278 1 . . . . . 4.74 1.8 4.74 1 1 
       279 1 . . . . . 3.78 1.8 3.78 1 1 
       280 1 . . . . . 4.46 1.8 4.46 1 1 
       281 1 . . . . .  5.6 1.8  5.6 1 1 
       282 1 . . . . .  4.5 1.8  4.5 1 1 
       283 1 . . . . . 5.66 1.8 5.66 1 1 
       284 1 . . . . .  4.5 1.8  4.5 1 1 
       285 1 . . . . . 3.78 1.8 3.78 1 1 
       286 1 . . . . . 4.28 1.8 4.28 1 1 
       287 1 . . . . . 3.57 1.8 3.57 1 1 
       288 1 . . . . . 4.27 1.8 4.27 1 1 
       289 1 . . . . .  3.7 1.8  3.7 1 1 
       290 1 . . . . . 3.17 1.8 3.17 1 1 
       291 1 . . . . . 3.97 1.8 3.97 1 1 
       292 1 . . . . . 4.68 1.8 4.68 1 1 
       293 1 . . . . . 5.98 1.8 5.98 1 1 
       294 1 . . . . .  6.0 1.8  6.0 1 1 
       295 1 . . . . .  5.4 1.8  5.4 1 1 
       296 1 . . . . . 3.75 1.8 3.75 1 1 
       297 1 . . . . . 3.26 1.8 3.26 1 1 
       298 1 . . . . . 4.53 1.8 4.53 1 1 
       299 1 . . . . . 3.83 1.8 3.83 1 1 
       300 1 . . . . . 2.95 1.8 2.95 1 1 
       301 1 . . . . . 3.92 1.8 3.92 1 1 
       302 1 . . . . . 5.04 1.8 5.04 1 1 
       303 1 . . . . . 3.62 1.8 3.62 1 1 
       304 1 . . . . .  5.3 1.8  5.3 1 1 
       305 1 . . . . . 3.73 1.8 3.73 1 1 
       306 1 . . . . . 4.02 1.8 4.02 1 1 
       307 1 . . . . . 3.58 1.8 3.58 1 1 
       308 1 . . . . . 4.76 1.8 4.76 1 1 
       309 1 . . . . . 4.93 1.8 4.93 1 1 
       310 1 . . . . . 3.11 1.8 3.11 1 1 
       311 1 . . . . . 4.17 1.8 4.17 1 1 
       312 1 . . . . . 3.02 1.8 3.02 1 1 
       313 1 . . . . . 4.01 1.8 4.01 1 1 
       314 1 . . . . . 4.19 1.8 4.19 1 1 
       315 1 . . . . . 4.33 1.8 4.33 1 1 
       316 1 . . . . . 5.58 1.8 5.58 1 1 
       317 1 . . . . . 3.94 1.8 3.94 1 1 
       318 1 . . . . . 4.53 1.8 4.53 1 1 
       319 1 . . . . . 4.02 1.8 4.02 1 1 
       320 1 . . . . . 3.14 1.8 3.14 1 1 
       321 1 . . . . . 4.35 1.8 4.35 1 1 
       322 1 . . . . . 4.04 1.8 4.04 1 1 
       323 1 . . . . . 4.92 1.8 4.92 1 1 
       324 1 . . . . . 3.39 1.8 3.39 1 1 
       325 1 . . . . . 3.86 1.8 3.86 1 1 
       326 1 . . . . .  4.6 1.8  4.6 1 1 
       327 1 . . . . . 4.63 1.8 4.63 1 1 
       328 1 . . . . .  6.0 1.8  6.0 1 1 
       329 1 . . . . . 4.17 1.8 4.17 1 1 
       330 1 . . . . . 3.21 1.8 3.21 1 1 
       331 1 . . . . . 5.32 1.8 5.32 1 1 
       332 1 . . . . . 4.04 1.8 4.04 1 1 
       333 1 . . . . . 5.73 1.8 5.73 1 1 
       334 1 . . . . . 4.89 1.8 4.89 1 1 
       335 1 . . . . . 5.61 1.8 5.61 1 1 
       336 1 . . . . . 4.83 1.8 4.83 1 1 
       337 1 . . . . . 4.05 1.8 4.05 1 1 
       338 1 . . . . . 4.26 1.8 4.26 1 1 
       339 1 . . . . . 4.65 1.8 4.65 1 1 
       340 1 . . . . . 4.74 1.8 4.74 1 1 
       341 1 . . . . . 2.85 1.8 2.85 1 1 
       342 1 . . . . . 4.25 1.8 4.25 1 1 
       343 1 . . . . . 3.04 1.8 3.04 1 1 
       344 1 . . . . . 4.25 1.8 4.25 1 1 
       345 1 . . . . . 4.97 1.8 4.97 1 1 
       346 1 . . . . . 4.47 1.8 4.47 1 1 
       347 1 . . . . . 4.79 1.8 4.79 1 1 
       348 1 . . . . . 4.92 1.8 4.92 1 1 
       349 1 . . . . . 4.68 1.8 4.68 1 1 
       350 1 . . . . .    . 1.8  5.5 1 1 
       351 1 . . . . . 3.49 1.8 3.49 1 1 
       352 1 . . . . . 4.89 1.8 4.89 1 1 
       353 1 . . . . . 4.76 1.8 4.76 1 1 
       354 1 . . . . . 4.73 1.8 4.73 1 1 
       355 1 . . . . . 4.95 1.8 4.95 1 1 
       356 1 . . . . . 4.69 1.8 4.69 1 1 
       357 1 . . . . . 4.82 1.8 4.82 1 1 
       358 1 . . . . .  3.5 1.8  3.5 1 1 
       359 1 . . . . . 4.42 1.8 4.42 1 1 
       360 1 . . . . . 4.11 1.8 4.11 1 1 
       361 1 . . . . . 4.65 1.8 4.65 1 1 
       362 1 . . . . . 4.15 1.8 4.15 1 1 
       363 1 . . . . . 4.65 1.8 4.65 1 1 
       364 1 . . . . . 4.59 1.8 4.59 1 1 
       365 1 . . . . .    . 1.8  4.0 1 1 
       366 1 . . . . . 5.84 1.8 5.84 1 1 
       367 1 . . . . .  4.3 1.8  4.3 1 1 
       368 1 . . . . .  4.8 1.8  4.8 1 1 
       369 1 . . . . . 4.55 1.8 4.55 1 1 
       370 1 . . . . . 4.96 1.8 4.96 1 1 
       371 1 . . . . . 4.55 1.8 4.55 1 1 
       372 1 . . . . .  6.0 1.8  6.0 1 1 
       373 1 . . . . . 4.02 1.8 4.02 1 1 
       374 1 . . . . . 3.16 1.8 3.16 1 1 
       375 1 . . . . . 2.74 1.8 2.74 1 1 
       376 1 . . . . . 4.46 1.8 4.46 1 1 
       377 1 . . . . . 5.16 1.8 5.16 1 1 
       378 1 . . . . .    . 1.8  4.0 1 1 
       379 1 . . . . . 4.52 1.8 4.52 1 1 
       380 1 . . . . .  4.6 1.8  4.6 1 1 
       381 1 . . . . . 4.01 1.8 4.01 1 1 
       382 1 . . . . . 4.41 1.8 4.41 1 1 
       383 1 . . . . . 5.06 1.8 5.06 1 1 
       384 1 . . . . . 4.23 1.8 4.23 1 1 
       385 1 . . . . . 4.18 1.8 4.18 1 1 
       386 1 . . . . . 5.27 1.8 5.27 1 1 
       387 1 . . . . . 4.25 1.8 4.25 1 1 
       388 1 . . . . . 3.08 1.8 3.08 1 1 
       389 1 . . . . . 3.64 1.8 3.64 1 1 
       390 1 . . . . .  4.9 1.8  4.9 1 1 
       391 1 . . . . . 5.22 1.8 5.22 1 1 
       392 1 . . . . . 4.23 1.8 4.23 1 1 
       393 1 . . . . . 4.24 1.8 4.24 1 1 
       394 1 . . . . . 4.91 1.8 4.91 1 1 
       395 1 . . . . . 4.72 1.8 4.72 1 1 
       396 1 . . . . . 3.13 1.8 3.13 1 1 
       397 1 . . . . . 3.62 1.8 3.62 1 1 
       398 1 . . . . .  4.4 1.8  4.4 1 1 
       399 1 . . . . . 2.97 1.8 2.97 1 1 
       400 1 . . . . . 4.36 1.8 4.36 1 1 
       401 1 . . . . . 4.51 1.8 4.51 1 1 
       402 1 . . . . . 3.03 1.8 3.03 1 1 
       403 1 . . . . .  4.8 1.8  4.8 1 1 
       404 1 . . . . . 3.77 1.8 3.77 1 1 
       405 1 . . . . . 4.57 1.8 4.57 1 1 
       406 1 . . . . . 4.36 1.8 4.36 1 1 
       407 1 . . . . . 5.09 1.8 5.09 1 1 
       408 1 . . . . . 5.25 1.8 5.25 1 1 
       409 1 . . . . . 3.33 1.8 3.33 1 1 
       410 1 . . . . . 3.78 1.8 3.78 1 1 
       411 1 . . . . . 4.11 1.8 4.11 1 1 
       412 1 . . . . . 4.98 1.8 4.98 1 1 
       413 1 . . . . . 4.46 1.8 4.46 1 1 
       414 1 . . . . . 4.81 1.8 4.81 1 1 
       415 1 . . . . . 3.36 1.8 3.36 1 1 
       416 1 . . . . . 3.32 1.8 3.32 1 1 
       417 1 . . . . . 5.56 1.8 5.56 1 1 
       418 1 . . . . . 4.25 1.8 4.25 1 1 
       419 1 . . . . . 4.39 1.8 4.39 1 1 
       420 1 . . . . . 5.34 1.8 5.34 1 1 
       421 1 . . . . . 4.69 1.8 4.69 1 1 
       422 1 . . . . . 4.03 1.8 4.03 1 1 
       423 1 . . . . . 4.63 1.8 4.63 1 1 
       424 1 . . . . . 4.39 1.8 4.39 1 1 
       425 1 . . . . .    . 1.8  4.0 1 1 
       426 1 . . . . . 3.68 1.8 3.68 1 1 
       427 1 . . . . .  6.0 1.8  6.0 1 1 
       428 1 . . . . . 3.01 1.8 3.01 1 1 
       429 1 . . . . . 3.15 1.8 3.15 1 1 
       430 1 . . . . . 4.52 1.8 4.52 1 1 
       431 1 . . . . . 5.41 1.8 5.41 1 1 
       432 1 . . . . . 4.16 1.8 4.16 1 1 
       433 1 . . . . . 4.13 1.8 4.13 1 1 
       434 1 . . . . . 4.27 1.8 4.27 1 1 
       435 1 . . . . . 3.88 1.8 3.88 1 1 
       436 1 . . . . . 3.59 1.8 3.59 1 1 
       437 1 . . . . .    . 1.8 3.05 1 1 
       438 1 . . . . . 3.75 1.8 3.75 1 1 
       439 1 . . . . . 5.71 1.8 5.71 1 1 
       440 1 . . . . . 5.29 1.8 5.29 1 1 
       441 1 . . . . . 4.85 1.8 4.85 1 1 
       442 1 . . . . . 5.89 1.8 5.89 1 1 
       443 1 . . . . . 4.21 1.8 4.21 1 1 
       444 1 . . . . . 3.37 1.8 3.37 1 1 
       445 1 . . . . . 5.54 1.8 5.54 1 1 
       446 1 . . . . .  5.2 1.8  5.2 1 1 
       447 1 . . . . . 3.97 1.8 3.97 1 1 
       448 1 . . . . . 4.87 1.8 4.87 1 1 
       449 1 . . . . . 4.44 1.8 4.44 1 1 
       450 1 . . . . . 5.45 1.8 5.45 1 1 
       451 1 . . . . .    . 1.8 3.11 1 1 
       452 1 . . . . . 3.68 1.8 3.68 1 1 
       453 1 . . . . . 3.68 1.8 3.68 1 1 
       454 1 . . . . . 3.44 1.8 3.44 1 1 
       455 1 . . . . . 4.83 1.8 4.83 1 1 
       456 1 . . . . . 5.02 1.8 5.02 1 1 
       457 1 . . . . . 5.08 1.8 5.08 1 1 
       458 1 . . . . . 4.83 1.8 4.83 1 1 
       459 1 . . . . . 5.04 1.8 5.04 1 1 
       460 1 . . . . . 5.22 1.8 5.22 1 1 
       461 1 . . . . . 4.31 1.8 4.31 1 1 
       462 1 . . . . . 5.24 1.8 5.24 1 1 
       463 1 . . . . . 3.58 1.8 3.58 1 1 
       464 1 . . . . .  6.0 1.8  6.0 1 1 
       465 1 . . . . . 4.08 1.8 4.08 1 1 
       466 1 . . . . .  6.0 1.8  6.0 1 1 
       467 1 . . . . . 4.08 1.8 4.08 1 1 
       468 1 . . . . . 3.79 1.8 3.79 1 1 
       469 1 . . . . . 5.62 1.8 5.62 1 1 
       470 1 . . . . .    . 1.8 4.11 1 1 
       471 1 . . . . . 5.38 1.8 5.38 1 1 
       472 1 . . . . .    . 1.8 3.51 1 1 
       473 1 . . . . . 4.78 1.8 4.78 1 1 
       474 1 . . . . . 4.76 1.8 4.76 1 1 
       475 1 . . . . . 4.74 1.8 4.74 1 1 
       476 1 . . . . . 3.49 1.8 3.49 1 1 
       477 1 . . . . . 3.73 1.8 3.73 1 1 
       478 1 . . . . . 4.86 1.8 4.86 1 1 
       479 1 . . . . .  4.2 1.8  4.2 1 1 
       480 1 . . . . . 4.97 1.8 4.97 1 1 
       481 1 . . . . . 3.84 1.8 3.84 1 1 
       482 1 . . . . . 3.34 1.8 3.34 1 1 
       483 1 . . . . . 3.84 1.8 3.84 1 1 
       484 1 . . . . . 4.48 1.8 4.48 1 1 
       485 1 . . . . . 4.52 1.8 4.52 1 1 
       486 1 . . . . . 3.71 1.8 3.71 1 1 
       487 1 . . . . . 4.78 1.8 4.78 1 1 
       488 1 . . . . . 4.79 1.8 4.79 1 1 
       489 1 . . . . . 3.85 1.8 3.85 1 1 
       490 1 . . . . . 4.28 1.8 4.28 1 1 
       491 1 . . . . . 3.24 1.8 3.24 1 1 
       492 1 . . . . . 4.59 1.8 4.59 1 1 
       493 1 . . . . . 4.28 1.8 4.28 1 1 
       494 1 . . . . . 4.23 1.8 4.23 1 1 
       495 1 . . . . . 3.71 1.8 3.71 1 1 
       496 1 . . . . . 4.56 1.8 4.56 1 1 
       497 1 . . . . . 4.45 1.8 4.45 1 1 
       498 1 . . . . . 3.69 1.8 3.69 1 1 
       499 1 . . . . . 4.55 1.8 4.55 1 1 
       500 1 . . . . . 5.97 1.8 5.97 1 1 
       501 1 . . . . . 4.53 1.8 4.53 1 1 
       502 1 . . . . . 4.28 1.8 4.28 1 1 
       503 1 . . . . .  4.0 1.8  4.0 1 1 
       504 1 . . . . .  2.8 1.8  2.8 1 1 
       505 1 . . . . . 5.23 1.8 5.23 1 1 
       506 1 . . . . . 4.34 1.8 4.34 1 1 
       507 1 . . . . . 5.58 1.8 5.58 1 1 
       508 1 . . . . . 4.02 1.8 4.02 1 1 
       509 1 . . . . . 3.57 1.8 3.57 1 1 
       510 1 . . . . .  4.1 1.8  4.1 1 1 
       511 1 . . . . . 2.81 1.8 2.81 1 1 
       512 1 . . . . . 5.61 1.8 5.61 1 1 
       513 1 . . . . . 4.88 1.8 4.88 1 1 
       514 1 . . . . .  6.0 1.8  6.0 1 1 
       515 1 . . . . . 4.76 1.8 4.76 1 1 
       516 1 . . . . . 3.69 1.8 3.69 1 1 
       517 1 . . . . . 4.47 1.8 4.47 1 1 
       518 1 . . . . . 4.79 1.8 4.79 1 1 
       519 1 . . . . . 3.82 1.8 3.82 1 1 
       520 1 . . . . . 5.33 1.8 5.33 1 1 
       521 1 . . . . . 3.75 1.8 3.75 1 1 
       522 1 . . . . . 3.83 1.8 3.83 1 1 
       523 1 . . . . . 4.83 1.8 4.83 1 1 
       524 1 . . . . .  6.0 1.8  6.0 1 1 
       525 1 . . . . . 3.03 1.8 3.03 1 1 
       526 1 . . . . . 4.73 1.8 4.73 1 1 
       527 1 . . . . . 4.84 1.8 4.84 1 1 
       528 1 . . . . . 4.29 1.8 4.29 1 1 
       529 1 . . . . . 3.83 1.8 3.83 1 1 
       530 1 . . . . . 3.76 1.8 3.76 1 1 
       531 1 . . . . . 2.79 1.8 2.79 1 1 
       532 1 . . . . . 4.41 1.8 4.41 1 1 
       533 1 . . . . .  5.1 1.8  5.1 1 1 
       534 1 . . . . . 4.32 1.8 4.32 1 1 
       535 1 . . . . . 5.17 1.8 5.17 1 1 
       536 1 . . . . . 4.71 1.8 4.71 1 1 
       537 1 . . . . . 5.73 1.8 5.73 1 1 
       538 1 . . . . . 5.24 1.8 5.24 1 1 
       539 1 . . . . . 3.91 1.8 3.91 1 1 
       540 1 . . . . . 3.52 1.8 3.52 1 1 
       541 1 . . . . . 3.73 1.8 3.73 1 1 
       542 1 . . . . .  4.9 1.8  4.9 1 1 
       543 1 . . . . .  5.6 1.8  5.6 1 1 
       544 1 . . . . . 4.94 1.8 4.94 1 1 
       545 1 . . . . . 5.24 1.8 5.24 1 1 
       546 1 . . . . . 5.01 1.8 5.01 1 1 
       547 1 . . . . . 5.01 1.8 5.01 1 1 
       548 1 . . . . . 4.08 1.8 4.08 1 1 
       549 1 . . . . . 5.51 1.8 5.51 1 1 
       550 1 . . . . . 3.18 1.8 3.18 1 1 
       551 1 . . . . . 4.06 1.8 4.06 1 1 
       552 1 . . . . . 5.23 1.8 5.23 1 1 
       553 1 . . . . . 4.63 1.8 4.63 1 1 
       554 1 . . . . . 3.85 1.8 3.85 1 1 
       555 1 . . . . . 4.08 1.8 4.08 1 1 
       556 1 . . . . . 3.21 1.8 3.21 1 1 
       557 1 . . . . . 3.98 1.8 3.98 1 1 
       558 1 . . . . . 4.83 1.8 4.83 1 1 
       559 1 . . . . . 3.34 1.8 3.34 1 1 
       560 1 . . . . .  3.9 1.8  3.9 1 1 
       561 1 . . . . .  6.0 1.8  6.0 1 1 
       562 1 . . . . . 3.27 1.8 3.27 1 1 
       563 1 . . . . . 4.93 1.8 4.93 1 1 
       564 1 . . . . . 3.38 1.8 3.38 1 1 
       565 1 . . . . . 4.33 1.8 4.33 1 1 
       566 1 . . . . .  5.1 1.8  5.1 1 1 
       567 1 . . . . . 4.99 1.8 4.99 1 1 
       568 1 . . . . . 5.12 1.8 5.12 1 1 
       569 1 . . . . . 4.71 1.8 4.71 1 1 
       570 1 . . . . . 5.32 1.8 5.32 1 1 
       571 1 . . . . .  3.3 1.8  3.3 1 1 
       572 1 . . . . . 4.38 1.8 4.38 1 1 
       573 1 . . . . . 3.46 1.8 3.46 1 1 
       574 1 . . . . . 3.96 1.8 3.96 1 1 
       575 1 . . . . . 4.93 1.8 4.93 1 1 
       576 1 . . . . .  6.0 1.8  6.0 1 1 
       577 1 . . . . .  6.0 1.8  6.0 1 1 
       578 1 . . . . . 3.77 1.8 3.77 1 1 
       579 1 . . . . . 3.63 1.8 3.63 1 1 
       580 1 . . . . . 3.33 1.8 3.33 1 1 
       581 1 . . . . . 4.07 1.8 4.07 1 1 
       582 1 . . . . . 4.37 1.8 4.37 1 1 
       583 1 . . . . . 4.76 1.8 4.76 1 1 
       584 1 . . . . . 3.96 1.8 3.96 1 1 
       585 1 . . . . . 4.69 1.8 4.69 1 1 
       586 1 . . . . . 3.95 1.8 3.95 1 1 
       587 1 . . . . . 4.56 1.8 4.56 1 1 
       588 1 . . . . . 4.88 1.8 4.88 1 1 
       589 1 . . . . . 3.98 1.8 3.98 1 1 
       590 1 . . . . . 4.72 1.8 4.72 1 1 
       591 1 . . . . . 4.72 1.8 4.72 1 1 
    stop_

save_


save_CNS/XPLOR_dihedral_3
    _Torsion_angle_constraint_list.Sf_category         torsion_angle_constraints
    _Torsion_angle_constraint_list.Entry_ID            1
    _Torsion_angle_constraint_list.ID                  1
    _Torsion_angle_constraint_list.Constraint_file_ID  .
    _Torsion_angle_constraint_list.Block_ID            .

    loop_
       _Torsion_angle_constraint.ID
       _Torsion_angle_constraint.Torsion_angle_name
       _Torsion_angle_constraint.Entity_assembly_ID_1
       _Torsion_angle_constraint.Entity_ID_1
       _Torsion_angle_constraint.Comp_index_ID_1
       _Torsion_angle_constraint.Comp_ID_1
       _Torsion_angle_constraint.Atom_ID_1
       _Torsion_angle_constraint.Entity_assembly_ID_2
       _Torsion_angle_constraint.Entity_ID_2
       _Torsion_angle_constraint.Comp_index_ID_2
       _Torsion_angle_constraint.Comp_ID_2
       _Torsion_angle_constraint.Atom_ID_2
       _Torsion_angle_constraint.Entity_assembly_ID_3
       _Torsion_angle_constraint.Entity_ID_3
       _Torsion_angle_constraint.Comp_index_ID_3
       _Torsion_angle_constraint.Comp_ID_3
       _Torsion_angle_constraint.Atom_ID_3
       _Torsion_angle_constraint.Entity_assembly_ID_4
       _Torsion_angle_constraint.Entity_ID_4
       _Torsion_angle_constraint.Comp_index_ID_4
       _Torsion_angle_constraint.Comp_ID_4
       _Torsion_angle_constraint.Atom_ID_4
       _Torsion_angle_constraint.Angle_lower_bound_val
       _Torsion_angle_constraint.Angle_upper_bound_val
       _Torsion_angle_constraint.Auth_asym_ID_1
       _Torsion_angle_constraint.Auth_seq_ID_1
       _Torsion_angle_constraint.Auth_comp_ID_1
       _Torsion_angle_constraint.Auth_atom_ID_1
       _Torsion_angle_constraint.Auth_asym_ID_2
       _Torsion_angle_constraint.Auth_seq_ID_2
       _Torsion_angle_constraint.Auth_comp_ID_2
       _Torsion_angle_constraint.Auth_atom_ID_2
       _Torsion_angle_constraint.Auth_asym_ID_3
       _Torsion_angle_constraint.Auth_seq_ID_3
       _Torsion_angle_constraint.Auth_comp_ID_3
       _Torsion_angle_constraint.Auth_atom_ID_3
       _Torsion_angle_constraint.Auth_asym_ID_4
       _Torsion_angle_constraint.Auth_seq_ID_4
       _Torsion_angle_constraint.Auth_comp_ID_4
       _Torsion_angle_constraint.Auth_atom_ID_4
       _Torsion_angle_constraint.Entry_ID
       _Torsion_angle_constraint.Torsion_angle_constraint_list_ID

         1 . 1 1   2 ALA C 1 1   3 TYR N  1 1   3 TYR CA 1 1   3 TYR C      -157.4      -17.4 .   2 . C .   3 . N  .   3 . CA .   3 . C 1 1 
         2 . 1 1   3 TYR N 1 1   3 TYR CA 1 1   3 TYR C  1 1   4 ASN N        92.1      167.9 .   3 . N .   3 . CA .   3 . C  .   4 . N 1 1 
         3 . 1 1   3 TYR C 1 1   4 ASN N  1 1   4 ASN CA 1 1   4 ASN C      -116.8      -61.9 .   3 . C .   4 . N  .   4 . CA .   4 . C 1 1 
         4 . 1 1   4 ASN N 1 1   4 ASN CA 1 1   4 ASN C  1 1   5 LYS N        59.9      174.2 .   4 . N .   4 . CA .   4 . C  .   5 . N 1 1 
         5 . 1 1   4 ASN C 1 1   5 LYS N  1 1   5 LYS CA 1 1   5 LYS C       -76.8 -36.799995 .   4 . C .   5 . N  .   5 . CA .   5 . C 1 1 
         6 . 1 1   5 LYS N 1 1   5 LYS CA 1 1   5 LYS C  1 1   6 GLU N  -61.199997      -13.0 .   5 . N .   5 . CA .   5 . C  .   6 . N 1 1 
         7 . 1 1   5 LYS C 1 1   6 GLU N  1 1   6 GLU CA 1 1   6 GLU C       -79.7      -39.7 .   5 . C .   6 . N  .   6 . CA .   6 . C 1 1 
         8 . 1 1   6 GLU N 1 1   6 GLU CA 1 1   6 GLU C  1 1   7 GLU N       -62.5 -22.499998 .   6 . N .   6 . CA .   6 . C  .   7 . N 1 1 
         9 . 1 1   6 GLU C 1 1   7 GLU N  1 1   7 GLU CA 1 1   7 GLU C       -86.1 -46.099995 .   6 . C .   7 . N  .   7 . CA .   7 . C 1 1 
        10 . 1 1   7 GLU N 1 1   7 GLU CA 1 1   7 GLU C  1 1   8 LYS N       -63.4      -23.4 .   7 . N .   7 . CA .   7 . C  .   8 . N 1 1 
        11 . 1 1   7 GLU C 1 1   8 LYS N  1 1   8 LYS CA 1 1   8 LYS C       -83.3      -43.3 .   7 . C .   8 . N  .   8 . CA .   8 . C 1 1 
        12 . 1 1   8 LYS N 1 1   8 LYS CA 1 1   8 LYS C  1 1   9 ILE N  -62.899998      -22.9 .   8 . N .   8 . CA .   8 . C  .   9 . N 1 1 
        13 . 1 1   8 LYS C 1 1   9 ILE N  1 1   9 ILE CA 1 1   9 ILE C       -83.3      -43.3 .   8 . C .   9 . N  .   9 . CA .   9 . C 1 1 
        14 . 1 1   9 ILE N 1 1   9 ILE CA 1 1   9 ILE C  1 1  10 LYS N  -62.199997      -22.2 .   9 . N .   9 . CA .   9 . C  .  10 . N 1 1 
        15 . 1 1   9 ILE C 1 1  10 LYS N  1 1  10 LYS CA 1 1  10 LYS C       -85.7      -45.7 .   9 . C .  10 . N  .  10 . CA .  10 . C 1 1 
        16 . 1 1  10 LYS N 1 1  10 LYS CA 1 1  10 LYS C  1 1  11 SER N  -59.099995        3.7 .  10 . N .  10 . CA .  10 . C  .  11 . N 1 1 
        17 . 1 1  10 LYS C 1 1  11 SER N  1 1  11 SER CA 1 1  11 SER C      -138.4      -43.6 .  10 . C .  11 . N  .  11 . CA .  11 . C 1 1 
        18 . 1 1  11 SER N 1 1  11 SER CA 1 1  11 SER C  1 1  12 LEU N       -76.3       47.1 .  11 . N .  11 . CA .  11 . C  .  12 . N 1 1 
        19 . 1 1  11 SER C 1 1  12 LEU N  1 1  12 LEU CA 1 1  12 LEU C      -123.5      -48.7 .  11 . C .  12 . N  .  12 . CA .  12 . C 1 1 
        20 . 1 1  12 LEU N 1 1  12 LEU CA 1 1  12 LEU C  1 1  13 ASN N       -72.3       45.2 .  12 . N .  12 . CA .  12 . C  .  13 . N 1 1 
        21 . 1 1  12 LEU C 1 1  13 ASN N  1 1  13 ASN CA 1 1  13 ASN C      -131.3 -29.700003 .  12 . C .  13 . N  .  13 . CA .  13 . C 1 1 
        22 . 1 1  13 ASN N 1 1  13 ASN CA 1 1  13 ASN C  1 1  14 ARG N       -85.8       54.2 .  13 . N .  13 . CA .  13 . C  .  14 . N 1 1 
        23 . 1 1  13 ASN C 1 1  14 ARG N  1 1  14 ARG CA 1 1  14 ARG C       -80.3      -40.3 .  13 . C .  14 . N  .  14 . CA .  14 . C 1 1 
        24 . 1 1  14 ARG N 1 1  14 ARG CA 1 1  14 ARG C  1 1  15 MET N       -57.3      -17.3 .  14 . N .  14 . CA .  14 . C  .  15 . N 1 1 
        25 . 1 1  14 ARG C 1 1  15 MET N  1 1  15 MET CA 1 1  15 MET C       -84.9      -44.9 .  14 . C .  15 . N  .  15 . CA .  15 . C 1 1 
        26 . 1 1  15 MET N 1 1  15 MET CA 1 1  15 MET C  1 1  16 GLN N  -62.199997      -22.2 .  15 . N .  15 . CA .  15 . C  .  16 . N 1 1 
        27 . 1 1  15 MET C 1 1  16 GLN N  1 1  16 GLN CA 1 1  16 GLN C       -83.9      -43.9 .  15 . C .  16 . N  .  16 . CA .  16 . C 1 1 
        28 . 1 1  16 GLN N 1 1  16 GLN CA 1 1  16 GLN C  1 1  17 TYR N  -60.200005      -20.2 .  16 . N .  16 . CA .  16 . C  .  17 . N 1 1 
        29 . 1 1  16 GLN C 1 1  17 TYR N  1 1  17 TYR CA 1 1  17 TYR C   -85.59999      -45.6 .  16 . C .  17 . N  .  17 . CA .  17 . C 1 1 
        30 . 1 1  17 TYR N 1 1  17 TYR CA 1 1  17 TYR C  1 1  18 GLU N       -62.5 -22.499998 .  17 . N .  17 . CA .  17 . C  .  18 . N 1 1 
        31 . 1 1  17 TYR C 1 1  18 GLU N  1 1  18 GLU CA 1 1  18 GLU C       -82.1      -42.1 .  17 . C .  18 . N  .  18 . CA .  18 . C 1 1 
        32 . 1 1  18 GLU N 1 1  18 GLU CA 1 1  18 GLU C  1 1  19 VAL N  -62.799995      -22.8 .  18 . N .  18 . CA .  18 . C  .  19 . N 1 1 
        33 . 1 1  18 GLU C 1 1  19 VAL N  1 1  19 VAL CA 1 1  19 VAL C       -82.4      -42.4 .  18 . C .  19 . N  .  19 . CA .  19 . C 1 1 
        34 . 1 1  19 VAL N 1 1  19 VAL CA 1 1  19 VAL C  1 1  20 THR N       -65.0      -25.0 .  19 . N .  19 . CA .  19 . C  .  20 . N 1 1 
        35 . 1 1  19 VAL C 1 1  20 THR N  1 1  20 THR CA 1 1  20 THR C       -85.5      -45.5 .  19 . C .  20 . N  .  20 . CA .  20 . C 1 1 
        36 . 1 1  20 THR N 1 1  20 THR CA 1 1  20 THR C  1 1  21 GLN N       -51.4      -10.8 .  20 . N .  20 . CA .  20 . C  .  21 . N 1 1 
        37 . 1 1  20 THR C 1 1  21 GLN N  1 1  21 GLN CA 1 1  21 GLN C      -110.2      -32.9 .  20 . C .  21 . N  .  21 . CA .  21 . C 1 1 
        38 . 1 1  21 GLN N 1 1  21 GLN CA 1 1  21 GLN C  1 1  22 ASN N       -52.2        4.0 .  21 . N .  21 . CA .  21 . C  .  22 . N 1 1 
        39 . 1 1  22 ASN C 1 1  23 ASN N  1 1  23 ASN CA 1 1  23 ASN C         0.0      140.0 .  22 . C .  23 . N  .  23 . CA .  23 . C 1 1 
        40 . 1 1  23 ASN N 1 1  23 ASN CA 1 1  23 ASN C  1 1  24 GLY N       -28.0   83.69999 .  23 . N .  23 . CA .  23 . C  .  24 . N 1 1 
        41 . 1 1  23 ASN C 1 1  24 GLY N  1 1  24 GLY CA 1 1  24 GLY C      -153.6      -27.5 .  23 . C .  24 . N  .  24 . CA .  24 . C 1 1 
        42 . 1 1  24 GLY N 1 1  24 GLY CA 1 1  24 GLY C  1 1  25 THR N       132.6      176.4 .  24 . N .  24 . CA .  24 . C  .  25 . N 1 1 
        43 . 1 1  24 GLY C 1 1  25 THR N  1 1  25 THR CA 1 1  25 THR C      -191.2      -51.2 .  24 . C .  25 . N  .  25 . CA .  25 . C 1 1 
        44 . 1 1  25 THR N 1 1  25 THR CA 1 1  25 THR C  1 1  26 GLU N   108.59999      168.2 .  25 . N .  25 . CA .  25 . C  .  26 . N 1 1 
        45 . 1 1  25 THR C 1 1  26 GLU N  1 1  26 GLU CA 1 1  26 GLU C      -146.9 -42.799995 .  25 . C .  26 . N  .  26 . CA .  26 . C 1 1 
        46 . 1 1  26 GLU N 1 1  26 GLU CA 1 1  26 GLU C  1 1  27 PRO N        92.4      183.7 .  26 . N .  26 . CA .  26 . C  .  27 . N 1 1 
        47 . 1 1  27 PRO N 1 1  27 PRO CA 1 1  27 PRO C  1 1  28 PRO N       128.7      168.7 .  27 . N .  27 . CA .  27 . C  .  28 . N 1 1 
        48 . 1 1  30 GLN C 1 1  31 ASN N  1 1  31 ASN CA 1 1  31 ASN C      -168.2      -29.9 .  30 . C .  31 . N  .  31 . CA .  31 . C 1 1 
        49 . 1 1  31 ASN N 1 1  31 ASN CA 1 1  31 ASN C  1 1  32 GLU N       146.0      186.0 .  31 . N .  31 . CA .  31 . C  .  32 . N 1 1 
        50 . 1 1  31 ASN C 1 1  32 GLU N  1 1  32 GLU CA 1 1  32 GLU C       -84.9      -44.9 .  31 . C .  32 . N  .  32 . CA .  32 . C 1 1 
        51 . 1 1  32 GLU N 1 1  32 GLU CA 1 1  32 GLU C  1 1  33 TYR N       -60.5       12.1 .  32 . N .  32 . CA .  32 . C  .  33 . N 1 1 
        52 . 1 1  32 GLU C 1 1  33 TYR N  1 1  33 TYR CA 1 1  33 TYR C      -123.7      -48.1 .  32 . C .  33 . N  .  33 . CA .  33 . C 1 1 
        53 . 1 1  33 TYR N 1 1  33 TYR CA 1 1  33 TYR C  1 1  34 TRP N       -77.5       39.4 .  33 . N .  33 . CA .  33 . C  .  34 . N 1 1 
        54 . 1 1  34 TRP C 1 1  35 ASP N  1 1  35 ASP CA 1 1  35 ASP C      -143.3      -39.1 .  34 . C .  35 . N  .  35 . CA .  35 . C 1 1 
        55 . 1 1  35 ASP N 1 1  35 ASP CA 1 1  35 ASP C  1 1  36 HIS N  -63.899998       61.1 .  35 . N .  35 . CA .  35 . C  .  36 . N 1 1 
        56 . 1 1  36 HIS C 1 1  37 LYS N  1 1  37 LYS CA 1 1  37 LYS C -125.700005      -67.2 .  36 . C .  37 . N  .  37 . CA .  37 . C 1 1 
        57 . 1 1  37 LYS N 1 1  37 LYS CA 1 1  37 LYS C  1 1  38 GLU N       -76.4       41.0 .  37 . N .  37 . CA .  37 . C  .  38 . N 1 1 
        58 . 1 1  37 LYS C 1 1  38 GLU N  1 1  38 GLU CA 1 1  38 GLU C      -188.6      -48.6 .  37 . C .  38 . N  .  38 . CA .  38 . C 1 1 
        59 . 1 1  38 GLU N 1 1  38 GLU CA 1 1  38 GLU C  1 1  39 GLU N        99.7      190.9 .  38 . N .  38 . CA .  38 . C  .  39 . N 1 1 
        60 . 1 1  38 GLU C 1 1  39 GLU N  1 1  39 GLU CA 1 1  39 GLU C      -139.0        1.0 .  38 . C .  39 . N  .  39 . CA .  39 . C 1 1 
        61 . 1 1  39 GLU N 1 1  39 GLU CA 1 1  39 GLU C  1 1  40 GLY N       114.7      154.7 .  39 . N .  39 . CA .  39 . C  .  40 . N 1 1 
        62 . 1 1  40 GLY C 1 1  41 LEU N  1 1  41 LEU CA 1 1  41 LEU C      -177.9      -80.5 .  40 . C .  41 . N  .  41 . CA .  41 . C 1 1 
        63 . 1 1  41 LEU N 1 1  41 LEU CA 1 1  41 LEU C  1 1  42 TYR N       134.8  177.49998 .  41 . N .  41 . CA .  41 . C  .  42 . N 1 1 
        64 . 1 1  41 LEU C 1 1  42 TYR N  1 1  42 TYR CA 1 1  42 TYR C      -165.0      -56.7 .  41 . C .  42 . N  .  42 . CA .  42 . C 1 1 
        65 . 1 1  42 TYR N 1 1  42 TYR CA 1 1  42 TYR C  1 1  43 VAL N       113.4      168.8 .  42 . N .  42 . CA .  42 . C  .  43 . N 1 1 
        66 . 1 1  42 TYR C 1 1  43 VAL N  1 1  43 VAL CA 1 1  43 VAL C      -163.7     -100.3 .  42 . C .  43 . N  .  43 . CA .  43 . C 1 1 
        67 . 1 1  43 VAL N 1 1  43 VAL CA 1 1  43 VAL C  1 1  44 ASP N       138.8  178.79999 .  43 . N .  43 . CA .  43 . C  .  44 . N 1 1 
        68 . 1 1  43 VAL C 1 1  44 ASP N  1 1  44 ASP CA 1 1  44 ASP C      -140.1       -0.1 .  43 . C .  44 . N  .  44 . CA .  44 . C 1 1 
        69 . 1 1  44 ASP N 1 1  44 ASP CA 1 1  44 ASP C  1 1  45 ILE N        71.5      199.0 .  44 . N .  44 . CA .  44 . C  .  45 . N 1 1 
        70 . 1 1  44 ASP C 1 1  45 ILE N  1 1  45 ILE CA 1 1  45 ILE C      -105.7 -30.699999 .  44 . C .  45 . N  .  45 . CA .  45 . C 1 1 
        71 . 1 1  45 ILE N 1 1  45 ILE CA 1 1  45 ILE C  1 1  46 VAL N       -64.1       10.1 .  45 . N .  45 . CA .  45 . C  .  46 . N 1 1 
        72 . 1 1  45 ILE C 1 1  46 VAL N  1 1  46 VAL CA 1 1  46 VAL C      -113.6      -41.0 .  45 . C .  46 . N  .  46 . CA .  46 . C 1 1 
        73 . 1 1  46 VAL N 1 1  46 VAL CA 1 1  46 VAL C  1 1  47 SER N       -67.1      -16.3 .  46 . N .  46 . CA .  46 . C  .  47 . N 1 1 
        74 . 1 1  46 VAL C 1 1  47 SER N  1 1  47 SER CA 1 1  47 SER C      -145.6      -71.6 .  46 . C .  47 . N  .  47 . CA .  47 . C 1 1 
        75 . 1 1  47 SER N 1 1  47 SER CA 1 1  47 SER C  1 1  48 GLY N       -37.9       32.0 .  47 . N .  47 . CA .  47 . C  .  48 . N 1 1 
        76 . 1 1  48 GLY C 1 1  49 LYS N  1 1  49 LYS CA 1 1  49 LYS C      -121.4      -57.3 .  48 . C .  49 . N  .  49 . CA .  49 . C 1 1 
        77 . 1 1  49 LYS N 1 1  49 LYS CA 1 1  49 LYS C  1 1  50 PRO N       115.5      163.8 .  49 . N .  49 . CA .  49 . C  .  50 . N 1 1 
        78 . 1 1  50 PRO N 1 1  50 PRO CA 1 1  50 PRO C  1 1  51 LEU N       123.5      163.5 .  50 . N .  50 . CA .  50 . C  .  51 . N 1 1 
        79 . 1 1  51 LEU C 1 1  52 PHE N  1 1  52 PHE CA 1 1  52 PHE C      -172.5      -91.2 .  51 . C .  52 . N  .  52 . CA .  52 . C 1 1 
        80 . 1 1  52 PHE N 1 1  52 PHE CA 1 1  52 PHE C  1 1  53 THR N       133.7  173.69998 .  52 . N .  52 . CA .  52 . C  .  53 . N 1 1 
        81 . 1 1  52 PHE C 1 1  53 THR N  1 1  53 THR CA 1 1  53 THR C      -137.4      -47.4 .  52 . C .  53 . N  .  53 . CA .  53 . C 1 1 
        82 . 1 1  53 THR N 1 1  53 THR CA 1 1  53 THR C  1 1  54 SER N       150.0      190.0 .  53 . N .  53 . CA .  53 . C  .  54 . N 1 1 
        83 . 1 1  53 THR C 1 1  54 SER N  1 1  54 SER CA 1 1  54 SER C       -79.7      -39.7 .  53 . C .  54 . N  .  54 . CA .  54 . C 1 1 
        84 . 1 1  54 SER N 1 1  54 SER CA 1 1  54 SER C  1 1  55 LYS N       -56.9      -16.9 .  54 . N .  54 . CA .  54 . C  .  55 . N 1 1 
        85 . 1 1  54 SER C 1 1  55 LYS N  1 1  55 LYS CA 1 1  55 LYS C       -87.0      -47.0 .  54 . C .  55 . N  .  55 . CA .  55 . C 1 1 
        86 . 1 1  55 LYS N 1 1  55 LYS CA 1 1  55 LYS C  1 1  56 ASP N       -51.1       -5.1 .  55 . N .  55 . CA .  55 . C  .  56 . N 1 1 
        87 . 1 1  56 ASP C 1 1  57 LYS N  1 1  57 LYS CA 1 1  57 LYS C      -143.2  -75.49999 .  56 . C .  57 . N  .  57 . CA .  57 . C 1 1 
        88 . 1 1  57 LYS N 1 1  57 LYS CA 1 1  57 LYS C  1 1  58 PHE N        94.4      157.4 .  57 . N .  57 . CA .  57 . C  .  58 . N 1 1 
        89 . 1 1  57 LYS C 1 1  58 PHE N  1 1  58 PHE CA 1 1  58 PHE C      -161.6     -106.3 .  57 . C .  58 . N  .  58 . CA .  58 . C 1 1 
        90 . 1 1  58 PHE N 1 1  58 PHE CA 1 1  58 PHE C  1 1  59 ASP N       135.6      175.6 .  58 . N .  58 . CA .  58 . C  .  59 . N 1 1 
        91 . 1 1  58 PHE C 1 1  59 ASP N  1 1  59 ASP CA 1 1  59 ASP C      -102.3 -53.199997 .  58 . C .  59 . N  .  59 . CA .  59 . C 1 1 
        92 . 1 1  59 ASP N 1 1  59 ASP CA 1 1  59 ASP C  1 1  60 SER N       120.9      160.9 .  59 . N .  59 . CA .  59 . C  .  60 . N 1 1 
        93 . 1 1  59 ASP C 1 1  60 SER N  1 1  60 SER CA 1 1  60 SER C      -151.9      -46.5 .  59 . C .  60 . N  .  60 . CA .  60 . C 1 1 
        94 . 1 1  60 SER N 1 1  60 SER CA 1 1  60 SER C  1 1  61 GLN N   63.500004      203.5 .  60 . N .  60 . CA .  60 . C  .  61 . N 1 1 
        95 . 1 1  60 SER C 1 1  61 GLN N  1 1  61 GLN CA 1 1  61 GLN C       -92.9      -46.6 .  60 . C .  61 . N  .  61 . CA .  61 . C 1 1 
        96 . 1 1  61 GLN N 1 1  61 GLN CA 1 1  61 GLN C  1 1  62 CYS N       -40.9        5.4 .  61 . N .  61 . CA .  61 . C  .  62 . N 1 1 
        97 . 1 1  61 GLN C 1 1  62 CYS N  1 1  62 CYS CA 1 1  62 CYS C -120.799995      -60.6 .  61 . C .  62 . N  .  62 . CA .  62 . C 1 1 
        98 . 1 1  62 CYS N 1 1  62 CYS CA 1 1  62 CYS C  1 1  63 GLY N       -26.3       36.0 .  62 . N .  62 . CA .  62 . C  .  63 . N 1 1 
        99 . 1 1  63 GLY C 1 1  64 TRP N  1 1  64 TRP CA 1 1  64 TRP C      -121.4 -54.299995 .  63 . C .  64 . N  .  64 . CA .  64 . C 1 1 
       100 . 1 1  64 TRP N 1 1  64 TRP CA 1 1  64 TRP C  1 1  65 PRO N  119.100006      167.7 .  64 . N .  64 . CA .  64 . C  .  65 . N 1 1 
       101 . 1 1  65 PRO N 1 1  65 PRO CA 1 1  65 PRO C  1 1  66 SER N  117.899994      170.4 .  65 . N .  65 . CA .  65 . C  .  66 . N 1 1 
       102 . 1 1  65 PRO C 1 1  66 SER N  1 1  66 SER CA 1 1  66 SER C      -165.2      -89.9 .  65 . C .  66 . N  .  66 . CA .  66 . C 1 1 
       103 . 1 1  66 SER N 1 1  66 SER CA 1 1  66 SER C  1 1  67 PHE N        92.7      183.7 .  66 . N .  66 . CA .  66 . C  .  67 . N 1 1 
       104 . 1 1  66 SER C 1 1  67 PHE N  1 1  67 PHE CA 1 1  67 PHE C      -157.6      -83.9 .  66 . C .  67 . N  .  67 . CA .  67 . C 1 1 
       105 . 1 1  67 PHE N 1 1  67 PHE CA 1 1  67 PHE C  1 1  68 THR N   118.99999      180.6 .  67 . N .  67 . CA .  67 . C  .  68 . N 1 1 
       106 . 1 1  67 PHE C 1 1  68 THR N  1 1  68 THR CA 1 1  68 THR C      -105.3 -56.199997 .  67 . C .  68 . N  .  68 . CA .  68 . C 1 1 
       107 . 1 1  68 THR N 1 1  68 THR CA 1 1  68 THR C  1 1  69 LYS N  -43.099995       -3.1 .  68 . N .  68 . CA .  68 . C  .  69 . N 1 1 
       108 . 1 1  68 THR C 1 1  69 LYS N  1 1  69 LYS CA 1 1  69 LYS C      -186.4      -46.4 .  68 . C .  69 . N  .  69 . CA .  69 . C 1 1 
       109 . 1 1  69 LYS N 1 1  69 LYS CA 1 1  69 LYS C  1 1  70 PRO N        64.4  195.79999 .  69 . N .  69 . CA .  69 . C  .  70 . N 1 1 
       110 . 1 1  70 PRO N 1 1  70 PRO CA 1 1  70 PRO C  1 1  71 ILE N       125.0      177.6 .  70 . N .  70 . CA .  70 . C  .  71 . N 1 1 
       111 . 1 1  71 ILE C 1 1  72 GLU N  1 1  72 GLU CA 1 1  72 GLU C       -79.7      -39.7 .  71 . C .  72 . N  .  72 . CA .  72 . C 1 1 
       112 . 1 1  72 GLU N 1 1  72 GLU CA 1 1  72 GLU C  1 1  73 GLU N       -63.2      -17.4 .  72 . N .  72 . CA .  72 . C  .  73 . N 1 1 
       113 . 1 1  72 GLU C 1 1  73 GLU N  1 1  73 GLU CA 1 1  73 GLU C       -96.7      -41.4 .  72 . C .  73 . N  .  73 . CA .  73 . C 1 1 
       114 . 1 1  73 GLU N 1 1  73 GLU CA 1 1  73 GLU C  1 1  74 GLU N       -46.8  13.299999 .  73 . N .  73 . CA .  73 . C  .  74 . N 1 1 
       115 . 1 1  73 GLU C 1 1  74 GLU N  1 1  74 GLU CA 1 1  74 GLU C      -124.6      -77.6 .  73 . C .  74 . N  .  74 . CA .  74 . C 1 1 
       116 . 1 1  74 GLU N 1 1  74 GLU CA 1 1  74 GLU C  1 1  75 VAL N       -29.8       19.3 .  74 . N .  74 . CA .  74 . C  .  75 . N 1 1 
       117 . 1 1  74 GLU C 1 1  75 VAL N  1 1  75 VAL CA 1 1  75 VAL C      -160.5      -81.2 .  74 . C .  75 . N  .  75 . CA .  75 . C 1 1 
       118 . 1 1  75 VAL N 1 1  75 VAL CA 1 1  75 VAL C  1 1  76 GLU N       111.0      157.5 .  75 . N .  75 . CA .  75 . C  .  76 . N 1 1 
       119 . 1 1  75 VAL C 1 1  76 GLU N  1 1  76 GLU CA 1 1  76 GLU C      -149.3     -102.2 .  75 . C .  76 . N  .  76 . CA .  76 . C 1 1 
       120 . 1 1  76 GLU N 1 1  76 GLU CA 1 1  76 GLU C  1 1  77 GLU N       122.3      165.8 .  76 . N .  76 . CA .  76 . C  .  77 . N 1 1 
       121 . 1 1  76 GLU C 1 1  77 GLU N  1 1  77 GLU CA 1 1  77 GLU C  -129.59999 -62.700005 .  76 . C .  77 . N  .  77 . CA .  77 . C 1 1 
       122 . 1 1  77 GLU N 1 1  77 GLU CA 1 1  77 GLU C  1 1  78 LYS N  114.299995      154.3 .  77 . N .  77 . CA .  77 . C  .  78 . N 1 1 
       123 . 1 1  77 GLU C 1 1  78 LYS N  1 1  78 LYS CA 1 1  78 LYS C      -169.7     -105.6 .  77 . C .  78 . N  .  78 . CA .  78 . C 1 1 
       124 . 1 1  78 LYS N 1 1  78 LYS CA 1 1  78 LYS C  1 1  79 LEU N        90.7      177.9 .  78 . N .  78 . CA .  78 . C  .  79 . N 1 1 
       125 . 1 1  78 LYS C 1 1  79 LEU N  1 1  79 LEU CA 1 1  79 LEU C      -110.6      -44.0 .  78 . C .  79 . N  .  79 . CA .  79 . C 1 1 
       126 . 1 1  79 LEU N 1 1  79 LEU CA 1 1  79 LEU C  1 1  80 ASP N       110.0      153.9 .  79 . N .  79 . CA .  79 . C  .  80 . N 1 1 
       127 . 1 1  79 LEU C 1 1  80 ASP N  1 1  80 ASP CA 1 1  80 ASP C      -145.9      -79.4 .  79 . C .  80 . N  .  80 . CA .  80 . C 1 1 
       128 . 1 1  80 ASP N 1 1  80 ASP CA 1 1  80 ASP C  1 1  81 THR N       114.4      169.6 .  80 . N .  80 . CA .  80 . C  .  81 . N 1 1 
       129 . 1 1  81 THR C 1 1  82 SER N  1 1  82 SER CA 1 1  82 SER C       -78.8      -38.8 .  81 . C .  82 . N  .  82 . CA .  82 . C 1 1 
       130 . 1 1  82 SER N 1 1  82 SER CA 1 1  82 SER C  1 1  83 HIS N       -57.8        2.1 .  82 . N .  82 . CA .  82 . C  .  83 . N 1 1 
       131 . 1 1  83 HIS C 1 1  84 GLY N  1 1  84 GLY CA 1 1  84 GLY C        45.9  121.09999 .  83 . C .  84 . N  .  84 . CA .  84 . C 1 1 
       132 . 1 1  84 GLY N 1 1  84 GLY CA 1 1  84 GLY C  1 1  85 MET N       -24.3       56.1 .  84 . N .  84 . CA .  84 . C  .  85 . N 1 1 
       133 . 1 1  84 GLY C 1 1  85 MET N  1 1  85 MET CA 1 1  85 MET C      -154.3      -84.0 .  84 . C .  85 . N  .  85 . CA .  85 . C 1 1 
       134 . 1 1  85 MET N 1 1  85 MET CA 1 1  85 MET C  1 1  86 ILE N       140.4      182.5 .  85 . N .  85 . CA .  85 . C  .  86 . N 1 1 
       135 . 1 1  85 MET C 1 1  86 ILE N  1 1  86 ILE CA 1 1  86 ILE C      -129.5      -68.5 .  85 . C .  86 . N  .  86 . CA .  86 . C 1 1 
       136 . 1 1  86 ILE N 1 1  86 ILE CA 1 1  86 ILE C  1 1  87 ARG N   112.69999      152.7 .  86 . N .  86 . CA .  86 . C  .  87 . N 1 1 
       137 . 1 1  86 ILE C 1 1  87 ARG N  1 1  87 ARG CA 1 1  87 ARG C      -203.6 -63.599995 .  86 . C .  87 . N  .  87 . CA .  87 . C 1 1 
       138 . 1 1  87 ARG N 1 1  87 ARG CA 1 1  87 ARG C  1 1  88 THR N       108.7      182.8 .  87 . N .  87 . CA .  87 . C  .  88 . N 1 1 
       139 . 1 1  87 ARG C 1 1  88 THR N  1 1  88 THR CA 1 1  88 THR C      -130.0      -67.5 .  87 . C .  88 . N  .  88 . CA .  88 . C 1 1 
       140 . 1 1  88 THR N 1 1  88 THR CA 1 1  88 THR C  1 1  89 GLU N       101.5      141.5 .  88 . N .  88 . CA .  88 . C  .  89 . N 1 1 
       141 . 1 1  88 THR C 1 1  89 GLU N  1 1  89 GLU CA 1 1  89 GLU C      -149.9  -81.49999 .  88 . C .  89 . N  .  89 . CA .  89 . C 1 1 
       142 . 1 1  89 GLU N 1 1  89 GLU CA 1 1  89 GLU C  1 1  90 VAL N        81.6      176.0 .  89 . N .  89 . CA .  89 . C  .  90 . N 1 1 
       143 . 1 1  89 GLU C 1 1  90 VAL N  1 1  90 VAL CA 1 1  90 VAL C      -162.9      -93.3 .  89 . C .  90 . N  .  90 . CA .  90 . C 1 1 
       144 . 1 1  90 VAL N 1 1  90 VAL CA 1 1  90 VAL C  1 1  91 ARG N        94.5      193.5 .  90 . N .  90 . CA .  90 . C  .  91 . N 1 1 
       145 . 1 1  90 VAL C 1 1  91 ARG N  1 1  91 ARG CA 1 1  91 ARG C      -161.5      -88.5 .  90 . C .  91 . N  .  91 . CA .  91 . C 1 1 
       146 . 1 1  91 ARG N 1 1  91 ARG CA 1 1  91 ARG C  1 1  92 SER N       115.9      178.3 .  91 . N .  91 . CA .  91 . C  .  92 . N 1 1 
       147 . 1 1  91 ARG C 1 1  92 SER N  1 1  92 SER CA 1 1  92 SER C      -100.8 -60.800003 .  91 . C .  92 . N  .  92 . CA .  92 . C 1 1 
       148 . 1 1  92 SER N 1 1  92 SER CA 1 1  92 SER C  1 1  93 ARG N       148.3      188.3 .  92 . N .  92 . CA .  92 . C  .  93 . N 1 1 
       149 . 1 1  92 SER C 1 1  93 ARG N  1 1  93 ARG CA 1 1  93 ARG C       -88.6      -39.7 .  92 . C .  93 . N  .  93 . CA .  93 . C 1 1 
       150 . 1 1  93 ARG N 1 1  93 ARG CA 1 1  93 ARG C  1 1  94 THR N       -56.3      -16.3 .  93 . N .  93 . CA .  93 . C  .  94 . N 1 1 
       151 . 1 1  93 ARG C 1 1  94 THR N  1 1  94 THR CA 1 1  94 THR C       -82.2      -42.2 .  93 . C .  94 . N  .  94 . CA .  94 . C 1 1 
       152 . 1 1  94 THR N 1 1  94 THR CA 1 1  94 THR C  1 1  95 ALA N  -62.700005      -22.7 .  94 . N .  94 . CA .  94 . C  .  95 . N 1 1 
       153 . 1 1  94 THR C 1 1  95 ALA N  1 1  95 ALA CA 1 1  95 ALA C      -116.4      -38.9 .  94 . C .  95 . N  .  95 . CA .  95 . C 1 1 
       154 . 1 1  95 ALA N 1 1  95 ALA CA 1 1  95 ALA C  1 1  96 ASP N       -51.6        6.3 .  95 . N .  95 . CA .  95 . C  .  96 . N 1 1 
       155 . 1 1  95 ALA C 1 1  96 ASP N  1 1  96 ASP CA 1 1  96 ASP C       -96.4      -41.9 .  95 . C .  96 . N  .  96 . CA .  96 . C 1 1 
       156 . 1 1  96 ASP N 1 1  96 ASP CA 1 1  96 ASP C  1 1  97 SER N  -61.399998        6.2 .  96 . N .  96 . CA .  96 . C  .  97 . N 1 1 
       157 . 1 1  96 ASP C 1 1  97 SER N  1 1  97 SER CA 1 1  97 SER C      -137.0      -63.1 .  96 . C .  97 . N  .  97 . CA .  97 . C 1 1 
       158 . 1 1  97 SER N 1 1  97 SER CA 1 1  97 SER C  1 1  98 HIS N       -34.6  30.699999 .  97 . N .  97 . CA .  97 . C  .  98 . N 1 1 
       159 . 1 1  97 SER C 1 1  98 HIS N  1 1  98 HIS CA 1 1  98 HIS C       -85.1      -42.9 .  97 . C .  98 . N  .  98 . CA .  98 . C 1 1 
       160 . 1 1  98 HIS N 1 1  98 HIS CA 1 1  98 HIS C  1 1  99 LEU N       -52.8       -5.0 .  98 . N .  98 . CA .  98 . C  .  99 . N 1 1 
       161 . 1 1  98 HIS C 1 1  99 LEU N  1 1  99 LEU CA 1 1  99 LEU C      -125.5 -47.999996 .  98 . C .  99 . N  .  99 . CA .  99 . C 1 1 
       162 . 1 1  99 LEU N 1 1  99 LEU CA 1 1  99 LEU C  1 1 100 GLY N       -72.8       41.1 .  99 . N .  99 . CA .  99 . C  . 100 . N 1 1 
       163 . 1 1  99 LEU C 1 1 100 GLY N  1 1 100 GLY CA 1 1 100 GLY C      -225.3      -94.0 .  99 . C . 100 . N  . 100 . CA . 100 . C 1 1 
       164 . 1 1 100 GLY N 1 1 100 GLY CA 1 1 100 GLY C  1 1 101 HIS N       114.1      195.3 . 100 . N . 100 . CA . 100 . C  . 101 . N 1 1 
       165 . 1 1 100 GLY C 1 1 101 HIS N  1 1 101 HIS CA 1 1 101 HIS C      -176.5     -104.4 . 100 . C . 101 . N  . 101 . CA . 101 . C 1 1 
       166 . 1 1 101 HIS N 1 1 101 HIS CA 1 1 101 HIS C  1 1 102 VAL N        98.9      164.1 . 101 . N . 101 . CA . 101 . C  . 102 . N 1 1 
       167 . 1 1 101 HIS C 1 1 102 VAL N  1 1 102 VAL CA 1 1 102 VAL C      -148.8     -108.8 . 101 . C . 102 . N  . 102 . CA . 102 . C 1 1 
       168 . 1 1 102 VAL N 1 1 102 VAL CA 1 1 102 VAL C  1 1 103 PHE N   110.49999      161.1 . 102 . N . 102 . CA . 102 . C  . 103 . N 1 1 
       169 . 1 1 102 VAL C 1 1 103 PHE N  1 1 103 PHE CA 1 1 103 PHE C      -166.6      -95.3 . 102 . C . 103 . N  . 103 . CA . 103 . C 1 1 
       170 . 1 1 103 PHE N 1 1 103 PHE CA 1 1 103 PHE C  1 1 104 ASN N       109.3  172.39998 . 103 . N . 103 . CA . 103 . C  . 104 . N 1 1 
       171 . 1 1 104 ASN C 1 1 105 ASP N  1 1 105 ASP CA 1 1 105 ASP C      -126.8      -86.8 . 104 . C . 105 . N  . 105 . CA . 105 . C 1 1 
       172 . 1 1 105 ASP N 1 1 105 ASP CA 1 1 105 ASP C  1 1 106 GLY N       -34.5  32.399998 . 105 . N . 105 . CA . 105 . C  . 106 . N 1 1 
       173 . 1 1 105 ASP C 1 1 106 GLY N  1 1 106 GLY CA 1 1 106 GLY C      -191.7      -51.7 . 105 . C . 106 . N  . 106 . CA . 106 . C 1 1 
       174 . 1 1 106 GLY N 1 1 106 GLY CA 1 1 106 GLY C  1 1 107 PRO N        72.1      212.1 . 106 . N . 106 . CA . 106 . C  . 107 . N 1 1 
       175 . 1 1 107 PRO N 1 1 107 PRO CA 1 1 107 PRO C  1 1 108 GLY N       130.3      172.8 . 107 . N . 107 . CA . 107 . C  . 108 . N 1 1 
       176 . 1 1 107 PRO C 1 1 108 GLY N  1 1 108 GLY CA 1 1 108 GLY C      -176.4      -36.4 . 107 . C . 108 . N  . 108 . CA . 108 . C 1 1 
       177 . 1 1 108 GLY N 1 1 108 GLY CA 1 1 108 GLY C  1 1 109 PRO N        61.9      201.9 . 108 . N . 108 . CA . 108 . C  . 109 . N 1 1 
       178 . 1 1 109 PRO N 1 1 109 PRO CA 1 1 109 PRO C  1 1 110 ASN N       -50.2      -10.2 . 109 . N . 109 . CA . 109 . C  . 110 . N 1 1 
       179 . 1 1 109 PRO C 1 1 110 ASN N  1 1 110 ASN CA 1 1 110 ASN C      -100.3      -59.0 . 109 . C . 110 . N  . 110 . CA . 110 . C 1 1 
       180 . 1 1 110 ASN N 1 1 110 ASN CA 1 1 110 ASN C  1 1 111 GLY N  -30.499998       20.6 . 110 . N . 110 . CA . 110 . C  . 111 . N 1 1 
       181 . 1 1 111 GLY C 1 1 112 LEU N  1 1 112 LEU CA 1 1 112 LEU C      -109.7      -53.5 . 111 . C . 112 . N  . 112 . CA . 112 . C 1 1 
       182 . 1 1 112 LEU N 1 1 112 LEU CA 1 1 112 LEU C  1 1 113 ARG N        70.9      202.8 . 112 . N . 112 . CA . 112 . C  . 113 . N 1 1 
       183 . 1 1 112 LEU C 1 1 113 ARG N  1 1 113 ARG CA 1 1 113 ARG C      -160.2 -100.69999 . 112 . C . 113 . N  . 113 . CA . 113 . C 1 1 
       184 . 1 1 113 ARG N 1 1 113 ARG CA 1 1 113 ARG C  1 1 114 TYR N  109.899994      164.4 . 113 . N . 113 . CA . 113 . C  . 114 . N 1 1 
       185 . 1 1 113 ARG C 1 1 114 TYR N  1 1 114 TYR CA 1 1 114 TYR C      -128.3 -49.899998 . 113 . C . 114 . N  . 114 . CA . 114 . C 1 1 
       186 . 1 1 114 TYR N 1 1 114 TYR CA 1 1 114 TYR C  1 1 115 CYS N        98.8      147.1 . 114 . N . 114 . CA . 114 . C  . 115 . N 1 1 
       187 . 1 1 114 TYR C 1 1 115 CYS N  1 1 115 CYS CA 1 1 115 CYS C      -132.2      -68.8 . 114 . C . 115 . N  . 115 . CA . 115 . C 1 1 
       188 . 1 1 115 CYS N 1 1 115 CYS CA 1 1 115 CYS C  1 1 116 ILE N   100.69999      140.7 . 115 . N . 115 . CA . 115 . C  . 116 . N 1 1 
       189 . 1 1 115 CYS C 1 1 116 ILE N  1 1 116 ILE CA 1 1 116 ILE C      -153.3      -65.6 . 115 . C . 116 . N  . 116 . CA . 116 . C 1 1 
       190 . 1 1 116 ILE N 1 1 116 ILE CA 1 1 116 ILE C  1 1 117 ASN N       113.9      178.2 . 116 . N . 116 . CA . 116 . C  . 117 . N 1 1 
       191 . 1 1 116 ILE C 1 1 117 ASN N  1 1 117 ASN CA 1 1 117 ASN C      -169.8      -29.8 . 116 . C . 117 . N  . 117 . CA . 117 . C 1 1 
       192 . 1 1 117 ASN N 1 1 117 ASN CA 1 1 117 ASN C  1 1 118 SER N       110.7      160.7 . 117 . N . 117 . CA . 117 . C  . 118 . N 1 1 
       193 . 1 1 117 ASN C 1 1 118 SER N  1 1 118 SER CA 1 1 118 SER C       -78.2      -38.2 . 117 . C . 118 . N  . 118 . CA . 118 . C 1 1 
       194 . 1 1 118 SER N 1 1 118 SER CA 1 1 118 SER C  1 1 119 ALA N       -56.8      -16.8 . 118 . N . 118 . CA . 118 . C  . 119 . N 1 1 
       195 . 1 1 118 SER C 1 1 119 ALA N  1 1 119 ALA CA 1 1 119 ALA C  -89.399994      -46.2 . 118 . C . 119 . N  . 119 . CA . 119 . C 1 1 
       196 . 1 1 119 ALA N 1 1 119 ALA CA 1 1 119 ALA C  1 1 120 ALA N       -42.9        6.5 . 119 . N . 119 . CA . 119 . C  . 120 . N 1 1 
       197 . 1 1 120 ALA C 1 1 121 LEU N  1 1 121 LEU CA 1 1 121 LEU C      -167.8      -82.4 . 120 . C . 121 . N  . 121 . CA . 121 . C 1 1 
       198 . 1 1 121 LEU N 1 1 121 LEU CA 1 1 121 LEU C  1 1 122 ARG N       136.2  176.19998 . 121 . N . 121 . CA . 121 . C  . 122 . N 1 1 
       199 . 1 1 121 LEU C 1 1 122 ARG N  1 1 122 ARG CA 1 1 122 ARG C      -174.9     -105.4 . 121 . C . 122 . N  . 122 . CA . 122 . C 1 1 
       200 . 1 1 122 ARG N 1 1 122 ARG CA 1 1 122 ARG C  1 1 123 PHE N       113.9      162.2 . 122 . N . 122 . CA . 122 . C  . 123 . N 1 1 
       201 . 1 1 122 ARG C 1 1 123 PHE N  1 1 123 PHE CA 1 1 123 PHE C      -153.3      -56.6 . 122 . C . 123 . N  . 123 . CA . 123 . C 1 1 
       202 . 1 1 123 PHE N 1 1 123 PHE CA 1 1 123 PHE C  1 1 124 VAL N        95.2      145.9 . 123 . N . 123 . CA . 123 . C  . 124 . N 1 1 
       203 . 1 1 123 PHE C 1 1 124 VAL N  1 1 124 VAL CA 1 1 124 VAL C      -148.7      -69.5 . 123 . C . 124 . N  . 124 . CA . 124 . C 1 1 
       204 . 1 1 124 VAL N 1 1 124 VAL CA 1 1 124 VAL C  1 1 125 PRO N        92.9      153.4 . 124 . N . 124 . CA . 124 . C  . 125 . N 1 1 
       205 . 1 1 125 PRO N 1 1 125 PRO CA 1 1 125 PRO C  1 1 126 LYS N  126.899994      166.9 . 125 . N . 125 . CA . 125 . C  . 126 . N 1 1 
       206 . 1 1 125 PRO C 1 1 126 LYS N  1 1 126 LYS CA 1 1 126 LYS C       -89.8      -23.3 . 125 . C . 126 . N  . 126 . CA . 126 . C 1 1 
       207 . 1 1 126 LYS N 1 1 126 LYS CA 1 1 126 LYS C  1 1 127 HIS N  -63.699997       -6.1 . 126 . N . 126 . CA . 126 . C  . 127 . N 1 1 
       208 . 1 1 126 LYS C 1 1 127 HIS N  1 1 127 HIS CA 1 1 127 HIS C   -85.59999      -45.6 . 126 . C . 127 . N  . 127 . CA . 127 . C 1 1 
       209 . 1 1 127 HIS N 1 1 127 HIS CA 1 1 127 HIS C  1 1 128 LYS N       -43.7  3.8000002 . 127 . N . 127 . CA . 127 . C  . 128 . N 1 1 
       210 . 1 1 127 HIS C 1 1 128 LYS N  1 1 128 LYS CA 1 1 128 LYS C  -132.69998      -47.6 . 127 . C . 128 . N  . 128 . CA . 128 . C 1 1 
       211 . 1 1 128 LYS N 1 1 128 LYS CA 1 1 128 LYS C  1 1 129 LEU N       -72.4       39.4 . 128 . N . 128 . CA . 128 . C  . 129 . N 1 1 
       212 . 1 1 128 LYS C 1 1 129 LEU N  1 1 129 LEU CA 1 1 129 LEU C       -82.3      -42.3 . 128 . C . 129 . N  . 129 . CA . 129 . C 1 1 
       213 . 1 1 129 LEU N 1 1 129 LEU CA 1 1 129 LEU C  1 1 130 LYS N  -59.400005      -19.4 . 129 . N . 129 . CA . 129 . C  . 130 . N 1 1 
       214 . 1 1 129 LEU C 1 1 130 LYS N  1 1 130 LYS CA 1 1 130 LYS C       -87.4      -47.4 . 129 . C . 130 . N  . 130 . CA . 130 . C 1 1 
       215 . 1 1 130 LYS N 1 1 130 LYS CA 1 1 130 LYS C  1 1 131 GLU N       -57.2      -11.5 . 130 . N . 130 . CA . 130 . C  . 131 . N 1 1 
       216 . 1 1 130 LYS C 1 1 131 GLU N  1 1 131 GLU CA 1 1 131 GLU C       -82.3      -42.3 . 130 . C . 131 . N  . 131 . CA . 131 . C 1 1 
       217 . 1 1 131 GLU N 1 1 131 GLU CA 1 1 131 GLU C  1 1 132 GLU N       -55.7 -15.699999 . 131 . N . 131 . CA . 131 . C  . 132 . N 1 1 
       218 . 1 1 131 GLU C 1 1 132 GLU N  1 1 132 GLU CA 1 1 132 GLU C      -102.8 -62.799995 . 131 . C . 132 . N  . 132 . CA . 132 . C 1 1 
       219 . 1 1 132 GLU N 1 1 132 GLU CA 1 1 132 GLU C  1 1 133 GLY N       -25.6       24.9 . 132 . N . 132 . CA . 132 . C  . 133 . N 1 1 
       220 . 1 1 132 GLU C 1 1 133 GLY N  1 1 133 GLY CA 1 1 133 GLY C        47.6      110.2 . 132 . C . 133 . N  . 133 . CA . 133 . C 1 1 
       221 . 1 1 133 GLY N 1 1 133 GLY CA 1 1 133 GLY C  1 1 134 TYR N        -0.2       48.3 . 133 . N . 133 . CA . 133 . C  . 134 . N 1 1 
       222 . 1 1 134 TYR C 1 1 135 GLU N  1 1 135 GLU CA 1 1 135 GLU C       -76.5      -36.5 . 134 . C . 135 . N  . 135 . CA . 135 . C 1 1 
       223 . 1 1 135 GLU N 1 1 135 GLU CA 1 1 135 GLU C  1 1 136 SER N       -58.4 -18.399998 . 135 . N . 135 . CA . 135 . C  . 136 . N 1 1 
       224 . 1 1 135 GLU C 1 1 136 SER N  1 1 136 SER CA 1 1 136 SER C   -85.59999      -45.6 . 135 . C . 136 . N  . 136 . CA . 136 . C 1 1 
       225 . 1 1 136 SER N 1 1 136 SER CA 1 1 136 SER C  1 1 137 TYR N  -46.099995       -6.1 . 136 . N . 136 . CA . 136 . C  . 137 . N 1 1 
       226 . 1 1 136 SER C 1 1 137 TYR N  1 1 137 TYR CA 1 1 137 TYR C      -109.7      -44.2 . 136 . C . 137 . N  . 137 . CA . 137 . C 1 1 
       227 . 1 1 137 TYR N 1 1 137 TYR CA 1 1 137 TYR C  1 1 138 LEU N       -64.6      -12.2 . 137 . N . 137 . CA . 137 . C  . 138 . N 1 1 
       228 . 1 1 137 TYR C 1 1 138 LEU N  1 1 138 LEU CA 1 1 138 LEU C       -80.3      -40.3 . 137 . C . 138 . N  . 138 . CA . 138 . C 1 1 
       229 . 1 1 138 LEU N 1 1 138 LEU CA 1 1 138 LEU C  1 1 139 HIS N  -62.899998      -22.9 . 138 . N . 138 . CA . 138 . C  . 139 . N 1 1 
       230 . 1 1 138 LEU C 1 1 139 HIS N  1 1 139 HIS CA 1 1 139 HIS C       -84.6      -44.6 . 138 . C . 139 . N  . 139 . CA . 139 . C 1 1 
       231 . 1 1 139 HIS N 1 1 139 HIS CA 1 1 139 HIS C  1 1 140 LEU N       -67.3       -5.5 . 139 . N . 139 . CA . 139 . C  . 140 . N 1 1 
       232 . 1 1 139 HIS C 1 1 140 LEU N  1 1 140 LEU CA 1 1 140 LEU C   -92.19999      -42.9 . 139 . C . 140 . N  . 140 . CA . 140 . C 1 1 
       233 . 1 1 140 LEU N 1 1 140 LEU CA 1 1 140 LEU C  1 1 141 PHE N       -47.3 -5.9999995 . 140 . N . 140 . CA . 140 . C  . 141 . N 1 1 
       234 . 1 1 140 LEU C 1 1 141 PHE N  1 1 141 PHE CA 1 1 141 PHE C  -123.99999      -60.9 . 140 . C . 141 . N  . 141 . CA . 141 . C 1 1 
       235 . 1 1 141 PHE N 1 1 141 PHE CA 1 1 141 PHE C  1 1 142 ASN N       -38.0       16.9 . 141 . N . 141 . CA . 141 . C  . 142 . N 1 1 
    stop_

save_


save_CNS/XPLOR_dihedral_5
    _Torsion_angle_constraint_list.Sf_category         torsion_angle_constraints
    _Torsion_angle_constraint_list.Entry_ID            1
    _Torsion_angle_constraint_list.ID                  2
    _Torsion_angle_constraint_list.Constraint_file_ID  .
    _Torsion_angle_constraint_list.Block_ID            .

    loop_
       _Torsion_angle_constraint.ID
       _Torsion_angle_constraint.Torsion_angle_name
       _Torsion_angle_constraint.Entity_assembly_ID_1
       _Torsion_angle_constraint.Entity_ID_1
       _Torsion_angle_constraint.Comp_index_ID_1
       _Torsion_angle_constraint.Comp_ID_1
       _Torsion_angle_constraint.Atom_ID_1
       _Torsion_angle_constraint.Entity_assembly_ID_2
       _Torsion_angle_constraint.Entity_ID_2
       _Torsion_angle_constraint.Comp_index_ID_2
       _Torsion_angle_constraint.Comp_ID_2
       _Torsion_angle_constraint.Atom_ID_2
       _Torsion_angle_constraint.Entity_assembly_ID_3
       _Torsion_angle_constraint.Entity_ID_3
       _Torsion_angle_constraint.Comp_index_ID_3
       _Torsion_angle_constraint.Comp_ID_3
       _Torsion_angle_constraint.Atom_ID_3
       _Torsion_angle_constraint.Entity_assembly_ID_4
       _Torsion_angle_constraint.Entity_ID_4
       _Torsion_angle_constraint.Comp_index_ID_4
       _Torsion_angle_constraint.Comp_ID_4
       _Torsion_angle_constraint.Atom_ID_4
       _Torsion_angle_constraint.Angle_lower_bound_val
       _Torsion_angle_constraint.Angle_upper_bound_val
       _Torsion_angle_constraint.Auth_asym_ID_1
       _Torsion_angle_constraint.Auth_seq_ID_1
       _Torsion_angle_constraint.Auth_comp_ID_1
       _Torsion_angle_constraint.Auth_atom_ID_1
       _Torsion_angle_constraint.Auth_asym_ID_2
       _Torsion_angle_constraint.Auth_seq_ID_2
       _Torsion_angle_constraint.Auth_comp_ID_2
       _Torsion_angle_constraint.Auth_atom_ID_2
       _Torsion_angle_constraint.Auth_asym_ID_3
       _Torsion_angle_constraint.Auth_seq_ID_3
       _Torsion_angle_constraint.Auth_comp_ID_3
       _Torsion_angle_constraint.Auth_atom_ID_3
       _Torsion_angle_constraint.Auth_asym_ID_4
       _Torsion_angle_constraint.Auth_seq_ID_4
       _Torsion_angle_constraint.Auth_comp_ID_4
       _Torsion_angle_constraint.Auth_atom_ID_4
       _Torsion_angle_constraint.Entry_ID
       _Torsion_angle_constraint.Torsion_angle_constraint_list_ID

         1 . 1 1   2 ALA C 1 1   3 TYR N  1 1   3 TYR CA 1 1   3 TYR C      -157.4      -17.4 .   2 . C .   3 . N  .   3 . CA .   3 . C 1 2 
         2 . 1 1   3 TYR N 1 1   3 TYR CA 1 1   3 TYR C  1 1   4 ASN N        92.1      167.9 .   3 . N .   3 . CA .   3 . C  .   4 . N 1 2 
         3 . 1 1   3 TYR C 1 1   4 ASN N  1 1   4 ASN CA 1 1   4 ASN C      -116.8      -61.9 .   3 . C .   4 . N  .   4 . CA .   4 . C 1 2 
         4 . 1 1   4 ASN N 1 1   4 ASN CA 1 1   4 ASN C  1 1   5 LYS N        59.9      174.2 .   4 . N .   4 . CA .   4 . C  .   5 . N 1 2 
         5 . 1 1   4 ASN C 1 1   5 LYS N  1 1   5 LYS CA 1 1   5 LYS C       -76.8 -36.799995 .   4 . C .   5 . N  .   5 . CA .   5 . C 1 2 
         6 . 1 1   5 LYS N 1 1   5 LYS CA 1 1   5 LYS C  1 1   6 GLU N  -61.199997      -13.0 .   5 . N .   5 . CA .   5 . C  .   6 . N 1 2 
         7 . 1 1   5 LYS C 1 1   6 GLU N  1 1   6 GLU CA 1 1   6 GLU C       -79.7      -39.7 .   5 . C .   6 . N  .   6 . CA .   6 . C 1 2 
         8 . 1 1   6 GLU N 1 1   6 GLU CA 1 1   6 GLU C  1 1   7 GLU N       -62.5 -22.499998 .   6 . N .   6 . CA .   6 . C  .   7 . N 1 2 
         9 . 1 1   6 GLU C 1 1   7 GLU N  1 1   7 GLU CA 1 1   7 GLU C       -86.1 -46.099995 .   6 . C .   7 . N  .   7 . CA .   7 . C 1 2 
        10 . 1 1   7 GLU N 1 1   7 GLU CA 1 1   7 GLU C  1 1   8 LYS N       -63.4      -23.4 .   7 . N .   7 . CA .   7 . C  .   8 . N 1 2 
        11 . 1 1   7 GLU C 1 1   8 LYS N  1 1   8 LYS CA 1 1   8 LYS C       -83.3      -43.3 .   7 . C .   8 . N  .   8 . CA .   8 . C 1 2 
        12 . 1 1   8 LYS N 1 1   8 LYS CA 1 1   8 LYS C  1 1   9 ILE N  -62.899998      -22.9 .   8 . N .   8 . CA .   8 . C  .   9 . N 1 2 
        13 . 1 1   8 LYS C 1 1   9 ILE N  1 1   9 ILE CA 1 1   9 ILE C       -83.3      -43.3 .   8 . C .   9 . N  .   9 . CA .   9 . C 1 2 
        14 . 1 1   9 ILE N 1 1   9 ILE CA 1 1   9 ILE C  1 1  10 LYS N  -62.199997      -22.2 .   9 . N .   9 . CA .   9 . C  .  10 . N 1 2 
        15 . 1 1   9 ILE C 1 1  10 LYS N  1 1  10 LYS CA 1 1  10 LYS C       -85.7      -45.7 .   9 . C .  10 . N  .  10 . CA .  10 . C 1 2 
        16 . 1 1  10 LYS N 1 1  10 LYS CA 1 1  10 LYS C  1 1  11 SER N  -59.099995        3.7 .  10 . N .  10 . CA .  10 . C  .  11 . N 1 2 
        17 . 1 1  10 LYS C 1 1  11 SER N  1 1  11 SER CA 1 1  11 SER C      -138.4      -43.6 .  10 . C .  11 . N  .  11 . CA .  11 . C 1 2 
        18 . 1 1  11 SER N 1 1  11 SER CA 1 1  11 SER C  1 1  12 LEU N       -76.3       47.1 .  11 . N .  11 . CA .  11 . C  .  12 . N 1 2 
        19 . 1 1  11 SER C 1 1  12 LEU N  1 1  12 LEU CA 1 1  12 LEU C      -123.5      -48.7 .  11 . C .  12 . N  .  12 . CA .  12 . C 1 2 
        20 . 1 1  12 LEU N 1 1  12 LEU CA 1 1  12 LEU C  1 1  13 ASN N       -72.3       45.2 .  12 . N .  12 . CA .  12 . C  .  13 . N 1 2 
        21 . 1 1  12 LEU C 1 1  13 ASN N  1 1  13 ASN CA 1 1  13 ASN C      -131.3 -29.700003 .  12 . C .  13 . N  .  13 . CA .  13 . C 1 2 
        22 . 1 1  13 ASN N 1 1  13 ASN CA 1 1  13 ASN C  1 1  14 ARG N       -85.8       54.2 .  13 . N .  13 . CA .  13 . C  .  14 . N 1 2 
        23 . 1 1  13 ASN C 1 1  14 ARG N  1 1  14 ARG CA 1 1  14 ARG C       -80.3      -40.3 .  13 . C .  14 . N  .  14 . CA .  14 . C 1 2 
        24 . 1 1  14 ARG N 1 1  14 ARG CA 1 1  14 ARG C  1 1  15 MET N       -57.3      -17.3 .  14 . N .  14 . CA .  14 . C  .  15 . N 1 2 
        25 . 1 1  14 ARG C 1 1  15 MET N  1 1  15 MET CA 1 1  15 MET C       -84.9      -44.9 .  14 . C .  15 . N  .  15 . CA .  15 . C 1 2 
        26 . 1 1  15 MET N 1 1  15 MET CA 1 1  15 MET C  1 1  16 GLN N  -62.199997      -22.2 .  15 . N .  15 . CA .  15 . C  .  16 . N 1 2 
        27 . 1 1  15 MET C 1 1  16 GLN N  1 1  16 GLN CA 1 1  16 GLN C       -83.9      -43.9 .  15 . C .  16 . N  .  16 . CA .  16 . C 1 2 
        28 . 1 1  16 GLN N 1 1  16 GLN CA 1 1  16 GLN C  1 1  17 TYR N  -60.200005      -20.2 .  16 . N .  16 . CA .  16 . C  .  17 . N 1 2 
        29 . 1 1  16 GLN C 1 1  17 TYR N  1 1  17 TYR CA 1 1  17 TYR C   -85.59999      -45.6 .  16 . C .  17 . N  .  17 . CA .  17 . C 1 2 
        30 . 1 1  17 TYR N 1 1  17 TYR CA 1 1  17 TYR C  1 1  18 GLU N       -62.5 -22.499998 .  17 . N .  17 . CA .  17 . C  .  18 . N 1 2 
        31 . 1 1  17 TYR C 1 1  18 GLU N  1 1  18 GLU CA 1 1  18 GLU C       -82.1      -42.1 .  17 . C .  18 . N  .  18 . CA .  18 . C 1 2 
        32 . 1 1  18 GLU N 1 1  18 GLU CA 1 1  18 GLU C  1 1  19 VAL N  -62.799995      -22.8 .  18 . N .  18 . CA .  18 . C  .  19 . N 1 2 
        33 . 1 1  18 GLU C 1 1  19 VAL N  1 1  19 VAL CA 1 1  19 VAL C       -82.4      -42.4 .  18 . C .  19 . N  .  19 . CA .  19 . C 1 2 
        34 . 1 1  19 VAL N 1 1  19 VAL CA 1 1  19 VAL C  1 1  20 THR N       -65.0      -25.0 .  19 . N .  19 . CA .  19 . C  .  20 . N 1 2 
        35 . 1 1  19 VAL C 1 1  20 THR N  1 1  20 THR CA 1 1  20 THR C       -85.5      -45.5 .  19 . C .  20 . N  .  20 . CA .  20 . C 1 2 
        36 . 1 1  20 THR N 1 1  20 THR CA 1 1  20 THR C  1 1  21 GLN N       -51.4      -10.8 .  20 . N .  20 . CA .  20 . C  .  21 . N 1 2 
        37 . 1 1  20 THR C 1 1  21 GLN N  1 1  21 GLN CA 1 1  21 GLN C      -110.2      -32.9 .  20 . C .  21 . N  .  21 . CA .  21 . C 1 2 
        38 . 1 1  21 GLN N 1 1  21 GLN CA 1 1  21 GLN C  1 1  22 ASN N       -52.2        4.0 .  21 . N .  21 . CA .  21 . C  .  22 . N 1 2 
        39 . 1 1  22 ASN C 1 1  23 ASN N  1 1  23 ASN CA 1 1  23 ASN C         0.0      140.0 .  22 . C .  23 . N  .  23 . CA .  23 . C 1 2 
        40 . 1 1  23 ASN N 1 1  23 ASN CA 1 1  23 ASN C  1 1  24 GLY N       -28.0   83.69999 .  23 . N .  23 . CA .  23 . C  .  24 . N 1 2 
        41 . 1 1  23 ASN C 1 1  24 GLY N  1 1  24 GLY CA 1 1  24 GLY C      -153.6      -27.5 .  23 . C .  24 . N  .  24 . CA .  24 . C 1 2 
        42 . 1 1  24 GLY N 1 1  24 GLY CA 1 1  24 GLY C  1 1  25 THR N       132.6      176.4 .  24 . N .  24 . CA .  24 . C  .  25 . N 1 2 
        43 . 1 1  24 GLY C 1 1  25 THR N  1 1  25 THR CA 1 1  25 THR C      -191.2      -51.2 .  24 . C .  25 . N  .  25 . CA .  25 . C 1 2 
        44 . 1 1  25 THR N 1 1  25 THR CA 1 1  25 THR C  1 1  26 GLU N   108.59999      168.2 .  25 . N .  25 . CA .  25 . C  .  26 . N 1 2 
        45 . 1 1  25 THR C 1 1  26 GLU N  1 1  26 GLU CA 1 1  26 GLU C      -146.9 -42.799995 .  25 . C .  26 . N  .  26 . CA .  26 . C 1 2 
        46 . 1 1  26 GLU N 1 1  26 GLU CA 1 1  26 GLU C  1 1  27 PRO N        92.4      183.7 .  26 . N .  26 . CA .  26 . C  .  27 . N 1 2 
        47 . 1 1  27 PRO N 1 1  27 PRO CA 1 1  27 PRO C  1 1  28 PRO N       128.7      168.7 .  27 . N .  27 . CA .  27 . C  .  28 . N 1 2 
        48 . 1 1  30 GLN C 1 1  31 ASN N  1 1  31 ASN CA 1 1  31 ASN C      -168.2      -29.9 .  30 . C .  31 . N  .  31 . CA .  31 . C 1 2 
        49 . 1 1  31 ASN N 1 1  31 ASN CA 1 1  31 ASN C  1 1  32 GLU N       146.0      186.0 .  31 . N .  31 . CA .  31 . C  .  32 . N 1 2 
        50 . 1 1  31 ASN C 1 1  32 GLU N  1 1  32 GLU CA 1 1  32 GLU C       -84.9      -44.9 .  31 . C .  32 . N  .  32 . CA .  32 . C 1 2 
        51 . 1 1  32 GLU N 1 1  32 GLU CA 1 1  32 GLU C  1 1  33 TYR N       -60.5       12.1 .  32 . N .  32 . CA .  32 . C  .  33 . N 1 2 
        52 . 1 1  32 GLU C 1 1  33 TYR N  1 1  33 TYR CA 1 1  33 TYR C      -123.7      -48.1 .  32 . C .  33 . N  .  33 . CA .  33 . C 1 2 
        53 . 1 1  33 TYR N 1 1  33 TYR CA 1 1  33 TYR C  1 1  34 TRP N       -77.5       39.4 .  33 . N .  33 . CA .  33 . C  .  34 . N 1 2 
        54 . 1 1  34 TRP C 1 1  35 ASP N  1 1  35 ASP CA 1 1  35 ASP C      -143.3      -39.1 .  34 . C .  35 . N  .  35 . CA .  35 . C 1 2 
        55 . 1 1  35 ASP N 1 1  35 ASP CA 1 1  35 ASP C  1 1  36 HIS N  -63.899998       61.1 .  35 . N .  35 . CA .  35 . C  .  36 . N 1 2 
        56 . 1 1  36 HIS C 1 1  37 LYS N  1 1  37 LYS CA 1 1  37 LYS C -125.700005      -67.2 .  36 . C .  37 . N  .  37 . CA .  37 . C 1 2 
        57 . 1 1  37 LYS N 1 1  37 LYS CA 1 1  37 LYS C  1 1  38 GLU N       -76.4       41.0 .  37 . N .  37 . CA .  37 . C  .  38 . N 1 2 
        58 . 1 1  37 LYS C 1 1  38 GLU N  1 1  38 GLU CA 1 1  38 GLU C      -188.6      -48.6 .  37 . C .  38 . N  .  38 . CA .  38 . C 1 2 
        59 . 1 1  38 GLU N 1 1  38 GLU CA 1 1  38 GLU C  1 1  39 GLU N        99.7      190.9 .  38 . N .  38 . CA .  38 . C  .  39 . N 1 2 
        60 . 1 1  38 GLU C 1 1  39 GLU N  1 1  39 GLU CA 1 1  39 GLU C      -139.0        1.0 .  38 . C .  39 . N  .  39 . CA .  39 . C 1 2 
        61 . 1 1  39 GLU N 1 1  39 GLU CA 1 1  39 GLU C  1 1  40 GLY N       114.7      154.7 .  39 . N .  39 . CA .  39 . C  .  40 . N 1 2 
        62 . 1 1  40 GLY C 1 1  41 LEU N  1 1  41 LEU CA 1 1  41 LEU C      -177.9      -80.5 .  40 . C .  41 . N  .  41 . CA .  41 . C 1 2 
        63 . 1 1  41 LEU N 1 1  41 LEU CA 1 1  41 LEU C  1 1  42 TYR N       134.8  177.49998 .  41 . N .  41 . CA .  41 . C  .  42 . N 1 2 
        64 . 1 1  41 LEU C 1 1  42 TYR N  1 1  42 TYR CA 1 1  42 TYR C      -165.0      -56.7 .  41 . C .  42 . N  .  42 . CA .  42 . C 1 2 
        65 . 1 1  42 TYR N 1 1  42 TYR CA 1 1  42 TYR C  1 1  43 VAL N       113.4      168.8 .  42 . N .  42 . CA .  42 . C  .  43 . N 1 2 
        66 . 1 1  42 TYR C 1 1  43 VAL N  1 1  43 VAL CA 1 1  43 VAL C      -163.7     -100.3 .  42 . C .  43 . N  .  43 . CA .  43 . C 1 2 
        67 . 1 1  43 VAL N 1 1  43 VAL CA 1 1  43 VAL C  1 1  44 ASP N       138.8  178.79999 .  43 . N .  43 . CA .  43 . C  .  44 . N 1 2 
        68 . 1 1  43 VAL C 1 1  44 ASP N  1 1  44 ASP CA 1 1  44 ASP C      -140.1       -0.1 .  43 . C .  44 . N  .  44 . CA .  44 . C 1 2 
        69 . 1 1  44 ASP N 1 1  44 ASP CA 1 1  44 ASP C  1 1  45 ILE N        71.5      199.0 .  44 . N .  44 . CA .  44 . C  .  45 . N 1 2 
        70 . 1 1  44 ASP C 1 1  45 ILE N  1 1  45 ILE CA 1 1  45 ILE C      -105.7 -30.699999 .  44 . C .  45 . N  .  45 . CA .  45 . C 1 2 
        71 . 1 1  45 ILE N 1 1  45 ILE CA 1 1  45 ILE C  1 1  46 VAL N       -64.1       10.1 .  45 . N .  45 . CA .  45 . C  .  46 . N 1 2 
        72 . 1 1  45 ILE C 1 1  46 VAL N  1 1  46 VAL CA 1 1  46 VAL C      -113.6      -41.0 .  45 . C .  46 . N  .  46 . CA .  46 . C 1 2 
        73 . 1 1  46 VAL N 1 1  46 VAL CA 1 1  46 VAL C  1 1  47 SER N       -67.1      -16.3 .  46 . N .  46 . CA .  46 . C  .  47 . N 1 2 
        74 . 1 1  46 VAL C 1 1  47 SER N  1 1  47 SER CA 1 1  47 SER C      -145.6      -71.6 .  46 . C .  47 . N  .  47 . CA .  47 . C 1 2 
        75 . 1 1  47 SER N 1 1  47 SER CA 1 1  47 SER C  1 1  48 GLY N       -37.9       32.0 .  47 . N .  47 . CA .  47 . C  .  48 . N 1 2 
        76 . 1 1  48 GLY C 1 1  49 LYS N  1 1  49 LYS CA 1 1  49 LYS C      -121.4      -57.3 .  48 . C .  49 . N  .  49 . CA .  49 . C 1 2 
        77 . 1 1  49 LYS N 1 1  49 LYS CA 1 1  49 LYS C  1 1  50 PRO N       115.5      163.8 .  49 . N .  49 . CA .  49 . C  .  50 . N 1 2 
        78 . 1 1  50 PRO N 1 1  50 PRO CA 1 1  50 PRO C  1 1  51 LEU N       123.5      163.5 .  50 . N .  50 . CA .  50 . C  .  51 . N 1 2 
        79 . 1 1  51 LEU C 1 1  52 PHE N  1 1  52 PHE CA 1 1  52 PHE C      -172.5      -91.2 .  51 . C .  52 . N  .  52 . CA .  52 . C 1 2 
        80 . 1 1  52 PHE N 1 1  52 PHE CA 1 1  52 PHE C  1 1  53 THR N       133.7  173.69998 .  52 . N .  52 . CA .  52 . C  .  53 . N 1 2 
        81 . 1 1  52 PHE C 1 1  53 THR N  1 1  53 THR CA 1 1  53 THR C      -137.4      -47.4 .  52 . C .  53 . N  .  53 . CA .  53 . C 1 2 
        82 . 1 1  53 THR N 1 1  53 THR CA 1 1  53 THR C  1 1  54 SER N       150.0      190.0 .  53 . N .  53 . CA .  53 . C  .  54 . N 1 2 
        83 . 1 1  53 THR C 1 1  54 SER N  1 1  54 SER CA 1 1  54 SER C       -79.7      -39.7 .  53 . C .  54 . N  .  54 . CA .  54 . C 1 2 
        84 . 1 1  54 SER N 1 1  54 SER CA 1 1  54 SER C  1 1  55 LYS N       -56.9      -16.9 .  54 . N .  54 . CA .  54 . C  .  55 . N 1 2 
        85 . 1 1  54 SER C 1 1  55 LYS N  1 1  55 LYS CA 1 1  55 LYS C       -87.0      -47.0 .  54 . C .  55 . N  .  55 . CA .  55 . C 1 2 
        86 . 1 1  55 LYS N 1 1  55 LYS CA 1 1  55 LYS C  1 1  56 ASP N       -51.1       -5.1 .  55 . N .  55 . CA .  55 . C  .  56 . N 1 2 
        87 . 1 1  56 ASP C 1 1  57 LYS N  1 1  57 LYS CA 1 1  57 LYS C      -143.2  -75.49999 .  56 . C .  57 . N  .  57 . CA .  57 . C 1 2 
        88 . 1 1  57 LYS N 1 1  57 LYS CA 1 1  57 LYS C  1 1  58 PHE N        94.4      157.4 .  57 . N .  57 . CA .  57 . C  .  58 . N 1 2 
        89 . 1 1  57 LYS C 1 1  58 PHE N  1 1  58 PHE CA 1 1  58 PHE C      -161.6     -106.3 .  57 . C .  58 . N  .  58 . CA .  58 . C 1 2 
        90 . 1 1  58 PHE N 1 1  58 PHE CA 1 1  58 PHE C  1 1  59 ASP N       135.6      175.6 .  58 . N .  58 . CA .  58 . C  .  59 . N 1 2 
        91 . 1 1  58 PHE C 1 1  59 ASP N  1 1  59 ASP CA 1 1  59 ASP C      -102.3 -53.199997 .  58 . C .  59 . N  .  59 . CA .  59 . C 1 2 
        92 . 1 1  59 ASP N 1 1  59 ASP CA 1 1  59 ASP C  1 1  60 SER N       120.9      160.9 .  59 . N .  59 . CA .  59 . C  .  60 . N 1 2 
        93 . 1 1  59 ASP C 1 1  60 SER N  1 1  60 SER CA 1 1  60 SER C      -151.9      -46.5 .  59 . C .  60 . N  .  60 . CA .  60 . C 1 2 
        94 . 1 1  60 SER N 1 1  60 SER CA 1 1  60 SER C  1 1  61 GLN N   63.500004      203.5 .  60 . N .  60 . CA .  60 . C  .  61 . N 1 2 
        95 . 1 1  60 SER C 1 1  61 GLN N  1 1  61 GLN CA 1 1  61 GLN C       -92.9      -46.6 .  60 . C .  61 . N  .  61 . CA .  61 . C 1 2 
        96 . 1 1  61 GLN N 1 1  61 GLN CA 1 1  61 GLN C  1 1  62 CYS N       -40.9        5.4 .  61 . N .  61 . CA .  61 . C  .  62 . N 1 2 
        97 . 1 1  61 GLN C 1 1  62 CYS N  1 1  62 CYS CA 1 1  62 CYS C -120.799995      -60.6 .  61 . C .  62 . N  .  62 . CA .  62 . C 1 2 
        98 . 1 1  62 CYS N 1 1  62 CYS CA 1 1  62 CYS C  1 1  63 GLY N       -26.3       36.0 .  62 . N .  62 . CA .  62 . C  .  63 . N 1 2 
        99 . 1 1  63 GLY C 1 1  64 TRP N  1 1  64 TRP CA 1 1  64 TRP C      -121.4 -54.299995 .  63 . C .  64 . N  .  64 . CA .  64 . C 1 2 
       100 . 1 1  64 TRP N 1 1  64 TRP CA 1 1  64 TRP C  1 1  65 PRO N  119.100006      167.7 .  64 . N .  64 . CA .  64 . C  .  65 . N 1 2 
       101 . 1 1  65 PRO N 1 1  65 PRO CA 1 1  65 PRO C  1 1  66 SER N  117.899994      170.4 .  65 . N .  65 . CA .  65 . C  .  66 . N 1 2 
       102 . 1 1  65 PRO C 1 1  66 SER N  1 1  66 SER CA 1 1  66 SER C      -165.2      -89.9 .  65 . C .  66 . N  .  66 . CA .  66 . C 1 2 
       103 . 1 1  66 SER N 1 1  66 SER CA 1 1  66 SER C  1 1  67 PHE N        92.7      183.7 .  66 . N .  66 . CA .  66 . C  .  67 . N 1 2 
       104 . 1 1  66 SER C 1 1  67 PHE N  1 1  67 PHE CA 1 1  67 PHE C      -157.6      -83.9 .  66 . C .  67 . N  .  67 . CA .  67 . C 1 2 
       105 . 1 1  67 PHE N 1 1  67 PHE CA 1 1  67 PHE C  1 1  68 THR N   118.99999      180.6 .  67 . N .  67 . CA .  67 . C  .  68 . N 1 2 
       106 . 1 1  67 PHE C 1 1  68 THR N  1 1  68 THR CA 1 1  68 THR C      -105.3 -56.199997 .  67 . C .  68 . N  .  68 . CA .  68 . C 1 2 
       107 . 1 1  68 THR N 1 1  68 THR CA 1 1  68 THR C  1 1  69 LYS N  -43.099995       -3.1 .  68 . N .  68 . CA .  68 . C  .  69 . N 1 2 
       108 . 1 1  68 THR C 1 1  69 LYS N  1 1  69 LYS CA 1 1  69 LYS C      -186.4      -46.4 .  68 . C .  69 . N  .  69 . CA .  69 . C 1 2 
       109 . 1 1  69 LYS N 1 1  69 LYS CA 1 1  69 LYS C  1 1  70 PRO N        64.4  195.79999 .  69 . N .  69 . CA .  69 . C  .  70 . N 1 2 
       110 . 1 1  70 PRO N 1 1  70 PRO CA 1 1  70 PRO C  1 1  71 ILE N       125.0      177.6 .  70 . N .  70 . CA .  70 . C  .  71 . N 1 2 
       111 . 1 1  71 ILE C 1 1  72 GLU N  1 1  72 GLU CA 1 1  72 GLU C       -79.7      -39.7 .  71 . C .  72 . N  .  72 . CA .  72 . C 1 2 
       112 . 1 1  72 GLU N 1 1  72 GLU CA 1 1  72 GLU C  1 1  73 GLU N       -63.2      -17.4 .  72 . N .  72 . CA .  72 . C  .  73 . N 1 2 
       113 . 1 1  72 GLU C 1 1  73 GLU N  1 1  73 GLU CA 1 1  73 GLU C       -96.7      -41.4 .  72 . C .  73 . N  .  73 . CA .  73 . C 1 2 
       114 . 1 1  73 GLU N 1 1  73 GLU CA 1 1  73 GLU C  1 1  74 GLU N       -46.8  13.299999 .  73 . N .  73 . CA .  73 . C  .  74 . N 1 2 
       115 . 1 1  73 GLU C 1 1  74 GLU N  1 1  74 GLU CA 1 1  74 GLU C      -124.6      -77.6 .  73 . C .  74 . N  .  74 . CA .  74 . C 1 2 
       116 . 1 1  74 GLU N 1 1  74 GLU CA 1 1  74 GLU C  1 1  75 VAL N       -29.8       19.3 .  74 . N .  74 . CA .  74 . C  .  75 . N 1 2 
       117 . 1 1  74 GLU C 1 1  75 VAL N  1 1  75 VAL CA 1 1  75 VAL C      -160.5      -81.2 .  74 . C .  75 . N  .  75 . CA .  75 . C 1 2 
       118 . 1 1  75 VAL N 1 1  75 VAL CA 1 1  75 VAL C  1 1  76 GLU N       111.0      157.5 .  75 . N .  75 . CA .  75 . C  .  76 . N 1 2 
       119 . 1 1  75 VAL C 1 1  76 GLU N  1 1  76 GLU CA 1 1  76 GLU C      -149.3     -102.2 .  75 . C .  76 . N  .  76 . CA .  76 . C 1 2 
       120 . 1 1  76 GLU N 1 1  76 GLU CA 1 1  76 GLU C  1 1  77 GLU N       122.3      165.8 .  76 . N .  76 . CA .  76 . C  .  77 . N 1 2 
       121 . 1 1  76 GLU C 1 1  77 GLU N  1 1  77 GLU CA 1 1  77 GLU C  -129.59999 -62.700005 .  76 . C .  77 . N  .  77 . CA .  77 . C 1 2 
       122 . 1 1  77 GLU N 1 1  77 GLU CA 1 1  77 GLU C  1 1  78 LYS N  114.299995      154.3 .  77 . N .  77 . CA .  77 . C  .  78 . N 1 2 
       123 . 1 1  77 GLU C 1 1  78 LYS N  1 1  78 LYS CA 1 1  78 LYS C      -169.7     -105.6 .  77 . C .  78 . N  .  78 . CA .  78 . C 1 2 
       124 . 1 1  78 LYS N 1 1  78 LYS CA 1 1  78 LYS C  1 1  79 LEU N        90.7      177.9 .  78 . N .  78 . CA .  78 . C  .  79 . N 1 2 
       125 . 1 1  78 LYS C 1 1  79 LEU N  1 1  79 LEU CA 1 1  79 LEU C      -110.6      -44.0 .  78 . C .  79 . N  .  79 . CA .  79 . C 1 2 
       126 . 1 1  79 LEU N 1 1  79 LEU CA 1 1  79 LEU C  1 1  80 ASP N       110.0      153.9 .  79 . N .  79 . CA .  79 . C  .  80 . N 1 2 
       127 . 1 1  79 LEU C 1 1  80 ASP N  1 1  80 ASP CA 1 1  80 ASP C      -145.9      -79.4 .  79 . C .  80 . N  .  80 . CA .  80 . C 1 2 
       128 . 1 1  80 ASP N 1 1  80 ASP CA 1 1  80 ASP C  1 1  81 THR N       114.4      169.6 .  80 . N .  80 . CA .  80 . C  .  81 . N 1 2 
       129 . 1 1  81 THR C 1 1  82 SER N  1 1  82 SER CA 1 1  82 SER C       -78.8      -38.8 .  81 . C .  82 . N  .  82 . CA .  82 . C 1 2 
       130 . 1 1  82 SER N 1 1  82 SER CA 1 1  82 SER C  1 1  83 HIS N       -57.8        2.1 .  82 . N .  82 . CA .  82 . C  .  83 . N 1 2 
       131 . 1 1  83 HIS C 1 1  84 GLY N  1 1  84 GLY CA 1 1  84 GLY C        45.9  121.09999 .  83 . C .  84 . N  .  84 . CA .  84 . C 1 2 
       132 . 1 1  84 GLY N 1 1  84 GLY CA 1 1  84 GLY C  1 1  85 MET N       -24.3       56.1 .  84 . N .  84 . CA .  84 . C  .  85 . N 1 2 
       133 . 1 1  84 GLY C 1 1  85 MET N  1 1  85 MET CA 1 1  85 MET C      -154.3      -84.0 .  84 . C .  85 . N  .  85 . CA .  85 . C 1 2 
       134 . 1 1  85 MET N 1 1  85 MET CA 1 1  85 MET C  1 1  86 ILE N       140.4      182.5 .  85 . N .  85 . CA .  85 . C  .  86 . N 1 2 
       135 . 1 1  85 MET C 1 1  86 ILE N  1 1  86 ILE CA 1 1  86 ILE C      -129.5      -68.5 .  85 . C .  86 . N  .  86 . CA .  86 . C 1 2 
       136 . 1 1  86 ILE N 1 1  86 ILE CA 1 1  86 ILE C  1 1  87 ARG N   112.69999      152.7 .  86 . N .  86 . CA .  86 . C  .  87 . N 1 2 
       137 . 1 1  86 ILE C 1 1  87 ARG N  1 1  87 ARG CA 1 1  87 ARG C      -203.6 -63.599995 .  86 . C .  87 . N  .  87 . CA .  87 . C 1 2 
       138 . 1 1  87 ARG N 1 1  87 ARG CA 1 1  87 ARG C  1 1  88 THR N       108.7      182.8 .  87 . N .  87 . CA .  87 . C  .  88 . N 1 2 
       139 . 1 1  87 ARG C 1 1  88 THR N  1 1  88 THR CA 1 1  88 THR C      -130.0      -67.5 .  87 . C .  88 . N  .  88 . CA .  88 . C 1 2 
       140 . 1 1  88 THR N 1 1  88 THR CA 1 1  88 THR C  1 1  89 GLU N       101.5      141.5 .  88 . N .  88 . CA .  88 . C  .  89 . N 1 2 
       141 . 1 1  88 THR C 1 1  89 GLU N  1 1  89 GLU CA 1 1  89 GLU C      -149.9  -81.49999 .  88 . C .  89 . N  .  89 . CA .  89 . C 1 2 
       142 . 1 1  89 GLU N 1 1  89 GLU CA 1 1  89 GLU C  1 1  90 VAL N        81.6      176.0 .  89 . N .  89 . CA .  89 . C  .  90 . N 1 2 
       143 . 1 1  89 GLU C 1 1  90 VAL N  1 1  90 VAL CA 1 1  90 VAL C      -162.9      -93.3 .  89 . C .  90 . N  .  90 . CA .  90 . C 1 2 
       144 . 1 1  90 VAL N 1 1  90 VAL CA 1 1  90 VAL C  1 1  91 ARG N        94.5      193.5 .  90 . N .  90 . CA .  90 . C  .  91 . N 1 2 
       145 . 1 1  90 VAL C 1 1  91 ARG N  1 1  91 ARG CA 1 1  91 ARG C      -161.5      -88.5 .  90 . C .  91 . N  .  91 . CA .  91 . C 1 2 
       146 . 1 1  91 ARG N 1 1  91 ARG CA 1 1  91 ARG C  1 1  92 SER N       115.9      178.3 .  91 . N .  91 . CA .  91 . C  .  92 . N 1 2 
       147 . 1 1  91 ARG C 1 1  92 SER N  1 1  92 SER CA 1 1  92 SER C      -100.8 -60.800003 .  91 . C .  92 . N  .  92 . CA .  92 . C 1 2 
       148 . 1 1  92 SER N 1 1  92 SER CA 1 1  92 SER C  1 1  93 ARG N       148.3      188.3 .  92 . N .  92 . CA .  92 . C  .  93 . N 1 2 
       149 . 1 1  92 SER C 1 1  93 ARG N  1 1  93 ARG CA 1 1  93 ARG C       -88.6      -39.7 .  92 . C .  93 . N  .  93 . CA .  93 . C 1 2 
       150 . 1 1  93 ARG N 1 1  93 ARG CA 1 1  93 ARG C  1 1  94 THR N       -56.3      -16.3 .  93 . N .  93 . CA .  93 . C  .  94 . N 1 2 
       151 . 1 1  93 ARG C 1 1  94 THR N  1 1  94 THR CA 1 1  94 THR C       -82.2      -42.2 .  93 . C .  94 . N  .  94 . CA .  94 . C 1 2 
       152 . 1 1  94 THR N 1 1  94 THR CA 1 1  94 THR C  1 1  95 ALA N  -62.700005      -22.7 .  94 . N .  94 . CA .  94 . C  .  95 . N 1 2 
       153 . 1 1  94 THR C 1 1  95 ALA N  1 1  95 ALA CA 1 1  95 ALA C      -116.4      -38.9 .  94 . C .  95 . N  .  95 . CA .  95 . C 1 2 
       154 . 1 1  95 ALA N 1 1  95 ALA CA 1 1  95 ALA C  1 1  96 ASP N       -51.6        6.3 .  95 . N .  95 . CA .  95 . C  .  96 . N 1 2 
       155 . 1 1  95 ALA C 1 1  96 ASP N  1 1  96 ASP CA 1 1  96 ASP C       -96.4      -41.9 .  95 . C .  96 . N  .  96 . CA .  96 . C 1 2 
       156 . 1 1  96 ASP N 1 1  96 ASP CA 1 1  96 ASP C  1 1  97 SER N  -61.399998        6.2 .  96 . N .  96 . CA .  96 . C  .  97 . N 1 2 
       157 . 1 1  96 ASP C 1 1  97 SER N  1 1  97 SER CA 1 1  97 SER C      -137.0      -63.1 .  96 . C .  97 . N  .  97 . CA .  97 . C 1 2 
       158 . 1 1  97 SER N 1 1  97 SER CA 1 1  97 SER C  1 1  98 HIS N       -34.6  30.699999 .  97 . N .  97 . CA .  97 . C  .  98 . N 1 2 
       159 . 1 1  97 SER C 1 1  98 HIS N  1 1  98 HIS CA 1 1  98 HIS C       -85.1      -42.9 .  97 . C .  98 . N  .  98 . CA .  98 . C 1 2 
       160 . 1 1  98 HIS N 1 1  98 HIS CA 1 1  98 HIS C  1 1  99 LEU N       -52.8       -5.0 .  98 . N .  98 . CA .  98 . C  .  99 . N 1 2 
       161 . 1 1  98 HIS C 1 1  99 LEU N  1 1  99 LEU CA 1 1  99 LEU C      -125.5 -47.999996 .  98 . C .  99 . N  .  99 . CA .  99 . C 1 2 
       162 . 1 1  99 LEU N 1 1  99 LEU CA 1 1  99 LEU C  1 1 100 GLY N       -72.8       41.1 .  99 . N .  99 . CA .  99 . C  . 100 . N 1 2 
       163 . 1 1  99 LEU C 1 1 100 GLY N  1 1 100 GLY CA 1 1 100 GLY C      -225.3      -94.0 .  99 . C . 100 . N  . 100 . CA . 100 . C 1 2 
       164 . 1 1 100 GLY N 1 1 100 GLY CA 1 1 100 GLY C  1 1 101 HIS N       114.1      195.3 . 100 . N . 100 . CA . 100 . C  . 101 . N 1 2 
       165 . 1 1 100 GLY C 1 1 101 HIS N  1 1 101 HIS CA 1 1 101 HIS C      -176.5     -104.4 . 100 . C . 101 . N  . 101 . CA . 101 . C 1 2 
       166 . 1 1 101 HIS N 1 1 101 HIS CA 1 1 101 HIS C  1 1 102 VAL N        98.9      164.1 . 101 . N . 101 . CA . 101 . C  . 102 . N 1 2 
       167 . 1 1 101 HIS C 1 1 102 VAL N  1 1 102 VAL CA 1 1 102 VAL C      -148.8     -108.8 . 101 . C . 102 . N  . 102 . CA . 102 . C 1 2 
       168 . 1 1 102 VAL N 1 1 102 VAL CA 1 1 102 VAL C  1 1 103 PHE N   110.49999      161.1 . 102 . N . 102 . CA . 102 . C  . 103 . N 1 2 
       169 . 1 1 102 VAL C 1 1 103 PHE N  1 1 103 PHE CA 1 1 103 PHE C      -166.6      -95.3 . 102 . C . 103 . N  . 103 . CA . 103 . C 1 2 
       170 . 1 1 103 PHE N 1 1 103 PHE CA 1 1 103 PHE C  1 1 104 ASN N       109.3  172.39998 . 103 . N . 103 . CA . 103 . C  . 104 . N 1 2 
       171 . 1 1 104 ASN C 1 1 105 ASP N  1 1 105 ASP CA 1 1 105 ASP C      -126.8      -86.8 . 104 . C . 105 . N  . 105 . CA . 105 . C 1 2 
       172 . 1 1 105 ASP N 1 1 105 ASP CA 1 1 105 ASP C  1 1 106 GLY N       -34.5  32.399998 . 105 . N . 105 . CA . 105 . C  . 106 . N 1 2 
       173 . 1 1 105 ASP C 1 1 106 GLY N  1 1 106 GLY CA 1 1 106 GLY C      -191.7      -51.7 . 105 . C . 106 . N  . 106 . CA . 106 . C 1 2 
       174 . 1 1 106 GLY N 1 1 106 GLY CA 1 1 106 GLY C  1 1 107 PRO N        72.1      212.1 . 106 . N . 106 . CA . 106 . C  . 107 . N 1 2 
       175 . 1 1 107 PRO N 1 1 107 PRO CA 1 1 107 PRO C  1 1 108 GLY N       130.3      172.8 . 107 . N . 107 . CA . 107 . C  . 108 . N 1 2 
       176 . 1 1 107 PRO C 1 1 108 GLY N  1 1 108 GLY CA 1 1 108 GLY C      -176.4      -36.4 . 107 . C . 108 . N  . 108 . CA . 108 . C 1 2 
       177 . 1 1 108 GLY N 1 1 108 GLY CA 1 1 108 GLY C  1 1 109 PRO N        61.9      201.9 . 108 . N . 108 . CA . 108 . C  . 109 . N 1 2 
       178 . 1 1 109 PRO N 1 1 109 PRO CA 1 1 109 PRO C  1 1 110 ASN N       -50.2      -10.2 . 109 . N . 109 . CA . 109 . C  . 110 . N 1 2 
       179 . 1 1 109 PRO C 1 1 110 ASN N  1 1 110 ASN CA 1 1 110 ASN C      -100.3      -59.0 . 109 . C . 110 . N  . 110 . CA . 110 . C 1 2 
       180 . 1 1 110 ASN N 1 1 110 ASN CA 1 1 110 ASN C  1 1 111 GLY N  -30.499998       20.6 . 110 . N . 110 . CA . 110 . C  . 111 . N 1 2 
       181 . 1 1 111 GLY C 1 1 112 LEU N  1 1 112 LEU CA 1 1 112 LEU C      -109.7      -53.5 . 111 . C . 112 . N  . 112 . CA . 112 . C 1 2 
       182 . 1 1 112 LEU N 1 1 112 LEU CA 1 1 112 LEU C  1 1 113 ARG N        70.9      202.8 . 112 . N . 112 . CA . 112 . C  . 113 . N 1 2 
       183 . 1 1 112 LEU C 1 1 113 ARG N  1 1 113 ARG CA 1 1 113 ARG C      -160.2 -100.69999 . 112 . C . 113 . N  . 113 . CA . 113 . C 1 2 
       184 . 1 1 113 ARG N 1 1 113 ARG CA 1 1 113 ARG C  1 1 114 TYR N  109.899994      164.4 . 113 . N . 113 . CA . 113 . C  . 114 . N 1 2 
       185 . 1 1 113 ARG C 1 1 114 TYR N  1 1 114 TYR CA 1 1 114 TYR C      -128.3 -49.899998 . 113 . C . 114 . N  . 114 . CA . 114 . C 1 2 
       186 . 1 1 114 TYR N 1 1 114 TYR CA 1 1 114 TYR C  1 1 115 CYS N        98.8      147.1 . 114 . N . 114 . CA . 114 . C  . 115 . N 1 2 
       187 . 1 1 114 TYR C 1 1 115 CYS N  1 1 115 CYS CA 1 1 115 CYS C      -132.2      -68.8 . 114 . C . 115 . N  . 115 . CA . 115 . C 1 2 
       188 . 1 1 115 CYS N 1 1 115 CYS CA 1 1 115 CYS C  1 1 116 ILE N   100.69999      140.7 . 115 . N . 115 . CA . 115 . C  . 116 . N 1 2 
       189 . 1 1 115 CYS C 1 1 116 ILE N  1 1 116 ILE CA 1 1 116 ILE C      -153.3      -65.6 . 115 . C . 116 . N  . 116 . CA . 116 . C 1 2 
       190 . 1 1 116 ILE N 1 1 116 ILE CA 1 1 116 ILE C  1 1 117 ASN N       113.9      178.2 . 116 . N . 116 . CA . 116 . C  . 117 . N 1 2 
       191 . 1 1 116 ILE C 1 1 117 ASN N  1 1 117 ASN CA 1 1 117 ASN C      -169.8      -29.8 . 116 . C . 117 . N  . 117 . CA . 117 . C 1 2 
       192 . 1 1 117 ASN N 1 1 117 ASN CA 1 1 117 ASN C  1 1 118 SER N       110.7      160.7 . 117 . N . 117 . CA . 117 . C  . 118 . N 1 2 
       193 . 1 1 117 ASN C 1 1 118 SER N  1 1 118 SER CA 1 1 118 SER C       -78.2      -38.2 . 117 . C . 118 . N  . 118 . CA . 118 . C 1 2 
       194 . 1 1 118 SER N 1 1 118 SER CA 1 1 118 SER C  1 1 119 ALA N       -56.8      -16.8 . 118 . N . 118 . CA . 118 . C  . 119 . N 1 2 
       195 . 1 1 118 SER C 1 1 119 ALA N  1 1 119 ALA CA 1 1 119 ALA C  -89.399994      -46.2 . 118 . C . 119 . N  . 119 . CA . 119 . C 1 2 
       196 . 1 1 119 ALA N 1 1 119 ALA CA 1 1 119 ALA C  1 1 120 ALA N       -42.9        6.5 . 119 . N . 119 . CA . 119 . C  . 120 . N 1 2 
       197 . 1 1 120 ALA C 1 1 121 LEU N  1 1 121 LEU CA 1 1 121 LEU C      -167.8      -82.4 . 120 . C . 121 . N  . 121 . CA . 121 . C 1 2 
       198 . 1 1 121 LEU N 1 1 121 LEU CA 1 1 121 LEU C  1 1 122 ARG N       136.2  176.19998 . 121 . N . 121 . CA . 121 . C  . 122 . N 1 2 
       199 . 1 1 121 LEU C 1 1 122 ARG N  1 1 122 ARG CA 1 1 122 ARG C      -174.9     -105.4 . 121 . C . 122 . N  . 122 . CA . 122 . C 1 2 
       200 . 1 1 122 ARG N 1 1 122 ARG CA 1 1 122 ARG C  1 1 123 PHE N       113.9      162.2 . 122 . N . 122 . CA . 122 . C  . 123 . N 1 2 
       201 . 1 1 122 ARG C 1 1 123 PHE N  1 1 123 PHE CA 1 1 123 PHE C      -153.3      -56.6 . 122 . C . 123 . N  . 123 . CA . 123 . C 1 2 
       202 . 1 1 123 PHE N 1 1 123 PHE CA 1 1 123 PHE C  1 1 124 VAL N        95.2      145.9 . 123 . N . 123 . CA . 123 . C  . 124 . N 1 2 
       203 . 1 1 123 PHE C 1 1 124 VAL N  1 1 124 VAL CA 1 1 124 VAL C      -148.7      -69.5 . 123 . C . 124 . N  . 124 . CA . 124 . C 1 2 
       204 . 1 1 124 VAL N 1 1 124 VAL CA 1 1 124 VAL C  1 1 125 PRO N        92.9      153.4 . 124 . N . 124 . CA . 124 . C  . 125 . N 1 2 
       205 . 1 1 125 PRO N 1 1 125 PRO CA 1 1 125 PRO C  1 1 126 LYS N  126.899994      166.9 . 125 . N . 125 . CA . 125 . C  . 126 . N 1 2 
       206 . 1 1 125 PRO C 1 1 126 LYS N  1 1 126 LYS CA 1 1 126 LYS C       -89.8      -23.3 . 125 . C . 126 . N  . 126 . CA . 126 . C 1 2 
       207 . 1 1 126 LYS N 1 1 126 LYS CA 1 1 126 LYS C  1 1 127 HIS N  -63.699997       -6.1 . 126 . N . 126 . CA . 126 . C  . 127 . N 1 2 
       208 . 1 1 126 LYS C 1 1 127 HIS N  1 1 127 HIS CA 1 1 127 HIS C   -85.59999      -45.6 . 126 . C . 127 . N  . 127 . CA . 127 . C 1 2 
       209 . 1 1 127 HIS N 1 1 127 HIS CA 1 1 127 HIS C  1 1 128 LYS N       -43.7  3.8000002 . 127 . N . 127 . CA . 127 . C  . 128 . N 1 2 
       210 . 1 1 127 HIS C 1 1 128 LYS N  1 1 128 LYS CA 1 1 128 LYS C  -132.69998      -47.6 . 127 . C . 128 . N  . 128 . CA . 128 . C 1 2 
       211 . 1 1 128 LYS N 1 1 128 LYS CA 1 1 128 LYS C  1 1 129 LEU N       -72.4       39.4 . 128 . N . 128 . CA . 128 . C  . 129 . N 1 2 
       212 . 1 1 128 LYS C 1 1 129 LEU N  1 1 129 LEU CA 1 1 129 LEU C       -82.3      -42.3 . 128 . C . 129 . N  . 129 . CA . 129 . C 1 2 
       213 . 1 1 129 LEU N 1 1 129 LEU CA 1 1 129 LEU C  1 1 130 LYS N  -59.400005      -19.4 . 129 . N . 129 . CA . 129 . C  . 130 . N 1 2 
       214 . 1 1 129 LEU C 1 1 130 LYS N  1 1 130 LYS CA 1 1 130 LYS C       -87.4      -47.4 . 129 . C . 130 . N  . 130 . CA . 130 . C 1 2 
       215 . 1 1 130 LYS N 1 1 130 LYS CA 1 1 130 LYS C  1 1 131 GLU N       -57.2      -11.5 . 130 . N . 130 . CA . 130 . C  . 131 . N 1 2 
       216 . 1 1 130 LYS C 1 1 131 GLU N  1 1 131 GLU CA 1 1 131 GLU C       -82.3      -42.3 . 130 . C . 131 . N  . 131 . CA . 131 . C 1 2 
       217 . 1 1 131 GLU N 1 1 131 GLU CA 1 1 131 GLU C  1 1 132 GLU N       -55.7 -15.699999 . 131 . N . 131 . CA . 131 . C  . 132 . N 1 2 
       218 . 1 1 131 GLU C 1 1 132 GLU N  1 1 132 GLU CA 1 1 132 GLU C      -102.8 -62.799995 . 131 . C . 132 . N  . 132 . CA . 132 . C 1 2 
       219 . 1 1 132 GLU N 1 1 132 GLU CA 1 1 132 GLU C  1 1 133 GLY N       -25.6       24.9 . 132 . N . 132 . CA . 132 . C  . 133 . N 1 2 
       220 . 1 1 132 GLU C 1 1 133 GLY N  1 1 133 GLY CA 1 1 133 GLY C        47.6      110.2 . 132 . C . 133 . N  . 133 . CA . 133 . C 1 2 
       221 . 1 1 133 GLY N 1 1 133 GLY CA 1 1 133 GLY C  1 1 134 TYR N        -0.2       48.3 . 133 . N . 133 . CA . 133 . C  . 134 . N 1 2 
       222 . 1 1 134 TYR C 1 1 135 GLU N  1 1 135 GLU CA 1 1 135 GLU C       -76.5      -36.5 . 134 . C . 135 . N  . 135 . CA . 135 . C 1 2 
       223 . 1 1 135 GLU N 1 1 135 GLU CA 1 1 135 GLU C  1 1 136 SER N       -58.4 -18.399998 . 135 . N . 135 . CA . 135 . C  . 136 . N 1 2 
       224 . 1 1 135 GLU C 1 1 136 SER N  1 1 136 SER CA 1 1 136 SER C   -85.59999      -45.6 . 135 . C . 136 . N  . 136 . CA . 136 . C 1 2 
       225 . 1 1 136 SER N 1 1 136 SER CA 1 1 136 SER C  1 1 137 TYR N  -46.099995       -6.1 . 136 . N . 136 . CA . 136 . C  . 137 . N 1 2 
       226 . 1 1 136 SER C 1 1 137 TYR N  1 1 137 TYR CA 1 1 137 TYR C      -109.7      -44.2 . 136 . C . 137 . N  . 137 . CA . 137 . C 1 2 
       227 . 1 1 137 TYR N 1 1 137 TYR CA 1 1 137 TYR C  1 1 138 LEU N       -64.6      -12.2 . 137 . N . 137 . CA . 137 . C  . 138 . N 1 2 
       228 . 1 1 137 TYR C 1 1 138 LEU N  1 1 138 LEU CA 1 1 138 LEU C       -80.3      -40.3 . 137 . C . 138 . N  . 138 . CA . 138 . C 1 2 
       229 . 1 1 138 LEU N 1 1 138 LEU CA 1 1 138 LEU C  1 1 139 HIS N  -62.899998      -22.9 . 138 . N . 138 . CA . 138 . C  . 139 . N 1 2 
       230 . 1 1 138 LEU C 1 1 139 HIS N  1 1 139 HIS CA 1 1 139 HIS C       -84.6      -44.6 . 138 . C . 139 . N  . 139 . CA . 139 . C 1 2 
       231 . 1 1 139 HIS N 1 1 139 HIS CA 1 1 139 HIS C  1 1 140 LEU N       -67.3       -5.5 . 139 . N . 139 . CA . 139 . C  . 140 . N 1 2 
       232 . 1 1 139 HIS C 1 1 140 LEU N  1 1 140 LEU CA 1 1 140 LEU C   -92.19999      -42.9 . 139 . C . 140 . N  . 140 . CA . 140 . C 1 2 
       233 . 1 1 140 LEU N 1 1 140 LEU CA 1 1 140 LEU C  1 1 141 PHE N       -47.3 -5.9999995 . 140 . N . 140 . CA . 140 . C  . 141 . N 1 2 
       234 . 1 1 140 LEU C 1 1 141 PHE N  1 1 141 PHE CA 1 1 141 PHE C  -123.99999      -60.9 . 140 . C . 141 . N  . 141 . CA . 141 . C 1 2 
       235 . 1 1 141 PHE N 1 1 141 PHE CA 1 1 141 PHE C  1 1 142 ASN N       -38.0       16.9 . 141 . N . 141 . CA . 141 . C  . 142 . N 1 2 
    stop_

save_


save_CNS/XPLOR_dipolar_coupling_4
    _RDC_constraint_list.Sf_category         RDC_constraints
    _RDC_constraint_list.Entry_ID            1
    _RDC_constraint_list.ID                  1
    _RDC_constraint_list.Constraint_file_ID  .
    _RDC_constraint_list.Block_ID            .

    loop_
       _RDC_constraint.ID
       _RDC_constraint.Entity_assembly_ID_1
       _RDC_constraint.Entity_ID_1
       _RDC_constraint.Comp_index_ID_1
       _RDC_constraint.Comp_ID_1
       _RDC_constraint.Atom_ID_1
       _RDC_constraint.Entity_assembly_ID_2
       _RDC_constraint.Entity_ID_2
       _RDC_constraint.Comp_index_ID_2
       _RDC_constraint.Comp_ID_2
       _RDC_constraint.Atom_ID_2
       _RDC_constraint.RDC_val
       _RDC_constraint.RDC_lower_bound
       _RDC_constraint.RDC_upper_bound
       _RDC_constraint.RDC_val_err
       _RDC_constraint.Auth_asym_ID_1
       _RDC_constraint.Auth_seq_ID_1
       _RDC_constraint.Auth_comp_ID_1
       _RDC_constraint.Auth_atom_ID_1
       _RDC_constraint.Auth_asym_ID_2
       _RDC_constraint.Auth_seq_ID_2
       _RDC_constraint.Auth_comp_ID_2
       _RDC_constraint.Auth_atom_ID_2
       _RDC_constraint.Entry_ID
       _RDC_constraint.RDC_constraint_list_ID

        1 1 1   5 LYS N 1 1   5 LYS H   0.463 . . . .   5 . HN .   5 . N  1 1 
        2 1 1   6 GLU N 1 1   6 GLU H   2.787 . . . .   6 . HN .   6 . N  1 1 
        3 1 1   7 GLU N 1 1   7 GLU H   -0.81 . . . .   7 . HN .   7 . N  1 1 
        4 1 1   8 LYS N 1 1   8 LYS H   0.406 . . . .   8 . HN .   8 . N  1 1 
        5 1 1   9 ILE N 1 1   9 ILE H    2.85 . . . .   9 . HN .   9 . N  1 1 
        6 1 1  10 LYS N 1 1  10 LYS H   2.351 . . . .  10 . HN .  10 . N  1 1 
        7 1 1  12 LEU N 1 1  12 LEU H  -2.532 . . . .  12 . HN .  12 . N  1 1 
        8 1 1  14 ARG N 1 1  14 ARG H   2.398 . . . .  14 . HN .  14 . N  1 1 
        9 1 1  15 MET N 1 1  15 MET H  -1.591 . . . .  15 . HN .  15 . N  1 1 
       10 1 1  16 GLN N 1 1  16 GLN H   4.483 . . . .  16 . HN .  16 . N  1 1 
       11 1 1  17 TYR N 1 1  17 TYR H   3.043 . . . .  17 . HN .  17 . N  1 1 
       12 1 1  18 GLU N 1 1  18 GLU H   1.987 . . . .  18 . HN .  18 . N  1 1 
       13 1 1  19 VAL N 1 1  19 VAL H   1.542 . . . .  19 . HN .  19 . N  1 1 
       14 1 1  20 THR N 1 1  20 THR H   2.542 . . . .  20 . HN .  20 . N  1 1 
       15 1 1  22 ASN N 1 1  22 ASN H  -4.502 . . . .  22 . HN .  22 . N  1 1 
       16 1 1  25 THR N 1 1  25 THR H  -6.694 . . . .  25 . HN .  25 . N  1 1 
       17 1 1  26 GLU N 1 1  26 GLU H   -4.19 . . . .  26 . HN .  26 . N  1 1 
       18 1 1  39 GLU N 1 1  39 GLU H  -5.648 . . . .  39 . HN .  39 . N  1 1 
       19 1 1  40 GLY N 1 1  40 GLY H   7.202 . . . .  40 . HN .  40 . N  1 1 
       20 1 1  41 LEU N 1 1  41 LEU H   6.625 . . . .  41 . HN .  41 . N  1 1 
       21 1 1  43 VAL N 1 1  43 VAL H   2.516 . . . .  43 . HN .  43 . N  1 1 
       22 1 1  44 ASP N 1 1  44 ASP H  -0.242 . . . .  44 . HN .  44 . N  1 1 
       23 1 1  45 ILE N 1 1  45 ILE H   5.993 . . . .  45 . HN .  45 . N  1 1 
       24 1 1  47 SER N 1 1  47 SER H   6.341 . . . .  47 . HN .  47 . N  1 1 
       25 1 1  48 GLY N 1 1  48 GLY H  -2.337 . . . .  48 . HN .  48 . N  1 1 
       26 1 1  49 LYS N 1 1  49 LYS H  -6.381 . . . .  49 . HN .  49 . N  1 1 
       27 1 1  51 LEU N 1 1  51 LEU H  -0.503 . . . .  51 . HN .  51 . N  1 1 
       28 1 1  52 PHE N 1 1  52 PHE H   6.148 . . . .  52 . HN .  52 . N  1 1 
       29 1 1  53 THR N 1 1  53 THR H   6.387 . . . .  53 . HN .  53 . N  1 1 
       30 1 1  54 SER N 1 1  54 SER H   6.562 . . . .  54 . HN .  54 . N  1 1 
       31 1 1  55 LYS N 1 1  55 LYS H   6.839 . . . .  55 . HN .  55 . N  1 1 
       32 1 1  57 LYS N 1 1  57 LYS H  -6.618 . . . .  57 . HN .  57 . N  1 1 
       33 1 1  68 THR N 1 1  68 THR H   -8.71 . . . .  68 . HN .  68 . N  1 1 
       34 1 1  69 LYS N 1 1  69 LYS H   1.245 . . . .  69 . HN .  69 . N  1 1 
       35 1 1  71 ILE N 1 1  71 ILE H  -0.523 . . . .  71 . HN .  71 . N  1 1 
       36 1 1  72 GLU N 1 1  72 GLU H  -7.127 . . . .  72 . HN .  72 . N  1 1 
       37 1 1  73 GLU N 1 1  73 GLU H   -4.88 . . . .  73 . HN .  73 . N  1 1 
       38 1 1  74 GLU N 1 1  74 GLU H   0.095 . . . .  74 . HN .  74 . N  1 1 
       39 1 1  75 VAL N 1 1  75 VAL H  -2.729 . . . .  75 . HN .  75 . N  1 1 
       40 1 1  76 GLU N 1 1  76 GLU H   2.001 . . . .  76 . HN .  76 . N  1 1 
       41 1 1  77 GLU N 1 1  77 GLU H  -0.622 . . . .  77 . HN .  77 . N  1 1 
       42 1 1  78 LYS N 1 1  78 LYS H   1.932 . . . .  78 . HN .  78 . N  1 1 
       43 1 1  79 LEU N 1 1  79 LEU H   2.209 . . . .  79 . HN .  79 . N  1 1 
       44 1 1  80 ASP N 1 1  80 ASP H   3.901 . . . .  80 . HN .  80 . N  1 1 
       45 1 1  87 ARG N 1 1  87 ARG H    3.61 . . . .  87 . HN .  87 . N  1 1 
       46 1 1  88 THR N 1 1  88 THR H   1.911 . . . .  88 . HN .  88 . N  1 1 
       47 1 1  89 GLU N 1 1  89 GLU H   -1.49 . . . .  89 . HN .  89 . N  1 1 
       48 1 1  90 VAL N 1 1  90 VAL H   0.795 . . . .  90 . HN .  90 . N  1 1 
       49 1 1  91 ARG N 1 1  91 ARG H   1.372 . . . .  91 . HN .  91 . N  1 1 
       50 1 1  92 SER N 1 1  92 SER H   -2.63 . . . .  92 . HN .  92 . N  1 1 
       51 1 1  93 ARG N 1 1  93 ARG H  -5.647 . . . .  93 . N  .  93 . HN 1 1 
       52 1 1  94 THR N 1 1  94 THR H  -4.938 . . . .  94 . N  .  94 . HN 1 1 
       53 1 1  95 ALA N 1 1  95 ALA H  -0.894 . . . .  95 . HN .  95 . N  1 1 
       54 1 1  98 HIS N 1 1  98 HIS H   2.251 . . . .  98 . HN .  98 . N  1 1 
       55 1 1  99 LEU N 1 1  99 LEU H    2.45 . . . .  99 . HN .  99 . N  1 1 
       56 1 1 100 GLY N 1 1 100 GLY H    0.66 . . . . 100 . HN . 100 . N  1 1 
       57 1 1 102 VAL N 1 1 102 VAL H  -7.657 . . . . 102 . HN . 102 . N  1 1 
       58 1 1 103 PHE N 1 1 103 PHE H  -7.418 . . . . 103 . HN . 103 . N  1 1 
       59 1 1 105 ASP N 1 1 105 ASP H   8.172 . . . . 105 . HN . 105 . N  1 1 
       60 1 1 106 GLY N 1 1 106 GLY H   1.403 . . . . 106 . HN . 106 . N  1 1 
       61 1 1 108 GLY N 1 1 108 GLY H  -0.063 . . . . 108 . HN . 108 . N  1 1 
       62 1 1 110 ASN N 1 1 110 ASN H   2.439 . . . . 110 . HN . 110 . N  1 1 
       63 1 1 111 GLY N 1 1 111 GLY H  -7.022 . . . . 111 . HN . 111 . N  1 1 
       64 1 1 112 LEU N 1 1 112 LEU H   -8.49 . . . . 112 . HN . 112 . N  1 1 
       65 1 1 115 CYS N 1 1 115 CYS H  -4.968 . . . . 115 . HN . 115 . N  1 1 
       66 1 1 116 ILE N 1 1 116 ILE H  -4.681 . . . . 116 . HN . 116 . N  1 1 
       67 1 1 117 ASN N 1 1 117 ASN H   2.078 . . . . 117 . HN . 117 . N  1 1 
       68 1 1 120 ALA N 1 1 120 ALA H   6.663 . . . . 120 . HN . 120 . N  1 1 
       69 1 1 121 LEU N 1 1 121 LEU H   2.275 . . . . 121 . HN . 121 . N  1 1 
       70 1 1 123 PHE N 1 1 123 PHE H   0.285 . . . . 123 . HN . 123 . N  1 1 
       71 1 1 124 VAL N 1 1 124 VAL H   6.395 . . . . 124 . HN . 124 . N  1 1 
       72 1 1 126 LYS N 1 1 126 LYS H   8.207 . . . . 126 . HN . 126 . N  1 1 
       73 1 1 127 HIS N 1 1 127 HIS H   3.372 . . . . 127 . HN . 127 . N  1 1 
       74 1 1 129 LEU N 1 1 129 LEU H   4.227 . . . . 129 . HN . 129 . N  1 1 
       75 1 1 130 LYS N 1 1 130 LYS H  -1.006 . . . . 130 . HN . 130 . N  1 1 
       76 1 1 131 GLU N 1 1 131 GLU H   2.871 . . . . 131 . HN . 131 . N  1 1 
       77 1 1 132 GLU N 1 1 132 GLU H   6.569 . . . . 132 . HN . 132 . N  1 1 
       78 1 1 133 GLY N 1 1 133 GLY H -10.122 . . . . 133 . HN . 133 . N  1 1 
       79 1 1 134 TYR N 1 1 134 TYR H  -0.389 . . . . 134 . HN . 134 . N  1 1 
       80 1 1 135 GLU N 1 1 135 GLU H   9.453 . . . . 135 . HN . 135 . N  1 1 
       81 1 1 136 SER N 1 1 136 SER H   0.726 . . . . 136 . N  . 136 . HN 1 1 
       82 1 1 137 TYR N 1 1 137 TYR H   5.871 . . . . 137 . HN . 137 . N  1 1 
       83 1 1 138 LEU N 1 1 138 LEU H   8.319 . . . . 138 . HN . 138 . N  1 1 
       84 1 1 140 LEU N 1 1 140 LEU H   6.235 . . . . 140 . HN . 140 . N  1 1 
       85 1 1 141 PHE N 1 1 141 PHE H   8.757 . . . . 141 . HN . 141 . N  1 1 
    stop_

save_


save_CNS/XPLOR_dipolar_coupling_7
    _RDC_constraint_list.Sf_category         RDC_constraints
    _RDC_constraint_list.Entry_ID            1
    _RDC_constraint_list.ID                  2
    _RDC_constraint_list.Constraint_file_ID  .
    _RDC_constraint_list.Block_ID            .

    loop_
       _RDC_constraint.ID
       _RDC_constraint.Entity_assembly_ID_1
       _RDC_constraint.Entity_ID_1
       _RDC_constraint.Comp_index_ID_1
       _RDC_constraint.Comp_ID_1
       _RDC_constraint.Atom_ID_1
       _RDC_constraint.Entity_assembly_ID_2
       _RDC_constraint.Entity_ID_2
       _RDC_constraint.Comp_index_ID_2
       _RDC_constraint.Comp_ID_2
       _RDC_constraint.Atom_ID_2
       _RDC_constraint.RDC_val
       _RDC_constraint.RDC_lower_bound
       _RDC_constraint.RDC_upper_bound
       _RDC_constraint.RDC_val_err
       _RDC_constraint.Auth_asym_ID_1
       _RDC_constraint.Auth_seq_ID_1
       _RDC_constraint.Auth_comp_ID_1
       _RDC_constraint.Auth_atom_ID_1
       _RDC_constraint.Auth_asym_ID_2
       _RDC_constraint.Auth_seq_ID_2
       _RDC_constraint.Auth_comp_ID_2
       _RDC_constraint.Auth_atom_ID_2
       _RDC_constraint.Entry_ID
       _RDC_constraint.RDC_constraint_list_ID

        1 1 1   5 LYS N 1 1   5 LYS H   0.463 . . . .   5 . HN .   5 . N  1 2 
        2 1 1   6 GLU N 1 1   6 GLU H   2.787 . . . .   6 . HN .   6 . N  1 2 
        3 1 1   7 GLU N 1 1   7 GLU H   -0.81 . . . .   7 . HN .   7 . N  1 2 
        4 1 1   8 LYS N 1 1   8 LYS H   0.406 . . . .   8 . HN .   8 . N  1 2 
        5 1 1   9 ILE N 1 1   9 ILE H    2.85 . . . .   9 . HN .   9 . N  1 2 
        6 1 1  10 LYS N 1 1  10 LYS H   2.351 . . . .  10 . HN .  10 . N  1 2 
        7 1 1  12 LEU N 1 1  12 LEU H  -2.532 . . . .  12 . HN .  12 . N  1 2 
        8 1 1  14 ARG N 1 1  14 ARG H   2.398 . . . .  14 . HN .  14 . N  1 2 
        9 1 1  15 MET N 1 1  15 MET H  -1.591 . . . .  15 . HN .  15 . N  1 2 
       10 1 1  16 GLN N 1 1  16 GLN H   4.483 . . . .  16 . HN .  16 . N  1 2 
       11 1 1  17 TYR N 1 1  17 TYR H   3.043 . . . .  17 . HN .  17 . N  1 2 
       12 1 1  18 GLU N 1 1  18 GLU H   1.987 . . . .  18 . HN .  18 . N  1 2 
       13 1 1  19 VAL N 1 1  19 VAL H   1.542 . . . .  19 . HN .  19 . N  1 2 
       14 1 1  20 THR N 1 1  20 THR H   2.542 . . . .  20 . HN .  20 . N  1 2 
       15 1 1  22 ASN N 1 1  22 ASN H  -4.502 . . . .  22 . HN .  22 . N  1 2 
       16 1 1  25 THR N 1 1  25 THR H  -6.694 . . . .  25 . HN .  25 . N  1 2 
       17 1 1  26 GLU N 1 1  26 GLU H   -4.19 . . . .  26 . HN .  26 . N  1 2 
       18 1 1  39 GLU N 1 1  39 GLU H  -5.648 . . . .  39 . HN .  39 . N  1 2 
       19 1 1  40 GLY N 1 1  40 GLY H   7.202 . . . .  40 . HN .  40 . N  1 2 
       20 1 1  41 LEU N 1 1  41 LEU H   6.625 . . . .  41 . HN .  41 . N  1 2 
       21 1 1  43 VAL N 1 1  43 VAL H   2.516 . . . .  43 . HN .  43 . N  1 2 
       22 1 1  44 ASP N 1 1  44 ASP H  -0.242 . . . .  44 . HN .  44 . N  1 2 
       23 1 1  45 ILE N 1 1  45 ILE H   5.993 . . . .  45 . HN .  45 . N  1 2 
       24 1 1  47 SER N 1 1  47 SER H   6.341 . . . .  47 . HN .  47 . N  1 2 
       25 1 1  48 GLY N 1 1  48 GLY H  -2.337 . . . .  48 . HN .  48 . N  1 2 
       26 1 1  49 LYS N 1 1  49 LYS H  -6.381 . . . .  49 . HN .  49 . N  1 2 
       27 1 1  51 LEU N 1 1  51 LEU H  -0.503 . . . .  51 . HN .  51 . N  1 2 
       28 1 1  52 PHE N 1 1  52 PHE H   6.148 . . . .  52 . HN .  52 . N  1 2 
       29 1 1  53 THR N 1 1  53 THR H   6.387 . . . .  53 . HN .  53 . N  1 2 
       30 1 1  54 SER N 1 1  54 SER H   6.562 . . . .  54 . HN .  54 . N  1 2 
       31 1 1  55 LYS N 1 1  55 LYS H   6.839 . . . .  55 . HN .  55 . N  1 2 
       32 1 1  57 LYS N 1 1  57 LYS H  -6.618 . . . .  57 . HN .  57 . N  1 2 
       33 1 1  68 THR N 1 1  68 THR H   -8.71 . . . .  68 . HN .  68 . N  1 2 
       34 1 1  69 LYS N 1 1  69 LYS H   1.245 . . . .  69 . HN .  69 . N  1 2 
       35 1 1  71 ILE N 1 1  71 ILE H  -0.523 . . . .  71 . HN .  71 . N  1 2 
       36 1 1  72 GLU N 1 1  72 GLU H  -7.127 . . . .  72 . HN .  72 . N  1 2 
       37 1 1  73 GLU N 1 1  73 GLU H   -4.88 . . . .  73 . HN .  73 . N  1 2 
       38 1 1  74 GLU N 1 1  74 GLU H   0.095 . . . .  74 . HN .  74 . N  1 2 
       39 1 1  75 VAL N 1 1  75 VAL H  -2.729 . . . .  75 . HN .  75 . N  1 2 
       40 1 1  76 GLU N 1 1  76 GLU H   2.001 . . . .  76 . HN .  76 . N  1 2 
       41 1 1  77 GLU N 1 1  77 GLU H  -0.622 . . . .  77 . HN .  77 . N  1 2 
       42 1 1  78 LYS N 1 1  78 LYS H   1.932 . . . .  78 . HN .  78 . N  1 2 
       43 1 1  79 LEU N 1 1  79 LEU H   2.209 . . . .  79 . HN .  79 . N  1 2 
       44 1 1  80 ASP N 1 1  80 ASP H   3.901 . . . .  80 . HN .  80 . N  1 2 
       45 1 1  87 ARG N 1 1  87 ARG H    3.61 . . . .  87 . HN .  87 . N  1 2 
       46 1 1  88 THR N 1 1  88 THR H   1.911 . . . .  88 . HN .  88 . N  1 2 
       47 1 1  89 GLU N 1 1  89 GLU H   -1.49 . . . .  89 . HN .  89 . N  1 2 
       48 1 1  90 VAL N 1 1  90 VAL H   0.795 . . . .  90 . HN .  90 . N  1 2 
       49 1 1  91 ARG N 1 1  91 ARG H   1.372 . . . .  91 . HN .  91 . N  1 2 
       50 1 1  92 SER N 1 1  92 SER H   -2.63 . . . .  92 . HN .  92 . N  1 2 
       51 1 1  93 ARG N 1 1  93 ARG H  -5.647 . . . .  93 . N  .  93 . HN 1 2 
       52 1 1  94 THR N 1 1  94 THR H  -4.938 . . . .  94 . N  .  94 . HN 1 2 
       53 1 1  95 ALA N 1 1  95 ALA H  -0.894 . . . .  95 . HN .  95 . N  1 2 
       54 1 1  98 HIS N 1 1  98 HIS H   2.251 . . . .  98 . HN .  98 . N  1 2 
       55 1 1  99 LEU N 1 1  99 LEU H    2.45 . . . .  99 . HN .  99 . N  1 2 
       56 1 1 100 GLY N 1 1 100 GLY H    0.66 . . . . 100 . HN . 100 . N  1 2 
       57 1 1 102 VAL N 1 1 102 VAL H  -7.657 . . . . 102 . HN . 102 . N  1 2 
       58 1 1 103 PHE N 1 1 103 PHE H  -7.418 . . . . 103 . HN . 103 . N  1 2 
       59 1 1 105 ASP N 1 1 105 ASP H   8.172 . . . . 105 . HN . 105 . N  1 2 
       60 1 1 106 GLY N 1 1 106 GLY H   1.403 . . . . 106 . HN . 106 . N  1 2 
       61 1 1 108 GLY N 1 1 108 GLY H  -0.063 . . . . 108 . HN . 108 . N  1 2 
       62 1 1 110 ASN N 1 1 110 ASN H   2.439 . . . . 110 . HN . 110 . N  1 2 
       63 1 1 111 GLY N 1 1 111 GLY H  -7.022 . . . . 111 . HN . 111 . N  1 2 
       64 1 1 112 LEU N 1 1 112 LEU H   -8.49 . . . . 112 . HN . 112 . N  1 2 
       65 1 1 115 CYS N 1 1 115 CYS H  -4.968 . . . . 115 . HN . 115 . N  1 2 
       66 1 1 116 ILE N 1 1 116 ILE H  -4.681 . . . . 116 . HN . 116 . N  1 2 
       67 1 1 117 ASN N 1 1 117 ASN H   2.078 . . . . 117 . HN . 117 . N  1 2 
       68 1 1 120 ALA N 1 1 120 ALA H   6.663 . . . . 120 . HN . 120 . N  1 2 
       69 1 1 121 LEU N 1 1 121 LEU H   2.275 . . . . 121 . HN . 121 . N  1 2 
       70 1 1 123 PHE N 1 1 123 PHE H   0.285 . . . . 123 . HN . 123 . N  1 2 
       71 1 1 124 VAL N 1 1 124 VAL H   6.395 . . . . 124 . HN . 124 . N  1 2 
       72 1 1 126 LYS N 1 1 126 LYS H   8.207 . . . . 126 . HN . 126 . N  1 2 
       73 1 1 127 HIS N 1 1 127 HIS H   3.372 . . . . 127 . HN . 127 . N  1 2 
       74 1 1 129 LEU N 1 1 129 LEU H   4.227 . . . . 129 . HN . 129 . N  1 2 
       75 1 1 130 LYS N 1 1 130 LYS H  -1.006 . . . . 130 . HN . 130 . N  1 2 
       76 1 1 131 GLU N 1 1 131 GLU H   2.871 . . . . 131 . HN . 131 . N  1 2 
       77 1 1 132 GLU N 1 1 132 GLU H   6.569 . . . . 132 . HN . 132 . N  1 2 
       78 1 1 133 GLY N 1 1 133 GLY H -10.122 . . . . 133 . HN . 133 . N  1 2 
       79 1 1 134 TYR N 1 1 134 TYR H  -0.389 . . . . 134 . HN . 134 . N  1 2 
       80 1 1 135 GLU N 1 1 135 GLU H   9.453 . . . . 135 . HN . 135 . N  1 2 
       81 1 1 136 SER N 1 1 136 SER H   0.726 . . . . 136 . N  . 136 . HN 1 2 
       82 1 1 137 TYR N 1 1 137 TYR H   5.871 . . . . 137 . HN . 137 . N  1 2 
       83 1 1 138 LEU N 1 1 138 LEU H   8.319 . . . . 138 . HN . 138 . N  1 2 
       84 1 1 140 LEU N 1 1 140 LEU H   6.235 . . . . 140 . HN . 140 . N  1 2 
       85 1 1 141 PHE N 1 1 141 PHE H   8.757 . . . . 141 . HN . 141 . N  1 2 
    stop_

save_


save_conformer_family_coord_set_1
    _Conformer_family_coord_set.Sf_category  conformer_family_coord_set
    _Conformer_family_coord_set.Entry_ID     1
    _Conformer_family_coord_set.ID           1

    loop_
       _Atom_site.Model_ID
       _Atom_site.ID
       _Atom_site.Label_entity_assembly_ID
       _Atom_site.Label_entity_ID
       _Atom_site.Label_comp_index_ID
       _Atom_site.Label_comp_ID
       _Atom_site.Label_atom_ID
       _Atom_site.Type_symbol
       _Atom_site.Cartn_x
       _Atom_site.Cartn_y
       _Atom_site.Cartn_z
       _Atom_site.Occupancy
       _Atom_site.Uncertainty
       _Atom_site.PDBX_label_asym_ID
       _Atom_site.PDB_strand_ID
       _Atom_site.PDB_ins_code
       _Atom_site.PDB_residue_no
       _Atom_site.PDB_residue_name
       _Atom_site.PDB_atom_name
       _Atom_site.Entry_ID
       _Atom_site.Conformer_family_coord_set_ID

        1     1 1 1   1 MET C    C -15.328  14.387  21.392 1.00 . A A .   1 MET C    1 1 
        1     2 1 1   1 MET CA   C -15.197  15.869  21.793 1.00 . A A .   1 MET CA   1 1 
        1     3 1 1   1 MET CB   C -13.757  16.396  21.544 1.00 . A A .   1 MET CB   1 1 
        1     4 1 1   1 MET CE   C -11.957  18.785  20.303 1.00 . A A .   1 MET CE   1 1 
        1     5 1 1   1 MET CG   C -13.288  16.327  20.083 1.00 . A A .   1 MET CG   1 1 
        1     6 1 1   1 MET H1   H -14.944  15.427  23.806 1.00 . A A .   1 MET H1   1 1 
        1     7 1 1   1 MET H2   H -16.543  15.752  23.374 1.00 . A A .   1 MET H2   1 1 
        1     8 1 1   1 MET H3   H -15.432  17.019  23.514 1.00 . A A .   1 MET H3   1 1 
        1     9 1 1   1 MET HA   H -15.898  16.460  21.209 1.00 . A A .   1 MET HA   1 1 
        1    10 1 1   1 MET HB2  H -13.705  17.430  21.865 1.00 . A A .   1 MET HB2  1 1 
        1    11 1 1   1 MET HB3  H -13.064  15.819  22.150 1.00 . A A .   1 MET HB3  1 1 
        1    12 1 1   1 MET HE1  H -12.280  18.820  21.331 1.00 . A A .   1 MET HE1  1 1 
        1    13 1 1   1 MET HE2  H -12.723  19.208  19.670 1.00 . A A .   1 MET HE2  1 1 
        1    14 1 1   1 MET HE3  H -11.043  19.350  20.194 1.00 . A A .   1 MET HE3  1 1 
        1    15 1 1   1 MET HG2  H -13.240  15.286  19.783 1.00 . A A .   1 MET HG2  1 1 
        1    16 1 1   1 MET HG3  H -14.004  16.843  19.453 1.00 . A A .   1 MET HG3  1 1 
        1    17 1 1   1 MET N    N -15.554  16.030  23.220 1.00 . A A .   1 MET N    1 1 
        1    18 1 1   1 MET O    O -14.610  13.532  21.924 1.00 . A A .   1 MET O    1 1 
        1    19 1 1   1 MET SD   S -11.660  17.082  19.829 1.00 . A A .   1 MET SD   1 1 
        1    20 1 1   2 ALA C    C -15.448  12.433  18.836 1.00 . A A .   2 ALA C    1 1 
        1    21 1 1   2 ALA CA   C -16.506  12.757  19.911 1.00 . A A .   2 ALA CA   1 1 
        1    22 1 1   2 ALA CB   C -17.932  12.678  19.332 1.00 . A A .   2 ALA CB   1 1 
        1    23 1 1   2 ALA H    H -16.835  14.839  20.151 1.00 . A A .   2 ALA H    1 1 
        1    24 1 1   2 ALA HA   H -16.424  12.028  20.714 1.00 . A A .   2 ALA HA   1 1 
        1    25 1 1   2 ALA HB1  H -18.651  12.913  20.104 1.00 . A A .   2 ALA HB1  1 1 
        1    26 1 1   2 ALA HB2  H -18.124  11.679  18.958 1.00 . A A .   2 ALA HB2  1 1 
        1    27 1 1   2 ALA HB3  H -18.039  13.388  18.520 1.00 . A A .   2 ALA HB3  1 1 
        1    28 1 1   2 ALA N    N -16.275  14.105  20.474 1.00 . A A .   2 ALA N    1 1 
        1    29 1 1   2 ALA O    O -14.644  13.298  18.470 1.00 . A A .   2 ALA O    1 1 
        1    30 1 1   3 TYR C    C -15.117   9.517  16.570 1.00 . A A .   3 TYR C    1 1 
        1    31 1 1   3 TYR CA   C -14.514  10.715  17.321 1.00 . A A .   3 TYR CA   1 1 
        1    32 1 1   3 TYR CB   C -13.164  10.347  17.983 1.00 . A A .   3 TYR CB   1 1 
        1    33 1 1   3 TYR CD1  C -11.363  10.756  16.215 1.00 . A A .   3 TYR CD1  1 1 
        1    34 1 1   3 TYR CD2  C -11.735   8.502  16.933 1.00 . A A .   3 TYR CD2  1 1 
        1    35 1 1   3 TYR CE1  C -10.361  10.318  15.372 1.00 . A A .   3 TYR CE1  1 1 
        1    36 1 1   3 TYR CE2  C -10.739   8.064  16.085 1.00 . A A .   3 TYR CE2  1 1 
        1    37 1 1   3 TYR CG   C -12.072   9.858  17.020 1.00 . A A .   3 TYR CG   1 1 
        1    38 1 1   3 TYR CZ   C -10.052   8.974  15.312 1.00 . A A .   3 TYR CZ   1 1 
        1    39 1 1   3 TYR H    H -16.125  10.554  18.688 1.00 . A A .   3 TYR H    1 1 
        1    40 1 1   3 TYR HA   H -14.349  11.529  16.613 1.00 . A A .   3 TYR HA   1 1 
        1    41 1 1   3 TYR HB2  H -12.780  11.220  18.498 1.00 . A A .   3 TYR HB2  1 1 
        1    42 1 1   3 TYR HB3  H -13.338   9.568  18.718 1.00 . A A .   3 TYR HB3  1 1 
        1    43 1 1   3 TYR HD1  H -11.601  11.810  16.261 1.00 . A A .   3 TYR HD1  1 1 
        1    44 1 1   3 TYR HD2  H -12.277   7.785  17.539 1.00 . A A .   3 TYR HD2  1 1 
        1    45 1 1   3 TYR HE1  H  -9.825  11.031  14.755 1.00 . A A .   3 TYR HE1  1 1 
        1    46 1 1   3 TYR HE2  H -10.495   7.009  16.036 1.00 . A A .   3 TYR HE2  1 1 
        1    47 1 1   3 TYR HH   H  -8.294   9.158  14.542 1.00 . A A .   3 TYR HH   1 1 
        1    48 1 1   3 TYR N    N -15.462  11.185  18.342 1.00 . A A .   3 TYR N    1 1 
        1    49 1 1   3 TYR O    O -15.270   8.430  17.138 1.00 . A A .   3 TYR O    1 1 
        1    50 1 1   3 TYR OH   O  -9.034   8.540  14.489 1.00 . A A .   3 TYR OH   1 1 
        1    51 1 1   4 ASN C    C -15.031   8.324  13.323 1.00 . A A .   4 ASN C    1 1 
        1    52 1 1   4 ASN CA   C -16.048   8.706  14.409 1.00 . A A .   4 ASN CA   1 1 
        1    53 1 1   4 ASN CB   C -17.377   9.201  13.778 1.00 . A A .   4 ASN CB   1 1 
        1    54 1 1   4 ASN CG   C -18.495   9.332  14.812 1.00 . A A .   4 ASN CG   1 1 
        1    55 1 1   4 ASN H    H -15.370  10.648  14.946 1.00 . A A .   4 ASN H    1 1 
        1    56 1 1   4 ASN HA   H -16.254   7.815  15.003 1.00 . A A .   4 ASN HA   1 1 
        1    57 1 1   4 ASN HB2  H -17.217  10.165  13.316 1.00 . A A .   4 ASN HB2  1 1 
        1    58 1 1   4 ASN HB3  H -17.701   8.499  13.014 1.00 . A A .   4 ASN HB3  1 1 
        1    59 1 1   4 ASN HD21 H -18.988   7.420  14.571 1.00 . A A .   4 ASN HD21 1 1 
        1    60 1 1   4 ASN HD22 H -19.928   8.297  15.721 1.00 . A A .   4 ASN HD22 1 1 
        1    61 1 1   4 ASN N    N -15.483   9.742  15.301 1.00 . A A .   4 ASN N    1 1 
        1    62 1 1   4 ASN ND2  N -19.213   8.243  15.056 1.00 . A A .   4 ASN ND2  1 1 
        1    63 1 1   4 ASN O    O -13.954   8.924  13.239 1.00 . A A .   4 ASN O    1 1 
        1    64 1 1   4 ASN OD1  O -18.704  10.393  15.394 1.00 . A A .   4 ASN OD1  1 1 
        1    65 1 1   5 LYS C    C -14.378   7.839  10.275 1.00 . A A .   5 LYS C    1 1 
        1    66 1 1   5 LYS CA   C -14.538   6.798  11.407 1.00 . A A .   5 LYS CA   1 1 
        1    67 1 1   5 LYS CB   C -15.119   5.467  10.857 1.00 . A A .   5 LYS CB   1 1 
        1    68 1 1   5 LYS CD   C -17.162   4.256   9.827 1.00 . A A .   5 LYS CD   1 1 
        1    69 1 1   5 LYS CE   C -18.537   4.453   9.161 1.00 . A A .   5 LYS CE   1 1 
        1    70 1 1   5 LYS CG   C -16.507   5.608  10.197 1.00 . A A .   5 LYS CG   1 1 
        1    71 1 1   5 LYS H    H -16.295   6.941  12.606 1.00 . A A .   5 LYS H    1 1 
        1    72 1 1   5 LYS HA   H -13.557   6.601  11.834 1.00 . A A .   5 LYS HA   1 1 
        1    73 1 1   5 LYS HB2  H -14.430   5.057  10.123 1.00 . A A .   5 LYS HB2  1 1 
        1    74 1 1   5 LYS HB3  H -15.202   4.762  11.678 1.00 . A A .   5 LYS HB3  1 1 
        1    75 1 1   5 LYS HD2  H -16.514   3.725   9.140 1.00 . A A .   5 LYS HD2  1 1 
        1    76 1 1   5 LYS HD3  H -17.290   3.666  10.727 1.00 . A A .   5 LYS HD3  1 1 
        1    77 1 1   5 LYS HE2  H -19.162   5.066   9.801 1.00 . A A .   5 LYS HE2  1 1 
        1    78 1 1   5 LYS HE3  H -18.401   4.960   8.215 1.00 . A A .   5 LYS HE3  1 1 
        1    79 1 1   5 LYS HG2  H -17.165   6.134  10.879 1.00 . A A .   5 LYS HG2  1 1 
        1    80 1 1   5 LYS HG3  H -16.397   6.201   9.293 1.00 . A A .   5 LYS HG3  1 1 
        1    81 1 1   5 LYS HZ1  H -18.672   2.571   8.286 1.00 . A A .   5 LYS HZ1  1 1 
        1    82 1 1   5 LYS HZ2  H -20.157   3.348   8.465 1.00 . A A .   5 LYS HZ2  1 1 
        1    83 1 1   5 LYS HZ3  H -19.394   2.669   9.809 1.00 . A A .   5 LYS HZ3  1 1 
        1    84 1 1   5 LYS N    N -15.399   7.322  12.495 1.00 . A A .   5 LYS N    1 1 
        1    85 1 1   5 LYS NZ   N -19.239   3.171   8.914 1.00 . A A .   5 LYS NZ   1 1 
        1    86 1 1   5 LYS O    O -13.396   7.805   9.533 1.00 . A A .   5 LYS O    1 1 
        1    87 1 1   6 GLU C    C -14.129  10.830   9.635 1.00 . A A .   6 GLU C    1 1 
        1    88 1 1   6 GLU CA   C -15.294   9.908   9.237 1.00 . A A .   6 GLU CA   1 1 
        1    89 1 1   6 GLU CB   C -16.667  10.667   9.246 1.00 . A A .   6 GLU CB   1 1 
        1    90 1 1   6 GLU CD   C -16.264  13.258   9.029 1.00 . A A .   6 GLU CD   1 1 
        1    91 1 1   6 GLU CG   C -16.765  11.948   8.363 1.00 . A A .   6 GLU CG   1 1 
        1    92 1 1   6 GLU H    H -16.153   8.655  10.725 1.00 . A A .   6 GLU H    1 1 
        1    93 1 1   6 GLU HA   H -15.115   9.516   8.238 1.00 . A A .   6 GLU HA   1 1 
        1    94 1 1   6 GLU HB2  H -17.430   9.975   8.898 1.00 . A A .   6 GLU HB2  1 1 
        1    95 1 1   6 GLU HB3  H -16.906  10.936  10.271 1.00 . A A .   6 GLU HB3  1 1 
        1    96 1 1   6 GLU HG2  H -16.197  11.776   7.457 1.00 . A A .   6 GLU HG2  1 1 
        1    97 1 1   6 GLU HG3  H -17.809  12.089   8.086 1.00 . A A .   6 GLU HG3  1 1 
        1    98 1 1   6 GLU N    N -15.355   8.760  10.165 1.00 . A A .   6 GLU N    1 1 
        1    99 1 1   6 GLU O    O -13.258  11.138   8.819 1.00 . A A .   6 GLU O    1 1 
        1   100 1 1   6 GLU OE1  O -16.960  13.785   9.921 1.00 . A A .   6 GLU OE1  1 1 
        1   101 1 1   6 GLU OE2  O -15.192  13.780   8.648 1.00 . A A .   6 GLU OE2  1 1 
        1   102 1 1   7 GLU C    C -11.755  11.447  11.614 1.00 . A A .   7 GLU C    1 1 
        1   103 1 1   7 GLU CA   C -13.121  12.150  11.499 1.00 . A A .   7 GLU CA   1 1 
        1   104 1 1   7 GLU CB   C -13.604  12.643  12.882 1.00 . A A .   7 GLU CB   1 1 
        1   105 1 1   7 GLU CD   C -15.464  13.787  14.222 1.00 . A A .   7 GLU CD   1 1 
        1   106 1 1   7 GLU CG   C -15.027  13.234  12.864 1.00 . A A .   7 GLU CG   1 1 
        1   107 1 1   7 GLU H    H -14.877  10.955  11.487 1.00 . A A .   7 GLU H    1 1 
        1   108 1 1   7 GLU HA   H -13.016  13.005  10.837 1.00 . A A .   7 GLU HA   1 1 
        1   109 1 1   7 GLU HB2  H -13.595  11.810  13.578 1.00 . A A .   7 GLU HB2  1 1 
        1   110 1 1   7 GLU HB3  H -12.925  13.407  13.243 1.00 . A A .   7 GLU HB3  1 1 
        1   111 1 1   7 GLU HG2  H -15.063  14.033  12.122 1.00 . A A .   7 GLU HG2  1 1 
        1   112 1 1   7 GLU HG3  H -15.723  12.456  12.563 1.00 . A A .   7 GLU HG3  1 1 
        1   113 1 1   7 GLU N    N -14.138  11.248  10.914 1.00 . A A .   7 GLU N    1 1 
        1   114 1 1   7 GLU O    O -10.706  12.103  11.617 1.00 . A A .   7 GLU O    1 1 
        1   115 1 1   7 GLU OE1  O -15.650  12.986  15.162 1.00 . A A .   7 GLU OE1  1 1 
        1   116 1 1   7 GLU OE2  O -15.631  15.021  14.352 1.00 . A A .   7 GLU OE2  1 1 
        1   117 1 1   8 LYS C    C  -9.874   9.462  10.340 1.00 . A A .   8 LYS C    1 1 
        1   118 1 1   8 LYS CA   C -10.610   9.257  11.662 1.00 . A A .   8 LYS CA   1 1 
        1   119 1 1   8 LYS CB   C -10.986   7.760  11.836 1.00 . A A .   8 LYS CB   1 1 
        1   120 1 1   8 LYS CD   C -10.226   5.293  11.726 1.00 . A A .   8 LYS CD   1 1 
        1   121 1 1   8 LYS CE   C -10.828   4.893  13.089 1.00 . A A .   8 LYS CE   1 1 
        1   122 1 1   8 LYS CG   C  -9.803   6.775  11.661 1.00 . A A .   8 LYS CG   1 1 
        1   123 1 1   8 LYS H    H -12.688   9.693  11.752 1.00 . A A .   8 LYS H    1 1 
        1   124 1 1   8 LYS HA   H  -9.967   9.559  12.481 1.00 . A A .   8 LYS HA   1 1 
        1   125 1 1   8 LYS HB2  H -11.403   7.618  12.827 1.00 . A A .   8 LYS HB2  1 1 
        1   126 1 1   8 LYS HB3  H -11.750   7.509  11.104 1.00 . A A .   8 LYS HB3  1 1 
        1   127 1 1   8 LYS HD2  H -10.963   5.104  10.953 1.00 . A A .   8 LYS HD2  1 1 
        1   128 1 1   8 LYS HD3  H  -9.351   4.680  11.534 1.00 . A A .   8 LYS HD3  1 1 
        1   129 1 1   8 LYS HE2  H -10.170   5.219  13.889 1.00 . A A .   8 LYS HE2  1 1 
        1   130 1 1   8 LYS HE3  H -11.792   5.373  13.206 1.00 . A A .   8 LYS HE3  1 1 
        1   131 1 1   8 LYS HG2  H  -9.345   6.957  10.693 1.00 . A A .   8 LYS HG2  1 1 
        1   132 1 1   8 LYS HG3  H  -9.072   6.971  12.438 1.00 . A A .   8 LYS HG3  1 1 
        1   133 1 1   8 LYS HZ1  H -11.365   3.179  14.149 1.00 . A A .   8 LYS HZ1  1 1 
        1   134 1 1   8 LYS HZ2  H -10.106   2.939  13.043 1.00 . A A .   8 LYS HZ2  1 1 
        1   135 1 1   8 LYS HZ3  H -11.695   3.100  12.492 1.00 . A A .   8 LYS HZ3  1 1 
        1   136 1 1   8 LYS N    N -11.804  10.109  11.691 1.00 . A A .   8 LYS N    1 1 
        1   137 1 1   8 LYS NZ   N -11.012   3.424  13.202 1.00 . A A .   8 LYS NZ   1 1 
        1   138 1 1   8 LYS O    O  -8.711   9.842  10.333 1.00 . A A .   8 LYS O    1 1 
        1   139 1 1   9 ILE C    C  -9.713  10.790   7.516 1.00 . A A .   9 ILE C    1 1 
        1   140 1 1   9 ILE CA   C -10.069   9.337   7.875 1.00 . A A .   9 ILE CA   1 1 
        1   141 1 1   9 ILE CB   C -11.069   8.697   6.832 1.00 . A A .   9 ILE CB   1 1 
        1   142 1 1   9 ILE CD1  C -10.045   6.348   7.249 1.00 . A A .   9 ILE CD1  1 1 
        1   143 1 1   9 ILE CG1  C -11.306   7.186   7.168 1.00 . A A .   9 ILE CG1  1 1 
        1   144 1 1   9 ILE CG2  C -10.598   8.863   5.366 1.00 . A A .   9 ILE CG2  1 1 
        1   145 1 1   9 ILE H    H -11.555   9.030   9.346 1.00 . A A .   9 ILE H    1 1 
        1   146 1 1   9 ILE HA   H  -9.151   8.754   7.857 1.00 . A A .   9 ILE HA   1 1 
        1   147 1 1   9 ILE HB   H -12.016   9.216   6.924 1.00 . A A .   9 ILE HB   1 1 
        1   148 1 1   9 ILE HD11 H  -9.450   6.670   8.091 1.00 . A A .   9 ILE HD11 1 1 
        1   149 1 1   9 ILE HD12 H  -9.467   6.461   6.337 1.00 . A A .   9 ILE HD12 1 1 
        1   150 1 1   9 ILE HD13 H -10.311   5.312   7.374 1.00 . A A .   9 ILE HD13 1 1 
        1   151 1 1   9 ILE HG12 H -11.802   7.109   8.123 1.00 . A A .   9 ILE HG12 1 1 
        1   152 1 1   9 ILE HG13 H -11.946   6.743   6.409 1.00 . A A .   9 ILE HG13 1 1 
        1   153 1 1   9 ILE HG21 H -10.501   9.918   5.128 1.00 . A A .   9 ILE HG21 1 1 
        1   154 1 1   9 ILE HG22 H -11.317   8.415   4.698 1.00 . A A .   9 ILE HG22 1 1 
        1   155 1 1   9 ILE HG23 H  -9.636   8.381   5.231 1.00 . A A .   9 ILE HG23 1 1 
        1   156 1 1   9 ILE N    N -10.610   9.252   9.237 1.00 . A A .   9 ILE N    1 1 
        1   157 1 1   9 ILE O    O  -8.708  11.029   6.869 1.00 . A A .   9 ILE O    1 1 
        1   158 1 1  10 LYS C    C  -8.919  13.663   8.322 1.00 . A A .  10 LYS C    1 1 
        1   159 1 1  10 LYS CA   C -10.277  13.195   7.750 1.00 . A A .  10 LYS CA   1 1 
        1   160 1 1  10 LYS CB   C -11.450  13.990   8.368 1.00 . A A .  10 LYS CB   1 1 
        1   161 1 1  10 LYS CD   C -12.699  16.196   8.677 1.00 . A A .  10 LYS CD   1 1 
        1   162 1 1  10 LYS CE   C -13.016  15.922  10.164 1.00 . A A .  10 LYS CE   1 1 
        1   163 1 1  10 LYS CG   C -11.394  15.524   8.202 1.00 . A A .  10 LYS CG   1 1 
        1   164 1 1  10 LYS H    H -11.320  11.516   8.477 1.00 . A A .  10 LYS H    1 1 
        1   165 1 1  10 LYS HA   H -10.278  13.350   6.672 1.00 . A A .  10 LYS HA   1 1 
        1   166 1 1  10 LYS HB2  H -12.376  13.638   7.920 1.00 . A A .  10 LYS HB2  1 1 
        1   167 1 1  10 LYS HB3  H -11.485  13.767   9.430 1.00 . A A .  10 LYS HB3  1 1 
        1   168 1 1  10 LYS HD2  H -12.613  17.268   8.533 1.00 . A A .  10 LYS HD2  1 1 
        1   169 1 1  10 LYS HD3  H -13.518  15.824   8.065 1.00 . A A .  10 LYS HD3  1 1 
        1   170 1 1  10 LYS HE2  H -12.837  14.878  10.384 1.00 . A A .  10 LYS HE2  1 1 
        1   171 1 1  10 LYS HE3  H -12.372  16.533  10.788 1.00 . A A .  10 LYS HE3  1 1 
        1   172 1 1  10 LYS HG2  H -10.562  15.916   8.777 1.00 . A A .  10 LYS HG2  1 1 
        1   173 1 1  10 LYS HG3  H -11.242  15.756   7.153 1.00 . A A .  10 LYS HG3  1 1 
        1   174 1 1  10 LYS HZ1  H -14.571  16.166  11.524 1.00 . A A .  10 LYS HZ1  1 1 
        1   175 1 1  10 LYS HZ2  H -15.063  15.540  10.028 1.00 . A A .  10 LYS HZ2  1 1 
        1   176 1 1  10 LYS HZ3  H -14.679  17.183  10.178 1.00 . A A .  10 LYS HZ3  1 1 
        1   177 1 1  10 LYS N    N -10.512  11.754   7.986 1.00 . A A .  10 LYS N    1 1 
        1   178 1 1  10 LYS NZ   N -14.430  16.224  10.498 1.00 . A A .  10 LYS NZ   1 1 
        1   179 1 1  10 LYS O    O  -8.113  14.278   7.609 1.00 . A A .  10 LYS O    1 1 
        1   180 1 1  11 SER C    C  -6.242  12.885   9.694 1.00 . A A .  11 SER C    1 1 
        1   181 1 1  11 SER CA   C  -7.416  13.686  10.292 1.00 . A A .  11 SER CA   1 1 
        1   182 1 1  11 SER CB   C  -7.552  13.404  11.802 1.00 . A A .  11 SER CB   1 1 
        1   183 1 1  11 SER H    H  -9.355  12.839  10.100 1.00 . A A .  11 SER H    1 1 
        1   184 1 1  11 SER HA   H  -7.234  14.747  10.143 1.00 . A A .  11 SER HA   1 1 
        1   185 1 1  11 SER HB2  H  -7.715  12.344  11.960 1.00 . A A .  11 SER HB2  1 1 
        1   186 1 1  11 SER HB3  H  -6.648  13.705  12.315 1.00 . A A .  11 SER HB3  1 1 
        1   187 1 1  11 SER HG   H  -9.354  13.490  12.571 1.00 . A A .  11 SER HG   1 1 
        1   188 1 1  11 SER N    N  -8.671  13.337   9.602 1.00 . A A .  11 SER N    1 1 
        1   189 1 1  11 SER O    O  -5.157  13.427   9.465 1.00 . A A .  11 SER O    1 1 
        1   190 1 1  11 SER OG   O  -8.648  14.111  12.365 1.00 . A A .  11 SER OG   1 1 
        1   191 1 1  12 LEU C    C  -5.026  11.181   7.456 1.00 . A A .  12 LEU C    1 1 
        1   192 1 1  12 LEU CA   C  -5.558  10.651   8.807 1.00 . A A .  12 LEU CA   1 1 
        1   193 1 1  12 LEU CB   C  -6.301   9.314   8.556 1.00 . A A .  12 LEU CB   1 1 
        1   194 1 1  12 LEU CD1  C  -4.484   7.490   8.400 1.00 . A A .  12 LEU CD1  1 1 
        1   195 1 1  12 LEU CD2  C  -6.591   7.357   6.946 1.00 . A A .  12 LEU CD2  1 1 
        1   196 1 1  12 LEU CG   C  -5.581   8.272   7.652 1.00 . A A .  12 LEU CG   1 1 
        1   197 1 1  12 LEU H    H  -7.332  11.204   9.801 1.00 . A A .  12 LEU H    1 1 
        1   198 1 1  12 LEU HA   H  -4.727  10.473   9.481 1.00 . A A .  12 LEU HA   1 1 
        1   199 1 1  12 LEU HB2  H  -6.509   8.853   9.522 1.00 . A A .  12 LEU HB2  1 1 
        1   200 1 1  12 LEU HB3  H  -7.258   9.560   8.101 1.00 . A A .  12 LEU HB3  1 1 
        1   201 1 1  12 LEU HD11 H  -4.916   6.935   9.221 1.00 . A A .  12 LEU HD11 1 1 
        1   202 1 1  12 LEU HD12 H  -3.740   8.180   8.777 1.00 . A A .  12 LEU HD12 1 1 
        1   203 1 1  12 LEU HD13 H  -4.008   6.802   7.712 1.00 . A A .  12 LEU HD13 1 1 
        1   204 1 1  12 LEU HD21 H  -6.065   6.674   6.290 1.00 . A A .  12 LEU HD21 1 1 
        1   205 1 1  12 LEU HD22 H  -7.272   7.959   6.356 1.00 . A A .  12 LEU HD22 1 1 
        1   206 1 1  12 LEU HD23 H  -7.157   6.790   7.675 1.00 . A A .  12 LEU HD23 1 1 
        1   207 1 1  12 LEU HG   H  -5.068   8.813   6.868 1.00 . A A .  12 LEU HG   1 1 
        1   208 1 1  12 LEU N    N  -6.493  11.585   9.465 1.00 . A A .  12 LEU N    1 1 
        1   209 1 1  12 LEU O    O  -3.824  11.176   7.220 1.00 . A A .  12 LEU O    1 1 
        1   210 1 1  13 ASN C    C  -4.715  13.181   5.066 1.00 . A A .  13 ASN C    1 1 
        1   211 1 1  13 ASN CA   C  -5.641  11.968   5.167 1.00 . A A .  13 ASN CA   1 1 
        1   212 1 1  13 ASN CB   C  -6.939  12.168   4.328 1.00 . A A .  13 ASN CB   1 1 
        1   213 1 1  13 ASN CG   C  -7.602  10.848   3.881 1.00 . A A .  13 ASN CG   1 1 
        1   214 1 1  13 ASN H    H  -6.873  11.723   6.898 1.00 . A A .  13 ASN H    1 1 
        1   215 1 1  13 ASN HA   H  -5.103  11.121   4.747 1.00 . A A .  13 ASN HA   1 1 
        1   216 1 1  13 ASN HB2  H  -7.656  12.720   4.919 1.00 . A A .  13 ASN HB2  1 1 
        1   217 1 1  13 ASN HB3  H  -6.705  12.743   3.439 1.00 . A A .  13 ASN HB3  1 1 
        1   218 1 1  13 ASN HD21 H  -7.174   9.916   5.607 1.00 . A A .  13 ASN HD21 1 1 
        1   219 1 1  13 ASN HD22 H  -8.019   8.987   4.428 1.00 . A A .  13 ASN HD22 1 1 
        1   220 1 1  13 ASN N    N  -5.952  11.616   6.580 1.00 . A A .  13 ASN N    1 1 
        1   221 1 1  13 ASN ND2  N  -7.594   9.813   4.725 1.00 . A A .  13 ASN ND2  1 1 
        1   222 1 1  13 ASN O    O  -4.106  13.403   4.024 1.00 . A A .  13 ASN O    1 1 
        1   223 1 1  13 ASN OD1  O  -8.145  10.761   2.779 1.00 . A A .  13 ASN OD1  1 1 
        1   224 1 1  14 ARG C    C  -2.205  14.379   6.284 1.00 . A A .  14 ARG C    1 1 
        1   225 1 1  14 ARG CA   C  -3.618  15.011   6.309 1.00 . A A .  14 ARG CA   1 1 
        1   226 1 1  14 ARG CB   C  -3.839  15.759   7.644 1.00 . A A .  14 ARG CB   1 1 
        1   227 1 1  14 ARG CD   C  -5.404  17.062   9.199 1.00 . A A .  14 ARG CD   1 1 
        1   228 1 1  14 ARG CG   C  -5.209  16.453   7.795 1.00 . A A .  14 ARG CG   1 1 
        1   229 1 1  14 ARG CZ   C  -4.051  18.483  10.758 1.00 . A A .  14 ARG CZ   1 1 
        1   230 1 1  14 ARG H    H  -5.326  13.874   6.847 1.00 . A A .  14 ARG H    1 1 
        1   231 1 1  14 ARG HA   H  -3.713  15.714   5.483 1.00 . A A .  14 ARG HA   1 1 
        1   232 1 1  14 ARG HB2  H  -3.736  15.045   8.457 1.00 . A A .  14 ARG HB2  1 1 
        1   233 1 1  14 ARG HB3  H  -3.063  16.515   7.751 1.00 . A A .  14 ARG HB3  1 1 
        1   234 1 1  14 ARG HD2  H  -6.352  17.587   9.226 1.00 . A A .  14 ARG HD2  1 1 
        1   235 1 1  14 ARG HD3  H  -5.421  16.261   9.932 1.00 . A A .  14 ARG HD3  1 1 
        1   236 1 1  14 ARG HE   H  -3.753  18.299   8.794 1.00 . A A .  14 ARG HE   1 1 
        1   237 1 1  14 ARG HG2  H  -5.286  17.246   7.059 1.00 . A A .  14 ARG HG2  1 1 
        1   238 1 1  14 ARG HG3  H  -5.998  15.725   7.614 1.00 . A A .  14 ARG HG3  1 1 
        1   239 1 1  14 ARG HH11 H  -5.567  17.517  11.711 1.00 . A A .  14 ARG HH11 1 1 
        1   240 1 1  14 ARG HH12 H  -4.565  18.497  12.725 1.00 . A A .  14 ARG HH12 1 1 
        1   241 1 1  14 ARG HH21 H  -2.464  19.559  10.113 1.00 . A A .  14 ARG HH21 1 1 
        1   242 1 1  14 ARG HH22 H  -2.798  19.674  11.812 1.00 . A A .  14 ARG HH22 1 1 
        1   243 1 1  14 ARG N    N  -4.642  13.969   6.147 1.00 . A A .  14 ARG N    1 1 
        1   244 1 1  14 ARG NE   N  -4.325  18.004   9.538 1.00 . A A .  14 ARG NE   1 1 
        1   245 1 1  14 ARG NH1  N  -4.788  18.140  11.816 1.00 . A A .  14 ARG NH1  1 1 
        1   246 1 1  14 ARG NH2  N  -3.024  19.304  10.910 1.00 . A A .  14 ARG NH2  1 1 
        1   247 1 1  14 ARG O    O  -1.338  14.817   5.531 1.00 . A A .  14 ARG O    1 1 
        1   248 1 1  15 MET C    C  -0.406  11.765   5.983 1.00 . A A .  15 MET C    1 1 
        1   249 1 1  15 MET CA   C  -0.721  12.612   7.233 1.00 . A A .  15 MET CA   1 1 
        1   250 1 1  15 MET CB   C  -0.711  11.733   8.516 1.00 . A A .  15 MET CB   1 1 
        1   251 1 1  15 MET CE   C   0.734  11.575  11.486 1.00 . A A .  15 MET CE   1 1 
        1   252 1 1  15 MET CG   C   0.591  10.942   8.761 1.00 . A A .  15 MET CG   1 1 
        1   253 1 1  15 MET H    H  -2.770  13.011   7.643 1.00 . A A .  15 MET H    1 1 
        1   254 1 1  15 MET HA   H   0.056  13.369   7.336 1.00 . A A .  15 MET HA   1 1 
        1   255 1 1  15 MET HB2  H  -0.876  12.375   9.373 1.00 . A A .  15 MET HB2  1 1 
        1   256 1 1  15 MET HB3  H  -1.531  11.027   8.460 1.00 . A A .  15 MET HB3  1 1 
        1   257 1 1  15 MET HE1  H   1.618  12.152  11.258 1.00 . A A .  15 MET HE1  1 1 
        1   258 1 1  15 MET HE2  H   0.783  11.238  12.513 1.00 . A A .  15 MET HE2  1 1 
        1   259 1 1  15 MET HE3  H  -0.145  12.193  11.355 1.00 . A A .  15 MET HE3  1 1 
        1   260 1 1  15 MET HG2  H   0.677  10.167   8.008 1.00 . A A .  15 MET HG2  1 1 
        1   261 1 1  15 MET HG3  H   1.436  11.612   8.674 1.00 . A A .  15 MET HG3  1 1 
        1   262 1 1  15 MET N    N  -2.014  13.324   7.102 1.00 . A A .  15 MET N    1 1 
        1   263 1 1  15 MET O    O   0.741  11.722   5.545 1.00 . A A .  15 MET O    1 1 
        1   264 1 1  15 MET SD   S   0.649  10.154  10.390 1.00 . A A .  15 MET SD   1 1 
        1   265 1 1  16 GLN C    C  -0.847  11.266   3.021 1.00 . A A .  16 GLN C    1 1 
        1   266 1 1  16 GLN CA   C  -1.327  10.337   4.154 1.00 . A A .  16 GLN CA   1 1 
        1   267 1 1  16 GLN CB   C  -2.705   9.742   3.766 1.00 . A A .  16 GLN CB   1 1 
        1   268 1 1  16 GLN CD   C  -2.758   7.622   5.226 1.00 . A A .  16 GLN CD   1 1 
        1   269 1 1  16 GLN CG   C  -3.411   8.951   4.873 1.00 . A A .  16 GLN CG   1 1 
        1   270 1 1  16 GLN H    H  -2.277  11.077   5.912 1.00 . A A .  16 GLN H    1 1 
        1   271 1 1  16 GLN HA   H  -0.612   9.536   4.294 1.00 . A A .  16 GLN HA   1 1 
        1   272 1 1  16 GLN HB2  H  -3.363  10.561   3.476 1.00 . A A .  16 GLN HB2  1 1 
        1   273 1 1  16 GLN HB3  H  -2.577   9.091   2.907 1.00 . A A .  16 GLN HB3  1 1 
        1   274 1 1  16 GLN HE21 H  -3.998   6.623   4.036 1.00 . A A .  16 GLN HE21 1 1 
        1   275 1 1  16 GLN HE22 H  -2.865   5.670   4.899 1.00 . A A .  16 GLN HE22 1 1 
        1   276 1 1  16 GLN HG2  H  -3.432   9.562   5.768 1.00 . A A .  16 GLN HG2  1 1 
        1   277 1 1  16 GLN HG3  H  -4.436   8.767   4.562 1.00 . A A .  16 GLN HG3  1 1 
        1   278 1 1  16 GLN N    N  -1.431  11.093   5.431 1.00 . A A .  16 GLN N    1 1 
        1   279 1 1  16 GLN NE2  N  -3.258   6.532   4.659 1.00 . A A .  16 GLN NE2  1 1 
        1   280 1 1  16 GLN O    O  -0.048  10.873   2.167 1.00 . A A .  16 GLN O    1 1 
        1   281 1 1  16 GLN OE1  O  -1.847   7.578   6.047 1.00 . A A .  16 GLN OE1  1 1 
        1   282 1 1  17 TYR C    C   0.477  14.006   2.346 1.00 . A A .  17 TYR C    1 1 
        1   283 1 1  17 TYR CA   C  -0.993  13.579   2.122 1.00 . A A .  17 TYR CA   1 1 
        1   284 1 1  17 TYR CB   C  -1.933  14.804   2.254 1.00 . A A .  17 TYR CB   1 1 
        1   285 1 1  17 TYR CD1  C  -1.703  15.918  -0.039 1.00 . A A .  17 TYR CD1  1 1 
        1   286 1 1  17 TYR CD2  C  -1.026  17.183   1.874 1.00 . A A .  17 TYR CD2  1 1 
        1   287 1 1  17 TYR CE1  C  -1.341  16.968  -0.866 1.00 . A A .  17 TYR CE1  1 1 
        1   288 1 1  17 TYR CE2  C  -0.668  18.237   1.049 1.00 . A A .  17 TYR CE2  1 1 
        1   289 1 1  17 TYR CG   C  -1.552  15.994   1.349 1.00 . A A .  17 TYR CG   1 1 
        1   290 1 1  17 TYR CZ   C  -0.825  18.128  -0.317 1.00 . A A .  17 TYR CZ   1 1 
        1   291 1 1  17 TYR H    H  -2.027  12.666   3.775 1.00 . A A .  17 TYR H    1 1 
        1   292 1 1  17 TYR HA   H  -1.091  13.175   1.112 1.00 . A A .  17 TYR HA   1 1 
        1   293 1 1  17 TYR HB2  H  -2.943  14.505   1.994 1.00 . A A .  17 TYR HB2  1 1 
        1   294 1 1  17 TYR HB3  H  -1.928  15.141   3.281 1.00 . A A .  17 TYR HB3  1 1 
        1   295 1 1  17 TYR HD1  H  -2.104  15.012  -0.476 1.00 . A A .  17 TYR HD1  1 1 
        1   296 1 1  17 TYR HD2  H  -0.893  17.272   2.947 1.00 . A A .  17 TYR HD2  1 1 
        1   297 1 1  17 TYR HE1  H  -1.469  16.879  -1.938 1.00 . A A .  17 TYR HE1  1 1 
        1   298 1 1  17 TYR HE2  H  -0.263  19.145   1.482 1.00 . A A .  17 TYR HE2  1 1 
        1   299 1 1  17 TYR HH   H  -1.115  19.287  -1.835 1.00 . A A .  17 TYR HH   1 1 
        1   300 1 1  17 TYR N    N  -1.371  12.499   3.061 1.00 . A A .  17 TYR N    1 1 
        1   301 1 1  17 TYR O    O   1.210  14.199   1.381 1.00 . A A .  17 TYR O    1 1 
        1   302 1 1  17 TYR OH   O  -0.457  19.177  -1.139 1.00 . A A .  17 TYR OH   1 1 
        1   303 1 1  18 GLU C    C   3.286  13.480   3.412 1.00 . A A .  18 GLU C    1 1 
        1   304 1 1  18 GLU CA   C   2.278  14.485   4.023 1.00 . A A .  18 GLU CA   1 1 
        1   305 1 1  18 GLU CB   C   2.428  14.525   5.577 1.00 . A A .  18 GLU CB   1 1 
        1   306 1 1  18 GLU CD   C   1.759  15.618   7.817 1.00 . A A .  18 GLU CD   1 1 
        1   307 1 1  18 GLU CG   C   1.669  15.669   6.276 1.00 . A A .  18 GLU CG   1 1 
        1   308 1 1  18 GLU H    H   0.202  14.057   4.338 1.00 . A A .  18 GLU H    1 1 
        1   309 1 1  18 GLU HA   H   2.496  15.472   3.623 1.00 . A A .  18 GLU HA   1 1 
        1   310 1 1  18 GLU HB2  H   2.069  13.588   5.987 1.00 . A A .  18 GLU HB2  1 1 
        1   311 1 1  18 GLU HB3  H   3.482  14.628   5.824 1.00 . A A .  18 GLU HB3  1 1 
        1   312 1 1  18 GLU HG2  H   2.087  16.613   5.944 1.00 . A A .  18 GLU HG2  1 1 
        1   313 1 1  18 GLU HG3  H   0.627  15.626   5.976 1.00 . A A .  18 GLU HG3  1 1 
        1   314 1 1  18 GLU N    N   0.877  14.152   3.632 1.00 . A A .  18 GLU N    1 1 
        1   315 1 1  18 GLU O    O   4.416  13.850   3.057 1.00 . A A .  18 GLU O    1 1 
        1   316 1 1  18 GLU OE1  O   2.873  15.782   8.363 1.00 . A A .  18 GLU OE1  1 1 
        1   317 1 1  18 GLU OE2  O   0.727  15.409   8.494 1.00 . A A .  18 GLU OE2  1 1 
        1   318 1 1  19 VAL C    C   3.717  11.216   1.174 1.00 . A A .  19 VAL C    1 1 
        1   319 1 1  19 VAL CA   C   3.690  11.139   2.714 1.00 . A A .  19 VAL CA   1 1 
        1   320 1 1  19 VAL CB   C   3.204   9.709   3.153 1.00 . A A .  19 VAL CB   1 1 
        1   321 1 1  19 VAL CG1  C   4.211   8.628   2.700 1.00 . A A .  19 VAL CG1  1 1 
        1   322 1 1  19 VAL CG2  C   2.976   9.621   4.680 1.00 . A A .  19 VAL CG2  1 1 
        1   323 1 1  19 VAL H    H   1.930  11.988   3.545 1.00 . A A .  19 VAL H    1 1 
        1   324 1 1  19 VAL HA   H   4.702  11.279   3.097 1.00 . A A .  19 VAL HA   1 1 
        1   325 1 1  19 VAL HB   H   2.252   9.509   2.663 1.00 . A A .  19 VAL HB   1 1 
        1   326 1 1  19 VAL HG11 H   3.886   7.657   3.061 1.00 . A A .  19 VAL HG11 1 1 
        1   327 1 1  19 VAL HG12 H   5.189   8.847   3.117 1.00 . A A .  19 VAL HG12 1 1 
        1   328 1 1  19 VAL HG13 H   4.280   8.609   1.618 1.00 . A A .  19 VAL HG13 1 1 
        1   329 1 1  19 VAL HG21 H   2.613   8.633   4.937 1.00 . A A .  19 VAL HG21 1 1 
        1   330 1 1  19 VAL HG22 H   2.245  10.361   4.982 1.00 . A A .  19 VAL HG22 1 1 
        1   331 1 1  19 VAL HG23 H   3.906   9.806   5.205 1.00 . A A .  19 VAL HG23 1 1 
        1   332 1 1  19 VAL N    N   2.850  12.212   3.267 1.00 . A A .  19 VAL N    1 1 
        1   333 1 1  19 VAL O    O   4.778  11.180   0.563 1.00 . A A .  19 VAL O    1 1 
        1   334 1 1  20 THR C    C   3.100  12.617  -1.488 1.00 . A A .  20 THR C    1 1 
        1   335 1 1  20 THR CA   C   2.359  11.394  -0.902 1.00 . A A .  20 THR CA   1 1 
        1   336 1 1  20 THR CB   C   0.844  11.484  -1.280 1.00 . A A .  20 THR CB   1 1 
        1   337 1 1  20 THR CG2  C   0.592  11.364  -2.801 1.00 . A A .  20 THR CG2  1 1 
        1   338 1 1  20 THR H    H   1.725  11.229   1.127 1.00 . A A .  20 THR H    1 1 
        1   339 1 1  20 THR HA   H   2.767  10.485  -1.340 1.00 . A A .  20 THR HA   1 1 
        1   340 1 1  20 THR HB   H   0.447  12.435  -0.937 1.00 . A A .  20 THR HB   1 1 
        1   341 1 1  20 THR HG1  H   0.746   9.783  -0.275 1.00 . A A .  20 THR HG1  1 1 
        1   342 1 1  20 THR HG21 H  -0.468  11.468  -3.008 1.00 . A A .  20 THR HG21 1 1 
        1   343 1 1  20 THR HG22 H   0.938  10.395  -3.158 1.00 . A A .  20 THR HG22 1 1 
        1   344 1 1  20 THR HG23 H   1.127  12.142  -3.323 1.00 . A A .  20 THR HG23 1 1 
        1   345 1 1  20 THR N    N   2.524  11.297   0.568 1.00 . A A .  20 THR N    1 1 
        1   346 1 1  20 THR O    O   3.765  12.517  -2.519 1.00 . A A .  20 THR O    1 1 
        1   347 1 1  20 THR OG1  O   0.130  10.446  -0.611 1.00 . A A .  20 THR OG1  1 1 
        1   348 1 1  21 GLN C    C   5.011  15.161  -1.162 1.00 . A A .  21 GLN C    1 1 
        1   349 1 1  21 GLN CA   C   3.480  15.042  -1.284 1.00 . A A .  21 GLN CA   1 1 
        1   350 1 1  21 GLN CB   C   2.768  16.199  -0.530 1.00 . A A .  21 GLN CB   1 1 
        1   351 1 1  21 GLN CD   C   2.839  17.953  -2.453 1.00 . A A .  21 GLN CD   1 1 
        1   352 1 1  21 GLN CG   C   3.166  17.625  -0.984 1.00 . A A .  21 GLN CG   1 1 
        1   353 1 1  21 GLN H    H   2.633  13.696   0.126 1.00 . A A .  21 GLN H    1 1 
        1   354 1 1  21 GLN HA   H   3.209  15.107  -2.337 1.00 . A A .  21 GLN HA   1 1 
        1   355 1 1  21 GLN HB2  H   1.699  16.089  -0.665 1.00 . A A .  21 GLN HB2  1 1 
        1   356 1 1  21 GLN HB3  H   2.986  16.107   0.533 1.00 . A A .  21 GLN HB3  1 1 
        1   357 1 1  21 GLN HE21 H   1.149  16.882  -2.397 1.00 . A A .  21 GLN HE21 1 1 
        1   358 1 1  21 GLN HE22 H   1.517  17.638  -3.908 1.00 . A A .  21 GLN HE22 1 1 
        1   359 1 1  21 GLN HG2  H   2.641  18.338  -0.368 1.00 . A A .  21 GLN HG2  1 1 
        1   360 1 1  21 GLN HG3  H   4.234  17.744  -0.823 1.00 . A A .  21 GLN HG3  1 1 
        1   361 1 1  21 GLN N    N   3.010  13.745  -0.780 1.00 . A A .  21 GLN N    1 1 
        1   362 1 1  21 GLN NE2  N   1.720  17.445  -2.968 1.00 . A A .  21 GLN NE2  1 1 
        1   363 1 1  21 GLN O    O   5.693  15.463  -2.145 1.00 . A A .  21 GLN O    1 1 
        1   364 1 1  21 GLN OE1  O   3.576  18.688  -3.112 1.00 . A A .  21 GLN OE1  1 1 
        1   365 1 1  22 ASN C    C   7.804  13.906   0.521 1.00 . A A .  22 ASN C    1 1 
        1   366 1 1  22 ASN CA   C   6.961  15.188   0.375 1.00 . A A .  22 ASN CA   1 1 
        1   367 1 1  22 ASN CB   C   7.023  16.027   1.689 1.00 . A A .  22 ASN CB   1 1 
        1   368 1 1  22 ASN CG   C   8.388  16.686   1.963 1.00 . A A .  22 ASN CG   1 1 
        1   369 1 1  22 ASN H    H   4.972  14.488   0.739 1.00 . A A .  22 ASN H    1 1 
        1   370 1 1  22 ASN HA   H   7.385  15.778  -0.434 1.00 . A A .  22 ASN HA   1 1 
        1   371 1 1  22 ASN HB2  H   6.301  16.822   1.629 1.00 . A A .  22 ASN HB2  1 1 
        1   372 1 1  22 ASN HB3  H   6.762  15.388   2.533 1.00 . A A .  22 ASN HB3  1 1 
        1   373 1 1  22 ASN HD21 H   8.135  16.492   3.923 1.00 . A A .  22 ASN HD21 1 1 
        1   374 1 1  22 ASN HD22 H   9.617  17.237   3.429 1.00 . A A .  22 ASN HD22 1 1 
        1   375 1 1  22 ASN N    N   5.543  14.891   0.044 1.00 . A A .  22 ASN N    1 1 
        1   376 1 1  22 ASN ND2  N   8.748  16.820   3.232 1.00 . A A .  22 ASN ND2  1 1 
        1   377 1 1  22 ASN O    O   9.016  13.997   0.756 1.00 . A A .  22 ASN O    1 1 
        1   378 1 1  22 ASN OD1  O   9.120  17.041   1.035 1.00 . A A .  22 ASN OD1  1 1 
        1   379 1 1  23 ASN C    C   7.999  11.263   2.175 1.00 . A A .  23 ASN C    1 1 
        1   380 1 1  23 ASN CA   C   7.776  11.395   0.661 1.00 . A A .  23 ASN CA   1 1 
        1   381 1 1  23 ASN CB   C   9.093  11.134  -0.138 1.00 . A A .  23 ASN CB   1 1 
        1   382 1 1  23 ASN CG   C   8.872  11.035  -1.645 1.00 . A A .  23 ASN CG   1 1 
        1   383 1 1  23 ASN H    H   6.234  12.735   0.022 1.00 . A A .  23 ASN H    1 1 
        1   384 1 1  23 ASN HA   H   7.042  10.645   0.380 1.00 . A A .  23 ASN HA   1 1 
        1   385 1 1  23 ASN HB2  H   9.793  11.943   0.054 1.00 . A A .  23 ASN HB2  1 1 
        1   386 1 1  23 ASN HB3  H   9.537  10.205   0.210 1.00 . A A .  23 ASN HB3  1 1 
        1   387 1 1  23 ASN HD21 H   9.034  13.006  -1.837 1.00 . A A .  23 ASN HD21 1 1 
        1   388 1 1  23 ASN HD22 H   8.734  12.132  -3.290 1.00 . A A .  23 ASN HD22 1 1 
        1   389 1 1  23 ASN N    N   7.163  12.722   0.354 1.00 . A A .  23 ASN N    1 1 
        1   390 1 1  23 ASN ND2  N   8.882  12.171  -2.330 1.00 . A A .  23 ASN ND2  1 1 
        1   391 1 1  23 ASN O    O   8.899  10.544   2.625 1.00 . A A .  23 ASN O    1 1 
        1   392 1 1  23 ASN OD1  O   8.684   9.949  -2.184 1.00 . A A .  23 ASN OD1  1 1 
        1   393 1 1  24 GLY C    C   7.155  10.684   5.096 1.00 . A A .  24 GLY C    1 1 
        1   394 1 1  24 GLY CA   C   7.242  12.030   4.390 1.00 . A A .  24 GLY CA   1 1 
        1   395 1 1  24 GLY H    H   6.349  12.363   2.506 1.00 . A A .  24 GLY H    1 1 
        1   396 1 1  24 GLY HA2  H   8.191  12.500   4.623 1.00 . A A .  24 GLY HA2  1 1 
        1   397 1 1  24 GLY HA3  H   6.449  12.662   4.761 1.00 . A A .  24 GLY HA3  1 1 
        1   398 1 1  24 GLY N    N   7.112  11.931   2.944 1.00 . A A .  24 GLY N    1 1 
        1   399 1 1  24 GLY O    O   6.228   9.907   4.864 1.00 . A A .  24 GLY O    1 1 
        1   400 1 1  25 THR C    C   7.395   9.410   8.047 1.00 . A A .  25 THR C    1 1 
        1   401 1 1  25 THR CA   C   8.191   9.202   6.751 1.00 . A A .  25 THR CA   1 1 
        1   402 1 1  25 THR CB   C   9.682   8.798   7.056 1.00 . A A .  25 THR CB   1 1 
        1   403 1 1  25 THR CG2  C  10.425   9.856   7.895 1.00 . A A .  25 THR CG2  1 1 
        1   404 1 1  25 THR H    H   8.815  11.113   6.074 1.00 . A A .  25 THR H    1 1 
        1   405 1 1  25 THR HA   H   7.732   8.398   6.174 1.00 . A A .  25 THR HA   1 1 
        1   406 1 1  25 THR HB   H  10.199   8.699   6.106 1.00 . A A .  25 THR HB   1 1 
        1   407 1 1  25 THR HG1  H   8.942   7.376   8.234 1.00 . A A .  25 THR HG1  1 1 
        1   408 1 1  25 THR HG21 H  10.420  10.805   7.373 1.00 . A A .  25 THR HG21 1 1 
        1   409 1 1  25 THR HG22 H  11.450   9.544   8.057 1.00 . A A .  25 THR HG22 1 1 
        1   410 1 1  25 THR HG23 H   9.933   9.973   8.853 1.00 . A A .  25 THR HG23 1 1 
        1   411 1 1  25 THR N    N   8.128  10.427   5.961 1.00 . A A .  25 THR N    1 1 
        1   412 1 1  25 THR O    O   7.464  10.488   8.653 1.00 . A A .  25 THR O    1 1 
        1   413 1 1  25 THR OG1  O   9.750   7.524   7.725 1.00 . A A .  25 THR OG1  1 1 
        1   414 1 1  26 GLU C    C   7.094   8.299  10.860 1.00 . A A .  26 GLU C    1 1 
        1   415 1 1  26 GLU CA   C   5.983   8.342   9.772 1.00 . A A .  26 GLU CA   1 1 
        1   416 1 1  26 GLU CB   C   5.040   7.090   9.892 1.00 . A A .  26 GLU CB   1 1 
        1   417 1 1  26 GLU CD   C   6.380   5.391   8.422 1.00 . A A .  26 GLU CD   1 1 
        1   418 1 1  26 GLU CG   C   5.715   5.688   9.787 1.00 . A A .  26 GLU CG   1 1 
        1   419 1 1  26 GLU H    H   6.351   7.701   7.800 1.00 . A A .  26 GLU H    1 1 
        1   420 1 1  26 GLU HA   H   5.394   9.243   9.909 1.00 . A A .  26 GLU HA   1 1 
        1   421 1 1  26 GLU HB2  H   4.528   7.137  10.848 1.00 . A A .  26 GLU HB2  1 1 
        1   422 1 1  26 GLU HB3  H   4.291   7.159   9.111 1.00 . A A .  26 GLU HB3  1 1 
        1   423 1 1  26 GLU HG2  H   6.470   5.620  10.562 1.00 . A A .  26 GLU HG2  1 1 
        1   424 1 1  26 GLU HG3  H   4.965   4.926   9.978 1.00 . A A .  26 GLU HG3  1 1 
        1   425 1 1  26 GLU N    N   6.588   8.412   8.429 1.00 . A A .  26 GLU N    1 1 
        1   426 1 1  26 GLU O    O   8.181   7.754  10.610 1.00 . A A .  26 GLU O    1 1 
        1   427 1 1  26 GLU OE1  O   5.679   4.995   7.470 1.00 . A A .  26 GLU OE1  1 1 
        1   428 1 1  26 GLU OE2  O   7.608   5.579   8.294 1.00 . A A .  26 GLU OE2  1 1 
        1   429 1 1  27 PRO C    C   7.824   7.341  13.773 1.00 . A A .  27 PRO C    1 1 
        1   430 1 1  27 PRO CA   C   7.807   8.796  13.209 1.00 . A A .  27 PRO CA   1 1 
        1   431 1 1  27 PRO CB   C   7.248   9.835  14.236 1.00 . A A .  27 PRO CB   1 1 
        1   432 1 1  27 PRO CD   C   5.704   9.759  12.415 1.00 . A A .  27 PRO CD   1 1 
        1   433 1 1  27 PRO CG   C   6.283  10.681  13.456 1.00 . A A .  27 PRO CG   1 1 
        1   434 1 1  27 PRO HA   H   8.816   9.071  12.909 1.00 . A A .  27 PRO HA   1 1 
        1   435 1 1  27 PRO HB2  H   6.754   9.323  15.059 1.00 . A A .  27 PRO HB2  1 1 
        1   436 1 1  27 PRO HB3  H   8.065  10.430  14.634 1.00 . A A .  27 PRO HB3  1 1 
        1   437 1 1  27 PRO HD2  H   4.895   9.159  12.828 1.00 . A A .  27 PRO HD2  1 1 
        1   438 1 1  27 PRO HD3  H   5.355  10.319  11.557 1.00 . A A .  27 PRO HD3  1 1 
        1   439 1 1  27 PRO HG2  H   5.504  11.057  14.109 1.00 . A A .  27 PRO HG2  1 1 
        1   440 1 1  27 PRO HG3  H   6.806  11.508  12.983 1.00 . A A .  27 PRO HG3  1 1 
        1   441 1 1  27 PRO N    N   6.867   8.910  12.065 1.00 . A A .  27 PRO N    1 1 
        1   442 1 1  27 PRO O    O   6.958   6.538  13.392 1.00 . A A .  27 PRO O    1 1 
        1   443 1 1  28 PRO C    C   7.536   5.254  15.989 1.00 . A A .  28 PRO C    1 1 
        1   444 1 1  28 PRO CA   C   8.875   5.634  15.308 1.00 . A A .  28 PRO CA   1 1 
        1   445 1 1  28 PRO CB   C  10.028   5.789  16.335 1.00 . A A .  28 PRO CB   1 1 
        1   446 1 1  28 PRO CD   C  10.030   7.780  14.993 1.00 . A A .  28 PRO CD   1 1 
        1   447 1 1  28 PRO CG   C  10.939   6.796  15.706 1.00 . A A .  28 PRO CG   1 1 
        1   448 1 1  28 PRO HA   H   9.140   4.855  14.592 1.00 . A A .  28 PRO HA   1 1 
        1   449 1 1  28 PRO HB2  H   9.641   6.139  17.291 1.00 . A A .  28 PRO HB2  1 1 
        1   450 1 1  28 PRO HB3  H  10.527   4.837  16.480 1.00 . A A .  28 PRO HB3  1 1 
        1   451 1 1  28 PRO HD2  H   9.754   8.599  15.653 1.00 . A A .  28 PRO HD2  1 1 
        1   452 1 1  28 PRO HD3  H  10.515   8.169  14.103 1.00 . A A .  28 PRO HD3  1 1 
        1   453 1 1  28 PRO HG2  H  11.527   7.297  16.468 1.00 . A A .  28 PRO HG2  1 1 
        1   454 1 1  28 PRO HG3  H  11.601   6.310  14.992 1.00 . A A .  28 PRO HG3  1 1 
        1   455 1 1  28 PRO N    N   8.831   6.964  14.639 1.00 . A A .  28 PRO N    1 1 
        1   456 1 1  28 PRO O    O   7.228   5.728  17.087 1.00 . A A .  28 PRO O    1 1 
        1   457 1 1  29 PHE C    C   5.256   2.578  15.096 1.00 . A A .  29 PHE C    1 1 
        1   458 1 1  29 PHE CA   C   5.427   3.962  15.702 1.00 . A A .  29 PHE CA   1 1 
        1   459 1 1  29 PHE CB   C   4.253   4.883  15.230 1.00 . A A .  29 PHE CB   1 1 
        1   460 1 1  29 PHE CD1  C   3.878   6.280  17.313 1.00 . A A .  29 PHE CD1  1 1 
        1   461 1 1  29 PHE CD2  C   4.316   7.431  15.264 1.00 . A A .  29 PHE CD2  1 1 
        1   462 1 1  29 PHE CE1  C   3.782   7.487  17.973 1.00 . A A .  29 PHE CE1  1 1 
        1   463 1 1  29 PHE CE2  C   4.215   8.638  15.932 1.00 . A A .  29 PHE CE2  1 1 
        1   464 1 1  29 PHE CG   C   4.151   6.228  15.947 1.00 . A A .  29 PHE CG   1 1 
        1   465 1 1  29 PHE CZ   C   3.951   8.665  17.285 1.00 . A A .  29 PHE CZ   1 1 
        1   466 1 1  29 PHE H    H   7.061   4.126  14.407 1.00 . A A .  29 PHE H    1 1 
        1   467 1 1  29 PHE HA   H   5.416   3.882  16.791 1.00 . A A .  29 PHE HA   1 1 
        1   468 1 1  29 PHE HB2  H   4.366   5.074  14.167 1.00 . A A .  29 PHE HB2  1 1 
        1   469 1 1  29 PHE HB3  H   3.311   4.358  15.381 1.00 . A A .  29 PHE HB3  1 1 
        1   470 1 1  29 PHE HD1  H   3.747   5.359  17.865 1.00 . A A .  29 PHE HD1  1 1 
        1   471 1 1  29 PHE HD2  H   4.525   7.419  14.201 1.00 . A A .  29 PHE HD2  1 1 
        1   472 1 1  29 PHE HE1  H   3.568   7.507  19.031 1.00 . A A .  29 PHE HE1  1 1 
        1   473 1 1  29 PHE HE2  H   4.346   9.570  15.390 1.00 . A A .  29 PHE HE2  1 1 
        1   474 1 1  29 PHE HZ   H   3.883   9.610  17.803 1.00 . A A .  29 PHE HZ   1 1 
        1   475 1 1  29 PHE N    N   6.735   4.448  15.274 1.00 . A A .  29 PHE N    1 1 
        1   476 1 1  29 PHE O    O   4.964   1.626  15.821 1.00 . A A .  29 PHE O    1 1 
        1   477 1 1  30 GLN C    C   6.074   0.090  13.491 1.00 . A A .  30 GLN C    1 1 
        1   478 1 1  30 GLN CA   C   5.353   1.315  12.885 1.00 . A A .  30 GLN CA   1 1 
        1   479 1 1  30 GLN CB   C   5.860   1.611  11.438 1.00 . A A .  30 GLN CB   1 1 
        1   480 1 1  30 GLN CD   C   7.911   2.143   9.966 1.00 . A A .  30 GLN CD   1 1 
        1   481 1 1  30 GLN CG   C   7.261   2.266  11.350 1.00 . A A .  30 GLN CG   1 1 
        1   482 1 1  30 GLN H    H   5.684   3.354  13.298 1.00 . A A .  30 GLN H    1 1 
        1   483 1 1  30 GLN HA   H   4.298   1.075  12.820 1.00 . A A .  30 GLN HA   1 1 
        1   484 1 1  30 GLN HB2  H   5.882   0.681  10.879 1.00 . A A .  30 GLN HB2  1 1 
        1   485 1 1  30 GLN HB3  H   5.150   2.277  10.957 1.00 . A A .  30 GLN HB3  1 1 
        1   486 1 1  30 GLN HE21 H   8.865   3.855  10.225 1.00 . A A .  30 GLN HE21 1 1 
        1   487 1 1  30 GLN HE22 H   9.154   3.054   8.722 1.00 . A A .  30 GLN HE22 1 1 
        1   488 1 1  30 GLN HG2  H   7.169   3.316  11.598 1.00 . A A .  30 GLN HG2  1 1 
        1   489 1 1  30 GLN HG3  H   7.913   1.792  12.075 1.00 . A A .  30 GLN HG3  1 1 
        1   490 1 1  30 GLN N    N   5.459   2.522  13.742 1.00 . A A .  30 GLN N    1 1 
        1   491 1 1  30 GLN NE2  N   8.723   3.115   9.598 1.00 . A A .  30 GLN NE2  1 1 
        1   492 1 1  30 GLN O    O   7.244  -0.205  13.223 1.00 . A A .  30 GLN O    1 1 
        1   493 1 1  30 GLN OE1  O   7.689   1.179   9.241 1.00 . A A .  30 GLN OE1  1 1 
        1   494 1 1  31 ASN C    C   4.576  -2.759  15.122 1.00 . A A .  31 ASN C    1 1 
        1   495 1 1  31 ASN CA   C   5.748  -1.761  15.104 1.00 . A A .  31 ASN CA   1 1 
        1   496 1 1  31 ASN CB   C   6.240  -1.422  16.545 1.00 . A A .  31 ASN CB   1 1 
        1   497 1 1  31 ASN CG   C   7.606  -0.731  16.586 1.00 . A A .  31 ASN CG   1 1 
        1   498 1 1  31 ASN H    H   4.497  -0.118  14.628 1.00 . A A .  31 ASN H    1 1 
        1   499 1 1  31 ASN HA   H   6.558  -2.222  14.550 1.00 . A A .  31 ASN HA   1 1 
        1   500 1 1  31 ASN HB2  H   5.510  -0.769  17.016 1.00 . A A .  31 ASN HB2  1 1 
        1   501 1 1  31 ASN HB3  H   6.309  -2.336  17.126 1.00 . A A .  31 ASN HB3  1 1 
        1   502 1 1  31 ASN HD21 H   7.099   0.254  18.227 1.00 . A A .  31 ASN HD21 1 1 
        1   503 1 1  31 ASN HD22 H   8.688   0.570  17.623 1.00 . A A .  31 ASN HD22 1 1 
        1   504 1 1  31 ASN N    N   5.350  -0.538  14.392 1.00 . A A .  31 ASN N    1 1 
        1   505 1 1  31 ASN ND2  N   7.818   0.115  17.579 1.00 . A A .  31 ASN ND2  1 1 
        1   506 1 1  31 ASN O    O   3.594  -2.584  14.385 1.00 . A A .  31 ASN O    1 1 
        1   507 1 1  31 ASN OD1  O   8.468  -0.967  15.734 1.00 . A A .  31 ASN OD1  1 1 
        1   508 1 1  32 GLU C    C   2.287  -4.530  16.228 1.00 . A A .  32 GLU C    1 1 
        1   509 1 1  32 GLU CA   C   3.773  -4.954  16.078 1.00 . A A .  32 GLU CA   1 1 
        1   510 1 1  32 GLU CB   C   4.175  -5.847  17.300 1.00 . A A .  32 GLU CB   1 1 
        1   511 1 1  32 GLU CD   C   6.346  -6.761  16.224 1.00 . A A .  32 GLU CD   1 1 
        1   512 1 1  32 GLU CG   C   5.686  -6.141  17.467 1.00 . A A .  32 GLU CG   1 1 
        1   513 1 1  32 GLU H    H   5.479  -3.806  16.564 1.00 . A A .  32 GLU H    1 1 
        1   514 1 1  32 GLU HA   H   3.873  -5.539  15.167 1.00 . A A .  32 GLU HA   1 1 
        1   515 1 1  32 GLU HB2  H   3.839  -5.362  18.208 1.00 . A A .  32 GLU HB2  1 1 
        1   516 1 1  32 GLU HB3  H   3.657  -6.800  17.214 1.00 . A A .  32 GLU HB3  1 1 
        1   517 1 1  32 GLU HG2  H   6.200  -5.212  17.712 1.00 . A A .  32 GLU HG2  1 1 
        1   518 1 1  32 GLU HG3  H   5.812  -6.823  18.305 1.00 . A A .  32 GLU HG3  1 1 
        1   519 1 1  32 GLU N    N   4.709  -3.808  15.968 1.00 . A A .  32 GLU N    1 1 
        1   520 1 1  32 GLU O    O   1.392  -5.331  16.013 1.00 . A A .  32 GLU O    1 1 
        1   521 1 1  32 GLU OE1  O   6.845  -6.001  15.360 1.00 . A A .  32 GLU OE1  1 1 
        1   522 1 1  32 GLU OE2  O   6.386  -8.002  16.115 1.00 . A A .  32 GLU OE2  1 1 
        1   523 1 1  33 TYR C    C   0.080  -2.378  15.412 1.00 . A A .  33 TYR C    1 1 
        1   524 1 1  33 TYR CA   C   0.695  -2.727  16.783 1.00 . A A .  33 TYR CA   1 1 
        1   525 1 1  33 TYR CB   C   0.746  -1.484  17.701 1.00 . A A .  33 TYR CB   1 1 
        1   526 1 1  33 TYR CD1  C  -1.627  -1.477  18.659 1.00 . A A .  33 TYR CD1  1 1 
        1   527 1 1  33 TYR CD2  C  -0.892   0.473  17.489 1.00 . A A .  33 TYR CD2  1 1 
        1   528 1 1  33 TYR CE1  C  -2.850  -0.875  18.889 1.00 . A A .  33 TYR CE1  1 1 
        1   529 1 1  33 TYR CE2  C  -2.112   1.077  17.717 1.00 . A A .  33 TYR CE2  1 1 
        1   530 1 1  33 TYR CG   C  -0.616  -0.817  17.954 1.00 . A A .  33 TYR CG   1 1 
        1   531 1 1  33 TYR CZ   C  -3.089   0.400  18.418 1.00 . A A .  33 TYR CZ   1 1 
        1   532 1 1  33 TYR H    H   2.806  -2.712  16.881 1.00 . A A .  33 TYR H    1 1 
        1   533 1 1  33 TYR HA   H   0.072  -3.482  17.262 1.00 . A A .  33 TYR HA   1 1 
        1   534 1 1  33 TYR HB2  H   1.149  -1.781  18.661 1.00 . A A .  33 TYR HB2  1 1 
        1   535 1 1  33 TYR HB3  H   1.414  -0.750  17.261 1.00 . A A .  33 TYR HB3  1 1 
        1   536 1 1  33 TYR HD1  H  -1.444  -2.478  19.032 1.00 . A A .  33 TYR HD1  1 1 
        1   537 1 1  33 TYR HD2  H  -0.129   1.002  16.938 1.00 . A A .  33 TYR HD2  1 1 
        1   538 1 1  33 TYR HE1  H  -3.619  -1.408  19.435 1.00 . A A .  33 TYR HE1  1 1 
        1   539 1 1  33 TYR HE2  H  -2.298   2.078  17.347 1.00 . A A .  33 TYR HE2  1 1 
        1   540 1 1  33 TYR HH   H  -4.571   0.883  19.563 1.00 . A A .  33 TYR HH   1 1 
        1   541 1 1  33 TYR N    N   2.044  -3.280  16.642 1.00 . A A .  33 TYR N    1 1 
        1   542 1 1  33 TYR O    O  -1.037  -2.795  15.108 1.00 . A A .  33 TYR O    1 1 
        1   543 1 1  33 TYR OH   O  -4.321   0.997  18.639 1.00 . A A .  33 TYR OH   1 1 
        1   544 1 1  34 TRP C    C   0.294  -1.942  12.160 1.00 . A A .  34 TRP C    1 1 
        1   545 1 1  34 TRP CA   C   0.283  -0.993  13.365 1.00 . A A .  34 TRP CA   1 1 
        1   546 1 1  34 TRP CB   C   1.087   0.284  13.023 1.00 . A A .  34 TRP CB   1 1 
        1   547 1 1  34 TRP CD1  C   2.060   1.438  15.094 1.00 . A A .  34 TRP CD1  1 1 
        1   548 1 1  34 TRP CD2  C   0.139   2.335  14.401 1.00 . A A .  34 TRP CD2  1 1 
        1   549 1 1  34 TRP CE2  C   0.591   3.053  15.525 1.00 . A A .  34 TRP CE2  1 1 
        1   550 1 1  34 TRP CE3  C  -1.062   2.719  13.800 1.00 . A A .  34 TRP CE3  1 1 
        1   551 1 1  34 TRP CG   C   1.114   1.311  14.130 1.00 . A A .  34 TRP CG   1 1 
        1   552 1 1  34 TRP CH2  C  -1.292   4.479  15.454 1.00 . A A .  34 TRP CH2  1 1 
        1   553 1 1  34 TRP CZ2  C  -0.114   4.129  16.059 1.00 . A A .  34 TRP CZ2  1 1 
        1   554 1 1  34 TRP CZ3  C  -1.765   3.786  14.327 1.00 . A A .  34 TRP CZ3  1 1 
        1   555 1 1  34 TRP H    H   1.791  -1.532  14.786 1.00 . A A .  34 TRP H    1 1 
        1   556 1 1  34 TRP HA   H  -0.749  -0.708  13.568 1.00 . A A .  34 TRP HA   1 1 
        1   557 1 1  34 TRP HB2  H   2.112   0.007  12.794 1.00 . A A .  34 TRP HB2  1 1 
        1   558 1 1  34 TRP HB3  H   0.650   0.752  12.152 1.00 . A A .  34 TRP HB3  1 1 
        1   559 1 1  34 TRP HD1  H   2.932   0.805  15.171 1.00 . A A .  34 TRP HD1  1 1 
        1   560 1 1  34 TRP HE1  H   2.319   2.786  16.677 1.00 . A A .  34 TRP HE1  1 1 
        1   561 1 1  34 TRP HE3  H  -1.440   2.194  12.937 1.00 . A A .  34 TRP HE3  1 1 
        1   562 1 1  34 TRP HH2  H  -1.877   5.310  15.836 1.00 . A A .  34 TRP HH2  1 1 
        1   563 1 1  34 TRP HZ2  H   0.241   4.675  16.925 1.00 . A A .  34 TRP HZ2  1 1 
        1   564 1 1  34 TRP HZ3  H  -2.700   4.089  13.876 1.00 . A A .  34 TRP HZ3  1 1 
        1   565 1 1  34 TRP N    N   0.830  -1.634  14.587 1.00 . A A .  34 TRP N    1 1 
        1   566 1 1  34 TRP NE1  N   1.772   2.490  15.918 1.00 . A A .  34 TRP NE1  1 1 
        1   567 1 1  34 TRP O    O  -0.629  -1.924  11.332 1.00 . A A .  34 TRP O    1 1 
        1   568 1 1  35 ASP C    C   1.740  -5.114  11.405 1.00 . A A .  35 ASP C    1 1 
        1   569 1 1  35 ASP CA   C   1.573  -3.662  10.916 1.00 . A A .  35 ASP CA   1 1 
        1   570 1 1  35 ASP CB   C   2.803  -3.170  10.091 1.00 . A A .  35 ASP CB   1 1 
        1   571 1 1  35 ASP CG   C   4.110  -3.112  10.908 1.00 . A A .  35 ASP CG   1 1 
        1   572 1 1  35 ASP H    H   2.032  -2.732  12.769 1.00 . A A .  35 ASP H    1 1 
        1   573 1 1  35 ASP HA   H   0.699  -3.633  10.276 1.00 . A A .  35 ASP HA   1 1 
        1   574 1 1  35 ASP HB2  H   2.947  -3.832   9.243 1.00 . A A .  35 ASP HB2  1 1 
        1   575 1 1  35 ASP HB3  H   2.590  -2.177   9.705 1.00 . A A .  35 ASP HB3  1 1 
        1   576 1 1  35 ASP N    N   1.355  -2.752  12.057 1.00 . A A .  35 ASP N    1 1 
        1   577 1 1  35 ASP O    O   2.567  -5.874  10.879 1.00 . A A .  35 ASP O    1 1 
        1   578 1 1  35 ASP OD1  O   4.378  -2.077  11.555 1.00 . A A .  35 ASP OD1  1 1 
        1   579 1 1  35 ASP OD2  O   4.880  -4.100  10.889 1.00 . A A .  35 ASP OD2  1 1 
        1   580 1 1  36 HIS C    C   0.923  -7.983  12.016 1.00 . A A .  36 HIS C    1 1 
        1   581 1 1  36 HIS CA   C   0.938  -6.826  13.041 1.00 . A A .  36 HIS CA   1 1 
        1   582 1 1  36 HIS CB   C  -0.237  -6.971  14.038 1.00 . A A .  36 HIS CB   1 1 
        1   583 1 1  36 HIS CD2  C   0.897  -8.450  15.859 1.00 . A A .  36 HIS CD2  1 1 
        1   584 1 1  36 HIS CE1  C  -0.692  -9.925  16.101 1.00 . A A .  36 HIS CE1  1 1 
        1   585 1 1  36 HIS CG   C  -0.101  -8.116  15.006 1.00 . A A .  36 HIS CG   1 1 
        1   586 1 1  36 HIS H    H   0.190  -4.868  12.654 1.00 . A A .  36 HIS H    1 1 
        1   587 1 1  36 HIS HA   H   1.874  -6.857  13.599 1.00 . A A .  36 HIS HA   1 1 
        1   588 1 1  36 HIS HB2  H  -0.323  -6.064  14.624 1.00 . A A .  36 HIS HB2  1 1 
        1   589 1 1  36 HIS HB3  H  -1.158  -7.111  13.482 1.00 . A A .  36 HIS HB3  1 1 
        1   590 1 1  36 HIS HD1  H  -1.932  -9.076  14.725 1.00 . A A .  36 HIS HD1  1 1 
        1   591 1 1  36 HIS HD2  H   1.837  -7.928  15.982 1.00 . A A .  36 HIS HD2  1 1 
        1   592 1 1  36 HIS HE1  H  -1.267 -10.780  16.445 1.00 . A A .  36 HIS HE1  1 1 
        1   593 1 1  36 HIS HE2  H   1.106 -10.179  17.021 1.00 . A A .  36 HIS HE2  1 1 
        1   594 1 1  36 HIS N    N   0.882  -5.503  12.373 1.00 . A A .  36 HIS N    1 1 
        1   595 1 1  36 HIS ND1  N  -1.074  -9.057  15.187 1.00 . A A .  36 HIS ND1  1 1 
        1   596 1 1  36 HIS NE2  N   0.504  -9.581  16.527 1.00 . A A .  36 HIS NE2  1 1 
        1   597 1 1  36 HIS O    O   0.036  -8.055  11.159 1.00 . A A .  36 HIS O    1 1 
        1   598 1 1  37 LYS C    C   1.223 -11.082  11.078 1.00 . A A .  37 LYS C    1 1 
        1   599 1 1  37 LYS CA   C   2.251  -9.924  11.168 1.00 . A A .  37 LYS CA   1 1 
        1   600 1 1  37 LYS CB   C   3.657 -10.491  11.518 1.00 . A A .  37 LYS CB   1 1 
        1   601 1 1  37 LYS CD   C   6.160 -10.031  11.959 1.00 . A A .  37 LYS CD   1 1 
        1   602 1 1  37 LYS CE   C   6.629 -11.299  11.221 1.00 . A A .  37 LYS CE   1 1 
        1   603 1 1  37 LYS CG   C   4.814  -9.469  11.426 1.00 . A A .  37 LYS CG   1 1 
        1   604 1 1  37 LYS H    H   2.420  -8.864  12.991 1.00 . A A .  37 LYS H    1 1 
        1   605 1 1  37 LYS HA   H   2.306  -9.443  10.196 1.00 . A A .  37 LYS HA   1 1 
        1   606 1 1  37 LYS HB2  H   3.631 -10.880  12.531 1.00 . A A .  37 LYS HB2  1 1 
        1   607 1 1  37 LYS HB3  H   3.881 -11.310  10.845 1.00 . A A .  37 LYS HB3  1 1 
        1   608 1 1  37 LYS HD2  H   6.920  -9.266  11.840 1.00 . A A .  37 LYS HD2  1 1 
        1   609 1 1  37 LYS HD3  H   6.055 -10.257  13.018 1.00 . A A .  37 LYS HD3  1 1 
        1   610 1 1  37 LYS HE2  H   7.605 -11.587  11.590 1.00 . A A .  37 LYS HE2  1 1 
        1   611 1 1  37 LYS HE3  H   5.929 -12.102  11.411 1.00 . A A .  37 LYS HE3  1 1 
        1   612 1 1  37 LYS HG2  H   4.942  -9.180  10.389 1.00 . A A .  37 LYS HG2  1 1 
        1   613 1 1  37 LYS HG3  H   4.549  -8.590  12.005 1.00 . A A .  37 LYS HG3  1 1 
        1   614 1 1  37 LYS HZ1  H   7.231 -11.888   9.319 1.00 . A A .  37 LYS HZ1  1 1 
        1   615 1 1  37 LYS HZ2  H   7.249 -10.217   9.551 1.00 . A A .  37 LYS HZ2  1 1 
        1   616 1 1  37 LYS HZ3  H   5.779 -11.029   9.334 1.00 . A A .  37 LYS HZ3  1 1 
        1   617 1 1  37 LYS N    N   1.901  -8.889  12.163 1.00 . A A .  37 LYS N    1 1 
        1   618 1 1  37 LYS NZ   N   6.727 -11.094   9.756 1.00 . A A .  37 LYS NZ   1 1 
        1   619 1 1  37 LYS O    O   1.482 -12.068  10.367 1.00 . A A .  37 LYS O    1 1 
        1   620 1 1  38 GLU C    C  -1.658 -11.945  10.337 1.00 . A A .  38 GLU C    1 1 
        1   621 1 1  38 GLU CA   C  -0.987 -11.985  11.727 1.00 . A A .  38 GLU CA   1 1 
        1   622 1 1  38 GLU CB   C  -2.024 -11.794  12.870 1.00 . A A .  38 GLU CB   1 1 
        1   623 1 1  38 GLU CD   C  -3.916 -10.429  13.959 1.00 . A A .  38 GLU CD   1 1 
        1   624 1 1  38 GLU CG   C  -2.910 -10.532  12.791 1.00 . A A .  38 GLU CG   1 1 
        1   625 1 1  38 GLU H    H  -0.049 -10.189  12.361 1.00 . A A .  38 GLU H    1 1 
        1   626 1 1  38 GLU HA   H  -0.511 -12.958  11.853 1.00 . A A .  38 GLU HA   1 1 
        1   627 1 1  38 GLU HB2  H  -2.682 -12.657  12.881 1.00 . A A .  38 GLU HB2  1 1 
        1   628 1 1  38 GLU HB3  H  -1.485 -11.770  13.812 1.00 . A A .  38 GLU HB3  1 1 
        1   629 1 1  38 GLU HG2  H  -2.265  -9.655  12.791 1.00 . A A .  38 GLU HG2  1 1 
        1   630 1 1  38 GLU HG3  H  -3.466 -10.555  11.861 1.00 . A A .  38 GLU HG3  1 1 
        1   631 1 1  38 GLU N    N   0.080 -10.972  11.792 1.00 . A A .  38 GLU N    1 1 
        1   632 1 1  38 GLU O    O  -1.863 -10.856   9.778 1.00 . A A .  38 GLU O    1 1 
        1   633 1 1  38 GLU OE1  O  -4.692 -11.385  14.174 1.00 . A A .  38 GLU OE1  1 1 
        1   634 1 1  38 GLU OE2  O  -3.927  -9.397  14.675 1.00 . A A .  38 GLU OE2  1 1 
        1   635 1 1  39 GLU C    C  -3.690 -12.407   8.122 1.00 . A A .  39 GLU C    1 1 
        1   636 1 1  39 GLU CA   C  -2.483 -13.325   8.424 1.00 . A A .  39 GLU CA   1 1 
        1   637 1 1  39 GLU CB   C  -2.839 -14.815   8.184 1.00 . A A .  39 GLU CB   1 1 
        1   638 1 1  39 GLU CD   C  -4.170 -16.888   8.900 1.00 . A A .  39 GLU CD   1 1 
        1   639 1 1  39 GLU CG   C  -3.926 -15.386   9.112 1.00 . A A .  39 GLU CG   1 1 
        1   640 1 1  39 GLU H    H  -1.709 -13.940  10.302 1.00 . A A .  39 GLU H    1 1 
        1   641 1 1  39 GLU HA   H  -1.682 -13.061   7.739 1.00 . A A .  39 GLU HA   1 1 
        1   642 1 1  39 GLU HB2  H  -3.174 -14.936   7.157 1.00 . A A .  39 GLU HB2  1 1 
        1   643 1 1  39 GLU HB3  H  -1.936 -15.407   8.315 1.00 . A A .  39 GLU HB3  1 1 
        1   644 1 1  39 GLU HG2  H  -3.627 -15.209  10.140 1.00 . A A .  39 GLU HG2  1 1 
        1   645 1 1  39 GLU HG3  H  -4.854 -14.851   8.925 1.00 . A A .  39 GLU HG3  1 1 
        1   646 1 1  39 GLU N    N  -1.936 -13.144   9.786 1.00 . A A .  39 GLU N    1 1 
        1   647 1 1  39 GLU O    O  -4.588 -12.254   8.947 1.00 . A A .  39 GLU O    1 1 
        1   648 1 1  39 GLU OE1  O  -4.738 -17.261   7.855 1.00 . A A .  39 GLU OE1  1 1 
        1   649 1 1  39 GLU OE2  O  -3.780 -17.704   9.765 1.00 . A A .  39 GLU OE2  1 1 
        1   650 1 1  40 GLY C    C  -4.119  -9.965   5.350 1.00 . A A .  40 GLY C    1 1 
        1   651 1 1  40 GLY CA   C  -4.642 -10.798   6.515 1.00 . A A .  40 GLY CA   1 1 
        1   652 1 1  40 GLY H    H  -2.945 -12.034   6.305 1.00 . A A .  40 GLY H    1 1 
        1   653 1 1  40 GLY HA2  H  -5.548 -11.304   6.209 1.00 . A A .  40 GLY HA2  1 1 
        1   654 1 1  40 GLY HA3  H  -4.866 -10.146   7.353 1.00 . A A .  40 GLY HA3  1 1 
        1   655 1 1  40 GLY N    N  -3.663 -11.796   6.927 1.00 . A A .  40 GLY N    1 1 
        1   656 1 1  40 GLY O    O  -3.497 -10.512   4.433 1.00 . A A .  40 GLY O    1 1 
        1   657 1 1  41 LEU C    C  -3.287  -6.438   4.890 1.00 . A A .  41 LEU C    1 1 
        1   658 1 1  41 LEU CA   C  -3.923  -7.708   4.312 1.00 . A A .  41 LEU CA   1 1 
        1   659 1 1  41 LEU CB   C  -5.146  -7.323   3.435 1.00 . A A .  41 LEU CB   1 1 
        1   660 1 1  41 LEU CD1  C  -7.099  -8.060   1.985 1.00 . A A .  41 LEU CD1  1 1 
        1   661 1 1  41 LEU CD2  C  -4.768  -8.814   1.388 1.00 . A A .  41 LEU CD2  1 1 
        1   662 1 1  41 LEU CG   C  -5.729  -8.454   2.537 1.00 . A A .  41 LEU CG   1 1 
        1   663 1 1  41 LEU H    H  -4.806  -8.267   6.164 1.00 . A A .  41 LEU H    1 1 
        1   664 1 1  41 LEU HA   H  -3.189  -8.211   3.687 1.00 . A A .  41 LEU HA   1 1 
        1   665 1 1  41 LEU HB2  H  -5.932  -6.971   4.101 1.00 . A A .  41 LEU HB2  1 1 
        1   666 1 1  41 LEU HB3  H  -4.859  -6.495   2.791 1.00 . A A .  41 LEU HB3  1 1 
        1   667 1 1  41 LEU HD11 H  -7.503  -8.875   1.398 1.00 . A A .  41 LEU HD11 1 1 
        1   668 1 1  41 LEU HD12 H  -7.010  -7.177   1.365 1.00 . A A .  41 LEU HD12 1 1 
        1   669 1 1  41 LEU HD13 H  -7.772  -7.853   2.808 1.00 . A A .  41 LEU HD13 1 1 
        1   670 1 1  41 LEU HD21 H  -4.592  -7.945   0.761 1.00 . A A .  41 LEU HD21 1 1 
        1   671 1 1  41 LEU HD22 H  -5.197  -9.605   0.788 1.00 . A A .  41 LEU HD22 1 1 
        1   672 1 1  41 LEU HD23 H  -3.825  -9.153   1.795 1.00 . A A .  41 LEU HD23 1 1 
        1   673 1 1  41 LEU HG   H  -5.870  -9.344   3.139 1.00 . A A .  41 LEU HG   1 1 
        1   674 1 1  41 LEU N    N  -4.340  -8.641   5.387 1.00 . A A .  41 LEU N    1 1 
        1   675 1 1  41 LEU O    O  -3.368  -6.174   6.091 1.00 . A A .  41 LEU O    1 1 
        1   676 1 1  42 TYR C    C  -2.688  -3.385   3.257 1.00 . A A .  42 TYR C    1 1 
        1   677 1 1  42 TYR CA   C  -2.121  -4.329   4.293 1.00 . A A .  42 TYR CA   1 1 
        1   678 1 1  42 TYR CB   C  -0.577  -4.324   4.288 1.00 . A A .  42 TYR CB   1 1 
        1   679 1 1  42 TYR CD1  C   0.165  -4.579   6.698 1.00 . A A .  42 TYR CD1  1 1 
        1   680 1 1  42 TYR CD2  C   0.283  -6.500   5.283 1.00 . A A .  42 TYR CD2  1 1 
        1   681 1 1  42 TYR CE1  C   0.616  -5.331   7.756 1.00 . A A .  42 TYR CE1  1 1 
        1   682 1 1  42 TYR CE2  C   0.738  -7.245   6.338 1.00 . A A .  42 TYR CE2  1 1 
        1   683 1 1  42 TYR CG   C  -0.009  -5.148   5.439 1.00 . A A .  42 TYR CG   1 1 
        1   684 1 1  42 TYR CZ   C   0.899  -6.662   7.575 1.00 . A A .  42 TYR CZ   1 1 
        1   685 1 1  42 TYR H    H  -2.544  -6.013   3.091 1.00 . A A .  42 TYR H    1 1 
        1   686 1 1  42 TYR HA   H  -2.473  -4.020   5.277 1.00 . A A .  42 TYR HA   1 1 
        1   687 1 1  42 TYR HB2  H  -0.220  -4.739   3.349 1.00 . A A .  42 TYR HB2  1 1 
        1   688 1 1  42 TYR HB3  H  -0.211  -3.305   4.385 1.00 . A A .  42 TYR HB3  1 1 
        1   689 1 1  42 TYR HD1  H  -0.056  -3.528   6.838 1.00 . A A .  42 TYR HD1  1 1 
        1   690 1 1  42 TYR HD2  H   0.158  -6.960   4.306 1.00 . A A .  42 TYR HD2  1 1 
        1   691 1 1  42 TYR HE1  H   0.746  -4.873   8.725 1.00 . A A .  42 TYR HE1  1 1 
        1   692 1 1  42 TYR HE2  H   0.968  -8.294   6.195 1.00 . A A .  42 TYR HE2  1 1 
        1   693 1 1  42 TYR HH   H   0.784  -7.298   9.390 1.00 . A A .  42 TYR HH   1 1 
        1   694 1 1  42 TYR N    N  -2.653  -5.667   4.002 1.00 . A A .  42 TYR N    1 1 
        1   695 1 1  42 TYR O    O  -2.422  -3.527   2.054 1.00 . A A .  42 TYR O    1 1 
        1   696 1 1  42 TYR OH   O   1.362  -7.419   8.634 1.00 . A A .  42 TYR OH   1 1 
        1   697 1 1  43 VAL C    C  -4.171  -0.139   3.156 1.00 . A A .  43 VAL C    1 1 
        1   698 1 1  43 VAL CA   C  -4.392  -1.634   2.879 1.00 . A A .  43 VAL CA   1 1 
        1   699 1 1  43 VAL CB   C  -5.906  -2.027   3.132 1.00 . A A .  43 VAL CB   1 1 
        1   700 1 1  43 VAL CG1  C  -6.136  -3.548   2.926 1.00 . A A .  43 VAL CG1  1 1 
        1   701 1 1  43 VAL CG2  C  -6.382  -1.598   4.535 1.00 . A A .  43 VAL CG2  1 1 
        1   702 1 1  43 VAL H    H  -3.524  -2.269   4.694 1.00 . A A .  43 VAL H    1 1 
        1   703 1 1  43 VAL HA   H  -4.160  -1.830   1.835 1.00 . A A .  43 VAL HA   1 1 
        1   704 1 1  43 VAL HB   H  -6.518  -1.500   2.391 1.00 . A A .  43 VAL HB   1 1 
        1   705 1 1  43 VAL HG11 H  -5.781  -3.843   1.943 1.00 . A A .  43 VAL HG11 1 1 
        1   706 1 1  43 VAL HG12 H  -7.193  -3.780   2.997 1.00 . A A .  43 VAL HG12 1 1 
        1   707 1 1  43 VAL HG13 H  -5.595  -4.111   3.677 1.00 . A A .  43 VAL HG13 1 1 
        1   708 1 1  43 VAL HG21 H  -5.737  -2.046   5.295 1.00 . A A .  43 VAL HG21 1 1 
        1   709 1 1  43 VAL HG22 H  -7.400  -1.920   4.703 1.00 . A A .  43 VAL HG22 1 1 
        1   710 1 1  43 VAL HG23 H  -6.333  -0.519   4.629 1.00 . A A .  43 VAL HG23 1 1 
        1   711 1 1  43 VAL N    N  -3.514  -2.445   3.729 1.00 . A A .  43 VAL N    1 1 
        1   712 1 1  43 VAL O    O  -3.768   0.234   4.266 1.00 . A A .  43 VAL O    1 1 
        1   713 1 1  44 ASP C    C  -5.634   2.598   3.074 1.00 . A A .  44 ASP C    1 1 
        1   714 1 1  44 ASP CA   C  -4.393   2.167   2.283 1.00 . A A .  44 ASP CA   1 1 
        1   715 1 1  44 ASP CB   C  -4.316   2.886   0.891 1.00 . A A .  44 ASP CB   1 1 
        1   716 1 1  44 ASP CG   C  -3.857   4.373   0.937 1.00 . A A .  44 ASP CG   1 1 
        1   717 1 1  44 ASP H    H  -4.713   0.329   1.291 1.00 . A A .  44 ASP H    1 1 
        1   718 1 1  44 ASP HA   H  -3.505   2.403   2.857 1.00 . A A .  44 ASP HA   1 1 
        1   719 1 1  44 ASP HB2  H  -3.618   2.339   0.265 1.00 . A A .  44 ASP HB2  1 1 
        1   720 1 1  44 ASP HB3  H  -5.289   2.849   0.421 1.00 . A A .  44 ASP HB3  1 1 
        1   721 1 1  44 ASP N    N  -4.449   0.704   2.144 1.00 . A A .  44 ASP N    1 1 
        1   722 1 1  44 ASP O    O  -6.748   2.472   2.580 1.00 . A A .  44 ASP O    1 1 
        1   723 1 1  44 ASP OD1  O  -3.818   4.994   2.038 1.00 . A A .  44 ASP OD1  1 1 
        1   724 1 1  44 ASP OD2  O  -3.555   4.937  -0.148 1.00 . A A .  44 ASP OD2  1 1 
        1   725 1 1  45 ILE C    C  -7.573   4.255   4.795 1.00 . A A .  45 ILE C    1 1 
        1   726 1 1  45 ILE CA   C  -6.473   3.304   5.326 1.00 . A A .  45 ILE CA   1 1 
        1   727 1 1  45 ILE CB   C  -5.877   3.899   6.667 1.00 . A A .  45 ILE CB   1 1 
        1   728 1 1  45 ILE CD1  C  -3.832   3.804   8.261 1.00 . A A .  45 ILE CD1  1 1 
        1   729 1 1  45 ILE CG1  C  -4.577   3.157   7.103 1.00 . A A .  45 ILE CG1  1 1 
        1   730 1 1  45 ILE CG2  C  -6.923   3.881   7.819 1.00 . A A .  45 ILE CG2  1 1 
        1   731 1 1  45 ILE H    H  -4.483   3.174   4.584 1.00 . A A .  45 ILE H    1 1 
        1   732 1 1  45 ILE HA   H  -6.929   2.344   5.554 1.00 . A A .  45 ILE HA   1 1 
        1   733 1 1  45 ILE HB   H  -5.627   4.941   6.475 1.00 . A A .  45 ILE HB   1 1 
        1   734 1 1  45 ILE HD11 H  -2.936   3.239   8.469 1.00 . A A .  45 ILE HD11 1 1 
        1   735 1 1  45 ILE HD12 H  -4.461   3.812   9.137 1.00 . A A .  45 ILE HD12 1 1 
        1   736 1 1  45 ILE HD13 H  -3.561   4.821   7.999 1.00 . A A .  45 ILE HD13 1 1 
        1   737 1 1  45 ILE HG12 H  -4.818   2.144   7.398 1.00 . A A .  45 ILE HG12 1 1 
        1   738 1 1  45 ILE HG13 H  -3.897   3.115   6.262 1.00 . A A .  45 ILE HG13 1 1 
        1   739 1 1  45 ILE HG21 H  -6.497   4.327   8.708 1.00 . A A .  45 ILE HG21 1 1 
        1   740 1 1  45 ILE HG22 H  -7.228   2.864   8.037 1.00 . A A .  45 ILE HG22 1 1 
        1   741 1 1  45 ILE HG23 H  -7.794   4.454   7.522 1.00 . A A .  45 ILE HG23 1 1 
        1   742 1 1  45 ILE N    N  -5.411   3.052   4.320 1.00 . A A .  45 ILE N    1 1 
        1   743 1 1  45 ILE O    O  -8.726   4.157   5.211 1.00 . A A .  45 ILE O    1 1 
        1   744 1 1  46 VAL C    C  -9.361   5.522   2.586 1.00 . A A .  46 VAL C    1 1 
        1   745 1 1  46 VAL CA   C  -8.100   6.153   3.236 1.00 . A A .  46 VAL CA   1 1 
        1   746 1 1  46 VAL CB   C  -7.321   6.982   2.142 1.00 . A A .  46 VAL CB   1 1 
        1   747 1 1  46 VAL CG1  C  -6.112   7.718   2.766 1.00 . A A .  46 VAL CG1  1 1 
        1   748 1 1  46 VAL CG2  C  -6.859   6.077   0.961 1.00 . A A .  46 VAL CG2  1 1 
        1   749 1 1  46 VAL H    H  -6.260   5.117   3.543 1.00 . A A .  46 VAL H    1 1 
        1   750 1 1  46 VAL HA   H  -8.416   6.837   4.021 1.00 . A A .  46 VAL HA   1 1 
        1   751 1 1  46 VAL HB   H  -7.997   7.737   1.745 1.00 . A A .  46 VAL HB   1 1 
        1   752 1 1  46 VAL HG11 H  -6.433   8.339   3.593 1.00 . A A .  46 VAL HG11 1 1 
        1   753 1 1  46 VAL HG12 H  -5.637   8.348   2.021 1.00 . A A .  46 VAL HG12 1 1 
        1   754 1 1  46 VAL HG13 H  -5.394   6.995   3.124 1.00 . A A .  46 VAL HG13 1 1 
        1   755 1 1  46 VAL HG21 H  -7.719   5.653   0.465 1.00 . A A .  46 VAL HG21 1 1 
        1   756 1 1  46 VAL HG22 H  -6.227   5.263   1.335 1.00 . A A .  46 VAL HG22 1 1 
        1   757 1 1  46 VAL HG23 H  -6.290   6.658   0.246 1.00 . A A .  46 VAL HG23 1 1 
        1   758 1 1  46 VAL N    N  -7.196   5.143   3.849 1.00 . A A .  46 VAL N    1 1 
        1   759 1 1  46 VAL O    O -10.410   6.165   2.486 1.00 . A A .  46 VAL O    1 1 
        1   760 1 1  47 SER C    C -10.469   2.112   1.950 1.00 . A A .  47 SER C    1 1 
        1   761 1 1  47 SER CA   C -10.231   3.530   1.393 1.00 . A A .  47 SER CA   1 1 
        1   762 1 1  47 SER CB   C  -9.698   3.434  -0.040 1.00 . A A .  47 SER CB   1 1 
        1   763 1 1  47 SER H    H  -8.394   3.796   2.398 1.00 . A A .  47 SER H    1 1 
        1   764 1 1  47 SER HA   H -11.164   4.081   1.392 1.00 . A A .  47 SER HA   1 1 
        1   765 1 1  47 SER HB2  H -10.392   2.881  -0.661 1.00 . A A .  47 SER HB2  1 1 
        1   766 1 1  47 SER HB3  H  -9.570   4.431  -0.451 1.00 . A A .  47 SER HB3  1 1 
        1   767 1 1  47 SER HG   H  -7.852   3.205  -0.688 1.00 . A A .  47 SER HG   1 1 
        1   768 1 1  47 SER N    N  -9.227   4.258   2.180 1.00 . A A .  47 SER N    1 1 
        1   769 1 1  47 SER O    O -11.562   1.552   1.813 1.00 . A A .  47 SER O    1 1 
        1   770 1 1  47 SER OG   O  -8.436   2.772  -0.053 1.00 . A A .  47 SER OG   1 1 
        1   771 1 1  48 GLY C    C  -9.298  -0.822   1.827 1.00 . A A .  48 GLY C    1 1 
        1   772 1 1  48 GLY CA   C  -9.411   0.151   3.000 1.00 . A A .  48 GLY CA   1 1 
        1   773 1 1  48 GLY H    H  -8.637   2.091   2.727 1.00 . A A .  48 GLY H    1 1 
        1   774 1 1  48 GLY HA2  H  -8.568   0.009   3.662 1.00 . A A .  48 GLY HA2  1 1 
        1   775 1 1  48 GLY HA3  H -10.319  -0.055   3.551 1.00 . A A .  48 GLY HA3  1 1 
        1   776 1 1  48 GLY N    N  -9.419   1.545   2.564 1.00 . A A .  48 GLY N    1 1 
        1   777 1 1  48 GLY O    O  -9.898  -1.896   1.847 1.00 . A A .  48 GLY O    1 1 
        1   778 1 1  49 LYS C    C  -7.076  -2.090  -0.395 1.00 . A A .  49 LYS C    1 1 
        1   779 1 1  49 LYS CA   C  -8.367  -1.243  -0.436 1.00 . A A .  49 LYS CA   1 1 
        1   780 1 1  49 LYS CB   C  -8.404  -0.334  -1.693 1.00 . A A .  49 LYS CB   1 1 
        1   781 1 1  49 LYS CD   C -10.944  -0.697  -2.099 1.00 . A A .  49 LYS CD   1 1 
        1   782 1 1  49 LYS CE   C -10.745  -1.731  -3.232 1.00 . A A .  49 LYS CE   1 1 
        1   783 1 1  49 LYS CG   C  -9.783   0.326  -1.980 1.00 . A A .  49 LYS CG   1 1 
        1   784 1 1  49 LYS H    H  -7.996   0.384   0.891 1.00 . A A .  49 LYS H    1 1 
        1   785 1 1  49 LYS HA   H  -9.217  -1.923  -0.486 1.00 . A A .  49 LYS HA   1 1 
        1   786 1 1  49 LYS HB2  H  -7.669   0.453  -1.574 1.00 . A A .  49 LYS HB2  1 1 
        1   787 1 1  49 LYS HB3  H  -8.133  -0.929  -2.562 1.00 . A A .  49 LYS HB3  1 1 
        1   788 1 1  49 LYS HD2  H -11.032  -1.232  -1.163 1.00 . A A .  49 LYS HD2  1 1 
        1   789 1 1  49 LYS HD3  H -11.869  -0.156  -2.281 1.00 . A A .  49 LYS HD3  1 1 
        1   790 1 1  49 LYS HE2  H -10.674  -1.215  -4.179 1.00 . A A .  49 LYS HE2  1 1 
        1   791 1 1  49 LYS HE3  H  -9.829  -2.278  -3.055 1.00 . A A .  49 LYS HE3  1 1 
        1   792 1 1  49 LYS HG2  H -10.011   1.015  -1.172 1.00 . A A .  49 LYS HG2  1 1 
        1   793 1 1  49 LYS HG3  H  -9.707   0.891  -2.907 1.00 . A A .  49 LYS HG3  1 1 
        1   794 1 1  49 LYS HZ1  H -11.950  -3.233  -2.421 1.00 . A A .  49 LYS HZ1  1 1 
        1   795 1 1  49 LYS HZ2  H -11.698  -3.372  -4.087 1.00 . A A .  49 LYS HZ2  1 1 
        1   796 1 1  49 LYS HZ3  H -12.761  -2.201  -3.493 1.00 . A A .  49 LYS HZ3  1 1 
        1   797 1 1  49 LYS N    N  -8.515  -0.443   0.799 1.00 . A A .  49 LYS N    1 1 
        1   798 1 1  49 LYS NZ   N -11.867  -2.701  -3.311 1.00 . A A .  49 LYS NZ   1 1 
        1   799 1 1  49 LYS O    O  -6.010  -1.559  -0.075 1.00 . A A .  49 LYS O    1 1 
        1   800 1 1  50 PRO C    C  -4.854  -4.036  -1.555 1.00 . A A .  50 PRO C    1 1 
        1   801 1 1  50 PRO CA   C  -6.025  -4.384  -0.609 1.00 . A A .  50 PRO CA   1 1 
        1   802 1 1  50 PRO CB   C  -6.663  -5.753  -0.970 1.00 . A A .  50 PRO CB   1 1 
        1   803 1 1  50 PRO CD   C  -8.396  -4.133  -1.158 1.00 . A A .  50 PRO CD   1 1 
        1   804 1 1  50 PRO CG   C  -8.130  -5.553  -0.751 1.00 . A A .  50 PRO CG   1 1 
        1   805 1 1  50 PRO HA   H  -5.653  -4.422   0.411 1.00 . A A .  50 PRO HA   1 1 
        1   806 1 1  50 PRO HB2  H  -6.448  -6.013  -2.006 1.00 . A A .  50 PRO HB2  1 1 
        1   807 1 1  50 PRO HB3  H  -6.268  -6.532  -0.322 1.00 . A A .  50 PRO HB3  1 1 
        1   808 1 1  50 PRO HD2  H  -8.520  -4.047  -2.234 1.00 . A A .  50 PRO HD2  1 1 
        1   809 1 1  50 PRO HD3  H  -9.274  -3.750  -0.647 1.00 . A A .  50 PRO HD3  1 1 
        1   810 1 1  50 PRO HG2  H  -8.699  -6.240  -1.367 1.00 . A A .  50 PRO HG2  1 1 
        1   811 1 1  50 PRO HG3  H  -8.379  -5.700   0.297 1.00 . A A .  50 PRO HG3  1 1 
        1   812 1 1  50 PRO N    N  -7.168  -3.431  -0.705 1.00 . A A .  50 PRO N    1 1 
        1   813 1 1  50 PRO O    O  -5.043  -3.930  -2.771 1.00 . A A .  50 PRO O    1 1 
        1   814 1 1  51 LEU C    C  -1.474  -4.662  -1.801 1.00 . A A .  51 LEU C    1 1 
        1   815 1 1  51 LEU CA   C  -2.426  -3.471  -1.691 1.00 . A A .  51 LEU CA   1 1 
        1   816 1 1  51 LEU CB   C  -1.755  -2.285  -0.959 1.00 . A A .  51 LEU CB   1 1 
        1   817 1 1  51 LEU CD1  C  -1.913   0.101  -0.050 1.00 . A A .  51 LEU CD1  1 1 
        1   818 1 1  51 LEU CD2  C  -3.455  -0.652  -1.964 1.00 . A A .  51 LEU CD2  1 1 
        1   819 1 1  51 LEU CG   C  -2.686  -1.070  -0.681 1.00 . A A .  51 LEU CG   1 1 
        1   820 1 1  51 LEU H    H  -3.602  -3.943   0.008 1.00 . A A .  51 LEU H    1 1 
        1   821 1 1  51 LEU HA   H  -2.708  -3.150  -2.695 1.00 . A A .  51 LEU HA   1 1 
        1   822 1 1  51 LEU HB2  H  -1.372  -2.645  -0.002 1.00 . A A .  51 LEU HB2  1 1 
        1   823 1 1  51 LEU HB3  H  -0.912  -1.943  -1.555 1.00 . A A .  51 LEU HB3  1 1 
        1   824 1 1  51 LEU HD11 H  -2.598   0.916   0.159 1.00 . A A .  51 LEU HD11 1 1 
        1   825 1 1  51 LEU HD12 H  -1.141   0.448  -0.726 1.00 . A A .  51 LEU HD12 1 1 
        1   826 1 1  51 LEU HD13 H  -1.461  -0.224   0.875 1.00 . A A .  51 LEU HD13 1 1 
        1   827 1 1  51 LEU HD21 H  -4.069  -1.481  -2.304 1.00 . A A .  51 LEU HD21 1 1 
        1   828 1 1  51 LEU HD22 H  -2.754  -0.381  -2.745 1.00 . A A .  51 LEU HD22 1 1 
        1   829 1 1  51 LEU HD23 H  -4.096   0.192  -1.750 1.00 . A A .  51 LEU HD23 1 1 
        1   830 1 1  51 LEU HG   H  -3.432  -1.374   0.050 1.00 . A A .  51 LEU HG   1 1 
        1   831 1 1  51 LEU N    N  -3.657  -3.854  -0.964 1.00 . A A .  51 LEU N    1 1 
        1   832 1 1  51 LEU O    O  -0.941  -4.951  -2.879 1.00 . A A .  51 LEU O    1 1 
        1   833 1 1  52 PHE C    C  -0.927  -7.430   0.607 1.00 . A A .  52 PHE C    1 1 
        1   834 1 1  52 PHE CA   C  -0.499  -6.604  -0.606 1.00 . A A .  52 PHE CA   1 1 
        1   835 1 1  52 PHE CB   C   1.043  -6.363  -0.624 1.00 . A A .  52 PHE CB   1 1 
        1   836 1 1  52 PHE CD1  C   1.493  -4.202   0.646 1.00 . A A .  52 PHE CD1  1 1 
        1   837 1 1  52 PHE CD2  C   2.347  -6.242   1.569 1.00 . A A .  52 PHE CD2  1 1 
        1   838 1 1  52 PHE CE1  C   2.046  -3.498   1.697 1.00 . A A .  52 PHE CE1  1 1 
        1   839 1 1  52 PHE CE2  C   2.903  -5.535   2.618 1.00 . A A .  52 PHE CE2  1 1 
        1   840 1 1  52 PHE CG   C   1.627  -5.587   0.561 1.00 . A A .  52 PHE CG   1 1 
        1   841 1 1  52 PHE CZ   C   2.756  -4.161   2.681 1.00 . A A .  52 PHE CZ   1 1 
        1   842 1 1  52 PHE H    H  -1.699  -5.013   0.152 1.00 . A A .  52 PHE H    1 1 
        1   843 1 1  52 PHE HA   H  -0.763  -7.178  -1.492 1.00 . A A .  52 PHE HA   1 1 
        1   844 1 1  52 PHE HB2  H   1.544  -7.325  -0.670 1.00 . A A .  52 PHE HB2  1 1 
        1   845 1 1  52 PHE HB3  H   1.294  -5.817  -1.527 1.00 . A A .  52 PHE HB3  1 1 
        1   846 1 1  52 PHE HD1  H   0.938  -3.675  -0.120 1.00 . A A .  52 PHE HD1  1 1 
        1   847 1 1  52 PHE HD2  H   2.464  -7.320   1.528 1.00 . A A .  52 PHE HD2  1 1 
        1   848 1 1  52 PHE HE1  H   1.929  -2.419   1.747 1.00 . A A .  52 PHE HE1  1 1 
        1   849 1 1  52 PHE HE2  H   3.455  -6.055   3.389 1.00 . A A .  52 PHE HE2  1 1 
        1   850 1 1  52 PHE HZ   H   3.191  -3.608   3.500 1.00 . A A .  52 PHE HZ   1 1 
        1   851 1 1  52 PHE N    N  -1.279  -5.352  -0.668 1.00 . A A .  52 PHE N    1 1 
        1   852 1 1  52 PHE O    O  -1.505  -6.906   1.565 1.00 . A A .  52 PHE O    1 1 
        1   853 1 1  53 THR C    C  -0.102  -9.834   2.699 1.00 . A A .  53 THR C    1 1 
        1   854 1 1  53 THR CA   C  -1.090  -9.718   1.533 1.00 . A A .  53 THR CA   1 1 
        1   855 1 1  53 THR CB   C  -1.260 -11.119   0.854 1.00 . A A .  53 THR CB   1 1 
        1   856 1 1  53 THR CG2  C  -2.314 -11.088  -0.262 1.00 . A A .  53 THR CG2  1 1 
        1   857 1 1  53 THR H    H  -0.075  -9.045  -0.193 1.00 . A A .  53 THR H    1 1 
        1   858 1 1  53 THR HA   H  -2.059  -9.404   1.916 1.00 . A A .  53 THR HA   1 1 
        1   859 1 1  53 THR HB   H  -1.573 -11.840   1.603 1.00 . A A .  53 THR HB   1 1 
        1   860 1 1  53 THR HG1  H   0.663 -10.875   0.429 1.00 . A A .  53 THR HG1  1 1 
        1   861 1 1  53 THR HG21 H  -2.395 -12.068  -0.711 1.00 . A A .  53 THR HG21 1 1 
        1   862 1 1  53 THR HG22 H  -2.024 -10.370  -1.020 1.00 . A A .  53 THR HG22 1 1 
        1   863 1 1  53 THR HG23 H  -3.275 -10.804   0.148 1.00 . A A .  53 THR HG23 1 1 
        1   864 1 1  53 THR N    N  -0.635  -8.732   0.546 1.00 . A A .  53 THR N    1 1 
        1   865 1 1  53 THR O    O   1.085  -9.552   2.537 1.00 . A A .  53 THR O    1 1 
        1   866 1 1  53 THR OG1  O  -0.008 -11.554   0.294 1.00 . A A .  53 THR OG1  1 1 
        1   867 1 1  54 SER C    C   0.820 -12.028   4.798 1.00 . A A .  54 SER C    1 1 
        1   868 1 1  54 SER CA   C   0.217 -10.629   5.024 1.00 . A A .  54 SER CA   1 1 
        1   869 1 1  54 SER CB   C  -0.605 -10.584   6.335 1.00 . A A .  54 SER CB   1 1 
        1   870 1 1  54 SER H    H  -1.586 -10.245   3.973 1.00 . A A .  54 SER H    1 1 
        1   871 1 1  54 SER HA   H   1.032  -9.914   5.100 1.00 . A A .  54 SER HA   1 1 
        1   872 1 1  54 SER HB2  H  -1.008  -9.591   6.473 1.00 . A A .  54 SER HB2  1 1 
        1   873 1 1  54 SER HB3  H  -1.426 -11.290   6.272 1.00 . A A .  54 SER HB3  1 1 
        1   874 1 1  54 SER HG   H   1.112 -10.907   7.242 1.00 . A A .  54 SER HG   1 1 
        1   875 1 1  54 SER N    N  -0.615 -10.238   3.871 1.00 . A A .  54 SER N    1 1 
        1   876 1 1  54 SER O    O   1.850 -12.365   5.387 1.00 . A A .  54 SER O    1 1 
        1   877 1 1  54 SER OG   O   0.178 -10.906   7.476 1.00 . A A .  54 SER OG   1 1 
        1   878 1 1  55 LYS C    C   1.989 -14.034   2.784 1.00 . A A .  55 LYS C    1 1 
        1   879 1 1  55 LYS CA   C   0.638 -14.159   3.510 1.00 . A A .  55 LYS CA   1 1 
        1   880 1 1  55 LYS CB   C  -0.416 -14.828   2.584 1.00 . A A .  55 LYS CB   1 1 
        1   881 1 1  55 LYS CD   C  -0.250 -17.186   3.610 1.00 . A A .  55 LYS CD   1 1 
        1   882 1 1  55 LYS CE   C  -0.081 -18.692   3.348 1.00 . A A .  55 LYS CE   1 1 
        1   883 1 1  55 LYS CG   C  -0.190 -16.332   2.312 1.00 . A A .  55 LYS CG   1 1 
        1   884 1 1  55 LYS H    H  -0.721 -12.533   3.616 1.00 . A A .  55 LYS H    1 1 
        1   885 1 1  55 LYS HA   H   0.776 -14.772   4.398 1.00 . A A .  55 LYS HA   1 1 
        1   886 1 1  55 LYS HB2  H  -1.392 -14.718   3.042 1.00 . A A .  55 LYS HB2  1 1 
        1   887 1 1  55 LYS HB3  H  -0.429 -14.306   1.632 1.00 . A A .  55 LYS HB3  1 1 
        1   888 1 1  55 LYS HD2  H   0.542 -16.861   4.278 1.00 . A A .  55 LYS HD2  1 1 
        1   889 1 1  55 LYS HD3  H  -1.208 -17.016   4.096 1.00 . A A .  55 LYS HD3  1 1 
        1   890 1 1  55 LYS HE2  H  -0.134 -19.223   4.293 1.00 . A A .  55 LYS HE2  1 1 
        1   891 1 1  55 LYS HE3  H  -0.887 -19.031   2.711 1.00 . A A .  55 LYS HE3  1 1 
        1   892 1 1  55 LYS HG2  H  -0.956 -16.682   1.624 1.00 . A A .  55 LYS HG2  1 1 
        1   893 1 1  55 LYS HG3  H   0.785 -16.457   1.848 1.00 . A A .  55 LYS HG3  1 1 
        1   894 1 1  55 LYS HZ1  H   1.228 -18.633   1.725 1.00 . A A .  55 LYS HZ1  1 1 
        1   895 1 1  55 LYS HZ2  H   1.350 -20.042   2.650 1.00 . A A .  55 LYS HZ2  1 1 
        1   896 1 1  55 LYS HZ3  H   2.001 -18.592   3.228 1.00 . A A .  55 LYS HZ3  1 1 
        1   897 1 1  55 LYS N    N   0.150 -12.834   3.947 1.00 . A A .  55 LYS N    1 1 
        1   898 1 1  55 LYS NZ   N   1.216 -19.011   2.694 1.00 . A A .  55 LYS NZ   1 1 
        1   899 1 1  55 LYS O    O   2.874 -14.888   2.907 1.00 . A A .  55 LYS O    1 1 
        1   900 1 1  56 ASP C    C   3.762 -11.164   1.597 1.00 . A A .  56 ASP C    1 1 
        1   901 1 1  56 ASP CA   C   3.347 -12.609   1.284 1.00 . A A .  56 ASP CA   1 1 
        1   902 1 1  56 ASP CB   C   3.112 -12.836  -0.235 1.00 . A A .  56 ASP CB   1 1 
        1   903 1 1  56 ASP CG   C   2.983 -14.323  -0.607 1.00 . A A .  56 ASP CG   1 1 
        1   904 1 1  56 ASP H    H   1.373 -12.314   1.977 1.00 . A A .  56 ASP H    1 1 
        1   905 1 1  56 ASP HA   H   4.147 -13.267   1.623 1.00 . A A .  56 ASP HA   1 1 
        1   906 1 1  56 ASP HB2  H   2.210 -12.317  -0.532 1.00 . A A .  56 ASP HB2  1 1 
        1   907 1 1  56 ASP HB3  H   3.947 -12.415  -0.790 1.00 . A A .  56 ASP HB3  1 1 
        1   908 1 1  56 ASP N    N   2.128 -12.938   2.031 1.00 . A A .  56 ASP N    1 1 
        1   909 1 1  56 ASP O    O   4.021 -10.364   0.700 1.00 . A A .  56 ASP O    1 1 
        1   910 1 1  56 ASP OD1  O   4.018 -15.020  -0.693 1.00 . A A .  56 ASP OD1  1 1 
        1   911 1 1  56 ASP OD2  O   1.851 -14.805  -0.818 1.00 . A A .  56 ASP OD2  1 1 
        1   912 1 1  57 LYS C    C   5.841  -9.593   3.492 1.00 . A A .  57 LYS C    1 1 
        1   913 1 1  57 LYS CA   C   4.304  -9.556   3.401 1.00 . A A .  57 LYS CA   1 1 
        1   914 1 1  57 LYS CB   C   3.731  -9.274   4.823 1.00 . A A .  57 LYS CB   1 1 
        1   915 1 1  57 LYS CD   C   4.169  -7.966   7.028 1.00 . A A .  57 LYS CD   1 1 
        1   916 1 1  57 LYS CE   C   4.567  -6.610   7.643 1.00 . A A .  57 LYS CE   1 1 
        1   917 1 1  57 LYS CG   C   4.201  -7.943   5.477 1.00 . A A .  57 LYS CG   1 1 
        1   918 1 1  57 LYS H    H   3.321 -11.424   3.538 1.00 . A A .  57 LYS H    1 1 
        1   919 1 1  57 LYS HA   H   3.993  -8.759   2.730 1.00 . A A .  57 LYS HA   1 1 
        1   920 1 1  57 LYS HB2  H   2.646  -9.251   4.757 1.00 . A A .  57 LYS HB2  1 1 
        1   921 1 1  57 LYS HB3  H   4.010 -10.096   5.475 1.00 . A A .  57 LYS HB3  1 1 
        1   922 1 1  57 LYS HD2  H   3.164  -8.211   7.355 1.00 . A A .  57 LYS HD2  1 1 
        1   923 1 1  57 LYS HD3  H   4.854  -8.731   7.386 1.00 . A A .  57 LYS HD3  1 1 
        1   924 1 1  57 LYS HE2  H   5.561  -6.345   7.307 1.00 . A A .  57 LYS HE2  1 1 
        1   925 1 1  57 LYS HE3  H   3.867  -5.854   7.308 1.00 . A A .  57 LYS HE3  1 1 
        1   926 1 1  57 LYS HG2  H   5.217  -7.738   5.163 1.00 . A A .  57 LYS HG2  1 1 
        1   927 1 1  57 LYS HG3  H   3.560  -7.136   5.125 1.00 . A A .  57 LYS HG3  1 1 
        1   928 1 1  57 LYS HZ1  H   5.262  -7.320   9.482 1.00 . A A .  57 LYS HZ1  1 1 
        1   929 1 1  57 LYS HZ2  H   3.618  -6.906   9.479 1.00 . A A .  57 LYS HZ2  1 1 
        1   930 1 1  57 LYS HZ3  H   4.795  -5.690   9.504 1.00 . A A .  57 LYS HZ3  1 1 
        1   931 1 1  57 LYS N    N   3.763 -10.832   2.894 1.00 . A A .  57 LYS N    1 1 
        1   932 1 1  57 LYS NZ   N   4.561  -6.635   9.130 1.00 . A A .  57 LYS NZ   1 1 
        1   933 1 1  57 LYS O    O   6.428 -10.637   3.786 1.00 . A A .  57 LYS O    1 1 
        1   934 1 1  58 PHE C    C   7.724  -7.103   4.826 1.00 . A A .  58 PHE C    1 1 
        1   935 1 1  58 PHE CA   C   7.843  -8.152   3.713 1.00 . A A .  58 PHE CA   1 1 
        1   936 1 1  58 PHE CB   C   8.750  -7.631   2.570 1.00 . A A .  58 PHE CB   1 1 
        1   937 1 1  58 PHE CD1  C  10.982  -8.385   3.538 1.00 . A A .  58 PHE CD1  1 1 
        1   938 1 1  58 PHE CD2  C  10.765  -6.094   2.883 1.00 . A A .  58 PHE CD2  1 1 
        1   939 1 1  58 PHE CE1  C  12.281  -8.142   3.933 1.00 . A A .  58 PHE CE1  1 1 
        1   940 1 1  58 PHE CE2  C  12.063  -5.853   3.277 1.00 . A A .  58 PHE CE2  1 1 
        1   941 1 1  58 PHE CG   C  10.197  -7.362   3.002 1.00 . A A .  58 PHE CG   1 1 
        1   942 1 1  58 PHE CZ   C  12.823  -6.878   3.802 1.00 . A A .  58 PHE CZ   1 1 
        1   943 1 1  58 PHE H    H   6.025  -7.762   2.698 1.00 . A A .  58 PHE H    1 1 
        1   944 1 1  58 PHE HA   H   8.274  -9.062   4.126 1.00 . A A .  58 PHE HA   1 1 
        1   945 1 1  58 PHE HB2  H   8.774  -8.375   1.781 1.00 . A A .  58 PHE HB2  1 1 
        1   946 1 1  58 PHE HB3  H   8.333  -6.714   2.165 1.00 . A A .  58 PHE HB3  1 1 
        1   947 1 1  58 PHE HD1  H  10.565  -9.378   3.642 1.00 . A A .  58 PHE HD1  1 1 
        1   948 1 1  58 PHE HD2  H  10.172  -5.287   2.470 1.00 . A A .  58 PHE HD2  1 1 
        1   949 1 1  58 PHE HE1  H  12.879  -8.945   4.349 1.00 . A A .  58 PHE HE1  1 1 
        1   950 1 1  58 PHE HE2  H  12.484  -4.862   3.174 1.00 . A A .  58 PHE HE2  1 1 
        1   951 1 1  58 PHE HZ   H  13.843  -6.691   4.112 1.00 . A A .  58 PHE HZ   1 1 
        1   952 1 1  58 PHE N    N   6.482  -8.443   3.233 1.00 . A A .  58 PHE N    1 1 
        1   953 1 1  58 PHE O    O   6.929  -6.172   4.704 1.00 . A A .  58 PHE O    1 1 
        1   954 1 1  59 ASP C    C   9.216  -5.043   6.703 1.00 . A A .  59 ASP C    1 1 
        1   955 1 1  59 ASP CA   C   8.474  -6.340   7.058 1.00 . A A .  59 ASP CA   1 1 
        1   956 1 1  59 ASP CB   C   9.106  -7.007   8.305 1.00 . A A .  59 ASP CB   1 1 
        1   957 1 1  59 ASP CG   C   8.304  -8.225   8.779 1.00 . A A .  59 ASP CG   1 1 
        1   958 1 1  59 ASP H    H   9.045  -8.079   5.976 1.00 . A A .  59 ASP H    1 1 
        1   959 1 1  59 ASP HA   H   7.441  -6.092   7.284 1.00 . A A .  59 ASP HA   1 1 
        1   960 1 1  59 ASP HB2  H  10.119  -7.313   8.070 1.00 . A A .  59 ASP HB2  1 1 
        1   961 1 1  59 ASP HB3  H   9.145  -6.286   9.119 1.00 . A A .  59 ASP HB3  1 1 
        1   962 1 1  59 ASP N    N   8.476  -7.284   5.924 1.00 . A A .  59 ASP N    1 1 
        1   963 1 1  59 ASP O    O   9.950  -4.992   5.710 1.00 . A A .  59 ASP O    1 1 
        1   964 1 1  59 ASP OD1  O   7.221  -8.037   9.381 1.00 . A A .  59 ASP OD1  1 1 
        1   965 1 1  59 ASP OD2  O   8.732  -9.375   8.536 1.00 . A A .  59 ASP OD2  1 1 
        1   966 1 1  60 SER C    C  11.176  -2.857   7.852 1.00 . A A .  60 SER C    1 1 
        1   967 1 1  60 SER CA   C   9.718  -2.710   7.354 1.00 . A A .  60 SER CA   1 1 
        1   968 1 1  60 SER CB   C   8.987  -1.583   8.117 1.00 . A A .  60 SER CB   1 1 
        1   969 1 1  60 SER H    H   8.306  -4.053   8.200 1.00 . A A .  60 SER H    1 1 
        1   970 1 1  60 SER HA   H   9.739  -2.457   6.294 1.00 . A A .  60 SER HA   1 1 
        1   971 1 1  60 SER HB2  H   9.025  -1.773   9.181 1.00 . A A .  60 SER HB2  1 1 
        1   972 1 1  60 SER HB3  H   9.465  -0.634   7.907 1.00 . A A .  60 SER HB3  1 1 
        1   973 1 1  60 SER HG   H   7.237  -0.711   8.139 1.00 . A A .  60 SER HG   1 1 
        1   974 1 1  60 SER N    N   8.994  -3.985   7.503 1.00 . A A .  60 SER N    1 1 
        1   975 1 1  60 SER O    O  11.549  -2.341   8.907 1.00 . A A .  60 SER O    1 1 
        1   976 1 1  60 SER OG   O   7.631  -1.495   7.733 1.00 . A A .  60 SER OG   1 1 
        1   977 1 1  61 GLN C    C  14.258  -2.883   6.567 1.00 . A A .  61 GLN C    1 1 
        1   978 1 1  61 GLN CA   C  13.396  -3.873   7.369 1.00 . A A .  61 GLN CA   1 1 
        1   979 1 1  61 GLN CB   C  13.757  -5.340   7.006 1.00 . A A .  61 GLN CB   1 1 
        1   980 1 1  61 GLN CD   C  13.052  -6.328   9.270 1.00 . A A .  61 GLN CD   1 1 
        1   981 1 1  61 GLN CG   C  12.929  -6.413   7.748 1.00 . A A .  61 GLN CG   1 1 
        1   982 1 1  61 GLN H    H  11.573  -4.061   6.315 1.00 . A A .  61 GLN H    1 1 
        1   983 1 1  61 GLN HA   H  13.582  -3.715   8.431 1.00 . A A .  61 GLN HA   1 1 
        1   984 1 1  61 GLN HB2  H  13.613  -5.488   5.938 1.00 . A A .  61 GLN HB2  1 1 
        1   985 1 1  61 GLN HB3  H  14.806  -5.508   7.235 1.00 . A A .  61 GLN HB3  1 1 
        1   986 1 1  61 GLN HE21 H  14.690  -7.458   9.239 1.00 . A A .  61 GLN HE21 1 1 
        1   987 1 1  61 GLN HE22 H  14.167  -6.931  10.800 1.00 . A A .  61 GLN HE22 1 1 
        1   988 1 1  61 GLN HG2  H  11.884  -6.289   7.480 1.00 . A A .  61 GLN HG2  1 1 
        1   989 1 1  61 GLN HG3  H  13.255  -7.398   7.427 1.00 . A A .  61 GLN HG3  1 1 
        1   990 1 1  61 GLN N    N  11.968  -3.631   7.097 1.00 . A A .  61 GLN N    1 1 
        1   991 1 1  61 GLN NE2  N  14.072  -6.970   9.826 1.00 . A A .  61 GLN NE2  1 1 
        1   992 1 1  61 GLN O    O  15.375  -2.542   6.967 1.00 . A A .  61 GLN O    1 1 
        1   993 1 1  61 GLN OE1  O  12.255  -5.667   9.936 1.00 . A A .  61 GLN OE1  1 1 
        1   994 1 1  62 CYS C    C  13.711  -0.061   4.739 1.00 . A A .  62 CYS C    1 1 
        1   995 1 1  62 CYS CA   C  14.340  -1.456   4.535 1.00 . A A .  62 CYS CA   1 1 
        1   996 1 1  62 CYS CB   C  14.153  -1.950   3.083 1.00 . A A .  62 CYS CB   1 1 
        1   997 1 1  62 CYS H    H  12.819  -2.762   5.186 1.00 . A A .  62 CYS H    1 1 
        1   998 1 1  62 CYS HA   H  15.402  -1.401   4.762 1.00 . A A .  62 CYS HA   1 1 
        1   999 1 1  62 CYS HB2  H  13.101  -1.936   2.830 1.00 . A A .  62 CYS HB2  1 1 
        1  1000 1 1  62 CYS HB3  H  14.694  -1.303   2.405 1.00 . A A .  62 CYS HB3  1 1 
        1  1001 1 1  62 CYS HG   H  14.254  -4.066   1.654 1.00 . A A .  62 CYS HG   1 1 
        1  1002 1 1  62 CYS N    N  13.705  -2.429   5.433 1.00 . A A .  62 CYS N    1 1 
        1  1003 1 1  62 CYS O    O  13.668   0.758   3.812 1.00 . A A .  62 CYS O    1 1 
        1  1004 1 1  62 CYS SG   S  14.747  -3.632   2.809 1.00 . A A .  62 CYS SG   1 1 
        1  1005 1 1  63 GLY C    C  11.032   1.297   6.083 1.00 . A A .  63 GLY C    1 1 
        1  1006 1 1  63 GLY CA   C  12.529   1.448   6.299 1.00 . A A .  63 GLY CA   1 1 
        1  1007 1 1  63 GLY H    H  13.410  -0.443   6.689 1.00 . A A .  63 GLY H    1 1 
        1  1008 1 1  63 GLY HA2  H  12.720   1.700   7.335 1.00 . A A .  63 GLY HA2  1 1 
        1  1009 1 1  63 GLY HA3  H  12.892   2.261   5.678 1.00 . A A .  63 GLY HA3  1 1 
        1  1010 1 1  63 GLY N    N  13.248   0.211   5.977 1.00 . A A .  63 GLY N    1 1 
        1  1011 1 1  63 GLY O    O  10.228   1.450   7.015 1.00 . A A .  63 GLY O    1 1 
        1  1012 1 1  64 TRP C    C   9.183  -0.730   3.880 1.00 . A A .  64 TRP C    1 1 
        1  1013 1 1  64 TRP CA   C   9.283   0.718   4.420 1.00 . A A .  64 TRP CA   1 1 
        1  1014 1 1  64 TRP CB   C   8.814   1.756   3.364 1.00 . A A .  64 TRP CB   1 1 
        1  1015 1 1  64 TRP CD1  C   7.938   3.399   5.158 1.00 . A A .  64 TRP CD1  1 1 
        1  1016 1 1  64 TRP CD2  C   8.689   4.409   3.299 1.00 . A A .  64 TRP CD2  1 1 
        1  1017 1 1  64 TRP CE2  C   8.239   5.391   4.203 1.00 . A A .  64 TRP CE2  1 1 
        1  1018 1 1  64 TRP CE3  C   9.206   4.818   2.062 1.00 . A A .  64 TRP CE3  1 1 
        1  1019 1 1  64 TRP CG   C   8.503   3.130   3.936 1.00 . A A .  64 TRP CG   1 1 
        1  1020 1 1  64 TRP CH2  C   8.786   7.124   2.691 1.00 . A A .  64 TRP CH2  1 1 
        1  1021 1 1  64 TRP CZ2  C   8.272   6.752   3.907 1.00 . A A .  64 TRP CZ2  1 1 
        1  1022 1 1  64 TRP CZ3  C   9.243   6.170   1.768 1.00 . A A .  64 TRP CZ3  1 1 
        1  1023 1 1  64 TRP H    H  11.359   1.018   4.138 1.00 . A A .  64 TRP H    1 1 
        1  1024 1 1  64 TRP HA   H   8.645   0.793   5.298 1.00 . A A .  64 TRP HA   1 1 
        1  1025 1 1  64 TRP HB2  H   9.585   1.872   2.613 1.00 . A A .  64 TRP HB2  1 1 
        1  1026 1 1  64 TRP HB3  H   7.914   1.394   2.880 1.00 . A A .  64 TRP HB3  1 1 
        1  1027 1 1  64 TRP HD1  H   7.664   2.647   5.884 1.00 . A A .  64 TRP HD1  1 1 
        1  1028 1 1  64 TRP HE1  H   7.409   5.189   6.116 1.00 . A A .  64 TRP HE1  1 1 
        1  1029 1 1  64 TRP HE3  H   9.566   4.093   1.344 1.00 . A A .  64 TRP HE3  1 1 
        1  1030 1 1  64 TRP HH2  H   8.833   8.174   2.420 1.00 . A A .  64 TRP HH2  1 1 
        1  1031 1 1  64 TRP HZ2  H   7.925   7.502   4.606 1.00 . A A .  64 TRP HZ2  1 1 
        1  1032 1 1  64 TRP HZ3  H   9.638   6.503   0.818 1.00 . A A .  64 TRP HZ3  1 1 
        1  1033 1 1  64 TRP N    N  10.665   1.015   4.829 1.00 . A A .  64 TRP N    1 1 
        1  1034 1 1  64 TRP NE1  N   7.785   4.752   5.321 1.00 . A A .  64 TRP NE1  1 1 
        1  1035 1 1  64 TRP O    O  10.179  -1.258   3.357 1.00 . A A .  64 TRP O    1 1 
        1  1036 1 1  65 PRO C    C   7.877  -2.853   1.978 1.00 . A A .  65 PRO C    1 1 
        1  1037 1 1  65 PRO CA   C   7.782  -2.790   3.522 1.00 . A A .  65 PRO CA   1 1 
        1  1038 1 1  65 PRO CB   C   6.367  -3.167   4.050 1.00 . A A .  65 PRO CB   1 1 
        1  1039 1 1  65 PRO CD   C   6.758  -0.903   4.721 1.00 . A A .  65 PRO CD   1 1 
        1  1040 1 1  65 PRO CG   C   5.677  -1.858   4.281 1.00 . A A .  65 PRO CG   1 1 
        1  1041 1 1  65 PRO HA   H   8.517  -3.468   3.947 1.00 . A A .  65 PRO HA   1 1 
        1  1042 1 1  65 PRO HB2  H   5.837  -3.778   3.323 1.00 . A A .  65 PRO HB2  1 1 
        1  1043 1 1  65 PRO HB3  H   6.466  -3.730   4.978 1.00 . A A .  65 PRO HB3  1 1 
        1  1044 1 1  65 PRO HD2  H   6.518   0.107   4.403 1.00 . A A .  65 PRO HD2  1 1 
        1  1045 1 1  65 PRO HD3  H   6.885  -0.928   5.797 1.00 . A A .  65 PRO HD3  1 1 
        1  1046 1 1  65 PRO HG2  H   5.218  -1.510   3.357 1.00 . A A .  65 PRO HG2  1 1 
        1  1047 1 1  65 PRO HG3  H   4.921  -1.958   5.052 1.00 . A A .  65 PRO HG3  1 1 
        1  1048 1 1  65 PRO N    N   7.987  -1.412   4.030 1.00 . A A .  65 PRO N    1 1 
        1  1049 1 1  65 PRO O    O   7.081  -2.231   1.263 1.00 . A A .  65 PRO O    1 1 
        1  1050 1 1  66 SER C    C   9.215  -5.179  -0.390 1.00 . A A .  66 SER C    1 1 
        1  1051 1 1  66 SER CA   C   9.192  -3.703   0.057 1.00 . A A .  66 SER CA   1 1 
        1  1052 1 1  66 SER CB   C  10.543  -2.996  -0.215 1.00 . A A .  66 SER CB   1 1 
        1  1053 1 1  66 SER H    H   9.431  -4.095   2.113 1.00 . A A .  66 SER H    1 1 
        1  1054 1 1  66 SER HA   H   8.414  -3.188  -0.504 1.00 . A A .  66 SER HA   1 1 
        1  1055 1 1  66 SER HB2  H  10.842  -3.160  -1.243 1.00 . A A .  66 SER HB2  1 1 
        1  1056 1 1  66 SER HB3  H  10.432  -1.934  -0.046 1.00 . A A .  66 SER HB3  1 1 
        1  1057 1 1  66 SER HG   H  11.631  -4.439   0.565 1.00 . A A .  66 SER HG   1 1 
        1  1058 1 1  66 SER N    N   8.875  -3.600   1.486 1.00 . A A .  66 SER N    1 1 
        1  1059 1 1  66 SER O    O  10.197  -5.892  -0.158 1.00 . A A .  66 SER O    1 1 
        1  1060 1 1  66 SER OG   O  11.572  -3.479   0.646 1.00 . A A .  66 SER OG   1 1 
        1  1061 1 1  67 PHE C    C   7.959  -7.043  -3.043 1.00 . A A .  67 PHE C    1 1 
        1  1062 1 1  67 PHE CA   C   7.973  -7.032  -1.494 1.00 . A A .  67 PHE CA   1 1 
        1  1063 1 1  67 PHE CB   C   6.682  -7.678  -0.878 1.00 . A A .  67 PHE CB   1 1 
        1  1064 1 1  67 PHE CD1  C   7.379  -9.979  -0.020 1.00 . A A .  67 PHE CD1  1 1 
        1  1065 1 1  67 PHE CD2  C   5.905  -9.892  -1.892 1.00 . A A .  67 PHE CD2  1 1 
        1  1066 1 1  67 PHE CE1  C   7.368 -11.359  -0.078 1.00 . A A .  67 PHE CE1  1 1 
        1  1067 1 1  67 PHE CE2  C   5.894 -11.271  -1.949 1.00 . A A .  67 PHE CE2  1 1 
        1  1068 1 1  67 PHE CG   C   6.648  -9.216  -0.930 1.00 . A A .  67 PHE CG   1 1 
        1  1069 1 1  67 PHE CZ   C   6.629 -12.006  -1.043 1.00 . A A .  67 PHE CZ   1 1 
        1  1070 1 1  67 PHE H    H   7.405  -4.994  -1.245 1.00 . A A .  67 PHE H    1 1 
        1  1071 1 1  67 PHE HA   H   8.846  -7.595  -1.164 1.00 . A A .  67 PHE HA   1 1 
        1  1072 1 1  67 PHE HB2  H   6.609  -7.385   0.164 1.00 . A A .  67 PHE HB2  1 1 
        1  1073 1 1  67 PHE HB3  H   5.808  -7.298  -1.400 1.00 . A A .  67 PHE HB3  1 1 
        1  1074 1 1  67 PHE HD1  H   7.966  -9.481   0.739 1.00 . A A .  67 PHE HD1  1 1 
        1  1075 1 1  67 PHE HD2  H   5.325  -9.323  -2.610 1.00 . A A .  67 PHE HD2  1 1 
        1  1076 1 1  67 PHE HE1  H   7.938 -11.935   0.640 1.00 . A A .  67 PHE HE1  1 1 
        1  1077 1 1  67 PHE HE2  H   5.310 -11.778  -2.708 1.00 . A A .  67 PHE HE2  1 1 
        1  1078 1 1  67 PHE HZ   H   6.620 -13.087  -1.087 1.00 . A A .  67 PHE HZ   1 1 
        1  1079 1 1  67 PHE N    N   8.121  -5.633  -1.029 1.00 . A A .  67 PHE N    1 1 
        1  1080 1 1  67 PHE O    O   7.997  -5.988  -3.668 1.00 . A A .  67 PHE O    1 1 
        1  1081 1 1  68 THR C    C   6.471  -8.415  -5.698 1.00 . A A .  68 THR C    1 1 
        1  1082 1 1  68 THR CA   C   7.915  -8.395  -5.124 1.00 . A A .  68 THR CA   1 1 
        1  1083 1 1  68 THR CB   C   8.677  -9.704  -5.532 1.00 . A A .  68 THR CB   1 1 
        1  1084 1 1  68 THR CG2  C   8.071 -10.962  -4.892 1.00 . A A .  68 THR CG2  1 1 
        1  1085 1 1  68 THR H    H   7.993  -9.038  -3.099 1.00 . A A .  68 THR H    1 1 
        1  1086 1 1  68 THR HA   H   8.445  -7.556  -5.566 1.00 . A A .  68 THR HA   1 1 
        1  1087 1 1  68 THR HB   H   9.706  -9.615  -5.192 1.00 . A A .  68 THR HB   1 1 
        1  1088 1 1  68 THR HG1  H   7.801  -9.910  -7.296 1.00 . A A .  68 THR HG1  1 1 
        1  1089 1 1  68 THR HG21 H   8.635 -11.837  -5.198 1.00 . A A .  68 THR HG21 1 1 
        1  1090 1 1  68 THR HG22 H   7.039 -11.074  -5.202 1.00 . A A .  68 THR HG22 1 1 
        1  1091 1 1  68 THR HG23 H   8.111 -10.878  -3.816 1.00 . A A .  68 THR HG23 1 1 
        1  1092 1 1  68 THR N    N   7.947  -8.233  -3.652 1.00 . A A .  68 THR N    1 1 
        1  1093 1 1  68 THR O    O   6.286  -8.290  -6.917 1.00 . A A .  68 THR O    1 1 
        1  1094 1 1  68 THR OG1  O   8.702  -9.869  -6.955 1.00 . A A .  68 THR OG1  1 1 
        1  1095 1 1  69 LYS C    C   3.091  -7.697  -4.828 1.00 . A A .  69 LYS C    1 1 
        1  1096 1 1  69 LYS CA   C   4.059  -8.825  -5.249 1.00 . A A .  69 LYS CA   1 1 
        1  1097 1 1  69 LYS CB   C   3.580 -10.183  -4.649 1.00 . A A .  69 LYS CB   1 1 
        1  1098 1 1  69 LYS CD   C   1.678 -11.905  -4.358 1.00 . A A .  69 LYS CD   1 1 
        1  1099 1 1  69 LYS CE   C   2.543 -13.139  -4.666 1.00 . A A .  69 LYS CE   1 1 
        1  1100 1 1  69 LYS CG   C   2.162 -10.625  -5.082 1.00 . A A .  69 LYS CG   1 1 
        1  1101 1 1  69 LYS H    H   5.630  -8.391  -3.876 1.00 . A A .  69 LYS H    1 1 
        1  1102 1 1  69 LYS HA   H   4.043  -8.909  -6.335 1.00 . A A .  69 LYS HA   1 1 
        1  1103 1 1  69 LYS HB2  H   4.278 -10.960  -4.954 1.00 . A A .  69 LYS HB2  1 1 
        1  1104 1 1  69 LYS HB3  H   3.602 -10.115  -3.565 1.00 . A A .  69 LYS HB3  1 1 
        1  1105 1 1  69 LYS HD2  H   1.699 -11.728  -3.287 1.00 . A A .  69 LYS HD2  1 1 
        1  1106 1 1  69 LYS HD3  H   0.652 -12.108  -4.658 1.00 . A A .  69 LYS HD3  1 1 
        1  1107 1 1  69 LYS HE2  H   2.510 -13.348  -5.727 1.00 . A A .  69 LYS HE2  1 1 
        1  1108 1 1  69 LYS HE3  H   3.565 -12.934  -4.376 1.00 . A A .  69 LYS HE3  1 1 
        1  1109 1 1  69 LYS HG2  H   1.466  -9.823  -4.865 1.00 . A A .  69 LYS HG2  1 1 
        1  1110 1 1  69 LYS HG3  H   2.166 -10.806  -6.155 1.00 . A A .  69 LYS HG3  1 1 
        1  1111 1 1  69 LYS HZ1  H   2.175 -14.210  -2.909 1.00 . A A .  69 LYS HZ1  1 1 
        1  1112 1 1  69 LYS HZ2  H   2.656 -15.171  -4.215 1.00 . A A .  69 LYS HZ2  1 1 
        1  1113 1 1  69 LYS HZ3  H   1.088 -14.549  -4.161 1.00 . A A .  69 LYS HZ3  1 1 
        1  1114 1 1  69 LYS N    N   5.452  -8.536  -4.824 1.00 . A A .  69 LYS N    1 1 
        1  1115 1 1  69 LYS NZ   N   2.081 -14.349  -3.937 1.00 . A A .  69 LYS NZ   1 1 
        1  1116 1 1  69 LYS O    O   2.826  -7.526  -3.634 1.00 . A A .  69 LYS O    1 1 
        1  1117 1 1  70 PRO C    C   0.085  -6.876  -5.820 1.00 . A A .  70 PRO C    1 1 
        1  1118 1 1  70 PRO CA   C   1.378  -6.053  -5.614 1.00 . A A .  70 PRO CA   1 1 
        1  1119 1 1  70 PRO CB   C   1.515  -4.968  -6.710 1.00 . A A .  70 PRO CB   1 1 
        1  1120 1 1  70 PRO CD   C   3.249  -6.601  -7.121 1.00 . A A .  70 PRO CD   1 1 
        1  1121 1 1  70 PRO CG   C   2.306  -5.625  -7.802 1.00 . A A .  70 PRO CG   1 1 
        1  1122 1 1  70 PRO HA   H   1.353  -5.589  -4.634 1.00 . A A .  70 PRO HA   1 1 
        1  1123 1 1  70 PRO HB2  H   0.537  -4.646  -7.054 1.00 . A A .  70 PRO HB2  1 1 
        1  1124 1 1  70 PRO HB3  H   2.044  -4.109  -6.304 1.00 . A A .  70 PRO HB3  1 1 
        1  1125 1 1  70 PRO HD2  H   3.339  -7.516  -7.699 1.00 . A A .  70 PRO HD2  1 1 
        1  1126 1 1  70 PRO HD3  H   4.230  -6.155  -6.981 1.00 . A A .  70 PRO HD3  1 1 
        1  1127 1 1  70 PRO HG2  H   1.631  -6.155  -8.471 1.00 . A A .  70 PRO HG2  1 1 
        1  1128 1 1  70 PRO HG3  H   2.862  -4.880  -8.362 1.00 . A A .  70 PRO HG3  1 1 
        1  1129 1 1  70 PRO N    N   2.601  -6.869  -5.803 1.00 . A A .  70 PRO N    1 1 
        1  1130 1 1  70 PRO O    O   0.130  -8.032  -6.252 1.00 . A A .  70 PRO O    1 1 
        1  1131 1 1  71 ILE C    C  -2.851  -5.981  -7.106 1.00 . A A .  71 ILE C    1 1 
        1  1132 1 1  71 ILE CA   C  -2.386  -6.775  -5.871 1.00 . A A .  71 ILE CA   1 1 
        1  1133 1 1  71 ILE CB   C  -3.422  -6.668  -4.688 1.00 . A A .  71 ILE CB   1 1 
        1  1134 1 1  71 ILE CD1  C  -3.867  -7.578  -2.287 1.00 . A A .  71 ILE CD1  1 1 
        1  1135 1 1  71 ILE CG1  C  -2.991  -7.626  -3.529 1.00 . A A .  71 ILE CG1  1 1 
        1  1136 1 1  71 ILE CG2  C  -4.867  -6.970  -5.160 1.00 . A A .  71 ILE CG2  1 1 
        1  1137 1 1  71 ILE H    H  -1.015  -5.437  -4.957 1.00 . A A .  71 ILE H    1 1 
        1  1138 1 1  71 ILE HA   H  -2.287  -7.830  -6.140 1.00 . A A .  71 ILE HA   1 1 
        1  1139 1 1  71 ILE HB   H  -3.399  -5.647  -4.317 1.00 . A A .  71 ILE HB   1 1 
        1  1140 1 1  71 ILE HD11 H  -3.866  -6.569  -1.882 1.00 . A A .  71 ILE HD11 1 1 
        1  1141 1 1  71 ILE HD12 H  -3.476  -8.258  -1.547 1.00 . A A .  71 ILE HD12 1 1 
        1  1142 1 1  71 ILE HD13 H  -4.878  -7.862  -2.539 1.00 . A A .  71 ILE HD13 1 1 
        1  1143 1 1  71 ILE HG12 H  -3.008  -8.644  -3.890 1.00 . A A .  71 ILE HG12 1 1 
        1  1144 1 1  71 ILE HG13 H  -1.978  -7.383  -3.221 1.00 . A A .  71 ILE HG13 1 1 
        1  1145 1 1  71 ILE HG21 H  -5.165  -6.255  -5.920 1.00 . A A .  71 ILE HG21 1 1 
        1  1146 1 1  71 ILE HG22 H  -5.549  -6.902  -4.325 1.00 . A A .  71 ILE HG22 1 1 
        1  1147 1 1  71 ILE HG23 H  -4.916  -7.971  -5.578 1.00 . A A .  71 ILE HG23 1 1 
        1  1148 1 1  71 ILE N    N  -1.061  -6.265  -5.485 1.00 . A A .  71 ILE N    1 1 
        1  1149 1 1  71 ILE O    O  -3.078  -4.775  -7.027 1.00 . A A .  71 ILE O    1 1 
        1  1150 1 1  72 GLU C    C  -4.561  -5.282  -9.656 1.00 . A A .  72 GLU C    1 1 
        1  1151 1 1  72 GLU CA   C  -3.235  -6.076  -9.567 1.00 . A A .  72 GLU CA   1 1 
        1  1152 1 1  72 GLU CB   C  -3.223  -7.192 -10.654 1.00 . A A .  72 GLU CB   1 1 
        1  1153 1 1  72 GLU CD   C  -0.647  -7.514 -10.735 1.00 . A A .  72 GLU CD   1 1 
        1  1154 1 1  72 GLU CG   C  -2.030  -8.174 -10.570 1.00 . A A .  72 GLU CG   1 1 
        1  1155 1 1  72 GLU H    H  -2.990  -7.663  -8.165 1.00 . A A .  72 GLU H    1 1 
        1  1156 1 1  72 GLU HA   H  -2.412  -5.394  -9.764 1.00 . A A .  72 GLU HA   1 1 
        1  1157 1 1  72 GLU HB2  H  -4.134  -7.775 -10.563 1.00 . A A .  72 GLU HB2  1 1 
        1  1158 1 1  72 GLU HB3  H  -3.209  -6.724 -11.635 1.00 . A A .  72 GLU HB3  1 1 
        1  1159 1 1  72 GLU HG2  H  -2.065  -8.670  -9.605 1.00 . A A .  72 GLU HG2  1 1 
        1  1160 1 1  72 GLU HG3  H  -2.153  -8.930 -11.343 1.00 . A A .  72 GLU HG3  1 1 
        1  1161 1 1  72 GLU N    N  -3.010  -6.686  -8.232 1.00 . A A .  72 GLU N    1 1 
        1  1162 1 1  72 GLU O    O  -4.749  -4.488 -10.580 1.00 . A A .  72 GLU O    1 1 
        1  1163 1 1  72 GLU OE1  O  -0.158  -7.399 -11.878 1.00 . A A .  72 GLU OE1  1 1 
        1  1164 1 1  72 GLU OE2  O  -0.034  -7.120  -9.723 1.00 . A A .  72 GLU OE2  1 1 
        1  1165 1 1  73 GLU C    C  -6.914  -3.462  -8.519 1.00 . A A .  73 GLU C    1 1 
        1  1166 1 1  73 GLU CA   C  -6.840  -4.992  -8.734 1.00 . A A .  73 GLU CA   1 1 
        1  1167 1 1  73 GLU CB   C  -7.691  -5.716  -7.659 1.00 . A A .  73 GLU CB   1 1 
        1  1168 1 1  73 GLU CD   C  -9.968  -5.968  -6.484 1.00 . A A .  73 GLU CD   1 1 
        1  1169 1 1  73 GLU CG   C  -9.164  -5.269  -7.590 1.00 . A A .  73 GLU CG   1 1 
        1  1170 1 1  73 GLU H    H  -5.212  -6.084  -7.940 1.00 . A A .  73 GLU H    1 1 
        1  1171 1 1  73 GLU HA   H  -7.253  -5.226  -9.712 1.00 . A A .  73 GLU HA   1 1 
        1  1172 1 1  73 GLU HB2  H  -7.671  -6.783  -7.863 1.00 . A A .  73 GLU HB2  1 1 
        1  1173 1 1  73 GLU HB3  H  -7.234  -5.546  -6.686 1.00 . A A .  73 GLU HB3  1 1 
        1  1174 1 1  73 GLU HG2  H  -9.198  -4.193  -7.421 1.00 . A A .  73 GLU HG2  1 1 
        1  1175 1 1  73 GLU HG3  H  -9.630  -5.474  -8.546 1.00 . A A .  73 GLU HG3  1 1 
        1  1176 1 1  73 GLU N    N  -5.468  -5.519  -8.695 1.00 . A A .  73 GLU N    1 1 
        1  1177 1 1  73 GLU O    O  -7.525  -2.755  -9.328 1.00 . A A .  73 GLU O    1 1 
        1  1178 1 1  73 GLU OE1  O -10.435  -7.107  -6.705 1.00 . A A .  73 GLU OE1  1 1 
        1  1179 1 1  73 GLU OE2  O -10.151  -5.378  -5.399 1.00 . A A .  73 GLU OE2  1 1 
        1  1180 1 1  74 GLU C    C  -5.117  -0.777  -7.063 1.00 . A A .  74 GLU C    1 1 
        1  1181 1 1  74 GLU CA   C  -6.458  -1.527  -7.058 1.00 . A A .  74 GLU CA   1 1 
        1  1182 1 1  74 GLU CB   C  -7.154  -1.454  -5.664 1.00 . A A .  74 GLU CB   1 1 
        1  1183 1 1  74 GLU CD   C  -9.022   0.150  -6.421 1.00 . A A .  74 GLU CD   1 1 
        1  1184 1 1  74 GLU CG   C  -7.900  -0.130  -5.399 1.00 . A A .  74 GLU CG   1 1 
        1  1185 1 1  74 GLU H    H  -5.706  -3.526  -6.902 1.00 . A A .  74 GLU H    1 1 
        1  1186 1 1  74 GLU HA   H  -7.104  -1.048  -7.793 1.00 . A A .  74 GLU HA   1 1 
        1  1187 1 1  74 GLU HB2  H  -7.874  -2.265  -5.590 1.00 . A A .  74 GLU HB2  1 1 
        1  1188 1 1  74 GLU HB3  H  -6.410  -1.589  -4.883 1.00 . A A .  74 GLU HB3  1 1 
        1  1189 1 1  74 GLU HG2  H  -8.336  -0.173  -4.410 1.00 . A A .  74 GLU HG2  1 1 
        1  1190 1 1  74 GLU HG3  H  -7.181   0.684  -5.426 1.00 . A A .  74 GLU HG3  1 1 
        1  1191 1 1  74 GLU N    N  -6.281  -2.946  -7.452 1.00 . A A .  74 GLU N    1 1 
        1  1192 1 1  74 GLU O    O  -5.032   0.394  -6.670 1.00 . A A .  74 GLU O    1 1 
        1  1193 1 1  74 GLU OE1  O -10.127  -0.425  -6.295 1.00 . A A .  74 GLU OE1  1 1 
        1  1194 1 1  74 GLU OE2  O  -8.809   0.943  -7.360 1.00 . A A .  74 GLU OE2  1 1 
        1  1195 1 1  75 VAL C    C  -2.358  -0.598  -9.058 1.00 . A A .  75 VAL C    1 1 
        1  1196 1 1  75 VAL CA   C  -2.716  -0.903  -7.600 1.00 . A A .  75 VAL CA   1 1 
        1  1197 1 1  75 VAL CB   C  -1.706  -1.922  -6.973 1.00 . A A .  75 VAL CB   1 1 
        1  1198 1 1  75 VAL CG1  C  -0.244  -1.477  -7.148 1.00 . A A .  75 VAL CG1  1 1 
        1  1199 1 1  75 VAL CG2  C  -2.036  -2.157  -5.483 1.00 . A A .  75 VAL CG2  1 1 
        1  1200 1 1  75 VAL H    H  -4.218  -2.338  -7.919 1.00 . A A .  75 VAL H    1 1 
        1  1201 1 1  75 VAL HA   H  -2.680   0.022  -7.019 1.00 . A A .  75 VAL HA   1 1 
        1  1202 1 1  75 VAL HB   H  -1.827  -2.870  -7.492 1.00 . A A .  75 VAL HB   1 1 
        1  1203 1 1  75 VAL HG11 H  -0.085  -0.521  -6.661 1.00 . A A .  75 VAL HG11 1 1 
        1  1204 1 1  75 VAL HG12 H  -0.005  -1.378  -8.202 1.00 . A A .  75 VAL HG12 1 1 
        1  1205 1 1  75 VAL HG13 H   0.421  -2.212  -6.707 1.00 . A A .  75 VAL HG13 1 1 
        1  1206 1 1  75 VAL HG21 H  -3.055  -2.519  -5.382 1.00 . A A .  75 VAL HG21 1 1 
        1  1207 1 1  75 VAL HG22 H  -1.937  -1.223  -4.943 1.00 . A A .  75 VAL HG22 1 1 
        1  1208 1 1  75 VAL HG23 H  -1.356  -2.887  -5.065 1.00 . A A .  75 VAL HG23 1 1 
        1  1209 1 1  75 VAL N    N  -4.071  -1.447  -7.548 1.00 . A A .  75 VAL N    1 1 
        1  1210 1 1  75 VAL O    O  -2.380  -1.499  -9.902 1.00 . A A .  75 VAL O    1 1 
        1  1211 1 1  76 GLU C    C  -0.185   1.501 -10.721 1.00 . A A .  76 GLU C    1 1 
        1  1212 1 1  76 GLU CA   C  -1.667   1.122 -10.707 1.00 . A A .  76 GLU CA   1 1 
        1  1213 1 1  76 GLU CB   C  -2.505   2.354 -11.171 1.00 . A A .  76 GLU CB   1 1 
        1  1214 1 1  76 GLU CD   C  -4.780   3.345 -11.842 1.00 . A A .  76 GLU CD   1 1 
        1  1215 1 1  76 GLU CG   C  -4.026   2.131 -11.256 1.00 . A A .  76 GLU CG   1 1 
        1  1216 1 1  76 GLU H    H  -2.034   1.328  -8.615 1.00 . A A .  76 GLU H    1 1 
        1  1217 1 1  76 GLU HA   H  -1.835   0.302 -11.408 1.00 . A A .  76 GLU HA   1 1 
        1  1218 1 1  76 GLU HB2  H  -2.333   3.177 -10.474 1.00 . A A .  76 GLU HB2  1 1 
        1  1219 1 1  76 GLU HB3  H  -2.156   2.660 -12.149 1.00 . A A .  76 GLU HB3  1 1 
        1  1220 1 1  76 GLU HG2  H  -4.207   1.263 -11.881 1.00 . A A .  76 GLU HG2  1 1 
        1  1221 1 1  76 GLU HG3  H  -4.410   1.932 -10.261 1.00 . A A .  76 GLU HG3  1 1 
        1  1222 1 1  76 GLU N    N  -2.047   0.673  -9.349 1.00 . A A .  76 GLU N    1 1 
        1  1223 1 1  76 GLU O    O   0.209   2.414 -10.001 1.00 . A A .  76 GLU O    1 1 
        1  1224 1 1  76 GLU OE1  O  -4.646   4.466 -11.302 1.00 . A A .  76 GLU OE1  1 1 
        1  1225 1 1  76 GLU OE2  O  -5.496   3.196 -12.860 1.00 . A A .  76 GLU OE2  1 1 
        1  1226 1 1  77 GLU C    C   2.119   2.280 -12.824 1.00 . A A .  77 GLU C    1 1 
        1  1227 1 1  77 GLU CA   C   2.035   1.171 -11.757 1.00 . A A .  77 GLU CA   1 1 
        1  1228 1 1  77 GLU CB   C   2.852  -0.081 -12.168 1.00 . A A .  77 GLU CB   1 1 
        1  1229 1 1  77 GLU CD   C   3.189  -1.948 -13.907 1.00 . A A .  77 GLU CD   1 1 
        1  1230 1 1  77 GLU CG   C   2.260  -0.866 -13.360 1.00 . A A .  77 GLU CG   1 1 
        1  1231 1 1  77 GLU H    H   0.228   0.123 -12.118 1.00 . A A .  77 GLU H    1 1 
        1  1232 1 1  77 GLU HA   H   2.425   1.557 -10.812 1.00 . A A .  77 GLU HA   1 1 
        1  1233 1 1  77 GLU HB2  H   3.859   0.227 -12.427 1.00 . A A .  77 GLU HB2  1 1 
        1  1234 1 1  77 GLU HB3  H   2.907  -0.752 -11.319 1.00 . A A .  77 GLU HB3  1 1 
        1  1235 1 1  77 GLU HG2  H   1.332  -1.332 -13.039 1.00 . A A .  77 GLU HG2  1 1 
        1  1236 1 1  77 GLU HG3  H   2.028  -0.165 -14.156 1.00 . A A .  77 GLU HG3  1 1 
        1  1237 1 1  77 GLU N    N   0.617   0.831 -11.562 1.00 . A A .  77 GLU N    1 1 
        1  1238 1 1  77 GLU O    O   1.522   2.156 -13.906 1.00 . A A .  77 GLU O    1 1 
        1  1239 1 1  77 GLU OE1  O   3.204  -3.074 -13.362 1.00 . A A .  77 GLU OE1  1 1 
        1  1240 1 1  77 GLU OE2  O   3.910  -1.677 -14.891 1.00 . A A .  77 GLU OE2  1 1 
        1  1241 1 1  78 LYS C    C   4.105   5.320 -13.331 1.00 . A A .  78 LYS C    1 1 
        1  1242 1 1  78 LYS CA   C   2.735   4.614 -13.283 1.00 . A A .  78 LYS CA   1 1 
        1  1243 1 1  78 LYS CB   C   1.620   5.473 -12.621 1.00 . A A .  78 LYS CB   1 1 
        1  1244 1 1  78 LYS CD   C  -0.343   7.106 -12.890 1.00 . A A .  78 LYS CD   1 1 
        1  1245 1 1  78 LYS CE   C  -1.405   6.026 -12.575 1.00 . A A .  78 LYS CE   1 1 
        1  1246 1 1  78 LYS CG   C   0.938   6.513 -13.538 1.00 . A A .  78 LYS CG   1 1 
        1  1247 1 1  78 LYS H    H   3.438   3.339 -11.744 1.00 . A A .  78 LYS H    1 1 
        1  1248 1 1  78 LYS HA   H   2.432   4.368 -14.303 1.00 . A A .  78 LYS HA   1 1 
        1  1249 1 1  78 LYS HB2  H   0.849   4.799 -12.258 1.00 . A A .  78 LYS HB2  1 1 
        1  1250 1 1  78 LYS HB3  H   2.038   5.997 -11.763 1.00 . A A .  78 LYS HB3  1 1 
        1  1251 1 1  78 LYS HD2  H  -0.071   7.606 -11.965 1.00 . A A .  78 LYS HD2  1 1 
        1  1252 1 1  78 LYS HD3  H  -0.774   7.835 -13.568 1.00 . A A .  78 LYS HD3  1 1 
        1  1253 1 1  78 LYS HE2  H  -1.766   5.601 -13.500 1.00 . A A .  78 LYS HE2  1 1 
        1  1254 1 1  78 LYS HE3  H  -0.949   5.244 -11.978 1.00 . A A .  78 LYS HE3  1 1 
        1  1255 1 1  78 LYS HG2  H   1.637   7.317 -13.740 1.00 . A A .  78 LYS HG2  1 1 
        1  1256 1 1  78 LYS HG3  H   0.668   6.033 -14.476 1.00 . A A .  78 LYS HG3  1 1 
        1  1257 1 1  78 LYS HZ1  H  -3.011   7.340 -12.359 1.00 . A A .  78 LYS HZ1  1 1 
        1  1258 1 1  78 LYS HZ2  H  -2.252   6.936 -10.902 1.00 . A A .  78 LYS HZ2  1 1 
        1  1259 1 1  78 LYS HZ3  H  -3.267   5.820 -11.666 1.00 . A A .  78 LYS HZ3  1 1 
        1  1260 1 1  78 LYS N    N   2.837   3.369 -12.516 1.00 . A A .  78 LYS N    1 1 
        1  1261 1 1  78 LYS NZ   N  -2.565   6.570 -11.824 1.00 . A A .  78 LYS NZ   1 1 
        1  1262 1 1  78 LYS O    O   4.620   5.777 -12.308 1.00 . A A .  78 LYS O    1 1 
        1  1263 1 1  79 LEU C    C   6.045   7.426 -14.680 1.00 . A A .  79 LEU C    1 1 
        1  1264 1 1  79 LEU CA   C   6.036   5.888 -14.798 1.00 . A A .  79 LEU CA   1 1 
        1  1265 1 1  79 LEU CB   C   6.501   5.452 -16.222 1.00 . A A .  79 LEU CB   1 1 
        1  1266 1 1  79 LEU CD1  C   8.942   4.794 -15.743 1.00 . A A .  79 LEU CD1  1 1 
        1  1267 1 1  79 LEU CD2  C   8.265   5.507 -18.088 1.00 . A A .  79 LEU CD2  1 1 
        1  1268 1 1  79 LEU CG   C   8.010   5.696 -16.577 1.00 . A A .  79 LEU CG   1 1 
        1  1269 1 1  79 LEU H    H   4.188   5.001 -15.294 1.00 . A A .  79 LEU H    1 1 
        1  1270 1 1  79 LEU HA   H   6.714   5.462 -14.058 1.00 . A A .  79 LEU HA   1 1 
        1  1271 1 1  79 LEU HB2  H   6.297   4.390 -16.332 1.00 . A A .  79 LEU HB2  1 1 
        1  1272 1 1  79 LEU HB3  H   5.891   5.984 -16.948 1.00 . A A .  79 LEU HB3  1 1 
        1  1273 1 1  79 LEU HD11 H   8.771   4.966 -14.689 1.00 . A A .  79 LEU HD11 1 1 
        1  1274 1 1  79 LEU HD12 H   9.974   5.028 -15.972 1.00 . A A .  79 LEU HD12 1 1 
        1  1275 1 1  79 LEU HD13 H   8.752   3.752 -15.972 1.00 . A A .  79 LEU HD13 1 1 
        1  1276 1 1  79 LEU HD21 H   7.647   6.198 -18.647 1.00 . A A .  79 LEU HD21 1 1 
        1  1277 1 1  79 LEU HD22 H   8.019   4.493 -18.380 1.00 . A A .  79 LEU HD22 1 1 
        1  1278 1 1  79 LEU HD23 H   9.303   5.703 -18.309 1.00 . A A .  79 LEU HD23 1 1 
        1  1279 1 1  79 LEU HG   H   8.261   6.719 -16.333 1.00 . A A .  79 LEU HG   1 1 
        1  1280 1 1  79 LEU N    N   4.689   5.354 -14.537 1.00 . A A .  79 LEU N    1 1 
        1  1281 1 1  79 LEU O    O   5.056   8.089 -15.009 1.00 . A A .  79 LEU O    1 1 
        1  1282 1 1  80 ASP C    C   8.905   9.710 -14.243 1.00 . A A .  80 ASP C    1 1 
        1  1283 1 1  80 ASP CA   C   7.404   9.412 -14.062 1.00 . A A .  80 ASP CA   1 1 
        1  1284 1 1  80 ASP CB   C   6.900   9.916 -12.684 1.00 . A A .  80 ASP CB   1 1 
        1  1285 1 1  80 ASP CG   C   7.618   9.255 -11.492 1.00 . A A .  80 ASP CG   1 1 
        1  1286 1 1  80 ASP H    H   7.867   7.361 -13.896 1.00 . A A .  80 ASP H    1 1 
        1  1287 1 1  80 ASP HA   H   6.857   9.924 -14.847 1.00 . A A .  80 ASP HA   1 1 
        1  1288 1 1  80 ASP HB2  H   7.042  10.990 -12.628 1.00 . A A .  80 ASP HB2  1 1 
        1  1289 1 1  80 ASP HB3  H   5.835   9.710 -12.602 1.00 . A A .  80 ASP HB3  1 1 
        1  1290 1 1  80 ASP N    N   7.163   7.966 -14.193 1.00 . A A .  80 ASP N    1 1 
        1  1291 1 1  80 ASP O    O   9.710   8.785 -14.356 1.00 . A A .  80 ASP O    1 1 
        1  1292 1 1  80 ASP OD1  O   7.169   8.184 -11.040 1.00 . A A .  80 ASP OD1  1 1 
        1  1293 1 1  80 ASP OD2  O   8.616   9.827 -10.991 1.00 . A A .  80 ASP OD2  1 1 
        1  1294 1 1  81 THR C    C  10.719  12.755 -13.400 1.00 . A A .  81 THR C    1 1 
        1  1295 1 1  81 THR CA   C  10.658  11.467 -14.244 1.00 . A A .  81 THR CA   1 1 
        1  1296 1 1  81 THR CB   C  11.298  11.690 -15.668 1.00 . A A .  81 THR CB   1 1 
        1  1297 1 1  81 THR CG2  C  10.475  12.632 -16.570 1.00 . A A .  81 THR CG2  1 1 
        1  1298 1 1  81 THR H    H   8.554  11.669 -14.430 1.00 . A A .  81 THR H    1 1 
        1  1299 1 1  81 THR HA   H  11.244  10.701 -13.735 1.00 . A A .  81 THR HA   1 1 
        1  1300 1 1  81 THR HB   H  11.358  10.722 -16.157 1.00 . A A .  81 THR HB   1 1 
        1  1301 1 1  81 THR HG1  H  13.090  11.743 -14.815 1.00 . A A .  81 THR HG1  1 1 
        1  1302 1 1  81 THR HG21 H  10.370  13.598 -16.090 1.00 . A A .  81 THR HG21 1 1 
        1  1303 1 1  81 THR HG22 H   9.493  12.208 -16.737 1.00 . A A .  81 THR HG22 1 1 
        1  1304 1 1  81 THR HG23 H  10.975  12.758 -17.519 1.00 . A A .  81 THR HG23 1 1 
        1  1305 1 1  81 THR N    N   9.259  11.001 -14.316 1.00 . A A .  81 THR N    1 1 
        1  1306 1 1  81 THR O    O  10.012  13.727 -13.694 1.00 . A A .  81 THR O    1 1 
        1  1307 1 1  81 THR OG1  O  12.643  12.199 -15.538 1.00 . A A .  81 THR OG1  1 1 
        1  1308 1 1  82 SER C    C  12.757  14.852 -12.023 1.00 . A A .  82 SER C    1 1 
        1  1309 1 1  82 SER CA   C  11.688  13.894 -11.436 1.00 . A A .  82 SER CA   1 1 
        1  1310 1 1  82 SER CB   C  12.073  13.420 -10.013 1.00 . A A .  82 SER CB   1 1 
        1  1311 1 1  82 SER H    H  11.974  11.894 -12.087 1.00 . A A .  82 SER H    1 1 
        1  1312 1 1  82 SER HA   H  10.739  14.424 -11.380 1.00 . A A .  82 SER HA   1 1 
        1  1313 1 1  82 SER HB2  H  13.043  12.945 -10.037 1.00 . A A .  82 SER HB2  1 1 
        1  1314 1 1  82 SER HB3  H  12.106  14.269  -9.339 1.00 . A A .  82 SER HB3  1 1 
        1  1315 1 1  82 SER HG   H  10.237  12.800  -9.680 1.00 . A A .  82 SER HG   1 1 
        1  1316 1 1  82 SER N    N  11.503  12.727 -12.309 1.00 . A A .  82 SER N    1 1 
        1  1317 1 1  82 SER O    O  12.460  16.015 -12.340 1.00 . A A .  82 SER O    1 1 
        1  1318 1 1  82 SER OG   O  11.132  12.479  -9.511 1.00 . A A .  82 SER OG   1 1 
        1  1319 1 1  83 HIS C    C  16.157  14.122 -13.358 1.00 . A A .  83 HIS C    1 1 
        1  1320 1 1  83 HIS CA   C  15.176  15.092 -12.668 1.00 . A A .  83 HIS CA   1 1 
        1  1321 1 1  83 HIS CB   C  15.918  15.835 -11.506 1.00 . A A .  83 HIS CB   1 1 
        1  1322 1 1  83 HIS CD2  C  14.586  16.935  -9.558 1.00 . A A .  83 HIS CD2  1 1 
        1  1323 1 1  83 HIS CE1  C  14.067  18.815 -10.551 1.00 . A A .  83 HIS CE1  1 1 
        1  1324 1 1  83 HIS CG   C  15.120  16.900 -10.804 1.00 . A A .  83 HIS CG   1 1 
        1  1325 1 1  83 HIS H    H  14.122  13.384 -11.984 1.00 . A A .  83 HIS H    1 1 
        1  1326 1 1  83 HIS HA   H  14.836  15.825 -13.399 1.00 . A A .  83 HIS HA   1 1 
        1  1327 1 1  83 HIS HB2  H  16.218  15.108 -10.763 1.00 . A A .  83 HIS HB2  1 1 
        1  1328 1 1  83 HIS HB3  H  16.813  16.307 -11.901 1.00 . A A .  83 HIS HB3  1 1 
        1  1329 1 1  83 HIS HD1  H  15.026  18.374 -12.306 1.00 . A A .  83 HIS HD1  1 1 
        1  1330 1 1  83 HIS HD2  H  14.653  16.154  -8.809 1.00 . A A .  83 HIS HD2  1 1 
        1  1331 1 1  83 HIS HE1  H  13.661  19.799 -10.743 1.00 . A A .  83 HIS HE1  1 1 
        1  1332 1 1  83 HIS HE2  H  13.349  18.381  -8.683 1.00 . A A .  83 HIS HE2  1 1 
        1  1333 1 1  83 HIS N    N  13.996  14.330 -12.189 1.00 . A A .  83 HIS N    1 1 
        1  1334 1 1  83 HIS ND1  N  14.781  18.096 -11.396 1.00 . A A .  83 HIS ND1  1 1 
        1  1335 1 1  83 HIS NE2  N  13.941  18.136  -9.427 1.00 . A A .  83 HIS NE2  1 1 
        1  1336 1 1  83 HIS O    O  17.009  13.524 -12.695 1.00 . A A .  83 HIS O    1 1 
        1  1337 1 1  84 GLY C    C  16.806  11.624 -15.405 1.00 . A A .  84 GLY C    1 1 
        1  1338 1 1  84 GLY CA   C  16.911  13.148 -15.511 1.00 . A A .  84 GLY CA   1 1 
        1  1339 1 1  84 GLY H    H  15.143  14.254 -15.081 1.00 . A A .  84 GLY H    1 1 
        1  1340 1 1  84 GLY HA2  H  16.732  13.426 -16.540 1.00 . A A .  84 GLY HA2  1 1 
        1  1341 1 1  84 GLY HA3  H  17.919  13.447 -15.254 1.00 . A A .  84 GLY HA3  1 1 
        1  1342 1 1  84 GLY N    N  15.959  13.900 -14.667 1.00 . A A .  84 GLY N    1 1 
        1  1343 1 1  84 GLY O    O  17.124  10.905 -16.363 1.00 . A A .  84 GLY O    1 1 
        1  1344 1 1  85 MET C    C  14.616   9.424 -14.023 1.00 . A A .  85 MET C    1 1 
        1  1345 1 1  85 MET CA   C  16.122   9.691 -14.020 1.00 . A A .  85 MET CA   1 1 
        1  1346 1 1  85 MET CB   C  16.730   9.228 -12.662 1.00 . A A .  85 MET CB   1 1 
        1  1347 1 1  85 MET CE   C  20.503  11.009 -12.076 1.00 . A A .  85 MET CE   1 1 
        1  1348 1 1  85 MET CG   C  18.250   9.406 -12.510 1.00 . A A .  85 MET CG   1 1 
        1  1349 1 1  85 MET H    H  16.141  11.737 -13.523 1.00 . A A .  85 MET H    1 1 
        1  1350 1 1  85 MET HA   H  16.589   9.127 -14.830 1.00 . A A .  85 MET HA   1 1 
        1  1351 1 1  85 MET HB2  H  16.257   9.785 -11.862 1.00 . A A .  85 MET HB2  1 1 
        1  1352 1 1  85 MET HB3  H  16.503   8.175 -12.525 1.00 . A A .  85 MET HB3  1 1 
        1  1353 1 1  85 MET HE1  H  20.606  10.586 -11.087 1.00 . A A .  85 MET HE1  1 1 
        1  1354 1 1  85 MET HE2  H  20.951  11.993 -12.094 1.00 . A A .  85 MET HE2  1 1 
        1  1355 1 1  85 MET HE3  H  21.001  10.376 -12.795 1.00 . A A .  85 MET HE3  1 1 
        1  1356 1 1  85 MET HG2  H  18.559   8.949 -11.578 1.00 . A A .  85 MET HG2  1 1 
        1  1357 1 1  85 MET HG3  H  18.747   8.904 -13.333 1.00 . A A .  85 MET HG3  1 1 
        1  1358 1 1  85 MET N    N  16.344  11.122 -14.251 1.00 . A A .  85 MET N    1 1 
        1  1359 1 1  85 MET O    O  13.835  10.231 -13.497 1.00 . A A .  85 MET O    1 1 
        1  1360 1 1  85 MET SD   S  18.765  11.138 -12.493 1.00 . A A .  85 MET SD   1 1 
        1  1361 1 1  86 ILE C    C  12.649   7.013 -13.237 1.00 . A A .  86 ILE C    1 1 
        1  1362 1 1  86 ILE CA   C  12.829   7.818 -14.532 1.00 . A A .  86 ILE CA   1 1 
        1  1363 1 1  86 ILE CB   C  12.373   6.942 -15.764 1.00 . A A .  86 ILE CB   1 1 
        1  1364 1 1  86 ILE CD1  C  12.744   4.645 -16.928 1.00 . A A .  86 ILE CD1  1 1 
        1  1365 1 1  86 ILE CG1  C  13.265   5.672 -15.932 1.00 . A A .  86 ILE CG1  1 1 
        1  1366 1 1  86 ILE CG2  C  12.344   7.780 -17.060 1.00 . A A .  86 ILE CG2  1 1 
        1  1367 1 1  86 ILE H    H  14.863   7.784 -15.147 1.00 . A A .  86 ILE H    1 1 
        1  1368 1 1  86 ILE HA   H  12.175   8.692 -14.487 1.00 . A A .  86 ILE HA   1 1 
        1  1369 1 1  86 ILE HB   H  11.346   6.622 -15.575 1.00 . A A .  86 ILE HB   1 1 
        1  1370 1 1  86 ILE HD11 H  13.411   3.796 -16.944 1.00 . A A .  86 ILE HD11 1 1 
        1  1371 1 1  86 ILE HD12 H  12.696   5.085 -17.915 1.00 . A A .  86 ILE HD12 1 1 
        1  1372 1 1  86 ILE HD13 H  11.754   4.321 -16.630 1.00 . A A .  86 ILE HD13 1 1 
        1  1373 1 1  86 ILE HG12 H  14.249   5.971 -16.265 1.00 . A A .  86 ILE HG12 1 1 
        1  1374 1 1  86 ILE HG13 H  13.358   5.174 -14.976 1.00 . A A .  86 ILE HG13 1 1 
        1  1375 1 1  86 ILE HG21 H  11.665   8.616 -16.942 1.00 . A A .  86 ILE HG21 1 1 
        1  1376 1 1  86 ILE HG22 H  12.003   7.163 -17.884 1.00 . A A .  86 ILE HG22 1 1 
        1  1377 1 1  86 ILE HG23 H  13.338   8.151 -17.280 1.00 . A A .  86 ILE HG23 1 1 
        1  1378 1 1  86 ILE N    N  14.212   8.303 -14.626 1.00 . A A .  86 ILE N    1 1 
        1  1379 1 1  86 ILE O    O  13.613   6.465 -12.677 1.00 . A A .  86 ILE O    1 1 
        1  1380 1 1  87 ARG C    C   9.578   5.656 -11.944 1.00 . A A .  87 ARG C    1 1 
        1  1381 1 1  87 ARG CA   C  10.957   6.211 -11.602 1.00 . A A .  87 ARG CA   1 1 
        1  1382 1 1  87 ARG CB   C  10.811   7.105 -10.333 1.00 . A A .  87 ARG CB   1 1 
        1  1383 1 1  87 ARG CD   C  11.795   8.712  -8.614 1.00 . A A .  87 ARG CD   1 1 
        1  1384 1 1  87 ARG CG   C  12.063   7.882  -9.886 1.00 . A A .  87 ARG CG   1 1 
        1  1385 1 1  87 ARG CZ   C   9.718   9.843  -7.750 1.00 . A A .  87 ARG CZ   1 1 
        1  1386 1 1  87 ARG H    H  10.712   7.433 -13.285 1.00 . A A .  87 ARG H    1 1 
        1  1387 1 1  87 ARG HA   H  11.645   5.391 -11.414 1.00 . A A .  87 ARG HA   1 1 
        1  1388 1 1  87 ARG HB2  H  10.026   7.837 -10.514 1.00 . A A .  87 ARG HB2  1 1 
        1  1389 1 1  87 ARG HB3  H  10.494   6.471  -9.503 1.00 . A A .  87 ARG HB3  1 1 
        1  1390 1 1  87 ARG HD2  H  11.702   8.039  -7.765 1.00 . A A .  87 ARG HD2  1 1 
        1  1391 1 1  87 ARG HD3  H  12.630   9.381  -8.444 1.00 . A A .  87 ARG HD3  1 1 
        1  1392 1 1  87 ARG HE   H  10.316   9.796  -9.654 1.00 . A A .  87 ARG HE   1 1 
        1  1393 1 1  87 ARG HG2  H  12.866   7.180  -9.683 1.00 . A A .  87 ARG HG2  1 1 
        1  1394 1 1  87 ARG HG3  H  12.368   8.550 -10.686 1.00 . A A .  87 ARG HG3  1 1 
        1  1395 1 1  87 ARG HH11 H  10.844   9.063  -6.246 1.00 . A A .  87 ARG HH11 1 1 
        1  1396 1 1  87 ARG HH12 H   9.353   9.795  -5.754 1.00 . A A .  87 ARG HH12 1 1 
        1  1397 1 1  87 ARG HH21 H   8.384  10.696  -8.996 1.00 . A A .  87 ARG HH21 1 1 
        1  1398 1 1  87 ARG HH22 H   7.939  10.706  -7.318 1.00 . A A .  87 ARG HH22 1 1 
        1  1399 1 1  87 ARG N    N  11.406   6.970 -12.777 1.00 . A A .  87 ARG N    1 1 
        1  1400 1 1  87 ARG NE   N  10.559   9.514  -8.743 1.00 . A A .  87 ARG NE   1 1 
        1  1401 1 1  87 ARG NH1  N   9.991   9.543  -6.480 1.00 . A A .  87 ARG NH1  1 1 
        1  1402 1 1  87 ARG NH2  N   8.595  10.472  -8.042 1.00 . A A .  87 ARG NH2  1 1 
        1  1403 1 1  87 ARG O    O   8.950   6.111 -12.892 1.00 . A A .  87 ARG O    1 1 
        1  1404 1 1  88 THR C    C   7.124   4.330  -9.858 1.00 . A A .  88 THR C    1 1 
        1  1405 1 1  88 THR CA   C   7.715   4.241 -11.259 1.00 . A A .  88 THR CA   1 1 
        1  1406 1 1  88 THR CB   C   7.632   2.784 -11.825 1.00 . A A .  88 THR CB   1 1 
        1  1407 1 1  88 THR CG2  C   6.210   2.401 -12.271 1.00 . A A .  88 THR CG2  1 1 
        1  1408 1 1  88 THR H    H   9.695   4.267 -10.532 1.00 . A A .  88 THR H    1 1 
        1  1409 1 1  88 THR HA   H   7.158   4.904 -11.926 1.00 . A A .  88 THR HA   1 1 
        1  1410 1 1  88 THR HB   H   7.961   2.082 -11.063 1.00 . A A .  88 THR HB   1 1 
        1  1411 1 1  88 THR HG1  H   8.871   3.519 -13.181 1.00 . A A .  88 THR HG1  1 1 
        1  1412 1 1  88 THR HG21 H   5.891   3.057 -13.069 1.00 . A A .  88 THR HG21 1 1 
        1  1413 1 1  88 THR HG22 H   5.525   2.496 -11.441 1.00 . A A .  88 THR HG22 1 1 
        1  1414 1 1  88 THR HG23 H   6.205   1.378 -12.628 1.00 . A A .  88 THR HG23 1 1 
        1  1415 1 1  88 THR N    N   9.098   4.694 -11.179 1.00 . A A .  88 THR N    1 1 
        1  1416 1 1  88 THR O    O   7.824   4.099  -8.873 1.00 . A A .  88 THR O    1 1 
        1  1417 1 1  88 THR OG1  O   8.509   2.658 -12.949 1.00 . A A .  88 THR OG1  1 1 
        1  1418 1 1  89 GLU C    C   3.841   4.039  -8.665 1.00 . A A .  89 GLU C    1 1 
        1  1419 1 1  89 GLU CA   C   5.147   4.776  -8.480 1.00 . A A .  89 GLU CA   1 1 
        1  1420 1 1  89 GLU CB   C   4.864   6.216  -7.979 1.00 . A A .  89 GLU CB   1 1 
        1  1421 1 1  89 GLU CD   C   5.781   8.538  -7.322 1.00 . A A .  89 GLU CD   1 1 
        1  1422 1 1  89 GLU CG   C   6.102   7.123  -7.853 1.00 . A A .  89 GLU CG   1 1 
        1  1423 1 1  89 GLU H    H   5.436   5.131 -10.558 1.00 . A A .  89 GLU H    1 1 
        1  1424 1 1  89 GLU HA   H   5.741   4.253  -7.730 1.00 . A A .  89 GLU HA   1 1 
        1  1425 1 1  89 GLU HB2  H   4.176   6.700  -8.671 1.00 . A A .  89 GLU HB2  1 1 
        1  1426 1 1  89 GLU HB3  H   4.386   6.158  -7.006 1.00 . A A .  89 GLU HB3  1 1 
        1  1427 1 1  89 GLU HG2  H   6.809   6.644  -7.182 1.00 . A A .  89 GLU HG2  1 1 
        1  1428 1 1  89 GLU HG3  H   6.560   7.222  -8.832 1.00 . A A .  89 GLU HG3  1 1 
        1  1429 1 1  89 GLU N    N   5.876   4.772  -9.753 1.00 . A A .  89 GLU N    1 1 
        1  1430 1 1  89 GLU O    O   3.252   4.067  -9.754 1.00 . A A .  89 GLU O    1 1 
        1  1431 1 1  89 GLU OE1  O   4.755   9.127  -7.728 1.00 . A A .  89 GLU OE1  1 1 
        1  1432 1 1  89 GLU OE2  O   6.551   9.065  -6.501 1.00 . A A .  89 GLU OE2  1 1 
        1  1433 1 1  90 VAL C    C   1.147   3.834  -6.890 1.00 . A A .  90 VAL C    1 1 
        1  1434 1 1  90 VAL CA   C   2.063   2.805  -7.552 1.00 . A A .  90 VAL CA   1 1 
        1  1435 1 1  90 VAL CB   C   2.029   1.412  -6.841 1.00 . A A .  90 VAL CB   1 1 
        1  1436 1 1  90 VAL CG1  C   2.686   0.345  -7.746 1.00 . A A .  90 VAL CG1  1 1 
        1  1437 1 1  90 VAL CG2  C   2.718   1.448  -5.464 1.00 . A A .  90 VAL CG2  1 1 
        1  1438 1 1  90 VAL H    H   3.966   3.288  -6.817 1.00 . A A .  90 VAL H    1 1 
        1  1439 1 1  90 VAL HA   H   1.725   2.654  -8.582 1.00 . A A .  90 VAL HA   1 1 
        1  1440 1 1  90 VAL HB   H   0.987   1.129  -6.694 1.00 . A A .  90 VAL HB   1 1 
        1  1441 1 1  90 VAL HG11 H   2.687  -0.611  -7.238 1.00 . A A .  90 VAL HG11 1 1 
        1  1442 1 1  90 VAL HG12 H   3.708   0.635  -7.965 1.00 . A A .  90 VAL HG12 1 1 
        1  1443 1 1  90 VAL HG13 H   2.133   0.256  -8.673 1.00 . A A .  90 VAL HG13 1 1 
        1  1444 1 1  90 VAL HG21 H   2.652   0.475  -4.995 1.00 . A A .  90 VAL HG21 1 1 
        1  1445 1 1  90 VAL HG22 H   2.226   2.178  -4.833 1.00 . A A .  90 VAL HG22 1 1 
        1  1446 1 1  90 VAL HG23 H   3.759   1.722  -5.581 1.00 . A A .  90 VAL HG23 1 1 
        1  1447 1 1  90 VAL N    N   3.395   3.370  -7.608 1.00 . A A .  90 VAL N    1 1 
        1  1448 1 1  90 VAL O    O   1.362   4.244  -5.743 1.00 . A A .  90 VAL O    1 1 
        1  1449 1 1  91 ARG C    C  -1.967   5.430  -8.132 1.00 . A A .  91 ARG C    1 1 
        1  1450 1 1  91 ARG CA   C  -0.666   5.446  -7.316 1.00 . A A .  91 ARG CA   1 1 
        1  1451 1 1  91 ARG CB   C   0.147   6.769  -7.566 1.00 . A A .  91 ARG CB   1 1 
        1  1452 1 1  91 ARG CD   C   1.633   8.174  -9.171 1.00 . A A .  91 ARG CD   1 1 
        1  1453 1 1  91 ARG CG   C   0.733   6.929  -9.003 1.00 . A A .  91 ARG CG   1 1 
        1  1454 1 1  91 ARG CZ   C   3.215   8.434 -11.136 1.00 . A A .  91 ARG CZ   1 1 
        1  1455 1 1  91 ARG H    H  -0.041   3.799  -8.487 1.00 . A A .  91 ARG H    1 1 
        1  1456 1 1  91 ARG HA   H  -0.912   5.375  -6.258 1.00 . A A .  91 ARG HA   1 1 
        1  1457 1 1  91 ARG HB2  H  -0.500   7.616  -7.365 1.00 . A A .  91 ARG HB2  1 1 
        1  1458 1 1  91 ARG HB3  H   0.971   6.797  -6.860 1.00 . A A .  91 ARG HB3  1 1 
        1  1459 1 1  91 ARG HD2  H   1.113   9.043  -8.779 1.00 . A A .  91 ARG HD2  1 1 
        1  1460 1 1  91 ARG HD3  H   2.547   8.021  -8.602 1.00 . A A .  91 ARG HD3  1 1 
        1  1461 1 1  91 ARG HE   H   1.219   8.598 -11.201 1.00 . A A .  91 ARG HE   1 1 
        1  1462 1 1  91 ARG HG2  H   1.329   6.051  -9.233 1.00 . A A .  91 ARG HG2  1 1 
        1  1463 1 1  91 ARG HG3  H  -0.087   6.990  -9.711 1.00 . A A .  91 ARG HG3  1 1 
        1  1464 1 1  91 ARG HH11 H   4.189   8.149  -9.390 1.00 . A A .  91 ARG HH11 1 1 
        1  1465 1 1  91 ARG HH12 H   5.201   8.251 -10.794 1.00 . A A .  91 ARG HH12 1 1 
        1  1466 1 1  91 ARG HH21 H   2.575   8.789 -13.026 1.00 . A A .  91 ARG HH21 1 1 
        1  1467 1 1  91 ARG HH22 H   4.290   8.623 -12.844 1.00 . A A .  91 ARG HH22 1 1 
        1  1468 1 1  91 ARG N    N   0.155   4.283  -7.658 1.00 . A A .  91 ARG N    1 1 
        1  1469 1 1  91 ARG NE   N   1.974   8.429 -10.597 1.00 . A A .  91 ARG NE   1 1 
        1  1470 1 1  91 ARG NH1  N   4.284   8.271 -10.381 1.00 . A A .  91 ARG NH1  1 1 
        1  1471 1 1  91 ARG NH2  N   3.374   8.634 -12.435 1.00 . A A .  91 ARG NH2  1 1 
        1  1472 1 1  91 ARG O    O  -1.935   5.327  -9.364 1.00 . A A .  91 ARG O    1 1 
        1  1473 1 1  92 SER C    C  -4.601   7.104  -8.555 1.00 . A A .  92 SER C    1 1 
        1  1474 1 1  92 SER CA   C  -4.429   5.654  -8.078 1.00 . A A .  92 SER CA   1 1 
        1  1475 1 1  92 SER CB   C  -5.546   5.269  -7.092 1.00 . A A .  92 SER CB   1 1 
        1  1476 1 1  92 SER H    H  -3.081   5.343  -6.464 1.00 . A A .  92 SER H    1 1 
        1  1477 1 1  92 SER HA   H  -4.478   4.992  -8.941 1.00 . A A .  92 SER HA   1 1 
        1  1478 1 1  92 SER HB2  H  -5.411   4.244  -6.783 1.00 . A A .  92 SER HB2  1 1 
        1  1479 1 1  92 SER HB3  H  -5.485   5.907  -6.219 1.00 . A A .  92 SER HB3  1 1 
        1  1480 1 1  92 SER HG   H  -7.361   4.602  -7.407 1.00 . A A .  92 SER HG   1 1 
        1  1481 1 1  92 SER N    N  -3.115   5.475  -7.436 1.00 . A A .  92 SER N    1 1 
        1  1482 1 1  92 SER O    O  -3.785   7.976  -8.246 1.00 . A A .  92 SER O    1 1 
        1  1483 1 1  92 SER OG   O  -6.846   5.388  -7.646 1.00 . A A .  92 SER OG   1 1 
        1  1484 1 1  93 ARG C    C  -6.670   9.597  -8.863 1.00 . A A .  93 ARG C    1 1 
        1  1485 1 1  93 ARG CA   C  -5.964   8.669  -9.885 1.00 . A A .  93 ARG CA   1 1 
        1  1486 1 1  93 ARG CB   C  -6.788   8.479 -11.192 1.00 . A A .  93 ARG CB   1 1 
        1  1487 1 1  93 ARG CD   C  -8.730   7.274 -12.367 1.00 . A A .  93 ARG CD   1 1 
        1  1488 1 1  93 ARG CG   C  -8.156   7.765 -11.027 1.00 . A A .  93 ARG CG   1 1 
        1  1489 1 1  93 ARG CZ   C  -7.930   5.846 -14.261 1.00 . A A .  93 ARG CZ   1 1 
        1  1490 1 1  93 ARG H    H  -6.327   6.623  -9.437 1.00 . A A .  93 ARG H    1 1 
        1  1491 1 1  93 ARG HA   H  -5.006   9.120 -10.152 1.00 . A A .  93 ARG HA   1 1 
        1  1492 1 1  93 ARG HB2  H  -6.971   9.456 -11.633 1.00 . A A .  93 ARG HB2  1 1 
        1  1493 1 1  93 ARG HB3  H  -6.184   7.902 -11.889 1.00 . A A .  93 ARG HB3  1 1 
        1  1494 1 1  93 ARG HD2  H  -9.717   6.860 -12.195 1.00 . A A .  93 ARG HD2  1 1 
        1  1495 1 1  93 ARG HD3  H  -8.813   8.117 -13.046 1.00 . A A .  93 ARG HD3  1 1 
        1  1496 1 1  93 ARG HE   H  -7.230   5.789 -12.390 1.00 . A A .  93 ARG HE   1 1 
        1  1497 1 1  93 ARG HG2  H  -8.031   6.910 -10.370 1.00 . A A .  93 ARG HG2  1 1 
        1  1498 1 1  93 ARG HG3  H  -8.858   8.458 -10.574 1.00 . A A .  93 ARG HG3  1 1 
        1  1499 1 1  93 ARG HH11 H  -9.409   7.127 -14.806 1.00 . A A .  93 ARG HH11 1 1 
        1  1500 1 1  93 ARG HH12 H  -8.815   6.096 -16.064 1.00 . A A .  93 ARG HH12 1 1 
        1  1501 1 1  93 ARG HH21 H  -6.482   4.448 -14.051 1.00 . A A .  93 ARG HH21 1 1 
        1  1502 1 1  93 ARG HH22 H  -7.144   4.595 -15.651 1.00 . A A .  93 ARG HH22 1 1 
        1  1503 1 1  93 ARG N    N  -5.683   7.354  -9.295 1.00 . A A .  93 ARG N    1 1 
        1  1504 1 1  93 ARG NE   N  -7.880   6.234 -12.979 1.00 . A A .  93 ARG NE   1 1 
        1  1505 1 1  93 ARG NH1  N  -8.788   6.400 -15.109 1.00 . A A .  93 ARG NH1  1 1 
        1  1506 1 1  93 ARG NH2  N  -7.125   4.882 -14.686 1.00 . A A .  93 ARG NH2  1 1 
        1  1507 1 1  93 ARG O    O  -6.260  10.751  -8.681 1.00 . A A .  93 ARG O    1 1 
        1  1508 1 1  94 THR C    C  -7.981  10.009  -5.866 1.00 . A A .  94 THR C    1 1 
        1  1509 1 1  94 THR CA   C  -8.568   9.885  -7.296 1.00 . A A .  94 THR CA   1 1 
        1  1510 1 1  94 THR CB   C -10.016   9.282  -7.247 1.00 . A A .  94 THR CB   1 1 
        1  1511 1 1  94 THR CG2  C -11.004  10.199  -6.498 1.00 . A A .  94 THR CG2  1 1 
        1  1512 1 1  94 THR H    H  -7.933   8.138  -8.343 1.00 . A A .  94 THR H    1 1 
        1  1513 1 1  94 THR HA   H  -8.642  10.888  -7.719 1.00 . A A .  94 THR HA   1 1 
        1  1514 1 1  94 THR HB   H  -9.980   8.326  -6.733 1.00 . A A .  94 THR HB   1 1 
        1  1515 1 1  94 THR HG1  H -11.178   9.692  -8.795 1.00 . A A .  94 THR HG1  1 1 
        1  1516 1 1  94 THR HG21 H -11.061  11.158  -6.997 1.00 . A A .  94 THR HG21 1 1 
        1  1517 1 1  94 THR HG22 H -10.668  10.345  -5.479 1.00 . A A .  94 THR HG22 1 1 
        1  1518 1 1  94 THR HG23 H -11.987   9.742  -6.486 1.00 . A A .  94 THR HG23 1 1 
        1  1519 1 1  94 THR N    N  -7.716   9.078  -8.189 1.00 . A A .  94 THR N    1 1 
        1  1520 1 1  94 THR O    O  -7.528  11.091  -5.470 1.00 . A A .  94 THR O    1 1 
        1  1521 1 1  94 THR OG1  O -10.488   9.054  -8.587 1.00 . A A .  94 THR OG1  1 1 
        1  1522 1 1  95 ALA C    C  -6.471   8.106  -3.228 1.00 . A A .  95 ALA C    1 1 
        1  1523 1 1  95 ALA CA   C  -7.716   8.903  -3.657 1.00 . A A .  95 ALA CA   1 1 
        1  1524 1 1  95 ALA CB   C  -8.968   8.389  -2.933 1.00 . A A .  95 ALA CB   1 1 
        1  1525 1 1  95 ALA H    H  -8.030   8.028  -5.587 1.00 . A A .  95 ALA H    1 1 
        1  1526 1 1  95 ALA HA   H  -7.570   9.944  -3.349 1.00 . A A .  95 ALA HA   1 1 
        1  1527 1 1  95 ALA HB1  H  -8.833   8.470  -1.863 1.00 . A A .  95 ALA HB1  1 1 
        1  1528 1 1  95 ALA HB2  H  -9.138   7.352  -3.195 1.00 . A A .  95 ALA HB2  1 1 
        1  1529 1 1  95 ALA HB3  H  -9.835   8.974  -3.227 1.00 . A A .  95 ALA HB3  1 1 
        1  1530 1 1  95 ALA N    N  -7.941   8.887  -5.128 1.00 . A A .  95 ALA N    1 1 
        1  1531 1 1  95 ALA O    O  -5.639   8.606  -2.465 1.00 . A A .  95 ALA O    1 1 
        1  1532 1 1  96 ASP C    C  -3.868   6.233  -3.651 1.00 . A A .  96 ASP C    1 1 
        1  1533 1 1  96 ASP CA   C  -5.329   5.865  -3.263 1.00 . A A .  96 ASP CA   1 1 
        1  1534 1 1  96 ASP CB   C  -5.634   4.416  -3.760 1.00 . A A .  96 ASP CB   1 1 
        1  1535 1 1  96 ASP CG   C  -7.120   4.027  -3.744 1.00 . A A .  96 ASP CG   1 1 
        1  1536 1 1  96 ASP H    H  -6.944   6.595  -4.466 1.00 . A A .  96 ASP H    1 1 
        1  1537 1 1  96 ASP HA   H  -5.386   5.866  -2.178 1.00 . A A .  96 ASP HA   1 1 
        1  1538 1 1  96 ASP HB2  H  -5.263   4.304  -4.771 1.00 . A A .  96 ASP HB2  1 1 
        1  1539 1 1  96 ASP HB3  H  -5.089   3.715  -3.130 1.00 . A A .  96 ASP HB3  1 1 
        1  1540 1 1  96 ASP N    N  -6.337   6.863  -3.744 1.00 . A A .  96 ASP N    1 1 
        1  1541 1 1  96 ASP O    O  -2.992   5.395  -3.569 1.00 . A A .  96 ASP O    1 1 
        1  1542 1 1  96 ASP OD1  O  -7.619   3.579  -2.702 1.00 . A A .  96 ASP OD1  1 1 
        1  1543 1 1  96 ASP OD2  O  -7.798   4.183  -4.785 1.00 . A A .  96 ASP OD2  1 1 
        1  1544 1 1  97 SER C    C  -1.148   7.814  -3.436 1.00 . A A .  97 SER C    1 1 
        1  1545 1 1  97 SER CA   C  -2.247   7.925  -4.540 1.00 . A A .  97 SER CA   1 1 
        1  1546 1 1  97 SER CB   C  -2.350   9.393  -5.019 1.00 . A A .  97 SER CB   1 1 
        1  1547 1 1  97 SER H    H  -4.325   8.128  -4.128 1.00 . A A .  97 SER H    1 1 
        1  1548 1 1  97 SER HA   H  -1.955   7.308  -5.381 1.00 . A A .  97 SER HA   1 1 
        1  1549 1 1  97 SER HB2  H  -2.570  10.041  -4.180 1.00 . A A .  97 SER HB2  1 1 
        1  1550 1 1  97 SER HB3  H  -1.411   9.702  -5.467 1.00 . A A .  97 SER HB3  1 1 
        1  1551 1 1  97 SER HG   H  -3.053   9.200  -6.828 1.00 . A A .  97 SER HG   1 1 
        1  1552 1 1  97 SER N    N  -3.598   7.478  -4.095 1.00 . A A .  97 SER N    1 1 
        1  1553 1 1  97 SER O    O   0.030   8.062  -3.716 1.00 . A A .  97 SER O    1 1 
        1  1554 1 1  97 SER OG   O  -3.372   9.538  -5.983 1.00 . A A .  97 SER OG   1 1 
        1  1555 1 1  98 HIS C    C   0.201   6.089  -0.990 1.00 . A A .  98 HIS C    1 1 
        1  1556 1 1  98 HIS CA   C  -0.642   7.377  -1.036 1.00 . A A .  98 HIS CA   1 1 
        1  1557 1 1  98 HIS CB   C  -1.457   7.491   0.289 1.00 . A A .  98 HIS CB   1 1 
        1  1558 1 1  98 HIS CD2  C  -3.909   8.268   0.045 1.00 . A A .  98 HIS CD2  1 1 
        1  1559 1 1  98 HIS CE1  C  -3.606  10.416   0.311 1.00 . A A .  98 HIS CE1  1 1 
        1  1560 1 1  98 HIS CG   C  -2.591   8.468   0.246 1.00 . A A .  98 HIS CG   1 1 
        1  1561 1 1  98 HIS H    H  -2.465   7.154  -2.074 1.00 . A A .  98 HIS H    1 1 
        1  1562 1 1  98 HIS HA   H   0.032   8.226  -1.097 1.00 . A A .  98 HIS HA   1 1 
        1  1563 1 1  98 HIS HB2  H  -1.883   6.524   0.533 1.00 . A A .  98 HIS HB2  1 1 
        1  1564 1 1  98 HIS HB3  H  -0.797   7.790   1.099 1.00 . A A .  98 HIS HB3  1 1 
        1  1565 1 1  98 HIS HD1  H  -1.579  10.289   0.556 1.00 . A A .  98 HIS HD1  1 1 
        1  1566 1 1  98 HIS HD2  H  -4.394   7.313  -0.122 1.00 . A A .  98 HIS HD2  1 1 
        1  1567 1 1  98 HIS HE1  H  -3.782  11.485   0.386 1.00 . A A .  98 HIS HE1  1 1 
        1  1568 1 1  98 HIS HE2  H  -5.420   9.682  -0.272 1.00 . A A .  98 HIS HE2  1 1 
        1  1569 1 1  98 HIS N    N  -1.538   7.423  -2.202 1.00 . A A .  98 HIS N    1 1 
        1  1570 1 1  98 HIS ND1  N  -2.433   9.824   0.407 1.00 . A A .  98 HIS ND1  1 1 
        1  1571 1 1  98 HIS NE2  N  -4.524   9.495   0.091 1.00 . A A .  98 HIS NE2  1 1 
        1  1572 1 1  98 HIS O    O   1.090   6.015  -0.149 1.00 . A A .  98 HIS O    1 1 
        1  1573 1 1  99 LEU C    C   2.015   3.723  -1.573 1.00 . A A .  99 LEU C    1 1 
        1  1574 1 1  99 LEU CA   C   0.481   3.719  -1.805 1.00 . A A .  99 LEU CA   1 1 
        1  1575 1 1  99 LEU CB   C   0.178   2.873  -3.089 1.00 . A A .  99 LEU CB   1 1 
        1  1576 1 1  99 LEU CD1  C  -1.435   1.943  -4.857 1.00 . A A .  99 LEU CD1  1 1 
        1  1577 1 1  99 LEU CD2  C  -2.305   2.583  -2.563 1.00 . A A .  99 LEU CD2  1 1 
        1  1578 1 1  99 LEU CG   C  -1.273   2.892  -3.650 1.00 . A A .  99 LEU CG   1 1 
        1  1579 1 1  99 LEU H    H  -0.716   5.299  -2.613 1.00 . A A .  99 LEU H    1 1 
        1  1580 1 1  99 LEU HA   H   0.009   3.232  -0.959 1.00 . A A .  99 LEU HA   1 1 
        1  1581 1 1  99 LEU HB2  H   0.836   3.219  -3.881 1.00 . A A .  99 LEU HB2  1 1 
        1  1582 1 1  99 LEU HB3  H   0.439   1.838  -2.876 1.00 . A A .  99 LEU HB3  1 1 
        1  1583 1 1  99 LEU HD11 H  -0.748   2.229  -5.642 1.00 . A A .  99 LEU HD11 1 1 
        1  1584 1 1  99 LEU HD12 H  -2.448   2.008  -5.235 1.00 . A A .  99 LEU HD12 1 1 
        1  1585 1 1  99 LEU HD13 H  -1.231   0.923  -4.553 1.00 . A A .  99 LEU HD13 1 1 
        1  1586 1 1  99 LEU HD21 H  -3.298   2.593  -2.995 1.00 . A A .  99 LEU HD21 1 1 
        1  1587 1 1  99 LEU HD22 H  -2.252   3.328  -1.783 1.00 . A A .  99 LEU HD22 1 1 
        1  1588 1 1  99 LEU HD23 H  -2.110   1.607  -2.144 1.00 . A A .  99 LEU HD23 1 1 
        1  1589 1 1  99 LEU HG   H  -1.479   3.895  -4.011 1.00 . A A .  99 LEU HG   1 1 
        1  1590 1 1  99 LEU N    N  -0.087   5.100  -1.888 1.00 . A A .  99 LEU N    1 1 
        1  1591 1 1  99 LEU O    O   2.489   3.496  -0.451 1.00 . A A .  99 LEU O    1 1 
        1  1592 1 1 100 GLY C    C   4.898   4.060  -3.921 1.00 . A A . 100 GLY C    1 1 
        1  1593 1 1 100 GLY CA   C   4.232   3.987  -2.560 1.00 . A A . 100 GLY CA   1 1 
        1  1594 1 1 100 GLY H    H   2.339   4.288  -3.472 1.00 . A A . 100 GLY H    1 1 
        1  1595 1 1 100 GLY HA2  H   4.580   4.820  -1.964 1.00 . A A . 100 GLY HA2  1 1 
        1  1596 1 1 100 GLY HA3  H   4.534   3.061  -2.074 1.00 . A A . 100 GLY HA3  1 1 
        1  1597 1 1 100 GLY N    N   2.779   4.037  -2.630 1.00 . A A . 100 GLY N    1 1 
        1  1598 1 1 100 GLY O    O   4.283   4.477  -4.912 1.00 . A A . 100 GLY O    1 1 
        1  1599 1 1 101 HIS C    C   7.585   2.375  -5.485 1.00 . A A . 101 HIS C    1 1 
        1  1600 1 1 101 HIS CA   C   7.064   3.772  -5.116 1.00 . A A . 101 HIS CA   1 1 
        1  1601 1 1 101 HIS CB   C   8.250   4.722  -4.775 1.00 . A A . 101 HIS CB   1 1 
        1  1602 1 1 101 HIS CD2  C   7.972   6.187  -2.633 1.00 . A A . 101 HIS CD2  1 1 
        1  1603 1 1 101 HIS CE1  C   6.897   7.863  -3.532 1.00 . A A . 101 HIS CE1  1 1 
        1  1604 1 1 101 HIS CG   C   7.847   5.927  -3.962 1.00 . A A . 101 HIS CG   1 1 
        1  1605 1 1 101 HIS H    H   6.518   3.196  -3.159 1.00 . A A . 101 HIS H    1 1 
        1  1606 1 1 101 HIS HA   H   6.501   4.178  -5.952 1.00 . A A . 101 HIS HA   1 1 
        1  1607 1 1 101 HIS HB2  H   9.002   4.180  -4.211 1.00 . A A . 101 HIS HB2  1 1 
        1  1608 1 1 101 HIS HB3  H   8.699   5.080  -5.694 1.00 . A A . 101 HIS HB3  1 1 
        1  1609 1 1 101 HIS HD1  H   6.940   7.123  -5.434 1.00 . A A . 101 HIS HD1  1 1 
        1  1610 1 1 101 HIS HD2  H   8.463   5.559  -1.902 1.00 . A A . 101 HIS HD2  1 1 
        1  1611 1 1 101 HIS HE1  H   6.371   8.798  -3.665 1.00 . A A . 101 HIS HE1  1 1 
        1  1612 1 1 101 HIS HE2  H   7.537   7.956  -1.600 1.00 . A A . 101 HIS HE2  1 1 
        1  1613 1 1 101 HIS N    N   6.169   3.646  -3.953 1.00 . A A . 101 HIS N    1 1 
        1  1614 1 1 101 HIS ND1  N   7.168   6.998  -4.489 1.00 . A A . 101 HIS ND1  1 1 
        1  1615 1 1 101 HIS NE2  N   7.372   7.397  -2.393 1.00 . A A . 101 HIS NE2  1 1 
        1  1616 1 1 101 HIS O    O   7.795   1.545  -4.599 1.00 . A A . 101 HIS O    1 1 
        1  1617 1 1 102 VAL C    C   9.435   1.017  -8.271 1.00 . A A . 102 VAL C    1 1 
        1  1618 1 1 102 VAL CA   C   8.292   0.813  -7.270 1.00 . A A . 102 VAL CA   1 1 
        1  1619 1 1 102 VAL CB   C   7.165  -0.101  -7.884 1.00 . A A . 102 VAL CB   1 1 
        1  1620 1 1 102 VAL CG1  C   6.024  -0.333  -6.875 1.00 . A A . 102 VAL CG1  1 1 
        1  1621 1 1 102 VAL CG2  C   6.611   0.467  -9.194 1.00 . A A . 102 VAL CG2  1 1 
        1  1622 1 1 102 VAL H    H   7.625   2.816  -7.434 1.00 . A A . 102 VAL H    1 1 
        1  1623 1 1 102 VAL HA   H   8.709   0.286  -6.410 1.00 . A A . 102 VAL HA   1 1 
        1  1624 1 1 102 VAL HB   H   7.613  -1.074  -8.101 1.00 . A A . 102 VAL HB   1 1 
        1  1625 1 1 102 VAL HG11 H   5.565   0.617  -6.622 1.00 . A A . 102 VAL HG11 1 1 
        1  1626 1 1 102 VAL HG12 H   6.416  -0.788  -5.975 1.00 . A A . 102 VAL HG12 1 1 
        1  1627 1 1 102 VAL HG13 H   5.278  -0.985  -7.306 1.00 . A A . 102 VAL HG13 1 1 
        1  1628 1 1 102 VAL HG21 H   5.838  -0.187  -9.580 1.00 . A A . 102 VAL HG21 1 1 
        1  1629 1 1 102 VAL HG22 H   7.413   0.534  -9.921 1.00 . A A . 102 VAL HG22 1 1 
        1  1630 1 1 102 VAL HG23 H   6.197   1.451  -9.026 1.00 . A A . 102 VAL HG23 1 1 
        1  1631 1 1 102 VAL N    N   7.783   2.109  -6.785 1.00 . A A . 102 VAL N    1 1 
        1  1632 1 1 102 VAL O    O   9.401   1.923  -9.107 1.00 . A A . 102 VAL O    1 1 
        1  1633 1 1 103 PHE C    C  11.985  -0.882  -9.819 1.00 . A A . 103 PHE C    1 1 
        1  1634 1 1 103 PHE CA   C  11.712   0.344  -8.936 1.00 . A A . 103 PHE CA   1 1 
        1  1635 1 1 103 PHE CB   C  12.891   0.602  -7.962 1.00 . A A . 103 PHE CB   1 1 
        1  1636 1 1 103 PHE CD1  C  13.177   3.124  -7.726 1.00 . A A . 103 PHE CD1  1 1 
        1  1637 1 1 103 PHE CD2  C  12.183   1.934  -5.899 1.00 . A A . 103 PHE CD2  1 1 
        1  1638 1 1 103 PHE CE1  C  13.036   4.310  -7.029 1.00 . A A . 103 PHE CE1  1 1 
        1  1639 1 1 103 PHE CE2  C  12.047   3.122  -5.204 1.00 . A A . 103 PHE CE2  1 1 
        1  1640 1 1 103 PHE CG   C  12.753   1.912  -7.173 1.00 . A A . 103 PHE CG   1 1 
        1  1641 1 1 103 PHE CZ   C  12.470   4.310  -5.768 1.00 . A A . 103 PHE CZ   1 1 
        1  1642 1 1 103 PHE H    H  10.430  -0.521  -7.486 1.00 . A A . 103 PHE H    1 1 
        1  1643 1 1 103 PHE HA   H  11.603   1.213  -9.586 1.00 . A A . 103 PHE HA   1 1 
        1  1644 1 1 103 PHE HB2  H  12.958  -0.217  -7.255 1.00 . A A . 103 PHE HB2  1 1 
        1  1645 1 1 103 PHE HB3  H  13.817   0.649  -8.527 1.00 . A A . 103 PHE HB3  1 1 
        1  1646 1 1 103 PHE HD1  H  13.622   3.132  -8.713 1.00 . A A . 103 PHE HD1  1 1 
        1  1647 1 1 103 PHE HD2  H  11.848   1.005  -5.450 1.00 . A A . 103 PHE HD2  1 1 
        1  1648 1 1 103 PHE HE1  H  13.372   5.239  -7.470 1.00 . A A . 103 PHE HE1  1 1 
        1  1649 1 1 103 PHE HE2  H  11.606   3.120  -4.214 1.00 . A A . 103 PHE HE2  1 1 
        1  1650 1 1 103 PHE HZ   H  12.358   5.237  -5.224 1.00 . A A . 103 PHE HZ   1 1 
        1  1651 1 1 103 PHE N    N  10.471   0.186  -8.157 1.00 . A A . 103 PHE N    1 1 
        1  1652 1 1 103 PHE O    O  11.753  -2.016  -9.406 1.00 . A A . 103 PHE O    1 1 
        1  1653 1 1 104 ASN C    C  14.199  -2.413 -11.651 1.00 . A A . 104 ASN C    1 1 
        1  1654 1 1 104 ASN CA   C  12.890  -1.667 -12.020 1.00 . A A . 104 ASN CA   1 1 
        1  1655 1 1 104 ASN CB   C  13.025  -1.008 -13.420 1.00 . A A . 104 ASN CB   1 1 
        1  1656 1 1 104 ASN CG   C  11.741  -0.308 -13.878 1.00 . A A . 104 ASN CG   1 1 
        1  1657 1 1 104 ASN H    H  12.727   0.311 -11.248 1.00 . A A . 104 ASN H    1 1 
        1  1658 1 1 104 ASN HA   H  12.078  -2.388 -12.049 1.00 . A A . 104 ASN HA   1 1 
        1  1659 1 1 104 ASN HB2  H  13.820  -0.272 -13.389 1.00 . A A . 104 ASN HB2  1 1 
        1  1660 1 1 104 ASN HB3  H  13.284  -1.764 -14.153 1.00 . A A . 104 ASN HB3  1 1 
        1  1661 1 1 104 ASN HD21 H  11.157  -1.910 -14.908 1.00 . A A . 104 ASN HD21 1 1 
        1  1662 1 1 104 ASN HD22 H  10.095  -0.551 -14.970 1.00 . A A . 104 ASN HD22 1 1 
        1  1663 1 1 104 ASN N    N  12.541  -0.627 -11.019 1.00 . A A . 104 ASN N    1 1 
        1  1664 1 1 104 ASN ND2  N  10.914  -0.993 -14.663 1.00 . A A . 104 ASN ND2  1 1 
        1  1665 1 1 104 ASN O    O  14.677  -3.269 -12.406 1.00 . A A . 104 ASN O    1 1 
        1  1666 1 1 104 ASN OD1  O  11.506   0.856 -13.541 1.00 . A A . 104 ASN OD1  1 1 
        1  1667 1 1 105 ASP C    C  15.630  -3.924  -9.069 1.00 . A A . 105 ASP C    1 1 
        1  1668 1 1 105 ASP CA   C  15.981  -2.686  -9.931 1.00 . A A . 105 ASP CA   1 1 
        1  1669 1 1 105 ASP CB   C  16.727  -1.599  -9.103 1.00 . A A . 105 ASP CB   1 1 
        1  1670 1 1 105 ASP CG   C  18.079  -2.049  -8.521 1.00 . A A . 105 ASP CG   1 1 
        1  1671 1 1 105 ASP H    H  14.273  -1.445  -9.916 1.00 . A A . 105 ASP H    1 1 
        1  1672 1 1 105 ASP HA   H  16.612  -2.998 -10.762 1.00 . A A . 105 ASP HA   1 1 
        1  1673 1 1 105 ASP HB2  H  16.908  -0.739  -9.743 1.00 . A A . 105 ASP HB2  1 1 
        1  1674 1 1 105 ASP HB3  H  16.083  -1.279  -8.287 1.00 . A A . 105 ASP HB3  1 1 
        1  1675 1 1 105 ASP N    N  14.748  -2.087 -10.472 1.00 . A A . 105 ASP N    1 1 
        1  1676 1 1 105 ASP O    O  16.500  -4.741  -8.753 1.00 . A A . 105 ASP O    1 1 
        1  1677 1 1 105 ASP OD1  O  19.066  -2.168  -9.279 1.00 . A A . 105 ASP OD1  1 1 
        1  1678 1 1 105 ASP OD2  O  18.169  -2.257  -7.297 1.00 . A A . 105 ASP OD2  1 1 
        1  1679 1 1 106 GLY C    C  13.241  -6.275  -8.779 1.00 . A A . 106 GLY C    1 1 
        1  1680 1 1 106 GLY CA   C  13.834  -5.165  -7.904 1.00 . A A . 106 GLY CA   1 1 
        1  1681 1 1 106 GLY H    H  13.716  -3.348  -9.001 1.00 . A A . 106 GLY H    1 1 
        1  1682 1 1 106 GLY HA2  H  14.637  -5.562  -7.291 1.00 . A A . 106 GLY HA2  1 1 
        1  1683 1 1 106 GLY HA3  H  13.058  -4.796  -7.246 1.00 . A A . 106 GLY HA3  1 1 
        1  1684 1 1 106 GLY N    N  14.336  -4.041  -8.701 1.00 . A A . 106 GLY N    1 1 
        1  1685 1 1 106 GLY O    O  12.389  -5.976  -9.614 1.00 . A A . 106 GLY O    1 1 
        1  1686 1 1 107 PRO C    C  11.662  -9.013  -9.080 1.00 . A A . 107 PRO C    1 1 
        1  1687 1 1 107 PRO CA   C  13.140  -8.707  -9.424 1.00 . A A . 107 PRO CA   1 1 
        1  1688 1 1 107 PRO CB   C  14.064  -9.904  -9.043 1.00 . A A . 107 PRO CB   1 1 
        1  1689 1 1 107 PRO CD   C  14.711  -8.027  -7.677 1.00 . A A . 107 PRO CD   1 1 
        1  1690 1 1 107 PRO CG   C  15.227  -9.295  -8.312 1.00 . A A . 107 PRO CG   1 1 
        1  1691 1 1 107 PRO HA   H  13.227  -8.507 -10.494 1.00 . A A . 107 PRO HA   1 1 
        1  1692 1 1 107 PRO HB2  H  13.529 -10.612  -8.413 1.00 . A A . 107 PRO HB2  1 1 
        1  1693 1 1 107 PRO HB3  H  14.390 -10.417  -9.944 1.00 . A A . 107 PRO HB3  1 1 
        1  1694 1 1 107 PRO HD2  H  14.277  -8.230  -6.701 1.00 . A A . 107 PRO HD2  1 1 
        1  1695 1 1 107 PRO HD3  H  15.508  -7.295  -7.584 1.00 . A A . 107 PRO HD3  1 1 
        1  1696 1 1 107 PRO HG2  H  15.590  -9.978  -7.549 1.00 . A A . 107 PRO HG2  1 1 
        1  1697 1 1 107 PRO HG3  H  16.029  -9.067  -9.010 1.00 . A A . 107 PRO HG3  1 1 
        1  1698 1 1 107 PRO N    N  13.677  -7.568  -8.628 1.00 . A A . 107 PRO N    1 1 
        1  1699 1 1 107 PRO O    O  11.310  -9.102  -7.899 1.00 . A A . 107 PRO O    1 1 
        1  1700 1 1 108 GLY C    C   8.726  -9.955 -11.212 1.00 . A A . 108 GLY C    1 1 
        1  1701 1 1 108 GLY CA   C   9.394  -9.460  -9.937 1.00 . A A . 108 GLY CA   1 1 
        1  1702 1 1 108 GLY H    H  11.189  -9.122 -11.024 1.00 . A A . 108 GLY H    1 1 
        1  1703 1 1 108 GLY HA2  H   9.261 -10.213  -9.169 1.00 . A A . 108 GLY HA2  1 1 
        1  1704 1 1 108 GLY HA3  H   8.904  -8.549  -9.618 1.00 . A A . 108 GLY HA3  1 1 
        1  1705 1 1 108 GLY N    N  10.824  -9.186 -10.116 1.00 . A A . 108 GLY N    1 1 
        1  1706 1 1 108 GLY O    O   9.402 -10.059 -12.247 1.00 . A A . 108 GLY O    1 1 
        1  1707 1 1 109 PRO C    C   6.735  -9.718 -13.567 1.00 . A A . 109 PRO C    1 1 
        1  1708 1 1 109 PRO CA   C   6.590 -10.686 -12.375 1.00 . A A . 109 PRO CA   1 1 
        1  1709 1 1 109 PRO CB   C   5.127 -10.696 -11.850 1.00 . A A . 109 PRO CB   1 1 
        1  1710 1 1 109 PRO CD   C   6.524 -10.233  -9.954 1.00 . A A . 109 PRO CD   1 1 
        1  1711 1 1 109 PRO CG   C   5.261 -10.948 -10.382 1.00 . A A . 109 PRO CG   1 1 
        1  1712 1 1 109 PRO HA   H   6.877 -11.683 -12.686 1.00 . A A . 109 PRO HA   1 1 
        1  1713 1 1 109 PRO HB2  H   4.645  -9.740 -12.044 1.00 . A A . 109 PRO HB2  1 1 
        1  1714 1 1 109 PRO HB3  H   4.566 -11.485 -12.341 1.00 . A A . 109 PRO HB3  1 1 
        1  1715 1 1 109 PRO HD2  H   6.308  -9.209  -9.656 1.00 . A A . 109 PRO HD2  1 1 
        1  1716 1 1 109 PRO HD3  H   7.003 -10.762  -9.136 1.00 . A A . 109 PRO HD3  1 1 
        1  1717 1 1 109 PRO HG2  H   4.397 -10.552  -9.857 1.00 . A A . 109 PRO HG2  1 1 
        1  1718 1 1 109 PRO HG3  H   5.348 -12.014 -10.192 1.00 . A A . 109 PRO HG3  1 1 
        1  1719 1 1 109 PRO N    N   7.380 -10.262 -11.177 1.00 . A A . 109 PRO N    1 1 
        1  1720 1 1 109 PRO O    O   6.850 -10.140 -14.726 1.00 . A A . 109 PRO O    1 1 
        1  1721 1 1 110 ASN C    C   8.402  -6.806 -14.063 1.00 . A A . 110 ASN C    1 1 
        1  1722 1 1 110 ASN CA   C   6.959  -7.340 -14.232 1.00 . A A . 110 ASN CA   1 1 
        1  1723 1 1 110 ASN CB   C   5.914  -6.207 -14.054 1.00 . A A . 110 ASN CB   1 1 
        1  1724 1 1 110 ASN CG   C   6.019  -5.106 -15.109 1.00 . A A . 110 ASN CG   1 1 
        1  1725 1 1 110 ASN H    H   6.503  -8.172 -12.330 1.00 . A A . 110 ASN H    1 1 
        1  1726 1 1 110 ASN HA   H   6.861  -7.754 -15.233 1.00 . A A . 110 ASN HA   1 1 
        1  1727 1 1 110 ASN HB2  H   4.921  -6.631 -14.125 1.00 . A A . 110 ASN HB2  1 1 
        1  1728 1 1 110 ASN HB3  H   6.032  -5.764 -13.067 1.00 . A A . 110 ASN HB3  1 1 
        1  1729 1 1 110 ASN HD21 H   5.343  -3.770 -13.819 1.00 . A A . 110 ASN HD21 1 1 
        1  1730 1 1 110 ASN HD22 H   5.698  -3.181 -15.399 1.00 . A A . 110 ASN HD22 1 1 
        1  1731 1 1 110 ASN N    N   6.702  -8.417 -13.257 1.00 . A A . 110 ASN N    1 1 
        1  1732 1 1 110 ASN ND2  N   5.657  -3.899 -14.741 1.00 . A A . 110 ASN ND2  1 1 
        1  1733 1 1 110 ASN O    O   8.973  -6.194 -14.979 1.00 . A A . 110 ASN O    1 1 
        1  1734 1 1 110 ASN OD1  O   6.431  -5.343 -16.247 1.00 . A A . 110 ASN OD1  1 1 
        1  1735 1 1 111 GLY C    C  10.318  -5.297 -11.773 1.00 . A A . 111 GLY C    1 1 
        1  1736 1 1 111 GLY CA   C  10.332  -6.612 -12.535 1.00 . A A . 111 GLY CA   1 1 
        1  1737 1 1 111 GLY H    H   8.488  -7.594 -12.226 1.00 . A A . 111 GLY H    1 1 
        1  1738 1 1 111 GLY HA2  H  10.793  -7.366 -11.912 1.00 . A A . 111 GLY HA2  1 1 
        1  1739 1 1 111 GLY HA3  H  10.928  -6.499 -13.436 1.00 . A A . 111 GLY HA3  1 1 
        1  1740 1 1 111 GLY N    N   8.985  -7.069 -12.881 1.00 . A A . 111 GLY N    1 1 
        1  1741 1 1 111 GLY O    O  11.220  -4.469 -11.930 1.00 . A A . 111 GLY O    1 1 
        1  1742 1 1 112 LEU C    C   9.285  -4.271  -8.610 1.00 . A A . 112 LEU C    1 1 
        1  1743 1 1 112 LEU CA   C   9.129  -3.910 -10.093 1.00 . A A . 112 LEU CA   1 1 
        1  1744 1 1 112 LEU CB   C   7.768  -3.226 -10.360 1.00 . A A . 112 LEU CB   1 1 
        1  1745 1 1 112 LEU CD1  C   6.213  -1.951 -11.922 1.00 . A A . 112 LEU CD1  1 1 
        1  1746 1 1 112 LEU CD2  C   8.708  -1.539 -12.059 1.00 . A A . 112 LEU CD2  1 1 
        1  1747 1 1 112 LEU CG   C   7.601  -2.583 -11.774 1.00 . A A . 112 LEU CG   1 1 
        1  1748 1 1 112 LEU H    H   8.645  -5.843 -10.819 1.00 . A A . 112 LEU H    1 1 
        1  1749 1 1 112 LEU HA   H   9.924  -3.208 -10.353 1.00 . A A . 112 LEU HA   1 1 
        1  1750 1 1 112 LEU HB2  H   6.982  -3.966 -10.226 1.00 . A A . 112 LEU HB2  1 1 
        1  1751 1 1 112 LEU HB3  H   7.625  -2.445  -9.617 1.00 . A A . 112 LEU HB3  1 1 
        1  1752 1 1 112 LEU HD11 H   6.120  -1.502 -12.902 1.00 . A A . 112 LEU HD11 1 1 
        1  1753 1 1 112 LEU HD12 H   6.074  -1.192 -11.166 1.00 . A A . 112 LEU HD12 1 1 
        1  1754 1 1 112 LEU HD13 H   5.455  -2.714 -11.808 1.00 . A A . 112 LEU HD13 1 1 
        1  1755 1 1 112 LEU HD21 H   8.666  -0.745 -11.322 1.00 . A A . 112 LEU HD21 1 1 
        1  1756 1 1 112 LEU HD22 H   8.568  -1.118 -13.048 1.00 . A A . 112 LEU HD22 1 1 
        1  1757 1 1 112 LEU HD23 H   9.677  -2.014 -12.015 1.00 . A A . 112 LEU HD23 1 1 
        1  1758 1 1 112 LEU HG   H   7.684  -3.360 -12.524 1.00 . A A . 112 LEU HG   1 1 
        1  1759 1 1 112 LEU N    N   9.286  -5.112 -10.932 1.00 . A A . 112 LEU N    1 1 
        1  1760 1 1 112 LEU O    O   8.978  -5.399  -8.204 1.00 . A A . 112 LEU O    1 1 
        1  1761 1 1 113 ARG C    C   8.870  -2.764  -5.591 1.00 . A A . 113 ARG C    1 1 
        1  1762 1 1 113 ARG CA   C   9.984  -3.473  -6.362 1.00 . A A . 113 ARG CA   1 1 
        1  1763 1 1 113 ARG CB   C  11.378  -2.885  -5.990 1.00 . A A . 113 ARG CB   1 1 
        1  1764 1 1 113 ARG CD   C  13.117  -2.334  -4.179 1.00 . A A . 113 ARG CD   1 1 
        1  1765 1 1 113 ARG CG   C  11.719  -2.902  -4.481 1.00 . A A . 113 ARG CG   1 1 
        1  1766 1 1 113 ARG CZ   C  15.278  -2.779  -5.391 1.00 . A A . 113 ARG CZ   1 1 
        1  1767 1 1 113 ARG H    H   9.913  -2.414  -8.210 1.00 . A A . 113 ARG H    1 1 
        1  1768 1 1 113 ARG HA   H   9.969  -4.535  -6.125 1.00 . A A . 113 ARG HA   1 1 
        1  1769 1 1 113 ARG HB2  H  12.142  -3.446  -6.517 1.00 . A A . 113 ARG HB2  1 1 
        1  1770 1 1 113 ARG HB3  H  11.416  -1.855  -6.330 1.00 . A A . 113 ARG HB3  1 1 
        1  1771 1 1 113 ARG HD2  H  13.194  -1.336  -4.604 1.00 . A A . 113 ARG HD2  1 1 
        1  1772 1 1 113 ARG HD3  H  13.239  -2.265  -3.105 1.00 . A A . 113 ARG HD3  1 1 
        1  1773 1 1 113 ARG HE   H  14.099  -4.154  -4.551 1.00 . A A . 113 ARG HE   1 1 
        1  1774 1 1 113 ARG HG2  H  10.980  -2.311  -3.951 1.00 . A A . 113 ARG HG2  1 1 
        1  1775 1 1 113 ARG HG3  H  11.672  -3.927  -4.124 1.00 . A A . 113 ARG HG3  1 1 
        1  1776 1 1 113 ARG HH11 H  14.793  -0.801  -5.404 1.00 . A A . 113 ARG HH11 1 1 
        1  1777 1 1 113 ARG HH12 H  16.291  -1.205  -6.180 1.00 . A A . 113 ARG HH12 1 1 
        1  1778 1 1 113 ARG HH21 H  16.044  -4.638  -5.572 1.00 . A A . 113 ARG HH21 1 1 
        1  1779 1 1 113 ARG HH22 H  16.995  -3.370  -6.281 1.00 . A A . 113 ARG HH22 1 1 
        1  1780 1 1 113 ARG N    N   9.747  -3.296  -7.811 1.00 . A A . 113 ARG N    1 1 
        1  1781 1 1 113 ARG NE   N  14.187  -3.193  -4.723 1.00 . A A . 113 ARG NE   1 1 
        1  1782 1 1 113 ARG NH1  N  15.465  -1.492  -5.684 1.00 . A A . 113 ARG NH1  1 1 
        1  1783 1 1 113 ARG NH2  N  16.175  -3.663  -5.778 1.00 . A A . 113 ARG NH2  1 1 
        1  1784 1 1 113 ARG O    O   8.901  -1.547  -5.449 1.00 . A A . 113 ARG O    1 1 
        1  1785 1 1 114 TYR C    C   6.949  -2.465  -3.064 1.00 . A A . 114 TYR C    1 1 
        1  1786 1 1 114 TYR CA   C   6.686  -2.998  -4.481 1.00 . A A . 114 TYR CA   1 1 
        1  1787 1 1 114 TYR CB   C   5.583  -4.096  -4.504 1.00 . A A . 114 TYR CB   1 1 
        1  1788 1 1 114 TYR CD1  C   3.609  -2.575  -4.940 1.00 . A A . 114 TYR CD1  1 1 
        1  1789 1 1 114 TYR CD2  C   3.442  -4.099  -3.107 1.00 . A A . 114 TYR CD2  1 1 
        1  1790 1 1 114 TYR CE1  C   2.353  -2.099  -4.660 1.00 . A A . 114 TYR CE1  1 1 
        1  1791 1 1 114 TYR CE2  C   2.183  -3.617  -2.825 1.00 . A A . 114 TYR CE2  1 1 
        1  1792 1 1 114 TYR CG   C   4.185  -3.587  -4.173 1.00 . A A . 114 TYR CG   1 1 
        1  1793 1 1 114 TYR CZ   C   1.644  -2.620  -3.605 1.00 . A A . 114 TYR CZ   1 1 
        1  1794 1 1 114 TYR H    H   8.064  -4.502  -5.021 1.00 . A A . 114 TYR H    1 1 
        1  1795 1 1 114 TYR HA   H   6.360  -2.172  -5.108 1.00 . A A . 114 TYR HA   1 1 
        1  1796 1 1 114 TYR HB2  H   5.541  -4.536  -5.495 1.00 . A A . 114 TYR HB2  1 1 
        1  1797 1 1 114 TYR HB3  H   5.845  -4.879  -3.793 1.00 . A A . 114 TYR HB3  1 1 
        1  1798 1 1 114 TYR HD1  H   4.164  -2.161  -5.773 1.00 . A A . 114 TYR HD1  1 1 
        1  1799 1 1 114 TYR HD2  H   3.865  -4.887  -2.495 1.00 . A A . 114 TYR HD2  1 1 
        1  1800 1 1 114 TYR HE1  H   1.924  -1.316  -5.274 1.00 . A A . 114 TYR HE1  1 1 
        1  1801 1 1 114 TYR HE2  H   1.620  -4.025  -1.995 1.00 . A A . 114 TYR HE2  1 1 
        1  1802 1 1 114 TYR HH   H  -0.038  -1.868  -4.117 1.00 . A A . 114 TYR HH   1 1 
        1  1803 1 1 114 TYR N    N   7.923  -3.537  -5.052 1.00 . A A . 114 TYR N    1 1 
        1  1804 1 1 114 TYR O    O   6.910  -3.219  -2.094 1.00 . A A . 114 TYR O    1 1 
        1  1805 1 1 114 TYR OH   O   0.408  -2.114  -3.310 1.00 . A A . 114 TYR OH   1 1 
        1  1806 1 1 115 CYS C    C   6.572   0.496  -1.267 1.00 . A A . 115 CYS C    1 1 
        1  1807 1 1 115 CYS CA   C   7.636  -0.504  -1.715 1.00 . A A . 115 CYS CA   1 1 
        1  1808 1 1 115 CYS CB   C   9.008   0.183  -1.898 1.00 . A A . 115 CYS CB   1 1 
        1  1809 1 1 115 CYS H    H   7.041  -0.584  -3.747 1.00 . A A . 115 CYS H    1 1 
        1  1810 1 1 115 CYS HA   H   7.742  -1.276  -0.947 1.00 . A A . 115 CYS HA   1 1 
        1  1811 1 1 115 CYS HB2  H   9.717  -0.538  -2.286 1.00 . A A . 115 CYS HB2  1 1 
        1  1812 1 1 115 CYS HB3  H   8.915   1.002  -2.603 1.00 . A A . 115 CYS HB3  1 1 
        1  1813 1 1 115 CYS HG   H   9.125   0.198   0.647 1.00 . A A . 115 CYS HG   1 1 
        1  1814 1 1 115 CYS N    N   7.198  -1.146  -2.962 1.00 . A A . 115 CYS N    1 1 
        1  1815 1 1 115 CYS O    O   6.393   1.551  -1.880 1.00 . A A . 115 CYS O    1 1 
        1  1816 1 1 115 CYS SG   S   9.694   0.850  -0.362 1.00 . A A . 115 CYS SG   1 1 
        1  1817 1 1 116 ILE C    C   5.082   1.476   1.676 1.00 . A A . 116 ILE C    1 1 
        1  1818 1 1 116 ILE CA   C   4.713   0.891   0.320 1.00 . A A . 116 ILE CA   1 1 
        1  1819 1 1 116 ILE CB   C   3.454  -0.049   0.441 1.00 . A A . 116 ILE CB   1 1 
        1  1820 1 1 116 ILE CD1  C   2.937   0.272  -2.064 1.00 . A A . 116 ILE CD1  1 1 
        1  1821 1 1 116 ILE CG1  C   3.156  -0.713  -0.929 1.00 . A A . 116 ILE CG1  1 1 
        1  1822 1 1 116 ILE CG2  C   2.206   0.702   0.956 1.00 . A A . 116 ILE CG2  1 1 
        1  1823 1 1 116 ILE H    H   6.146  -0.670   0.281 1.00 . A A . 116 ILE H    1 1 
        1  1824 1 1 116 ILE HA   H   4.479   1.703  -0.368 1.00 . A A . 116 ILE HA   1 1 
        1  1825 1 1 116 ILE HB   H   3.686  -0.834   1.158 1.00 . A A . 116 ILE HB   1 1 
        1  1826 1 1 116 ILE HD11 H   2.702  -0.271  -2.962 1.00 . A A . 116 ILE HD11 1 1 
        1  1827 1 1 116 ILE HD12 H   3.837   0.854  -2.223 1.00 . A A . 116 ILE HD12 1 1 
        1  1828 1 1 116 ILE HD13 H   2.118   0.934  -1.823 1.00 . A A . 116 ILE HD13 1 1 
        1  1829 1 1 116 ILE HG12 H   3.987  -1.348  -1.210 1.00 . A A . 116 ILE HG12 1 1 
        1  1830 1 1 116 ILE HG13 H   2.265  -1.325  -0.849 1.00 . A A . 116 ILE HG13 1 1 
        1  1831 1 1 116 ILE HG21 H   2.410   1.123   1.934 1.00 . A A . 116 ILE HG21 1 1 
        1  1832 1 1 116 ILE HG22 H   1.374   0.015   1.037 1.00 . A A . 116 ILE HG22 1 1 
        1  1833 1 1 116 ILE HG23 H   1.943   1.500   0.274 1.00 . A A . 116 ILE HG23 1 1 
        1  1834 1 1 116 ILE N    N   5.862   0.134  -0.203 1.00 . A A . 116 ILE N    1 1 
        1  1835 1 1 116 ILE O    O   5.872   0.885   2.395 1.00 . A A . 116 ILE O    1 1 
        1  1836 1 1 117 ASN C    C   3.893   2.779   4.395 1.00 . A A . 117 ASN C    1 1 
        1  1837 1 1 117 ASN CA   C   4.823   3.307   3.295 1.00 . A A . 117 ASN CA   1 1 
        1  1838 1 1 117 ASN CB   C   4.716   4.840   3.147 1.00 . A A . 117 ASN CB   1 1 
        1  1839 1 1 117 ASN CG   C   3.288   5.339   3.002 1.00 . A A . 117 ASN CG   1 1 
        1  1840 1 1 117 ASN H    H   3.871   3.050   1.405 1.00 . A A . 117 ASN H    1 1 
        1  1841 1 1 117 ASN HA   H   5.849   3.059   3.566 1.00 . A A . 117 ASN HA   1 1 
        1  1842 1 1 117 ASN HB2  H   5.157   5.311   4.018 1.00 . A A . 117 ASN HB2  1 1 
        1  1843 1 1 117 ASN HB3  H   5.278   5.153   2.272 1.00 . A A . 117 ASN HB3  1 1 
        1  1844 1 1 117 ASN HD21 H   3.263   4.832   1.093 1.00 . A A . 117 ASN HD21 1 1 
        1  1845 1 1 117 ASN HD22 H   1.816   5.539   1.702 1.00 . A A . 117 ASN HD22 1 1 
        1  1846 1 1 117 ASN N    N   4.523   2.641   2.018 1.00 . A A . 117 ASN N    1 1 
        1  1847 1 1 117 ASN ND2  N   2.738   5.226   1.816 1.00 . A A . 117 ASN ND2  1 1 
        1  1848 1 1 117 ASN O    O   2.702   2.566   4.149 1.00 . A A . 117 ASN O    1 1 
        1  1849 1 1 117 ASN OD1  O   2.680   5.801   3.960 1.00 . A A . 117 ASN OD1  1 1 
        1  1850 1 1 118 SER C    C   2.684   2.999   7.320 1.00 . A A . 118 SER C    1 1 
        1  1851 1 1 118 SER CA   C   3.719   2.012   6.744 1.00 . A A . 118 SER CA   1 1 
        1  1852 1 1 118 SER CB   C   4.724   1.581   7.827 1.00 . A A . 118 SER CB   1 1 
        1  1853 1 1 118 SER H    H   5.374   2.867   5.737 1.00 . A A . 118 SER H    1 1 
        1  1854 1 1 118 SER HA   H   3.191   1.129   6.391 1.00 . A A . 118 SER HA   1 1 
        1  1855 1 1 118 SER HB2  H   5.192   2.457   8.264 1.00 . A A . 118 SER HB2  1 1 
        1  1856 1 1 118 SER HB3  H   4.213   1.025   8.608 1.00 . A A . 118 SER HB3  1 1 
        1  1857 1 1 118 SER HG   H   6.599   1.153   7.458 1.00 . A A . 118 SER HG   1 1 
        1  1858 1 1 118 SER N    N   4.445   2.595   5.602 1.00 . A A . 118 SER N    1 1 
        1  1859 1 1 118 SER O    O   1.742   2.582   8.003 1.00 . A A . 118 SER O    1 1 
        1  1860 1 1 118 SER OG   O   5.739   0.761   7.277 1.00 . A A . 118 SER OG   1 1 
        1  1861 1 1 119 ALA C    C   0.573   5.200   6.787 1.00 . A A . 119 ALA C    1 1 
        1  1862 1 1 119 ALA CA   C   1.946   5.365   7.456 1.00 . A A . 119 ALA CA   1 1 
        1  1863 1 1 119 ALA CB   C   2.539   6.742   7.134 1.00 . A A . 119 ALA CB   1 1 
        1  1864 1 1 119 ALA H    H   3.648   4.558   6.477 1.00 . A A . 119 ALA H    1 1 
        1  1865 1 1 119 ALA HA   H   1.834   5.286   8.538 1.00 . A A . 119 ALA HA   1 1 
        1  1866 1 1 119 ALA HB1  H   2.649   6.848   6.063 1.00 . A A . 119 ALA HB1  1 1 
        1  1867 1 1 119 ALA HB2  H   3.512   6.840   7.604 1.00 . A A . 119 ALA HB2  1 1 
        1  1868 1 1 119 ALA HB3  H   1.887   7.523   7.507 1.00 . A A . 119 ALA HB3  1 1 
        1  1869 1 1 119 ALA N    N   2.865   4.303   7.020 1.00 . A A . 119 ALA N    1 1 
        1  1870 1 1 119 ALA O    O  -0.467   5.414   7.424 1.00 . A A . 119 ALA O    1 1 
        1  1871 1 1 120 ALA C    C  -1.332   3.297   5.004 1.00 . A A . 120 ALA C    1 1 
        1  1872 1 1 120 ALA CA   C  -0.641   4.627   4.710 1.00 . A A . 120 ALA CA   1 1 
        1  1873 1 1 120 ALA CB   C  -0.347   4.761   3.210 1.00 . A A . 120 ALA CB   1 1 
        1  1874 1 1 120 ALA H    H   1.446   4.572   5.074 1.00 . A A . 120 ALA H    1 1 
        1  1875 1 1 120 ALA HA   H  -1.318   5.431   4.986 1.00 . A A . 120 ALA HA   1 1 
        1  1876 1 1 120 ALA HB1  H  -1.276   4.712   2.650 1.00 . A A . 120 ALA HB1  1 1 
        1  1877 1 1 120 ALA HB2  H   0.306   3.955   2.892 1.00 . A A . 120 ALA HB2  1 1 
        1  1878 1 1 120 ALA HB3  H   0.137   5.710   3.013 1.00 . A A . 120 ALA HB3  1 1 
        1  1879 1 1 120 ALA N    N   0.583   4.781   5.502 1.00 . A A . 120 ALA N    1 1 
        1  1880 1 1 120 ALA O    O  -2.461   3.081   4.579 1.00 . A A . 120 ALA O    1 1 
        1  1881 1 1 121 LEU C    C  -1.760   0.796   7.289 1.00 . A A . 121 LEU C    1 1 
        1  1882 1 1 121 LEU CA   C  -1.096   1.035   5.947 1.00 . A A . 121 LEU CA   1 1 
        1  1883 1 1 121 LEU CB   C   0.101   0.074   5.802 1.00 . A A . 121 LEU CB   1 1 
        1  1884 1 1 121 LEU CD1  C   1.916  -0.938   4.361 1.00 . A A . 121 LEU CD1  1 1 
        1  1885 1 1 121 LEU CD2  C  -0.278  -0.169   3.304 1.00 . A A . 121 LEU CD2  1 1 
        1  1886 1 1 121 LEU CG   C   0.768   0.070   4.411 1.00 . A A . 121 LEU CG   1 1 
        1  1887 1 1 121 LEU H    H   0.155   2.719   6.213 1.00 . A A . 121 LEU H    1 1 
        1  1888 1 1 121 LEU HA   H  -1.814   0.800   5.161 1.00 . A A . 121 LEU HA   1 1 
        1  1889 1 1 121 LEU HB2  H   0.853   0.334   6.546 1.00 . A A . 121 LEU HB2  1 1 
        1  1890 1 1 121 LEU HB3  H  -0.243  -0.938   6.009 1.00 . A A . 121 LEU HB3  1 1 
        1  1891 1 1 121 LEU HD11 H   2.360  -0.939   3.376 1.00 . A A . 121 LEU HD11 1 1 
        1  1892 1 1 121 LEU HD12 H   1.542  -1.929   4.590 1.00 . A A . 121 LEU HD12 1 1 
        1  1893 1 1 121 LEU HD13 H   2.665  -0.656   5.087 1.00 . A A . 121 LEU HD13 1 1 
        1  1894 1 1 121 LEU HD21 H   0.211  -0.228   2.343 1.00 . A A . 121 LEU HD21 1 1 
        1  1895 1 1 121 LEU HD22 H  -0.974   0.662   3.295 1.00 . A A . 121 LEU HD22 1 1 
        1  1896 1 1 121 LEU HD23 H  -0.817  -1.088   3.491 1.00 . A A . 121 LEU HD23 1 1 
        1  1897 1 1 121 LEU HG   H   1.201   1.048   4.234 1.00 . A A . 121 LEU HG   1 1 
        1  1898 1 1 121 LEU N    N  -0.659   2.419   5.760 1.00 . A A . 121 LEU N    1 1 
        1  1899 1 1 121 LEU O    O  -1.411   1.405   8.306 1.00 . A A . 121 LEU O    1 1 
        1  1900 1 1 122 ARG C    C  -3.282  -2.283   8.140 1.00 . A A . 122 ARG C    1 1 
        1  1901 1 1 122 ARG CA   C  -3.254  -0.788   8.437 1.00 . A A . 122 ARG CA   1 1 
        1  1902 1 1 122 ARG CB   C  -4.670  -0.269   8.839 1.00 . A A . 122 ARG CB   1 1 
        1  1903 1 1 122 ARG CD   C  -7.159   0.028   8.233 1.00 . A A . 122 ARG CD   1 1 
        1  1904 1 1 122 ARG CG   C  -5.750  -0.365   7.745 1.00 . A A . 122 ARG CG   1 1 
        1  1905 1 1 122 ARG CZ   C  -8.816  -1.719   8.969 1.00 . A A . 122 ARG CZ   1 1 
        1  1906 1 1 122 ARG H    H  -3.063  -0.385   6.362 1.00 . A A . 122 ARG H    1 1 
        1  1907 1 1 122 ARG HA   H  -2.566  -0.613   9.268 1.00 . A A . 122 ARG HA   1 1 
        1  1908 1 1 122 ARG HB2  H  -5.016  -0.828   9.704 1.00 . A A . 122 ARG HB2  1 1 
        1  1909 1 1 122 ARG HB3  H  -4.577   0.776   9.128 1.00 . A A . 122 ARG HB3  1 1 
        1  1910 1 1 122 ARG HD2  H  -7.107   0.994   8.726 1.00 . A A . 122 ARG HD2  1 1 
        1  1911 1 1 122 ARG HD3  H  -7.814   0.110   7.371 1.00 . A A . 122 ARG HD3  1 1 
        1  1912 1 1 122 ARG HE   H  -7.238  -1.070  10.033 1.00 . A A . 122 ARG HE   1 1 
        1  1913 1 1 122 ARG HG2  H  -5.473   0.290   6.925 1.00 . A A . 122 ARG HG2  1 1 
        1  1914 1 1 122 ARG HG3  H  -5.784  -1.386   7.379 1.00 . A A . 122 ARG HG3  1 1 
        1  1915 1 1 122 ARG HH11 H  -9.216  -1.010   7.106 1.00 . A A . 122 ARG HH11 1 1 
        1  1916 1 1 122 ARG HH12 H -10.306  -2.238   7.678 1.00 . A A . 122 ARG HH12 1 1 
        1  1917 1 1 122 ARG HH21 H  -8.712  -2.668  10.757 1.00 . A A . 122 ARG HH21 1 1 
        1  1918 1 1 122 ARG HH22 H -10.026  -3.156   9.733 1.00 . A A . 122 ARG HH22 1 1 
        1  1919 1 1 122 ARG N    N  -2.717  -0.121   7.252 1.00 . A A . 122 ARG N    1 1 
        1  1920 1 1 122 ARG NE   N  -7.717  -0.962   9.180 1.00 . A A . 122 ARG NE   1 1 
        1  1921 1 1 122 ARG NH1  N  -9.501  -1.645   7.827 1.00 . A A . 122 ARG NH1  1 1 
        1  1922 1 1 122 ARG NH2  N  -9.214  -2.580   9.894 1.00 . A A . 122 ARG NH2  1 1 
        1  1923 1 1 122 ARG O    O  -3.653  -2.698   7.030 1.00 . A A . 122 ARG O    1 1 
        1  1924 1 1 123 PHE C    C  -4.462  -4.820   9.281 1.00 . A A . 123 PHE C    1 1 
        1  1925 1 1 123 PHE CA   C  -2.970  -4.524   9.082 1.00 . A A . 123 PHE CA   1 1 
        1  1926 1 1 123 PHE CB   C  -2.097  -5.214  10.183 1.00 . A A . 123 PHE CB   1 1 
        1  1927 1 1 123 PHE CD1  C  -2.793  -4.010  12.325 1.00 . A A . 123 PHE CD1  1 1 
        1  1928 1 1 123 PHE CD2  C  -3.220  -6.355  12.173 1.00 . A A . 123 PHE CD2  1 1 
        1  1929 1 1 123 PHE CE1  C  -3.380  -3.991  13.574 1.00 . A A . 123 PHE CE1  1 1 
        1  1930 1 1 123 PHE CE2  C  -3.797  -6.329  13.427 1.00 . A A . 123 PHE CE2  1 1 
        1  1931 1 1 123 PHE CG   C  -2.699  -5.193  11.596 1.00 . A A . 123 PHE CG   1 1 
        1  1932 1 1 123 PHE CZ   C  -3.880  -5.149  14.123 1.00 . A A . 123 PHE CZ   1 1 
        1  1933 1 1 123 PHE H    H  -2.385  -2.662   9.870 1.00 . A A . 123 PHE H    1 1 
        1  1934 1 1 123 PHE HA   H  -2.652  -4.872   8.095 1.00 . A A . 123 PHE HA   1 1 
        1  1935 1 1 123 PHE HB2  H  -1.927  -6.249   9.899 1.00 . A A . 123 PHE HB2  1 1 
        1  1936 1 1 123 PHE HB3  H  -1.134  -4.717  10.228 1.00 . A A . 123 PHE HB3  1 1 
        1  1937 1 1 123 PHE HD1  H  -2.404  -3.093  11.903 1.00 . A A . 123 PHE HD1  1 1 
        1  1938 1 1 123 PHE HD2  H  -3.162  -7.293  11.630 1.00 . A A . 123 PHE HD2  1 1 
        1  1939 1 1 123 PHE HE1  H  -3.443  -3.059  14.126 1.00 . A A . 123 PHE HE1  1 1 
        1  1940 1 1 123 PHE HE2  H  -4.189  -7.239  13.860 1.00 . A A . 123 PHE HE2  1 1 
        1  1941 1 1 123 PHE HZ   H  -4.335  -5.127  15.102 1.00 . A A . 123 PHE HZ   1 1 
        1  1942 1 1 123 PHE N    N  -2.824  -3.076   9.111 1.00 . A A . 123 PHE N    1 1 
        1  1943 1 1 123 PHE O    O  -5.106  -4.217  10.157 1.00 . A A . 123 PHE O    1 1 
        1  1944 1 1 124 VAL C    C  -6.440  -7.601   8.610 1.00 . A A . 124 VAL C    1 1 
        1  1945 1 1 124 VAL CA   C  -6.427  -6.074   8.609 1.00 . A A . 124 VAL CA   1 1 
        1  1946 1 1 124 VAL CB   C  -7.383  -5.498   7.501 1.00 . A A . 124 VAL CB   1 1 
        1  1947 1 1 124 VAL CG1  C  -8.852  -5.529   7.988 1.00 . A A . 124 VAL CG1  1 1 
        1  1948 1 1 124 VAL CG2  C  -6.972  -4.076   7.064 1.00 . A A . 124 VAL CG2  1 1 
        1  1949 1 1 124 VAL H    H  -4.526  -6.030   7.697 1.00 . A A . 124 VAL H    1 1 
        1  1950 1 1 124 VAL HA   H  -6.783  -5.725   9.581 1.00 . A A . 124 VAL HA   1 1 
        1  1951 1 1 124 VAL HB   H  -7.310  -6.142   6.627 1.00 . A A . 124 VAL HB   1 1 
        1  1952 1 1 124 VAL HG11 H  -9.504  -5.138   7.214 1.00 . A A . 124 VAL HG11 1 1 
        1  1953 1 1 124 VAL HG12 H  -8.956  -4.924   8.877 1.00 . A A . 124 VAL HG12 1 1 
        1  1954 1 1 124 VAL HG13 H  -9.145  -6.555   8.219 1.00 . A A . 124 VAL HG13 1 1 
        1  1955 1 1 124 VAL HG21 H  -5.960  -4.092   6.672 1.00 . A A . 124 VAL HG21 1 1 
        1  1956 1 1 124 VAL HG22 H  -7.007  -3.404   7.917 1.00 . A A . 124 VAL HG22 1 1 
        1  1957 1 1 124 VAL HG23 H  -7.644  -3.716   6.298 1.00 . A A . 124 VAL HG23 1 1 
        1  1958 1 1 124 VAL N    N  -5.040  -5.665   8.443 1.00 . A A . 124 VAL N    1 1 
        1  1959 1 1 124 VAL O    O  -6.308  -8.207   7.546 1.00 . A A . 124 VAL O    1 1 
        1  1960 1 1 125 PRO C    C  -7.641 -10.371   9.140 1.00 . A A . 125 PRO C    1 1 
        1  1961 1 1 125 PRO CA   C  -6.518  -9.718   9.948 1.00 . A A . 125 PRO CA   1 1 
        1  1962 1 1 125 PRO CB   C  -6.737  -9.963  11.462 1.00 . A A . 125 PRO CB   1 1 
        1  1963 1 1 125 PRO CD   C  -6.639  -7.588  11.145 1.00 . A A . 125 PRO CD   1 1 
        1  1964 1 1 125 PRO CG   C  -6.306  -8.693  12.115 1.00 . A A . 125 PRO CG   1 1 
        1  1965 1 1 125 PRO HA   H  -5.561 -10.135   9.640 1.00 . A A . 125 PRO HA   1 1 
        1  1966 1 1 125 PRO HB2  H  -7.783 -10.180  11.671 1.00 . A A . 125 PRO HB2  1 1 
        1  1967 1 1 125 PRO HB3  H  -6.131 -10.802  11.790 1.00 . A A . 125 PRO HB3  1 1 
        1  1968 1 1 125 PRO HD2  H  -7.647  -7.222  11.314 1.00 . A A . 125 PRO HD2  1 1 
        1  1969 1 1 125 PRO HD3  H  -5.926  -6.775  11.236 1.00 . A A . 125 PRO HD3  1 1 
        1  1970 1 1 125 PRO HG2  H  -6.839  -8.556  13.053 1.00 . A A . 125 PRO HG2  1 1 
        1  1971 1 1 125 PRO HG3  H  -5.235  -8.718  12.307 1.00 . A A . 125 PRO HG3  1 1 
        1  1972 1 1 125 PRO N    N  -6.527  -8.245   9.819 1.00 . A A . 125 PRO N    1 1 
        1  1973 1 1 125 PRO O    O  -8.679  -9.761   8.954 1.00 . A A . 125 PRO O    1 1 
        1  1974 1 1 126 LYS C    C  -9.770 -12.509   8.707 1.00 . A A . 126 LYS C    1 1 
        1  1975 1 1 126 LYS CA   C  -8.413 -12.424   7.959 1.00 . A A . 126 LYS CA   1 1 
        1  1976 1 1 126 LYS CB   C  -7.826 -13.836   7.710 1.00 . A A . 126 LYS CB   1 1 
        1  1977 1 1 126 LYS CD   C  -8.036 -16.114   6.549 1.00 . A A . 126 LYS CD   1 1 
        1  1978 1 1 126 LYS CE   C  -8.036 -16.949   7.844 1.00 . A A . 126 LYS CE   1 1 
        1  1979 1 1 126 LYS CG   C  -8.636 -14.706   6.733 1.00 . A A . 126 LYS CG   1 1 
        1  1980 1 1 126 LYS H    H  -6.549 -12.010   8.868 1.00 . A A . 126 LYS H    1 1 
        1  1981 1 1 126 LYS HA   H  -8.567 -11.936   7.000 1.00 . A A . 126 LYS HA   1 1 
        1  1982 1 1 126 LYS HB2  H  -6.820 -13.736   7.314 1.00 . A A . 126 LYS HB2  1 1 
        1  1983 1 1 126 LYS HB3  H  -7.766 -14.361   8.660 1.00 . A A . 126 LYS HB3  1 1 
        1  1984 1 1 126 LYS HD2  H  -8.611 -16.638   5.798 1.00 . A A . 126 LYS HD2  1 1 
        1  1985 1 1 126 LYS HD3  H  -7.014 -16.010   6.199 1.00 . A A . 126 LYS HD3  1 1 
        1  1986 1 1 126 LYS HE2  H  -7.429 -16.457   8.594 1.00 . A A . 126 LYS HE2  1 1 
        1  1987 1 1 126 LYS HE3  H  -9.049 -17.042   8.210 1.00 . A A . 126 LYS HE3  1 1 
        1  1988 1 1 126 LYS HG2  H  -9.656 -14.800   7.096 1.00 . A A . 126 LYS HG2  1 1 
        1  1989 1 1 126 LYS HG3  H  -8.655 -14.207   5.766 1.00 . A A . 126 LYS HG3  1 1 
        1  1990 1 1 126 LYS HZ1  H  -6.505 -18.247   7.287 1.00 . A A . 126 LYS HZ1  1 1 
        1  1991 1 1 126 LYS HZ2  H  -8.054 -18.813   6.908 1.00 . A A . 126 LYS HZ2  1 1 
        1  1992 1 1 126 LYS HZ3  H  -7.505 -18.849   8.506 1.00 . A A . 126 LYS HZ3  1 1 
        1  1993 1 1 126 LYS N    N  -7.424 -11.618   8.704 1.00 . A A . 126 LYS N    1 1 
        1  1994 1 1 126 LYS NZ   N  -7.488 -18.307   7.620 1.00 . A A . 126 LYS NZ   1 1 
        1  1995 1 1 126 LYS O    O -10.831 -12.634   8.089 1.00 . A A . 126 LYS O    1 1 
        1  1996 1 1 127 HIS C    C -11.639 -11.045  10.801 1.00 . A A . 127 HIS C    1 1 
        1  1997 1 1 127 HIS CA   C -10.863 -12.368  10.947 1.00 . A A . 127 HIS CA   1 1 
        1  1998 1 1 127 HIS CB   C -10.382 -12.553  12.409 1.00 . A A . 127 HIS CB   1 1 
        1  1999 1 1 127 HIS CD2  C -12.344 -13.427  13.881 1.00 . A A . 127 HIS CD2  1 1 
        1  2000 1 1 127 HIS CE1  C -12.728 -11.598  15.020 1.00 . A A . 127 HIS CE1  1 1 
        1  2001 1 1 127 HIS CG   C -11.470 -12.488  13.448 1.00 . A A . 127 HIS CG   1 1 
        1  2002 1 1 127 HIS H    H  -8.807 -12.245  10.442 1.00 . A A . 127 HIS H    1 1 
        1  2003 1 1 127 HIS HA   H -11.510 -13.200  10.679 1.00 . A A . 127 HIS HA   1 1 
        1  2004 1 1 127 HIS HB2  H  -9.899 -13.519  12.500 1.00 . A A . 127 HIS HB2  1 1 
        1  2005 1 1 127 HIS HB3  H  -9.656 -11.785  12.644 1.00 . A A . 127 HIS HB3  1 1 
        1  2006 1 1 127 HIS HD1  H -11.267 -10.491  14.105 1.00 . A A . 127 HIS HD1  1 1 
        1  2007 1 1 127 HIS HD2  H -12.415 -14.445  13.526 1.00 . A A . 127 HIS HD2  1 1 
        1  2008 1 1 127 HIS HE1  H -13.157 -10.887  15.717 1.00 . A A . 127 HIS HE1  1 1 
        1  2009 1 1 127 HIS HE2  H -13.759 -13.318  15.427 1.00 . A A . 127 HIS HE2  1 1 
        1  2010 1 1 127 HIS N    N  -9.694 -12.380  10.047 1.00 . A A . 127 HIS N    1 1 
        1  2011 1 1 127 HIS ND1  N -11.740 -11.351  14.182 1.00 . A A . 127 HIS ND1  1 1 
        1  2012 1 1 127 HIS NE2  N -13.112 -12.848  14.856 1.00 . A A . 127 HIS NE2  1 1 
        1  2013 1 1 127 HIS O    O -12.872 -11.031  10.765 1.00 . A A . 127 HIS O    1 1 
        1  2014 1 1 128 LYS C    C -11.919  -8.306   9.172 1.00 . A A . 128 LYS C    1 1 
        1  2015 1 1 128 LYS CA   C -11.431  -8.586  10.602 1.00 . A A . 128 LYS CA   1 1 
        1  2016 1 1 128 LYS CB   C -10.344  -7.573  11.035 1.00 . A A . 128 LYS CB   1 1 
        1  2017 1 1 128 LYS CD   C -11.966  -5.828  12.019 1.00 . A A . 128 LYS CD   1 1 
        1  2018 1 1 128 LYS CE   C -12.394  -4.357  12.006 1.00 . A A . 128 LYS CE   1 1 
        1  2019 1 1 128 LYS CG   C -10.788  -6.098  11.058 1.00 . A A . 128 LYS CG   1 1 
        1  2020 1 1 128 LYS H    H  -9.910 -10.056  10.582 1.00 . A A . 128 LYS H    1 1 
        1  2021 1 1 128 LYS HA   H -12.272  -8.518  11.284 1.00 . A A . 128 LYS HA   1 1 
        1  2022 1 1 128 LYS HB2  H -10.001  -7.839  12.028 1.00 . A A . 128 LYS HB2  1 1 
        1  2023 1 1 128 LYS HB3  H  -9.500  -7.659  10.353 1.00 . A A . 128 LYS HB3  1 1 
        1  2024 1 1 128 LYS HD2  H -12.813  -6.437  11.723 1.00 . A A . 128 LYS HD2  1 1 
        1  2025 1 1 128 LYS HD3  H -11.671  -6.100  13.030 1.00 . A A . 128 LYS HD3  1 1 
        1  2026 1 1 128 LYS HE2  H -11.545  -3.733  12.254 1.00 . A A . 128 LYS HE2  1 1 
        1  2027 1 1 128 LYS HE3  H -12.746  -4.102  11.013 1.00 . A A . 128 LYS HE3  1 1 
        1  2028 1 1 128 LYS HG2  H  -9.944  -5.488  11.361 1.00 . A A . 128 LYS HG2  1 1 
        1  2029 1 1 128 LYS HG3  H -11.085  -5.808  10.052 1.00 . A A . 128 LYS HG3  1 1 
        1  2030 1 1 128 LYS HZ1  H -14.289  -4.704  12.795 1.00 . A A . 128 LYS HZ1  1 1 
        1  2031 1 1 128 LYS HZ2  H -13.786  -3.094  12.887 1.00 . A A . 128 LYS HZ2  1 1 
        1  2032 1 1 128 LYS HZ3  H -13.139  -4.236  13.945 1.00 . A A . 128 LYS HZ3  1 1 
        1  2033 1 1 128 LYS N    N -10.880  -9.946  10.678 1.00 . A A . 128 LYS N    1 1 
        1  2034 1 1 128 LYS NZ   N -13.476  -4.079  12.977 1.00 . A A . 128 LYS NZ   1 1 
        1  2035 1 1 128 LYS O    O -12.840  -7.512   8.957 1.00 . A A . 128 LYS O    1 1 
        1  2036 1 1 129 LEU C    C -13.023  -9.572   6.579 1.00 . A A . 129 LEU C    1 1 
        1  2037 1 1 129 LEU CA   C -11.650  -8.931   6.802 1.00 . A A . 129 LEU CA   1 1 
        1  2038 1 1 129 LEU CB   C -10.602  -9.662   5.947 1.00 . A A . 129 LEU CB   1 1 
        1  2039 1 1 129 LEU CD1  C  -8.205 -10.028   5.158 1.00 . A A . 129 LEU CD1  1 1 
        1  2040 1 1 129 LEU CD2  C  -9.131  -7.685   5.336 1.00 . A A . 129 LEU CD2  1 1 
        1  2041 1 1 129 LEU CG   C  -9.157  -9.092   5.924 1.00 . A A . 129 LEU CG   1 1 
        1  2042 1 1 129 LEU H    H -10.593  -9.630   8.476 1.00 . A A . 129 LEU H    1 1 
        1  2043 1 1 129 LEU HA   H -11.687  -7.883   6.510 1.00 . A A . 129 LEU HA   1 1 
        1  2044 1 1 129 LEU HB2  H -10.547 -10.691   6.301 1.00 . A A . 129 LEU HB2  1 1 
        1  2045 1 1 129 LEU HB3  H -10.963  -9.688   4.920 1.00 . A A . 129 LEU HB3  1 1 
        1  2046 1 1 129 LEU HD11 H  -8.506 -10.090   4.119 1.00 . A A . 129 LEU HD11 1 1 
        1  2047 1 1 129 LEU HD12 H  -8.244 -11.018   5.599 1.00 . A A . 129 LEU HD12 1 1 
        1  2048 1 1 129 LEU HD13 H  -7.193  -9.652   5.224 1.00 . A A . 129 LEU HD13 1 1 
        1  2049 1 1 129 LEU HD21 H  -9.798  -7.045   5.902 1.00 . A A . 129 LEU HD21 1 1 
        1  2050 1 1 129 LEU HD22 H  -9.456  -7.712   4.308 1.00 . A A . 129 LEU HD22 1 1 
        1  2051 1 1 129 LEU HD23 H  -8.130  -7.285   5.389 1.00 . A A . 129 LEU HD23 1 1 
        1  2052 1 1 129 LEU HG   H  -8.792  -9.026   6.946 1.00 . A A . 129 LEU HG   1 1 
        1  2053 1 1 129 LEU N    N -11.298  -9.006   8.212 1.00 . A A . 129 LEU N    1 1 
        1  2054 1 1 129 LEU O    O -13.809  -9.088   5.771 1.00 . A A . 129 LEU O    1 1 
        1  2055 1 1 130 LYS C    C -15.740 -10.470   7.741 1.00 . A A . 130 LYS C    1 1 
        1  2056 1 1 130 LYS CA   C -14.596 -11.380   7.279 1.00 . A A . 130 LYS CA   1 1 
        1  2057 1 1 130 LYS CB   C -14.523 -12.674   8.142 1.00 . A A . 130 LYS CB   1 1 
        1  2058 1 1 130 LYS CD   C -15.654 -14.844   8.955 1.00 . A A . 130 LYS CD   1 1 
        1  2059 1 1 130 LYS CE   C -16.873 -15.783   8.848 1.00 . A A . 130 LYS CE   1 1 
        1  2060 1 1 130 LYS CG   C -15.781 -13.576   8.077 1.00 . A A . 130 LYS CG   1 1 
        1  2061 1 1 130 LYS H    H -12.662 -10.981   8.010 1.00 . A A . 130 LYS H    1 1 
        1  2062 1 1 130 LYS HA   H -14.773 -11.656   6.245 1.00 . A A . 130 LYS HA   1 1 
        1  2063 1 1 130 LYS HB2  H -13.670 -13.260   7.810 1.00 . A A . 130 LYS HB2  1 1 
        1  2064 1 1 130 LYS HB3  H -14.357 -12.392   9.178 1.00 . A A . 130 LYS HB3  1 1 
        1  2065 1 1 130 LYS HD2  H -14.766 -15.391   8.654 1.00 . A A . 130 LYS HD2  1 1 
        1  2066 1 1 130 LYS HD3  H -15.541 -14.538   9.991 1.00 . A A . 130 LYS HD3  1 1 
        1  2067 1 1 130 LYS HE2  H -16.994 -16.095   7.818 1.00 . A A . 130 LYS HE2  1 1 
        1  2068 1 1 130 LYS HE3  H -16.693 -16.656   9.461 1.00 . A A . 130 LYS HE3  1 1 
        1  2069 1 1 130 LYS HG2  H -16.639 -13.003   8.414 1.00 . A A . 130 LYS HG2  1 1 
        1  2070 1 1 130 LYS HG3  H -15.941 -13.875   7.045 1.00 . A A . 130 LYS HG3  1 1 
        1  2071 1 1 130 LYS HZ1  H -18.382 -14.348   8.669 1.00 . A A . 130 LYS HZ1  1 1 
        1  2072 1 1 130 LYS HZ2  H -18.038 -14.783  10.266 1.00 . A A . 130 LYS HZ2  1 1 
        1  2073 1 1 130 LYS HZ3  H -18.917 -15.831   9.273 1.00 . A A . 130 LYS HZ3  1 1 
        1  2074 1 1 130 LYS N    N -13.309 -10.659   7.342 1.00 . A A . 130 LYS N    1 1 
        1  2075 1 1 130 LYS NZ   N -18.138 -15.140   9.297 1.00 . A A . 130 LYS NZ   1 1 
        1  2076 1 1 130 LYS O    O -16.873 -10.587   7.269 1.00 . A A . 130 LYS O    1 1 
        1  2077 1 1 131 GLU C    C -16.584  -7.435   8.073 1.00 . A A . 131 GLU C    1 1 
        1  2078 1 1 131 GLU CA   C -16.376  -8.528   9.134 1.00 . A A . 131 GLU CA   1 1 
        1  2079 1 1 131 GLU CB   C -15.835  -7.890  10.437 1.00 . A A . 131 GLU CB   1 1 
        1  2080 1 1 131 GLU CD   C -16.108  -6.029  12.213 1.00 . A A . 131 GLU CD   1 1 
        1  2081 1 1 131 GLU CG   C -16.774  -6.852  11.095 1.00 . A A . 131 GLU CG   1 1 
        1  2082 1 1 131 GLU H    H -14.500  -9.460   8.968 1.00 . A A . 131 GLU H    1 1 
        1  2083 1 1 131 GLU HA   H -17.322  -9.026   9.340 1.00 . A A . 131 GLU HA   1 1 
        1  2084 1 1 131 GLU HB2  H -15.653  -8.680  11.159 1.00 . A A . 131 GLU HB2  1 1 
        1  2085 1 1 131 GLU HB3  H -14.887  -7.405  10.219 1.00 . A A . 131 GLU HB3  1 1 
        1  2086 1 1 131 GLU HG2  H -17.132  -6.174  10.326 1.00 . A A . 131 GLU HG2  1 1 
        1  2087 1 1 131 GLU HG3  H -17.623  -7.376  11.519 1.00 . A A . 131 GLU HG3  1 1 
        1  2088 1 1 131 GLU N    N -15.420  -9.526   8.642 1.00 . A A . 131 GLU N    1 1 
        1  2089 1 1 131 GLU O    O -17.698  -6.947   7.871 1.00 . A A . 131 GLU O    1 1 
        1  2090 1 1 131 GLU OE1  O -15.372  -6.604  13.043 1.00 . A A . 131 GLU OE1  1 1 
        1  2091 1 1 131 GLU OE2  O -16.306  -4.797  12.273 1.00 . A A . 131 GLU OE2  1 1 
        1  2092 1 1 132 GLU C    C -15.733  -6.324   5.009 1.00 . A A . 132 GLU C    1 1 
        1  2093 1 1 132 GLU CA   C -15.439  -5.925   6.470 1.00 . A A . 132 GLU CA   1 1 
        1  2094 1 1 132 GLU CB   C -14.052  -5.227   6.562 1.00 . A A . 132 GLU CB   1 1 
        1  2095 1 1 132 GLU CD   C -12.444  -3.663   7.822 1.00 . A A . 132 GLU CD   1 1 
        1  2096 1 1 132 GLU CG   C -13.777  -4.442   7.863 1.00 . A A . 132 GLU CG   1 1 
        1  2097 1 1 132 GLU H    H -14.669  -7.603   7.519 1.00 . A A . 132 GLU H    1 1 
        1  2098 1 1 132 GLU HA   H -16.200  -5.213   6.778 1.00 . A A . 132 GLU HA   1 1 
        1  2099 1 1 132 GLU HB2  H -13.280  -5.982   6.459 1.00 . A A . 132 GLU HB2  1 1 
        1  2100 1 1 132 GLU HB3  H -13.959  -4.533   5.727 1.00 . A A . 132 GLU HB3  1 1 
        1  2101 1 1 132 GLU HG2  H -14.581  -3.730   8.018 1.00 . A A . 132 GLU HG2  1 1 
        1  2102 1 1 132 GLU HG3  H -13.759  -5.141   8.694 1.00 . A A . 132 GLU HG3  1 1 
        1  2103 1 1 132 GLU N    N -15.483  -7.070   7.398 1.00 . A A . 132 GLU N    1 1 
        1  2104 1 1 132 GLU O    O -15.730  -5.447   4.138 1.00 . A A . 132 GLU O    1 1 
        1  2105 1 1 132 GLU OE1  O -12.149  -3.016   6.790 1.00 . A A . 132 GLU OE1  1 1 
        1  2106 1 1 132 GLU OE2  O -11.698  -3.661   8.819 1.00 . A A . 132 GLU OE2  1 1 
        1  2107 1 1 133 GLY C    C -15.172  -8.959   2.737 1.00 . A A . 133 GLY C    1 1 
        1  2108 1 1 133 GLY CA   C -16.251  -8.053   3.338 1.00 . A A . 133 GLY CA   1 1 
        1  2109 1 1 133 GLY H    H -16.048  -8.277   5.448 1.00 . A A . 133 GLY H    1 1 
        1  2110 1 1 133 GLY HA2  H -17.186  -8.595   3.333 1.00 . A A . 133 GLY HA2  1 1 
        1  2111 1 1 133 GLY HA3  H -16.376  -7.185   2.699 1.00 . A A . 133 GLY HA3  1 1 
        1  2112 1 1 133 GLY N    N -15.995  -7.618   4.722 1.00 . A A . 133 GLY N    1 1 
        1  2113 1 1 133 GLY O    O -14.585  -8.629   1.710 1.00 . A A . 133 GLY O    1 1 
        1  2114 1 1 134 TYR C    C -14.123 -11.562   1.478 1.00 . A A . 134 TYR C    1 1 
        1  2115 1 1 134 TYR CA   C -14.055 -11.220   2.992 1.00 . A A . 134 TYR CA   1 1 
        1  2116 1 1 134 TYR CB   C -14.485 -12.477   3.809 1.00 . A A . 134 TYR CB   1 1 
        1  2117 1 1 134 TYR CD1  C -16.966 -12.043   4.316 1.00 . A A . 134 TYR CD1  1 1 
        1  2118 1 1 134 TYR CD2  C -16.431 -13.936   2.966 1.00 . A A . 134 TYR CD2  1 1 
        1  2119 1 1 134 TYR CE1  C -18.306 -12.337   4.208 1.00 . A A . 134 TYR CE1  1 1 
        1  2120 1 1 134 TYR CE2  C -17.781 -14.233   2.852 1.00 . A A . 134 TYR CE2  1 1 
        1  2121 1 1 134 TYR CG   C -15.987 -12.834   3.701 1.00 . A A . 134 TYR CG   1 1 
        1  2122 1 1 134 TYR CZ   C -18.713 -13.428   3.475 1.00 . A A . 134 TYR CZ   1 1 
        1  2123 1 1 134 TYR H    H -15.123 -10.055   4.398 1.00 . A A . 134 TYR H    1 1 
        1  2124 1 1 134 TYR HA   H -13.022 -11.000   3.241 1.00 . A A . 134 TYR HA   1 1 
        1  2125 1 1 134 TYR HB2  H -13.905 -13.333   3.476 1.00 . A A . 134 TYR HB2  1 1 
        1  2126 1 1 134 TYR HB3  H -14.258 -12.306   4.854 1.00 . A A . 134 TYR HB3  1 1 
        1  2127 1 1 134 TYR HD1  H -16.653 -11.179   4.898 1.00 . A A . 134 TYR HD1  1 1 
        1  2128 1 1 134 TYR HD2  H -15.700 -14.568   2.475 1.00 . A A . 134 TYR HD2  1 1 
        1  2129 1 1 134 TYR HE1  H -19.037 -11.705   4.697 1.00 . A A . 134 TYR HE1  1 1 
        1  2130 1 1 134 TYR HE2  H -18.098 -15.098   2.280 1.00 . A A . 134 TYR HE2  1 1 
        1  2131 1 1 134 TYR HH   H -20.518 -12.902   3.030 1.00 . A A . 134 TYR HH   1 1 
        1  2132 1 1 134 TYR N    N -14.858 -10.047   3.453 1.00 . A A . 134 TYR N    1 1 
        1  2133 1 1 134 TYR O    O -13.125 -11.979   0.909 1.00 . A A . 134 TYR O    1 1 
        1  2134 1 1 134 TYR OH   O -20.062 -13.697   3.346 1.00 . A A . 134 TYR OH   1 1 
        1  2135 1 1 135 GLU C    C -14.630 -10.839  -1.515 1.00 . A A . 135 GLU C    1 1 
        1  2136 1 1 135 GLU CA   C -15.455 -11.777  -0.598 1.00 . A A . 135 GLU CA   1 1 
        1  2137 1 1 135 GLU CB   C -16.953 -11.787  -0.996 1.00 . A A . 135 GLU CB   1 1 
        1  2138 1 1 135 GLU CD   C -18.712 -12.363  -2.789 1.00 . A A . 135 GLU CD   1 1 
        1  2139 1 1 135 GLU CG   C -17.220 -12.257  -2.442 1.00 . A A . 135 GLU CG   1 1 
        1  2140 1 1 135 GLU H    H -16.048 -11.032   1.323 1.00 . A A . 135 GLU H    1 1 
        1  2141 1 1 135 GLU HA   H -15.065 -12.787  -0.711 1.00 . A A . 135 GLU HA   1 1 
        1  2142 1 1 135 GLU HB2  H -17.486 -12.447  -0.319 1.00 . A A . 135 GLU HB2  1 1 
        1  2143 1 1 135 GLU HB3  H -17.349 -10.782  -0.882 1.00 . A A . 135 GLU HB3  1 1 
        1  2144 1 1 135 GLU HG2  H -16.755 -11.553  -3.126 1.00 . A A . 135 GLU HG2  1 1 
        1  2145 1 1 135 GLU HG3  H -16.754 -13.229  -2.581 1.00 . A A . 135 GLU HG3  1 1 
        1  2146 1 1 135 GLU N    N -15.290 -11.409   0.836 1.00 . A A . 135 GLU N    1 1 
        1  2147 1 1 135 GLU O    O -14.237 -11.213  -2.624 1.00 . A A . 135 GLU O    1 1 
        1  2148 1 1 135 GLU OE1  O -19.335 -11.326  -3.105 1.00 . A A . 135 GLU OE1  1 1 
        1  2149 1 1 135 GLU OE2  O -19.269 -13.482  -2.745 1.00 . A A . 135 GLU OE2  1 1 
        1  2150 1 1 136 SER C    C -12.030  -8.885  -1.295 1.00 . A A . 136 SER C    1 1 
        1  2151 1 1 136 SER CA   C -13.499  -8.652  -1.695 1.00 . A A . 136 SER CA   1 1 
        1  2152 1 1 136 SER CB   C -13.949  -7.230  -1.303 1.00 . A A . 136 SER CB   1 1 
        1  2153 1 1 136 SER H    H -14.670  -9.443  -0.112 1.00 . A A . 136 SER H    1 1 
        1  2154 1 1 136 SER HA   H -13.607  -8.781  -2.772 1.00 . A A . 136 SER HA   1 1 
        1  2155 1 1 136 SER HB2  H -13.820  -7.090  -0.233 1.00 . A A . 136 SER HB2  1 1 
        1  2156 1 1 136 SER HB3  H -13.350  -6.499  -1.831 1.00 . A A . 136 SER HB3  1 1 
        1  2157 1 1 136 SER HG   H -15.663  -7.762  -2.119 1.00 . A A . 136 SER HG   1 1 
        1  2158 1 1 136 SER N    N -14.354  -9.634  -1.016 1.00 . A A . 136 SER N    1 1 
        1  2159 1 1 136 SER O    O -11.128  -8.929  -2.135 1.00 . A A . 136 SER O    1 1 
        1  2160 1 1 136 SER OG   O -15.320  -7.011  -1.617 1.00 . A A . 136 SER OG   1 1 
        1  2161 1 1 137 TYR C    C  -9.831 -10.521   0.480 1.00 . A A . 137 TYR C    1 1 
        1  2162 1 1 137 TYR CA   C -10.498  -9.134   0.649 1.00 . A A . 137 TYR CA   1 1 
        1  2163 1 1 137 TYR CB   C -10.634  -8.799   2.145 1.00 . A A . 137 TYR CB   1 1 
        1  2164 1 1 137 TYR CD1  C -10.262  -6.276   2.049 1.00 . A A . 137 TYR CD1  1 1 
        1  2165 1 1 137 TYR CD2  C -12.207  -7.061   3.173 1.00 . A A . 137 TYR CD2  1 1 
        1  2166 1 1 137 TYR CE1  C -10.601  -4.974   2.364 1.00 . A A . 137 TYR CE1  1 1 
        1  2167 1 1 137 TYR CE2  C -12.553  -5.764   3.475 1.00 . A A . 137 TYR CE2  1 1 
        1  2168 1 1 137 TYR CG   C -11.055  -7.351   2.448 1.00 . A A . 137 TYR CG   1 1 
        1  2169 1 1 137 TYR CZ   C -11.756  -4.724   3.076 1.00 . A A . 137 TYR CZ   1 1 
        1  2170 1 1 137 TYR H    H -12.618  -8.987   0.604 1.00 . A A . 137 TYR H    1 1 
        1  2171 1 1 137 TYR HA   H  -9.858  -8.384   0.191 1.00 . A A . 137 TYR HA   1 1 
        1  2172 1 1 137 TYR HB2  H -11.363  -9.466   2.594 1.00 . A A . 137 TYR HB2  1 1 
        1  2173 1 1 137 TYR HB3  H  -9.674  -8.963   2.636 1.00 . A A . 137 TYR HB3  1 1 
        1  2174 1 1 137 TYR HD1  H  -9.357  -6.470   1.483 1.00 . A A . 137 TYR HD1  1 1 
        1  2175 1 1 137 TYR HD2  H -12.843  -7.875   3.498 1.00 . A A . 137 TYR HD2  1 1 
        1  2176 1 1 137 TYR HE1  H  -9.968  -4.159   2.040 1.00 . A A . 137 TYR HE1  1 1 
        1  2177 1 1 137 TYR HE2  H -13.462  -5.571   4.032 1.00 . A A . 137 TYR HE2  1 1 
        1  2178 1 1 137 TYR HH   H -12.264  -3.391   4.367 1.00 . A A . 137 TYR HH   1 1 
        1  2179 1 1 137 TYR N    N -11.829  -9.027   0.021 1.00 . A A . 137 TYR N    1 1 
        1  2180 1 1 137 TYR O    O  -8.765 -10.631  -0.130 1.00 . A A . 137 TYR O    1 1 
        1  2181 1 1 137 TYR OH   O -12.102  -3.433   3.416 1.00 . A A . 137 TYR OH   1 1 
        1  2182 1 1 138 LEU C    C  -9.794 -13.557  -0.302 1.00 . A A . 138 LEU C    1 1 
        1  2183 1 1 138 LEU CA   C  -9.933 -12.954   1.094 1.00 . A A . 138 LEU CA   1 1 
        1  2184 1 1 138 LEU CB   C -10.796 -13.891   2.014 1.00 . A A . 138 LEU CB   1 1 
        1  2185 1 1 138 LEU CD1  C -10.644 -12.353   4.021 1.00 . A A . 138 LEU CD1  1 1 
        1  2186 1 1 138 LEU CD2  C -11.460 -14.683   4.380 1.00 . A A . 138 LEU CD2  1 1 
        1  2187 1 1 138 LEU CG   C -10.523 -13.787   3.545 1.00 . A A . 138 LEU CG   1 1 
        1  2188 1 1 138 LEU H    H -11.322 -11.386   1.476 1.00 . A A . 138 LEU H    1 1 
        1  2189 1 1 138 LEU HA   H  -8.934 -12.892   1.521 1.00 . A A . 138 LEU HA   1 1 
        1  2190 1 1 138 LEU HB2  H -11.838 -13.658   1.840 1.00 . A A . 138 LEU HB2  1 1 
        1  2191 1 1 138 LEU HB3  H -10.633 -14.925   1.720 1.00 . A A . 138 LEU HB3  1 1 
        1  2192 1 1 138 LEU HD11 H -10.470 -12.298   5.086 1.00 . A A . 138 LEU HD11 1 1 
        1  2193 1 1 138 LEU HD12 H -11.641 -11.977   3.802 1.00 . A A . 138 LEU HD12 1 1 
        1  2194 1 1 138 LEU HD13 H  -9.917 -11.733   3.512 1.00 . A A . 138 LEU HD13 1 1 
        1  2195 1 1 138 LEU HD21 H -12.491 -14.429   4.172 1.00 . A A . 138 LEU HD21 1 1 
        1  2196 1 1 138 LEU HD22 H -11.261 -14.518   5.438 1.00 . A A . 138 LEU HD22 1 1 
        1  2197 1 1 138 LEU HD23 H -11.288 -15.724   4.142 1.00 . A A . 138 LEU HD23 1 1 
        1  2198 1 1 138 LEU HG   H  -9.506 -14.110   3.743 1.00 . A A . 138 LEU HG   1 1 
        1  2199 1 1 138 LEU N    N -10.462 -11.560   1.056 1.00 . A A . 138 LEU N    1 1 
        1  2200 1 1 138 LEU O    O  -9.074 -14.521  -0.464 1.00 . A A . 138 LEU O    1 1 
        1  2201 1 1 139 HIS C    C  -8.961 -13.058  -3.239 1.00 . A A . 139 HIS C    1 1 
        1  2202 1 1 139 HIS CA   C -10.377 -13.398  -2.705 1.00 . A A . 139 HIS CA   1 1 
        1  2203 1 1 139 HIS CB   C -11.464 -12.698  -3.558 1.00 . A A . 139 HIS CB   1 1 
        1  2204 1 1 139 HIS CD2  C -11.517 -14.294  -5.613 1.00 . A A . 139 HIS CD2  1 1 
        1  2205 1 1 139 HIS CE1  C -11.433 -12.789  -7.197 1.00 . A A . 139 HIS CE1  1 1 
        1  2206 1 1 139 HIS CG   C -11.458 -13.079  -5.015 1.00 . A A . 139 HIS CG   1 1 
        1  2207 1 1 139 HIS H    H -11.174 -12.312  -1.057 1.00 . A A . 139 HIS H    1 1 
        1  2208 1 1 139 HIS HA   H -10.522 -14.474  -2.760 1.00 . A A . 139 HIS HA   1 1 
        1  2209 1 1 139 HIS HB2  H -12.440 -12.947  -3.162 1.00 . A A . 139 HIS HB2  1 1 
        1  2210 1 1 139 HIS HB3  H -11.326 -11.625  -3.491 1.00 . A A . 139 HIS HB3  1 1 
        1  2211 1 1 139 HIS HD1  H -11.371 -11.183  -5.934 1.00 . A A . 139 HIS HD1  1 1 
        1  2212 1 1 139 HIS HD2  H -11.561 -15.256  -5.111 1.00 . A A . 139 HIS HD2  1 1 
        1  2213 1 1 139 HIS HE1  H -11.402 -12.323  -8.173 1.00 . A A . 139 HIS HE1  1 1 
        1  2214 1 1 139 HIS HE2  H -11.657 -14.775  -7.649 1.00 . A A . 139 HIS HE2  1 1 
        1  2215 1 1 139 HIS N    N -10.518 -13.004  -1.288 1.00 . A A . 139 HIS N    1 1 
        1  2216 1 1 139 HIS ND1  N -11.412 -12.158  -6.040 1.00 . A A . 139 HIS ND1  1 1 
        1  2217 1 1 139 HIS NE2  N -11.497 -14.087  -6.965 1.00 . A A . 139 HIS NE2  1 1 
        1  2218 1 1 139 HIS O    O  -8.396 -13.792  -4.054 1.00 . A A . 139 HIS O    1 1 
        1  2219 1 1 140 LEU C    C  -5.992 -12.013  -2.210 1.00 . A A . 140 LEU C    1 1 
        1  2220 1 1 140 LEU CA   C  -7.069 -11.446  -3.146 1.00 . A A . 140 LEU CA   1 1 
        1  2221 1 1 140 LEU CB   C  -7.080  -9.904  -3.086 1.00 . A A . 140 LEU CB   1 1 
        1  2222 1 1 140 LEU CD1  C  -8.286  -7.734  -3.642 1.00 . A A . 140 LEU CD1  1 1 
        1  2223 1 1 140 LEU CD2  C  -7.927  -9.462  -5.463 1.00 . A A . 140 LEU CD2  1 1 
        1  2224 1 1 140 LEU CG   C  -8.179  -9.226  -3.958 1.00 . A A . 140 LEU CG   1 1 
        1  2225 1 1 140 LEU H    H  -8.907 -11.420  -2.095 1.00 . A A . 140 LEU H    1 1 
        1  2226 1 1 140 LEU HA   H  -6.858 -11.764  -4.167 1.00 . A A . 140 LEU HA   1 1 
        1  2227 1 1 140 LEU HB2  H  -7.228  -9.603  -2.050 1.00 . A A . 140 LEU HB2  1 1 
        1  2228 1 1 140 LEU HB3  H  -6.111  -9.534  -3.411 1.00 . A A . 140 LEU HB3  1 1 
        1  2229 1 1 140 LEU HD11 H  -8.504  -7.613  -2.587 1.00 . A A . 140 LEU HD11 1 1 
        1  2230 1 1 140 LEU HD12 H  -9.084  -7.294  -4.221 1.00 . A A . 140 LEU HD12 1 1 
        1  2231 1 1 140 LEU HD13 H  -7.351  -7.236  -3.874 1.00 . A A . 140 LEU HD13 1 1 
        1  2232 1 1 140 LEU HD21 H  -6.964  -9.050  -5.745 1.00 . A A . 140 LEU HD21 1 1 
        1  2233 1 1 140 LEU HD22 H  -8.706  -8.981  -6.043 1.00 . A A . 140 LEU HD22 1 1 
        1  2234 1 1 140 LEU HD23 H  -7.938 -10.523  -5.671 1.00 . A A . 140 LEU HD23 1 1 
        1  2235 1 1 140 LEU HG   H  -9.141  -9.670  -3.715 1.00 . A A . 140 LEU HG   1 1 
        1  2236 1 1 140 LEU N    N  -8.407 -11.940  -2.757 1.00 . A A . 140 LEU N    1 1 
        1  2237 1 1 140 LEU O    O  -4.819 -12.125  -2.585 1.00 . A A . 140 LEU O    1 1 
        1  2238 1 1 141 PHE C    C  -5.303 -14.463  -0.310 1.00 . A A . 141 PHE C    1 1 
        1  2239 1 1 141 PHE CA   C  -5.546 -12.970   0.034 1.00 . A A . 141 PHE CA   1 1 
        1  2240 1 1 141 PHE CB   C  -6.190 -12.816   1.438 1.00 . A A . 141 PHE CB   1 1 
        1  2241 1 1 141 PHE CD1  C  -4.167 -13.097   2.955 1.00 . A A . 141 PHE CD1  1 1 
        1  2242 1 1 141 PHE CD2  C  -6.011 -14.580   3.281 1.00 . A A . 141 PHE CD2  1 1 
        1  2243 1 1 141 PHE CE1  C  -3.488 -13.718   3.987 1.00 . A A . 141 PHE CE1  1 1 
        1  2244 1 1 141 PHE CE2  C  -5.327 -15.200   4.311 1.00 . A A . 141 PHE CE2  1 1 
        1  2245 1 1 141 PHE CG   C  -5.443 -13.513   2.581 1.00 . A A . 141 PHE CG   1 1 
        1  2246 1 1 141 PHE CZ   C  -4.067 -14.768   4.662 1.00 . A A . 141 PHE CZ   1 1 
        1  2247 1 1 141 PHE H    H  -7.324 -12.074  -0.721 1.00 . A A . 141 PHE H    1 1 
        1  2248 1 1 141 PHE HA   H  -4.589 -12.456   0.034 1.00 . A A . 141 PHE HA   1 1 
        1  2249 1 1 141 PHE HB2  H  -6.247 -11.759   1.681 1.00 . A A . 141 PHE HB2  1 1 
        1  2250 1 1 141 PHE HB3  H  -7.201 -13.211   1.400 1.00 . A A . 141 PHE HB3  1 1 
        1  2251 1 1 141 PHE HD1  H  -3.700 -12.267   2.431 1.00 . A A . 141 PHE HD1  1 1 
        1  2252 1 1 141 PHE HD2  H  -7.001 -14.925   3.010 1.00 . A A . 141 PHE HD2  1 1 
        1  2253 1 1 141 PHE HE1  H  -2.498 -13.380   4.260 1.00 . A A . 141 PHE HE1  1 1 
        1  2254 1 1 141 PHE HE2  H  -5.783 -16.024   4.845 1.00 . A A . 141 PHE HE2  1 1 
        1  2255 1 1 141 PHE HZ   H  -3.533 -15.256   5.466 1.00 . A A . 141 PHE HZ   1 1 
        1  2256 1 1 141 PHE N    N  -6.407 -12.319  -0.972 1.00 . A A . 141 PHE N    1 1 
        1  2257 1 1 141 PHE O    O  -4.185 -14.977  -0.137 1.00 . A A . 141 PHE O    1 1 
        1  2258 1 1 142 ASN C    C  -7.508 -16.938  -2.059 1.00 . A A . 142 ASN C    1 1 
        1  2259 1 1 142 ASN CA   C  -6.346 -16.580  -1.107 1.00 . A A . 142 ASN CA   1 1 
        1  2260 1 1 142 ASN CB   C  -6.468 -17.413   0.203 1.00 . A A . 142 ASN CB   1 1 
        1  2261 1 1 142 ASN CG   C  -6.519 -18.939  -0.026 1.00 . A A . 142 ASN CG   1 1 
        1  2262 1 1 142 ASN H    H  -7.166 -14.626  -1.027 1.00 . A A . 142 ASN H    1 1 
        1  2263 1 1 142 ASN HA   H  -5.402 -16.822  -1.589 1.00 . A A . 142 ASN HA   1 1 
        1  2264 1 1 142 ASN HB2  H  -5.616 -17.200   0.833 1.00 . A A . 142 ASN HB2  1 1 
        1  2265 1 1 142 ASN HB3  H  -7.369 -17.116   0.724 1.00 . A A . 142 ASN HB3  1 1 
        1  2266 1 1 142 ASN HD21 H  -5.166 -18.852  -1.507 1.00 . A A . 142 ASN HD21 1 1 
        1  2267 1 1 142 ASN HD22 H  -5.791 -20.418  -1.141 1.00 . A A . 142 ASN HD22 1 1 
        1  2268 1 1 142 ASN N    N  -6.355 -15.131  -0.818 1.00 . A A . 142 ASN N    1 1 
        1  2269 1 1 142 ASN ND2  N  -5.743 -19.455  -0.984 1.00 . A A . 142 ASN ND2  1 1 
        1  2270 1 1 142 ASN O    O  -8.680 -16.819  -1.697 1.00 . A A . 142 ASN O    1 1 
        1  2271 1 1 142 ASN OD1  O  -7.233 -19.658   0.681 1.00 . A A . 142 ASN OD1  1 1 
        1  2272 1 1 143 LYS C    C  -7.663 -19.157  -4.918 1.00 . A A . 143 LYS C    1 1 
        1  2273 1 1 143 LYS CA   C  -8.155 -17.857  -4.268 1.00 . A A . 143 LYS CA   1 1 
        1  2274 1 1 143 LYS CB   C  -8.409 -16.770  -5.358 1.00 . A A . 143 LYS CB   1 1 
        1  2275 1 1 143 LYS CD   C  -7.466 -15.327  -7.269 1.00 . A A . 143 LYS CD   1 1 
        1  2276 1 1 143 LYS CE   C  -6.225 -14.952  -8.098 1.00 . A A . 143 LYS CE   1 1 
        1  2277 1 1 143 LYS CG   C  -7.164 -16.390  -6.190 1.00 . A A . 143 LYS CG   1 1 
        1  2278 1 1 143 LYS H    H  -6.219 -17.418  -3.505 1.00 . A A . 143 LYS H    1 1 
        1  2279 1 1 143 LYS HA   H  -9.089 -18.067  -3.754 1.00 . A A . 143 LYS HA   1 1 
        1  2280 1 1 143 LYS HB2  H  -9.176 -17.128  -6.039 1.00 . A A . 143 LYS HB2  1 1 
        1  2281 1 1 143 LYS HB3  H  -8.780 -15.871  -4.871 1.00 . A A . 143 LYS HB3  1 1 
        1  2282 1 1 143 LYS HD2  H  -8.225 -15.713  -7.940 1.00 . A A . 143 LYS HD2  1 1 
        1  2283 1 1 143 LYS HD3  H  -7.846 -14.430  -6.785 1.00 . A A . 143 LYS HD3  1 1 
        1  2284 1 1 143 LYS HE2  H  -5.461 -14.556  -7.441 1.00 . A A . 143 LYS HE2  1 1 
        1  2285 1 1 143 LYS HE3  H  -5.841 -15.840  -8.590 1.00 . A A . 143 LYS HE3  1 1 
        1  2286 1 1 143 LYS HG2  H  -6.403 -16.004  -5.518 1.00 . A A . 143 LYS HG2  1 1 
        1  2287 1 1 143 LYS HG3  H  -6.787 -17.288  -6.672 1.00 . A A . 143 LYS HG3  1 1 
        1  2288 1 1 143 LYS HZ1  H  -6.961 -13.095  -8.690 1.00 . A A . 143 LYS HZ1  1 1 
        1  2289 1 1 143 LYS HZ2  H  -7.200 -14.321  -9.832 1.00 . A A . 143 LYS HZ2  1 1 
        1  2290 1 1 143 LYS HZ3  H  -5.664 -13.648  -9.617 1.00 . A A . 143 LYS HZ3  1 1 
        1  2291 1 1 143 LYS N    N  -7.170 -17.387  -3.271 1.00 . A A . 143 LYS N    1 1 
        1  2292 1 1 143 LYS NZ   N  -6.535 -13.936  -9.132 1.00 . A A . 143 LYS NZ   1 1 
        1  2293 1 1 143 LYS O    O  -6.518 -19.582  -4.709 1.00 . A A . 143 LYS O    1 1 
        1  2294 1 1 144 LEU C    C  -9.226 -20.950  -7.707 1.00 . A A . 144 LEU C    1 1 
        1  2295 1 1 144 LEU CA   C  -8.238 -20.930  -6.537 1.00 . A A . 144 LEU CA   1 1 
        1  2296 1 1 144 LEU CB   C  -8.262 -22.278  -5.742 1.00 . A A . 144 LEU CB   1 1 
        1  2297 1 1 144 LEU CD1  C  -9.504 -24.255  -4.689 1.00 . A A . 144 LEU CD1  1 1 
        1  2298 1 1 144 LEU CD2  C -10.324 -21.894  -4.226 1.00 . A A . 144 LEU CD2  1 1 
        1  2299 1 1 144 LEU CG   C  -9.651 -22.828  -5.255 1.00 . A A . 144 LEU CG   1 1 
        1  2300 1 1 144 LEU H    H  -9.473 -19.440  -5.703 1.00 . A A . 144 LEU H    1 1 
        1  2301 1 1 144 LEU HA   H  -7.237 -20.777  -6.938 1.00 . A A . 144 LEU HA   1 1 
        1  2302 1 1 144 LEU HB2  H  -7.804 -23.038  -6.371 1.00 . A A . 144 LEU HB2  1 1 
        1  2303 1 1 144 LEU HB3  H  -7.628 -22.154  -4.870 1.00 . A A . 144 LEU HB3  1 1 
        1  2304 1 1 144 LEU HD11 H  -8.840 -24.244  -3.830 1.00 . A A . 144 LEU HD11 1 1 
        1  2305 1 1 144 LEU HD12 H  -9.095 -24.903  -5.452 1.00 . A A . 144 LEU HD12 1 1 
        1  2306 1 1 144 LEU HD13 H -10.476 -24.627  -4.390 1.00 . A A . 144 LEU HD13 1 1 
        1  2307 1 1 144 LEU HD21 H -11.280 -22.306  -3.928 1.00 . A A . 144 LEU HD21 1 1 
        1  2308 1 1 144 LEU HD22 H -10.481 -20.923  -4.677 1.00 . A A . 144 LEU HD22 1 1 
        1  2309 1 1 144 LEU HD23 H  -9.693 -21.783  -3.354 1.00 . A A . 144 LEU HD23 1 1 
        1  2310 1 1 144 LEU HG   H -10.312 -22.900  -6.113 1.00 . A A . 144 LEU HG   1 1 
        1  2311 1 1 144 LEU N    N  -8.552 -19.776  -5.696 1.00 . A A . 144 LEU N    1 1 
        1  2312 1 1 144 LEU O    O -10.406 -20.589  -7.549 1.00 . A A . 144 LEU O    1 1 
        1  2313 1 1 145 GLU C    C  -9.394 -22.727 -10.783 1.00 . A A . 145 GLU C    1 1 
        1  2314 1 1 145 GLU CA   C  -9.512 -21.340 -10.134 1.00 . A A . 145 GLU CA   1 1 
        1  2315 1 1 145 GLU CB   C  -9.015 -20.185 -11.061 1.00 . A A . 145 GLU CB   1 1 
        1  2316 1 1 145 GLU CD   C  -8.552 -17.641 -11.242 1.00 . A A . 145 GLU CD   1 1 
        1  2317 1 1 145 GLU CG   C  -9.189 -18.780 -10.433 1.00 . A A . 145 GLU CG   1 1 
        1  2318 1 1 145 GLU H    H  -7.808 -21.654  -8.916 1.00 . A A . 145 GLU H    1 1 
        1  2319 1 1 145 GLU HA   H -10.561 -21.164  -9.893 1.00 . A A . 145 GLU HA   1 1 
        1  2320 1 1 145 GLU HB2  H  -7.963 -20.339 -11.279 1.00 . A A . 145 GLU HB2  1 1 
        1  2321 1 1 145 GLU HB3  H  -9.571 -20.213 -11.992 1.00 . A A . 145 GLU HB3  1 1 
        1  2322 1 1 145 GLU HG2  H -10.248 -18.579 -10.330 1.00 . A A . 145 GLU HG2  1 1 
        1  2323 1 1 145 GLU HG3  H  -8.746 -18.795  -9.438 1.00 . A A . 145 GLU HG3  1 1 
        1  2324 1 1 145 GLU N    N  -8.735 -21.340  -8.884 1.00 . A A . 145 GLU N    1 1 
        1  2325 1 1 145 GLU O    O  -8.552 -22.961 -11.657 1.00 . A A . 145 GLU O    1 1 
        1  2326 1 1 145 GLU OE1  O  -9.121 -17.245 -12.281 1.00 . A A . 145 GLU OE1  1 1 
        1  2327 1 1 145 GLU OE2  O  -7.486 -17.117 -10.836 1.00 . A A . 145 GLU OE2  1 1 
        1  2328 1 1 146 HIS C    C -10.793 -25.326 -12.026 1.00 . A A . 146 HIS C    1 1 
        1  2329 1 1 146 HIS CA   C -10.163 -25.082 -10.642 1.00 . A A . 146 HIS CA   1 1 
        1  2330 1 1 146 HIS CB   C -10.867 -25.943  -9.556 1.00 . A A . 146 HIS CB   1 1 
        1  2331 1 1 146 HIS CD2  C -10.007 -28.334 -10.180 1.00 . A A . 146 HIS CD2  1 1 
        1  2332 1 1 146 HIS CE1  C -11.936 -29.374 -10.203 1.00 . A A . 146 HIS CE1  1 1 
        1  2333 1 1 146 HIS CG   C -10.962 -27.423  -9.868 1.00 . A A . 146 HIS CG   1 1 
        1  2334 1 1 146 HIS H    H -10.887 -23.376  -9.626 1.00 . A A . 146 HIS H    1 1 
        1  2335 1 1 146 HIS HA   H  -9.115 -25.372 -10.678 1.00 . A A . 146 HIS HA   1 1 
        1  2336 1 1 146 HIS HB2  H -10.323 -25.847  -8.629 1.00 . A A . 146 HIS HB2  1 1 
        1  2337 1 1 146 HIS HB3  H -11.874 -25.568  -9.409 1.00 . A A . 146 HIS HB3  1 1 
        1  2338 1 1 146 HIS HD1  H -13.045 -27.733  -9.701 1.00 . A A . 146 HIS HD1  1 1 
        1  2339 1 1 146 HIS HD2  H  -8.942 -28.151 -10.242 1.00 . A A . 146 HIS HD2  1 1 
        1  2340 1 1 146 HIS HE1  H -12.690 -30.148 -10.298 1.00 . A A . 146 HIS HE1  1 1 
        1  2341 1 1 146 HIS HE2  H -10.200 -30.394 -10.552 1.00 . A A . 146 HIS HE2  1 1 
        1  2342 1 1 146 HIS N    N -10.215 -23.660 -10.272 1.00 . A A . 146 HIS N    1 1 
        1  2343 1 1 146 HIS ND1  N -12.159 -28.113  -9.897 1.00 . A A . 146 HIS ND1  1 1 
        1  2344 1 1 146 HIS NE2  N -10.641 -29.535 -10.384 1.00 . A A . 146 HIS NE2  1 1 
        1  2345 1 1 146 HIS O    O -12.025 -25.321 -12.169 1.00 . A A . 146 HIS O    1 1 
        1  2346 1 1 147 HIS C    C -10.219 -27.497 -14.450 1.00 . A A . 147 HIS C    1 1 
        1  2347 1 1 147 HIS CA   C -10.352 -25.950 -14.377 1.00 . A A . 147 HIS CA   1 1 
        1  2348 1 1 147 HIS CB   C  -9.520 -25.218 -15.476 1.00 . A A . 147 HIS CB   1 1 
        1  2349 1 1 147 HIS CD2  C -10.888 -25.202 -17.697 1.00 . A A . 147 HIS CD2  1 1 
        1  2350 1 1 147 HIS CE1  C  -9.753 -26.739 -18.766 1.00 . A A . 147 HIS CE1  1 1 
        1  2351 1 1 147 HIS CG   C  -9.888 -25.617 -16.880 1.00 . A A . 147 HIS CG   1 1 
        1  2352 1 1 147 HIS H    H  -8.977 -25.361 -12.881 1.00 . A A . 147 HIS H    1 1 
        1  2353 1 1 147 HIS HA   H -11.403 -25.683 -14.507 1.00 . A A . 147 HIS HA   1 1 
        1  2354 1 1 147 HIS HB2  H  -9.666 -24.150 -15.383 1.00 . A A . 147 HIS HB2  1 1 
        1  2355 1 1 147 HIS HB3  H  -8.466 -25.437 -15.333 1.00 . A A . 147 HIS HB3  1 1 
        1  2356 1 1 147 HIS HD1  H  -8.425 -27.076 -17.252 1.00 . A A . 147 HIS HD1  1 1 
        1  2357 1 1 147 HIS HD2  H -11.628 -24.444 -17.473 1.00 . A A . 147 HIS HD2  1 1 
        1  2358 1 1 147 HIS HE1  H  -9.425 -27.436 -19.526 1.00 . A A . 147 HIS HE1  1 1 
        1  2359 1 1 147 HIS HE2  H -11.491 -25.985 -19.548 1.00 . A A . 147 HIS HE2  1 1 
        1  2360 1 1 147 HIS N    N  -9.932 -25.515 -13.040 1.00 . A A . 147 HIS N    1 1 
        1  2361 1 1 147 HIS ND1  N  -9.200 -26.575 -17.582 1.00 . A A . 147 HIS ND1  1 1 
        1  2362 1 1 147 HIS NE2  N -10.784 -25.917 -18.863 1.00 . A A . 147 HIS NE2  1 1 
        1  2363 1 1 147 HIS O    O  -9.150 -28.005 -14.849 1.00 . A A . 147 HIS O    1 1 
        2  2364 1 1   1 MET C    C -21.221  10.782  17.780 1.00 . A A .   1 MET C    1 1 
        2  2365 1 1   1 MET CA   C -21.685  12.249  17.789 1.00 . A A .   1 MET CA   1 1 
        2  2366 1 1   1 MET CB   C -20.480  13.205  18.035 1.00 . A A .   1 MET CB   1 1 
        2  2367 1 1   1 MET CE   C -20.165  17.405  18.253 1.00 . A A .   1 MET CE   1 1 
        2  2368 1 1   1 MET CG   C -20.829  14.702  17.976 1.00 . A A .   1 MET CG   1 1 
        2  2369 1 1   1 MET H1   H -22.318  12.240  19.775 1.00 . A A .   1 MET H1   1 1 
        2  2370 1 1   1 MET H2   H -23.522  11.823  18.672 1.00 . A A .   1 MET H2   1 1 
        2  2371 1 1   1 MET H3   H -23.053  13.436  18.834 1.00 . A A .   1 MET H3   1 1 
        2  2372 1 1   1 MET HA   H -22.133  12.484  16.833 1.00 . A A .   1 MET HA   1 1 
        2  2373 1 1   1 MET HB2  H -20.062  12.999  19.015 1.00 . A A .   1 MET HB2  1 1 
        2  2374 1 1   1 MET HB3  H -19.716  13.008  17.290 1.00 . A A .   1 MET HB3  1 1 
        2  2375 1 1   1 MET HE1  H -20.486  17.513  17.228 1.00 . A A .   1 MET HE1  1 1 
        2  2376 1 1   1 MET HE2  H -19.418  18.155  18.479 1.00 . A A .   1 MET HE2  1 1 
        2  2377 1 1   1 MET HE3  H -21.008  17.532  18.912 1.00 . A A .   1 MET HE3  1 1 
        2  2378 1 1   1 MET HG2  H -21.100  14.955  16.957 1.00 . A A .   1 MET HG2  1 1 
        2  2379 1 1   1 MET HG3  H -21.679  14.892  18.624 1.00 . A A .   1 MET HG3  1 1 
        2  2380 1 1   1 MET N    N -22.713  12.452  18.837 1.00 . A A .   1 MET N    1 1 
        2  2381 1 1   1 MET O    O -20.807  10.258  18.815 1.00 . A A .   1 MET O    1 1 
        2  2382 1 1   1 MET SD   S -19.463  15.768  18.489 1.00 . A A .   1 MET SD   1 1 
        2  2383 1 1   2 ALA C    C -19.577   8.740  15.550 1.00 . A A .   2 ALA C    1 1 
        2  2384 1 1   2 ALA CA   C -20.854   8.732  16.399 1.00 . A A .   2 ALA CA   1 1 
        2  2385 1 1   2 ALA CB   C -21.958   7.896  15.728 1.00 . A A .   2 ALA CB   1 1 
        2  2386 1 1   2 ALA H    H -21.724  10.591  15.845 1.00 . A A .   2 ALA H    1 1 
        2  2387 1 1   2 ALA HA   H -20.628   8.282  17.366 1.00 . A A .   2 ALA HA   1 1 
        2  2388 1 1   2 ALA HB1  H -22.842   7.898  16.353 1.00 . A A .   2 ALA HB1  1 1 
        2  2389 1 1   2 ALA HB2  H -21.620   6.876  15.594 1.00 . A A .   2 ALA HB2  1 1 
        2  2390 1 1   2 ALA HB3  H -22.206   8.320  14.761 1.00 . A A .   2 ALA HB3  1 1 
        2  2391 1 1   2 ALA N    N -21.325  10.122  16.608 1.00 . A A .   2 ALA N    1 1 
        2  2392 1 1   2 ALA O    O -19.221   9.769  14.973 1.00 . A A .   2 ALA O    1 1 
        2  2393 1 1   3 TYR C    C -17.970   7.425  13.208 1.00 . A A .   3 TYR C    1 1 
        2  2394 1 1   3 TYR CA   C -17.638   7.481  14.706 1.00 . A A .   3 TYR CA   1 1 
        2  2395 1 1   3 TYR CB   C -16.808   6.258  15.170 1.00 . A A .   3 TYR CB   1 1 
        2  2396 1 1   3 TYR CD1  C -15.545   7.323  17.112 1.00 . A A .   3 TYR CD1  1 1 
        2  2397 1 1   3 TYR CD2  C -16.939   5.442  17.603 1.00 . A A .   3 TYR CD2  1 1 
        2  2398 1 1   3 TYR CE1  C -15.203   7.420  18.444 1.00 . A A .   3 TYR CE1  1 1 
        2  2399 1 1   3 TYR CE2  C -16.597   5.543  18.940 1.00 . A A .   3 TYR CE2  1 1 
        2  2400 1 1   3 TYR CG   C -16.418   6.331  16.656 1.00 . A A .   3 TYR CG   1 1 
        2  2401 1 1   3 TYR CZ   C -15.730   6.533  19.355 1.00 . A A .   3 TYR CZ   1 1 
        2  2402 1 1   3 TYR H    H -19.207   6.812  15.968 1.00 . A A .   3 TYR H    1 1 
        2  2403 1 1   3 TYR HA   H -17.048   8.379  14.893 1.00 . A A .   3 TYR HA   1 1 
        2  2404 1 1   3 TYR HB2  H -17.379   5.353  15.003 1.00 . A A .   3 TYR HB2  1 1 
        2  2405 1 1   3 TYR HB3  H -15.892   6.205  14.588 1.00 . A A .   3 TYR HB3  1 1 
        2  2406 1 1   3 TYR HD1  H -15.125   8.028  16.402 1.00 . A A .   3 TYR HD1  1 1 
        2  2407 1 1   3 TYR HD2  H -17.619   4.662  17.281 1.00 . A A .   3 TYR HD2  1 1 
        2  2408 1 1   3 TYR HE1  H -14.523   8.199  18.771 1.00 . A A .   3 TYR HE1  1 1 
        2  2409 1 1   3 TYR HE2  H -17.014   4.843  19.656 1.00 . A A .   3 TYR HE2  1 1 
        2  2410 1 1   3 TYR HH   H -15.175   5.767  21.028 1.00 . A A .   3 TYR HH   1 1 
        2  2411 1 1   3 TYR N    N -18.880   7.597  15.486 1.00 . A A .   3 TYR N    1 1 
        2  2412 1 1   3 TYR O    O -18.228   6.351  12.645 1.00 . A A .   3 TYR O    1 1 
        2  2413 1 1   3 TYR OH   O -15.398   6.639  20.685 1.00 . A A .   3 TYR OH   1 1 
        2  2414 1 1   4 ASN C    C -17.006   8.648  10.352 1.00 . A A .   4 ASN C    1 1 
        2  2415 1 1   4 ASN CA   C -18.295   8.795  11.161 1.00 . A A .   4 ASN CA   1 1 
        2  2416 1 1   4 ASN CB   C -18.937  10.189  10.890 1.00 . A A .   4 ASN CB   1 1 
        2  2417 1 1   4 ASN CG   C -20.347  10.332  11.468 1.00 . A A .   4 ASN CG   1 1 
        2  2418 1 1   4 ASN H    H -17.868   9.422  13.136 1.00 . A A .   4 ASN H    1 1 
        2  2419 1 1   4 ASN HA   H -18.991   8.019  10.852 1.00 . A A .   4 ASN HA   1 1 
        2  2420 1 1   4 ASN HB2  H -18.313  10.957  11.328 1.00 . A A .   4 ASN HB2  1 1 
        2  2421 1 1   4 ASN HB3  H -18.990  10.361   9.817 1.00 . A A .   4 ASN HB3  1 1 
        2  2422 1 1   4 ASN HD21 H -21.141   9.619   9.789 1.00 . A A .   4 ASN HD21 1 1 
        2  2423 1 1   4 ASN HD22 H -22.262  10.047  11.032 1.00 . A A .   4 ASN HD22 1 1 
        2  2424 1 1   4 ASN N    N -18.016   8.621  12.594 1.00 . A A .   4 ASN N    1 1 
        2  2425 1 1   4 ASN ND2  N -21.352   9.965  10.685 1.00 . A A .   4 ASN ND2  1 1 
        2  2426 1 1   4 ASN O    O -15.914   8.932  10.857 1.00 . A A .   4 ASN O    1 1 
        2  2427 1 1   4 ASN OD1  O -20.526  10.774  12.598 1.00 . A A .   4 ASN OD1  1 1 
        2  2428 1 1   5 LYS C    C -15.316   9.411   7.969 1.00 . A A .   5 LYS C    1 1 
        2  2429 1 1   5 LYS CA   C -16.039   8.068   8.150 1.00 . A A .   5 LYS CA   1 1 
        2  2430 1 1   5 LYS CB   C -16.539   7.557   6.784 1.00 . A A .   5 LYS CB   1 1 
        2  2431 1 1   5 LYS CD   C -17.700   5.735   5.428 1.00 . A A .   5 LYS CD   1 1 
        2  2432 1 1   5 LYS CE   C -18.459   4.406   5.456 1.00 . A A .   5 LYS CE   1 1 
        2  2433 1 1   5 LYS CG   C -17.252   6.195   6.829 1.00 . A A .   5 LYS CG   1 1 
        2  2434 1 1   5 LYS H    H -18.051   7.921   8.803 1.00 . A A .   5 LYS H    1 1 
        2  2435 1 1   5 LYS HA   H -15.345   7.340   8.566 1.00 . A A .   5 LYS HA   1 1 
        2  2436 1 1   5 LYS HB2  H -17.233   8.285   6.372 1.00 . A A .   5 LYS HB2  1 1 
        2  2437 1 1   5 LYS HB3  H -15.690   7.470   6.112 1.00 . A A .   5 LYS HB3  1 1 
        2  2438 1 1   5 LYS HD2  H -18.343   6.495   4.997 1.00 . A A .   5 LYS HD2  1 1 
        2  2439 1 1   5 LYS HD3  H -16.819   5.622   4.800 1.00 . A A .   5 LYS HD3  1 1 
        2  2440 1 1   5 LYS HE2  H -17.838   3.644   5.911 1.00 . A A .   5 LYS HE2  1 1 
        2  2441 1 1   5 LYS HE3  H -19.364   4.522   6.040 1.00 . A A .   5 LYS HE3  1 1 
        2  2442 1 1   5 LYS HG2  H -16.572   5.456   7.242 1.00 . A A .   5 LYS HG2  1 1 
        2  2443 1 1   5 LYS HG3  H -18.125   6.275   7.473 1.00 . A A .   5 LYS HG3  1 1 
        2  2444 1 1   5 LYS HZ1  H -17.976   3.856   3.507 1.00 . A A .   5 LYS HZ1  1 1 
        2  2445 1 1   5 LYS HZ2  H -19.454   4.659   3.641 1.00 . A A .   5 LYS HZ2  1 1 
        2  2446 1 1   5 LYS HZ3  H -19.320   3.047   4.132 1.00 . A A .   5 LYS HZ3  1 1 
        2  2447 1 1   5 LYS N    N -17.158   8.201   9.094 1.00 . A A .   5 LYS N    1 1 
        2  2448 1 1   5 LYS NZ   N -18.829   3.962   4.090 1.00 . A A .   5 LYS NZ   1 1 
        2  2449 1 1   5 LYS O    O -14.103   9.472   8.106 1.00 . A A .   5 LYS O    1 1 
        2  2450 1 1   6 GLU C    C -14.794  12.342   8.759 1.00 . A A .   6 GLU C    1 1 
        2  2451 1 1   6 GLU CA   C -15.552  11.841   7.505 1.00 . A A .   6 GLU CA   1 1 
        2  2452 1 1   6 GLU CB   C -16.678  12.839   7.104 1.00 . A A .   6 GLU CB   1 1 
        2  2453 1 1   6 GLU CD   C -18.851  14.065   7.739 1.00 . A A .   6 GLU CD   1 1 
        2  2454 1 1   6 GLU CG   C -17.830  12.979   8.123 1.00 . A A .   6 GLU CG   1 1 
        2  2455 1 1   6 GLU H    H -17.060  10.334   7.647 1.00 . A A .   6 GLU H    1 1 
        2  2456 1 1   6 GLU HA   H -14.840  11.782   6.680 1.00 . A A .   6 GLU HA   1 1 
        2  2457 1 1   6 GLU HB2  H -16.237  13.823   6.950 1.00 . A A .   6 GLU HB2  1 1 
        2  2458 1 1   6 GLU HB3  H -17.106  12.515   6.159 1.00 . A A .   6 GLU HB3  1 1 
        2  2459 1 1   6 GLU HG2  H -18.343  12.026   8.192 1.00 . A A .   6 GLU HG2  1 1 
        2  2460 1 1   6 GLU HG3  H -17.408  13.212   9.100 1.00 . A A .   6 GLU HG3  1 1 
        2  2461 1 1   6 GLU N    N -16.094  10.476   7.708 1.00 . A A .   6 GLU N    1 1 
        2  2462 1 1   6 GLU O    O -13.752  12.982   8.633 1.00 . A A .   6 GLU O    1 1 
        2  2463 1 1   6 GLU OE1  O -19.684  13.821   6.842 1.00 . A A .   6 GLU OE1  1 1 
        2  2464 1 1   6 GLU OE2  O -18.805  15.171   8.318 1.00 . A A .   6 GLU OE2  1 1 
        2  2465 1 1   7 GLU C    C -13.327  11.691  11.377 1.00 . A A .   7 GLU C    1 1 
        2  2466 1 1   7 GLU CA   C -14.724  12.350  11.252 1.00 . A A .   7 GLU CA   1 1 
        2  2467 1 1   7 GLU CB   C -15.658  11.883  12.411 1.00 . A A .   7 GLU CB   1 1 
        2  2468 1 1   7 GLU CD   C -15.996  11.569  14.949 1.00 . A A .   7 GLU CD   1 1 
        2  2469 1 1   7 GLU CG   C -15.116  12.156  13.829 1.00 . A A .   7 GLU CG   1 1 
        2  2470 1 1   7 GLU H    H -16.239  11.627   9.947 1.00 . A A .   7 GLU H    1 1 
        2  2471 1 1   7 GLU HA   H -14.615  13.431  11.309 1.00 . A A .   7 GLU HA   1 1 
        2  2472 1 1   7 GLU HB2  H -16.614  12.390  12.313 1.00 . A A .   7 GLU HB2  1 1 
        2  2473 1 1   7 GLU HB3  H -15.828  10.815  12.308 1.00 . A A .   7 GLU HB3  1 1 
        2  2474 1 1   7 GLU HG2  H -14.121  11.726  13.906 1.00 . A A .   7 GLU HG2  1 1 
        2  2475 1 1   7 GLU HG3  H -15.038  13.231  13.964 1.00 . A A .   7 GLU HG3  1 1 
        2  2476 1 1   7 GLU N    N -15.347  12.036   9.950 1.00 . A A .   7 GLU N    1 1 
        2  2477 1 1   7 GLU O    O -12.352  12.346  11.764 1.00 . A A .   7 GLU O    1 1 
        2  2478 1 1   7 GLU OE1  O -15.895  10.349  15.215 1.00 . A A .   7 GLU OE1  1 1 
        2  2479 1 1   7 GLU OE2  O -16.784  12.321  15.569 1.00 . A A .   7 GLU OE2  1 1 
        2  2480 1 1   8 LYS C    C -10.950  10.017  10.123 1.00 . A A .   8 LYS C    1 1 
        2  2481 1 1   8 LYS CA   C -12.029   9.583  11.130 1.00 . A A .   8 LYS CA   1 1 
        2  2482 1 1   8 LYS CB   C -12.356   8.064  10.975 1.00 . A A .   8 LYS CB   1 1 
        2  2483 1 1   8 LYS CD   C -12.653   7.433  13.508 1.00 . A A .   8 LYS CD   1 1 
        2  2484 1 1   8 LYS CE   C -12.905   8.736  14.303 1.00 . A A .   8 LYS CE   1 1 
        2  2485 1 1   8 LYS CG   C -13.272   7.433  12.073 1.00 . A A .   8 LYS CG   1 1 
        2  2486 1 1   8 LYS H    H -14.050  10.003  10.571 1.00 . A A .   8 LYS H    1 1 
        2  2487 1 1   8 LYS HA   H -11.641   9.746  12.136 1.00 . A A .   8 LYS HA   1 1 
        2  2488 1 1   8 LYS HB2  H -12.841   7.915  10.016 1.00 . A A .   8 LYS HB2  1 1 
        2  2489 1 1   8 LYS HB3  H -11.421   7.509  10.968 1.00 . A A .   8 LYS HB3  1 1 
        2  2490 1 1   8 LYS HD2  H -13.081   6.612  14.067 1.00 . A A .   8 LYS HD2  1 1 
        2  2491 1 1   8 LYS HD3  H -11.581   7.275  13.424 1.00 . A A .   8 LYS HD3  1 1 
        2  2492 1 1   8 LYS HE2  H -12.699   9.587  13.669 1.00 . A A .   8 LYS HE2  1 1 
        2  2493 1 1   8 LYS HE3  H -13.944   8.775  14.615 1.00 . A A .   8 LYS HE3  1 1 
        2  2494 1 1   8 LYS HG2  H -14.211   7.976  12.101 1.00 . A A .   8 LYS HG2  1 1 
        2  2495 1 1   8 LYS HG3  H -13.481   6.404  11.791 1.00 . A A .   8 LYS HG3  1 1 
        2  2496 1 1   8 LYS HZ1  H -11.049   8.716  15.236 1.00 . A A .   8 LYS HZ1  1 1 
        2  2497 1 1   8 LYS HZ2  H -12.307   8.100  16.184 1.00 . A A .   8 LYS HZ2  1 1 
        2  2498 1 1   8 LYS HZ3  H -12.169   9.768  15.945 1.00 . A A .   8 LYS HZ3  1 1 
        2  2499 1 1   8 LYS N    N -13.252  10.401  10.990 1.00 . A A .   8 LYS N    1 1 
        2  2500 1 1   8 LYS NZ   N -12.048   8.836  15.501 1.00 . A A .   8 LYS NZ   1 1 
        2  2501 1 1   8 LYS O    O  -9.829  10.329  10.513 1.00 . A A .   8 LYS O    1 1 
        2  2502 1 1   9 ILE C    C  -9.838  11.763   7.786 1.00 . A A .   9 ILE C    1 1 
        2  2503 1 1   9 ILE CA   C -10.440  10.344   7.703 1.00 . A A .   9 ILE CA   1 1 
        2  2504 1 1   9 ILE CB   C -11.195  10.114   6.324 1.00 . A A .   9 ILE CB   1 1 
        2  2505 1 1   9 ILE CD1  C -10.634   7.578   6.348 1.00 . A A .   9 ILE CD1  1 1 
        2  2506 1 1   9 ILE CG1  C -11.709   8.637   6.213 1.00 . A A .   9 ILE CG1  1 1 
        2  2507 1 1   9 ILE CG2  C -10.310  10.481   5.099 1.00 . A A .   9 ILE CG2  1 1 
        2  2508 1 1   9 ILE H    H -12.282   9.917   8.649 1.00 . A A .   9 ILE H    1 1 
        2  2509 1 1   9 ILE HA   H  -9.626   9.626   7.760 1.00 . A A .   9 ILE HA   1 1 
        2  2510 1 1   9 ILE HB   H -12.061  10.778   6.309 1.00 . A A .   9 ILE HB   1 1 
        2  2511 1 1   9 ILE HD11 H -10.185   7.640   7.332 1.00 . A A .   9 ILE HD11 1 1 
        2  2512 1 1   9 ILE HD12 H  -9.871   7.732   5.596 1.00 . A A .   9 ILE HD12 1 1 
        2  2513 1 1   9 ILE HD13 H -11.073   6.602   6.218 1.00 . A A .   9 ILE HD13 1 1 
        2  2514 1 1   9 ILE HG12 H -12.435   8.454   6.993 1.00 . A A .   9 ILE HG12 1 1 
        2  2515 1 1   9 ILE HG13 H -12.193   8.495   5.251 1.00 . A A .   9 ILE HG13 1 1 
        2  2516 1 1   9 ILE HG21 H -10.028  11.526   5.156 1.00 . A A .   9 ILE HG21 1 1 
        2  2517 1 1   9 ILE HG22 H -10.863  10.312   4.183 1.00 . A A .   9 ILE HG22 1 1 
        2  2518 1 1   9 ILE HG23 H  -9.417   9.868   5.097 1.00 . A A .   9 ILE HG23 1 1 
        2  2519 1 1   9 ILE N    N -11.339  10.072   8.842 1.00 . A A .   9 ILE N    1 1 
        2  2520 1 1   9 ILE O    O  -8.679  11.958   7.431 1.00 . A A .   9 ILE O    1 1 
        2  2521 1 1  10 LYS C    C  -8.967  14.260   9.368 1.00 . A A .  10 LYS C    1 1 
        2  2522 1 1  10 LYS CA   C -10.197  14.134   8.449 1.00 . A A .  10 LYS CA   1 1 
        2  2523 1 1  10 LYS CB   C -11.377  14.978   9.004 1.00 . A A .  10 LYS CB   1 1 
        2  2524 1 1  10 LYS CD   C -12.315  17.269   9.698 1.00 . A A .  10 LYS CD   1 1 
        2  2525 1 1  10 LYS CE   C -12.825  16.806  11.078 1.00 . A A .  10 LYS CE   1 1 
        2  2526 1 1  10 LYS CG   C -11.081  16.480   9.203 1.00 . A A .  10 LYS CG   1 1 
        2  2527 1 1  10 LYS H    H -11.529  12.488   8.588 1.00 . A A .  10 LYS H    1 1 
        2  2528 1 1  10 LYS HA   H  -9.939  14.503   7.456 1.00 . A A .  10 LYS HA   1 1 
        2  2529 1 1  10 LYS HB2  H -12.217  14.887   8.318 1.00 . A A .  10 LYS HB2  1 1 
        2  2530 1 1  10 LYS HB3  H -11.678  14.560   9.959 1.00 . A A .  10 LYS HB3  1 1 
        2  2531 1 1  10 LYS HD2  H -12.049  18.316   9.765 1.00 . A A .  10 LYS HD2  1 1 
        2  2532 1 1  10 LYS HD3  H -13.116  17.157   8.972 1.00 . A A .  10 LYS HD3  1 1 
        2  2533 1 1  10 LYS HE2  H -13.060  15.751  11.037 1.00 . A A .  10 LYS HE2  1 1 
        2  2534 1 1  10 LYS HE3  H -12.052  16.969  11.819 1.00 . A A .  10 LYS HE3  1 1 
        2  2535 1 1  10 LYS HG2  H -10.283  16.590   9.929 1.00 . A A .  10 LYS HG2  1 1 
        2  2536 1 1  10 LYS HG3  H -10.754  16.901   8.254 1.00 . A A .  10 LYS HG3  1 1 
        2  2537 1 1  10 LYS HZ1  H -14.815  17.385  10.809 1.00 . A A .  10 LYS HZ1  1 1 
        2  2538 1 1  10 LYS HZ2  H -13.850  18.564  11.541 1.00 . A A .  10 LYS HZ2  1 1 
        2  2539 1 1  10 LYS HZ3  H -14.360  17.224  12.427 1.00 . A A .  10 LYS HZ3  1 1 
        2  2540 1 1  10 LYS N    N -10.622  12.723   8.303 1.00 . A A .  10 LYS N    1 1 
        2  2541 1 1  10 LYS NZ   N -14.046  17.545  11.492 1.00 . A A .  10 LYS NZ   1 1 
        2  2542 1 1  10 LYS O    O  -7.993  14.942   9.025 1.00 . A A .  10 LYS O    1 1 
        2  2543 1 1  11 SER C    C  -6.762  12.728  10.938 1.00 . A A .  11 SER C    1 1 
        2  2544 1 1  11 SER CA   C  -7.939  13.546  11.502 1.00 . A A .  11 SER CA   1 1 
        2  2545 1 1  11 SER CB   C  -8.450  12.925  12.820 1.00 . A A .  11 SER CB   1 1 
        2  2546 1 1  11 SER H    H  -9.842  13.056  10.709 1.00 . A A .  11 SER H    1 1 
        2  2547 1 1  11 SER HA   H  -7.612  14.573  11.686 1.00 . A A .  11 SER HA   1 1 
        2  2548 1 1  11 SER HB2  H  -8.679  11.878  12.661 1.00 . A A .  11 SER HB2  1 1 
        2  2549 1 1  11 SER HB3  H  -7.689  13.011  13.587 1.00 . A A .  11 SER HB3  1 1 
        2  2550 1 1  11 SER HG   H  -9.737  14.408  12.821 1.00 . A A .  11 SER HG   1 1 
        2  2551 1 1  11 SER N    N  -9.029  13.574  10.518 1.00 . A A .  11 SER N    1 1 
        2  2552 1 1  11 SER O    O  -5.623  13.195  10.898 1.00 . A A .  11 SER O    1 1 
        2  2553 1 1  11 SER OG   O  -9.629  13.569  13.279 1.00 . A A .  11 SER OG   1 1 
        2  2554 1 1  12 LEU C    C  -5.219  11.035   8.841 1.00 . A A .  12 LEU C    1 1 
        2  2555 1 1  12 LEU CA   C  -6.158  10.501   9.949 1.00 . A A .  12 LEU CA   1 1 
        2  2556 1 1  12 LEU CB   C  -7.030   9.373   9.365 1.00 . A A .  12 LEU CB   1 1 
        2  2557 1 1  12 LEU CD1  C  -5.655   7.301   9.926 1.00 . A A .  12 LEU CD1  1 1 
        2  2558 1 1  12 LEU CD2  C  -7.220   7.322   7.887 1.00 . A A .  12 LEU CD2  1 1 
        2  2559 1 1  12 LEU CG   C  -6.285   8.143   8.793 1.00 . A A .  12 LEU CG   1 1 
        2  2560 1 1  12 LEU H    H  -8.005  11.183  10.631 1.00 . A A .  12 LEU H    1 1 
        2  2561 1 1  12 LEU HA   H  -5.567  10.098  10.763 1.00 . A A .  12 LEU HA   1 1 
        2  2562 1 1  12 LEU HB2  H  -7.708   9.029  10.146 1.00 . A A .  12 LEU HB2  1 1 
        2  2563 1 1  12 LEU HB3  H  -7.636   9.806   8.573 1.00 . A A .  12 LEU HB3  1 1 
        2  2564 1 1  12 LEU HD11 H  -4.933   7.906  10.462 1.00 . A A .  12 LEU HD11 1 1 
        2  2565 1 1  12 LEU HD12 H  -5.148   6.445   9.503 1.00 . A A .  12 LEU HD12 1 1 
        2  2566 1 1  12 LEU HD13 H  -6.420   6.962  10.613 1.00 . A A .  12 LEU HD13 1 1 
        2  2567 1 1  12 LEU HD21 H  -8.055   6.939   8.458 1.00 . A A .  12 LEU HD21 1 1 
        2  2568 1 1  12 LEU HD22 H  -6.673   6.497   7.451 1.00 . A A .  12 LEU HD22 1 1 
        2  2569 1 1  12 LEU HD23 H  -7.594   7.953   7.087 1.00 . A A .  12 LEU HD23 1 1 
        2  2570 1 1  12 LEU HG   H  -5.467   8.491   8.173 1.00 . A A .  12 LEU HG   1 1 
        2  2571 1 1  12 LEU N    N  -7.087  11.502  10.509 1.00 . A A .  12 LEU N    1 1 
        2  2572 1 1  12 LEU O    O  -4.019  10.717   8.817 1.00 . A A .  12 LEU O    1 1 
        2  2573 1 1  13 ASN C    C  -3.935  13.289   7.103 1.00 . A A .  13 ASN C    1 1 
        2  2574 1 1  13 ASN CA   C  -5.068  12.329   6.724 1.00 . A A .  13 ASN CA   1 1 
        2  2575 1 1  13 ASN CB   C  -6.052  12.994   5.712 1.00 . A A .  13 ASN CB   1 1 
        2  2576 1 1  13 ASN CG   C  -6.779  11.993   4.795 1.00 . A A .  13 ASN CG   1 1 
        2  2577 1 1  13 ASN H    H  -6.725  12.096   8.051 1.00 . A A .  13 ASN H    1 1 
        2  2578 1 1  13 ASN HA   H  -4.616  11.468   6.238 1.00 . A A .  13 ASN HA   1 1 
        2  2579 1 1  13 ASN HB2  H  -6.799  13.553   6.252 1.00 . A A .  13 ASN HB2  1 1 
        2  2580 1 1  13 ASN HB3  H  -5.501  13.683   5.072 1.00 . A A .  13 ASN HB3  1 1 
        2  2581 1 1  13 ASN HD21 H  -6.924  10.606   6.232 1.00 . A A .  13 ASN HD21 1 1 
        2  2582 1 1  13 ASN HD22 H  -7.586  10.177   4.697 1.00 . A A .  13 ASN HD22 1 1 
        2  2583 1 1  13 ASN N    N  -5.790  11.826   7.915 1.00 . A A .  13 ASN N    1 1 
        2  2584 1 1  13 ASN ND2  N  -7.133  10.809   5.295 1.00 . A A .  13 ASN ND2  1 1 
        2  2585 1 1  13 ASN O    O  -2.987  13.445   6.342 1.00 . A A .  13 ASN O    1 1 
        2  2586 1 1  13 ASN OD1  O  -7.057  12.303   3.636 1.00 . A A .  13 ASN OD1  1 1 
        2  2587 1 1  14 ARG C    C  -1.591  14.082   8.818 1.00 . A A .  14 ARG C    1 1 
        2  2588 1 1  14 ARG CA   C  -2.965  14.801   8.811 1.00 . A A .  14 ARG CA   1 1 
        2  2589 1 1  14 ARG CB   C  -3.337  15.307  10.233 1.00 . A A .  14 ARG CB   1 1 
        2  2590 1 1  14 ARG CD   C  -2.778  17.778   9.814 1.00 . A A .  14 ARG CD   1 1 
        2  2591 1 1  14 ARG CG   C  -2.527  16.537  10.699 1.00 . A A .  14 ARG CG   1 1 
        2  2592 1 1  14 ARG CZ   C  -5.079  18.152   8.841 1.00 . A A .  14 ARG CZ   1 1 
        2  2593 1 1  14 ARG H    H  -4.817  13.745   8.849 1.00 . A A .  14 ARG H    1 1 
        2  2594 1 1  14 ARG HA   H  -2.915  15.652   8.136 1.00 . A A .  14 ARG HA   1 1 
        2  2595 1 1  14 ARG HB2  H  -4.394  15.571  10.247 1.00 . A A .  14 ARG HB2  1 1 
        2  2596 1 1  14 ARG HB3  H  -3.183  14.500  10.946 1.00 . A A .  14 ARG HB3  1 1 
        2  2597 1 1  14 ARG HD2  H  -2.150  18.592  10.167 1.00 . A A .  14 ARG HD2  1 1 
        2  2598 1 1  14 ARG HD3  H  -2.501  17.548   8.788 1.00 . A A .  14 ARG HD3  1 1 
        2  2599 1 1  14 ARG HE   H  -4.499  18.604  10.713 1.00 . A A .  14 ARG HE   1 1 
        2  2600 1 1  14 ARG HG2  H  -2.808  16.776  11.719 1.00 . A A .  14 ARG HG2  1 1 
        2  2601 1 1  14 ARG HG3  H  -1.470  16.290  10.673 1.00 . A A .  14 ARG HG3  1 1 
        2  2602 1 1  14 ARG HH11 H  -3.827  17.255   7.517 1.00 . A A .  14 ARG HH11 1 1 
        2  2603 1 1  14 ARG HH12 H  -5.422  17.574   6.917 1.00 . A A .  14 ARG HH12 1 1 
        2  2604 1 1  14 ARG HH21 H  -6.578  18.985   9.905 1.00 . A A .  14 ARG HH21 1 1 
        2  2605 1 1  14 ARG HH22 H  -6.977  18.562   8.269 1.00 . A A .  14 ARG HH22 1 1 
        2  2606 1 1  14 ARG N    N  -4.019  13.900   8.297 1.00 . A A .  14 ARG N    1 1 
        2  2607 1 1  14 ARG NE   N  -4.192  18.223   9.860 1.00 . A A .  14 ARG NE   1 1 
        2  2608 1 1  14 ARG NH1  N  -4.748  17.618   7.665 1.00 . A A .  14 ARG NH1  1 1 
        2  2609 1 1  14 ARG NH2  N  -6.307  18.603   9.020 1.00 . A A .  14 ARG NH2  1 1 
        2  2610 1 1  14 ARG O    O  -0.553  14.690   8.541 1.00 . A A .  14 ARG O    1 1 
        2  2611 1 1  15 MET C    C  -0.194  11.321   7.708 1.00 . A A .  15 MET C    1 1 
        2  2612 1 1  15 MET CA   C  -0.465  11.886   9.121 1.00 . A A .  15 MET CA   1 1 
        2  2613 1 1  15 MET CB   C  -0.691  10.724  10.139 1.00 . A A .  15 MET CB   1 1 
        2  2614 1 1  15 MET CE   C  -3.002  12.347  13.282 1.00 . A A .  15 MET CE   1 1 
        2  2615 1 1  15 MET CG   C  -1.139  11.171  11.543 1.00 . A A .  15 MET CG   1 1 
        2  2616 1 1  15 MET H    H  -2.515  12.375   9.304 1.00 . A A .  15 MET H    1 1 
        2  2617 1 1  15 MET HA   H   0.397  12.464   9.447 1.00 . A A .  15 MET HA   1 1 
        2  2618 1 1  15 MET HB2  H  -1.450  10.054   9.750 1.00 . A A .  15 MET HB2  1 1 
        2  2619 1 1  15 MET HB3  H   0.238  10.163  10.245 1.00 . A A .  15 MET HB3  1 1 
        2  2620 1 1  15 MET HE1  H  -2.251  13.087  13.508 1.00 . A A .  15 MET HE1  1 1 
        2  2621 1 1  15 MET HE2  H  -2.877  11.502  13.937 1.00 . A A .  15 MET HE2  1 1 
        2  2622 1 1  15 MET HE3  H  -3.984  12.775  13.423 1.00 . A A .  15 MET HE3  1 1 
        2  2623 1 1  15 MET HG2  H  -1.091  10.319  12.214 1.00 . A A .  15 MET HG2  1 1 
        2  2624 1 1  15 MET HG3  H  -0.470  11.943  11.894 1.00 . A A .  15 MET HG3  1 1 
        2  2625 1 1  15 MET N    N  -1.638  12.767   9.103 1.00 . A A .  15 MET N    1 1 
        2  2626 1 1  15 MET O    O   0.811  11.644   7.072 1.00 . A A .  15 MET O    1 1 
        2  2627 1 1  15 MET SD   S  -2.826  11.822  11.581 1.00 . A A .  15 MET SD   1 1 
        2  2628 1 1  16 GLN C    C  -0.882  10.523   4.701 1.00 . A A .  16 GLN C    1 1 
        2  2629 1 1  16 GLN CA   C  -1.012   9.698   5.990 1.00 . A A .  16 GLN CA   1 1 
        2  2630 1 1  16 GLN CB   C  -2.195   8.710   5.857 1.00 . A A .  16 GLN CB   1 1 
        2  2631 1 1  16 GLN CD   C  -3.326   6.589   6.773 1.00 . A A .  16 GLN CD   1 1 
        2  2632 1 1  16 GLN CG   C  -2.288   7.690   7.005 1.00 . A A .  16 GLN CG   1 1 
        2  2633 1 1  16 GLN H    H  -2.022  10.493   7.687 1.00 . A A .  16 GLN H    1 1 
        2  2634 1 1  16 GLN HA   H  -0.104   9.112   6.118 1.00 . A A .  16 GLN HA   1 1 
        2  2635 1 1  16 GLN HB2  H  -3.124   9.272   5.822 1.00 . A A .  16 GLN HB2  1 1 
        2  2636 1 1  16 GLN HB3  H  -2.088   8.157   4.926 1.00 . A A .  16 GLN HB3  1 1 
        2  2637 1 1  16 GLN HE21 H  -3.411   6.204   8.696 1.00 . A A .  16 GLN HE21 1 1 
        2  2638 1 1  16 GLN HE22 H  -4.410   5.244   7.696 1.00 . A A .  16 GLN HE22 1 1 
        2  2639 1 1  16 GLN HG2  H  -1.318   7.216   7.121 1.00 . A A .  16 GLN HG2  1 1 
        2  2640 1 1  16 GLN HG3  H  -2.534   8.218   7.919 1.00 . A A .  16 GLN HG3  1 1 
        2  2641 1 1  16 GLN N    N  -1.168  10.531   7.207 1.00 . A A .  16 GLN N    1 1 
        2  2642 1 1  16 GLN NE2  N  -3.764   5.954   7.829 1.00 . A A .  16 GLN NE2  1 1 
        2  2643 1 1  16 GLN O    O  -0.006  10.252   3.879 1.00 . A A .  16 GLN O    1 1 
        2  2644 1 1  16 GLN OE1  O  -3.670   6.259   5.642 1.00 . A A .  16 GLN OE1  1 1 
        2  2645 1 1  17 TYR C    C  -0.483  13.183   3.260 1.00 . A A .  17 TYR C    1 1 
        2  2646 1 1  17 TYR CA   C  -1.811  12.392   3.347 1.00 . A A .  17 TYR CA   1 1 
        2  2647 1 1  17 TYR CB   C  -3.046  13.336   3.356 1.00 . A A .  17 TYR CB   1 1 
        2  2648 1 1  17 TYR CD1  C  -3.614  13.759   0.899 1.00 . A A .  17 TYR CD1  1 1 
        2  2649 1 1  17 TYR CD2  C  -2.871  15.620   2.214 1.00 . A A .  17 TYR CD2  1 1 
        2  2650 1 1  17 TYR CE1  C  -3.746  14.590  -0.196 1.00 . A A .  17 TYR CE1  1 1 
        2  2651 1 1  17 TYR CE2  C  -2.997  16.446   1.123 1.00 . A A .  17 TYR CE2  1 1 
        2  2652 1 1  17 TYR CG   C  -3.172  14.255   2.130 1.00 . A A .  17 TYR CG   1 1 
        2  2653 1 1  17 TYR CZ   C  -3.438  15.932  -0.079 1.00 . A A .  17 TYR CZ   1 1 
        2  2654 1 1  17 TYR H    H  -2.469  11.594   5.240 1.00 . A A .  17 TYR H    1 1 
        2  2655 1 1  17 TYR HA   H  -1.883  11.746   2.468 1.00 . A A .  17 TYR HA   1 1 
        2  2656 1 1  17 TYR HB2  H  -3.955  12.741   3.417 1.00 . A A .  17 TYR HB2  1 1 
        2  2657 1 1  17 TYR HB3  H  -2.999  13.962   4.240 1.00 . A A .  17 TYR HB3  1 1 
        2  2658 1 1  17 TYR HD1  H  -3.852  12.706   0.807 1.00 . A A .  17 TYR HD1  1 1 
        2  2659 1 1  17 TYR HD2  H  -2.525  16.022   3.159 1.00 . A A .  17 TYR HD2  1 1 
        2  2660 1 1  17 TYR HE1  H  -4.087  14.185  -1.141 1.00 . A A .  17 TYR HE1  1 1 
        2  2661 1 1  17 TYR HE2  H  -2.752  17.497   1.214 1.00 . A A .  17 TYR HE2  1 1 
        2  2662 1 1  17 TYR HH   H  -2.831  17.370  -1.202 1.00 . A A .  17 TYR HH   1 1 
        2  2663 1 1  17 TYR N    N  -1.791  11.505   4.538 1.00 . A A .  17 TYR N    1 1 
        2  2664 1 1  17 TYR O    O   0.127  13.237   2.200 1.00 . A A .  17 TYR O    1 1 
        2  2665 1 1  17 TYR OH   O  -3.575  16.763  -1.168 1.00 . A A .  17 TYR OH   1 1 
        2  2666 1 1  18 GLU C    C   2.472  13.556   4.093 1.00 . A A .  18 GLU C    1 1 
        2  2667 1 1  18 GLU CA   C   1.273  14.481   4.470 1.00 . A A .  18 GLU CA   1 1 
        2  2668 1 1  18 GLU CB   C   1.471  15.125   5.879 1.00 . A A .  18 GLU CB   1 1 
        2  2669 1 1  18 GLU CD   C   2.897  16.682   7.368 1.00 . A A .  18 GLU CD   1 1 
        2  2670 1 1  18 GLU CG   C   2.806  15.884   6.055 1.00 . A A .  18 GLU CG   1 1 
        2  2671 1 1  18 GLU H    H  -0.566  13.658   5.221 1.00 . A A .  18 GLU H    1 1 
        2  2672 1 1  18 GLU HA   H   1.220  15.282   3.733 1.00 . A A .  18 GLU HA   1 1 
        2  2673 1 1  18 GLU HB2  H   0.657  15.826   6.056 1.00 . A A .  18 GLU HB2  1 1 
        2  2674 1 1  18 GLU HB3  H   1.417  14.345   6.630 1.00 . A A .  18 GLU HB3  1 1 
        2  2675 1 1  18 GLU HG2  H   3.619  15.164   6.029 1.00 . A A .  18 GLU HG2  1 1 
        2  2676 1 1  18 GLU HG3  H   2.929  16.566   5.218 1.00 . A A .  18 GLU HG3  1 1 
        2  2677 1 1  18 GLU N    N  -0.021  13.740   4.402 1.00 . A A .  18 GLU N    1 1 
        2  2678 1 1  18 GLU O    O   3.427  14.000   3.434 1.00 . A A .  18 GLU O    1 1 
        2  2679 1 1  18 GLU OE1  O   3.191  16.087   8.422 1.00 . A A .  18 GLU OE1  1 1 
        2  2680 1 1  18 GLU OE2  O   2.676  17.914   7.356 1.00 . A A .  18 GLU OE2  1 1 
        2  2681 1 1  19 VAL C    C   3.492  11.010   2.664 1.00 . A A .  19 VAL C    1 1 
        2  2682 1 1  19 VAL CA   C   3.401  11.244   4.182 1.00 . A A .  19 VAL CA   1 1 
        2  2683 1 1  19 VAL CB   C   3.157   9.886   4.975 1.00 . A A .  19 VAL CB   1 1 
        2  2684 1 1  19 VAL CG1  C   3.895   8.678   4.338 1.00 . A A .  19 VAL CG1  1 1 
        2  2685 1 1  19 VAL CG2  C   3.596  10.047   6.446 1.00 . A A .  19 VAL CG2  1 1 
        2  2686 1 1  19 VAL H    H   1.538  12.005   4.918 1.00 . A A .  19 VAL H    1 1 
        2  2687 1 1  19 VAL HA   H   4.357  11.652   4.517 1.00 . A A .  19 VAL HA   1 1 
        2  2688 1 1  19 VAL HB   H   2.090   9.669   4.969 1.00 . A A .  19 VAL HB   1 1 
        2  2689 1 1  19 VAL HG11 H   3.722   7.782   4.918 1.00 . A A .  19 VAL HG11 1 1 
        2  2690 1 1  19 VAL HG12 H   4.955   8.878   4.297 1.00 . A A .  19 VAL HG12 1 1 
        2  2691 1 1  19 VAL HG13 H   3.529   8.506   3.324 1.00 . A A .  19 VAL HG13 1 1 
        2  2692 1 1  19 VAL HG21 H   3.023  10.841   6.916 1.00 . A A .  19 VAL HG21 1 1 
        2  2693 1 1  19 VAL HG22 H   4.651  10.291   6.481 1.00 . A A .  19 VAL HG22 1 1 
        2  2694 1 1  19 VAL HG23 H   3.431   9.124   6.987 1.00 . A A .  19 VAL HG23 1 1 
        2  2695 1 1  19 VAL N    N   2.365  12.263   4.467 1.00 . A A .  19 VAL N    1 1 
        2  2696 1 1  19 VAL O    O   4.542  11.236   2.078 1.00 . A A .  19 VAL O    1 1 
        2  2697 1 1  20 THR C    C   2.591  11.502  -0.312 1.00 . A A .  20 THR C    1 1 
        2  2698 1 1  20 THR CA   C   2.317  10.282   0.600 1.00 . A A .  20 THR CA   1 1 
        2  2699 1 1  20 THR CB   C   0.957   9.610   0.208 1.00 . A A .  20 THR CB   1 1 
        2  2700 1 1  20 THR CG2  C  -0.243  10.565   0.336 1.00 . A A .  20 THR CG2  1 1 
        2  2701 1 1  20 THR H    H   1.554  10.501   2.583 1.00 . A A .  20 THR H    1 1 
        2  2702 1 1  20 THR HA   H   3.106   9.549   0.423 1.00 . A A .  20 THR HA   1 1 
        2  2703 1 1  20 THR HB   H   0.794   8.765   0.874 1.00 . A A .  20 THR HB   1 1 
        2  2704 1 1  20 THR HG1  H   1.740   9.529  -1.619 1.00 . A A .  20 THR HG1  1 1 
        2  2705 1 1  20 THR HG21 H  -0.318  10.922   1.355 1.00 . A A .  20 THR HG21 1 1 
        2  2706 1 1  20 THR HG22 H  -1.153  10.042   0.073 1.00 . A A .  20 THR HG22 1 1 
        2  2707 1 1  20 THR HG23 H  -0.112  11.409  -0.328 1.00 . A A .  20 THR HG23 1 1 
        2  2708 1 1  20 THR N    N   2.368  10.614   2.044 1.00 . A A .  20 THR N    1 1 
        2  2709 1 1  20 THR O    O   2.990  11.328  -1.470 1.00 . A A .  20 THR O    1 1 
        2  2710 1 1  20 THR OG1  O   1.020   9.105  -1.142 1.00 . A A .  20 THR OG1  1 1 
        2  2711 1 1  21 GLN C    C   4.188  14.276  -0.592 1.00 . A A .  21 GLN C    1 1 
        2  2712 1 1  21 GLN CA   C   2.679  13.972  -0.555 1.00 . A A .  21 GLN CA   1 1 
        2  2713 1 1  21 GLN CB   C   1.881  15.178   0.000 1.00 . A A .  21 GLN CB   1 1 
        2  2714 1 1  21 GLN CD   C  -0.057  14.958  -1.678 1.00 . A A .  21 GLN CD   1 1 
        2  2715 1 1  21 GLN CG   C   0.353  15.090  -0.213 1.00 . A A .  21 GLN CG   1 1 
        2  2716 1 1  21 GLN H    H   2.092  12.799   1.152 1.00 . A A .  21 GLN H    1 1 
        2  2717 1 1  21 GLN HA   H   2.351  13.794  -1.581 1.00 . A A .  21 GLN HA   1 1 
        2  2718 1 1  21 GLN HB2  H   2.067  15.251   1.064 1.00 . A A .  21 GLN HB2  1 1 
        2  2719 1 1  21 GLN HB3  H   2.234  16.091  -0.475 1.00 . A A .  21 GLN HB3  1 1 
        2  2720 1 1  21 GLN HE21 H  -0.128  16.931  -1.882 1.00 . A A .  21 GLN HE21 1 1 
        2  2721 1 1  21 GLN HE22 H  -0.507  16.008  -3.296 1.00 . A A .  21 GLN HE22 1 1 
        2  2722 1 1  21 GLN HG2  H  -0.022  14.228   0.322 1.00 . A A .  21 GLN HG2  1 1 
        2  2723 1 1  21 GLN HG3  H  -0.107  15.981   0.199 1.00 . A A .  21 GLN HG3  1 1 
        2  2724 1 1  21 GLN N    N   2.404  12.730   0.217 1.00 . A A .  21 GLN N    1 1 
        2  2725 1 1  21 GLN NE2  N  -0.254  16.078  -2.352 1.00 . A A .  21 GLN NE2  1 1 
        2  2726 1 1  21 GLN O    O   4.668  15.001  -1.472 1.00 . A A .  21 GLN O    1 1 
        2  2727 1 1  21 GLN OE1  O  -0.192  13.851  -2.201 1.00 . A A .  21 GLN OE1  1 1 
        2  2728 1 1  22 ASN C    C   6.934  12.417  -0.146 1.00 . A A .  22 ASN C    1 1 
        2  2729 1 1  22 ASN CA   C   6.382  13.743   0.427 1.00 . A A .  22 ASN CA   1 1 
        2  2730 1 1  22 ASN CB   C   6.860  13.934   1.900 1.00 . A A .  22 ASN CB   1 1 
        2  2731 1 1  22 ASN CG   C   8.361  14.233   2.017 1.00 . A A .  22 ASN CG   1 1 
        2  2732 1 1  22 ASN H    H   4.434  13.289   1.120 1.00 . A A .  22 ASN H    1 1 
        2  2733 1 1  22 ASN HA   H   6.745  14.572  -0.180 1.00 . A A .  22 ASN HA   1 1 
        2  2734 1 1  22 ASN HB2  H   6.318  14.758   2.342 1.00 . A A .  22 ASN HB2  1 1 
        2  2735 1 1  22 ASN HB3  H   6.641  13.036   2.469 1.00 . A A .  22 ASN HB3  1 1 
        2  2736 1 1  22 ASN HD21 H   8.799  12.299   2.075 1.00 . A A .  22 ASN HD21 1 1 
        2  2737 1 1  22 ASN HD22 H  10.144  13.372   2.177 1.00 . A A .  22 ASN HD22 1 1 
        2  2738 1 1  22 ASN N    N   4.910  13.725   0.386 1.00 . A A .  22 ASN N    1 1 
        2  2739 1 1  22 ASN ND2  N   9.184  13.197   2.102 1.00 . A A .  22 ASN ND2  1 1 
        2  2740 1 1  22 ASN O    O   8.089  12.356  -0.581 1.00 . A A .  22 ASN O    1 1 
        2  2741 1 1  22 ASN OD1  O   8.772  15.393   2.027 1.00 . A A .  22 ASN OD1  1 1 
        2  2742 1 1  23 ASN C    C   7.471   9.526   0.732 1.00 . A A .  23 ASN C    1 1 
        2  2743 1 1  23 ASN CA   C   6.459   9.953  -0.347 1.00 . A A .  23 ASN CA   1 1 
        2  2744 1 1  23 ASN CB   C   6.968   9.683  -1.800 1.00 . A A .  23 ASN CB   1 1 
        2  2745 1 1  23 ASN CG   C   5.828   9.427  -2.785 1.00 . A A .  23 ASN CG   1 1 
        2  2746 1 1  23 ASN H    H   5.116  11.565  -0.029 1.00 . A A .  23 ASN H    1 1 
        2  2747 1 1  23 ASN HA   H   5.560   9.367  -0.176 1.00 . A A .  23 ASN HA   1 1 
        2  2748 1 1  23 ASN HB2  H   7.539  10.541  -2.149 1.00 . A A .  23 ASN HB2  1 1 
        2  2749 1 1  23 ASN HB3  H   7.622   8.817  -1.805 1.00 . A A .  23 ASN HB3  1 1 
        2  2750 1 1  23 ASN HD21 H   5.593  11.373  -3.078 1.00 . A A .  23 ASN HD21 1 1 
        2  2751 1 1  23 ASN HD22 H   4.528  10.341  -3.966 1.00 . A A .  23 ASN HD22 1 1 
        2  2752 1 1  23 ASN N    N   6.068  11.372  -0.155 1.00 . A A .  23 ASN N    1 1 
        2  2753 1 1  23 ASN ND2  N   5.261  10.486  -3.332 1.00 . A A .  23 ASN ND2  1 1 
        2  2754 1 1  23 ASN O    O   8.361   8.708   0.491 1.00 . A A .  23 ASN O    1 1 
        2  2755 1 1  23 ASN OD1  O   5.451   8.278  -3.023 1.00 . A A .  23 ASN OD1  1 1 
        2  2756 1 1  24 GLY C    C   7.873   8.576   3.828 1.00 . A A .  24 GLY C    1 1 
        2  2757 1 1  24 GLY CA   C   8.150   9.867   3.080 1.00 . A A .  24 GLY CA   1 1 
        2  2758 1 1  24 GLY H    H   6.459  10.629   2.069 1.00 . A A .  24 GLY H    1 1 
        2  2759 1 1  24 GLY HA2  H   9.179   9.863   2.735 1.00 . A A .  24 GLY HA2  1 1 
        2  2760 1 1  24 GLY HA3  H   8.023  10.695   3.765 1.00 . A A .  24 GLY HA3  1 1 
        2  2761 1 1  24 GLY N    N   7.263  10.076   1.944 1.00 . A A .  24 GLY N    1 1 
        2  2762 1 1  24 GLY O    O   6.886   7.885   3.557 1.00 . A A .  24 GLY O    1 1 
        2  2763 1 1  25 THR C    C   8.313   7.472   7.068 1.00 . A A .  25 THR C    1 1 
        2  2764 1 1  25 THR CA   C   8.642   7.065   5.621 1.00 . A A .  25 THR CA   1 1 
        2  2765 1 1  25 THR CB   C   9.937   6.171   5.550 1.00 . A A .  25 THR CB   1 1 
        2  2766 1 1  25 THR CG2  C  11.213   6.928   5.941 1.00 . A A .  25 THR CG2  1 1 
        2  2767 1 1  25 THR H    H   9.462   8.912   4.969 1.00 . A A .  25 THR H    1 1 
        2  2768 1 1  25 THR HA   H   7.813   6.465   5.238 1.00 . A A .  25 THR HA   1 1 
        2  2769 1 1  25 THR HB   H  10.054   5.832   4.523 1.00 . A A .  25 THR HB   1 1 
        2  2770 1 1  25 THR HG1  H  10.332   4.291   6.022 1.00 . A A .  25 THR HG1  1 1 
        2  2771 1 1  25 THR HG21 H  12.068   6.266   5.868 1.00 . A A .  25 THR HG21 1 1 
        2  2772 1 1  25 THR HG22 H  11.130   7.285   6.961 1.00 . A A .  25 THR HG22 1 1 
        2  2773 1 1  25 THR HG23 H  11.357   7.771   5.278 1.00 . A A .  25 THR HG23 1 1 
        2  2774 1 1  25 THR N    N   8.748   8.269   4.791 1.00 . A A .  25 THR N    1 1 
        2  2775 1 1  25 THR O    O   8.957   8.354   7.652 1.00 . A A .  25 THR O    1 1 
        2  2776 1 1  25 THR OG1  O   9.799   5.005   6.382 1.00 . A A .  25 THR OG1  1 1 
        2  2777 1 1  26 GLU C    C   6.862   5.540   9.595 1.00 . A A .  26 GLU C    1 1 
        2  2778 1 1  26 GLU CA   C   6.871   6.972   9.022 1.00 . A A .  26 GLU CA   1 1 
        2  2779 1 1  26 GLU CB   C   5.455   7.612   9.112 1.00 . A A .  26 GLU CB   1 1 
        2  2780 1 1  26 GLU CD   C   3.416   8.241  10.546 1.00 . A A .  26 GLU CD   1 1 
        2  2781 1 1  26 GLU CG   C   4.875   7.746  10.533 1.00 . A A .  26 GLU CG   1 1 
        2  2782 1 1  26 GLU H    H   6.742   6.249   7.056 1.00 . A A .  26 GLU H    1 1 
        2  2783 1 1  26 GLU HA   H   7.594   7.580   9.556 1.00 . A A .  26 GLU HA   1 1 
        2  2784 1 1  26 GLU HB2  H   5.501   8.603   8.678 1.00 . A A .  26 GLU HB2  1 1 
        2  2785 1 1  26 GLU HB3  H   4.765   7.013   8.521 1.00 . A A .  26 GLU HB3  1 1 
        2  2786 1 1  26 GLU HG2  H   4.934   6.777  11.021 1.00 . A A .  26 GLU HG2  1 1 
        2  2787 1 1  26 GLU HG3  H   5.489   8.449  11.094 1.00 . A A .  26 GLU HG3  1 1 
        2  2788 1 1  26 GLU N    N   7.270   6.857   7.611 1.00 . A A .  26 GLU N    1 1 
        2  2789 1 1  26 GLU O    O   6.445   4.625   8.872 1.00 . A A .  26 GLU O    1 1 
        2  2790 1 1  26 GLU OE1  O   3.193   9.454  10.341 1.00 . A A .  26 GLU OE1  1 1 
        2  2791 1 1  26 GLU OE2  O   2.493   7.430  10.767 1.00 . A A .  26 GLU OE2  1 1 
        2  2792 1 1  27 PRO C    C   5.851   3.359  11.459 1.00 . A A .  27 PRO C    1 1 
        2  2793 1 1  27 PRO CA   C   7.289   3.954  11.498 1.00 . A A .  27 PRO CA   1 1 
        2  2794 1 1  27 PRO CB   C   7.769   4.210  12.963 1.00 . A A .  27 PRO CB   1 1 
        2  2795 1 1  27 PRO CD   C   7.960   6.294  11.787 1.00 . A A .  27 PRO CD   1 1 
        2  2796 1 1  27 PRO CG   C   7.692   5.698  13.147 1.00 . A A .  27 PRO CG   1 1 
        2  2797 1 1  27 PRO HA   H   7.975   3.275  11.005 1.00 . A A .  27 PRO HA   1 1 
        2  2798 1 1  27 PRO HB2  H   7.131   3.687  13.675 1.00 . A A .  27 PRO HB2  1 1 
        2  2799 1 1  27 PRO HB3  H   8.788   3.851  13.082 1.00 . A A .  27 PRO HB3  1 1 
        2  2800 1 1  27 PRO HD2  H   7.486   7.268  11.698 1.00 . A A .  27 PRO HD2  1 1 
        2  2801 1 1  27 PRO HD3  H   9.026   6.381  11.599 1.00 . A A .  27 PRO HD3  1 1 
        2  2802 1 1  27 PRO HG2  H   6.697   5.977  13.491 1.00 . A A .  27 PRO HG2  1 1 
        2  2803 1 1  27 PRO HG3  H   8.434   6.032  13.864 1.00 . A A .  27 PRO HG3  1 1 
        2  2804 1 1  27 PRO N    N   7.340   5.300  10.868 1.00 . A A .  27 PRO N    1 1 
        2  2805 1 1  27 PRO O    O   4.896   4.063  11.803 1.00 . A A .  27 PRO O    1 1 
        2  2806 1 1  28 PRO C    C   3.937   0.910  12.374 1.00 . A A .  28 PRO C    1 1 
        2  2807 1 1  28 PRO CA   C   4.351   1.400  10.966 1.00 . A A .  28 PRO CA   1 1 
        2  2808 1 1  28 PRO CB   C   4.545   0.213   9.959 1.00 . A A .  28 PRO CB   1 1 
        2  2809 1 1  28 PRO CD   C   6.716   1.195  10.434 1.00 . A A .  28 PRO CD   1 1 
        2  2810 1 1  28 PRO CG   C   5.961   0.326   9.451 1.00 . A A .  28 PRO CG   1 1 
        2  2811 1 1  28 PRO HA   H   3.578   2.073  10.594 1.00 . A A .  28 PRO HA   1 1 
        2  2812 1 1  28 PRO HB2  H   4.379  -0.740  10.457 1.00 . A A .  28 PRO HB2  1 1 
        2  2813 1 1  28 PRO HB3  H   3.829   0.306   9.146 1.00 . A A .  28 PRO HB3  1 1 
        2  2814 1 1  28 PRO HD2  H   7.173   0.595  11.218 1.00 . A A .  28 PRO HD2  1 1 
        2  2815 1 1  28 PRO HD3  H   7.478   1.773   9.921 1.00 . A A .  28 PRO HD3  1 1 
        2  2816 1 1  28 PRO HG2  H   6.414  -0.656   9.389 1.00 . A A .  28 PRO HG2  1 1 
        2  2817 1 1  28 PRO HG3  H   5.961   0.789   8.471 1.00 . A A .  28 PRO HG3  1 1 
        2  2818 1 1  28 PRO N    N   5.667   2.075  10.991 1.00 . A A .  28 PRO N    1 1 
        2  2819 1 1  28 PRO O    O   3.658  -0.282  12.579 1.00 . A A .  28 PRO O    1 1 
        2  2820 1 1  29 PHE C    C   1.988   1.068  14.857 1.00 . A A .  29 PHE C    1 1 
        2  2821 1 1  29 PHE CA   C   3.427   1.625  14.745 1.00 . A A .  29 PHE CA   1 1 
        2  2822 1 1  29 PHE CB   C   3.577   2.928  15.582 1.00 . A A .  29 PHE CB   1 1 
        2  2823 1 1  29 PHE CD1  C   1.381   4.229  15.694 1.00 . A A .  29 PHE CD1  1 1 
        2  2824 1 1  29 PHE CD2  C   3.077   5.006  14.197 1.00 . A A .  29 PHE CD2  1 1 
        2  2825 1 1  29 PHE CE1  C   0.556   5.258  15.299 1.00 . A A .  29 PHE CE1  1 1 
        2  2826 1 1  29 PHE CE2  C   2.249   6.035  13.803 1.00 . A A .  29 PHE CE2  1 1 
        2  2827 1 1  29 PHE CG   C   2.661   4.081  15.151 1.00 . A A .  29 PHE CG   1 1 
        2  2828 1 1  29 PHE CZ   C   0.988   6.158  14.350 1.00 . A A .  29 PHE CZ   1 1 
        2  2829 1 1  29 PHE H    H   4.024   2.791  13.066 1.00 . A A .  29 PHE H    1 1 
        2  2830 1 1  29 PHE HA   H   4.107   0.880  15.146 1.00 . A A .  29 PHE HA   1 1 
        2  2831 1 1  29 PHE HB2  H   3.371   2.705  16.624 1.00 . A A .  29 PHE HB2  1 1 
        2  2832 1 1  29 PHE HB3  H   4.604   3.274  15.510 1.00 . A A .  29 PHE HB3  1 1 
        2  2833 1 1  29 PHE HD1  H   1.039   3.522  16.442 1.00 . A A .  29 PHE HD1  1 1 
        2  2834 1 1  29 PHE HD2  H   4.063   4.914  13.759 1.00 . A A .  29 PHE HD2  1 1 
        2  2835 1 1  29 PHE HE1  H  -0.435   5.357  15.730 1.00 . A A .  29 PHE HE1  1 1 
        2  2836 1 1  29 PHE HE2  H   2.589   6.746  13.060 1.00 . A A .  29 PHE HE2  1 1 
        2  2837 1 1  29 PHE HZ   H   0.342   6.963  14.037 1.00 . A A .  29 PHE HZ   1 1 
        2  2838 1 1  29 PHE N    N   3.826   1.872  13.327 1.00 . A A .  29 PHE N    1 1 
        2  2839 1 1  29 PHE O    O   1.511   0.760  15.951 1.00 . A A .  29 PHE O    1 1 
        2  2840 1 1  30 GLN C    C   0.085  -1.162  14.055 1.00 . A A .  30 GLN C    1 1 
        2  2841 1 1  30 GLN CA   C   0.045   0.281  13.473 1.00 . A A .  30 GLN CA   1 1 
        2  2842 1 1  30 GLN CB   C  -0.229   0.215  11.934 1.00 . A A .  30 GLN CB   1 1 
        2  2843 1 1  30 GLN CD   C  -1.116   2.611  11.376 1.00 . A A .  30 GLN CD   1 1 
        2  2844 1 1  30 GLN CG   C  -0.029   1.545  11.150 1.00 . A A .  30 GLN CG   1 1 
        2  2845 1 1  30 GLN H    H   1.716   1.449  12.942 1.00 . A A .  30 GLN H    1 1 
        2  2846 1 1  30 GLN HA   H  -0.744   0.848  13.955 1.00 . A A .  30 GLN HA   1 1 
        2  2847 1 1  30 GLN HB2  H   0.441  -0.524  11.498 1.00 . A A .  30 GLN HB2  1 1 
        2  2848 1 1  30 GLN HB3  H  -1.247  -0.122  11.777 1.00 . A A .  30 GLN HB3  1 1 
        2  2849 1 1  30 GLN HE21 H  -0.778   3.401   9.570 1.00 . A A .  30 GLN HE21 1 1 
        2  2850 1 1  30 GLN HE22 H  -2.001   4.172  10.517 1.00 . A A .  30 GLN HE22 1 1 
        2  2851 1 1  30 GLN HG2  H   0.921   1.968  11.436 1.00 . A A .  30 GLN HG2  1 1 
        2  2852 1 1  30 GLN HG3  H   0.001   1.305  10.089 1.00 . A A .  30 GLN HG3  1 1 
        2  2853 1 1  30 GLN N    N   1.323   0.989  13.698 1.00 . A A .  30 GLN N    1 1 
        2  2854 1 1  30 GLN NE2  N  -1.318   3.484  10.389 1.00 . A A .  30 GLN NE2  1 1 
        2  2855 1 1  30 GLN O    O  -0.950  -1.740  14.382 1.00 . A A .  30 GLN O    1 1 
        2  2856 1 1  30 GLN OE1  O  -1.742   2.680  12.434 1.00 . A A .  30 GLN OE1  1 1 
        2  2857 1 1  31 ASN C    C   2.763  -2.864  15.784 1.00 . A A .  31 ASN C    1 1 
        2  2858 1 1  31 ASN CA   C   1.583  -3.024  14.792 1.00 . A A .  31 ASN CA   1 1 
        2  2859 1 1  31 ASN CB   C   1.894  -4.070  13.694 1.00 . A A .  31 ASN CB   1 1 
        2  2860 1 1  31 ASN CG   C   2.189  -5.466  14.235 1.00 . A A .  31 ASN CG   1 1 
        2  2861 1 1  31 ASN H    H   2.074  -1.230  13.788 1.00 . A A .  31 ASN H    1 1 
        2  2862 1 1  31 ASN HA   H   0.700  -3.333  15.348 1.00 . A A .  31 ASN HA   1 1 
        2  2863 1 1  31 ASN HB2  H   1.046  -4.139  13.021 1.00 . A A .  31 ASN HB2  1 1 
        2  2864 1 1  31 ASN HB3  H   2.754  -3.736  13.119 1.00 . A A .  31 ASN HB3  1 1 
        2  2865 1 1  31 ASN HD21 H   0.271  -5.935  14.243 1.00 . A A .  31 ASN HD21 1 1 
        2  2866 1 1  31 ASN HD22 H   1.349  -7.175  14.765 1.00 . A A .  31 ASN HD22 1 1 
        2  2867 1 1  31 ASN N    N   1.308  -1.725  14.156 1.00 . A A .  31 ASN N    1 1 
        2  2868 1 1  31 ASN ND2  N   1.169  -6.269  14.438 1.00 . A A .  31 ASN ND2  1 1 
        2  2869 1 1  31 ASN O    O   3.520  -1.889  15.701 1.00 . A A .  31 ASN O    1 1 
        2  2870 1 1  31 ASN OD1  O   3.333  -5.799  14.491 1.00 . A A .  31 ASN OD1  1 1 
        2  2871 1 1  32 GLU C    C   5.303  -4.285  17.189 1.00 . A A .  32 GLU C    1 1 
        2  2872 1 1  32 GLU CA   C   3.944  -3.829  17.760 1.00 . A A .  32 GLU CA   1 1 
        2  2873 1 1  32 GLU CB   C   3.537  -4.746  18.964 1.00 . A A .  32 GLU CB   1 1 
        2  2874 1 1  32 GLU CD   C   0.966  -4.384  19.031 1.00 . A A .  32 GLU CD   1 1 
        2  2875 1 1  32 GLU CG   C   2.306  -4.269  19.782 1.00 . A A .  32 GLU CG   1 1 
        2  2876 1 1  32 GLU H    H   2.256  -4.563  16.705 1.00 . A A .  32 GLU H    1 1 
        2  2877 1 1  32 GLU HA   H   4.048  -2.806  18.129 1.00 . A A .  32 GLU HA   1 1 
        2  2878 1 1  32 GLU HB2  H   3.321  -5.742  18.590 1.00 . A A .  32 GLU HB2  1 1 
        2  2879 1 1  32 GLU HB3  H   4.380  -4.817  19.649 1.00 . A A .  32 GLU HB3  1 1 
        2  2880 1 1  32 GLU HG2  H   2.240  -4.862  20.691 1.00 . A A .  32 GLU HG2  1 1 
        2  2881 1 1  32 GLU HG3  H   2.464  -3.231  20.066 1.00 . A A .  32 GLU HG3  1 1 
        2  2882 1 1  32 GLU N    N   2.898  -3.828  16.714 1.00 . A A .  32 GLU N    1 1 
        2  2883 1 1  32 GLU O    O   6.314  -3.607  17.367 1.00 . A A .  32 GLU O    1 1 
        2  2884 1 1  32 GLU OE1  O   0.392  -5.492  18.984 1.00 . A A .  32 GLU OE1  1 1 
        2  2885 1 1  32 GLU OE2  O   0.486  -3.376  18.470 1.00 . A A .  32 GLU OE2  1 1 
        2  2886 1 1  33 TYR C    C   7.041  -5.539  14.675 1.00 . A A .  33 TYR C    1 1 
        2  2887 1 1  33 TYR CA   C   6.571  -6.090  16.027 1.00 . A A .  33 TYR CA   1 1 
        2  2888 1 1  33 TYR CB   C   6.400  -7.628  15.974 1.00 . A A .  33 TYR CB   1 1 
        2  2889 1 1  33 TYR CD1  C   7.378  -8.521  18.149 1.00 . A A .  33 TYR CD1  1 1 
        2  2890 1 1  33 TYR CD2  C   4.996  -8.547  17.906 1.00 . A A .  33 TYR CD2  1 1 
        2  2891 1 1  33 TYR CE1  C   7.260  -9.064  19.412 1.00 . A A .  33 TYR CE1  1 1 
        2  2892 1 1  33 TYR CE2  C   4.874  -9.087  19.171 1.00 . A A .  33 TYR CE2  1 1 
        2  2893 1 1  33 TYR CG   C   6.251  -8.252  17.367 1.00 . A A .  33 TYR CG   1 1 
        2  2894 1 1  33 TYR CZ   C   6.009  -9.343  19.920 1.00 . A A .  33 TYR CZ   1 1 
        2  2895 1 1  33 TYR H    H   4.462  -5.891  16.330 1.00 . A A .  33 TYR H    1 1 
        2  2896 1 1  33 TYR HA   H   7.348  -5.861  16.754 1.00 . A A .  33 TYR HA   1 1 
        2  2897 1 1  33 TYR HB2  H   5.519  -7.874  15.390 1.00 . A A .  33 TYR HB2  1 1 
        2  2898 1 1  33 TYR HB3  H   7.269  -8.076  15.496 1.00 . A A .  33 TYR HB3  1 1 
        2  2899 1 1  33 TYR HD1  H   8.365  -8.305  17.748 1.00 . A A .  33 TYR HD1  1 1 
        2  2900 1 1  33 TYR HD2  H   4.108  -8.341  17.317 1.00 . A A .  33 TYR HD2  1 1 
        2  2901 1 1  33 TYR HE1  H   8.147  -9.262  19.997 1.00 . A A .  33 TYR HE1  1 1 
        2  2902 1 1  33 TYR HE2  H   3.890  -9.310  19.567 1.00 . A A .  33 TYR HE2  1 1 
        2  2903 1 1  33 TYR HH   H   6.458  -9.402  21.792 1.00 . A A .  33 TYR HH   1 1 
        2  2904 1 1  33 TYR N    N   5.316  -5.447  16.512 1.00 . A A .  33 TYR N    1 1 
        2  2905 1 1  33 TYR O    O   8.223  -5.653  14.352 1.00 . A A .  33 TYR O    1 1 
        2  2906 1 1  33 TYR OH   O   5.885  -9.880  21.181 1.00 . A A .  33 TYR OH   1 1 
        2  2907 1 1  34 TRP C    C   6.714  -5.179  11.414 1.00 . A A .  34 TRP C    1 1 
        2  2908 1 1  34 TRP CA   C   6.363  -4.244  12.612 1.00 . A A .  34 TRP CA   1 1 
        2  2909 1 1  34 TRP CB   C   7.465  -3.152  12.770 1.00 . A A .  34 TRP CB   1 1 
        2  2910 1 1  34 TRP CD1  C   6.180  -1.298  13.996 1.00 . A A .  34 TRP CD1  1 1 
        2  2911 1 1  34 TRP CD2  C   8.039  -1.938  15.053 1.00 . A A .  34 TRP CD2  1 1 
        2  2912 1 1  34 TRP CE2  C   7.418  -0.933  15.811 1.00 . A A .  34 TRP CE2  1 1 
        2  2913 1 1  34 TRP CE3  C   9.225  -2.510  15.527 1.00 . A A .  34 TRP CE3  1 1 
        2  2914 1 1  34 TRP CG   C   7.219  -2.162  13.891 1.00 . A A .  34 TRP CG   1 1 
        2  2915 1 1  34 TRP CH2  C   9.110  -1.046  17.453 1.00 . A A .  34 TRP CH2  1 1 
        2  2916 1 1  34 TRP CZ2  C   7.949  -0.470  17.010 1.00 . A A .  34 TRP CZ2  1 1 
        2  2917 1 1  34 TRP CZ3  C   9.755  -2.051  16.715 1.00 . A A .  34 TRP CZ3  1 1 
        2  2918 1 1  34 TRP H    H   5.169  -5.011  14.201 1.00 . A A .  34 TRP H    1 1 
        2  2919 1 1  34 TRP HA   H   5.434  -3.745  12.363 1.00 . A A .  34 TRP HA   1 1 
        2  2920 1 1  34 TRP HB2  H   8.415  -3.641  12.958 1.00 . A A .  34 TRP HB2  1 1 
        2  2921 1 1  34 TRP HB3  H   7.545  -2.593  11.844 1.00 . A A .  34 TRP HB3  1 1 
        2  2922 1 1  34 TRP HD1  H   5.385  -1.219  13.272 1.00 . A A .  34 TRP HD1  1 1 
        2  2923 1 1  34 TRP HE1  H   5.654   0.147  15.428 1.00 . A A .  34 TRP HE1  1 1 
        2  2924 1 1  34 TRP HE3  H   9.732  -3.285  14.966 1.00 . A A .  34 TRP HE3  1 1 
        2  2925 1 1  34 TRP HH2  H   9.560  -0.715  18.384 1.00 . A A .  34 TRP HH2  1 1 
        2  2926 1 1  34 TRP HZ2  H   7.463   0.307  17.590 1.00 . A A .  34 TRP HZ2  1 1 
        2  2927 1 1  34 TRP HZ3  H  10.675  -2.481  17.102 1.00 . A A .  34 TRP HZ3  1 1 
        2  2928 1 1  34 TRP N    N   6.099  -4.963  13.896 1.00 . A A .  34 TRP N    1 1 
        2  2929 1 1  34 TRP NE1  N   6.291  -0.549  15.139 1.00 . A A .  34 TRP NE1  1 1 
        2  2930 1 1  34 TRP O    O   6.513  -4.783  10.257 1.00 . A A .  34 TRP O    1 1 
        2  2931 1 1  35 ASP C    C   6.506  -7.826   9.788 1.00 . A A .  35 ASP C    1 1 
        2  2932 1 1  35 ASP CA   C   7.686  -7.348  10.653 1.00 . A A .  35 ASP CA   1 1 
        2  2933 1 1  35 ASP CB   C   8.369  -8.579  11.305 1.00 . A A .  35 ASP CB   1 1 
        2  2934 1 1  35 ASP CG   C   9.542  -8.239  12.236 1.00 . A A .  35 ASP CG   1 1 
        2  2935 1 1  35 ASP H    H   7.316  -6.658  12.626 1.00 . A A .  35 ASP H    1 1 
        2  2936 1 1  35 ASP HA   H   8.409  -6.837  10.021 1.00 . A A .  35 ASP HA   1 1 
        2  2937 1 1  35 ASP HB2  H   7.625  -9.128  11.878 1.00 . A A .  35 ASP HB2  1 1 
        2  2938 1 1  35 ASP HB3  H   8.736  -9.232  10.517 1.00 . A A .  35 ASP HB3  1 1 
        2  2939 1 1  35 ASP N    N   7.229  -6.395  11.692 1.00 . A A .  35 ASP N    1 1 
        2  2940 1 1  35 ASP O    O   6.556  -7.753   8.554 1.00 . A A .  35 ASP O    1 1 
        2  2941 1 1  35 ASP OD1  O  10.675  -8.038  11.742 1.00 . A A .  35 ASP OD1  1 1 
        2  2942 1 1  35 ASP OD2  O   9.342  -8.192  13.468 1.00 . A A .  35 ASP OD2  1 1 
        2  2943 1 1  36 HIS C    C   4.388 -10.204   9.256 1.00 . A A .  36 HIS C    1 1 
        2  2944 1 1  36 HIS CA   C   4.205  -8.822   9.916 1.00 . A A .  36 HIS CA   1 1 
        2  2945 1 1  36 HIS CB   C   3.512  -7.816   8.967 1.00 . A A .  36 HIS CB   1 1 
        2  2946 1 1  36 HIS CD2  C   1.848  -6.277  10.270 1.00 . A A .  36 HIS CD2  1 1 
        2  2947 1 1  36 HIS CE1  C   3.050  -4.445  10.260 1.00 . A A .  36 HIS CE1  1 1 
        2  2948 1 1  36 HIS CG   C   3.018  -6.562   9.650 1.00 . A A .  36 HIS CG   1 1 
        2  2949 1 1  36 HIS H    H   5.545  -8.311  11.466 1.00 . A A .  36 HIS H    1 1 
        2  2950 1 1  36 HIS HA   H   3.545  -8.966  10.773 1.00 . A A .  36 HIS HA   1 1 
        2  2951 1 1  36 HIS HB2  H   4.214  -7.520   8.194 1.00 . A A .  36 HIS HB2  1 1 
        2  2952 1 1  36 HIS HB3  H   2.662  -8.291   8.494 1.00 . A A .  36 HIS HB3  1 1 
        2  2953 1 1  36 HIS HD1  H   4.648  -5.278   9.303 1.00 . A A .  36 HIS HD1  1 1 
        2  2954 1 1  36 HIS HD2  H   1.033  -6.966  10.459 1.00 . A A .  36 HIS HD2  1 1 
        2  2955 1 1  36 HIS HE1  H   3.369  -3.419  10.402 1.00 . A A .  36 HIS HE1  1 1 
        2  2956 1 1  36 HIS HE2  H   1.099  -4.411  10.856 1.00 . A A .  36 HIS HE2  1 1 
        2  2957 1 1  36 HIS N    N   5.461  -8.302  10.488 1.00 . A A .  36 HIS N    1 1 
        2  2958 1 1  36 HIS ND1  N   3.745  -5.392   9.669 1.00 . A A .  36 HIS ND1  1 1 
        2  2959 1 1  36 HIS NE2  N   1.890  -4.952  10.636 1.00 . A A .  36 HIS NE2  1 1 
        2  2960 1 1  36 HIS O    O   4.618 -10.321   8.048 1.00 . A A .  36 HIS O    1 1 
        2  2961 1 1  37 LYS C    C   2.938 -13.316   9.970 1.00 . A A .  37 LYS C    1 1 
        2  2962 1 1  37 LYS CA   C   4.307 -12.666   9.693 1.00 . A A .  37 LYS CA   1 1 
        2  2963 1 1  37 LYS CB   C   5.421 -13.432  10.451 1.00 . A A .  37 LYS CB   1 1 
        2  2964 1 1  37 LYS CD   C   6.460 -14.121  12.722 1.00 . A A .  37 LYS CD   1 1 
        2  2965 1 1  37 LYS CE   C   7.855 -13.614  12.309 1.00 . A A .  37 LYS CE   1 1 
        2  2966 1 1  37 LYS CG   C   5.305 -13.387  11.992 1.00 . A A .  37 LYS CG   1 1 
        2  2967 1 1  37 LYS H    H   4.198 -11.042  11.059 1.00 . A A .  37 LYS H    1 1 
        2  2968 1 1  37 LYS HA   H   4.504 -12.721   8.627 1.00 . A A .  37 LYS HA   1 1 
        2  2969 1 1  37 LYS HB2  H   5.410 -14.474  10.136 1.00 . A A .  37 LYS HB2  1 1 
        2  2970 1 1  37 LYS HB3  H   6.376 -13.005  10.170 1.00 . A A .  37 LYS HB3  1 1 
        2  2971 1 1  37 LYS HD2  H   6.341 -13.975  13.790 1.00 . A A .  37 LYS HD2  1 1 
        2  2972 1 1  37 LYS HD3  H   6.391 -15.184  12.506 1.00 . A A .  37 LYS HD3  1 1 
        2  2973 1 1  37 LYS HE2  H   8.600 -14.067  12.949 1.00 . A A .  37 LYS HE2  1 1 
        2  2974 1 1  37 LYS HE3  H   8.046 -13.906  11.284 1.00 . A A .  37 LYS HE3  1 1 
        2  2975 1 1  37 LYS HG2  H   5.305 -12.352  12.309 1.00 . A A .  37 LYS HG2  1 1 
        2  2976 1 1  37 LYS HG3  H   4.361 -13.842  12.284 1.00 . A A .  37 LYS HG3  1 1 
        2  2977 1 1  37 LYS HZ1  H   7.774 -11.823  13.385 1.00 . A A .  37 LYS HZ1  1 1 
        2  2978 1 1  37 LYS HZ2  H   7.310 -11.671  11.765 1.00 . A A .  37 LYS HZ2  1 1 
        2  2979 1 1  37 LYS HZ3  H   8.940 -11.839  12.166 1.00 . A A .  37 LYS HZ3  1 1 
        2  2980 1 1  37 LYS N    N   4.295 -11.243  10.104 1.00 . A A .  37 LYS N    1 1 
        2  2981 1 1  37 LYS NZ   N   7.978 -12.135  12.415 1.00 . A A .  37 LYS NZ   1 1 
        2  2982 1 1  37 LYS O    O   2.741 -14.518   9.723 1.00 . A A .  37 LYS O    1 1 
        2  2983 1 1  38 GLU C    C  -0.289 -12.800   9.587 1.00 . A A .  38 GLU C    1 1 
        2  2984 1 1  38 GLU CA   C   0.634 -12.931  10.807 1.00 . A A .  38 GLU CA   1 1 
        2  2985 1 1  38 GLU CB   C   0.066 -12.097  12.008 1.00 . A A .  38 GLU CB   1 1 
        2  2986 1 1  38 GLU CD   C   1.250  -9.775  12.338 1.00 . A A .  38 GLU CD   1 1 
        2  2987 1 1  38 GLU CG   C   0.019 -10.543  11.799 1.00 . A A .  38 GLU CG   1 1 
        2  2988 1 1  38 GLU H    H   2.231 -11.565  10.605 1.00 . A A .  38 GLU H    1 1 
        2  2989 1 1  38 GLU HA   H   0.670 -13.978  11.098 1.00 . A A .  38 GLU HA   1 1 
        2  2990 1 1  38 GLU HB2  H  -0.943 -12.445  12.225 1.00 . A A .  38 GLU HB2  1 1 
        2  2991 1 1  38 GLU HB3  H   0.679 -12.303  12.880 1.00 . A A .  38 GLU HB3  1 1 
        2  2992 1 1  38 GLU HG2  H  -0.056 -10.333  10.739 1.00 . A A .  38 GLU HG2  1 1 
        2  2993 1 1  38 GLU HG3  H  -0.874 -10.156  12.289 1.00 . A A .  38 GLU HG3  1 1 
        2  2994 1 1  38 GLU N    N   1.998 -12.503  10.470 1.00 . A A .  38 GLU N    1 1 
        2  2995 1 1  38 GLU O    O   0.109 -12.287   8.529 1.00 . A A .  38 GLU O    1 1 
        2  2996 1 1  38 GLU OE1  O   2.377 -10.304  12.282 1.00 . A A .  38 GLU OE1  1 1 
        2  2997 1 1  38 GLU OE2  O   1.096  -8.628  12.807 1.00 . A A .  38 GLU OE2  1 1 
        2  2998 1 1  39 GLU C    C  -2.954 -11.635   8.668 1.00 . A A .  39 GLU C    1 1 
        2  2999 1 1  39 GLU CA   C  -2.587 -13.122   8.758 1.00 . A A .  39 GLU CA   1 1 
        2  3000 1 1  39 GLU CB   C  -3.830 -13.973   9.142 1.00 . A A .  39 GLU CB   1 1 
        2  3001 1 1  39 GLU CD   C  -5.634 -14.519  10.880 1.00 . A A .  39 GLU CD   1 1 
        2  3002 1 1  39 GLU CG   C  -4.419 -13.658  10.530 1.00 . A A .  39 GLU CG   1 1 
        2  3003 1 1  39 GLU H    H  -1.736 -13.764  10.583 1.00 . A A .  39 GLU H    1 1 
        2  3004 1 1  39 GLU HA   H  -2.205 -13.467   7.798 1.00 . A A .  39 GLU HA   1 1 
        2  3005 1 1  39 GLU HB2  H  -4.611 -13.828   8.397 1.00 . A A .  39 GLU HB2  1 1 
        2  3006 1 1  39 GLU HB3  H  -3.544 -15.019   9.131 1.00 . A A .  39 GLU HB3  1 1 
        2  3007 1 1  39 GLU HG2  H  -3.646 -13.818  11.276 1.00 . A A .  39 GLU HG2  1 1 
        2  3008 1 1  39 GLU HG3  H  -4.703 -12.610  10.553 1.00 . A A .  39 GLU HG3  1 1 
        2  3009 1 1  39 GLU N    N  -1.528 -13.286   9.753 1.00 . A A .  39 GLU N    1 1 
        2  3010 1 1  39 GLU O    O  -3.115 -10.960   9.704 1.00 . A A .  39 GLU O    1 1 
        2  3011 1 1  39 GLU OE1  O  -5.443 -15.608  11.448 1.00 . A A .  39 GLU OE1  1 1 
        2  3012 1 1  39 GLU OE2  O  -6.785 -14.115  10.583 1.00 . A A .  39 GLU OE2  1 1 
        2  3013 1 1  40 GLY C    C  -3.450  -9.342   5.788 1.00 . A A .  40 GLY C    1 1 
        2  3014 1 1  40 GLY CA   C  -3.462  -9.758   7.238 1.00 . A A .  40 GLY CA   1 1 
        2  3015 1 1  40 GLY H    H  -2.662 -11.629   6.690 1.00 . A A .  40 GLY H    1 1 
        2  3016 1 1  40 GLY HA2  H  -4.475  -9.675   7.624 1.00 . A A .  40 GLY HA2  1 1 
        2  3017 1 1  40 GLY HA3  H  -2.826  -9.078   7.797 1.00 . A A .  40 GLY HA3  1 1 
        2  3018 1 1  40 GLY N    N  -3.004 -11.111   7.446 1.00 . A A .  40 GLY N    1 1 
        2  3019 1 1  40 GLY O    O  -2.725  -9.914   4.968 1.00 . A A .  40 GLY O    1 1 
        2  3020 1 1  41 LEU C    C  -3.750  -6.198   4.606 1.00 . A A .  41 LEU C    1 1 
        2  3021 1 1  41 LEU CA   C  -4.239  -7.586   4.249 1.00 . A A .  41 LEU CA   1 1 
        2  3022 1 1  41 LEU CB   C  -5.603  -7.474   3.534 1.00 . A A .  41 LEU CB   1 1 
        2  3023 1 1  41 LEU CD1  C  -7.381  -8.434   2.038 1.00 . A A .  41 LEU CD1  1 1 
        2  3024 1 1  41 LEU CD2  C  -5.011  -9.217   1.748 1.00 . A A .  41 LEU CD2  1 1 
        2  3025 1 1  41 LEU CG   C  -6.071  -8.733   2.756 1.00 . A A .  41 LEU CG   1 1 
        2  3026 1 1  41 LEU H    H  -5.070  -8.218   6.077 1.00 . A A .  41 LEU H    1 1 
        2  3027 1 1  41 LEU HA   H  -3.520  -8.053   3.570 1.00 . A A .  41 LEU HA   1 1 
        2  3028 1 1  41 LEU HB2  H  -6.361  -7.233   4.283 1.00 . A A .  41 LEU HB2  1 1 
        2  3029 1 1  41 LEU HB3  H  -5.560  -6.643   2.830 1.00 . A A .  41 LEU HB3  1 1 
        2  3030 1 1  41 LEU HD11 H  -8.131  -8.149   2.762 1.00 . A A .  41 LEU HD11 1 1 
        2  3031 1 1  41 LEU HD12 H  -7.714  -9.313   1.510 1.00 . A A .  41 LEU HD12 1 1 
        2  3032 1 1  41 LEU HD13 H  -7.234  -7.621   1.332 1.00 . A A .  41 LEU HD13 1 1 
        2  3033 1 1  41 LEU HD21 H  -5.393 -10.075   1.206 1.00 . A A .  41 LEU HD21 1 1 
        2  3034 1 1  41 LEU HD22 H  -4.112  -9.498   2.277 1.00 . A A .  41 LEU HD22 1 1 
        2  3035 1 1  41 LEU HD23 H  -4.778  -8.419   1.046 1.00 . A A .  41 LEU HD23 1 1 
        2  3036 1 1  41 LEU HG   H  -6.255  -9.542   3.458 1.00 . A A .  41 LEU HG   1 1 
        2  3037 1 1  41 LEU N    N  -4.320  -8.382   5.469 1.00 . A A .  41 LEU N    1 1 
        2  3038 1 1  41 LEU O    O  -4.225  -5.583   5.558 1.00 . A A .  41 LEU O    1 1 
        2  3039 1 1  42 TYR C    C  -3.251  -3.491   3.041 1.00 . A A .  42 TYR C    1 1 
        2  3040 1 1  42 TYR CA   C  -2.319  -4.358   3.867 1.00 . A A .  42 TYR CA   1 1 
        2  3041 1 1  42 TYR CB   C  -0.882  -4.266   3.329 1.00 . A A .  42 TYR CB   1 1 
        2  3042 1 1  42 TYR CD1  C   0.677  -5.881   4.568 1.00 . A A .  42 TYR CD1  1 1 
        2  3043 1 1  42 TYR CD2  C   0.856  -3.539   5.040 1.00 . A A .  42 TYR CD2  1 1 
        2  3044 1 1  42 TYR CE1  C   1.716  -6.126   5.442 1.00 . A A .  42 TYR CE1  1 1 
        2  3045 1 1  42 TYR CE2  C   1.900  -3.784   5.894 1.00 . A A .  42 TYR CE2  1 1 
        2  3046 1 1  42 TYR CG   C   0.221  -4.578   4.348 1.00 . A A .  42 TYR CG   1 1 
        2  3047 1 1  42 TYR CZ   C   2.326  -5.074   6.091 1.00 . A A .  42 TYR CZ   1 1 
        2  3048 1 1  42 TYR H    H  -2.504  -6.296   3.094 1.00 . A A .  42 TYR H    1 1 
        2  3049 1 1  42 TYR HA   H  -2.338  -4.027   4.909 1.00 . A A .  42 TYR HA   1 1 
        2  3050 1 1  42 TYR HB2  H  -0.769  -4.960   2.499 1.00 . A A .  42 TYR HB2  1 1 
        2  3051 1 1  42 TYR HB3  H  -0.701  -3.264   2.948 1.00 . A A .  42 TYR HB3  1 1 
        2  3052 1 1  42 TYR HD1  H   0.197  -6.706   4.057 1.00 . A A .  42 TYR HD1  1 1 
        2  3053 1 1  42 TYR HD2  H   0.516  -2.521   4.892 1.00 . A A .  42 TYR HD2  1 1 
        2  3054 1 1  42 TYR HE1  H   2.056  -7.141   5.605 1.00 . A A .  42 TYR HE1  1 1 
        2  3055 1 1  42 TYR HE2  H   2.375  -2.965   6.419 1.00 . A A .  42 TYR HE2  1 1 
        2  3056 1 1  42 TYR HH   H   3.895  -6.049   6.589 1.00 . A A .  42 TYR HH   1 1 
        2  3057 1 1  42 TYR N    N  -2.821  -5.719   3.802 1.00 . A A .  42 TYR N    1 1 
        2  3058 1 1  42 TYR O    O  -3.334  -3.633   1.810 1.00 . A A .  42 TYR O    1 1 
        2  3059 1 1  42 TYR OH   O   3.384  -5.311   6.926 1.00 . A A .  42 TYR OH   1 1 
        2  3060 1 1  43 VAL C    C  -4.612  -0.310   3.681 1.00 . A A .  43 VAL C    1 1 
        2  3061 1 1  43 VAL CA   C  -4.926  -1.712   3.144 1.00 . A A .  43 VAL CA   1 1 
        2  3062 1 1  43 VAL CB   C  -6.423  -2.132   3.480 1.00 . A A .  43 VAL CB   1 1 
        2  3063 1 1  43 VAL CG1  C  -6.702  -3.613   3.090 1.00 . A A .  43 VAL CG1  1 1 
        2  3064 1 1  43 VAL CG2  C  -6.776  -1.861   4.963 1.00 . A A .  43 VAL CG2  1 1 
        2  3065 1 1  43 VAL H    H  -3.849  -2.588   4.700 1.00 . A A .  43 VAL H    1 1 
        2  3066 1 1  43 VAL HA   H  -4.797  -1.711   2.060 1.00 . A A .  43 VAL HA   1 1 
        2  3067 1 1  43 VAL HB   H  -7.077  -1.510   2.868 1.00 . A A .  43 VAL HB   1 1 
        2  3068 1 1  43 VAL HG11 H  -7.729  -3.870   3.322 1.00 . A A .  43 VAL HG11 1 1 
        2  3069 1 1  43 VAL HG12 H  -6.036  -4.274   3.635 1.00 . A A .  43 VAL HG12 1 1 
        2  3070 1 1  43 VAL HG13 H  -6.532  -3.745   2.028 1.00 . A A .  43 VAL HG13 1 1 
        2  3071 1 1  43 VAL HG21 H  -6.699  -0.797   5.159 1.00 . A A .  43 VAL HG21 1 1 
        2  3072 1 1  43 VAL HG22 H  -6.082  -2.391   5.608 1.00 . A A .  43 VAL HG22 1 1 
        2  3073 1 1  43 VAL HG23 H  -7.785  -2.187   5.170 1.00 . A A .  43 VAL HG23 1 1 
        2  3074 1 1  43 VAL N    N  -3.973  -2.629   3.735 1.00 . A A .  43 VAL N    1 1 
        2  3075 1 1  43 VAL O    O  -4.186  -0.168   4.839 1.00 . A A .  43 VAL O    1 1 
        2  3076 1 1  44 ASP C    C  -5.892   2.453   4.130 1.00 . A A .  44 ASP C    1 1 
        2  3077 1 1  44 ASP CA   C  -4.656   2.105   3.296 1.00 . A A .  44 ASP CA   1 1 
        2  3078 1 1  44 ASP CB   C  -4.512   3.059   2.088 1.00 . A A .  44 ASP CB   1 1 
        2  3079 1 1  44 ASP CG   C  -5.618   2.867   1.041 1.00 . A A .  44 ASP CG   1 1 
        2  3080 1 1  44 ASP H    H  -5.074   0.539   1.934 1.00 . A A .  44 ASP H    1 1 
        2  3081 1 1  44 ASP HA   H  -3.766   2.182   3.924 1.00 . A A .  44 ASP HA   1 1 
        2  3082 1 1  44 ASP HB2  H  -4.530   4.088   2.438 1.00 . A A .  44 ASP HB2  1 1 
        2  3083 1 1  44 ASP HB3  H  -3.550   2.881   1.619 1.00 . A A .  44 ASP HB3  1 1 
        2  3084 1 1  44 ASP N    N  -4.791   0.714   2.853 1.00 . A A .  44 ASP N    1 1 
        2  3085 1 1  44 ASP O    O  -6.997   2.168   3.712 1.00 . A A .  44 ASP O    1 1 
        2  3086 1 1  44 ASP OD1  O  -6.692   3.496   1.152 1.00 . A A .  44 ASP OD1  1 1 
        2  3087 1 1  44 ASP OD2  O  -5.413   2.089   0.098 1.00 . A A .  44 ASP OD2  1 1 
        2  3088 1 1  45 ILE C    C  -7.611   4.575   5.573 1.00 . A A .  45 ILE C    1 1 
        2  3089 1 1  45 ILE CA   C  -6.826   3.385   6.209 1.00 . A A .  45 ILE CA   1 1 
        2  3090 1 1  45 ILE CB   C  -6.366   3.751   7.677 1.00 . A A .  45 ILE CB   1 1 
        2  3091 1 1  45 ILE CD1  C  -4.649   3.143   9.534 1.00 . A A .  45 ILE CD1  1 1 
        2  3092 1 1  45 ILE CG1  C  -5.259   2.778   8.186 1.00 . A A .  45 ILE CG1  1 1 
        2  3093 1 1  45 ILE CG2  C  -7.577   3.780   8.660 1.00 . A A .  45 ILE CG2  1 1 
        2  3094 1 1  45 ILE H    H  -4.782   2.986   5.686 1.00 . A A .  45 ILE H    1 1 
        2  3095 1 1  45 ILE HA   H  -7.505   2.535   6.272 1.00 . A A .  45 ILE HA   1 1 
        2  3096 1 1  45 ILE HB   H  -5.945   4.752   7.647 1.00 . A A .  45 ILE HB   1 1 
        2  3097 1 1  45 ILE HD11 H  -3.862   2.442   9.772 1.00 . A A .  45 ILE HD11 1 1 
        2  3098 1 1  45 ILE HD12 H  -5.409   3.110  10.300 1.00 . A A .  45 ILE HD12 1 1 
        2  3099 1 1  45 ILE HD13 H  -4.232   4.141   9.482 1.00 . A A .  45 ILE HD13 1 1 
        2  3100 1 1  45 ILE HG12 H  -5.671   1.785   8.275 1.00 . A A .  45 ILE HG12 1 1 
        2  3101 1 1  45 ILE HG13 H  -4.450   2.754   7.461 1.00 . A A .  45 ILE HG13 1 1 
        2  3102 1 1  45 ILE HG21 H  -7.237   4.072   9.649 1.00 . A A .  45 ILE HG21 1 1 
        2  3103 1 1  45 ILE HG22 H  -8.035   2.802   8.715 1.00 . A A .  45 ILE HG22 1 1 
        2  3104 1 1  45 ILE HG23 H  -8.311   4.498   8.313 1.00 . A A .  45 ILE HG23 1 1 
        2  3105 1 1  45 ILE N    N  -5.696   2.967   5.343 1.00 . A A .  45 ILE N    1 1 
        2  3106 1 1  45 ILE O    O  -8.824   4.692   5.794 1.00 . A A .  45 ILE O    1 1 
        2  3107 1 1  46 VAL C    C  -8.774   6.270   3.238 1.00 . A A .  46 VAL C    1 1 
        2  3108 1 1  46 VAL CA   C  -7.522   6.616   4.085 1.00 . A A .  46 VAL CA   1 1 
        2  3109 1 1  46 VAL CB   C  -6.500   7.428   3.180 1.00 . A A .  46 VAL CB   1 1 
        2  3110 1 1  46 VAL CG1  C  -5.494   8.218   4.036 1.00 . A A .  46 VAL CG1  1 1 
        2  3111 1 1  46 VAL CG2  C  -5.771   6.521   2.154 1.00 . A A .  46 VAL CG2  1 1 
        2  3112 1 1  46 VAL H    H  -5.931   5.303   4.710 1.00 . A A .  46 VAL H    1 1 
        2  3113 1 1  46 VAL HA   H  -7.853   7.287   4.874 1.00 . A A .  46 VAL HA   1 1 
        2  3114 1 1  46 VAL HB   H  -7.070   8.163   2.616 1.00 . A A .  46 VAL HB   1 1 
        2  3115 1 1  46 VAL HG11 H  -4.921   7.534   4.641 1.00 . A A .  46 VAL HG11 1 1 
        2  3116 1 1  46 VAL HG12 H  -6.025   8.902   4.682 1.00 . A A .  46 VAL HG12 1 1 
        2  3117 1 1  46 VAL HG13 H  -4.824   8.779   3.396 1.00 . A A .  46 VAL HG13 1 1 
        2  3118 1 1  46 VAL HG21 H  -5.127   7.121   1.516 1.00 . A A .  46 VAL HG21 1 1 
        2  3119 1 1  46 VAL HG22 H  -6.498   6.009   1.530 1.00 . A A .  46 VAL HG22 1 1 
        2  3120 1 1  46 VAL HG23 H  -5.170   5.782   2.670 1.00 . A A .  46 VAL HG23 1 1 
        2  3121 1 1  46 VAL N    N  -6.903   5.439   4.782 1.00 . A A .  46 VAL N    1 1 
        2  3122 1 1  46 VAL O    O  -9.712   7.079   3.171 1.00 . A A .  46 VAL O    1 1 
        2  3123 1 1  47 SER C    C -10.239   3.183   1.840 1.00 . A A .  47 SER C    1 1 
        2  3124 1 1  47 SER CA   C  -9.922   4.694   1.706 1.00 . A A .  47 SER CA   1 1 
        2  3125 1 1  47 SER CB   C  -9.594   5.093   0.243 1.00 . A A .  47 SER CB   1 1 
        2  3126 1 1  47 SER H    H  -8.021   4.494   2.666 1.00 . A A .  47 SER H    1 1 
        2  3127 1 1  47 SER HA   H -10.810   5.237   2.025 1.00 . A A .  47 SER HA   1 1 
        2  3128 1 1  47 SER HB2  H  -9.294   6.130   0.219 1.00 . A A .  47 SER HB2  1 1 
        2  3129 1 1  47 SER HB3  H  -8.777   4.481  -0.123 1.00 . A A .  47 SER HB3  1 1 
        2  3130 1 1  47 SER HG   H -11.108   4.069  -0.488 1.00 . A A .  47 SER HG   1 1 
        2  3131 1 1  47 SER N    N  -8.792   5.097   2.584 1.00 . A A .  47 SER N    1 1 
        2  3132 1 1  47 SER O    O -11.164   2.680   1.186 1.00 . A A .  47 SER O    1 1 
        2  3133 1 1  47 SER OG   O -10.706   4.934  -0.632 1.00 . A A .  47 SER OG   1 1 
        2  3134 1 1  48 GLY C    C  -9.556   0.117   1.813 1.00 . A A .  48 GLY C    1 1 
        2  3135 1 1  48 GLY CA   C  -9.719   1.053   3.013 1.00 . A A .  48 GLY CA   1 1 
        2  3136 1 1  48 GLY H    H  -8.754   2.951   3.154 1.00 . A A .  48 GLY H    1 1 
        2  3137 1 1  48 GLY HA2  H  -9.016   0.753   3.780 1.00 . A A .  48 GLY HA2  1 1 
        2  3138 1 1  48 GLY HA3  H -10.723   0.947   3.410 1.00 . A A .  48 GLY HA3  1 1 
        2  3139 1 1  48 GLY N    N  -9.486   2.480   2.704 1.00 . A A .  48 GLY N    1 1 
        2  3140 1 1  48 GLY O    O -10.289  -0.865   1.701 1.00 . A A .  48 GLY O    1 1 
        2  3141 1 1  49 LYS C    C  -7.453  -1.484  -0.208 1.00 . A A .  49 LYS C    1 1 
        2  3142 1 1  49 LYS CA   C  -8.420  -0.297  -0.364 1.00 . A A .  49 LYS CA   1 1 
        2  3143 1 1  49 LYS CB   C  -7.860   0.672  -1.437 1.00 . A A .  49 LYS CB   1 1 
        2  3144 1 1  49 LYS CD   C -10.027   1.952  -1.969 1.00 . A A .  49 LYS CD   1 1 
        2  3145 1 1  49 LYS CE   C -10.154   1.464  -3.406 1.00 . A A .  49 LYS CE   1 1 
        2  3146 1 1  49 LYS CG   C  -8.564   2.035  -1.501 1.00 . A A .  49 LYS CG   1 1 
        2  3147 1 1  49 LYS H    H  -7.956   1.143   1.149 1.00 . A A .  49 LYS H    1 1 
        2  3148 1 1  49 LYS HA   H  -9.395  -0.656  -0.685 1.00 . A A .  49 LYS HA   1 1 
        2  3149 1 1  49 LYS HB2  H  -6.814   0.858  -1.221 1.00 . A A .  49 LYS HB2  1 1 
        2  3150 1 1  49 LYS HB3  H  -7.931   0.201  -2.416 1.00 . A A .  49 LYS HB3  1 1 
        2  3151 1 1  49 LYS HD2  H -10.568   1.276  -1.319 1.00 . A A .  49 LYS HD2  1 1 
        2  3152 1 1  49 LYS HD3  H -10.467   2.940  -1.896 1.00 . A A .  49 LYS HD3  1 1 
        2  3153 1 1  49 LYS HE2  H  -9.828   0.429  -3.467 1.00 . A A .  49 LYS HE2  1 1 
        2  3154 1 1  49 LYS HE3  H -11.188   1.530  -3.710 1.00 . A A .  49 LYS HE3  1 1 
        2  3155 1 1  49 LYS HG2  H  -8.547   2.474  -0.508 1.00 . A A .  49 LYS HG2  1 1 
        2  3156 1 1  49 LYS HG3  H  -8.010   2.682  -2.177 1.00 . A A .  49 LYS HG3  1 1 
        2  3157 1 1  49 LYS HZ1  H  -8.321   2.204  -4.086 1.00 . A A .  49 LYS HZ1  1 1 
        2  3158 1 1  49 LYS HZ2  H  -9.616   3.271  -4.299 1.00 . A A .  49 LYS HZ2  1 1 
        2  3159 1 1  49 LYS HZ3  H  -9.444   1.936  -5.307 1.00 . A A .  49 LYS HZ3  1 1 
        2  3160 1 1  49 LYS N    N  -8.589   0.420   0.928 1.00 . A A .  49 LYS N    1 1 
        2  3161 1 1  49 LYS NZ   N  -9.330   2.279  -4.336 1.00 . A A .  49 LYS NZ   1 1 
        2  3162 1 1  49 LYS O    O  -6.421  -1.322   0.427 1.00 . A A .  49 LYS O    1 1 
        2  3163 1 1  50 PRO C    C  -5.608  -3.621  -1.691 1.00 . A A .  50 PRO C    1 1 
        2  3164 1 1  50 PRO CA   C  -6.813  -3.835  -0.746 1.00 . A A .  50 PRO CA   1 1 
        2  3165 1 1  50 PRO CB   C  -7.707  -5.020  -1.181 1.00 . A A .  50 PRO CB   1 1 
        2  3166 1 1  50 PRO CD   C  -8.943  -2.990  -1.630 1.00 . A A .  50 PRO CD   1 1 
        2  3167 1 1  50 PRO CG   C  -8.707  -4.410  -2.128 1.00 . A A .  50 PRO CG   1 1 
        2  3168 1 1  50 PRO HA   H  -6.457  -3.998   0.272 1.00 . A A .  50 PRO HA   1 1 
        2  3169 1 1  50 PRO HB2  H  -7.110  -5.790  -1.662 1.00 . A A .  50 PRO HB2  1 1 
        2  3170 1 1  50 PRO HB3  H  -8.199  -5.449  -0.311 1.00 . A A .  50 PRO HB3  1 1 
        2  3171 1 1  50 PRO HD2  H  -9.030  -2.297  -2.460 1.00 . A A .  50 PRO HD2  1 1 
        2  3172 1 1  50 PRO HD3  H  -9.839  -2.943  -1.016 1.00 . A A .  50 PRO HD3  1 1 
        2  3173 1 1  50 PRO HG2  H  -8.299  -4.394  -3.136 1.00 . A A .  50 PRO HG2  1 1 
        2  3174 1 1  50 PRO HG3  H  -9.631  -4.978  -2.116 1.00 . A A .  50 PRO HG3  1 1 
        2  3175 1 1  50 PRO N    N  -7.736  -2.683  -0.814 1.00 . A A .  50 PRO N    1 1 
        2  3176 1 1  50 PRO O    O  -5.771  -3.461  -2.907 1.00 . A A .  50 PRO O    1 1 
        2  3177 1 1  51 LEU C    C  -2.199  -4.421  -1.999 1.00 . A A .  51 LEU C    1 1 
        2  3178 1 1  51 LEU CA   C  -3.154  -3.235  -1.853 1.00 . A A .  51 LEU CA   1 1 
        2  3179 1 1  51 LEU CB   C  -2.457  -2.051  -1.141 1.00 . A A .  51 LEU CB   1 1 
        2  3180 1 1  51 LEU CD1  C  -2.599   0.292  -0.148 1.00 . A A .  51 LEU CD1  1 1 
        2  3181 1 1  51 LEU CD2  C  -4.137  -0.353  -2.104 1.00 . A A .  51 LEU CD2  1 1 
        2  3182 1 1  51 LEU CG   C  -3.381  -0.835  -0.835 1.00 . A A .  51 LEU CG   1 1 
        2  3183 1 1  51 LEU H    H  -4.321  -3.795  -0.150 1.00 . A A .  51 LEU H    1 1 
        2  3184 1 1  51 LEU HA   H  -3.439  -2.911  -2.848 1.00 . A A .  51 LEU HA   1 1 
        2  3185 1 1  51 LEU HB2  H  -2.043  -2.412  -0.199 1.00 . A A .  51 LEU HB2  1 1 
        2  3186 1 1  51 LEU HB3  H  -1.630  -1.708  -1.761 1.00 . A A .  51 LEU HB3  1 1 
        2  3187 1 1  51 LEU HD11 H  -1.803   0.643  -0.798 1.00 . A A .  51 LEU HD11 1 1 
        2  3188 1 1  51 LEU HD12 H  -2.168  -0.085   0.770 1.00 . A A .  51 LEU HD12 1 1 
        2  3189 1 1  51 LEU HD13 H  -3.265   1.108   0.084 1.00 . A A .  51 LEU HD13 1 1 
        2  3190 1 1  51 LEU HD21 H  -3.433  -0.081  -2.879 1.00 . A A .  51 LEU HD21 1 1 
        2  3191 1 1  51 LEU HD22 H  -4.752   0.506  -1.861 1.00 . A A .  51 LEU HD22 1 1 
        2  3192 1 1  51 LEU HD23 H  -4.777  -1.147  -2.468 1.00 . A A .  51 LEU HD23 1 1 
        2  3193 1 1  51 LEU HG   H  -4.134  -1.156  -0.121 1.00 . A A .  51 LEU HG   1 1 
        2  3194 1 1  51 LEU N    N  -4.389  -3.603  -1.113 1.00 . A A .  51 LEU N    1 1 
        2  3195 1 1  51 LEU O    O  -1.567  -4.584  -3.046 1.00 . A A .  51 LEU O    1 1 
        2  3196 1 1  52 PHE C    C  -1.532  -7.218   0.403 1.00 . A A .  52 PHE C    1 1 
        2  3197 1 1  52 PHE CA   C  -1.271  -6.465  -0.902 1.00 . A A .  52 PHE CA   1 1 
        2  3198 1 1  52 PHE CB   C   0.256  -6.205  -1.121 1.00 . A A .  52 PHE CB   1 1 
        2  3199 1 1  52 PHE CD1  C   0.751  -3.935  -0.060 1.00 . A A .  52 PHE CD1  1 1 
        2  3200 1 1  52 PHE CD2  C   1.880  -5.861   0.818 1.00 . A A .  52 PHE CD2  1 1 
        2  3201 1 1  52 PHE CE1  C   1.429  -3.130   0.834 1.00 . A A .  52 PHE CE1  1 1 
        2  3202 1 1  52 PHE CE2  C   2.568  -5.053   1.701 1.00 . A A .  52 PHE CE2  1 1 
        2  3203 1 1  52 PHE CG   C   0.961  -5.319  -0.085 1.00 . A A .  52 PHE CG   1 1 
        2  3204 1 1  52 PHE CZ   C   2.341  -3.688   1.709 1.00 . A A .  52 PHE CZ   1 1 
        2  3205 1 1  52 PHE H    H  -2.599  -4.999  -0.120 1.00 . A A .  52 PHE H    1 1 
        2  3206 1 1  52 PHE HA   H  -1.633  -7.093  -1.713 1.00 . A A .  52 PHE HA   1 1 
        2  3207 1 1  52 PHE HB2  H   0.767  -7.158  -1.147 1.00 . A A .  52 PHE HB2  1 1 
        2  3208 1 1  52 PHE HB3  H   0.388  -5.735  -2.096 1.00 . A A .  52 PHE HB3  1 1 
        2  3209 1 1  52 PHE HD1  H   0.036  -3.491  -0.742 1.00 . A A .  52 PHE HD1  1 1 
        2  3210 1 1  52 PHE HD2  H   2.055  -6.931   0.818 1.00 . A A .  52 PHE HD2  1 1 
        2  3211 1 1  52 PHE HE1  H   1.251  -2.062   0.843 1.00 . A A .  52 PHE HE1  1 1 
        2  3212 1 1  52 PHE HE2  H   3.276  -5.490   2.393 1.00 . A A .  52 PHE HE2  1 1 
        2  3213 1 1  52 PHE HZ   H   2.882  -3.056   2.399 1.00 . A A .  52 PHE HZ   1 1 
        2  3214 1 1  52 PHE N    N  -2.093  -5.232  -0.931 1.00 . A A .  52 PHE N    1 1 
        2  3215 1 1  52 PHE O    O  -2.335  -6.777   1.219 1.00 . A A .  52 PHE O    1 1 
        2  3216 1 1  53 THR C    C   0.224  -9.307   2.604 1.00 . A A .  53 THR C    1 1 
        2  3217 1 1  53 THR CA   C  -1.064  -9.238   1.752 1.00 . A A .  53 THR CA   1 1 
        2  3218 1 1  53 THR CB   C  -1.524 -10.680   1.342 1.00 . A A .  53 THR CB   1 1 
        2  3219 1 1  53 THR CG2  C  -0.526 -11.375   0.381 1.00 . A A .  53 THR CG2  1 1 
        2  3220 1 1  53 THR H    H  -0.283  -8.677  -0.144 1.00 . A A .  53 THR H    1 1 
        2  3221 1 1  53 THR HA   H  -1.854  -8.810   2.372 1.00 . A A .  53 THR HA   1 1 
        2  3222 1 1  53 THR HB   H  -2.482 -10.595   0.836 1.00 . A A .  53 THR HB   1 1 
        2  3223 1 1  53 THR HG1  H  -2.555 -11.236   2.931 1.00 . A A .  53 THR HG1  1 1 
        2  3224 1 1  53 THR HG21 H  -0.407 -10.778  -0.516 1.00 . A A .  53 THR HG21 1 1 
        2  3225 1 1  53 THR HG22 H  -0.899 -12.355   0.108 1.00 . A A .  53 THR HG22 1 1 
        2  3226 1 1  53 THR HG23 H   0.438 -11.485   0.864 1.00 . A A .  53 THR HG23 1 1 
        2  3227 1 1  53 THR N    N  -0.893  -8.384   0.565 1.00 . A A .  53 THR N    1 1 
        2  3228 1 1  53 THR O    O   1.345  -9.172   2.094 1.00 . A A .  53 THR O    1 1 
        2  3229 1 1  53 THR OG1  O  -1.718 -11.477   2.519 1.00 . A A .  53 THR OG1  1 1 
        2  3230 1 1  54 SER C    C   1.700 -11.181   4.691 1.00 . A A .  54 SER C    1 1 
        2  3231 1 1  54 SER CA   C   1.094  -9.773   4.904 1.00 . A A .  54 SER CA   1 1 
        2  3232 1 1  54 SER CB   C   0.524  -9.638   6.342 1.00 . A A .  54 SER CB   1 1 
        2  3233 1 1  54 SER H    H  -0.894  -9.449   4.255 1.00 . A A .  54 SER H    1 1 
        2  3234 1 1  54 SER HA   H   1.873  -9.030   4.764 1.00 . A A .  54 SER HA   1 1 
        2  3235 1 1  54 SER HB2  H   0.052  -8.670   6.455 1.00 . A A .  54 SER HB2  1 1 
        2  3236 1 1  54 SER HB3  H  -0.217 -10.411   6.512 1.00 . A A .  54 SER HB3  1 1 
        2  3237 1 1  54 SER HG   H   2.169 -10.431   7.082 1.00 . A A .  54 SER HG   1 1 
        2  3238 1 1  54 SER N    N   0.024  -9.506   3.923 1.00 . A A .  54 SER N    1 1 
        2  3239 1 1  54 SER O    O   2.807 -11.462   5.158 1.00 . A A .  54 SER O    1 1 
        2  3240 1 1  54 SER OG   O   1.531  -9.753   7.335 1.00 . A A .  54 SER OG   1 1 
        2  3241 1 1  55 LYS C    C   2.671 -13.372   2.747 1.00 . A A .  55 LYS C    1 1 
        2  3242 1 1  55 LYS CA   C   1.389 -13.413   3.609 1.00 . A A .  55 LYS CA   1 1 
        2  3243 1 1  55 LYS CB   C   0.240 -14.131   2.848 1.00 . A A .  55 LYS CB   1 1 
        2  3244 1 1  55 LYS CD   C  -0.579 -16.191   1.536 1.00 . A A .  55 LYS CD   1 1 
        2  3245 1 1  55 LYS CE   C  -0.198 -17.555   0.932 1.00 . A A .  55 LYS CE   1 1 
        2  3246 1 1  55 LYS CG   C   0.583 -15.539   2.320 1.00 . A A .  55 LYS CG   1 1 
        2  3247 1 1  55 LYS H    H   0.046 -11.773   3.727 1.00 . A A .  55 LYS H    1 1 
        2  3248 1 1  55 LYS HA   H   1.596 -13.961   4.526 1.00 . A A .  55 LYS HA   1 1 
        2  3249 1 1  55 LYS HB2  H  -0.614 -14.218   3.515 1.00 . A A .  55 LYS HB2  1 1 
        2  3250 1 1  55 LYS HB3  H  -0.052 -13.510   2.005 1.00 . A A .  55 LYS HB3  1 1 
        2  3251 1 1  55 LYS HD2  H  -1.416 -16.334   2.209 1.00 . A A .  55 LYS HD2  1 1 
        2  3252 1 1  55 LYS HD3  H  -0.883 -15.524   0.733 1.00 . A A .  55 LYS HD3  1 1 
        2  3253 1 1  55 LYS HE2  H   0.629 -17.429   0.247 1.00 . A A .  55 LYS HE2  1 1 
        2  3254 1 1  55 LYS HE3  H   0.099 -18.226   1.729 1.00 . A A .  55 LYS HE3  1 1 
        2  3255 1 1  55 LYS HG2  H   1.447 -15.462   1.669 1.00 . A A .  55 LYS HG2  1 1 
        2  3256 1 1  55 LYS HG3  H   0.833 -16.170   3.167 1.00 . A A .  55 LYS HG3  1 1 
        2  3257 1 1  55 LYS HZ1  H  -1.030 -19.055  -0.249 1.00 . A A .  55 LYS HZ1  1 1 
        2  3258 1 1  55 LYS HZ2  H  -1.669 -17.519  -0.541 1.00 . A A .  55 LYS HZ2  1 1 
        2  3259 1 1  55 LYS HZ3  H  -2.116 -18.369   0.853 1.00 . A A .  55 LYS HZ3  1 1 
        2  3260 1 1  55 LYS N    N   0.947 -12.053   3.990 1.00 . A A .  55 LYS N    1 1 
        2  3261 1 1  55 LYS NZ   N  -1.332 -18.167   0.199 1.00 . A A .  55 LYS NZ   1 1 
        2  3262 1 1  55 LYS O    O   3.533 -14.255   2.853 1.00 . A A .  55 LYS O    1 1 
        2  3263 1 1  56 ASP C    C   4.723 -10.879   1.353 1.00 . A A .  56 ASP C    1 1 
        2  3264 1 1  56 ASP CA   C   3.944 -12.163   0.994 1.00 . A A .  56 ASP CA   1 1 
        2  3265 1 1  56 ASP CB   C   3.445 -12.159  -0.481 1.00 . A A .  56 ASP CB   1 1 
        2  3266 1 1  56 ASP CG   C   4.562 -12.463  -1.501 1.00 . A A .  56 ASP CG   1 1 
        2  3267 1 1  56 ASP H    H   2.094 -11.642   1.906 1.00 . A A .  56 ASP H    1 1 
        2  3268 1 1  56 ASP HA   H   4.619 -13.007   1.135 1.00 . A A .  56 ASP HA   1 1 
        2  3269 1 1  56 ASP HB2  H   2.670 -12.911  -0.594 1.00 . A A .  56 ASP HB2  1 1 
        2  3270 1 1  56 ASP HB3  H   3.014 -11.189  -0.708 1.00 . A A .  56 ASP HB3  1 1 
        2  3271 1 1  56 ASP N    N   2.793 -12.329   1.907 1.00 . A A .  56 ASP N    1 1 
        2  3272 1 1  56 ASP O    O   5.308 -10.209   0.488 1.00 . A A .  56 ASP O    1 1 
        2  3273 1 1  56 ASP OD1  O   4.976 -13.639  -1.595 1.00 . A A .  56 ASP OD1  1 1 
        2  3274 1 1  56 ASP OD2  O   5.035 -11.540  -2.208 1.00 . A A .  56 ASP OD2  1 1 
        2  3275 1 1  57 LYS C    C   7.014  -9.761   3.207 1.00 . A A .  57 LYS C    1 1 
        2  3276 1 1  57 LYS CA   C   5.509  -9.437   3.208 1.00 . A A .  57 LYS CA   1 1 
        2  3277 1 1  57 LYS CB   C   5.009  -9.122   4.649 1.00 . A A .  57 LYS CB   1 1 
        2  3278 1 1  57 LYS CD   C   5.824  -6.673   4.776 1.00 . A A .  57 LYS CD   1 1 
        2  3279 1 1  57 LYS CE   C   6.538  -5.623   5.653 1.00 . A A .  57 LYS CE   1 1 
        2  3280 1 1  57 LYS CG   C   5.815  -8.066   5.440 1.00 . A A .  57 LYS CG   1 1 
        2  3281 1 1  57 LYS H    H   4.245 -11.131   3.284 1.00 . A A .  57 LYS H    1 1 
        2  3282 1 1  57 LYS HA   H   5.324  -8.572   2.572 1.00 . A A .  57 LYS HA   1 1 
        2  3283 1 1  57 LYS HB2  H   3.985  -8.774   4.586 1.00 . A A .  57 LYS HB2  1 1 
        2  3284 1 1  57 LYS HB3  H   5.014 -10.046   5.223 1.00 . A A .  57 LYS HB3  1 1 
        2  3285 1 1  57 LYS HD2  H   6.336  -6.739   3.821 1.00 . A A .  57 LYS HD2  1 1 
        2  3286 1 1  57 LYS HD3  H   4.797  -6.356   4.610 1.00 . A A .  57 LYS HD3  1 1 
        2  3287 1 1  57 LYS HE2  H   6.530  -4.674   5.138 1.00 . A A .  57 LYS HE2  1 1 
        2  3288 1 1  57 LYS HE3  H   5.999  -5.519   6.589 1.00 . A A .  57 LYS HE3  1 1 
        2  3289 1 1  57 LYS HG2  H   5.382  -7.973   6.432 1.00 . A A .  57 LYS HG2  1 1 
        2  3290 1 1  57 LYS HG3  H   6.841  -8.415   5.539 1.00 . A A .  57 LYS HG3  1 1 
        2  3291 1 1  57 LYS HZ1  H   8.427  -5.194   6.431 1.00 . A A .  57 LYS HZ1  1 1 
        2  3292 1 1  57 LYS HZ2  H   8.461  -6.201   5.076 1.00 . A A .  57 LYS HZ2  1 1 
        2  3293 1 1  57 LYS HZ3  H   7.979  -6.817   6.575 1.00 . A A .  57 LYS HZ3  1 1 
        2  3294 1 1  57 LYS N    N   4.755 -10.574   2.661 1.00 . A A .  57 LYS N    1 1 
        2  3295 1 1  57 LYS NZ   N   7.946  -5.984   5.952 1.00 . A A .  57 LYS NZ   1 1 
        2  3296 1 1  57 LYS O    O   7.446 -10.755   3.802 1.00 . A A .  57 LYS O    1 1 
        2  3297 1 1  58 PHE C    C   9.833  -7.851   3.320 1.00 . A A .  58 PHE C    1 1 
        2  3298 1 1  58 PHE CA   C   9.256  -8.996   2.463 1.00 . A A .  58 PHE CA   1 1 
        2  3299 1 1  58 PHE CB   C   9.749  -8.902   0.986 1.00 . A A .  58 PHE CB   1 1 
        2  3300 1 1  58 PHE CD1  C  11.813 -10.392   0.951 1.00 . A A .  58 PHE CD1  1 1 
        2  3301 1 1  58 PHE CD2  C  12.096  -8.081   0.412 1.00 . A A .  58 PHE CD2  1 1 
        2  3302 1 1  58 PHE CE1  C  13.165 -10.601   0.759 1.00 . A A .  58 PHE CE1  1 1 
        2  3303 1 1  58 PHE CE2  C  13.446  -8.297   0.217 1.00 . A A .  58 PHE CE2  1 1 
        2  3304 1 1  58 PHE CG   C  11.250  -9.126   0.781 1.00 . A A .  58 PHE CG   1 1 
        2  3305 1 1  58 PHE CZ   C  13.982  -9.554   0.393 1.00 . A A .  58 PHE CZ   1 1 
        2  3306 1 1  58 PHE H    H   7.351  -8.201   2.008 1.00 . A A .  58 PHE H    1 1 
        2  3307 1 1  58 PHE HA   H   9.570  -9.952   2.884 1.00 . A A .  58 PHE HA   1 1 
        2  3308 1 1  58 PHE HB2  H   9.229  -9.648   0.395 1.00 . A A .  58 PHE HB2  1 1 
        2  3309 1 1  58 PHE HB3  H   9.495  -7.922   0.592 1.00 . A A .  58 PHE HB3  1 1 
        2  3310 1 1  58 PHE HD1  H  11.182 -11.224   1.242 1.00 . A A .  58 PHE HD1  1 1 
        2  3311 1 1  58 PHE HD2  H  11.686  -7.085   0.280 1.00 . A A .  58 PHE HD2  1 1 
        2  3312 1 1  58 PHE HE1  H  13.585 -11.589   0.896 1.00 . A A .  58 PHE HE1  1 1 
        2  3313 1 1  58 PHE HE2  H  14.084  -7.474  -0.072 1.00 . A A .  58 PHE HE2  1 1 
        2  3314 1 1  58 PHE HZ   H  15.041  -9.719   0.234 1.00 . A A .  58 PHE HZ   1 1 
        2  3315 1 1  58 PHE N    N   7.788  -8.919   2.509 1.00 . A A .  58 PHE N    1 1 
        2  3316 1 1  58 PHE O    O   9.249  -6.756   3.390 1.00 . A A .  58 PHE O    1 1 
        2  3317 1 1  59 ASP C    C  12.264  -5.989   4.068 1.00 . A A .  59 ASP C    1 1 
        2  3318 1 1  59 ASP CA   C  11.663  -7.169   4.868 1.00 . A A .  59 ASP CA   1 1 
        2  3319 1 1  59 ASP CB   C  12.772  -7.901   5.669 1.00 . A A .  59 ASP CB   1 1 
        2  3320 1 1  59 ASP CG   C  13.768  -8.641   4.759 1.00 . A A .  59 ASP CG   1 1 
        2  3321 1 1  59 ASP H    H  11.367  -9.014   3.849 1.00 . A A .  59 ASP H    1 1 
        2  3322 1 1  59 ASP HA   H  10.926  -6.780   5.568 1.00 . A A .  59 ASP HA   1 1 
        2  3323 1 1  59 ASP HB2  H  13.316  -7.175   6.270 1.00 . A A .  59 ASP HB2  1 1 
        2  3324 1 1  59 ASP HB3  H  12.311  -8.622   6.340 1.00 . A A .  59 ASP HB3  1 1 
        2  3325 1 1  59 ASP N    N  10.967  -8.127   3.976 1.00 . A A .  59 ASP N    1 1 
        2  3326 1 1  59 ASP O    O  12.620  -6.146   2.899 1.00 . A A .  59 ASP O    1 1 
        2  3327 1 1  59 ASP OD1  O  13.477  -9.788   4.347 1.00 . A A .  59 ASP OD1  1 1 
        2  3328 1 1  59 ASP OD2  O  14.838  -8.084   4.440 1.00 . A A .  59 ASP OD2  1 1 
        2  3329 1 1  60 SER C    C  13.555  -2.689   5.139 1.00 . A A .  60 SER C    1 1 
        2  3330 1 1  60 SER CA   C  12.892  -3.593   4.087 1.00 . A A .  60 SER CA   1 1 
        2  3331 1 1  60 SER CB   C  11.737  -2.845   3.381 1.00 . A A .  60 SER CB   1 1 
        2  3332 1 1  60 SER H    H  12.147  -4.790   5.673 1.00 . A A .  60 SER H    1 1 
        2  3333 1 1  60 SER HA   H  13.638  -3.873   3.341 1.00 . A A .  60 SER HA   1 1 
        2  3334 1 1  60 SER HB2  H  11.275  -3.501   2.656 1.00 . A A .  60 SER HB2  1 1 
        2  3335 1 1  60 SER HB3  H  10.991  -2.550   4.110 1.00 . A A .  60 SER HB3  1 1 
        2  3336 1 1  60 SER HG   H  11.430  -1.241   2.295 1.00 . A A .  60 SER HG   1 1 
        2  3337 1 1  60 SER N    N  12.390  -4.823   4.722 1.00 . A A .  60 SER N    1 1 
        2  3338 1 1  60 SER O    O  12.916  -2.308   6.130 1.00 . A A .  60 SER O    1 1 
        2  3339 1 1  60 SER OG   O  12.190  -1.682   2.696 1.00 . A A .  60 SER OG   1 1 
        2  3340 1 1  61 GLN C    C  15.190   0.046   5.484 1.00 . A A .  61 GLN C    1 1 
        2  3341 1 1  61 GLN CA   C  15.614  -1.418   5.762 1.00 . A A .  61 GLN CA   1 1 
        2  3342 1 1  61 GLN CB   C  17.135  -1.605   5.503 1.00 . A A .  61 GLN CB   1 1 
        2  3343 1 1  61 GLN CD   C  19.052  -1.531   3.789 1.00 . A A .  61 GLN CD   1 1 
        2  3344 1 1  61 GLN CG   C  17.594  -1.185   4.091 1.00 . A A .  61 GLN CG   1 1 
        2  3345 1 1  61 GLN H    H  15.305  -2.801   4.167 1.00 . A A .  61 GLN H    1 1 
        2  3346 1 1  61 GLN HA   H  15.404  -1.646   6.801 1.00 . A A .  61 GLN HA   1 1 
        2  3347 1 1  61 GLN HB2  H  17.693  -1.023   6.234 1.00 . A A .  61 GLN HB2  1 1 
        2  3348 1 1  61 GLN HB3  H  17.380  -2.654   5.643 1.00 . A A .  61 GLN HB3  1 1 
        2  3349 1 1  61 GLN HE21 H  19.680   0.215   4.501 1.00 . A A .  61 GLN HE21 1 1 
        2  3350 1 1  61 GLN HE22 H  20.909  -0.843   3.902 1.00 . A A .  61 GLN HE22 1 1 
        2  3351 1 1  61 GLN HG2  H  16.969  -1.685   3.359 1.00 . A A .  61 GLN HG2  1 1 
        2  3352 1 1  61 GLN HG3  H  17.460  -0.112   3.981 1.00 . A A .  61 GLN HG3  1 1 
        2  3353 1 1  61 GLN N    N  14.845  -2.370   4.920 1.00 . A A .  61 GLN N    1 1 
        2  3354 1 1  61 GLN NE2  N  19.973  -0.630   4.097 1.00 . A A .  61 GLN NE2  1 1 
        2  3355 1 1  61 GLN O    O  15.625   0.973   6.176 1.00 . A A .  61 GLN O    1 1 
        2  3356 1 1  61 GLN OE1  O  19.346  -2.611   3.285 1.00 . A A .  61 GLN OE1  1 1 
        2  3357 1 1  62 CYS C    C  12.548   1.935   4.815 1.00 . A A .  62 CYS C    1 1 
        2  3358 1 1  62 CYS CA   C  13.819   1.536   4.032 1.00 . A A .  62 CYS CA   1 1 
        2  3359 1 1  62 CYS CB   C  13.505   1.456   2.529 1.00 . A A .  62 CYS CB   1 1 
        2  3360 1 1  62 CYS H    H  14.050  -0.555   3.953 1.00 . A A .  62 CYS H    1 1 
        2  3361 1 1  62 CYS HA   H  14.587   2.288   4.192 1.00 . A A .  62 CYS HA   1 1 
        2  3362 1 1  62 CYS HB2  H  12.696   0.754   2.363 1.00 . A A .  62 CYS HB2  1 1 
        2  3363 1 1  62 CYS HB3  H  13.204   2.431   2.167 1.00 . A A .  62 CYS HB3  1 1 
        2  3364 1 1  62 CYS HG   H  16.007   1.367   2.066 1.00 . A A .  62 CYS HG   1 1 
        2  3365 1 1  62 CYS N    N  14.339   0.230   4.456 1.00 . A A .  62 CYS N    1 1 
        2  3366 1 1  62 CYS O    O  12.044   3.058   4.653 1.00 . A A .  62 CYS O    1 1 
        2  3367 1 1  62 CYS SG   S  14.891   0.913   1.512 1.00 . A A .  62 CYS SG   1 1 
        2  3368 1 1  63 GLY C    C   9.524   0.927   5.572 1.00 . A A .  63 GLY C    1 1 
        2  3369 1 1  63 GLY CA   C  10.776   1.237   6.394 1.00 . A A .  63 GLY CA   1 1 
        2  3370 1 1  63 GLY H    H  12.469   0.135   5.719 1.00 . A A .  63 GLY H    1 1 
        2  3371 1 1  63 GLY HA2  H  10.789   0.606   7.273 1.00 . A A .  63 GLY HA2  1 1 
        2  3372 1 1  63 GLY HA3  H  10.737   2.273   6.716 1.00 . A A .  63 GLY HA3  1 1 
        2  3373 1 1  63 GLY N    N  12.013   1.001   5.632 1.00 . A A .  63 GLY N    1 1 
        2  3374 1 1  63 GLY O    O   8.600   0.259   6.063 1.00 . A A .  63 GLY O    1 1 
        2  3375 1 1  64 TRP C    C   8.360  -0.369   3.070 1.00 . A A .  64 TRP C    1 1 
        2  3376 1 1  64 TRP CA   C   8.426   1.152   3.341 1.00 . A A .  64 TRP CA   1 1 
        2  3377 1 1  64 TRP CB   C   8.669   1.892   1.998 1.00 . A A .  64 TRP CB   1 1 
        2  3378 1 1  64 TRP CD1  C   7.690   4.245   2.366 1.00 . A A .  64 TRP CD1  1 1 
        2  3379 1 1  64 TRP CD2  C   9.859   4.227   1.830 1.00 . A A .  64 TRP CD2  1 1 
        2  3380 1 1  64 TRP CE2  C   9.447   5.556   1.983 1.00 . A A .  64 TRP CE2  1 1 
        2  3381 1 1  64 TRP CE3  C  11.183   3.966   1.487 1.00 . A A .  64 TRP CE3  1 1 
        2  3382 1 1  64 TRP CG   C   8.721   3.397   2.077 1.00 . A A .  64 TRP CG   1 1 
        2  3383 1 1  64 TRP CH2  C  11.617   6.344   1.490 1.00 . A A .  64 TRP CH2  1 1 
        2  3384 1 1  64 TRP CZ2  C  10.321   6.627   1.819 1.00 . A A .  64 TRP CZ2  1 1 
        2  3385 1 1  64 TRP CZ3  C  12.052   5.025   1.328 1.00 . A A .  64 TRP CZ3  1 1 
        2  3386 1 1  64 TRP H    H  10.209   2.044   4.047 1.00 . A A .  64 TRP H    1 1 
        2  3387 1 1  64 TRP HA   H   7.486   1.490   3.765 1.00 . A A .  64 TRP HA   1 1 
        2  3388 1 1  64 TRP HB2  H   9.608   1.556   1.574 1.00 . A A .  64 TRP HB2  1 1 
        2  3389 1 1  64 TRP HB3  H   7.869   1.635   1.307 1.00 . A A .  64 TRP HB3  1 1 
        2  3390 1 1  64 TRP HD1  H   6.685   3.929   2.602 1.00 . A A .  64 TRP HD1  1 1 
        2  3391 1 1  64 TRP HE1  H   7.558   6.330   2.469 1.00 . A A .  64 TRP HE1  1 1 
        2  3392 1 1  64 TRP HE3  H  11.530   2.953   1.352 1.00 . A A .  64 TRP HE3  1 1 
        2  3393 1 1  64 TRP HH2  H  12.330   7.148   1.352 1.00 . A A .  64 TRP HH2  1 1 
        2  3394 1 1  64 TRP HZ2  H   9.997   7.654   1.940 1.00 . A A .  64 TRP HZ2  1 1 
        2  3395 1 1  64 TRP HZ3  H  13.088   4.839   1.064 1.00 . A A .  64 TRP HZ3  1 1 
        2  3396 1 1  64 TRP N    N   9.491   1.443   4.318 1.00 . A A .  64 TRP N    1 1 
        2  3397 1 1  64 TRP NE1  N   8.117   5.539   2.303 1.00 . A A .  64 TRP NE1  1 1 
        2  3398 1 1  64 TRP O    O   9.356  -0.934   2.606 1.00 . A A .  64 TRP O    1 1 
        2  3399 1 1  65 PRO C    C   7.330  -2.949   1.697 1.00 . A A .  65 PRO C    1 1 
        2  3400 1 1  65 PRO CA   C   7.052  -2.518   3.155 1.00 . A A .  65 PRO CA   1 1 
        2  3401 1 1  65 PRO CB   C   5.569  -2.792   3.560 1.00 . A A .  65 PRO CB   1 1 
        2  3402 1 1  65 PRO CD   C   5.962  -0.463   3.929 1.00 . A A .  65 PRO CD   1 1 
        2  3403 1 1  65 PRO CG   C   4.907  -1.453   3.518 1.00 . A A .  65 PRO CG   1 1 
        2  3404 1 1  65 PRO HA   H   7.711  -3.074   3.821 1.00 . A A .  65 PRO HA   1 1 
        2  3405 1 1  65 PRO HB2  H   5.103  -3.493   2.871 1.00 . A A .  65 PRO HB2  1 1 
        2  3406 1 1  65 PRO HB3  H   5.537  -3.215   4.560 1.00 . A A .  65 PRO HB3  1 1 
        2  3407 1 1  65 PRO HD2  H   5.758   0.513   3.499 1.00 . A A .  65 PRO HD2  1 1 
        2  3408 1 1  65 PRO HD3  H   6.029  -0.386   5.013 1.00 . A A .  65 PRO HD3  1 1 
        2  3409 1 1  65 PRO HG2  H   4.560  -1.240   2.510 1.00 . A A .  65 PRO HG2  1 1 
        2  3410 1 1  65 PRO HG3  H   4.073  -1.423   4.209 1.00 . A A .  65 PRO HG3  1 1 
        2  3411 1 1  65 PRO N    N   7.206  -1.052   3.364 1.00 . A A .  65 PRO N    1 1 
        2  3412 1 1  65 PRO O    O   6.621  -2.529   0.773 1.00 . A A .  65 PRO O    1 1 
        2  3413 1 1  66 SER C    C   7.978  -5.645   0.015 1.00 . A A .  66 SER C    1 1 
        2  3414 1 1  66 SER CA   C   8.736  -4.335   0.220 1.00 . A A .  66 SER CA   1 1 
        2  3415 1 1  66 SER CB   C  10.263  -4.546   0.133 1.00 . A A .  66 SER CB   1 1 
        2  3416 1 1  66 SER H    H   8.923  -4.009   2.296 1.00 . A A .  66 SER H    1 1 
        2  3417 1 1  66 SER HA   H   8.439  -3.632  -0.552 1.00 . A A .  66 SER HA   1 1 
        2  3418 1 1  66 SER HB2  H  10.590  -5.181   0.944 1.00 . A A .  66 SER HB2  1 1 
        2  3419 1 1  66 SER HB3  H  10.520  -5.007  -0.813 1.00 . A A .  66 SER HB3  1 1 
        2  3420 1 1  66 SER HG   H  10.302  -2.592   0.345 1.00 . A A .  66 SER HG   1 1 
        2  3421 1 1  66 SER N    N   8.376  -3.770   1.518 1.00 . A A .  66 SER N    1 1 
        2  3422 1 1  66 SER O    O   7.723  -6.381   0.974 1.00 . A A .  66 SER O    1 1 
        2  3423 1 1  66 SER OG   O  10.947  -3.301   0.230 1.00 . A A .  66 SER OG   1 1 
        2  3424 1 1  67 PHE C    C   6.987  -7.273  -3.167 1.00 . A A .  67 PHE C    1 1 
        2  3425 1 1  67 PHE CA   C   6.844  -7.088  -1.647 1.00 . A A .  67 PHE CA   1 1 
        2  3426 1 1  67 PHE CB   C   5.355  -7.030  -1.211 1.00 . A A .  67 PHE CB   1 1 
        2  3427 1 1  67 PHE CD1  C   4.668  -4.590  -1.110 1.00 . A A .  67 PHE CD1  1 1 
        2  3428 1 1  67 PHE CD2  C   3.751  -5.925  -2.865 1.00 . A A .  67 PHE CD2  1 1 
        2  3429 1 1  67 PHE CE1  C   3.971  -3.504  -1.574 1.00 . A A .  67 PHE CE1  1 1 
        2  3430 1 1  67 PHE CE2  C   3.052  -4.830  -3.327 1.00 . A A .  67 PHE CE2  1 1 
        2  3431 1 1  67 PHE CG   C   4.575  -5.825  -1.742 1.00 . A A .  67 PHE CG   1 1 
        2  3432 1 1  67 PHE CZ   C   3.158  -3.620  -2.682 1.00 . A A .  67 PHE CZ   1 1 
        2  3433 1 1  67 PHE H    H   7.735  -5.191  -1.908 1.00 . A A .  67 PHE H    1 1 
        2  3434 1 1  67 PHE HA   H   7.321  -7.934  -1.161 1.00 . A A .  67 PHE HA   1 1 
        2  3435 1 1  67 PHE HB2  H   4.856  -7.934  -1.544 1.00 . A A .  67 PHE HB2  1 1 
        2  3436 1 1  67 PHE HB3  H   5.311  -7.002  -0.126 1.00 . A A .  67 PHE HB3  1 1 
        2  3437 1 1  67 PHE HD1  H   5.303  -4.485  -0.237 1.00 . A A .  67 PHE HD1  1 1 
        2  3438 1 1  67 PHE HD2  H   3.657  -6.875  -3.377 1.00 . A A .  67 PHE HD2  1 1 
        2  3439 1 1  67 PHE HE1  H   4.056  -2.556  -1.063 1.00 . A A .  67 PHE HE1  1 1 
        2  3440 1 1  67 PHE HE2  H   2.424  -4.920  -4.198 1.00 . A A .  67 PHE HE2  1 1 
        2  3441 1 1  67 PHE HZ   H   2.611  -2.761  -3.044 1.00 . A A .  67 PHE HZ   1 1 
        2  3442 1 1  67 PHE N    N   7.562  -5.876  -1.231 1.00 . A A .  67 PHE N    1 1 
        2  3443 1 1  67 PHE O    O   7.490  -6.378  -3.865 1.00 . A A .  67 PHE O    1 1 
        2  3444 1 1  68 THR C    C   5.540  -8.562  -5.976 1.00 . A A .  68 THR C    1 1 
        2  3445 1 1  68 THR CA   C   6.755  -8.850  -5.062 1.00 . A A .  68 THR CA   1 1 
        2  3446 1 1  68 THR CB   C   7.093 -10.374  -5.069 1.00 . A A .  68 THR CB   1 1 
        2  3447 1 1  68 THR CG2  C   7.613 -10.853  -6.428 1.00 . A A .  68 THR CG2  1 1 
        2  3448 1 1  68 THR H    H   6.041  -9.041  -3.081 1.00 . A A .  68 THR H    1 1 
        2  3449 1 1  68 THR HA   H   7.623  -8.314  -5.447 1.00 . A A .  68 THR HA   1 1 
        2  3450 1 1  68 THR HB   H   6.204 -10.944  -4.810 1.00 . A A .  68 THR HB   1 1 
        2  3451 1 1  68 THR HG1  H   8.593  -9.826  -3.902 1.00 . A A .  68 THR HG1  1 1 
        2  3452 1 1  68 THR HG21 H   7.814 -11.919  -6.394 1.00 . A A .  68 THR HG21 1 1 
        2  3453 1 1  68 THR HG22 H   8.526 -10.322  -6.671 1.00 . A A .  68 THR HG22 1 1 
        2  3454 1 1  68 THR HG23 H   6.874 -10.655  -7.191 1.00 . A A .  68 THR HG23 1 1 
        2  3455 1 1  68 THR N    N   6.527  -8.427  -3.670 1.00 . A A .  68 THR N    1 1 
        2  3456 1 1  68 THR O    O   5.707  -8.179  -7.144 1.00 . A A .  68 THR O    1 1 
        2  3457 1 1  68 THR OG1  O   8.096 -10.637  -4.073 1.00 . A A .  68 THR OG1  1 1 
        2  3458 1 1  69 LYS C    C   2.001  -7.849  -5.520 1.00 . A A .  69 LYS C    1 1 
        2  3459 1 1  69 LYS CA   C   3.078  -8.691  -6.225 1.00 . A A .  69 LYS CA   1 1 
        2  3460 1 1  69 LYS CB   C   2.545 -10.136  -6.460 1.00 . A A .  69 LYS CB   1 1 
        2  3461 1 1  69 LYS CD   C   1.507  -9.736  -8.804 1.00 . A A .  69 LYS CD   1 1 
        2  3462 1 1  69 LYS CE   C   0.243  -9.828  -9.681 1.00 . A A .  69 LYS CE   1 1 
        2  3463 1 1  69 LYS CG   C   1.271 -10.226  -7.347 1.00 . A A .  69 LYS CG   1 1 
        2  3464 1 1  69 LYS H    H   4.246  -8.766  -4.450 1.00 . A A .  69 LYS H    1 1 
        2  3465 1 1  69 LYS HA   H   3.304  -8.242  -7.191 1.00 . A A .  69 LYS HA   1 1 
        2  3466 1 1  69 LYS HB2  H   3.327 -10.722  -6.934 1.00 . A A .  69 LYS HB2  1 1 
        2  3467 1 1  69 LYS HB3  H   2.322 -10.588  -5.497 1.00 . A A .  69 LYS HB3  1 1 
        2  3468 1 1  69 LYS HD2  H   1.833  -8.703  -8.781 1.00 . A A .  69 LYS HD2  1 1 
        2  3469 1 1  69 LYS HD3  H   2.290 -10.340  -9.256 1.00 . A A .  69 LYS HD3  1 1 
        2  3470 1 1  69 LYS HE2  H   0.487  -9.517 -10.687 1.00 . A A .  69 LYS HE2  1 1 
        2  3471 1 1  69 LYS HE3  H  -0.106 -10.852  -9.701 1.00 . A A .  69 LYS HE3  1 1 
        2  3472 1 1  69 LYS HG2  H   0.940 -11.257  -7.374 1.00 . A A .  69 LYS HG2  1 1 
        2  3473 1 1  69 LYS HG3  H   0.491  -9.619  -6.893 1.00 . A A .  69 LYS HG3  1 1 
        2  3474 1 1  69 LYS HZ1  H  -1.682  -9.015  -9.812 1.00 . A A .  69 LYS HZ1  1 1 
        2  3475 1 1  69 LYS HZ2  H  -0.538  -7.968  -9.132 1.00 . A A .  69 LYS HZ2  1 1 
        2  3476 1 1  69 LYS HZ3  H  -1.150  -9.258  -8.226 1.00 . A A .  69 LYS HZ3  1 1 
        2  3477 1 1  69 LYS N    N   4.320  -8.711  -5.426 1.00 . A A .  69 LYS N    1 1 
        2  3478 1 1  69 LYS NZ   N  -0.856  -8.959  -9.177 1.00 . A A .  69 LYS NZ   1 1 
        2  3479 1 1  69 LYS O    O   1.553  -8.210  -4.423 1.00 . A A .  69 LYS O    1 1 
        2  3480 1 1  70 PRO C    C  -0.912  -6.493  -6.050 1.00 . A A .  70 PRO C    1 1 
        2  3481 1 1  70 PRO CA   C   0.440  -5.919  -5.606 1.00 . A A .  70 PRO CA   1 1 
        2  3482 1 1  70 PRO CB   C   0.697  -4.533  -6.242 1.00 . A A .  70 PRO CB   1 1 
        2  3483 1 1  70 PRO CD   C   2.130  -6.096  -7.367 1.00 . A A .  70 PRO CD   1 1 
        2  3484 1 1  70 PRO CG   C   1.271  -4.863  -7.588 1.00 . A A .  70 PRO CG   1 1 
        2  3485 1 1  70 PRO HA   H   0.462  -5.837  -4.524 1.00 . A A .  70 PRO HA   1 1 
        2  3486 1 1  70 PRO HB2  H  -0.236  -3.973  -6.322 1.00 . A A .  70 PRO HB2  1 1 
        2  3487 1 1  70 PRO HB3  H   1.400  -3.970  -5.636 1.00 . A A .  70 PRO HB3  1 1 
        2  3488 1 1  70 PRO HD2  H   2.051  -6.789  -8.205 1.00 . A A .  70 PRO HD2  1 1 
        2  3489 1 1  70 PRO HD3  H   3.167  -5.823  -7.214 1.00 . A A .  70 PRO HD3  1 1 
        2  3490 1 1  70 PRO HG2  H   0.467  -5.076  -8.293 1.00 . A A .  70 PRO HG2  1 1 
        2  3491 1 1  70 PRO HG3  H   1.872  -4.041  -7.954 1.00 . A A .  70 PRO HG3  1 1 
        2  3492 1 1  70 PRO N    N   1.564  -6.711  -6.129 1.00 . A A .  70 PRO N    1 1 
        2  3493 1 1  70 PRO O    O  -0.976  -7.482  -6.800 1.00 . A A .  70 PRO O    1 1 
        2  3494 1 1  71 ILE C    C  -3.641  -5.183  -7.177 1.00 . A A .  71 ILE C    1 1 
        2  3495 1 1  71 ILE CA   C  -3.338  -6.136  -6.015 1.00 . A A .  71 ILE CA   1 1 
        2  3496 1 1  71 ILE CB   C  -4.364  -6.006  -4.824 1.00 . A A .  71 ILE CB   1 1 
        2  3497 1 1  71 ILE CD1  C  -4.884  -7.070  -2.491 1.00 . A A .  71 ILE CD1  1 1 
        2  3498 1 1  71 ILE CG1  C  -4.032  -7.101  -3.746 1.00 . A A .  71 ILE CG1  1 1 
        2  3499 1 1  71 ILE CG2  C  -5.842  -6.097  -5.306 1.00 . A A .  71 ILE CG2  1 1 
        2  3500 1 1  71 ILE H    H  -1.832  -5.118  -4.951 1.00 . A A .  71 ILE H    1 1 
        2  3501 1 1  71 ILE HA   H  -3.373  -7.164  -6.377 1.00 . A A .  71 ILE HA   1 1 
        2  3502 1 1  71 ILE HB   H  -4.226  -5.028  -4.372 1.00 . A A .  71 ILE HB   1 1 
        2  3503 1 1  71 ILE HD11 H  -4.774  -6.109  -2.006 1.00 . A A .  71 ILE HD11 1 1 
        2  3504 1 1  71 ILE HD12 H  -4.562  -7.848  -1.816 1.00 . A A .  71 ILE HD12 1 1 
        2  3505 1 1  71 ILE HD13 H  -5.921  -7.224  -2.747 1.00 . A A .  71 ILE HD13 1 1 
        2  3506 1 1  71 ILE HG12 H  -4.150  -8.082  -4.185 1.00 . A A .  71 ILE HG12 1 1 
        2  3507 1 1  71 ILE HG13 H  -3.000  -6.984  -3.434 1.00 . A A .  71 ILE HG13 1 1 
        2  3508 1 1  71 ILE HG21 H  -6.019  -7.060  -5.771 1.00 . A A .  71 ILE HG21 1 1 
        2  3509 1 1  71 ILE HG22 H  -6.045  -5.314  -6.028 1.00 . A A .  71 ILE HG22 1 1 
        2  3510 1 1  71 ILE HG23 H  -6.512  -5.979  -4.463 1.00 . A A .  71 ILE HG23 1 1 
        2  3511 1 1  71 ILE N    N  -1.977  -5.850  -5.583 1.00 . A A .  71 ILE N    1 1 
        2  3512 1 1  71 ILE O    O  -3.885  -3.988  -6.978 1.00 . A A .  71 ILE O    1 1 
        2  3513 1 1  72 GLU C    C  -4.974  -4.286  -9.896 1.00 . A A .  72 GLU C    1 1 
        2  3514 1 1  72 GLU CA   C  -3.638  -5.004  -9.673 1.00 . A A .  72 GLU CA   1 1 
        2  3515 1 1  72 GLU CB   C  -3.317  -5.970 -10.846 1.00 . A A .  72 GLU CB   1 1 
        2  3516 1 1  72 GLU CD   C  -3.723  -8.264 -11.928 1.00 . A A .  72 GLU CD   1 1 
        2  3517 1 1  72 GLU CG   C  -4.250  -7.197 -10.958 1.00 . A A .  72 GLU CG   1 1 
        2  3518 1 1  72 GLU H    H  -3.600  -6.729  -8.424 1.00 . A A .  72 GLU H    1 1 
        2  3519 1 1  72 GLU HA   H  -2.853  -4.253  -9.628 1.00 . A A .  72 GLU HA   1 1 
        2  3520 1 1  72 GLU HB2  H  -3.361  -5.421 -11.784 1.00 . A A .  72 GLU HB2  1 1 
        2  3521 1 1  72 GLU HB3  H  -2.300  -6.333 -10.715 1.00 . A A .  72 GLU HB3  1 1 
        2  3522 1 1  72 GLU HG2  H  -4.345  -7.644  -9.973 1.00 . A A .  72 GLU HG2  1 1 
        2  3523 1 1  72 GLU HG3  H  -5.234  -6.866 -11.285 1.00 . A A .  72 GLU HG3  1 1 
        2  3524 1 1  72 GLU N    N  -3.603  -5.750  -8.392 1.00 . A A .  72 GLU N    1 1 
        2  3525 1 1  72 GLU O    O  -5.081  -3.405 -10.755 1.00 . A A .  72 GLU O    1 1 
        2  3526 1 1  72 GLU OE1  O  -2.731  -8.946 -11.578 1.00 . A A .  72 GLU OE1  1 1 
        2  3527 1 1  72 GLU OE2  O  -4.266  -8.410 -13.046 1.00 . A A .  72 GLU OE2  1 1 
        2  3528 1 1  73 GLU C    C  -7.202  -2.599  -8.671 1.00 . A A .  73 GLU C    1 1 
        2  3529 1 1  73 GLU CA   C  -7.299  -4.080  -9.108 1.00 . A A .  73 GLU CA   1 1 
        2  3530 1 1  73 GLU CB   C  -8.238  -4.861  -8.151 1.00 . A A .  73 GLU CB   1 1 
        2  3531 1 1  73 GLU CD   C -10.385  -4.765  -9.571 1.00 . A A .  73 GLU CD   1 1 
        2  3532 1 1  73 GLU CG   C  -9.720  -4.448  -8.225 1.00 . A A .  73 GLU CG   1 1 
        2  3533 1 1  73 GLU H    H  -5.794  -5.402  -8.463 1.00 . A A .  73 GLU H    1 1 
        2  3534 1 1  73 GLU HA   H  -7.700  -4.137 -10.121 1.00 . A A .  73 GLU HA   1 1 
        2  3535 1 1  73 GLU HB2  H  -8.169  -5.921  -8.373 1.00 . A A .  73 GLU HB2  1 1 
        2  3536 1 1  73 GLU HB3  H  -7.896  -4.706  -7.130 1.00 . A A .  73 GLU HB3  1 1 
        2  3537 1 1  73 GLU HG2  H -10.264  -4.961  -7.439 1.00 . A A .  73 GLU HG2  1 1 
        2  3538 1 1  73 GLU HG3  H  -9.785  -3.381  -8.043 1.00 . A A .  73 GLU HG3  1 1 
        2  3539 1 1  73 GLU N    N  -5.977  -4.686  -9.103 1.00 . A A .  73 GLU N    1 1 
        2  3540 1 1  73 GLU O    O  -7.806  -1.724  -9.295 1.00 . A A .  73 GLU O    1 1 
        2  3541 1 1  73 GLU OE1  O -10.885  -5.895  -9.751 1.00 . A A .  73 GLU OE1  1 1 
        2  3542 1 1  73 GLU OE2  O -10.428  -3.883 -10.450 1.00 . A A .  73 GLU OE2  1 1 
        2  3543 1 1  74 GLU C    C  -4.928  -0.322  -7.158 1.00 . A A .  74 GLU C    1 1 
        2  3544 1 1  74 GLU CA   C  -6.306  -0.978  -6.980 1.00 . A A .  74 GLU CA   1 1 
        2  3545 1 1  74 GLU CB   C  -6.679  -1.048  -5.466 1.00 . A A .  74 GLU CB   1 1 
        2  3546 1 1  74 GLU CD   C  -9.234  -0.999  -5.992 1.00 . A A .  74 GLU CD   1 1 
        2  3547 1 1  74 GLU CG   C  -8.080  -1.643  -5.181 1.00 . A A .  74 GLU CG   1 1 
        2  3548 1 1  74 GLU H    H  -5.858  -3.060  -7.229 1.00 . A A .  74 GLU H    1 1 
        2  3549 1 1  74 GLU HA   H  -7.035  -0.335  -7.471 1.00 . A A .  74 GLU HA   1 1 
        2  3550 1 1  74 GLU HB2  H  -5.942  -1.656  -4.944 1.00 . A A .  74 GLU HB2  1 1 
        2  3551 1 1  74 GLU HB3  H  -6.650  -0.044  -5.048 1.00 . A A .  74 GLU HB3  1 1 
        2  3552 1 1  74 GLU HG2  H  -8.045  -2.702  -5.416 1.00 . A A .  74 GLU HG2  1 1 
        2  3553 1 1  74 GLU HG3  H  -8.296  -1.531  -4.122 1.00 . A A .  74 GLU HG3  1 1 
        2  3554 1 1  74 GLU N    N  -6.399  -2.330  -7.606 1.00 . A A .  74 GLU N    1 1 
        2  3555 1 1  74 GLU O    O  -4.725   0.830  -6.745 1.00 . A A .  74 GLU O    1 1 
        2  3556 1 1  74 GLU OE1  O  -9.236   0.233  -6.206 1.00 . A A .  74 GLU OE1  1 1 
        2  3557 1 1  74 GLU OE2  O -10.167  -1.720  -6.404 1.00 . A A .  74 GLU OE2  1 1 
        2  3558 1 1  75 VAL C    C  -2.291  -0.429  -9.475 1.00 . A A .  75 VAL C    1 1 
        2  3559 1 1  75 VAL CA   C  -2.601  -0.561  -7.976 1.00 . A A .  75 VAL CA   1 1 
        2  3560 1 1  75 VAL CB   C  -1.572  -1.531  -7.271 1.00 . A A .  75 VAL CB   1 1 
        2  3561 1 1  75 VAL CG1  C  -0.112  -1.073  -7.511 1.00 . A A .  75 VAL CG1  1 1 
        2  3562 1 1  75 VAL CG2  C  -1.862  -1.649  -5.746 1.00 . A A .  75 VAL CG2  1 1 
        2  3563 1 1  75 VAL H    H  -4.241  -1.866  -8.232 1.00 . A A .  75 VAL H    1 1 
        2  3564 1 1  75 VAL HA   H  -2.503   0.426  -7.516 1.00 . A A .  75 VAL HA   1 1 
        2  3565 1 1  75 VAL HB   H  -1.691  -2.522  -7.708 1.00 . A A .  75 VAL HB   1 1 
        2  3566 1 1  75 VAL HG11 H   0.573  -1.748  -7.015 1.00 . A A .  75 VAL HG11 1 1 
        2  3567 1 1  75 VAL HG12 H   0.031  -0.073  -7.124 1.00 . A A .  75 VAL HG12 1 1 
        2  3568 1 1  75 VAL HG13 H   0.103  -1.071  -8.576 1.00 . A A .  75 VAL HG13 1 1 
        2  3569 1 1  75 VAL HG21 H  -2.865  -2.028  -5.589 1.00 . A A .  75 VAL HG21 1 1 
        2  3570 1 1  75 VAL HG22 H  -1.772  -0.672  -5.282 1.00 . A A .  75 VAL HG22 1 1 
        2  3571 1 1  75 VAL HG23 H  -1.152  -2.325  -5.287 1.00 . A A .  75 VAL HG23 1 1 
        2  3572 1 1  75 VAL N    N  -3.990  -1.030  -7.803 1.00 . A A .  75 VAL N    1 1 
        2  3573 1 1  75 VAL O    O  -2.688  -1.282 -10.272 1.00 . A A .  75 VAL O    1 1 
        2  3574 1 1  76 GLU C    C   0.321   1.302 -11.219 1.00 . A A .  76 GLU C    1 1 
        2  3575 1 1  76 GLU CA   C  -1.177   0.983 -11.215 1.00 . A A .  76 GLU CA   1 1 
        2  3576 1 1  76 GLU CB   C  -1.947   2.208 -11.804 1.00 . A A .  76 GLU CB   1 1 
        2  3577 1 1  76 GLU CD   C  -4.142   3.244 -12.691 1.00 . A A .  76 GLU CD   1 1 
        2  3578 1 1  76 GLU CG   C  -3.451   2.003 -12.072 1.00 . A A .  76 GLU CG   1 1 
        2  3579 1 1  76 GLU H    H  -1.411   1.314  -9.122 1.00 . A A .  76 GLU H    1 1 
        2  3580 1 1  76 GLU HA   H  -1.360   0.111 -11.844 1.00 . A A .  76 GLU HA   1 1 
        2  3581 1 1  76 GLU HB2  H  -1.847   3.044 -11.118 1.00 . A A .  76 GLU HB2  1 1 
        2  3582 1 1  76 GLU HB3  H  -1.482   2.490 -12.748 1.00 . A A .  76 GLU HB3  1 1 
        2  3583 1 1  76 GLU HG2  H  -3.570   1.169 -12.752 1.00 . A A .  76 GLU HG2  1 1 
        2  3584 1 1  76 GLU HG3  H  -3.939   1.764 -11.130 1.00 . A A .  76 GLU HG3  1 1 
        2  3585 1 1  76 GLU N    N  -1.618   0.678  -9.834 1.00 . A A .  76 GLU N    1 1 
        2  3586 1 1  76 GLU O    O   0.742   2.200 -10.500 1.00 . A A .  76 GLU O    1 1 
        2  3587 1 1  76 GLU OE1  O  -3.479   4.022 -13.414 1.00 . A A .  76 GLU OE1  1 1 
        2  3588 1 1  76 GLU OE2  O  -5.343   3.466 -12.440 1.00 . A A .  76 GLU OE2  1 1 
        2  3589 1 1  77 GLU C    C   2.620   1.976 -13.340 1.00 . A A .  77 GLU C    1 1 
        2  3590 1 1  77 GLU CA   C   2.528   0.898 -12.261 1.00 . A A .  77 GLU CA   1 1 
        2  3591 1 1  77 GLU CB   C   3.344  -0.366 -12.672 1.00 . A A .  77 GLU CB   1 1 
        2  3592 1 1  77 GLU CD   C   2.265  -2.056 -11.024 1.00 . A A .  77 GLU CD   1 1 
        2  3593 1 1  77 GLU CG   C   3.554  -1.399 -11.537 1.00 . A A .  77 GLU CG   1 1 
        2  3594 1 1  77 GLU H    H   0.692  -0.067 -12.638 1.00 . A A .  77 GLU H    1 1 
        2  3595 1 1  77 GLU HA   H   2.927   1.292 -11.323 1.00 . A A .  77 GLU HA   1 1 
        2  3596 1 1  77 GLU HB2  H   2.834  -0.861 -13.494 1.00 . A A .  77 GLU HB2  1 1 
        2  3597 1 1  77 GLU HB3  H   4.324  -0.052 -13.022 1.00 . A A .  77 GLU HB3  1 1 
        2  3598 1 1  77 GLU HG2  H   4.205  -2.186 -11.900 1.00 . A A .  77 GLU HG2  1 1 
        2  3599 1 1  77 GLU HG3  H   4.047  -0.894 -10.710 1.00 . A A .  77 GLU HG3  1 1 
        2  3600 1 1  77 GLU N    N   1.101   0.607 -12.066 1.00 . A A .  77 GLU N    1 1 
        2  3601 1 1  77 GLU O    O   2.259   1.741 -14.497 1.00 . A A .  77 GLU O    1 1 
        2  3602 1 1  77 GLU OE1  O   1.442  -2.494 -11.857 1.00 . A A .  77 GLU OE1  1 1 
        2  3603 1 1  77 GLU OE2  O   2.096  -2.199  -9.797 1.00 . A A .  77 GLU OE2  1 1 
        2  3604 1 1  78 LYS C    C   4.499   4.923 -13.770 1.00 . A A .  78 LYS C    1 1 
        2  3605 1 1  78 LYS CA   C   3.086   4.352 -13.788 1.00 . A A .  78 LYS CA   1 1 
        2  3606 1 1  78 LYS CB   C   2.033   5.368 -13.248 1.00 . A A .  78 LYS CB   1 1 
        2  3607 1 1  78 LYS CD   C   0.589   7.478 -13.709 1.00 . A A .  78 LYS CD   1 1 
        2  3608 1 1  78 LYS CE   C  -0.788   6.808 -13.977 1.00 . A A .  78 LYS CE   1 1 
        2  3609 1 1  78 LYS CG   C   1.808   6.612 -14.136 1.00 . A A .  78 LYS CG   1 1 
        2  3610 1 1  78 LYS H    H   3.416   3.246 -12.030 1.00 . A A .  78 LYS H    1 1 
        2  3611 1 1  78 LYS HA   H   2.826   4.065 -14.806 1.00 . A A .  78 LYS HA   1 1 
        2  3612 1 1  78 LYS HB2  H   1.084   4.850 -13.150 1.00 . A A .  78 LYS HB2  1 1 
        2  3613 1 1  78 LYS HB3  H   2.337   5.704 -12.260 1.00 . A A .  78 LYS HB3  1 1 
        2  3614 1 1  78 LYS HD2  H   0.664   7.698 -12.649 1.00 . A A .  78 LYS HD2  1 1 
        2  3615 1 1  78 LYS HD3  H   0.630   8.412 -14.259 1.00 . A A .  78 LYS HD3  1 1 
        2  3616 1 1  78 LYS HE2  H  -1.564   7.545 -13.837 1.00 . A A .  78 LYS HE2  1 1 
        2  3617 1 1  78 LYS HE3  H  -0.817   6.464 -15.006 1.00 . A A .  78 LYS HE3  1 1 
        2  3618 1 1  78 LYS HG2  H   2.700   7.228 -14.094 1.00 . A A .  78 LYS HG2  1 1 
        2  3619 1 1  78 LYS HG3  H   1.659   6.287 -15.163 1.00 . A A .  78 LYS HG3  1 1 
        2  3620 1 1  78 LYS HZ1  H  -2.051   5.325 -13.240 1.00 . A A .  78 LYS HZ1  1 1 
        2  3621 1 1  78 LYS HZ2  H  -0.984   5.940 -12.089 1.00 . A A .  78 LYS HZ2  1 1 
        2  3622 1 1  78 LYS HZ3  H  -0.429   4.873 -13.276 1.00 . A A .  78 LYS HZ3  1 1 
        2  3623 1 1  78 LYS N    N   3.069   3.164 -12.943 1.00 . A A .  78 LYS N    1 1 
        2  3624 1 1  78 LYS NZ   N  -1.081   5.659 -13.081 1.00 . A A .  78 LYS NZ   1 1 
        2  3625 1 1  78 LYS O    O   4.900   5.527 -12.784 1.00 . A A .  78 LYS O    1 1 
        2  3626 1 1  79 LEU C    C   6.876   6.590 -14.888 1.00 . A A .  79 LEU C    1 1 
        2  3627 1 1  79 LEU CA   C   6.684   5.058 -14.915 1.00 . A A .  79 LEU CA   1 1 
        2  3628 1 1  79 LEU CB   C   7.310   4.439 -16.193 1.00 . A A .  79 LEU CB   1 1 
        2  3629 1 1  79 LEU CD1  C   9.616   4.046 -15.172 1.00 . A A .  79 LEU CD1  1 1 
        2  3630 1 1  79 LEU CD2  C   9.353   4.029 -17.701 1.00 . A A .  79 LEU CD2  1 1 
        2  3631 1 1  79 LEU CG   C   8.850   4.630 -16.368 1.00 . A A .  79 LEU CG   1 1 
        2  3632 1 1  79 LEU H    H   4.844   4.316 -15.650 1.00 . A A .  79 LEU H    1 1 
        2  3633 1 1  79 LEU HA   H   7.169   4.630 -14.043 1.00 . A A .  79 LEU HA   1 1 
        2  3634 1 1  79 LEU HB2  H   7.090   3.373 -16.193 1.00 . A A .  79 LEU HB2  1 1 
        2  3635 1 1  79 LEU HB3  H   6.814   4.878 -17.054 1.00 . A A .  79 LEU HB3  1 1 
        2  3636 1 1  79 LEU HD11 H   9.446   2.977 -15.105 1.00 . A A .  79 LEU HD11 1 1 
        2  3637 1 1  79 LEU HD12 H   9.271   4.518 -14.259 1.00 . A A .  79 LEU HD12 1 1 
        2  3638 1 1  79 LEU HD13 H  10.670   4.238 -15.287 1.00 . A A .  79 LEU HD13 1 1 
        2  3639 1 1  79 LEU HD21 H   8.816   4.479 -18.526 1.00 . A A .  79 LEU HD21 1 1 
        2  3640 1 1  79 LEU HD22 H   9.194   2.958 -17.711 1.00 . A A .  79 LEU HD22 1 1 
        2  3641 1 1  79 LEU HD23 H  10.411   4.233 -17.818 1.00 . A A .  79 LEU HD23 1 1 
        2  3642 1 1  79 LEU HG   H   9.069   5.690 -16.390 1.00 . A A .  79 LEU HG   1 1 
        2  3643 1 1  79 LEU N    N   5.258   4.702 -14.849 1.00 . A A .  79 LEU N    1 1 
        2  3644 1 1  79 LEU O    O   6.075   7.330 -15.474 1.00 . A A .  79 LEU O    1 1 
        2  3645 1 1  80 ASP C    C   9.617   8.759 -14.710 1.00 . A A .  80 ASP C    1 1 
        2  3646 1 1  80 ASP CA   C   8.269   8.471 -14.037 1.00 . A A .  80 ASP CA   1 1 
        2  3647 1 1  80 ASP CB   C   8.334   8.852 -12.522 1.00 . A A .  80 ASP CB   1 1 
        2  3648 1 1  80 ASP CG   C   8.745  10.323 -12.264 1.00 . A A .  80 ASP CG   1 1 
        2  3649 1 1  80 ASP H    H   8.595   6.395 -13.872 1.00 . A A .  80 ASP H    1 1 
        2  3650 1 1  80 ASP HA   H   7.496   9.072 -14.522 1.00 . A A .  80 ASP HA   1 1 
        2  3651 1 1  80 ASP HB2  H   7.358   8.682 -12.078 1.00 . A A .  80 ASP HB2  1 1 
        2  3652 1 1  80 ASP HB3  H   9.047   8.202 -12.021 1.00 . A A .  80 ASP HB3  1 1 
        2  3653 1 1  80 ASP N    N   7.945   7.043 -14.210 1.00 . A A .  80 ASP N    1 1 
        2  3654 1 1  80 ASP O    O  10.496   7.890 -14.772 1.00 . A A .  80 ASP O    1 1 
        2  3655 1 1  80 ASP OD1  O   9.959  10.612 -12.182 1.00 . A A .  80 ASP OD1  1 1 
        2  3656 1 1  80 ASP OD2  O   7.859  11.198 -12.146 1.00 . A A .  80 ASP OD2  1 1 
        2  3657 1 1  81 THR C    C  11.125  12.036 -15.385 1.00 . A A .  81 THR C    1 1 
        2  3658 1 1  81 THR CA   C  10.990  10.529 -15.762 1.00 . A A .  81 THR CA   1 1 
        2  3659 1 1  81 THR CB   C  11.030  10.315 -17.315 1.00 . A A .  81 THR CB   1 1 
        2  3660 1 1  81 THR CG2  C   9.899  11.065 -18.046 1.00 . A A .  81 THR CG2  1 1 
        2  3661 1 1  81 THR H    H   8.962  10.559 -15.219 1.00 . A A .  81 THR H    1 1 
        2  3662 1 1  81 THR HA   H  11.831   9.990 -15.320 1.00 . A A .  81 THR HA   1 1 
        2  3663 1 1  81 THR HB   H  10.920   9.253 -17.510 1.00 . A A .  81 THR HB   1 1 
        2  3664 1 1  81 THR HG1  H  12.401  11.677 -17.721 1.00 . A A .  81 THR HG1  1 1 
        2  3665 1 1  81 THR HG21 H   8.940  10.733 -17.671 1.00 . A A .  81 THR HG21 1 1 
        2  3666 1 1  81 THR HG22 H   9.958  10.867 -19.107 1.00 . A A .  81 THR HG22 1 1 
        2  3667 1 1  81 THR HG23 H   9.998  12.131 -17.877 1.00 . A A .  81 THR HG23 1 1 
        2  3668 1 1  81 THR N    N   9.748   9.987 -15.210 1.00 . A A .  81 THR N    1 1 
        2  3669 1 1  81 THR O    O  12.088  12.707 -15.784 1.00 . A A .  81 THR O    1 1 
        2  3670 1 1  81 THR OG1  O  12.296  10.724 -17.839 1.00 . A A .  81 THR OG1  1 1 
        2  3671 1 1  82 SER C    C  11.198  14.287 -13.121 1.00 . A A .  82 SER C    1 1 
        2  3672 1 1  82 SER CA   C  10.092  13.951 -14.142 1.00 . A A .  82 SER CA   1 1 
        2  3673 1 1  82 SER CB   C   8.700  14.269 -13.551 1.00 . A A .  82 SER CB   1 1 
        2  3674 1 1  82 SER H    H   9.466  11.927 -14.248 1.00 . A A .  82 SER H    1 1 
        2  3675 1 1  82 SER HA   H  10.243  14.567 -15.025 1.00 . A A .  82 SER HA   1 1 
        2  3676 1 1  82 SER HB2  H   8.511  13.637 -12.698 1.00 . A A .  82 SER HB2  1 1 
        2  3677 1 1  82 SER HB3  H   8.664  15.307 -13.242 1.00 . A A .  82 SER HB3  1 1 
        2  3678 1 1  82 SER HG   H   7.124  13.312 -14.215 1.00 . A A .  82 SER HG   1 1 
        2  3679 1 1  82 SER N    N  10.157  12.539 -14.573 1.00 . A A .  82 SER N    1 1 
        2  3680 1 1  82 SER O    O  11.639  15.438 -13.027 1.00 . A A .  82 SER O    1 1 
        2  3681 1 1  82 SER OG   O   7.669  14.054 -14.500 1.00 . A A .  82 SER OG   1 1 
        2  3682 1 1  83 HIS C    C  14.141  13.428 -12.134 1.00 . A A .  83 HIS C    1 1 
        2  3683 1 1  83 HIS CA   C  12.773  13.398 -11.410 1.00 . A A .  83 HIS CA   1 1 
        2  3684 1 1  83 HIS CB   C  12.734  12.244 -10.370 1.00 . A A .  83 HIS CB   1 1 
        2  3685 1 1  83 HIS CD2  C  11.187  13.163  -8.496 1.00 . A A .  83 HIS CD2  1 1 
        2  3686 1 1  83 HIS CE1  C   9.596  11.669  -8.617 1.00 . A A .  83 HIS CE1  1 1 
        2  3687 1 1  83 HIS CG   C  11.529  12.288  -9.467 1.00 . A A .  83 HIS CG   1 1 
        2  3688 1 1  83 HIS H    H  11.210  12.390 -12.463 1.00 . A A .  83 HIS H    1 1 
        2  3689 1 1  83 HIS HA   H  12.658  14.345 -10.886 1.00 . A A .  83 HIS HA   1 1 
        2  3690 1 1  83 HIS HB2  H  12.733  11.292 -10.888 1.00 . A A .  83 HIS HB2  1 1 
        2  3691 1 1  83 HIS HB3  H  13.618  12.295  -9.740 1.00 . A A .  83 HIS HB3  1 1 
        2  3692 1 1  83 HIS HD1  H  10.459  10.599 -10.118 1.00 . A A .  83 HIS HD1  1 1 
        2  3693 1 1  83 HIS HD2  H  11.762  14.023  -8.175 1.00 . A A .  83 HIS HD2  1 1 
        2  3694 1 1  83 HIS HE1  H   8.679  11.119  -8.431 1.00 . A A .  83 HIS HE1  1 1 
        2  3695 1 1  83 HIS HE2  H   9.406  13.294  -7.395 1.00 . A A .  83 HIS HE2  1 1 
        2  3696 1 1  83 HIS N    N  11.648  13.265 -12.369 1.00 . A A .  83 HIS N    1 1 
        2  3697 1 1  83 HIS ND1  N  10.511  11.362  -9.508 1.00 . A A .  83 HIS ND1  1 1 
        2  3698 1 1  83 HIS NE2  N   9.981  12.756  -7.986 1.00 . A A .  83 HIS NE2  1 1 
        2  3699 1 1  83 HIS O    O  15.186  13.547 -11.484 1.00 . A A .  83 HIS O    1 1 
        2  3700 1 1  84 GLY C    C  15.897  11.856 -14.361 1.00 . A A .  84 GLY C    1 1 
        2  3701 1 1  84 GLY CA   C  15.338  13.267 -14.288 1.00 . A A .  84 GLY CA   1 1 
        2  3702 1 1  84 GLY H    H  13.254  13.303 -13.938 1.00 . A A .  84 GLY H    1 1 
        2  3703 1 1  84 GLY HA2  H  15.100  13.600 -15.285 1.00 . A A .  84 GLY HA2  1 1 
        2  3704 1 1  84 GLY HA3  H  16.087  13.931 -13.869 1.00 . A A .  84 GLY HA3  1 1 
        2  3705 1 1  84 GLY N    N  14.120  13.336 -13.483 1.00 . A A .  84 GLY N    1 1 
        2  3706 1 1  84 GLY O    O  17.022  11.649 -14.830 1.00 . A A .  84 GLY O    1 1 
        2  3707 1 1  85 MET C    C  14.226   8.577 -14.067 1.00 . A A .  85 MET C    1 1 
        2  3708 1 1  85 MET CA   C  15.469   9.466 -13.864 1.00 . A A .  85 MET CA   1 1 
        2  3709 1 1  85 MET CB   C  16.172   9.135 -12.514 1.00 . A A .  85 MET CB   1 1 
        2  3710 1 1  85 MET CE   C  17.587   5.254 -13.344 1.00 . A A .  85 MET CE   1 1 
        2  3711 1 1  85 MET CG   C  16.540   7.651 -12.328 1.00 . A A .  85 MET CG   1 1 
        2  3712 1 1  85 MET H    H  14.192  11.120 -13.612 1.00 . A A .  85 MET H    1 1 
        2  3713 1 1  85 MET HA   H  16.168   9.280 -14.681 1.00 . A A .  85 MET HA   1 1 
        2  3714 1 1  85 MET HB2  H  17.086   9.715 -12.454 1.00 . A A .  85 MET HB2  1 1 
        2  3715 1 1  85 MET HB3  H  15.523   9.431 -11.697 1.00 . A A .  85 MET HB3  1 1 
        2  3716 1 1  85 MET HE1  H  16.581   4.857 -13.289 1.00 . A A .  85 MET HE1  1 1 
        2  3717 1 1  85 MET HE2  H  18.095   5.093 -12.399 1.00 . A A .  85 MET HE2  1 1 
        2  3718 1 1  85 MET HE3  H  18.122   4.745 -14.128 1.00 . A A .  85 MET HE3  1 1 
        2  3719 1 1  85 MET HG2  H  17.112   7.537 -11.422 1.00 . A A .  85 MET HG2  1 1 
        2  3720 1 1  85 MET HG3  H  15.626   7.070 -12.251 1.00 . A A .  85 MET HG3  1 1 
        2  3721 1 1  85 MET N    N  15.087  10.878 -13.914 1.00 . A A .  85 MET N    1 1 
        2  3722 1 1  85 MET O    O  13.141   8.881 -13.556 1.00 . A A .  85 MET O    1 1 
        2  3723 1 1  85 MET SD   S  17.527   7.015 -13.710 1.00 . A A .  85 MET SD   1 1 
        2  3724 1 1  86 ILE C    C  13.291   5.633 -13.693 1.00 . A A .  86 ILE C    1 1 
        2  3725 1 1  86 ILE CA   C  13.425   6.424 -15.010 1.00 . A A .  86 ILE CA   1 1 
        2  3726 1 1  86 ILE CB   C  13.834   5.489 -16.222 1.00 . A A .  86 ILE CB   1 1 
        2  3727 1 1  86 ILE CD1  C  12.216   6.659 -17.888 1.00 . A A .  86 ILE CD1  1 1 
        2  3728 1 1  86 ILE CG1  C  13.647   6.246 -17.578 1.00 . A A .  86 ILE CG1  1 1 
        2  3729 1 1  86 ILE CG2  C  13.084   4.127 -16.233 1.00 . A A .  86 ILE CG2  1 1 
        2  3730 1 1  86 ILE H    H  15.278   7.405 -15.300 1.00 . A A .  86 ILE H    1 1 
        2  3731 1 1  86 ILE HA   H  12.470   6.888 -15.241 1.00 . A A .  86 ILE HA   1 1 
        2  3732 1 1  86 ILE HB   H  14.890   5.264 -16.109 1.00 . A A .  86 ILE HB   1 1 
        2  3733 1 1  86 ILE HD11 H  12.196   7.177 -18.834 1.00 . A A .  86 ILE HD11 1 1 
        2  3734 1 1  86 ILE HD12 H  11.846   7.312 -17.112 1.00 . A A .  86 ILE HD12 1 1 
        2  3735 1 1  86 ILE HD13 H  11.590   5.778 -17.950 1.00 . A A .  86 ILE HD13 1 1 
        2  3736 1 1  86 ILE HG12 H  14.243   7.149 -17.571 1.00 . A A .  86 ILE HG12 1 1 
        2  3737 1 1  86 ILE HG13 H  13.986   5.614 -18.389 1.00 . A A .  86 ILE HG13 1 1 
        2  3738 1 1  86 ILE HG21 H  13.295   3.588 -15.318 1.00 . A A .  86 ILE HG21 1 1 
        2  3739 1 1  86 ILE HG22 H  13.411   3.530 -17.076 1.00 . A A .  86 ILE HG22 1 1 
        2  3740 1 1  86 ILE HG23 H  12.019   4.296 -16.309 1.00 . A A .  86 ILE HG23 1 1 
        2  3741 1 1  86 ILE N    N  14.417   7.492 -14.836 1.00 . A A .  86 ILE N    1 1 
        2  3742 1 1  86 ILE O    O  14.227   4.952 -13.272 1.00 . A A .  86 ILE O    1 1 
        2  3743 1 1  87 ARG C    C  10.269   5.057 -11.695 1.00 . A A .  87 ARG C    1 1 
        2  3744 1 1  87 ARG CA   C  11.797   5.122 -11.769 1.00 . A A .  87 ARG CA   1 1 
        2  3745 1 1  87 ARG CB   C  12.433   5.925 -10.578 1.00 . A A .  87 ARG CB   1 1 
        2  3746 1 1  87 ARG CD   C  11.078   5.366  -8.422 1.00 . A A .  87 ARG CD   1 1 
        2  3747 1 1  87 ARG CG   C  12.416   5.232  -9.176 1.00 . A A .  87 ARG CG   1 1 
        2  3748 1 1  87 ARG CZ   C   9.513   7.315  -8.273 1.00 . A A .  87 ARG CZ   1 1 
        2  3749 1 1  87 ARG H    H  11.441   6.352 -13.448 1.00 . A A .  87 ARG H    1 1 
        2  3750 1 1  87 ARG HA   H  12.197   4.110 -11.786 1.00 . A A .  87 ARG HA   1 1 
        2  3751 1 1  87 ARG HB2  H  13.471   6.122 -10.825 1.00 . A A .  87 ARG HB2  1 1 
        2  3752 1 1  87 ARG HB3  H  11.924   6.880 -10.492 1.00 . A A .  87 ARG HB3  1 1 
        2  3753 1 1  87 ARG HD2  H  10.289   4.910  -9.017 1.00 . A A .  87 ARG HD2  1 1 
        2  3754 1 1  87 ARG HD3  H  11.146   4.839  -7.475 1.00 . A A .  87 ARG HD3  1 1 
        2  3755 1 1  87 ARG HE   H  11.461   7.348  -7.807 1.00 . A A .  87 ARG HE   1 1 
        2  3756 1 1  87 ARG HG2  H  12.630   4.178  -9.304 1.00 . A A .  87 ARG HG2  1 1 
        2  3757 1 1  87 ARG HG3  H  13.197   5.671  -8.559 1.00 . A A .  87 ARG HG3  1 1 
        2  3758 1 1  87 ARG HH11 H   8.672   5.689  -9.121 1.00 . A A .  87 ARG HH11 1 1 
        2  3759 1 1  87 ARG HH12 H   7.609   7.040  -8.892 1.00 . A A .  87 ARG HH12 1 1 
        2  3760 1 1  87 ARG HH21 H  10.041   9.104  -7.525 1.00 . A A .  87 ARG HH21 1 1 
        2  3761 1 1  87 ARG HH22 H   8.369   8.950  -7.963 1.00 . A A .  87 ARG HH22 1 1 
        2  3762 1 1  87 ARG N    N  12.125   5.775 -13.046 1.00 . A A .  87 ARG N    1 1 
        2  3763 1 1  87 ARG NE   N  10.736   6.777  -8.146 1.00 . A A .  87 ARG NE   1 1 
        2  3764 1 1  87 ARG NH1  N   8.521   6.624  -8.805 1.00 . A A .  87 ARG NH1  1 1 
        2  3765 1 1  87 ARG NH2  N   9.293   8.557  -7.897 1.00 . A A .  87 ARG NH2  1 1 
        2  3766 1 1  87 ARG O    O   9.609   6.080 -11.842 1.00 . A A .  87 ARG O    1 1 
        2  3767 1 1  88 THR C    C   7.525   4.029 -10.380 1.00 . A A .  88 THR C    1 1 
        2  3768 1 1  88 THR CA   C   8.279   3.619 -11.649 1.00 . A A .  88 THR CA   1 1 
        2  3769 1 1  88 THR CB   C   8.006   2.118 -12.014 1.00 . A A .  88 THR CB   1 1 
        2  3770 1 1  88 THR CG2  C   6.528   1.852 -12.367 1.00 . A A .  88 THR CG2  1 1 
        2  3771 1 1  88 THR H    H  10.276   3.140 -11.120 1.00 . A A .  88 THR H    1 1 
        2  3772 1 1  88 THR HA   H   7.934   4.233 -12.484 1.00 . A A .  88 THR HA   1 1 
        2  3773 1 1  88 THR HB   H   8.273   1.498 -11.165 1.00 . A A .  88 THR HB   1 1 
        2  3774 1 1  88 THR HG1  H   9.587   1.223 -12.786 1.00 . A A .  88 THR HG1  1 1 
        2  3775 1 1  88 THR HG21 H   6.238   2.458 -13.216 1.00 . A A .  88 THR HG21 1 1 
        2  3776 1 1  88 THR HG22 H   5.900   2.103 -11.520 1.00 . A A .  88 THR HG22 1 1 
        2  3777 1 1  88 THR HG23 H   6.388   0.806 -12.611 1.00 . A A .  88 THR HG23 1 1 
        2  3778 1 1  88 THR N    N   9.712   3.861 -11.467 1.00 . A A .  88 THR N    1 1 
        2  3779 1 1  88 THR O    O   8.019   3.851  -9.289 1.00 . A A .  88 THR O    1 1 
        2  3780 1 1  88 THR OG1  O   8.833   1.722 -13.118 1.00 . A A .  88 THR OG1  1 1 
        2  3781 1 1  89 GLU C    C   4.408   3.903  -9.340 1.00 . A A .  89 GLU C    1 1 
        2  3782 1 1  89 GLU CA   C   5.480   5.003  -9.412 1.00 . A A .  89 GLU CA   1 1 
        2  3783 1 1  89 GLU CB   C   4.825   6.399  -9.666 1.00 . A A .  89 GLU CB   1 1 
        2  3784 1 1  89 GLU CD   C   5.427   7.800  -7.570 1.00 . A A .  89 GLU CD   1 1 
        2  3785 1 1  89 GLU CG   C   4.308   7.146  -8.410 1.00 . A A .  89 GLU CG   1 1 
        2  3786 1 1  89 GLU H    H   6.128   4.947 -11.416 1.00 . A A .  89 GLU H    1 1 
        2  3787 1 1  89 GLU HA   H   6.048   5.022  -8.480 1.00 . A A .  89 GLU HA   1 1 
        2  3788 1 1  89 GLU HB2  H   5.560   7.039 -10.148 1.00 . A A .  89 GLU HB2  1 1 
        2  3789 1 1  89 GLU HB3  H   3.991   6.279 -10.357 1.00 . A A .  89 GLU HB3  1 1 
        2  3790 1 1  89 GLU HG2  H   3.628   7.932  -8.728 1.00 . A A .  89 GLU HG2  1 1 
        2  3791 1 1  89 GLU HG3  H   3.760   6.445  -7.787 1.00 . A A .  89 GLU HG3  1 1 
        2  3792 1 1  89 GLU N    N   6.381   4.673 -10.530 1.00 . A A .  89 GLU N    1 1 
        2  3793 1 1  89 GLU O    O   4.234   3.141 -10.294 1.00 . A A .  89 GLU O    1 1 
        2  3794 1 1  89 GLU OE1  O   6.325   8.445  -8.166 1.00 . A A .  89 GLU OE1  1 1 
        2  3795 1 1  89 GLU OE2  O   5.398   7.725  -6.328 1.00 . A A .  89 GLU OE2  1 1 
        2  3796 1 1  90 VAL C    C   1.408   3.960  -7.518 1.00 . A A .  90 VAL C    1 1 
        2  3797 1 1  90 VAL CA   C   2.468   3.037  -8.101 1.00 . A A .  90 VAL CA   1 1 
        2  3798 1 1  90 VAL CB   C   2.563   1.688  -7.298 1.00 . A A .  90 VAL CB   1 1 
        2  3799 1 1  90 VAL CG1  C   3.352   0.630  -8.091 1.00 . A A .  90 VAL CG1  1 1 
        2  3800 1 1  90 VAL CG2  C   3.172   1.885  -5.897 1.00 . A A .  90 VAL CG2  1 1 
        2  3801 1 1  90 VAL H    H   4.074   4.232  -7.401 1.00 . A A .  90 VAL H    1 1 
        2  3802 1 1  90 VAL HA   H   2.155   2.791  -9.123 1.00 . A A .  90 VAL HA   1 1 
        2  3803 1 1  90 VAL HB   H   1.549   1.307  -7.168 1.00 . A A .  90 VAL HB   1 1 
        2  3804 1 1  90 VAL HG11 H   4.359   0.993  -8.278 1.00 . A A .  90 VAL HG11 1 1 
        2  3805 1 1  90 VAL HG12 H   2.860   0.432  -9.033 1.00 . A A .  90 VAL HG12 1 1 
        2  3806 1 1  90 VAL HG13 H   3.404  -0.285  -7.516 1.00 . A A .  90 VAL HG13 1 1 
        2  3807 1 1  90 VAL HG21 H   3.198   0.936  -5.373 1.00 . A A .  90 VAL HG21 1 1 
        2  3808 1 1  90 VAL HG22 H   2.568   2.582  -5.329 1.00 . A A .  90 VAL HG22 1 1 
        2  3809 1 1  90 VAL HG23 H   4.178   2.275  -5.981 1.00 . A A .  90 VAL HG23 1 1 
        2  3810 1 1  90 VAL N    N   3.729   3.790  -8.201 1.00 . A A .  90 VAL N    1 1 
        2  3811 1 1  90 VAL O    O   1.516   4.419  -6.377 1.00 . A A .  90 VAL O    1 1 
        2  3812 1 1  91 ARG C    C  -1.825   5.042  -9.005 1.00 . A A .  91 ARG C    1 1 
        2  3813 1 1  91 ARG CA   C  -0.683   5.176  -7.985 1.00 . A A .  91 ARG CA   1 1 
        2  3814 1 1  91 ARG CB   C  -0.169   6.651  -7.841 1.00 . A A .  91 ARG CB   1 1 
        2  3815 1 1  91 ARG CD   C  -0.297   7.961 -10.088 1.00 . A A .  91 ARG CD   1 1 
        2  3816 1 1  91 ARG CG   C   0.606   7.265  -9.049 1.00 . A A .  91 ARG CG   1 1 
        2  3817 1 1  91 ARG CZ   C  -0.780  10.264  -9.233 1.00 . A A .  91 ARG CZ   1 1 
        2  3818 1 1  91 ARG H    H   0.390   3.877  -9.237 1.00 . A A .  91 ARG H    1 1 
        2  3819 1 1  91 ARG HA   H  -1.059   4.849  -7.013 1.00 . A A .  91 ARG HA   1 1 
        2  3820 1 1  91 ARG HB2  H  -1.017   7.289  -7.621 1.00 . A A .  91 ARG HB2  1 1 
        2  3821 1 1  91 ARG HB3  H   0.491   6.675  -6.977 1.00 . A A .  91 ARG HB3  1 1 
        2  3822 1 1  91 ARG HD2  H   0.323   8.418 -10.854 1.00 . A A .  91 ARG HD2  1 1 
        2  3823 1 1  91 ARG HD3  H  -0.936   7.220 -10.553 1.00 . A A .  91 ARG HD3  1 1 
        2  3824 1 1  91 ARG HE   H  -2.052   8.710  -9.203 1.00 . A A .  91 ARG HE   1 1 
        2  3825 1 1  91 ARG HG2  H   1.308   7.999  -8.671 1.00 . A A .  91 ARG HG2  1 1 
        2  3826 1 1  91 ARG HG3  H   1.165   6.474  -9.542 1.00 . A A .  91 ARG HG3  1 1 
        2  3827 1 1  91 ARG HH11 H   1.092  10.112  -9.995 1.00 . A A .  91 ARG HH11 1 1 
        2  3828 1 1  91 ARG HH12 H   0.676  11.672  -9.366 1.00 . A A .  91 ARG HH12 1 1 
        2  3829 1 1  91 ARG HH21 H  -2.557  10.760  -8.404 1.00 . A A .  91 ARG HH21 1 1 
        2  3830 1 1  91 ARG HH22 H  -1.381  12.034  -8.467 1.00 . A A .  91 ARG HH22 1 1 
        2  3831 1 1  91 ARG N    N   0.411   4.283  -8.349 1.00 . A A .  91 ARG N    1 1 
        2  3832 1 1  91 ARG NE   N  -1.145   8.989  -9.467 1.00 . A A .  91 ARG NE   1 1 
        2  3833 1 1  91 ARG NH1  N   0.424  10.719  -9.559 1.00 . A A .  91 ARG NH1  1 1 
        2  3834 1 1  91 ARG NH2  N  -1.642  11.084  -8.658 1.00 . A A .  91 ARG NH2  1 1 
        2  3835 1 1  91 ARG O    O  -1.583   5.091 -10.221 1.00 . A A .  91 ARG O    1 1 
        2  3836 1 1  92 SER C    C  -4.758   6.351  -9.393 1.00 . A A .  92 SER C    1 1 
        2  3837 1 1  92 SER CA   C  -4.262   4.897  -9.362 1.00 . A A .  92 SER CA   1 1 
        2  3838 1 1  92 SER CB   C  -5.352   3.919  -8.872 1.00 . A A .  92 SER CB   1 1 
        2  3839 1 1  92 SER H    H  -3.159   4.570  -7.571 1.00 . A A .  92 SER H    1 1 
        2  3840 1 1  92 SER HA   H  -3.979   4.614 -10.377 1.00 . A A .  92 SER HA   1 1 
        2  3841 1 1  92 SER HB2  H  -4.960   2.909  -8.871 1.00 . A A .  92 SER HB2  1 1 
        2  3842 1 1  92 SER HB3  H  -5.646   4.182  -7.870 1.00 . A A .  92 SER HB3  1 1 
        2  3843 1 1  92 SER HG   H  -6.319   3.439 -10.498 1.00 . A A .  92 SER HG   1 1 
        2  3844 1 1  92 SER N    N  -3.058   4.819  -8.518 1.00 . A A .  92 SER N    1 1 
        2  3845 1 1  92 SER O    O  -4.326   7.189  -8.589 1.00 . A A .  92 SER O    1 1 
        2  3846 1 1  92 SER OG   O  -6.499   3.941  -9.694 1.00 . A A .  92 SER OG   1 1 
        2  3847 1 1  93 ARG C    C  -7.206   8.560  -9.838 1.00 . A A .  93 ARG C    1 1 
        2  3848 1 1  93 ARG CA   C  -6.056   7.996 -10.694 1.00 . A A .  93 ARG CA   1 1 
        2  3849 1 1  93 ARG CB   C  -6.380   8.004 -12.209 1.00 . A A .  93 ARG CB   1 1 
        2  3850 1 1  93 ARG CD   C  -5.466   7.291 -14.512 1.00 . A A .  93 ARG CD   1 1 
        2  3851 1 1  93 ARG CG   C  -5.127   7.830 -13.114 1.00 . A A .  93 ARG CG   1 1 
        2  3852 1 1  93 ARG CZ   C  -6.018   5.060 -15.512 1.00 . A A .  93 ARG CZ   1 1 
        2  3853 1 1  93 ARG H    H  -6.144   5.878 -10.732 1.00 . A A .  93 ARG H    1 1 
        2  3854 1 1  93 ARG HA   H  -5.191   8.633 -10.533 1.00 . A A .  93 ARG HA   1 1 
        2  3855 1 1  93 ARG HB2  H  -7.076   7.199 -12.415 1.00 . A A .  93 ARG HB2  1 1 
        2  3856 1 1  93 ARG HB3  H  -6.857   8.944 -12.471 1.00 . A A .  93 ARG HB3  1 1 
        2  3857 1 1  93 ARG HD2  H  -6.293   7.860 -14.926 1.00 . A A .  93 ARG HD2  1 1 
        2  3858 1 1  93 ARG HD3  H  -4.599   7.405 -15.149 1.00 . A A .  93 ARG HD3  1 1 
        2  3859 1 1  93 ARG HE   H  -5.913   5.463 -13.561 1.00 . A A .  93 ARG HE   1 1 
        2  3860 1 1  93 ARG HG2  H  -4.642   8.794 -13.223 1.00 . A A .  93 ARG HG2  1 1 
        2  3861 1 1  93 ARG HG3  H  -4.430   7.143 -12.635 1.00 . A A .  93 ARG HG3  1 1 
        2  3862 1 1  93 ARG HH11 H  -5.714   6.496 -16.913 1.00 . A A .  93 ARG HH11 1 1 
        2  3863 1 1  93 ARG HH12 H  -6.058   4.916 -17.532 1.00 . A A .  93 ARG HH12 1 1 
        2  3864 1 1  93 ARG HH21 H  -6.301   3.410 -14.373 1.00 . A A .  93 ARG HH21 1 1 
        2  3865 1 1  93 ARG HH22 H  -6.405   3.157 -16.087 1.00 . A A .  93 ARG HH22 1 1 
        2  3866 1 1  93 ARG N    N  -5.675   6.629 -10.315 1.00 . A A .  93 ARG N    1 1 
        2  3867 1 1  93 ARG NE   N  -5.835   5.861 -14.457 1.00 . A A .  93 ARG NE   1 1 
        2  3868 1 1  93 ARG NH1  N  -5.926   5.529 -16.750 1.00 . A A .  93 ARG NH1  1 1 
        2  3869 1 1  93 ARG NH2  N  -6.262   3.774 -15.310 1.00 . A A .  93 ARG NH2  1 1 
        2  3870 1 1  93 ARG O    O  -7.326   9.785  -9.715 1.00 . A A .  93 ARG O    1 1 
        2  3871 1 1  94 THR C    C  -8.749   8.476  -6.969 1.00 . A A .  94 THR C    1 1 
        2  3872 1 1  94 THR CA   C  -9.187   8.154  -8.419 1.00 . A A .  94 THR CA   1 1 
        2  3873 1 1  94 THR CB   C -10.326   7.075  -8.410 1.00 . A A .  94 THR CB   1 1 
        2  3874 1 1  94 THR CG2  C -11.629   7.610  -7.786 1.00 . A A .  94 THR CG2  1 1 
        2  3875 1 1  94 THR H    H  -7.919   6.726  -9.344 1.00 . A A .  94 THR H    1 1 
        2  3876 1 1  94 THR HA   H  -9.585   9.063  -8.874 1.00 . A A .  94 THR HA   1 1 
        2  3877 1 1  94 THR HB   H  -9.988   6.218  -7.829 1.00 . A A .  94 THR HB   1 1 
        2  3878 1 1  94 THR HG1  H -10.590   7.380 -10.361 1.00 . A A .  94 THR HG1  1 1 
        2  3879 1 1  94 THR HG21 H -11.446   7.913  -6.760 1.00 . A A .  94 THR HG21 1 1 
        2  3880 1 1  94 THR HG22 H -12.386   6.837  -7.797 1.00 . A A .  94 THR HG22 1 1 
        2  3881 1 1  94 THR HG23 H -11.982   8.462  -8.352 1.00 . A A .  94 THR HG23 1 1 
        2  3882 1 1  94 THR N    N  -8.046   7.691  -9.236 1.00 . A A .  94 THR N    1 1 
        2  3883 1 1  94 THR O    O  -8.718   9.643  -6.565 1.00 . A A .  94 THR O    1 1 
        2  3884 1 1  94 THR OG1  O -10.584   6.628  -9.751 1.00 . A A .  94 THR OG1  1 1 
        2  3885 1 1  95 ALA C    C  -6.593   7.150  -4.471 1.00 . A A .  95 ALA C    1 1 
        2  3886 1 1  95 ALA CA   C  -8.045   7.546  -4.769 1.00 . A A .  95 ALA CA   1 1 
        2  3887 1 1  95 ALA CB   C  -9.009   6.664  -3.950 1.00 . A A .  95 ALA CB   1 1 
        2  3888 1 1  95 ALA H    H  -8.303   6.546  -6.634 1.00 . A A .  95 ALA H    1 1 
        2  3889 1 1  95 ALA HA   H  -8.194   8.579  -4.457 1.00 . A A .  95 ALA HA   1 1 
        2  3890 1 1  95 ALA HB1  H  -8.878   5.623  -4.221 1.00 . A A .  95 ALA HB1  1 1 
        2  3891 1 1  95 ALA HB2  H -10.034   6.957  -4.150 1.00 . A A .  95 ALA HB2  1 1 
        2  3892 1 1  95 ALA HB3  H  -8.810   6.786  -2.891 1.00 . A A .  95 ALA HB3  1 1 
        2  3893 1 1  95 ALA N    N  -8.363   7.429  -6.214 1.00 . A A .  95 ALA N    1 1 
        2  3894 1 1  95 ALA O    O  -5.923   7.772  -3.644 1.00 . A A .  95 ALA O    1 1 
        2  3895 1 1  96 ASP C    C  -3.575   6.107  -5.201 1.00 . A A .  96 ASP C    1 1 
        2  3896 1 1  96 ASP CA   C  -4.875   5.366  -4.843 1.00 . A A .  96 ASP CA   1 1 
        2  3897 1 1  96 ASP CB   C  -4.907   3.941  -5.426 1.00 . A A .  96 ASP CB   1 1 
        2  3898 1 1  96 ASP CG   C  -6.202   3.189  -5.084 1.00 . A A .  96 ASP CG   1 1 
        2  3899 1 1  96 ASP H    H  -6.613   5.830  -5.980 1.00 . A A .  96 ASP H    1 1 
        2  3900 1 1  96 ASP HA   H  -4.869   5.265  -3.764 1.00 . A A .  96 ASP HA   1 1 
        2  3901 1 1  96 ASP HB2  H  -4.798   3.998  -6.499 1.00 . A A .  96 ASP HB2  1 1 
        2  3902 1 1  96 ASP HB3  H  -4.067   3.377  -5.028 1.00 . A A .  96 ASP HB3  1 1 
        2  3903 1 1  96 ASP N    N  -6.114   6.114  -5.180 1.00 . A A .  96 ASP N    1 1 
        2  3904 1 1  96 ASP O    O  -2.526   5.494  -5.321 1.00 . A A .  96 ASP O    1 1 
        2  3905 1 1  96 ASP OD1  O  -6.312   2.660  -3.961 1.00 . A A .  96 ASP OD1  1 1 
        2  3906 1 1  96 ASP OD2  O  -7.137   3.187  -5.915 1.00 . A A .  96 ASP OD2  1 1 
        2  3907 1 1  97 SER C    C  -1.591   8.223  -4.207 1.00 . A A .  97 SER C    1 1 
        2  3908 1 1  97 SER CA   C  -2.429   8.267  -5.522 1.00 . A A .  97 SER CA   1 1 
        2  3909 1 1  97 SER CB   C  -2.840   9.705  -5.874 1.00 . A A .  97 SER CB   1 1 
        2  3910 1 1  97 SER H    H  -4.519   7.857  -5.427 1.00 . A A .  97 SER H    1 1 
        2  3911 1 1  97 SER HA   H  -1.826   7.869  -6.330 1.00 . A A .  97 SER HA   1 1 
        2  3912 1 1  97 SER HB2  H  -3.437  10.124  -5.070 1.00 . A A .  97 SER HB2  1 1 
        2  3913 1 1  97 SER HB3  H  -1.956  10.314  -6.029 1.00 . A A .  97 SER HB3  1 1 
        2  3914 1 1  97 SER HG   H  -4.388  10.277  -6.939 1.00 . A A .  97 SER HG   1 1 
        2  3915 1 1  97 SER N    N  -3.642   7.425  -5.402 1.00 . A A .  97 SER N    1 1 
        2  3916 1 1  97 SER O    O  -0.418   8.597  -4.191 1.00 . A A .  97 SER O    1 1 
        2  3917 1 1  97 SER OG   O  -3.609   9.734  -7.069 1.00 . A A .  97 SER OG   1 1 
        2  3918 1 1  98 HIS C    C  -0.664   6.379  -1.650 1.00 . A A .  98 HIS C    1 1 
        2  3919 1 1  98 HIS CA   C  -1.661   7.570  -1.789 1.00 . A A .  98 HIS CA   1 1 
        2  3920 1 1  98 HIS CB   C  -2.814   7.425  -0.744 1.00 . A A .  98 HIS CB   1 1 
        2  3921 1 1  98 HIS CD2  C  -3.654   4.997  -1.249 1.00 . A A .  98 HIS CD2  1 1 
        2  3922 1 1  98 HIS CE1  C  -5.789   5.425  -1.426 1.00 . A A .  98 HIS CE1  1 1 
        2  3923 1 1  98 HIS CG   C  -3.814   6.327  -1.044 1.00 . A A .  98 HIS CG   1 1 
        2  3924 1 1  98 HIS H    H  -3.183   7.490  -3.259 1.00 . A A .  98 HIS H    1 1 
        2  3925 1 1  98 HIS HA   H  -1.122   8.484  -1.566 1.00 . A A .  98 HIS HA   1 1 
        2  3926 1 1  98 HIS HB2  H  -2.390   7.219   0.227 1.00 . A A .  98 HIS HB2  1 1 
        2  3927 1 1  98 HIS HB3  H  -3.357   8.363  -0.691 1.00 . A A .  98 HIS HB3  1 1 
        2  3928 1 1  98 HIS HD1  H  -5.606   7.428  -1.067 1.00 . A A .  98 HIS HD1  1 1 
        2  3929 1 1  98 HIS HD2  H  -2.715   4.460  -1.239 1.00 . A A .  98 HIS HD2  1 1 
        2  3930 1 1  98 HIS HE1  H  -6.853   5.307  -1.573 1.00 . A A .  98 HIS HE1  1 1 
        2  3931 1 1  98 HIS HE2  H  -5.100   3.501  -1.510 1.00 . A A .  98 HIS HE2  1 1 
        2  3932 1 1  98 HIS N    N  -2.240   7.729  -3.134 1.00 . A A .  98 HIS N    1 1 
        2  3933 1 1  98 HIS ND1  N  -5.166   6.558  -1.161 1.00 . A A .  98 HIS ND1  1 1 
        2  3934 1 1  98 HIS NE2  N  -4.892   4.465  -1.487 1.00 . A A .  98 HIS NE2  1 1 
        2  3935 1 1  98 HIS O    O  -0.035   6.250  -0.586 1.00 . A A .  98 HIS O    1 1 
        2  3936 1 1  99 LEU C    C   1.727   4.475  -2.280 1.00 . A A .  99 LEU C    1 1 
        2  3937 1 1  99 LEU CA   C   0.230   4.228  -2.558 1.00 . A A .  99 LEU CA   1 1 
        2  3938 1 1  99 LEU CB   C   0.089   3.343  -3.822 1.00 . A A .  99 LEU CB   1 1 
        2  3939 1 1  99 LEU CD1  C  -1.349   2.065  -5.509 1.00 . A A .  99 LEU CD1  1 1 
        2  3940 1 1  99 LEU CD2  C  -2.082   2.252  -3.078 1.00 . A A .  99 LEU CD2  1 1 
        2  3941 1 1  99 LEU CG   C  -1.344   2.930  -4.232 1.00 . A A .  99 LEU CG   1 1 
        2  3942 1 1  99 LEU H    H  -1.056   5.666  -3.508 1.00 . A A .  99 LEU H    1 1 
        2  3943 1 1  99 LEU HA   H  -0.183   3.675  -1.717 1.00 . A A .  99 LEU HA   1 1 
        2  3944 1 1  99 LEU HB2  H   0.528   3.885  -4.648 1.00 . A A .  99 LEU HB2  1 1 
        2  3945 1 1  99 LEU HB3  H   0.673   2.437  -3.674 1.00 . A A .  99 LEU HB3  1 1 
        2  3946 1 1  99 LEU HD11 H  -2.368   1.820  -5.780 1.00 . A A .  99 LEU HD11 1 1 
        2  3947 1 1  99 LEU HD12 H  -0.796   1.148  -5.340 1.00 . A A .  99 LEU HD12 1 1 
        2  3948 1 1  99 LEU HD13 H  -0.887   2.613  -6.322 1.00 . A A .  99 LEU HD13 1 1 
        2  3949 1 1  99 LEU HD21 H  -1.537   1.370  -2.759 1.00 . A A .  99 LEU HD21 1 1 
        2  3950 1 1  99 LEU HD22 H  -3.074   1.963  -3.401 1.00 . A A .  99 LEU HD22 1 1 
        2  3951 1 1  99 LEU HD23 H  -2.172   2.942  -2.245 1.00 . A A .  99 LEU HD23 1 1 
        2  3952 1 1  99 LEU HG   H  -1.894   3.823  -4.466 1.00 . A A .  99 LEU HG   1 1 
        2  3953 1 1  99 LEU N    N  -0.560   5.492  -2.677 1.00 . A A .  99 LEU N    1 1 
        2  3954 1 1  99 LEU O    O   2.174   4.313  -1.143 1.00 . A A .  99 LEU O    1 1 
        2  3955 1 1 100 GLY C    C   4.689   4.934  -4.482 1.00 . A A . 100 GLY C    1 1 
        2  3956 1 1 100 GLY CA   C   3.941   5.039  -3.166 1.00 . A A . 100 GLY CA   1 1 
        2  3957 1 1 100 GLY H    H   2.075   5.069  -4.181 1.00 . A A . 100 GLY H    1 1 
        2  3958 1 1 100 GLY HA2  H   4.136   6.012  -2.740 1.00 . A A . 100 GLY HA2  1 1 
        2  3959 1 1 100 GLY HA3  H   4.321   4.280  -2.482 1.00 . A A . 100 GLY HA3  1 1 
        2  3960 1 1 100 GLY N    N   2.493   4.887  -3.310 1.00 . A A . 100 GLY N    1 1 
        2  3961 1 1 100 GLY O    O   4.118   5.130  -5.554 1.00 . A A . 100 GLY O    1 1 
        2  3962 1 1 101 HIS C    C   7.628   3.218  -5.525 1.00 . A A . 101 HIS C    1 1 
        2  3963 1 1 101 HIS CA   C   6.941   4.586  -5.508 1.00 . A A . 101 HIS CA   1 1 
        2  3964 1 1 101 HIS CB   C   7.980   5.724  -5.329 1.00 . A A . 101 HIS CB   1 1 
        2  3965 1 1 101 HIS CD2  C   9.595   5.160  -3.349 1.00 . A A . 101 HIS CD2  1 1 
        2  3966 1 1 101 HIS CE1  C   8.656   6.397  -1.816 1.00 . A A . 101 HIS CE1  1 1 
        2  3967 1 1 101 HIS CG   C   8.551   5.795  -3.928 1.00 . A A . 101 HIS CG   1 1 
        2  3968 1 1 101 HIS H    H   6.322   4.383  -3.492 1.00 . A A . 101 HIS H    1 1 
        2  3969 1 1 101 HIS HA   H   6.404   4.726  -6.444 1.00 . A A . 101 HIS HA   1 1 
        2  3970 1 1 101 HIS HB2  H   8.799   5.584  -6.025 1.00 . A A . 101 HIS HB2  1 1 
        2  3971 1 1 101 HIS HB3  H   7.503   6.676  -5.542 1.00 . A A . 101 HIS HB3  1 1 
        2  3972 1 1 101 HIS HD1  H   7.197   7.136  -3.040 1.00 . A A . 101 HIS HD1  1 1 
        2  3973 1 1 101 HIS HD2  H  10.260   4.458  -3.833 1.00 . A A . 101 HIS HD2  1 1 
        2  3974 1 1 101 HIS HE1  H   8.440   6.881  -0.874 1.00 . A A . 101 HIS HE1  1 1 
        2  3975 1 1 101 HIS HE2  H  10.426   5.458  -1.451 1.00 . A A . 101 HIS HE2  1 1 
        2  3976 1 1 101 HIS N    N   5.984   4.633  -4.378 1.00 . A A . 101 HIS N    1 1 
        2  3977 1 1 101 HIS ND1  N   7.985   6.561  -2.937 1.00 . A A . 101 HIS ND1  1 1 
        2  3978 1 1 101 HIS NE2  N   9.639   5.551  -2.033 1.00 . A A . 101 HIS NE2  1 1 
        2  3979 1 1 101 HIS O    O   7.694   2.546  -4.490 1.00 . A A . 101 HIS O    1 1 
        2  3980 1 1 102 VAL C    C  10.072   1.611  -7.682 1.00 . A A . 102 VAL C    1 1 
        2  3981 1 1 102 VAL CA   C   8.797   1.480  -6.832 1.00 . A A . 102 VAL CA   1 1 
        2  3982 1 1 102 VAL CB   C   7.829   0.380  -7.426 1.00 . A A . 102 VAL CB   1 1 
        2  3983 1 1 102 VAL CG1  C   6.536   0.253  -6.604 1.00 . A A . 102 VAL CG1  1 1 
        2  3984 1 1 102 VAL CG2  C   7.480   0.631  -8.890 1.00 . A A . 102 VAL CG2  1 1 
        2  3985 1 1 102 VAL H    H   8.152   3.403  -7.463 1.00 . A A . 102 VAL H    1 1 
        2  3986 1 1 102 VAL HA   H   9.101   1.148  -5.834 1.00 . A A . 102 VAL HA   1 1 
        2  3987 1 1 102 VAL HB   H   8.348  -0.578  -7.368 1.00 . A A . 102 VAL HB   1 1 
        2  3988 1 1 102 VAL HG11 H   5.975   1.180  -6.655 1.00 . A A . 102 VAL HG11 1 1 
        2  3989 1 1 102 VAL HG12 H   6.775   0.041  -5.570 1.00 . A A . 102 VAL HG12 1 1 
        2  3990 1 1 102 VAL HG13 H   5.930  -0.553  -6.998 1.00 . A A . 102 VAL HG13 1 1 
        2  3991 1 1 102 VAL HG21 H   6.804  -0.137  -9.245 1.00 . A A . 102 VAL HG21 1 1 
        2  3992 1 1 102 VAL HG22 H   8.385   0.608  -9.487 1.00 . A A . 102 VAL HG22 1 1 
        2  3993 1 1 102 VAL HG23 H   7.008   1.600  -8.996 1.00 . A A . 102 VAL HG23 1 1 
        2  3994 1 1 102 VAL N    N   8.152   2.796  -6.688 1.00 . A A . 102 VAL N    1 1 
        2  3995 1 1 102 VAL O    O  10.103   2.321  -8.691 1.00 . A A . 102 VAL O    1 1 
        2  3996 1 1 103 PHE C    C  12.705  -0.117  -8.846 1.00 . A A . 103 PHE C    1 1 
        2  3997 1 1 103 PHE CA   C  12.461   1.045  -7.883 1.00 . A A . 103 PHE CA   1 1 
        2  3998 1 1 103 PHE CB   C  13.546   1.103  -6.787 1.00 . A A . 103 PHE CB   1 1 
        2  3999 1 1 103 PHE CD1  C  12.681   2.463  -4.811 1.00 . A A . 103 PHE CD1  1 1 
        2  4000 1 1 103 PHE CD2  C  14.281   3.484  -6.271 1.00 . A A . 103 PHE CD2  1 1 
        2  4001 1 1 103 PHE CE1  C  12.649   3.614  -4.051 1.00 . A A . 103 PHE CE1  1 1 
        2  4002 1 1 103 PHE CE2  C  14.243   4.634  -5.511 1.00 . A A . 103 PHE CE2  1 1 
        2  4003 1 1 103 PHE CG   C  13.502   2.376  -5.937 1.00 . A A . 103 PHE CG   1 1 
        2  4004 1 1 103 PHE CZ   C  13.427   4.699  -4.401 1.00 . A A . 103 PHE CZ   1 1 
        2  4005 1 1 103 PHE H    H  11.019   0.303  -6.517 1.00 . A A . 103 PHE H    1 1 
        2  4006 1 1 103 PHE HA   H  12.496   1.975  -8.451 1.00 . A A . 103 PHE HA   1 1 
        2  4007 1 1 103 PHE HB2  H  13.431   0.251  -6.125 1.00 . A A . 103 PHE HB2  1 1 
        2  4008 1 1 103 PHE HB3  H  14.527   1.045  -7.249 1.00 . A A . 103 PHE HB3  1 1 
        2  4009 1 1 103 PHE HD1  H  12.067   1.615  -4.528 1.00 . A A . 103 PHE HD1  1 1 
        2  4010 1 1 103 PHE HD2  H  14.925   3.440  -7.144 1.00 . A A . 103 PHE HD2  1 1 
        2  4011 1 1 103 PHE HE1  H  12.010   3.666  -3.179 1.00 . A A . 103 PHE HE1  1 1 
        2  4012 1 1 103 PHE HE2  H  14.854   5.485  -5.784 1.00 . A A . 103 PHE HE2  1 1 
        2  4013 1 1 103 PHE HZ   H  13.395   5.601  -3.805 1.00 . A A . 103 PHE HZ   1 1 
        2  4014 1 1 103 PHE N    N  11.133   0.927  -7.262 1.00 . A A . 103 PHE N    1 1 
        2  4015 1 1 103 PHE O    O  12.433  -1.269  -8.519 1.00 . A A . 103 PHE O    1 1 
        2  4016 1 1 104 ASN C    C  14.687  -1.629 -10.988 1.00 . A A . 104 ASN C    1 1 
        2  4017 1 1 104 ASN CA   C  13.423  -0.744 -11.143 1.00 . A A . 104 ASN CA   1 1 
        2  4018 1 1 104 ASN CB   C  13.456   0.054 -12.487 1.00 . A A . 104 ASN CB   1 1 
        2  4019 1 1 104 ASN CG   C  12.218   0.952 -12.721 1.00 . A A . 104 ASN CG   1 1 
        2  4020 1 1 104 ASN H    H  13.593   1.123 -10.139 1.00 . A A . 104 ASN H    1 1 
        2  4021 1 1 104 ASN HA   H  12.556  -1.396 -11.150 1.00 . A A . 104 ASN HA   1 1 
        2  4022 1 1 104 ASN HB2  H  14.329   0.694 -12.502 1.00 . A A . 104 ASN HB2  1 1 
        2  4023 1 1 104 ASN HB3  H  13.526  -0.652 -13.303 1.00 . A A . 104 ASN HB3  1 1 
        2  4024 1 1 104 ASN HD21 H  12.297   0.626 -14.679 1.00 . A A . 104 ASN HD21 1 1 
        2  4025 1 1 104 ASN HD22 H  11.008   1.647 -14.144 1.00 . A A . 104 ASN HD22 1 1 
        2  4026 1 1 104 ASN N    N  13.268   0.205 -10.018 1.00 . A A . 104 ASN N    1 1 
        2  4027 1 1 104 ASN ND2  N  11.804   1.095 -13.973 1.00 . A A . 104 ASN ND2  1 1 
        2  4028 1 1 104 ASN O    O  15.096  -2.310 -11.934 1.00 . A A . 104 ASN O    1 1 
        2  4029 1 1 104 ASN OD1  O  11.627   1.504 -11.786 1.00 . A A . 104 ASN OD1  1 1 
        2  4030 1 1 105 ASP C    C  16.144  -3.646  -8.582 1.00 . A A . 105 ASP C    1 1 
        2  4031 1 1 105 ASP CA   C  16.495  -2.414  -9.451 1.00 . A A . 105 ASP CA   1 1 
        2  4032 1 1 105 ASP CB   C  17.503  -1.489  -8.716 1.00 . A A . 105 ASP CB   1 1 
        2  4033 1 1 105 ASP CG   C  18.866  -2.144  -8.422 1.00 . A A . 105 ASP CG   1 1 
        2  4034 1 1 105 ASP H    H  14.852  -1.129  -9.062 1.00 . A A . 105 ASP H    1 1 
        2  4035 1 1 105 ASP HA   H  16.943  -2.762 -10.381 1.00 . A A . 105 ASP HA   1 1 
        2  4036 1 1 105 ASP HB2  H  17.680  -0.610  -9.327 1.00 . A A . 105 ASP HB2  1 1 
        2  4037 1 1 105 ASP HB3  H  17.061  -1.162  -7.776 1.00 . A A . 105 ASP HB3  1 1 
        2  4038 1 1 105 ASP N    N  15.273  -1.640  -9.774 1.00 . A A . 105 ASP N    1 1 
        2  4039 1 1 105 ASP O    O  16.924  -4.603  -8.493 1.00 . A A . 105 ASP O    1 1 
        2  4040 1 1 105 ASP OD1  O  19.669  -2.309  -9.359 1.00 . A A . 105 ASP OD1  1 1 
        2  4041 1 1 105 ASP OD2  O  19.123  -2.529  -7.264 1.00 . A A . 105 ASP OD2  1 1 
        2  4042 1 1 106 GLY C    C  14.131  -5.980  -7.799 1.00 . A A . 106 GLY C    1 1 
        2  4043 1 1 106 GLY CA   C  14.489  -4.684  -7.063 1.00 . A A . 106 GLY CA   1 1 
        2  4044 1 1 106 GLY H    H  14.383  -2.823  -8.101 1.00 . A A . 106 GLY H    1 1 
        2  4045 1 1 106 GLY HA2  H  15.267  -4.880  -6.331 1.00 . A A . 106 GLY HA2  1 1 
        2  4046 1 1 106 GLY HA3  H  13.611  -4.338  -6.541 1.00 . A A . 106 GLY HA3  1 1 
        2  4047 1 1 106 GLY N    N  14.950  -3.609  -7.954 1.00 . A A . 106 GLY N    1 1 
        2  4048 1 1 106 GLY O    O  13.695  -5.916  -8.946 1.00 . A A . 106 GLY O    1 1 
        2  4049 1 1 107 PRO C    C  12.510  -8.804  -7.835 1.00 . A A . 107 PRO C    1 1 
        2  4050 1 1 107 PRO CA   C  14.027  -8.482  -7.818 1.00 . A A . 107 PRO CA   1 1 
        2  4051 1 1 107 PRO CB   C  14.817  -9.492  -6.946 1.00 . A A . 107 PRO CB   1 1 
        2  4052 1 1 107 PRO CD   C  14.893  -7.366  -5.797 1.00 . A A . 107 PRO CD   1 1 
        2  4053 1 1 107 PRO CG   C  14.832  -8.870  -5.576 1.00 . A A . 107 PRO CG   1 1 
        2  4054 1 1 107 PRO HA   H  14.413  -8.511  -8.839 1.00 . A A . 107 PRO HA   1 1 
        2  4055 1 1 107 PRO HB2  H  14.326 -10.463  -6.950 1.00 . A A . 107 PRO HB2  1 1 
        2  4056 1 1 107 PRO HB3  H  15.826  -9.607  -7.340 1.00 . A A . 107 PRO HB3  1 1 
        2  4057 1 1 107 PRO HD2  H  14.287  -6.843  -5.068 1.00 . A A . 107 PRO HD2  1 1 
        2  4058 1 1 107 PRO HD3  H  15.918  -7.009  -5.746 1.00 . A A . 107 PRO HD3  1 1 
        2  4059 1 1 107 PRO HG2  H  13.925  -9.137  -5.040 1.00 . A A . 107 PRO HG2  1 1 
        2  4060 1 1 107 PRO HG3  H  15.700  -9.208  -5.021 1.00 . A A . 107 PRO HG3  1 1 
        2  4061 1 1 107 PRO N    N  14.332  -7.183  -7.171 1.00 . A A . 107 PRO N    1 1 
        2  4062 1 1 107 PRO O    O  11.830  -8.704  -6.810 1.00 . A A . 107 PRO O    1 1 
        2  4063 1 1 108 GLY C    C  10.370 -10.126 -10.599 1.00 . A A . 108 GLY C    1 1 
        2  4064 1 1 108 GLY CA   C  10.639  -9.670  -9.171 1.00 . A A . 108 GLY CA   1 1 
        2  4065 1 1 108 GLY H    H  12.539  -8.995  -9.824 1.00 . A A . 108 GLY H    1 1 
        2  4066 1 1 108 GLY HA2  H  10.495 -10.511  -8.497 1.00 . A A . 108 GLY HA2  1 1 
        2  4067 1 1 108 GLY HA3  H   9.936  -8.889  -8.919 1.00 . A A . 108 GLY HA3  1 1 
        2  4068 1 1 108 GLY N    N  11.999  -9.152  -9.021 1.00 . A A . 108 GLY N    1 1 
        2  4069 1 1 108 GLY O    O  11.270 -10.024 -11.447 1.00 . A A . 108 GLY O    1 1 
        2  4070 1 1 109 PRO C    C   8.769  -9.806 -13.251 1.00 . A A . 109 PRO C    1 1 
        2  4071 1 1 109 PRO CA   C   8.745 -11.022 -12.306 1.00 . A A . 109 PRO CA   1 1 
        2  4072 1 1 109 PRO CB   C   7.298 -11.592 -12.148 1.00 . A A . 109 PRO CB   1 1 
        2  4073 1 1 109 PRO CD   C   8.015 -10.875  -9.972 1.00 . A A . 109 PRO CD   1 1 
        2  4074 1 1 109 PRO CG   C   7.176 -11.912 -10.687 1.00 . A A . 109 PRO CG   1 1 
        2  4075 1 1 109 PRO HA   H   9.407 -11.798 -12.693 1.00 . A A . 109 PRO HA   1 1 
        2  4076 1 1 109 PRO HB2  H   6.559 -10.854 -12.454 1.00 . A A . 109 PRO HB2  1 1 
        2  4077 1 1 109 PRO HB3  H   7.183 -12.484 -12.757 1.00 . A A . 109 PRO HB3  1 1 
        2  4078 1 1 109 PRO HD2  H   7.453  -9.960  -9.802 1.00 . A A . 109 PRO HD2  1 1 
        2  4079 1 1 109 PRO HD3  H   8.382 -11.267  -9.026 1.00 . A A . 109 PRO HD3  1 1 
        2  4080 1 1 109 PRO HG2  H   6.141 -11.848 -10.371 1.00 . A A . 109 PRO HG2  1 1 
        2  4081 1 1 109 PRO HG3  H   7.561 -12.909 -10.487 1.00 . A A . 109 PRO HG3  1 1 
        2  4082 1 1 109 PRO N    N   9.131 -10.635 -10.920 1.00 . A A . 109 PRO N    1 1 
        2  4083 1 1 109 PRO O    O   9.122  -9.911 -14.424 1.00 . A A . 109 PRO O    1 1 
        2  4084 1 1 110 ASN C    C   9.732  -6.644 -13.159 1.00 . A A . 110 ASN C    1 1 
        2  4085 1 1 110 ASN CA   C   8.381  -7.349 -13.366 1.00 . A A . 110 ASN CA   1 1 
        2  4086 1 1 110 ASN CB   C   7.214  -6.472 -12.836 1.00 . A A . 110 ASN CB   1 1 
        2  4087 1 1 110 ASN CG   C   7.219  -6.218 -11.320 1.00 . A A . 110 ASN CG   1 1 
        2  4088 1 1 110 ASN H    H   8.004  -8.694 -11.779 1.00 . A A . 110 ASN H    1 1 
        2  4089 1 1 110 ASN HA   H   8.238  -7.511 -14.433 1.00 . A A . 110 ASN HA   1 1 
        2  4090 1 1 110 ASN HB2  H   7.239  -5.510 -13.339 1.00 . A A . 110 ASN HB2  1 1 
        2  4091 1 1 110 ASN HB3  H   6.277  -6.958 -13.085 1.00 . A A . 110 ASN HB3  1 1 
        2  4092 1 1 110 ASN HD21 H   6.070  -4.618 -11.571 1.00 . A A . 110 ASN HD21 1 1 
        2  4093 1 1 110 ASN HD22 H   6.509  -4.982  -9.940 1.00 . A A . 110 ASN HD22 1 1 
        2  4094 1 1 110 ASN N    N   8.356  -8.661 -12.696 1.00 . A A . 110 ASN N    1 1 
        2  4095 1 1 110 ASN ND2  N   6.536  -5.167 -10.901 1.00 . A A . 110 ASN ND2  1 1 
        2  4096 1 1 110 ASN O    O  10.164  -5.849 -14.002 1.00 . A A . 110 ASN O    1 1 
        2  4097 1 1 110 ASN OD1  O   7.794  -6.978 -10.536 1.00 . A A . 110 ASN OD1  1 1 
        2  4098 1 1 111 GLY C    C  11.589  -5.017 -10.995 1.00 . A A . 111 GLY C    1 1 
        2  4099 1 1 111 GLY CA   C  11.685  -6.372 -11.681 1.00 . A A . 111 GLY CA   1 1 
        2  4100 1 1 111 GLY H    H   9.931  -7.512 -11.369 1.00 . A A . 111 GLY H    1 1 
        2  4101 1 1 111 GLY HA2  H  12.182  -7.060 -11.013 1.00 . A A . 111 GLY HA2  1 1 
        2  4102 1 1 111 GLY HA3  H  12.282  -6.278 -12.584 1.00 . A A . 111 GLY HA3  1 1 
        2  4103 1 1 111 GLY N    N  10.373  -6.929 -12.014 1.00 . A A . 111 GLY N    1 1 
        2  4104 1 1 111 GLY O    O  12.448  -4.149 -11.195 1.00 . A A . 111 GLY O    1 1 
        2  4105 1 1 112 LEU C    C  10.462  -3.955  -7.873 1.00 . A A . 112 LEU C    1 1 
        2  4106 1 1 112 LEU CA   C  10.316  -3.628  -9.368 1.00 . A A . 112 LEU CA   1 1 
        2  4107 1 1 112 LEU CB   C   8.918  -3.020  -9.669 1.00 . A A . 112 LEU CB   1 1 
        2  4108 1 1 112 LEU CD1  C   7.269  -2.019 -11.362 1.00 . A A . 112 LEU CD1  1 1 
        2  4109 1 1 112 LEU CD2  C   9.721  -1.356 -11.452 1.00 . A A . 112 LEU CD2  1 1 
        2  4110 1 1 112 LEU CG   C   8.718  -2.481 -11.124 1.00 . A A . 112 LEU CG   1 1 
        2  4111 1 1 112 LEU H    H   9.891  -5.577 -10.095 1.00 . A A . 112 LEU H    1 1 
        2  4112 1 1 112 LEU HA   H  11.079  -2.898  -9.635 1.00 . A A . 112 LEU HA   1 1 
        2  4113 1 1 112 LEU HB2  H   8.170  -3.789  -9.483 1.00 . A A . 112 LEU HB2  1 1 
        2  4114 1 1 112 LEU HB3  H   8.739  -2.202  -8.974 1.00 . A A . 112 LEU HB3  1 1 
        2  4115 1 1 112 LEU HD11 H   6.599  -2.859 -11.241 1.00 . A A . 112 LEU HD11 1 1 
        2  4116 1 1 112 LEU HD12 H   7.170  -1.634 -12.366 1.00 . A A . 112 LEU HD12 1 1 
        2  4117 1 1 112 LEU HD13 H   7.004  -1.244 -10.656 1.00 . A A . 112 LEU HD13 1 1 
        2  4118 1 1 112 LEU HD21 H   9.577  -1.023 -12.472 1.00 . A A . 112 LEU HD21 1 1 
        2  4119 1 1 112 LEU HD22 H  10.730  -1.728 -11.347 1.00 . A A . 112 LEU HD22 1 1 
        2  4120 1 1 112 LEU HD23 H   9.578  -0.519 -10.780 1.00 . A A . 112 LEU HD23 1 1 
        2  4121 1 1 112 LEU HG   H   8.905  -3.291 -11.818 1.00 . A A . 112 LEU HG   1 1 
        2  4122 1 1 112 LEU N    N  10.535  -4.842 -10.181 1.00 . A A . 112 LEU N    1 1 
        2  4123 1 1 112 LEU O    O  10.318  -5.116  -7.463 1.00 . A A . 112 LEU O    1 1 
        2  4124 1 1 113 ARG C    C   9.782  -2.084  -5.000 1.00 . A A . 113 ARG C    1 1 
        2  4125 1 1 113 ARG CA   C  10.819  -3.020  -5.600 1.00 . A A . 113 ARG CA   1 1 
        2  4126 1 1 113 ARG CB   C  12.226  -2.654  -5.057 1.00 . A A . 113 ARG CB   1 1 
        2  4127 1 1 113 ARG CD   C  13.738  -2.457  -2.971 1.00 . A A . 113 ARG CD   1 1 
        2  4128 1 1 113 ARG CG   C  12.357  -2.840  -3.524 1.00 . A A . 113 ARG CG   1 1 
        2  4129 1 1 113 ARG CZ   C  14.621  -1.933  -0.689 1.00 . A A . 113 ARG CZ   1 1 
        2  4130 1 1 113 ARG H    H  10.816  -2.023  -7.477 1.00 . A A . 113 ARG H    1 1 
        2  4131 1 1 113 ARG HA   H  10.584  -4.046  -5.311 1.00 . A A . 113 ARG HA   1 1 
        2  4132 1 1 113 ARG HB2  H  12.960  -3.283  -5.544 1.00 . A A . 113 ARG HB2  1 1 
        2  4133 1 1 113 ARG HB3  H  12.445  -1.619  -5.297 1.00 . A A . 113 ARG HB3  1 1 
        2  4134 1 1 113 ARG HD2  H  14.490  -3.107  -3.405 1.00 . A A . 113 ARG HD2  1 1 
        2  4135 1 1 113 ARG HD3  H  13.951  -1.428  -3.243 1.00 . A A . 113 ARG HD3  1 1 
        2  4136 1 1 113 ARG HE   H  13.138  -3.206  -1.093 1.00 . A A . 113 ARG HE   1 1 
        2  4137 1 1 113 ARG HG2  H  11.615  -2.218  -3.035 1.00 . A A . 113 ARG HG2  1 1 
        2  4138 1 1 113 ARG HG3  H  12.156  -3.881  -3.277 1.00 . A A . 113 ARG HG3  1 1 
        2  4139 1 1 113 ARG HH11 H  15.636  -0.972  -2.158 1.00 . A A . 113 ARG HH11 1 1 
        2  4140 1 1 113 ARG HH12 H  16.150  -0.611  -0.545 1.00 . A A . 113 ARG HH12 1 1 
        2  4141 1 1 113 ARG HH21 H  13.846  -2.744   0.981 1.00 . A A . 113 ARG HH21 1 1 
        2  4142 1 1 113 ARG HH22 H  15.160  -1.641   1.232 1.00 . A A . 113 ARG HH22 1 1 
        2  4143 1 1 113 ARG N    N  10.724  -2.912  -7.067 1.00 . A A . 113 ARG N    1 1 
        2  4144 1 1 113 ARG NE   N  13.783  -2.588  -1.501 1.00 . A A . 113 ARG NE   1 1 
        2  4145 1 1 113 ARG NH1  N  15.544  -1.108  -1.170 1.00 . A A . 113 ARG NH1  1 1 
        2  4146 1 1 113 ARG NH2  N  14.530  -2.112   0.611 1.00 . A A . 113 ARG NH2  1 1 
        2  4147 1 1 113 ARG O    O   9.948  -0.858  -5.023 1.00 . A A . 113 ARG O    1 1 
        2  4148 1 1 114 TYR C    C   7.772  -1.259  -2.671 1.00 . A A . 114 TYR C    1 1 
        2  4149 1 1 114 TYR CA   C   7.540  -1.950  -4.013 1.00 . A A . 114 TYR CA   1 1 
        2  4150 1 1 114 TYR CB   C   6.348  -2.919  -3.984 1.00 . A A . 114 TYR CB   1 1 
        2  4151 1 1 114 TYR CD1  C   6.521  -4.208  -6.191 1.00 . A A . 114 TYR CD1  1 1 
        2  4152 1 1 114 TYR CD2  C   4.715  -2.665  -5.929 1.00 . A A . 114 TYR CD2  1 1 
        2  4153 1 1 114 TYR CE1  C   6.089  -4.498  -7.472 1.00 . A A . 114 TYR CE1  1 1 
        2  4154 1 1 114 TYR CE2  C   4.289  -2.942  -7.205 1.00 . A A . 114 TYR CE2  1 1 
        2  4155 1 1 114 TYR CG   C   5.840  -3.287  -5.390 1.00 . A A . 114 TYR CG   1 1 
        2  4156 1 1 114 TYR CZ   C   4.973  -3.858  -7.976 1.00 . A A . 114 TYR CZ   1 1 
        2  4157 1 1 114 TYR H    H   8.739  -3.647  -4.353 1.00 . A A . 114 TYR H    1 1 
        2  4158 1 1 114 TYR HA   H   7.334  -1.182  -4.753 1.00 . A A . 114 TYR HA   1 1 
        2  4159 1 1 114 TYR HB2  H   6.641  -3.832  -3.473 1.00 . A A . 114 TYR HB2  1 1 
        2  4160 1 1 114 TYR HB3  H   5.530  -2.464  -3.436 1.00 . A A . 114 TYR HB3  1 1 
        2  4161 1 1 114 TYR HD1  H   7.399  -4.712  -5.790 1.00 . A A . 114 TYR HD1  1 1 
        2  4162 1 1 114 TYR HD2  H   4.169  -1.947  -5.321 1.00 . A A . 114 TYR HD2  1 1 
        2  4163 1 1 114 TYR HE1  H   6.630  -5.221  -8.070 1.00 . A A . 114 TYR HE1  1 1 
        2  4164 1 1 114 TYR HE2  H   3.406  -2.445  -7.596 1.00 . A A . 114 TYR HE2  1 1 
        2  4165 1 1 114 TYR HH   H   4.172  -3.318  -9.644 1.00 . A A . 114 TYR HH   1 1 
        2  4166 1 1 114 TYR N    N   8.724  -2.673  -4.459 1.00 . A A . 114 TYR N    1 1 
        2  4167 1 1 114 TYR O    O   8.022  -1.913  -1.670 1.00 . A A . 114 TYR O    1 1 
        2  4168 1 1 114 TYR OH   O   4.545  -4.125  -9.253 1.00 . A A . 114 TYR OH   1 1 
        2  4169 1 1 115 CYS C    C   6.670   1.776  -1.298 1.00 . A A . 115 CYS C    1 1 
        2  4170 1 1 115 CYS CA   C   7.931   0.914  -1.500 1.00 . A A . 115 CYS CA   1 1 
        2  4171 1 1 115 CYS CB   C   9.199   1.773  -1.693 1.00 . A A . 115 CYS CB   1 1 
        2  4172 1 1 115 CYS H    H   7.623   0.553  -3.543 1.00 . A A . 115 CYS H    1 1 
        2  4173 1 1 115 CYS HA   H   8.067   0.269  -0.628 1.00 . A A . 115 CYS HA   1 1 
        2  4174 1 1 115 CYS HB2  H   9.029   2.500  -2.479 1.00 . A A . 115 CYS HB2  1 1 
        2  4175 1 1 115 CYS HB3  H   9.433   2.291  -0.772 1.00 . A A . 115 CYS HB3  1 1 
        2  4176 1 1 115 CYS HG   H  10.222  -0.251  -2.846 1.00 . A A . 115 CYS HG   1 1 
        2  4177 1 1 115 CYS N    N   7.748   0.086  -2.689 1.00 . A A . 115 CYS N    1 1 
        2  4178 1 1 115 CYS O    O   6.497   2.826  -1.937 1.00 . A A . 115 CYS O    1 1 
        2  4179 1 1 115 CYS SG   S  10.650   0.800  -2.162 1.00 . A A . 115 CYS SG   1 1 
        2  4180 1 1 116 ILE C    C   4.571   2.677   1.193 1.00 . A A . 116 ILE C    1 1 
        2  4181 1 1 116 ILE CA   C   4.475   1.921  -0.130 1.00 . A A . 116 ILE CA   1 1 
        2  4182 1 1 116 ILE CB   C   3.327   0.833  -0.059 1.00 . A A . 116 ILE CB   1 1 
        2  4183 1 1 116 ILE CD1  C   3.191   0.652  -2.641 1.00 . A A . 116 ILE CD1  1 1 
        2  4184 1 1 116 ILE CG1  C   3.345  -0.076  -1.326 1.00 . A A . 116 ILE CG1  1 1 
        2  4185 1 1 116 ILE CG2  C   1.926   1.470   0.126 1.00 . A A . 116 ILE CG2  1 1 
        2  4186 1 1 116 ILE H    H   6.037   0.487   0.081 1.00 . A A . 116 ILE H    1 1 
        2  4187 1 1 116 ILE HA   H   4.244   2.620  -0.934 1.00 . A A . 116 ILE HA   1 1 
        2  4188 1 1 116 ILE HB   H   3.518   0.207   0.812 1.00 . A A . 116 ILE HB   1 1 
        2  4189 1 1 116 ILE HD11 H   3.185  -0.066  -3.447 1.00 . A A . 116 ILE HD11 1 1 
        2  4190 1 1 116 ILE HD12 H   4.022   1.336  -2.780 1.00 . A A . 116 ILE HD12 1 1 
        2  4191 1 1 116 ILE HD13 H   2.263   1.206  -2.646 1.00 . A A . 116 ILE HD13 1 1 
        2  4192 1 1 116 ILE HG12 H   4.286  -0.608  -1.368 1.00 . A A . 116 ILE HG12 1 1 
        2  4193 1 1 116 ILE HG13 H   2.544  -0.799  -1.257 1.00 . A A . 116 ILE HG13 1 1 
        2  4194 1 1 116 ILE HG21 H   1.909   2.054   1.035 1.00 . A A . 116 ILE HG21 1 1 
        2  4195 1 1 116 ILE HG22 H   1.172   0.694   0.191 1.00 . A A . 116 ILE HG22 1 1 
        2  4196 1 1 116 ILE HG23 H   1.701   2.113  -0.715 1.00 . A A . 116 ILE HG23 1 1 
        2  4197 1 1 116 ILE N    N   5.784   1.294  -0.416 1.00 . A A . 116 ILE N    1 1 
        2  4198 1 1 116 ILE O    O   5.245   2.206   2.115 1.00 . A A . 116 ILE O    1 1 
        2  4199 1 1 117 ASN C    C   3.400   3.898   3.696 1.00 . A A . 117 ASN C    1 1 
        2  4200 1 1 117 ASN CA   C   3.911   4.689   2.471 1.00 . A A . 117 ASN CA   1 1 
        2  4201 1 1 117 ASN CB   C   3.063   5.958   2.220 1.00 . A A . 117 ASN CB   1 1 
        2  4202 1 1 117 ASN CG   C   3.622   6.835   1.085 1.00 . A A . 117 ASN CG   1 1 
        2  4203 1 1 117 ASN H    H   3.341   4.132   0.531 1.00 . A A . 117 ASN H    1 1 
        2  4204 1 1 117 ASN HA   H   4.944   4.986   2.644 1.00 . A A . 117 ASN HA   1 1 
        2  4205 1 1 117 ASN HB2  H   2.049   5.666   1.970 1.00 . A A . 117 ASN HB2  1 1 
        2  4206 1 1 117 ASN HB3  H   3.037   6.550   3.127 1.00 . A A . 117 ASN HB3  1 1 
        2  4207 1 1 117 ASN HD21 H   2.232   6.178  -0.176 1.00 . A A . 117 ASN HD21 1 1 
        2  4208 1 1 117 ASN HD22 H   3.355   7.325  -0.816 1.00 . A A . 117 ASN HD22 1 1 
        2  4209 1 1 117 ASN N    N   3.893   3.842   1.283 1.00 . A A . 117 ASN N    1 1 
        2  4210 1 1 117 ASN ND2  N   3.013   6.775  -0.088 1.00 . A A . 117 ASN ND2  1 1 
        2  4211 1 1 117 ASN O    O   2.217   3.551   3.773 1.00 . A A . 117 ASN O    1 1 
        2  4212 1 1 117 ASN OD1  O   4.568   7.593   1.285 1.00 . A A . 117 ASN OD1  1 1 
        2  4213 1 1 118 SER C    C   2.995   3.297   6.707 1.00 . A A . 118 SER C    1 1 
        2  4214 1 1 118 SER CA   C   4.114   2.750   5.805 1.00 . A A . 118 SER CA   1 1 
        2  4215 1 1 118 SER CB   C   5.432   2.673   6.590 1.00 . A A . 118 SER CB   1 1 
        2  4216 1 1 118 SER H    H   5.242   3.942   4.470 1.00 . A A . 118 SER H    1 1 
        2  4217 1 1 118 SER HA   H   3.848   1.753   5.462 1.00 . A A . 118 SER HA   1 1 
        2  4218 1 1 118 SER HB2  H   5.640   3.630   7.047 1.00 . A A . 118 SER HB2  1 1 
        2  4219 1 1 118 SER HB3  H   5.354   1.914   7.359 1.00 . A A . 118 SER HB3  1 1 
        2  4220 1 1 118 SER HG   H   7.020   1.646   6.144 1.00 . A A . 118 SER HG   1 1 
        2  4221 1 1 118 SER N    N   4.337   3.596   4.615 1.00 . A A . 118 SER N    1 1 
        2  4222 1 1 118 SER O    O   2.218   2.526   7.291 1.00 . A A . 118 SER O    1 1 
        2  4223 1 1 118 SER OG   O   6.508   2.345   5.741 1.00 . A A . 118 SER OG   1 1 
        2  4224 1 1 119 ALA C    C   0.508   5.100   7.064 1.00 . A A . 119 ALA C    1 1 
        2  4225 1 1 119 ALA CA   C   1.932   5.379   7.565 1.00 . A A . 119 ALA CA   1 1 
        2  4226 1 1 119 ALA CB   C   2.210   6.879   7.464 1.00 . A A . 119 ALA CB   1 1 
        2  4227 1 1 119 ALA H    H   3.619   5.149   6.300 1.00 . A A . 119 ALA H    1 1 
        2  4228 1 1 119 ALA HA   H   2.017   5.084   8.610 1.00 . A A . 119 ALA HA   1 1 
        2  4229 1 1 119 ALA HB1  H   2.125   7.198   6.432 1.00 . A A . 119 ALA HB1  1 1 
        2  4230 1 1 119 ALA HB2  H   3.210   7.091   7.815 1.00 . A A . 119 ALA HB2  1 1 
        2  4231 1 1 119 ALA HB3  H   1.501   7.434   8.068 1.00 . A A . 119 ALA HB3  1 1 
        2  4232 1 1 119 ALA N    N   2.945   4.637   6.791 1.00 . A A . 119 ALA N    1 1 
        2  4233 1 1 119 ALA O    O  -0.443   5.040   7.859 1.00 . A A . 119 ALA O    1 1 
        2  4234 1 1 120 ALA C    C  -1.592   3.470   5.416 1.00 . A A . 120 ALA C    1 1 
        2  4235 1 1 120 ALA CA   C  -0.900   4.789   5.053 1.00 . A A . 120 ALA CA   1 1 
        2  4236 1 1 120 ALA CB   C  -0.737   4.928   3.530 1.00 . A A . 120 ALA CB   1 1 
        2  4237 1 1 120 ALA H    H   1.214   4.818   5.203 1.00 . A A . 120 ALA H    1 1 
        2  4238 1 1 120 ALA HA   H  -1.521   5.609   5.391 1.00 . A A . 120 ALA HA   1 1 
        2  4239 1 1 120 ALA HB1  H  -0.131   4.116   3.148 1.00 . A A . 120 ALA HB1  1 1 
        2  4240 1 1 120 ALA HB2  H  -0.256   5.869   3.295 1.00 . A A . 120 ALA HB2  1 1 
        2  4241 1 1 120 ALA HB3  H  -1.710   4.899   3.053 1.00 . A A . 120 ALA HB3  1 1 
        2  4242 1 1 120 ALA N    N   0.393   4.915   5.733 1.00 . A A . 120 ALA N    1 1 
        2  4243 1 1 120 ALA O    O  -2.811   3.397   5.494 1.00 . A A . 120 ALA O    1 1 
        2  4244 1 1 121 LEU C    C  -1.679   0.562   7.076 1.00 . A A . 121 LEU C    1 1 
        2  4245 1 1 121 LEU CA   C  -1.200   1.062   5.715 1.00 . A A . 121 LEU CA   1 1 
        2  4246 1 1 121 LEU CB   C  -0.040   0.189   5.197 1.00 . A A . 121 LEU CB   1 1 
        2  4247 1 1 121 LEU CD1  C   1.672  -0.287   3.375 1.00 . A A . 121 LEU CD1  1 1 
        2  4248 1 1 121 LEU CD2  C  -0.586   0.696   2.749 1.00 . A A . 121 LEU CD2  1 1 
        2  4249 1 1 121 LEU CG   C   0.526   0.620   3.813 1.00 . A A . 121 LEU CG   1 1 
        2  4250 1 1 121 LEU H    H   0.140   2.663   5.989 1.00 . A A . 121 LEU H    1 1 
        2  4251 1 1 121 LEU HA   H  -2.030   0.970   5.011 1.00 . A A . 121 LEU HA   1 1 
        2  4252 1 1 121 LEU HB2  H   0.769   0.223   5.928 1.00 . A A . 121 LEU HB2  1 1 
        2  4253 1 1 121 LEU HB3  H  -0.387  -0.839   5.121 1.00 . A A . 121 LEU HB3  1 1 
        2  4254 1 1 121 LEU HD11 H   1.326  -1.311   3.270 1.00 . A A . 121 LEU HD11 1 1 
        2  4255 1 1 121 LEU HD12 H   2.458  -0.248   4.117 1.00 . A A . 121 LEU HD12 1 1 
        2  4256 1 1 121 LEU HD13 H   2.066   0.058   2.432 1.00 . A A . 121 LEU HD13 1 1 
        2  4257 1 1 121 LEU HD21 H  -0.162   0.998   1.799 1.00 . A A . 121 LEU HD21 1 1 
        2  4258 1 1 121 LEU HD22 H  -1.321   1.430   3.052 1.00 . A A . 121 LEU HD22 1 1 
        2  4259 1 1 121 LEU HD23 H  -1.067  -0.268   2.636 1.00 . A A . 121 LEU HD23 1 1 
        2  4260 1 1 121 LEU HG   H   0.941   1.616   3.907 1.00 . A A . 121 LEU HG   1 1 
        2  4261 1 1 121 LEU N    N  -0.777   2.459   5.727 1.00 . A A . 121 LEU N    1 1 
        2  4262 1 1 121 LEU O    O  -1.353   1.114   8.132 1.00 . A A . 121 LEU O    1 1 
        2  4263 1 1 122 ARG C    C  -3.158  -2.702   7.723 1.00 . A A . 122 ARG C    1 1 
        2  4264 1 1 122 ARG CA   C  -3.069  -1.222   8.099 1.00 . A A . 122 ARG CA   1 1 
        2  4265 1 1 122 ARG CB   C  -4.487  -0.648   8.336 1.00 . A A . 122 ARG CB   1 1 
        2  4266 1 1 122 ARG CD   C  -6.813  -0.856   9.382 1.00 . A A . 122 ARG CD   1 1 
        2  4267 1 1 122 ARG CG   C  -5.383  -1.426   9.320 1.00 . A A . 122 ARG CG   1 1 
        2  4268 1 1 122 ARG CZ   C  -8.826  -2.312   9.621 1.00 . A A . 122 ARG CZ   1 1 
        2  4269 1 1 122 ARG H    H  -2.678  -0.819   6.084 1.00 . A A . 122 ARG H    1 1 
        2  4270 1 1 122 ARG HA   H  -2.460  -1.096   8.993 1.00 . A A . 122 ARG HA   1 1 
        2  4271 1 1 122 ARG HB2  H  -4.383   0.367   8.708 1.00 . A A . 122 ARG HB2  1 1 
        2  4272 1 1 122 ARG HB3  H  -5.000  -0.600   7.377 1.00 . A A . 122 ARG HB3  1 1 
        2  4273 1 1 122 ARG HD2  H  -6.794   0.102   9.890 1.00 . A A . 122 ARG HD2  1 1 
        2  4274 1 1 122 ARG HD3  H  -7.184  -0.717   8.370 1.00 . A A . 122 ARG HD3  1 1 
        2  4275 1 1 122 ARG HE   H  -7.420  -2.033  11.011 1.00 . A A . 122 ARG HE   1 1 
        2  4276 1 1 122 ARG HG2  H  -5.438  -2.460   8.994 1.00 . A A . 122 ARG HG2  1 1 
        2  4277 1 1 122 ARG HG3  H  -4.940  -1.392  10.313 1.00 . A A . 122 ARG HG3  1 1 
        2  4278 1 1 122 ARG HH11 H  -8.866  -1.246   7.895 1.00 . A A . 122 ARG HH11 1 1 
        2  4279 1 1 122 ARG HH12 H -10.161  -2.386   8.092 1.00 . A A . 122 ARG HH12 1 1 
        2  4280 1 1 122 ARG HH21 H  -9.101  -3.526  11.200 1.00 . A A . 122 ARG HH21 1 1 
        2  4281 1 1 122 ARG HH22 H -10.265  -3.662   9.924 1.00 . A A . 122 ARG HH22 1 1 
        2  4282 1 1 122 ARG N    N  -2.460  -0.505   6.985 1.00 . A A . 122 ARG N    1 1 
        2  4283 1 1 122 ARG NE   N  -7.709  -1.765  10.113 1.00 . A A . 122 ARG NE   1 1 
        2  4284 1 1 122 ARG NH1  N  -9.322  -1.947   8.443 1.00 . A A . 122 ARG NH1  1 1 
        2  4285 1 1 122 ARG NH2  N  -9.448  -3.229  10.309 1.00 . A A . 122 ARG NH2  1 1 
        2  4286 1 1 122 ARG O    O  -3.724  -3.029   6.676 1.00 . A A . 122 ARG O    1 1 
        2  4287 1 1 123 PHE C    C  -4.120  -5.409   9.004 1.00 . A A . 123 PHE C    1 1 
        2  4288 1 1 123 PHE CA   C  -2.755  -5.039   8.401 1.00 . A A . 123 PHE CA   1 1 
        2  4289 1 1 123 PHE CB   C  -1.581  -5.857   9.057 1.00 . A A . 123 PHE CB   1 1 
        2  4290 1 1 123 PHE CD1  C  -1.488  -5.097  11.500 1.00 . A A . 123 PHE CD1  1 1 
        2  4291 1 1 123 PHE CD2  C  -2.093  -7.373  11.061 1.00 . A A . 123 PHE CD2  1 1 
        2  4292 1 1 123 PHE CE1  C  -1.647  -5.322  12.855 1.00 . A A . 123 PHE CE1  1 1 
        2  4293 1 1 123 PHE CE2  C  -2.241  -7.593  12.417 1.00 . A A . 123 PHE CE2  1 1 
        2  4294 1 1 123 PHE CG   C  -1.709  -6.115  10.571 1.00 . A A . 123 PHE CG   1 1 
        2  4295 1 1 123 PHE CZ   C  -2.022  -6.569  13.311 1.00 . A A . 123 PHE CZ   1 1 
        2  4296 1 1 123 PHE H    H  -2.081  -3.248   9.321 1.00 . A A . 123 PHE H    1 1 
        2  4297 1 1 123 PHE HA   H  -2.774  -5.251   7.326 1.00 . A A . 123 PHE HA   1 1 
        2  4298 1 1 123 PHE HB2  H  -1.505  -6.818   8.556 1.00 . A A . 123 PHE HB2  1 1 
        2  4299 1 1 123 PHE HB3  H  -0.649  -5.323   8.889 1.00 . A A . 123 PHE HB3  1 1 
        2  4300 1 1 123 PHE HD1  H  -1.186  -4.115  11.154 1.00 . A A . 123 PHE HD1  1 1 
        2  4301 1 1 123 PHE HD2  H  -2.272  -8.184  10.365 1.00 . A A . 123 PHE HD2  1 1 
        2  4302 1 1 123 PHE HE1  H  -1.467  -4.520  13.561 1.00 . A A . 123 PHE HE1  1 1 
        2  4303 1 1 123 PHE HE2  H  -2.532  -8.571  12.779 1.00 . A A . 123 PHE HE2  1 1 
        2  4304 1 1 123 PHE HZ   H  -2.143  -6.742  14.374 1.00 . A A . 123 PHE HZ   1 1 
        2  4305 1 1 123 PHE N    N  -2.589  -3.587   8.563 1.00 . A A . 123 PHE N    1 1 
        2  4306 1 1 123 PHE O    O  -4.479  -4.922  10.090 1.00 . A A . 123 PHE O    1 1 
        2  4307 1 1 124 VAL C    C  -6.365  -8.143   8.611 1.00 . A A . 124 VAL C    1 1 
        2  4308 1 1 124 VAL CA   C  -6.248  -6.615   8.729 1.00 . A A . 124 VAL CA   1 1 
        2  4309 1 1 124 VAL CB   C  -7.397  -5.928   7.890 1.00 . A A . 124 VAL CB   1 1 
        2  4310 1 1 124 VAL CG1  C  -8.757  -6.043   8.635 1.00 . A A . 124 VAL CG1  1 1 
        2  4311 1 1 124 VAL CG2  C  -7.063  -4.462   7.525 1.00 . A A . 124 VAL CG2  1 1 
        2  4312 1 1 124 VAL H    H  -4.567  -6.564   7.436 1.00 . A A . 124 VAL H    1 1 
        2  4313 1 1 124 VAL HA   H  -6.371  -6.333   9.775 1.00 . A A . 124 VAL HA   1 1 
        2  4314 1 1 124 VAL HB   H  -7.496  -6.476   6.952 1.00 . A A . 124 VAL HB   1 1 
        2  4315 1 1 124 VAL HG11 H  -8.994  -7.091   8.810 1.00 . A A . 124 VAL HG11 1 1 
        2  4316 1 1 124 VAL HG12 H  -9.543  -5.601   8.036 1.00 . A A . 124 VAL HG12 1 1 
        2  4317 1 1 124 VAL HG13 H  -8.701  -5.529   9.586 1.00 . A A . 124 VAL HG13 1 1 
        2  4318 1 1 124 VAL HG21 H  -7.867  -4.030   6.941 1.00 . A A . 124 VAL HG21 1 1 
        2  4319 1 1 124 VAL HG22 H  -6.145  -4.428   6.944 1.00 . A A . 124 VAL HG22 1 1 
        2  4320 1 1 124 VAL HG23 H  -6.928  -3.879   8.427 1.00 . A A . 124 VAL HG23 1 1 
        2  4321 1 1 124 VAL N    N  -4.904  -6.217   8.284 1.00 . A A . 124 VAL N    1 1 
        2  4322 1 1 124 VAL O    O  -6.489  -8.645   7.483 1.00 . A A . 124 VAL O    1 1 
        2  4323 1 1 125 PRO C    C  -7.667 -10.872   9.007 1.00 . A A . 125 PRO C    1 1 
        2  4324 1 1 125 PRO CA   C  -6.416 -10.391   9.769 1.00 . A A . 125 PRO CA   1 1 
        2  4325 1 1 125 PRO CB   C  -6.546 -10.689  11.282 1.00 . A A . 125 PRO CB   1 1 
        2  4326 1 1 125 PRO CD   C  -5.919  -8.388  11.113 1.00 . A A . 125 PRO CD   1 1 
        2  4327 1 1 125 PRO CG   C  -5.695  -9.646  11.928 1.00 . A A . 125 PRO CG   1 1 
        2  4328 1 1 125 PRO HA   H  -5.535 -10.889   9.371 1.00 . A A . 125 PRO HA   1 1 
        2  4329 1 1 125 PRO HB2  H  -7.587 -10.609  11.600 1.00 . A A . 125 PRO HB2  1 1 
        2  4330 1 1 125 PRO HB3  H  -6.185 -11.690  11.497 1.00 . A A . 125 PRO HB3  1 1 
        2  4331 1 1 125 PRO HD2  H  -6.747  -7.811  11.517 1.00 . A A . 125 PRO HD2  1 1 
        2  4332 1 1 125 PRO HD3  H  -5.020  -7.781  11.091 1.00 . A A . 125 PRO HD3  1 1 
        2  4333 1 1 125 PRO HG2  H  -6.004  -9.501  12.961 1.00 . A A . 125 PRO HG2  1 1 
        2  4334 1 1 125 PRO HG3  H  -4.648  -9.941  11.897 1.00 . A A . 125 PRO HG3  1 1 
        2  4335 1 1 125 PRO N    N  -6.250  -8.907   9.750 1.00 . A A . 125 PRO N    1 1 
        2  4336 1 1 125 PRO O    O  -8.673 -10.184   9.023 1.00 . A A . 125 PRO O    1 1 
        2  4337 1 1 126 LYS C    C  -9.967 -12.929   8.459 1.00 . A A . 126 LYS C    1 1 
        2  4338 1 1 126 LYS CA   C  -8.735 -12.610   7.575 1.00 . A A . 126 LYS CA   1 1 
        2  4339 1 1 126 LYS CB   C  -8.278 -13.818   6.696 1.00 . A A . 126 LYS CB   1 1 
        2  4340 1 1 126 LYS CD   C  -8.687 -16.002   8.055 1.00 . A A . 126 LYS CD   1 1 
        2  4341 1 1 126 LYS CE   C  -8.058 -17.299   8.584 1.00 . A A . 126 LYS CE   1 1 
        2  4342 1 1 126 LYS CG   C  -7.649 -15.041   7.427 1.00 . A A . 126 LYS CG   1 1 
        2  4343 1 1 126 LYS H    H  -6.757 -12.555   8.386 1.00 . A A . 126 LYS H    1 1 
        2  4344 1 1 126 LYS HA   H  -9.040 -11.817   6.898 1.00 . A A . 126 LYS HA   1 1 
        2  4345 1 1 126 LYS HB2  H  -9.134 -14.173   6.135 1.00 . A A . 126 LYS HB2  1 1 
        2  4346 1 1 126 LYS HB3  H  -7.545 -13.450   5.983 1.00 . A A . 126 LYS HB3  1 1 
        2  4347 1 1 126 LYS HD2  H  -9.186 -15.496   8.878 1.00 . A A . 126 LYS HD2  1 1 
        2  4348 1 1 126 LYS HD3  H  -9.432 -16.253   7.303 1.00 . A A . 126 LYS HD3  1 1 
        2  4349 1 1 126 LYS HE2  H  -8.844 -17.931   8.978 1.00 . A A . 126 LYS HE2  1 1 
        2  4350 1 1 126 LYS HE3  H  -7.571 -17.812   7.763 1.00 . A A . 126 LYS HE3  1 1 
        2  4351 1 1 126 LYS HG2  H  -7.055 -15.602   6.714 1.00 . A A . 126 LYS HG2  1 1 
        2  4352 1 1 126 LYS HG3  H  -6.994 -14.675   8.214 1.00 . A A . 126 LYS HG3  1 1 
        2  4353 1 1 126 LYS HZ1  H  -7.504 -16.494  10.424 1.00 . A A . 126 LYS HZ1  1 1 
        2  4354 1 1 126 LYS HZ2  H  -6.264 -16.502   9.276 1.00 . A A . 126 LYS HZ2  1 1 
        2  4355 1 1 126 LYS HZ3  H  -6.717 -17.936  10.039 1.00 . A A . 126 LYS HZ3  1 1 
        2  4356 1 1 126 LYS N    N  -7.596 -12.056   8.357 1.00 . A A . 126 LYS N    1 1 
        2  4357 1 1 126 LYS NZ   N  -7.068 -17.044   9.654 1.00 . A A . 126 LYS NZ   1 1 
        2  4358 1 1 126 LYS O    O -11.089 -13.057   7.953 1.00 . A A . 126 LYS O    1 1 
        2  4359 1 1 127 HIS C    C -11.435 -11.830  11.129 1.00 . A A . 127 HIS C    1 1 
        2  4360 1 1 127 HIS CA   C -10.784 -13.202  10.795 1.00 . A A . 127 HIS CA   1 1 
        2  4361 1 1 127 HIS CB   C -10.171 -13.870  12.055 1.00 . A A . 127 HIS CB   1 1 
        2  4362 1 1 127 HIS CD2  C -11.650 -13.644  14.185 1.00 . A A . 127 HIS CD2  1 1 
        2  4363 1 1 127 HIS CE1  C -12.628 -15.601  14.094 1.00 . A A . 127 HIS CE1  1 1 
        2  4364 1 1 127 HIS CG   C -11.176 -14.290  13.091 1.00 . A A . 127 HIS CG   1 1 
        2  4365 1 1 127 HIS H    H  -8.800 -12.957  10.086 1.00 . A A . 127 HIS H    1 1 
        2  4366 1 1 127 HIS HA   H -11.549 -13.859  10.382 1.00 . A A . 127 HIS HA   1 1 
        2  4367 1 1 127 HIS HB2  H  -9.626 -14.759  11.755 1.00 . A A . 127 HIS HB2  1 1 
        2  4368 1 1 127 HIS HB3  H  -9.473 -13.183  12.521 1.00 . A A . 127 HIS HB3  1 1 
        2  4369 1 1 127 HIS HD1  H -11.684 -16.210  12.388 1.00 . A A . 127 HIS HD1  1 1 
        2  4370 1 1 127 HIS HD2  H -11.369 -12.652  14.516 1.00 . A A . 127 HIS HD2  1 1 
        2  4371 1 1 127 HIS HE1  H -13.237 -16.456  14.342 1.00 . A A . 127 HIS HE1  1 1 
        2  4372 1 1 127 HIS HE2  H -13.171 -14.226  15.508 1.00 . A A . 127 HIS HE2  1 1 
        2  4373 1 1 127 HIS N    N  -9.729 -13.025   9.780 1.00 . A A . 127 HIS N    1 1 
        2  4374 1 1 127 HIS ND1  N -11.805 -15.515  13.071 1.00 . A A . 127 HIS ND1  1 1 
        2  4375 1 1 127 HIS NE2  N -12.550 -14.482  14.788 1.00 . A A . 127 HIS NE2  1 1 
        2  4376 1 1 127 HIS O    O -12.623 -11.757  11.469 1.00 . A A . 127 HIS O    1 1 
        2  4377 1 1 128 LYS C    C -11.771  -8.794  10.008 1.00 . A A . 128 LYS C    1 1 
        2  4378 1 1 128 LYS CA   C -11.088  -9.367  11.258 1.00 . A A . 128 LYS CA   1 1 
        2  4379 1 1 128 LYS CB   C  -9.865  -8.491  11.642 1.00 . A A . 128 LYS CB   1 1 
        2  4380 1 1 128 LYS CD   C -10.972  -7.009  13.431 1.00 . A A . 128 LYS CD   1 1 
        2  4381 1 1 128 LYS CE   C -11.462  -5.597  13.775 1.00 . A A . 128 LYS CE   1 1 
        2  4382 1 1 128 LYS CG   C -10.215  -7.056  12.081 1.00 . A A . 128 LYS CG   1 1 
        2  4383 1 1 128 LYS H    H  -9.748 -10.876  10.623 1.00 . A A . 128 LYS H    1 1 
        2  4384 1 1 128 LYS HA   H -11.800  -9.383  12.082 1.00 . A A . 128 LYS HA   1 1 
        2  4385 1 1 128 LYS HB2  H  -9.335  -8.974  12.453 1.00 . A A . 128 LYS HB2  1 1 
        2  4386 1 1 128 LYS HB3  H  -9.192  -8.433  10.785 1.00 . A A . 128 LYS HB3  1 1 
        2  4387 1 1 128 LYS HD2  H -11.834  -7.669  13.377 1.00 . A A . 128 LYS HD2  1 1 
        2  4388 1 1 128 LYS HD3  H -10.310  -7.356  14.218 1.00 . A A . 128 LYS HD3  1 1 
        2  4389 1 1 128 LYS HE2  H -11.837  -5.591  14.788 1.00 . A A . 128 LYS HE2  1 1 
        2  4390 1 1 128 LYS HE3  H -10.634  -4.898  13.699 1.00 . A A . 128 LYS HE3  1 1 
        2  4391 1 1 128 LYS HG2  H  -9.297  -6.487  12.177 1.00 . A A . 128 LYS HG2  1 1 
        2  4392 1 1 128 LYS HG3  H -10.833  -6.597  11.310 1.00 . A A . 128 LYS HG3  1 1 
        2  4393 1 1 128 LYS HZ1  H -12.256  -5.252  11.870 1.00 . A A . 128 LYS HZ1  1 1 
        2  4394 1 1 128 LYS HZ2  H -12.783  -4.152  13.047 1.00 . A A . 128 LYS HZ2  1 1 
        2  4395 1 1 128 LYS HZ3  H -13.407  -5.717  13.024 1.00 . A A . 128 LYS HZ3  1 1 
        2  4396 1 1 128 LYS N    N -10.648 -10.749  10.980 1.00 . A A . 128 LYS N    1 1 
        2  4397 1 1 128 LYS NZ   N -12.553  -5.148  12.863 1.00 . A A . 128 LYS NZ   1 1 
        2  4398 1 1 128 LYS O    O -12.689  -7.972  10.105 1.00 . A A . 128 LYS O    1 1 
        2  4399 1 1 129 LEU C    C -13.305  -9.287   7.399 1.00 . A A . 129 LEU C    1 1 
        2  4400 1 1 129 LEU CA   C -11.820  -8.901   7.531 1.00 . A A . 129 LEU CA   1 1 
        2  4401 1 1 129 LEU CB   C -11.008  -9.621   6.422 1.00 . A A . 129 LEU CB   1 1 
        2  4402 1 1 129 LEU CD1  C  -8.859 -10.028   5.069 1.00 . A A . 129 LEU CD1  1 1 
        2  4403 1 1 129 LEU CD2  C  -9.567  -7.685   5.687 1.00 . A A . 129 LEU CD2  1 1 
        2  4404 1 1 129 LEU CG   C  -9.560  -9.140   6.127 1.00 . A A . 129 LEU CG   1 1 
        2  4405 1 1 129 LEU H    H -10.662 -10.008   8.886 1.00 . A A . 129 LEU H    1 1 
        2  4406 1 1 129 LEU HA   H -11.712  -7.822   7.424 1.00 . A A . 129 LEU HA   1 1 
        2  4407 1 1 129 LEU HB2  H -10.962 -10.672   6.683 1.00 . A A . 129 LEU HB2  1 1 
        2  4408 1 1 129 LEU HB3  H -11.571  -9.538   5.499 1.00 . A A . 129 LEU HB3  1 1 
        2  4409 1 1 129 LEU HD11 H  -9.402  -9.994   4.131 1.00 . A A . 129 LEU HD11 1 1 
        2  4410 1 1 129 LEU HD12 H  -8.823 -11.047   5.421 1.00 . A A . 129 LEU HD12 1 1 
        2  4411 1 1 129 LEU HD13 H  -7.847  -9.677   4.911 1.00 . A A . 129 LEU HD13 1 1 
        2  4412 1 1 129 LEU HD21 H -10.114  -7.577   4.758 1.00 . A A . 129 LEU HD21 1 1 
        2  4413 1 1 129 LEU HD22 H  -8.546  -7.349   5.551 1.00 . A A . 129 LEU HD22 1 1 
        2  4414 1 1 129 LEU HD23 H -10.041  -7.087   6.459 1.00 . A A . 129 LEU HD23 1 1 
        2  4415 1 1 129 LEU HG   H  -8.976  -9.202   7.036 1.00 . A A . 129 LEU HG   1 1 
        2  4416 1 1 129 LEU N    N -11.323  -9.293   8.845 1.00 . A A . 129 LEU N    1 1 
        2  4417 1 1 129 LEU O    O -14.123  -8.499   6.949 1.00 . A A . 129 LEU O    1 1 
        2  4418 1 1 130 LYS C    C -15.936 -10.320   8.748 1.00 . A A . 130 LYS C    1 1 
        2  4419 1 1 130 LYS CA   C -14.991 -11.071   7.796 1.00 . A A . 130 LYS CA   1 1 
        2  4420 1 1 130 LYS CB   C -14.928 -12.594   8.156 1.00 . A A . 130 LYS CB   1 1 
        2  4421 1 1 130 LYS CD   C -17.055 -13.768   7.084 1.00 . A A . 130 LYS CD   1 1 
        2  4422 1 1 130 LYS CE   C -17.762 -12.620   6.327 1.00 . A A . 130 LYS CE   1 1 
        2  4423 1 1 130 LYS CG   C -16.291 -13.338   8.379 1.00 . A A . 130 LYS CG   1 1 
        2  4424 1 1 130 LYS H    H -13.009 -10.971   8.426 1.00 . A A . 130 LYS H    1 1 
        2  4425 1 1 130 LYS HA   H -15.349 -10.958   6.779 1.00 . A A . 130 LYS HA   1 1 
        2  4426 1 1 130 LYS HB2  H -14.401 -13.108   7.358 1.00 . A A . 130 LYS HB2  1 1 
        2  4427 1 1 130 LYS HB3  H -14.336 -12.704   9.063 1.00 . A A . 130 LYS HB3  1 1 
        2  4428 1 1 130 LYS HD2  H -16.353 -14.239   6.405 1.00 . A A . 130 LYS HD2  1 1 
        2  4429 1 1 130 LYS HD3  H -17.804 -14.509   7.359 1.00 . A A . 130 LYS HD3  1 1 
        2  4430 1 1 130 LYS HE2  H -18.438 -12.113   7.001 1.00 . A A . 130 LYS HE2  1 1 
        2  4431 1 1 130 LYS HE3  H -17.018 -11.921   5.972 1.00 . A A . 130 LYS HE3  1 1 
        2  4432 1 1 130 LYS HG2  H -16.093 -14.235   8.960 1.00 . A A . 130 LYS HG2  1 1 
        2  4433 1 1 130 LYS HG3  H -16.938 -12.695   8.965 1.00 . A A . 130 LYS HG3  1 1 
        2  4434 1 1 130 LYS HZ1  H -19.047 -12.332   4.708 1.00 . A A . 130 LYS HZ1  1 1 
        2  4435 1 1 130 LYS HZ2  H -19.236 -13.825   5.476 1.00 . A A . 130 LYS HZ2  1 1 
        2  4436 1 1 130 LYS HZ3  H -17.906 -13.558   4.465 1.00 . A A . 130 LYS HZ3  1 1 
        2  4437 1 1 130 LYS N    N -13.641 -10.489   7.884 1.00 . A A . 130 LYS N    1 1 
        2  4438 1 1 130 LYS NZ   N -18.541 -13.117   5.163 1.00 . A A . 130 LYS NZ   1 1 
        2  4439 1 1 130 LYS O    O -17.139 -10.221   8.488 1.00 . A A . 130 LYS O    1 1 
        2  4440 1 1 131 GLU C    C -16.628  -7.675  10.188 1.00 . A A . 131 GLU C    1 1 
        2  4441 1 1 131 GLU CA   C -16.132  -8.988  10.812 1.00 . A A . 131 GLU CA   1 1 
        2  4442 1 1 131 GLU CB   C -15.276  -8.693  12.072 1.00 . A A . 131 GLU CB   1 1 
        2  4443 1 1 131 GLU CD   C -15.162  -7.546  14.366 1.00 . A A . 131 GLU CD   1 1 
        2  4444 1 1 131 GLU CG   C -16.027  -7.886  13.147 1.00 . A A . 131 GLU CG   1 1 
        2  4445 1 1 131 GLU H    H -14.385  -9.670   9.870 1.00 . A A . 131 GLU H    1 1 
        2  4446 1 1 131 GLU HA   H -16.987  -9.601  11.097 1.00 . A A . 131 GLU HA   1 1 
        2  4447 1 1 131 GLU HB2  H -14.959  -9.636  12.510 1.00 . A A . 131 GLU HB2  1 1 
        2  4448 1 1 131 GLU HB3  H -14.391  -8.135  11.777 1.00 . A A . 131 GLU HB3  1 1 
        2  4449 1 1 131 GLU HG2  H -16.391  -6.961  12.702 1.00 . A A . 131 GLU HG2  1 1 
        2  4450 1 1 131 GLU HG3  H -16.881  -8.467  13.477 1.00 . A A . 131 GLU HG3  1 1 
        2  4451 1 1 131 GLU N    N -15.359  -9.718   9.812 1.00 . A A . 131 GLU N    1 1 
        2  4452 1 1 131 GLU O    O -17.817  -7.353  10.271 1.00 . A A . 131 GLU O    1 1 
        2  4453 1 1 131 GLU OE1  O -14.984  -8.421  15.235 1.00 . A A . 131 GLU OE1  1 1 
        2  4454 1 1 131 GLU OE2  O -14.654  -6.408  14.455 1.00 . A A . 131 GLU OE2  1 1 
        2  4455 1 1 132 GLU C    C -16.486  -5.714   7.472 1.00 . A A . 132 GLU C    1 1 
        2  4456 1 1 132 GLU CA   C -15.994  -5.616   8.936 1.00 . A A . 132 GLU CA   1 1 
        2  4457 1 1 132 GLU CB   C -14.731  -4.721   9.073 1.00 . A A . 132 GLU CB   1 1 
        2  4458 1 1 132 GLU CD   C -12.186  -4.590   8.884 1.00 . A A . 132 GLU CD   1 1 
        2  4459 1 1 132 GLU CG   C -13.459  -5.302   8.427 1.00 . A A . 132 GLU CG   1 1 
        2  4460 1 1 132 GLU H    H -14.786  -7.323   9.415 1.00 . A A . 132 GLU H    1 1 
        2  4461 1 1 132 GLU HA   H -16.797  -5.163   9.520 1.00 . A A . 132 GLU HA   1 1 
        2  4462 1 1 132 GLU HB2  H -14.934  -3.751   8.623 1.00 . A A . 132 GLU HB2  1 1 
        2  4463 1 1 132 GLU HB3  H -14.538  -4.569  10.131 1.00 . A A . 132 GLU HB3  1 1 
        2  4464 1 1 132 GLU HG2  H -13.378  -6.355   8.695 1.00 . A A . 132 GLU HG2  1 1 
        2  4465 1 1 132 GLU HG3  H -13.550  -5.226   7.349 1.00 . A A . 132 GLU HG3  1 1 
        2  4466 1 1 132 GLU N    N -15.704  -6.950   9.517 1.00 . A A . 132 GLU N    1 1 
        2  4467 1 1 132 GLU O    O -16.439  -4.721   6.729 1.00 . A A . 132 GLU O    1 1 
        2  4468 1 1 132 GLU OE1  O -11.808  -4.771  10.060 1.00 . A A . 132 GLU OE1  1 1 
        2  4469 1 1 132 GLU OE2  O -11.568  -3.848   8.098 1.00 . A A . 132 GLU OE2  1 1 
        2  4470 1 1 133 GLY C    C -16.714  -6.908   4.584 1.00 . A A . 133 GLY C    1 1 
        2  4471 1 1 133 GLY CA   C -17.641  -7.108   5.775 1.00 . A A . 133 GLY CA   1 1 
        2  4472 1 1 133 GLY H    H -16.993  -7.665   7.698 1.00 . A A . 133 GLY H    1 1 
        2  4473 1 1 133 GLY HA2  H -18.019  -8.120   5.738 1.00 . A A . 133 GLY HA2  1 1 
        2  4474 1 1 133 GLY HA3  H -18.483  -6.426   5.692 1.00 . A A . 133 GLY HA3  1 1 
        2  4475 1 1 133 GLY N    N -17.005  -6.906   7.081 1.00 . A A . 133 GLY N    1 1 
        2  4476 1 1 133 GLY O    O -17.165  -6.497   3.518 1.00 . A A . 133 GLY O    1 1 
        2  4477 1 1 134 TYR C    C -14.378  -8.400   2.835 1.00 . A A . 134 TYR C    1 1 
        2  4478 1 1 134 TYR CA   C -14.404  -7.112   3.692 1.00 . A A . 134 TYR CA   1 1 
        2  4479 1 1 134 TYR CB   C -12.992  -6.822   4.325 1.00 . A A . 134 TYR CB   1 1 
        2  4480 1 1 134 TYR CD1  C -13.605  -4.373   4.838 1.00 . A A . 134 TYR CD1  1 1 
        2  4481 1 1 134 TYR CD2  C -11.303  -4.903   4.515 1.00 . A A . 134 TYR CD2  1 1 
        2  4482 1 1 134 TYR CE1  C -13.265  -3.048   5.037 1.00 . A A . 134 TYR CE1  1 1 
        2  4483 1 1 134 TYR CE2  C -10.961  -3.582   4.708 1.00 . A A . 134 TYR CE2  1 1 
        2  4484 1 1 134 TYR CG   C -12.634  -5.337   4.574 1.00 . A A . 134 TYR CG   1 1 
        2  4485 1 1 134 TYR CZ   C -11.943  -2.658   4.968 1.00 . A A . 134 TYR CZ   1 1 
        2  4486 1 1 134 TYR H    H -15.128  -7.551   5.635 1.00 . A A . 134 TYR H    1 1 
        2  4487 1 1 134 TYR HA   H -14.675  -6.284   3.043 1.00 . A A . 134 TYR HA   1 1 
        2  4488 1 1 134 TYR HB2  H -12.922  -7.330   5.278 1.00 . A A . 134 TYR HB2  1 1 
        2  4489 1 1 134 TYR HB3  H -12.228  -7.229   3.670 1.00 . A A . 134 TYR HB3  1 1 
        2  4490 1 1 134 TYR HD1  H -14.648  -4.677   4.903 1.00 . A A . 134 TYR HD1  1 1 
        2  4491 1 1 134 TYR HD2  H -10.526  -5.628   4.309 1.00 . A A . 134 TYR HD2  1 1 
        2  4492 1 1 134 TYR HE1  H -14.044  -2.323   5.245 1.00 . A A . 134 TYR HE1  1 1 
        2  4493 1 1 134 TYR HE2  H  -9.922  -3.279   4.650 1.00 . A A . 134 TYR HE2  1 1 
        2  4494 1 1 134 TYR HH   H -10.952  -1.078   4.500 1.00 . A A . 134 TYR HH   1 1 
        2  4495 1 1 134 TYR N    N -15.419  -7.223   4.759 1.00 . A A . 134 TYR N    1 1 
        2  4496 1 1 134 TYR O    O -13.336  -8.763   2.328 1.00 . A A . 134 TYR O    1 1 
        2  4497 1 1 134 TYR OH   O -11.605  -1.338   5.162 1.00 . A A . 134 TYR OH   1 1 
        2  4498 1 1 135 GLU C    C -15.010 -10.538   0.653 1.00 . A A . 135 GLU C    1 1 
        2  4499 1 1 135 GLU CA   C -15.727 -10.362   2.012 1.00 . A A . 135 GLU CA   1 1 
        2  4500 1 1 135 GLU CB   C -17.236 -10.647   1.841 1.00 . A A . 135 GLU CB   1 1 
        2  4501 1 1 135 GLU CD   C -19.572 -10.508   2.849 1.00 . A A . 135 GLU CD   1 1 
        2  4502 1 1 135 GLU CG   C -18.068 -10.396   3.109 1.00 . A A . 135 GLU CG   1 1 
        2  4503 1 1 135 GLU H    H -16.370  -8.505   2.831 1.00 . A A . 135 GLU H    1 1 
        2  4504 1 1 135 GLU HA   H -15.316 -11.080   2.722 1.00 . A A . 135 GLU HA   1 1 
        2  4505 1 1 135 GLU HB2  H -17.629 -10.009   1.053 1.00 . A A . 135 GLU HB2  1 1 
        2  4506 1 1 135 GLU HB3  H -17.375 -11.684   1.548 1.00 . A A . 135 GLU HB3  1 1 
        2  4507 1 1 135 GLU HG2  H -17.774 -11.115   3.872 1.00 . A A . 135 GLU HG2  1 1 
        2  4508 1 1 135 GLU HG3  H -17.850  -9.395   3.476 1.00 . A A . 135 GLU HG3  1 1 
        2  4509 1 1 135 GLU N    N -15.558  -9.004   2.604 1.00 . A A . 135 GLU N    1 1 
        2  4510 1 1 135 GLU O    O -14.469 -11.612   0.365 1.00 . A A . 135 GLU O    1 1 
        2  4511 1 1 135 GLU OE1  O -20.124  -9.610   2.182 1.00 . A A . 135 GLU OE1  1 1 
        2  4512 1 1 135 GLU OE2  O -20.199 -11.493   3.288 1.00 . A A . 135 GLU OE2  1 1 
        2  4513 1 1 136 SER C    C -12.871  -9.381  -1.471 1.00 . A A . 136 SER C    1 1 
        2  4514 1 1 136 SER CA   C -14.416  -9.461  -1.514 1.00 . A A . 136 SER CA   1 1 
        2  4515 1 1 136 SER CB   C -15.016  -8.265  -2.295 1.00 . A A . 136 SER CB   1 1 
        2  4516 1 1 136 SER H    H -15.251  -8.590   0.224 1.00 . A A . 136 SER H    1 1 
        2  4517 1 1 136 SER HA   H -14.712 -10.391  -2.001 1.00 . A A . 136 SER HA   1 1 
        2  4518 1 1 136 SER HB2  H -16.096  -8.353  -2.313 1.00 . A A . 136 SER HB2  1 1 
        2  4519 1 1 136 SER HB3  H -14.745  -7.338  -1.804 1.00 . A A . 136 SER HB3  1 1 
        2  4520 1 1 136 SER HG   H -14.049  -7.417  -3.762 1.00 . A A . 136 SER HG   1 1 
        2  4521 1 1 136 SER N    N -14.967  -9.454  -0.141 1.00 . A A . 136 SER N    1 1 
        2  4522 1 1 136 SER O    O -12.182  -9.758  -2.420 1.00 . A A . 136 SER O    1 1 
        2  4523 1 1 136 SER OG   O -14.559  -8.218  -3.631 1.00 . A A . 136 SER OG   1 1 
        2  4524 1 1 137 TYR C    C -10.287 -10.103   0.263 1.00 . A A . 137 TYR C    1 1 
        2  4525 1 1 137 TYR CA   C -10.913  -8.734  -0.091 1.00 . A A . 137 TYR CA   1 1 
        2  4526 1 1 137 TYR CB   C -10.681  -7.727   1.073 1.00 . A A . 137 TYR CB   1 1 
        2  4527 1 1 137 TYR CD1  C -12.659  -6.132   0.658 1.00 . A A . 137 TYR CD1  1 1 
        2  4528 1 1 137 TYR CD2  C -10.528  -5.168   1.105 1.00 . A A . 137 TYR CD2  1 1 
        2  4529 1 1 137 TYR CE1  C -13.218  -4.881   0.574 1.00 . A A . 137 TYR CE1  1 1 
        2  4530 1 1 137 TYR CE2  C -11.091  -3.908   1.030 1.00 . A A . 137 TYR CE2  1 1 
        2  4531 1 1 137 TYR CG   C -11.298  -6.316   0.924 1.00 . A A . 137 TYR CG   1 1 
        2  4532 1 1 137 TYR CZ   C -12.433  -3.772   0.764 1.00 . A A . 137 TYR CZ   1 1 
        2  4533 1 1 137 TYR H    H -12.969  -8.703   0.392 1.00 . A A . 137 TYR H    1 1 
        2  4534 1 1 137 TYR HA   H -10.449  -8.351  -0.998 1.00 . A A . 137 TYR HA   1 1 
        2  4535 1 1 137 TYR HB2  H -11.084  -8.149   1.989 1.00 . A A . 137 TYR HB2  1 1 
        2  4536 1 1 137 TYR HB3  H  -9.615  -7.603   1.203 1.00 . A A . 137 TYR HB3  1 1 
        2  4537 1 1 137 TYR HD1  H -13.286  -7.007   0.509 1.00 . A A . 137 TYR HD1  1 1 
        2  4538 1 1 137 TYR HD2  H  -9.466  -5.267   1.303 1.00 . A A . 137 TYR HD2  1 1 
        2  4539 1 1 137 TYR HE1  H -14.276  -4.778   0.365 1.00 . A A . 137 TYR HE1  1 1 
        2  4540 1 1 137 TYR HE2  H -10.467  -3.034   1.169 1.00 . A A . 137 TYR HE2  1 1 
        2  4541 1 1 137 TYR HH   H -13.792  -2.507   1.258 1.00 . A A . 137 TYR HH   1 1 
        2  4542 1 1 137 TYR N    N -12.353  -8.910  -0.335 1.00 . A A . 137 TYR N    1 1 
        2  4543 1 1 137 TYR O    O  -9.135 -10.380  -0.092 1.00 . A A . 137 TYR O    1 1 
        2  4544 1 1 137 TYR OH   O -12.997  -2.522   0.706 1.00 . A A . 137 TYR OH   1 1 
        2  4545 1 1 138 LEU C    C -10.541 -13.193   0.052 1.00 . A A . 138 LEU C    1 1 
        2  4546 1 1 138 LEU CA   C -10.673 -12.353   1.319 1.00 . A A . 138 LEU CA   1 1 
        2  4547 1 1 138 LEU CB   C -11.692 -13.076   2.268 1.00 . A A . 138 LEU CB   1 1 
        2  4548 1 1 138 LEU CD1  C -12.307 -11.113   3.735 1.00 . A A . 138 LEU CD1  1 1 
        2  4549 1 1 138 LEU CD2  C -12.769 -13.428   4.573 1.00 . A A . 138 LEU CD2  1 1 
        2  4550 1 1 138 LEU CG   C -11.829 -12.550   3.725 1.00 . A A . 138 LEU CG   1 1 
        2  4551 1 1 138 LEU H    H -11.962 -10.649   1.246 1.00 . A A . 138 LEU H    1 1 
        2  4552 1 1 138 LEU HA   H  -9.705 -12.300   1.814 1.00 . A A . 138 LEU HA   1 1 
        2  4553 1 1 138 LEU HB2  H -12.671 -13.025   1.802 1.00 . A A . 138 LEU HB2  1 1 
        2  4554 1 1 138 LEU HB3  H -11.409 -14.125   2.326 1.00 . A A . 138 LEU HB3  1 1 
        2  4555 1 1 138 LEU HD11 H -13.210 -11.011   3.143 1.00 . A A . 138 LEU HD11 1 1 
        2  4556 1 1 138 LEU HD12 H -11.534 -10.473   3.316 1.00 . A A . 138 LEU HD12 1 1 
        2  4557 1 1 138 LEU HD13 H -12.510 -10.794   4.748 1.00 . A A . 138 LEU HD13 1 1 
        2  4558 1 1 138 LEU HD21 H -12.390 -14.442   4.609 1.00 . A A . 138 LEU HD21 1 1 
        2  4559 1 1 138 LEU HD22 H -13.765 -13.432   4.141 1.00 . A A . 138 LEU HD22 1 1 
        2  4560 1 1 138 LEU HD23 H -12.823 -13.033   5.580 1.00 . A A . 138 LEU HD23 1 1 
        2  4561 1 1 138 LEU HG   H -10.854 -12.569   4.195 1.00 . A A . 138 LEU HG   1 1 
        2  4562 1 1 138 LEU N    N -11.079 -10.960   0.963 1.00 . A A . 138 LEU N    1 1 
        2  4563 1 1 138 LEU O    O  -9.753 -14.121   0.021 1.00 . A A . 138 LEU O    1 1 
        2  4564 1 1 139 HIS C    C -10.002 -13.412  -2.996 1.00 . A A . 139 HIS C    1 1 
        2  4565 1 1 139 HIS CA   C -11.374 -13.525  -2.283 1.00 . A A . 139 HIS CA   1 1 
        2  4566 1 1 139 HIS CB   C -12.523 -12.923  -3.147 1.00 . A A . 139 HIS CB   1 1 
        2  4567 1 1 139 HIS CD2  C -12.508 -14.916  -4.847 1.00 . A A . 139 HIS CD2  1 1 
        2  4568 1 1 139 HIS CE1  C -14.237 -14.316  -6.039 1.00 . A A . 139 HIS CE1  1 1 
        2  4569 1 1 139 HIS CG   C -12.970 -13.753  -4.329 1.00 . A A . 139 HIS CG   1 1 
        2  4570 1 1 139 HIS H    H -11.955 -12.084  -0.837 1.00 . A A . 139 HIS H    1 1 
        2  4571 1 1 139 HIS HA   H -11.585 -14.578  -2.100 1.00 . A A . 139 HIS HA   1 1 
        2  4572 1 1 139 HIS HB2  H -13.392 -12.785  -2.518 1.00 . A A . 139 HIS HB2  1 1 
        2  4573 1 1 139 HIS HB3  H -12.218 -11.951  -3.522 1.00 . A A . 139 HIS HB3  1 1 
        2  4574 1 1 139 HIS HD1  H -14.620 -12.619  -4.969 1.00 . A A . 139 HIS HD1  1 1 
        2  4575 1 1 139 HIS HD2  H -11.656 -15.484  -4.487 1.00 . A A . 139 HIS HD2  1 1 
        2  4576 1 1 139 HIS HE1  H -15.018 -14.301  -6.790 1.00 . A A . 139 HIS HE1  1 1 
        2  4577 1 1 139 HIS HE2  H -13.239 -16.055  -6.453 1.00 . A A . 139 HIS HE2  1 1 
        2  4578 1 1 139 HIS N    N -11.344 -12.839  -0.972 1.00 . A A . 139 HIS N    1 1 
        2  4579 1 1 139 HIS ND1  N -14.052 -13.408  -5.105 1.00 . A A . 139 HIS ND1  1 1 
        2  4580 1 1 139 HIS NE2  N -13.310 -15.238  -5.908 1.00 . A A . 139 HIS NE2  1 1 
        2  4581 1 1 139 HIS O    O  -9.605 -14.300  -3.746 1.00 . A A . 139 HIS O    1 1 
        2  4582 1 1 140 LEU C    C  -6.893 -12.903  -2.486 1.00 . A A . 140 LEU C    1 1 
        2  4583 1 1 140 LEU CA   C  -7.933 -12.063  -3.255 1.00 . A A . 140 LEU CA   1 1 
        2  4584 1 1 140 LEU CB   C  -7.621 -10.551  -3.113 1.00 . A A . 140 LEU CB   1 1 
        2  4585 1 1 140 LEU CD1  C  -8.409  -8.130  -3.381 1.00 . A A . 140 LEU CD1  1 1 
        2  4586 1 1 140 LEU CD2  C  -8.642  -9.766  -5.337 1.00 . A A . 140 LEU CD2  1 1 
        2  4587 1 1 140 LEU CG   C  -8.648  -9.593  -3.797 1.00 . A A . 140 LEU CG   1 1 
        2  4588 1 1 140 LEU H    H  -9.688 -11.637  -2.136 1.00 . A A . 140 LEU H    1 1 
        2  4589 1 1 140 LEU HA   H  -7.916 -12.334  -4.307 1.00 . A A . 140 LEU HA   1 1 
        2  4590 1 1 140 LEU HB2  H  -7.589 -10.313  -2.052 1.00 . A A . 140 LEU HB2  1 1 
        2  4591 1 1 140 LEU HB3  H  -6.638 -10.356  -3.533 1.00 . A A . 140 LEU HB3  1 1 
        2  4592 1 1 140 LEU HD11 H  -7.417  -7.812  -3.682 1.00 . A A . 140 LEU HD11 1 1 
        2  4593 1 1 140 LEU HD12 H  -8.498  -8.044  -2.307 1.00 . A A . 140 LEU HD12 1 1 
        2  4594 1 1 140 LEU HD13 H  -9.150  -7.494  -3.846 1.00 . A A . 140 LEU HD13 1 1 
        2  4595 1 1 140 LEU HD21 H  -8.888 -10.790  -5.584 1.00 . A A . 140 LEU HD21 1 1 
        2  4596 1 1 140 LEU HD22 H  -7.666  -9.527  -5.737 1.00 . A A . 140 LEU HD22 1 1 
        2  4597 1 1 140 LEU HD23 H  -9.381  -9.112  -5.781 1.00 . A A . 140 LEU HD23 1 1 
        2  4598 1 1 140 LEU HG   H  -9.643  -9.852  -3.449 1.00 . A A . 140 LEU HG   1 1 
        2  4599 1 1 140 LEU N    N  -9.289 -12.313  -2.725 1.00 . A A . 140 LEU N    1 1 
        2  4600 1 1 140 LEU O    O  -5.987 -13.493  -3.076 1.00 . A A . 140 LEU O    1 1 
        2  4601 1 1 141 PHE C    C  -6.286 -15.170  -0.282 1.00 . A A . 141 PHE C    1 1 
        2  4602 1 1 141 PHE CA   C  -6.152 -13.624  -0.219 1.00 . A A . 141 PHE CA   1 1 
        2  4603 1 1 141 PHE CB   C  -6.471 -13.093   1.207 1.00 . A A . 141 PHE CB   1 1 
        2  4604 1 1 141 PHE CD1  C  -4.304 -13.430   2.503 1.00 . A A . 141 PHE CD1  1 1 
        2  4605 1 1 141 PHE CD2  C  -6.246 -14.612   3.255 1.00 . A A . 141 PHE CD2  1 1 
        2  4606 1 1 141 PHE CE1  C  -3.568 -13.991   3.532 1.00 . A A . 141 PHE CE1  1 1 
        2  4607 1 1 141 PHE CE2  C  -5.505 -15.173   4.281 1.00 . A A . 141 PHE CE2  1 1 
        2  4608 1 1 141 PHE CG   C  -5.658 -13.728   2.345 1.00 . A A . 141 PHE CG   1 1 
        2  4609 1 1 141 PHE CZ   C  -4.168 -14.861   4.416 1.00 . A A . 141 PHE CZ   1 1 
        2  4610 1 1 141 PHE H    H  -7.867 -12.511  -0.785 1.00 . A A . 141 PHE H    1 1 
        2  4611 1 1 141 PHE HA   H  -5.138 -13.343  -0.480 1.00 . A A . 141 PHE HA   1 1 
        2  4612 1 1 141 PHE HB2  H  -6.285 -12.025   1.227 1.00 . A A . 141 PHE HB2  1 1 
        2  4613 1 1 141 PHE HB3  H  -7.527 -13.256   1.408 1.00 . A A . 141 PHE HB3  1 1 
        2  4614 1 1 141 PHE HD1  H  -3.822 -12.748   1.809 1.00 . A A . 141 PHE HD1  1 1 
        2  4615 1 1 141 PHE HD2  H  -7.296 -14.864   3.153 1.00 . A A . 141 PHE HD2  1 1 
        2  4616 1 1 141 PHE HE1  H  -2.521 -13.746   3.638 1.00 . A A . 141 PHE HE1  1 1 
        2  4617 1 1 141 PHE HE2  H  -5.977 -15.855   4.978 1.00 . A A . 141 PHE HE2  1 1 
        2  4618 1 1 141 PHE HZ   H  -3.591 -15.297   5.222 1.00 . A A . 141 PHE HZ   1 1 
        2  4619 1 1 141 PHE N    N  -7.071 -12.953  -1.159 1.00 . A A . 141 PHE N    1 1 
        2  4620 1 1 141 PHE O    O  -5.298 -15.901  -0.128 1.00 . A A . 141 PHE O    1 1 
        2  4621 1 1 142 ASN C    C  -9.290 -17.237  -1.117 1.00 . A A . 142 ASN C    1 1 
        2  4622 1 1 142 ASN CA   C  -7.934 -17.040  -0.383 1.00 . A A . 142 ASN CA   1 1 
        2  4623 1 1 142 ASN CB   C  -8.067 -17.344   1.140 1.00 . A A . 142 ASN CB   1 1 
        2  4624 1 1 142 ASN CG   C  -8.422 -18.791   1.470 1.00 . A A . 142 ASN CG   1 1 
        2  4625 1 1 142 ASN H    H  -8.186 -15.001  -0.859 1.00 . A A . 142 ASN H    1 1 
        2  4626 1 1 142 ASN HA   H  -7.188 -17.687  -0.829 1.00 . A A . 142 ASN HA   1 1 
        2  4627 1 1 142 ASN HB2  H  -7.116 -17.128   1.616 1.00 . A A . 142 ASN HB2  1 1 
        2  4628 1 1 142 ASN HB3  H  -8.819 -16.690   1.569 1.00 . A A . 142 ASN HB3  1 1 
        2  4629 1 1 142 ASN HD21 H  -9.764 -18.186   2.800 1.00 . A A . 142 ASN HD21 1 1 
        2  4630 1 1 142 ASN HD22 H  -9.599 -19.897   2.615 1.00 . A A . 142 ASN HD22 1 1 
        2  4631 1 1 142 ASN N    N  -7.515 -15.634  -0.540 1.00 . A A . 142 ASN N    1 1 
        2  4632 1 1 142 ASN ND2  N  -9.353 -18.980   2.390 1.00 . A A . 142 ASN ND2  1 1 
        2  4633 1 1 142 ASN O    O  -9.832 -16.286  -1.671 1.00 . A A . 142 ASN O    1 1 
        2  4634 1 1 142 ASN OD1  O  -7.911 -19.727   0.852 1.00 . A A . 142 ASN OD1  1 1 
        2  4635 1 1 143 LYS C    C -12.034 -19.129  -0.354 1.00 . A A . 143 LYS C    1 1 
        2  4636 1 1 143 LYS CA   C -11.211 -18.732  -1.594 1.00 . A A . 143 LYS CA   1 1 
        2  4637 1 1 143 LYS CB   C -11.270 -19.799  -2.741 1.00 . A A . 143 LYS CB   1 1 
        2  4638 1 1 143 LYS CD   C -11.458 -22.171  -1.679 1.00 . A A . 143 LYS CD   1 1 
        2  4639 1 1 143 LYS CE   C -10.726 -23.492  -1.414 1.00 . A A . 143 LYS CE   1 1 
        2  4640 1 1 143 LYS CG   C -10.580 -21.163  -2.461 1.00 . A A . 143 LYS CG   1 1 
        2  4641 1 1 143 LYS H    H  -9.256 -19.233  -0.918 1.00 . A A . 143 LYS H    1 1 
        2  4642 1 1 143 LYS HA   H -11.626 -17.797  -1.979 1.00 . A A . 143 LYS HA   1 1 
        2  4643 1 1 143 LYS HB2  H -12.310 -19.987  -2.984 1.00 . A A . 143 LYS HB2  1 1 
        2  4644 1 1 143 LYS HB3  H -10.799 -19.364  -3.622 1.00 . A A . 143 LYS HB3  1 1 
        2  4645 1 1 143 LYS HD2  H -11.740 -21.731  -0.728 1.00 . A A . 143 LYS HD2  1 1 
        2  4646 1 1 143 LYS HD3  H -12.357 -22.375  -2.254 1.00 . A A . 143 LYS HD3  1 1 
        2  4647 1 1 143 LYS HE2  H  -9.845 -23.293  -0.816 1.00 . A A . 143 LYS HE2  1 1 
        2  4648 1 1 143 LYS HE3  H -11.383 -24.155  -0.866 1.00 . A A . 143 LYS HE3  1 1 
        2  4649 1 1 143 LYS HG2  H -10.311 -21.616  -3.409 1.00 . A A . 143 LYS HG2  1 1 
        2  4650 1 1 143 LYS HG3  H  -9.671 -20.979  -1.894 1.00 . A A . 143 LYS HG3  1 1 
        2  4651 1 1 143 LYS HZ1  H  -9.617 -23.583  -3.193 1.00 . A A . 143 LYS HZ1  1 1 
        2  4652 1 1 143 LYS HZ2  H -11.134 -24.331  -3.286 1.00 . A A . 143 LYS HZ2  1 1 
        2  4653 1 1 143 LYS HZ3  H  -9.872 -25.082  -2.462 1.00 . A A . 143 LYS HZ3  1 1 
        2  4654 1 1 143 LYS N    N  -9.814 -18.472  -1.176 1.00 . A A . 143 LYS N    1 1 
        2  4655 1 1 143 LYS NZ   N -10.307 -24.164  -2.675 1.00 . A A . 143 LYS NZ   1 1 
        2  4656 1 1 143 LYS O    O -11.509 -19.778   0.562 1.00 . A A . 143 LYS O    1 1 
        2  4657 1 1 144 LEU C    C -14.976 -20.304   0.556 1.00 . A A . 144 LEU C    1 1 
        2  4658 1 1 144 LEU CA   C -14.216 -18.999   0.802 1.00 . A A . 144 LEU CA   1 1 
        2  4659 1 1 144 LEU CB   C -15.231 -17.837   0.999 1.00 . A A . 144 LEU CB   1 1 
        2  4660 1 1 144 LEU CD1  C -15.329 -17.883   3.545 1.00 . A A . 144 LEU CD1  1 1 
        2  4661 1 1 144 LEU CD2  C -17.285 -16.898   2.238 1.00 . A A . 144 LEU CD2  1 1 
        2  4662 1 1 144 LEU CG   C -16.162 -17.958   2.252 1.00 . A A . 144 LEU CG   1 1 
        2  4663 1 1 144 LEU H    H -13.653 -18.205  -1.084 1.00 . A A . 144 LEU H    1 1 
        2  4664 1 1 144 LEU HA   H -13.618 -19.098   1.705 1.00 . A A . 144 LEU HA   1 1 
        2  4665 1 1 144 LEU HB2  H -14.668 -16.910   1.079 1.00 . A A . 144 LEU HB2  1 1 
        2  4666 1 1 144 LEU HB3  H -15.853 -17.773   0.115 1.00 . A A . 144 LEU HB3  1 1 
        2  4667 1 1 144 LEU HD11 H -14.827 -16.923   3.606 1.00 . A A . 144 LEU HD11 1 1 
        2  4668 1 1 144 LEU HD12 H -14.585 -18.671   3.543 1.00 . A A . 144 LEU HD12 1 1 
        2  4669 1 1 144 LEU HD13 H -15.971 -18.007   4.404 1.00 . A A . 144 LEU HD13 1 1 
        2  4670 1 1 144 LEU HD21 H -17.932 -17.040   3.095 1.00 . A A . 144 LEU HD21 1 1 
        2  4671 1 1 144 LEU HD22 H -17.870 -17.005   1.334 1.00 . A A . 144 LEU HD22 1 1 
        2  4672 1 1 144 LEU HD23 H -16.858 -15.902   2.271 1.00 . A A . 144 LEU HD23 1 1 
        2  4673 1 1 144 LEU HG   H -16.637 -18.934   2.240 1.00 . A A . 144 LEU HG   1 1 
        2  4674 1 1 144 LEU N    N -13.309 -18.717  -0.322 1.00 . A A . 144 LEU N    1 1 
        2  4675 1 1 144 LEU O    O -15.533 -20.501  -0.530 1.00 . A A . 144 LEU O    1 1 
        2  4676 1 1 145 GLU C    C -17.275 -22.084   1.835 1.00 . A A . 145 GLU C    1 1 
        2  4677 1 1 145 GLU CA   C -15.793 -22.418   1.524 1.00 . A A . 145 GLU CA   1 1 
        2  4678 1 1 145 GLU CB   C -15.222 -23.492   2.499 1.00 . A A . 145 GLU CB   1 1 
        2  4679 1 1 145 GLU CD   C -15.393 -25.916   3.371 1.00 . A A . 145 GLU CD   1 1 
        2  4680 1 1 145 GLU CG   C -15.979 -24.835   2.450 1.00 . A A . 145 GLU CG   1 1 
        2  4681 1 1 145 GLU H    H -14.503 -20.978   2.387 1.00 . A A . 145 GLU H    1 1 
        2  4682 1 1 145 GLU HA   H -15.733 -22.808   0.510 1.00 . A A . 145 GLU HA   1 1 
        2  4683 1 1 145 GLU HB2  H -14.177 -23.678   2.256 1.00 . A A . 145 GLU HB2  1 1 
        2  4684 1 1 145 GLU HB3  H -15.276 -23.109   3.512 1.00 . A A . 145 GLU HB3  1 1 
        2  4685 1 1 145 GLU HG2  H -17.007 -24.656   2.748 1.00 . A A . 145 GLU HG2  1 1 
        2  4686 1 1 145 GLU HG3  H -15.974 -25.196   1.424 1.00 . A A . 145 GLU HG3  1 1 
        2  4687 1 1 145 GLU N    N -15.009 -21.183   1.574 1.00 . A A . 145 GLU N    1 1 
        2  4688 1 1 145 GLU O    O -17.720 -22.131   2.993 1.00 . A A . 145 GLU O    1 1 
        2  4689 1 1 145 GLU OE1  O -15.410 -25.729   4.604 1.00 . A A . 145 GLU OE1  1 1 
        2  4690 1 1 145 GLU OE2  O -14.942 -26.976   2.874 1.00 . A A . 145 GLU OE2  1 1 
        2  4691 1 1 146 HIS C    C -20.266 -22.577   0.505 1.00 . A A . 146 HIS C    1 1 
        2  4692 1 1 146 HIS CA   C -19.435 -21.328   0.856 1.00 . A A . 146 HIS CA   1 1 
        2  4693 1 1 146 HIS CB   C -19.745 -20.137  -0.100 1.00 . A A . 146 HIS CB   1 1 
        2  4694 1 1 146 HIS CD2  C -22.193 -20.069  -1.010 1.00 . A A . 146 HIS CD2  1 1 
        2  4695 1 1 146 HIS CE1  C -23.026 -18.642   0.419 1.00 . A A . 146 HIS CE1  1 1 
        2  4696 1 1 146 HIS CG   C -21.199 -19.722  -0.155 1.00 . A A . 146 HIS CG   1 1 
        2  4697 1 1 146 HIS H    H -17.556 -21.605  -0.086 1.00 . A A . 146 HIS H    1 1 
        2  4698 1 1 146 HIS HA   H -19.670 -21.027   1.879 1.00 . A A . 146 HIS HA   1 1 
        2  4699 1 1 146 HIS HB2  H -19.174 -19.274   0.216 1.00 . A A . 146 HIS HB2  1 1 
        2  4700 1 1 146 HIS HB3  H -19.437 -20.402  -1.106 1.00 . A A . 146 HIS HB3  1 1 
        2  4701 1 1 146 HIS HD1  H -21.284 -18.372   1.457 1.00 . A A . 146 HIS HD1  1 1 
        2  4702 1 1 146 HIS HD2  H -22.110 -20.759  -1.841 1.00 . A A . 146 HIS HD2  1 1 
        2  4703 1 1 146 HIS HE1  H -23.707 -17.982   0.936 1.00 . A A . 146 HIS HE1  1 1 
        2  4704 1 1 146 HIS HE2  H -24.230 -19.606  -0.921 1.00 . A A . 146 HIS HE2  1 1 
        2  4705 1 1 146 HIS N    N -18.003 -21.670   0.782 1.00 . A A . 146 HIS N    1 1 
        2  4706 1 1 146 HIS ND1  N -21.757 -18.825   0.722 1.00 . A A . 146 HIS ND1  1 1 
        2  4707 1 1 146 HIS NE2  N -23.316 -19.383  -0.633 1.00 . A A . 146 HIS NE2  1 1 
        2  4708 1 1 146 HIS O    O -20.574 -22.827  -0.666 1.00 . A A . 146 HIS O    1 1 
        2  4709 1 1 147 HIS C    C -22.873 -24.192   1.569 1.00 . A A . 147 HIS C    1 1 
        2  4710 1 1 147 HIS CA   C -21.389 -24.598   1.396 1.00 . A A . 147 HIS CA   1 1 
        2  4711 1 1 147 HIS CB   C -20.956 -25.672   2.441 1.00 . A A . 147 HIS CB   1 1 
        2  4712 1 1 147 HIS CD2  C -22.870 -27.407   2.854 1.00 . A A . 147 HIS CD2  1 1 
        2  4713 1 1 147 HIS CE1  C -22.073 -29.052   1.651 1.00 . A A . 147 HIS CE1  1 1 
        2  4714 1 1 147 HIS CG   C -21.694 -26.987   2.321 1.00 . A A . 147 HIS CG   1 1 
        2  4715 1 1 147 HIS H    H -20.201 -23.169   2.413 1.00 . A A . 147 HIS H    1 1 
        2  4716 1 1 147 HIS HA   H -21.239 -25.014   0.396 1.00 . A A . 147 HIS HA   1 1 
        2  4717 1 1 147 HIS HB2  H -19.898 -25.884   2.318 1.00 . A A . 147 HIS HB2  1 1 
        2  4718 1 1 147 HIS HB3  H -21.121 -25.287   3.439 1.00 . A A . 147 HIS HB3  1 1 
        2  4719 1 1 147 HIS HD1  H -20.387 -28.063   1.069 1.00 . A A . 147 HIS HD1  1 1 
        2  4720 1 1 147 HIS HD2  H -23.521 -26.832   3.503 1.00 . A A . 147 HIS HD2  1 1 
        2  4721 1 1 147 HIS HE1  H -21.961 -30.015   1.164 1.00 . A A . 147 HIS HE1  1 1 
        2  4722 1 1 147 HIS HE2  H -23.927 -29.181   2.499 1.00 . A A . 147 HIS HE2  1 1 
        2  4723 1 1 147 HIS N    N -20.556 -23.391   1.529 1.00 . A A . 147 HIS N    1 1 
        2  4724 1 1 147 HIS ND1  N -21.224 -28.048   1.576 1.00 . A A . 147 HIS ND1  1 1 
        2  4725 1 1 147 HIS NE2  N -23.080 -28.690   2.420 1.00 . A A . 147 HIS NE2  1 1 
        2  4726 1 1 147 HIS O    O -23.642 -24.247   0.592 1.00 . A A . 147 HIS O    1 1 
        3  4727 1 1   1 MET C    C -14.530  14.592  19.292 1.00 . A A .   1 MET C    1 1 
        3  4728 1 1   1 MET CA   C -13.225  15.249  19.772 1.00 . A A .   1 MET CA   1 1 
        3  4729 1 1   1 MET CB   C -13.511  16.397  20.774 1.00 . A A .   1 MET CB   1 1 
        3  4730 1 1   1 MET CE   C -15.773  18.265  22.167 1.00 . A A .   1 MET CE   1 1 
        3  4731 1 1   1 MET CG   C -14.194  15.959  22.078 1.00 . A A .   1 MET CG   1 1 
        3  4732 1 1   1 MET H1   H -12.245  15.003  17.948 1.00 . A A .   1 MET H1   1 1 
        3  4733 1 1   1 MET H2   H -11.616  16.258  18.898 1.00 . A A .   1 MET H2   1 1 
        3  4734 1 1   1 MET H3   H -13.084  16.460  18.091 1.00 . A A .   1 MET H3   1 1 
        3  4735 1 1   1 MET HA   H -12.598  14.502  20.250 1.00 . A A .   1 MET HA   1 1 
        3  4736 1 1   1 MET HB2  H -12.572  16.877  21.028 1.00 . A A .   1 MET HB2  1 1 
        3  4737 1 1   1 MET HB3  H -14.145  17.133  20.289 1.00 . A A .   1 MET HB3  1 1 
        3  4738 1 1   1 MET HE1  H -16.121  19.123  22.720 1.00 . A A .   1 MET HE1  1 1 
        3  4739 1 1   1 MET HE2  H -16.613  17.631  21.921 1.00 . A A .   1 MET HE2  1 1 
        3  4740 1 1   1 MET HE3  H -15.291  18.595  21.257 1.00 . A A .   1 MET HE3  1 1 
        3  4741 1 1   1 MET HG2  H -15.107  15.436  21.836 1.00 . A A .   1 MET HG2  1 1 
        3  4742 1 1   1 MET HG3  H -13.531  15.288  22.613 1.00 . A A .   1 MET HG3  1 1 
        3  4743 1 1   1 MET N    N -12.489  15.778  18.601 1.00 . A A .   1 MET N    1 1 
        3  4744 1 1   1 MET O    O -15.295  15.227  18.552 1.00 . A A .   1 MET O    1 1 
        3  4745 1 1   1 MET SD   S -14.600  17.345  23.170 1.00 . A A .   1 MET SD   1 1 
        3  4746 1 1   2 ALA C    C -15.740  12.207  17.753 1.00 . A A .   2 ALA C    1 1 
        3  4747 1 1   2 ALA CA   C -15.877  12.474  19.266 1.00 . A A .   2 ALA CA   1 1 
        3  4748 1 1   2 ALA CB   C -17.258  13.055  19.648 1.00 . A A .   2 ALA CB   1 1 
        3  4749 1 1   2 ALA H    H -14.142  12.952  20.385 1.00 . A A .   2 ALA H    1 1 
        3  4750 1 1   2 ALA HA   H -15.771  11.520  19.789 1.00 . A A .   2 ALA HA   1 1 
        3  4751 1 1   2 ALA HB1  H -17.402  14.004  19.149 1.00 . A A .   2 ALA HB1  1 1 
        3  4752 1 1   2 ALA HB2  H -17.304  13.207  20.721 1.00 . A A .   2 ALA HB2  1 1 
        3  4753 1 1   2 ALA HB3  H -18.042  12.371  19.353 1.00 . A A .   2 ALA HB3  1 1 
        3  4754 1 1   2 ALA N    N -14.763  13.331  19.726 1.00 . A A .   2 ALA N    1 1 
        3  4755 1 1   2 ALA O    O -16.359  12.883  16.918 1.00 . A A .   2 ALA O    1 1 
        3  4756 1 1   3 TYR C    C -15.471  10.344  15.162 1.00 . A A .   3 TYR C    1 1 
        3  4757 1 1   3 TYR CA   C -14.398  10.978  16.064 1.00 . A A .   3 TYR CA   1 1 
        3  4758 1 1   3 TYR CB   C -13.113  10.104  16.105 1.00 . A A .   3 TYR CB   1 1 
        3  4759 1 1   3 TYR CD1  C -11.551  10.975  17.937 1.00 . A A .   3 TYR CD1  1 1 
        3  4760 1 1   3 TYR CD2  C -10.996  11.477  15.663 1.00 . A A .   3 TYR CD2  1 1 
        3  4761 1 1   3 TYR CE1  C -10.433  11.669  18.359 1.00 . A A .   3 TYR CE1  1 1 
        3  4762 1 1   3 TYR CE2  C  -9.875  12.169  16.083 1.00 . A A .   3 TYR CE2  1 1 
        3  4763 1 1   3 TYR CG   C -11.861  10.861  16.580 1.00 . A A .   3 TYR CG   1 1 
        3  4764 1 1   3 TYR CZ   C  -9.596  12.261  17.431 1.00 . A A .   3 TYR CZ   1 1 
        3  4765 1 1   3 TYR H    H -14.534  10.668  18.152 1.00 . A A .   3 TYR H    1 1 
        3  4766 1 1   3 TYR HA   H -14.130  11.939  15.630 1.00 . A A .   3 TYR HA   1 1 
        3  4767 1 1   3 TYR HB2  H -13.271   9.264  16.773 1.00 . A A .   3 TYR HB2  1 1 
        3  4768 1 1   3 TYR HB3  H -12.909   9.715  15.114 1.00 . A A .   3 TYR HB3  1 1 
        3  4769 1 1   3 TYR HD1  H -12.202  10.510  18.670 1.00 . A A .   3 TYR HD1  1 1 
        3  4770 1 1   3 TYR HD2  H -11.214  11.409  14.604 1.00 . A A .   3 TYR HD2  1 1 
        3  4771 1 1   3 TYR HE1  H -10.216  11.747  19.418 1.00 . A A .   3 TYR HE1  1 1 
        3  4772 1 1   3 TYR HE2  H  -9.220  12.636  15.353 1.00 . A A .   3 TYR HE2  1 1 
        3  4773 1 1   3 TYR HH   H  -7.993  12.418  18.490 1.00 . A A .   3 TYR HH   1 1 
        3  4774 1 1   3 TYR N    N -14.872  11.237  17.431 1.00 . A A .   3 TYR N    1 1 
        3  4775 1 1   3 TYR O    O -15.644   9.122  15.141 1.00 . A A .   3 TYR O    1 1 
        3  4776 1 1   3 TYR OH   O  -8.476  12.953  17.854 1.00 . A A .   3 TYR OH   1 1 
        3  4777 1 1   4 ASN C    C -16.117  10.469  12.105 1.00 . A A .   4 ASN C    1 1 
        3  4778 1 1   4 ASN CA   C -17.042  10.801  13.296 1.00 . A A .   4 ASN CA   1 1 
        3  4779 1 1   4 ASN CB   C -18.018  11.949  12.921 1.00 . A A .   4 ASN CB   1 1 
        3  4780 1 1   4 ASN CG   C -18.927  11.655  11.716 1.00 . A A .   4 ASN CG   1 1 
        3  4781 1 1   4 ASN H    H -16.198  12.157  14.705 1.00 . A A .   4 ASN H    1 1 
        3  4782 1 1   4 ASN HA   H -17.604   9.916  13.575 1.00 . A A .   4 ASN HA   1 1 
        3  4783 1 1   4 ASN HB2  H -18.663  12.144  13.770 1.00 . A A .   4 ASN HB2  1 1 
        3  4784 1 1   4 ASN HB3  H -17.444  12.849  12.716 1.00 . A A .   4 ASN HB3  1 1 
        3  4785 1 1   4 ASN HD21 H -18.745  13.529  11.062 1.00 . A A .   4 ASN HD21 1 1 
        3  4786 1 1   4 ASN HD22 H -19.767  12.497  10.122 1.00 . A A .   4 ASN HD22 1 1 
        3  4787 1 1   4 ASN N    N -16.208  11.207  14.445 1.00 . A A .   4 ASN N    1 1 
        3  4788 1 1   4 ASN ND2  N -19.163  12.657  10.877 1.00 . A A .   4 ASN ND2  1 1 
        3  4789 1 1   4 ASN O    O -14.988  10.949  12.062 1.00 . A A .   4 ASN O    1 1 
        3  4790 1 1   4 ASN OD1  O -19.368  10.521  11.514 1.00 . A A .   4 ASN OD1  1 1 
        3  4791 1 1   5 LYS C    C -15.174  10.411   9.199 1.00 . A A .   5 LYS C    1 1 
        3  4792 1 1   5 LYS CA   C -15.862   9.236   9.946 1.00 . A A .   5 LYS CA   1 1 
        3  4793 1 1   5 LYS CB   C -16.807   8.453   8.996 1.00 . A A .   5 LYS CB   1 1 
        3  4794 1 1   5 LYS CD   C -19.043   8.438   7.694 1.00 . A A .   5 LYS CD   1 1 
        3  4795 1 1   5 LYS CE   C -19.793   7.466   8.621 1.00 . A A .   5 LYS CE   1 1 
        3  4796 1 1   5 LYS CG   C -17.997   9.284   8.455 1.00 . A A .   5 LYS CG   1 1 
        3  4797 1 1   5 LYS H    H -17.569   9.426  11.206 1.00 . A A .   5 LYS H    1 1 
        3  4798 1 1   5 LYS HA   H -15.092   8.556  10.302 1.00 . A A .   5 LYS HA   1 1 
        3  4799 1 1   5 LYS HB2  H -16.230   8.083   8.150 1.00 . A A .   5 LYS HB2  1 1 
        3  4800 1 1   5 LYS HB3  H -17.202   7.597   9.538 1.00 . A A .   5 LYS HB3  1 1 
        3  4801 1 1   5 LYS HD2  H -19.761   9.105   7.231 1.00 . A A .   5 LYS HD2  1 1 
        3  4802 1 1   5 LYS HD3  H -18.537   7.873   6.916 1.00 . A A .   5 LYS HD3  1 1 
        3  4803 1 1   5 LYS HE2  H -20.492   6.886   8.034 1.00 . A A .   5 LYS HE2  1 1 
        3  4804 1 1   5 LYS HE3  H -19.077   6.794   9.080 1.00 . A A .   5 LYS HE3  1 1 
        3  4805 1 1   5 LYS HG2  H -18.490   9.768   9.291 1.00 . A A .   5 LYS HG2  1 1 
        3  4806 1 1   5 LYS HG3  H -17.608  10.052   7.791 1.00 . A A .   5 LYS HG3  1 1 
        3  4807 1 1   5 LYS HZ1  H -19.895   8.675  10.333 1.00 . A A .   5 LYS HZ1  1 1 
        3  4808 1 1   5 LYS HZ2  H -21.096   7.489  10.256 1.00 . A A .   5 LYS HZ2  1 1 
        3  4809 1 1   5 LYS HZ3  H -21.205   8.862   9.281 1.00 . A A .   5 LYS HZ3  1 1 
        3  4810 1 1   5 LYS N    N -16.627   9.690  11.133 1.00 . A A .   5 LYS N    1 1 
        3  4811 1 1   5 LYS NZ   N -20.547   8.173   9.696 1.00 . A A .   5 LYS NZ   1 1 
        3  4812 1 1   5 LYS O    O -14.055  10.267   8.718 1.00 . A A .   5 LYS O    1 1 
        3  4813 1 1   6 GLU C    C -14.099  13.341   9.289 1.00 . A A .   6 GLU C    1 1 
        3  4814 1 1   6 GLU CA   C -15.320  12.795   8.517 1.00 . A A .   6 GLU CA   1 1 
        3  4815 1 1   6 GLU CB   C -16.435  13.869   8.411 1.00 . A A .   6 GLU CB   1 1 
        3  4816 1 1   6 GLU CD   C -17.539  12.904   6.277 1.00 . A A .   6 GLU CD   1 1 
        3  4817 1 1   6 GLU CG   C -17.735  13.388   7.728 1.00 . A A .   6 GLU CG   1 1 
        3  4818 1 1   6 GLU H    H -16.723  11.604   9.600 1.00 . A A .   6 GLU H    1 1 
        3  4819 1 1   6 GLU HA   H -15.003  12.524   7.510 1.00 . A A .   6 GLU HA   1 1 
        3  4820 1 1   6 GLU HB2  H -16.690  14.199   9.412 1.00 . A A .   6 GLU HB2  1 1 
        3  4821 1 1   6 GLU HB3  H -16.053  14.720   7.853 1.00 . A A .   6 GLU HB3  1 1 
        3  4822 1 1   6 GLU HG2  H -18.150  12.570   8.315 1.00 . A A .   6 GLU HG2  1 1 
        3  4823 1 1   6 GLU HG3  H -18.453  14.205   7.734 1.00 . A A .   6 GLU HG3  1 1 
        3  4824 1 1   6 GLU N    N -15.843  11.578   9.168 1.00 . A A .   6 GLU N    1 1 
        3  4825 1 1   6 GLU O    O -13.066  13.656   8.693 1.00 . A A .   6 GLU O    1 1 
        3  4826 1 1   6 GLU OE1  O -17.590  13.742   5.346 1.00 . A A .   6 GLU OE1  1 1 
        3  4827 1 1   6 GLU OE2  O -17.322  11.691   6.054 1.00 . A A .   6 GLU OE2  1 1 
        3  4828 1 1   7 GLU C    C -11.977  12.946  11.548 1.00 . A A .   7 GLU C    1 1 
        3  4829 1 1   7 GLU CA   C -13.180  13.908  11.546 1.00 . A A .   7 GLU CA   1 1 
        3  4830 1 1   7 GLU CB   C -13.748  14.065  12.982 1.00 . A A .   7 GLU CB   1 1 
        3  4831 1 1   7 GLU CD   C -13.358  14.855  15.413 1.00 . A A .   7 GLU CD   1 1 
        3  4832 1 1   7 GLU CG   C -12.743  14.611  14.021 1.00 . A A .   7 GLU CG   1 1 
        3  4833 1 1   7 GLU H    H -15.114  13.196  11.009 1.00 . A A .   7 GLU H    1 1 
        3  4834 1 1   7 GLU HA   H -12.848  14.879  11.189 1.00 . A A .   7 GLU HA   1 1 
        3  4835 1 1   7 GLU HB2  H -14.595  14.743  12.945 1.00 . A A .   7 GLU HB2  1 1 
        3  4836 1 1   7 GLU HB3  H -14.103  13.096  13.324 1.00 . A A .   7 GLU HB3  1 1 
        3  4837 1 1   7 GLU HG2  H -11.928  13.902  14.119 1.00 . A A .   7 GLU HG2  1 1 
        3  4838 1 1   7 GLU HG3  H -12.337  15.551  13.654 1.00 . A A .   7 GLU HG3  1 1 
        3  4839 1 1   7 GLU N    N -14.246  13.436  10.626 1.00 . A A .   7 GLU N    1 1 
        3  4840 1 1   7 GLU O    O -10.819  13.381  11.653 1.00 . A A .   7 GLU O    1 1 
        3  4841 1 1   7 GLU OE1  O -14.110  15.840  15.573 1.00 . A A .   7 GLU OE1  1 1 
        3  4842 1 1   7 GLU OE2  O -13.070  14.089  16.353 1.00 . A A .   7 GLU OE2  1 1 
        3  4843 1 1   8 LYS C    C -10.413  10.741  10.122 1.00 . A A .   8 LYS C    1 1 
        3  4844 1 1   8 LYS CA   C -11.257  10.584  11.377 1.00 . A A .   8 LYS CA   1 1 
        3  4845 1 1   8 LYS CB   C -11.918   9.184  11.402 1.00 . A A .   8 LYS CB   1 1 
        3  4846 1 1   8 LYS CD   C -13.427   7.524  12.645 1.00 . A A .   8 LYS CD   1 1 
        3  4847 1 1   8 LYS CE   C -12.489   6.331  12.402 1.00 . A A .   8 LYS CE   1 1 
        3  4848 1 1   8 LYS CG   C -12.678   8.868  12.700 1.00 . A A .   8 LYS CG   1 1 
        3  4849 1 1   8 LYS H    H -13.205  11.382  11.296 1.00 . A A .   8 LYS H    1 1 
        3  4850 1 1   8 LYS HA   H -10.628  10.695  12.256 1.00 . A A .   8 LYS HA   1 1 
        3  4851 1 1   8 LYS HB2  H -12.620   9.114  10.577 1.00 . A A .   8 LYS HB2  1 1 
        3  4852 1 1   8 LYS HB3  H -11.150   8.425  11.270 1.00 . A A .   8 LYS HB3  1 1 
        3  4853 1 1   8 LYS HD2  H -13.942   7.375  13.588 1.00 . A A .   8 LYS HD2  1 1 
        3  4854 1 1   8 LYS HD3  H -14.161   7.565  11.844 1.00 . A A .   8 LYS HD3  1 1 
        3  4855 1 1   8 LYS HE2  H -11.998   6.452  11.446 1.00 . A A .   8 LYS HE2  1 1 
        3  4856 1 1   8 LYS HE3  H -11.741   6.292  13.188 1.00 . A A .   8 LYS HE3  1 1 
        3  4857 1 1   8 LYS HG2  H -11.975   8.843  13.525 1.00 . A A .   8 LYS HG2  1 1 
        3  4858 1 1   8 LYS HG3  H -13.401   9.659  12.882 1.00 . A A .   8 LYS HG3  1 1 
        3  4859 1 1   8 LYS HZ1  H -13.640   4.858  13.321 1.00 . A A .   8 LYS HZ1  1 1 
        3  4860 1 1   8 LYS HZ2  H -12.589   4.271  12.134 1.00 . A A .   8 LYS HZ2  1 1 
        3  4861 1 1   8 LYS HZ3  H -13.995   5.091  11.685 1.00 . A A .   8 LYS HZ3  1 1 
        3  4862 1 1   8 LYS N    N -12.273  11.641  11.407 1.00 . A A .   8 LYS N    1 1 
        3  4863 1 1   8 LYS NZ   N -13.231   5.048  12.383 1.00 . A A .   8 LYS NZ   1 1 
        3  4864 1 1   8 LYS O    O  -9.220  10.920  10.213 1.00 . A A .   8 LYS O    1 1 
        3  4865 1 1   9 ILE C    C  -9.658  12.228   7.538 1.00 . A A .   9 ILE C    1 1 
        3  4866 1 1   9 ILE CA   C -10.428  10.891   7.649 1.00 . A A .   9 ILE CA   1 1 
        3  4867 1 1   9 ILE CB   C -11.495  10.707   6.489 1.00 . A A .   9 ILE CB   1 1 
        3  4868 1 1   9 ILE CD1  C -10.996   8.163   6.348 1.00 . A A .   9 ILE CD1  1 1 
        3  4869 1 1   9 ILE CG1  C -12.056   9.246   6.491 1.00 . A A .   9 ILE CG1  1 1 
        3  4870 1 1   9 ILE CG2  C -10.943  11.070   5.092 1.00 . A A .   9 ILE CG2  1 1 
        3  4871 1 1   9 ILE H    H -12.051  10.639   8.987 1.00 . A A .   9 ILE H    1 1 
        3  4872 1 1   9 ILE HA   H  -9.704  10.082   7.565 1.00 . A A .   9 ILE HA   1 1 
        3  4873 1 1   9 ILE HB   H -12.313  11.385   6.693 1.00 . A A .   9 ILE HB   1 1 
        3  4874 1 1   9 ILE HD11 H -10.304   8.225   7.180 1.00 . A A .   9 ILE HD11 1 1 
        3  4875 1 1   9 ILE HD12 H -10.458   8.298   5.421 1.00 . A A .   9 ILE HD12 1 1 
        3  4876 1 1   9 ILE HD13 H -11.472   7.196   6.353 1.00 . A A .   9 ILE HD13 1 1 
        3  4877 1 1   9 ILE HG12 H -12.580   9.064   7.422 1.00 . A A .   9 ILE HG12 1 1 
        3  4878 1 1   9 ILE HG13 H -12.757   9.126   5.672 1.00 . A A .   9 ILE HG13 1 1 
        3  4879 1 1   9 ILE HG21 H -11.711  10.928   4.340 1.00 . A A .   9 ILE HG21 1 1 
        3  4880 1 1   9 ILE HG22 H -10.095  10.440   4.859 1.00 . A A .   9 ILE HG22 1 1 
        3  4881 1 1   9 ILE HG23 H -10.625  12.107   5.081 1.00 . A A .   9 ILE HG23 1 1 
        3  4882 1 1   9 ILE N    N -11.078  10.746   8.961 1.00 . A A .   9 ILE N    1 1 
        3  4883 1 1   9 ILE O    O  -8.615  12.283   6.909 1.00 . A A .   9 ILE O    1 1 
        3  4884 1 1  10 LYS C    C  -8.137  14.569   8.960 1.00 . A A .  10 LYS C    1 1 
        3  4885 1 1  10 LYS CA   C  -9.475  14.606   8.186 1.00 . A A .  10 LYS CA   1 1 
        3  4886 1 1  10 LYS CB   C -10.397  15.706   8.779 1.00 . A A .  10 LYS CB   1 1 
        3  4887 1 1  10 LYS CD   C -10.500  18.182   9.520 1.00 . A A .  10 LYS CD   1 1 
        3  4888 1 1  10 LYS CE   C -10.122  17.908  10.985 1.00 . A A .  10 LYS CE   1 1 
        3  4889 1 1  10 LYS CG   C  -9.873  17.148   8.560 1.00 . A A .  10 LYS CG   1 1 
        3  4890 1 1  10 LYS H    H -10.945  13.184   8.748 1.00 . A A .  10 LYS H    1 1 
        3  4891 1 1  10 LYS HA   H  -9.269  14.843   7.145 1.00 . A A .  10 LYS HA   1 1 
        3  4892 1 1  10 LYS HB2  H -11.380  15.626   8.316 1.00 . A A .  10 LYS HB2  1 1 
        3  4893 1 1  10 LYS HB3  H -10.508  15.530   9.843 1.00 . A A .  10 LYS HB3  1 1 
        3  4894 1 1  10 LYS HD2  H -10.144  19.173   9.247 1.00 . A A .  10 LYS HD2  1 1 
        3  4895 1 1  10 LYS HD3  H -11.579  18.153   9.415 1.00 . A A .  10 LYS HD3  1 1 
        3  4896 1 1  10 LYS HE2  H -10.528  18.698  11.605 1.00 . A A .  10 LYS HE2  1 1 
        3  4897 1 1  10 LYS HE3  H -10.554  16.965  11.289 1.00 . A A .  10 LYS HE3  1 1 
        3  4898 1 1  10 LYS HG2  H  -8.796  17.156   8.702 1.00 . A A .  10 LYS HG2  1 1 
        3  4899 1 1  10 LYS HG3  H -10.087  17.443   7.535 1.00 . A A .  10 LYS HG3  1 1 
        3  4900 1 1  10 LYS HZ1  H  -8.438  17.610  12.181 1.00 . A A .  10 LYS HZ1  1 1 
        3  4901 1 1  10 LYS HZ2  H  -8.217  18.769  10.971 1.00 . A A .  10 LYS HZ2  1 1 
        3  4902 1 1  10 LYS HZ3  H  -8.227  17.127  10.578 1.00 . A A .  10 LYS HZ3  1 1 
        3  4903 1 1  10 LYS N    N -10.132  13.280   8.220 1.00 . A A .  10 LYS N    1 1 
        3  4904 1 1  10 LYS NZ   N  -8.649  17.850  11.193 1.00 . A A .  10 LYS NZ   1 1 
        3  4905 1 1  10 LYS O    O  -7.137  15.146   8.521 1.00 . A A .  10 LYS O    1 1 
        3  4906 1 1  11 SER C    C  -5.975  12.725  10.287 1.00 . A A .  11 SER C    1 1 
        3  4907 1 1  11 SER CA   C  -6.952  13.709  10.954 1.00 . A A .  11 SER CA   1 1 
        3  4908 1 1  11 SER CB   C  -7.381  13.201  12.355 1.00 . A A .  11 SER CB   1 1 
        3  4909 1 1  11 SER H    H  -8.983  13.455  10.390 1.00 . A A .  11 SER H    1 1 
        3  4910 1 1  11 SER HA   H  -6.474  14.681  11.059 1.00 . A A .  11 SER HA   1 1 
        3  4911 1 1  11 SER HB2  H  -8.096  13.889  12.788 1.00 . A A .  11 SER HB2  1 1 
        3  4912 1 1  11 SER HB3  H  -7.841  12.226  12.263 1.00 . A A .  11 SER HB3  1 1 
        3  4913 1 1  11 SER HG   H  -5.906  12.210  13.189 1.00 . A A .  11 SER HG   1 1 
        3  4914 1 1  11 SER N    N  -8.144  13.877  10.108 1.00 . A A .  11 SER N    1 1 
        3  4915 1 1  11 SER O    O  -4.827  13.069   9.973 1.00 . A A .  11 SER O    1 1 
        3  4916 1 1  11 SER OG   O  -6.278  13.098  13.239 1.00 . A A .  11 SER OG   1 1 
        3  4917 1 1  12 LEU C    C  -5.095  10.716   8.149 1.00 . A A .  12 LEU C    1 1 
        3  4918 1 1  12 LEU CA   C  -5.787  10.363   9.478 1.00 . A A .  12 LEU CA   1 1 
        3  4919 1 1  12 LEU CB   C  -6.857   9.255   9.251 1.00 . A A .  12 LEU CB   1 1 
        3  4920 1 1  12 LEU CD1  C  -5.478   7.092   9.415 1.00 . A A .  12 LEU CD1  1 1 
        3  4921 1 1  12 LEU CD2  C  -7.623   7.166   7.998 1.00 . A A .  12 LEU CD2  1 1 
        3  4922 1 1  12 LEU CG   C  -6.407   7.955   8.537 1.00 . A A .  12 LEU CG   1 1 
        3  4923 1 1  12 LEU H    H  -7.356  11.295  10.478 1.00 . A A .  12 LEU H    1 1 
        3  4924 1 1  12 LEU HA   H  -5.048   9.994  10.182 1.00 . A A .  12 LEU HA   1 1 
        3  4925 1 1  12 LEU HB2  H  -7.269   8.978  10.219 1.00 . A A .  12 LEU HB2  1 1 
        3  4926 1 1  12 LEU HB3  H  -7.663   9.705   8.668 1.00 . A A .  12 LEU HB3  1 1 
        3  4927 1 1  12 LEU HD11 H  -5.165   6.217   8.858 1.00 . A A .  12 LEU HD11 1 1 
        3  4928 1 1  12 LEU HD12 H  -5.998   6.783  10.311 1.00 . A A .  12 LEU HD12 1 1 
        3  4929 1 1  12 LEU HD13 H  -4.601   7.668   9.688 1.00 . A A .  12 LEU HD13 1 1 
        3  4930 1 1  12 LEU HD21 H  -7.276   6.293   7.458 1.00 . A A .  12 LEU HD21 1 1 
        3  4931 1 1  12 LEU HD22 H  -8.188   7.794   7.321 1.00 . A A .  12 LEU HD22 1 1 
        3  4932 1 1  12 LEU HD23 H  -8.257   6.852   8.815 1.00 . A A .  12 LEU HD23 1 1 
        3  4933 1 1  12 LEU HG   H  -5.821   8.238   7.678 1.00 . A A .  12 LEU HG   1 1 
        3  4934 1 1  12 LEU N    N  -6.478  11.501  10.103 1.00 . A A .  12 LEU N    1 1 
        3  4935 1 1  12 LEU O    O  -3.867  10.612   8.042 1.00 . A A .  12 LEU O    1 1 
        3  4936 1 1  13 ASN C    C  -4.330  12.457   5.719 1.00 . A A .  13 ASN C    1 1 
        3  4937 1 1  13 ASN CA   C  -5.404  11.378   5.776 1.00 . A A .  13 ASN CA   1 1 
        3  4938 1 1  13 ASN CB   C  -6.547  11.717   4.786 1.00 . A A .  13 ASN CB   1 1 
        3  4939 1 1  13 ASN CG   C  -7.516  10.557   4.498 1.00 . A A .  13 ASN CG   1 1 
        3  4940 1 1  13 ASN H    H  -6.827  11.369   7.366 1.00 . A A .  13 ASN H    1 1 
        3  4941 1 1  13 ASN HA   H  -4.956  10.437   5.458 1.00 . A A .  13 ASN HA   1 1 
        3  4942 1 1  13 ASN HB2  H  -7.126  12.535   5.192 1.00 . A A .  13 ASN HB2  1 1 
        3  4943 1 1  13 ASN HB3  H  -6.117  12.034   3.840 1.00 . A A .  13 ASN HB3  1 1 
        3  4944 1 1  13 ASN HD21 H  -7.306   9.775   6.323 1.00 . A A .  13 ASN HD21 1 1 
        3  4945 1 1  13 ASN HD22 H  -8.378   8.939   5.269 1.00 . A A .  13 ASN HD22 1 1 
        3  4946 1 1  13 ASN N    N  -5.892  11.168   7.158 1.00 . A A .  13 ASN N    1 1 
        3  4947 1 1  13 ASN ND2  N  -7.753   9.667   5.464 1.00 . A A .  13 ASN ND2  1 1 
        3  4948 1 1  13 ASN O    O  -3.455  12.362   4.895 1.00 . A A .  13 ASN O    1 1 
        3  4949 1 1  13 ASN OD1  O  -8.064  10.459   3.399 1.00 . A A .  13 ASN OD1  1 1 
        3  4950 1 1  14 ARG C    C  -2.002  14.016   7.003 1.00 . A A .  14 ARG C    1 1 
        3  4951 1 1  14 ARG CA   C  -3.405  14.557   6.666 1.00 . A A .  14 ARG CA   1 1 
        3  4952 1 1  14 ARG CB   C  -3.812  15.618   7.720 1.00 . A A .  14 ARG CB   1 1 
        3  4953 1 1  14 ARG CD   C  -3.159  17.763   8.992 1.00 . A A .  14 ARG CD   1 1 
        3  4954 1 1  14 ARG CG   C  -2.849  16.828   7.811 1.00 . A A .  14 ARG CG   1 1 
        3  4955 1 1  14 ARG CZ   C  -2.357  17.592  11.365 1.00 . A A .  14 ARG CZ   1 1 
        3  4956 1 1  14 ARG H    H  -5.144  13.469   7.252 1.00 . A A .  14 ARG H    1 1 
        3  4957 1 1  14 ARG HA   H  -3.377  15.024   5.686 1.00 . A A .  14 ARG HA   1 1 
        3  4958 1 1  14 ARG HB2  H  -4.807  15.989   7.478 1.00 . A A .  14 ARG HB2  1 1 
        3  4959 1 1  14 ARG HB3  H  -3.857  15.139   8.694 1.00 . A A .  14 ARG HB3  1 1 
        3  4960 1 1  14 ARG HD2  H  -2.488  18.614   8.944 1.00 . A A .  14 ARG HD2  1 1 
        3  4961 1 1  14 ARG HD3  H  -4.177  18.115   8.906 1.00 . A A .  14 ARG HD3  1 1 
        3  4962 1 1  14 ARG HE   H  -3.416  16.198  10.390 1.00 . A A .  14 ARG HE   1 1 
        3  4963 1 1  14 ARG HG2  H  -1.835  16.463   7.925 1.00 . A A .  14 ARG HG2  1 1 
        3  4964 1 1  14 ARG HG3  H  -2.915  17.395   6.887 1.00 . A A .  14 ARG HG3  1 1 
        3  4965 1 1  14 ARG HH11 H  -1.766  19.302  10.444 1.00 . A A .  14 ARG HH11 1 1 
        3  4966 1 1  14 ARG HH12 H  -1.273  19.145  12.100 1.00 . A A .  14 ARG HH12 1 1 
        3  4967 1 1  14 ARG HH21 H  -2.761  16.007  12.552 1.00 . A A .  14 ARG HH21 1 1 
        3  4968 1 1  14 ARG HH22 H  -1.852  17.278  13.300 1.00 . A A .  14 ARG HH22 1 1 
        3  4969 1 1  14 ARG N    N  -4.398  13.462   6.613 1.00 . A A .  14 ARG N    1 1 
        3  4970 1 1  14 ARG NE   N  -3.001  17.085  10.299 1.00 . A A .  14 ARG NE   1 1 
        3  4971 1 1  14 ARG NH1  N  -1.753  18.775  11.297 1.00 . A A .  14 ARG NH1  1 1 
        3  4972 1 1  14 ARG NH2  N  -2.319  16.904  12.495 1.00 . A A .  14 ARG NH2  1 1 
        3  4973 1 1  14 ARG O    O  -1.015  14.308   6.311 1.00 . A A .  14 ARG O    1 1 
        3  4974 1 1  15 MET C    C  -0.020  11.702   7.746 1.00 . A A .  15 MET C    1 1 
        3  4975 1 1  15 MET CA   C  -0.710  12.711   8.670 1.00 . A A .  15 MET CA   1 1 
        3  4976 1 1  15 MET CB   C  -1.009  12.079  10.057 1.00 . A A .  15 MET CB   1 1 
        3  4977 1 1  15 MET CE   C  -0.723  12.462  13.268 1.00 . A A .  15 MET CE   1 1 
        3  4978 1 1  15 MET CG   C   0.224  11.540  10.806 1.00 . A A .  15 MET CG   1 1 
        3  4979 1 1  15 MET H    H  -2.800  12.940   8.480 1.00 . A A .  15 MET H    1 1 
        3  4980 1 1  15 MET HA   H  -0.049  13.565   8.813 1.00 . A A .  15 MET HA   1 1 
        3  4981 1 1  15 MET HB2  H  -1.477  12.830  10.686 1.00 . A A .  15 MET HB2  1 1 
        3  4982 1 1  15 MET HB3  H  -1.708  11.261   9.928 1.00 . A A .  15 MET HB3  1 1 
        3  4983 1 1  15 MET HE1  H   0.081  13.195  13.257 1.00 . A A .  15 MET HE1  1 1 
        3  4984 1 1  15 MET HE2  H  -1.008  12.258  14.294 1.00 . A A .  15 MET HE2  1 1 
        3  4985 1 1  15 MET HE3  H  -1.580  12.861  12.748 1.00 . A A .  15 MET HE3  1 1 
        3  4986 1 1  15 MET HG2  H   0.641  10.711  10.256 1.00 . A A .  15 MET HG2  1 1 
        3  4987 1 1  15 MET HG3  H   0.966  12.329  10.886 1.00 . A A .  15 MET HG3  1 1 
        3  4988 1 1  15 MET N    N  -1.954  13.209   8.074 1.00 . A A .  15 MET N    1 1 
        3  4989 1 1  15 MET O    O   1.192  11.773   7.534 1.00 . A A .  15 MET O    1 1 
        3  4990 1 1  15 MET SD   S  -0.159  10.947  12.457 1.00 . A A .  15 MET SD   1 1 
        3  4991 1 1  16 GLN C    C  -0.012  10.207   4.898 1.00 . A A .  16 GLN C    1 1 
        3  4992 1 1  16 GLN CA   C  -0.278   9.702   6.330 1.00 . A A .  16 GLN CA   1 1 
        3  4993 1 1  16 GLN CB   C  -1.239   8.497   6.335 1.00 . A A .  16 GLN CB   1 1 
        3  4994 1 1  16 GLN CD   C  -3.670   7.715   5.966 1.00 . A A .  16 GLN CD   1 1 
        3  4995 1 1  16 GLN CG   C  -2.587   8.741   5.632 1.00 . A A .  16 GLN CG   1 1 
        3  4996 1 1  16 GLN H    H  -1.774  10.794   7.368 1.00 . A A .  16 GLN H    1 1 
        3  4997 1 1  16 GLN HA   H   0.670   9.382   6.759 1.00 . A A .  16 GLN HA   1 1 
        3  4998 1 1  16 GLN HB2  H  -0.752   7.659   5.846 1.00 . A A .  16 GLN HB2  1 1 
        3  4999 1 1  16 GLN HB3  H  -1.438   8.224   7.368 1.00 . A A .  16 GLN HB3  1 1 
        3  5000 1 1  16 GLN HE21 H  -2.366   6.258   6.289 1.00 . A A .  16 GLN HE21 1 1 
        3  5001 1 1  16 GLN HE22 H  -4.017   5.845   6.487 1.00 . A A .  16 GLN HE22 1 1 
        3  5002 1 1  16 GLN HG2  H  -2.951   9.720   5.923 1.00 . A A .  16 GLN HG2  1 1 
        3  5003 1 1  16 GLN HG3  H  -2.426   8.737   4.559 1.00 . A A .  16 GLN HG3  1 1 
        3  5004 1 1  16 GLN N    N  -0.809  10.773   7.188 1.00 . A A .  16 GLN N    1 1 
        3  5005 1 1  16 GLN NE2  N  -3.314   6.482   6.271 1.00 . A A .  16 GLN NE2  1 1 
        3  5006 1 1  16 GLN O    O   0.857   9.665   4.223 1.00 . A A .  16 GLN O    1 1 
        3  5007 1 1  16 GLN OE1  O  -4.836   8.042   5.942 1.00 . A A .  16 GLN OE1  1 1 
        3  5008 1 1  17 TYR C    C   0.885  12.545   3.238 1.00 . A A .  17 TYR C    1 1 
        3  5009 1 1  17 TYR CA   C  -0.510  11.947   3.170 1.00 . A A .  17 TYR CA   1 1 
        3  5010 1 1  17 TYR CB   C  -1.529  13.073   2.850 1.00 . A A .  17 TYR CB   1 1 
        3  5011 1 1  17 TYR CD1  C  -1.556  13.250   0.297 1.00 . A A .  17 TYR CD1  1 1 
        3  5012 1 1  17 TYR CD2  C  -0.697  15.116   1.524 1.00 . A A .  17 TYR CD2  1 1 
        3  5013 1 1  17 TYR CE1  C  -1.304  13.914  -0.887 1.00 . A A .  17 TYR CE1  1 1 
        3  5014 1 1  17 TYR CE2  C  -0.447  15.781   0.339 1.00 . A A .  17 TYR CE2  1 1 
        3  5015 1 1  17 TYR CG   C  -1.258  13.830   1.533 1.00 . A A .  17 TYR CG   1 1 
        3  5016 1 1  17 TYR CZ   C  -0.751  15.174  -0.863 1.00 . A A .  17 TYR CZ   1 1 
        3  5017 1 1  17 TYR H    H  -1.607  11.399   4.955 1.00 . A A .  17 TYR H    1 1 
        3  5018 1 1  17 TYR HA   H  -0.534  11.213   2.367 1.00 . A A .  17 TYR HA   1 1 
        3  5019 1 1  17 TYR HB2  H  -2.520  12.633   2.781 1.00 . A A .  17 TYR HB2  1 1 
        3  5020 1 1  17 TYR HB3  H  -1.535  13.791   3.664 1.00 . A A .  17 TYR HB3  1 1 
        3  5021 1 1  17 TYR HD1  H  -1.996  12.259   0.272 1.00 . A A .  17 TYR HD1  1 1 
        3  5022 1 1  17 TYR HD2  H  -0.463  15.595   2.468 1.00 . A A .  17 TYR HD2  1 1 
        3  5023 1 1  17 TYR HE1  H  -1.548  13.442  -1.833 1.00 . A A .  17 TYR HE1  1 1 
        3  5024 1 1  17 TYR HE2  H  -0.014  16.774   0.355 1.00 . A A .  17 TYR HE2  1 1 
        3  5025 1 1  17 TYR HH   H   0.406  16.154  -2.056 1.00 . A A .  17 TYR HH   1 1 
        3  5026 1 1  17 TYR N    N  -0.798  11.216   4.442 1.00 . A A .  17 TYR N    1 1 
        3  5027 1 1  17 TYR O    O   1.668  12.384   2.318 1.00 . A A .  17 TYR O    1 1 
        3  5028 1 1  17 TYR OH   O  -0.502  15.837  -2.051 1.00 . A A .  17 TYR OH   1 1 
        3  5029 1 1  18 GLU C    C   3.632  12.774   4.489 1.00 . A A .  18 GLU C    1 1 
        3  5030 1 1  18 GLU CA   C   2.490  13.805   4.653 1.00 . A A .  18 GLU CA   1 1 
        3  5031 1 1  18 GLU CB   C   2.478  14.379   6.089 1.00 . A A .  18 GLU CB   1 1 
        3  5032 1 1  18 GLU CD   C   3.677  15.610   7.973 1.00 . A A .  18 GLU CD   1 1 
        3  5033 1 1  18 GLU CG   C   3.748  15.129   6.515 1.00 . A A .  18 GLU CG   1 1 
        3  5034 1 1  18 GLU H    H   0.492  13.213   5.084 1.00 . A A .  18 GLU H    1 1 
        3  5035 1 1  18 GLU HA   H   2.626  14.615   3.941 1.00 . A A .  18 GLU HA   1 1 
        3  5036 1 1  18 GLU HB2  H   1.640  15.063   6.177 1.00 . A A .  18 GLU HB2  1 1 
        3  5037 1 1  18 GLU HB3  H   2.317  13.557   6.783 1.00 . A A .  18 GLU HB3  1 1 
        3  5038 1 1  18 GLU HG2  H   4.601  14.467   6.403 1.00 . A A .  18 GLU HG2  1 1 
        3  5039 1 1  18 GLU HG3  H   3.884  15.985   5.863 1.00 . A A .  18 GLU HG3  1 1 
        3  5040 1 1  18 GLU N    N   1.180  13.182   4.381 1.00 . A A .  18 GLU N    1 1 
        3  5041 1 1  18 GLU O    O   4.708  13.088   3.975 1.00 . A A .  18 GLU O    1 1 
        3  5042 1 1  18 GLU OE1  O   3.985  14.813   8.883 1.00 . A A .  18 GLU OE1  1 1 
        3  5043 1 1  18 GLU OE2  O   3.291  16.776   8.226 1.00 . A A .  18 GLU OE2  1 1 
        3  5044 1 1  19 VAL C    C   4.487   9.941   3.397 1.00 . A A .  19 VAL C    1 1 
        3  5045 1 1  19 VAL CA   C   4.282  10.415   4.847 1.00 . A A .  19 VAL CA   1 1 
        3  5046 1 1  19 VAL CB   C   3.809   9.233   5.765 1.00 . A A .  19 VAL CB   1 1 
        3  5047 1 1  19 VAL CG1  C   4.760   8.023   5.667 1.00 . A A .  19 VAL CG1  1 1 
        3  5048 1 1  19 VAL CG2  C   3.676   9.708   7.227 1.00 . A A .  19 VAL CG2  1 1 
        3  5049 1 1  19 VAL H    H   2.413  11.360   5.191 1.00 . A A .  19 VAL H    1 1 
        3  5050 1 1  19 VAL HA   H   5.238  10.779   5.235 1.00 . A A .  19 VAL HA   1 1 
        3  5051 1 1  19 VAL HB   H   2.824   8.914   5.425 1.00 . A A .  19 VAL HB   1 1 
        3  5052 1 1  19 VAL HG11 H   5.761   8.314   5.964 1.00 . A A .  19 VAL HG11 1 1 
        3  5053 1 1  19 VAL HG12 H   4.786   7.662   4.639 1.00 . A A .  19 VAL HG12 1 1 
        3  5054 1 1  19 VAL HG13 H   4.411   7.224   6.307 1.00 . A A .  19 VAL HG13 1 1 
        3  5055 1 1  19 VAL HG21 H   3.335   8.891   7.851 1.00 . A A .  19 VAL HG21 1 1 
        3  5056 1 1  19 VAL HG22 H   2.962  10.525   7.285 1.00 . A A .  19 VAL HG22 1 1 
        3  5057 1 1  19 VAL HG23 H   4.639  10.053   7.583 1.00 . A A .  19 VAL HG23 1 1 
        3  5058 1 1  19 VAL N    N   3.332  11.528   4.886 1.00 . A A .  19 VAL N    1 1 
        3  5059 1 1  19 VAL O    O   5.578  10.057   2.874 1.00 . A A .  19 VAL O    1 1 
        3  5060 1 1  20 THR C    C   3.863   9.924   0.319 1.00 . A A .  20 THR C    1 1 
        3  5061 1 1  20 THR CA   C   3.453   8.882   1.392 1.00 . A A .  20 THR CA   1 1 
        3  5062 1 1  20 THR CB   C   2.081   8.217   1.024 1.00 . A A .  20 THR CB   1 1 
        3  5063 1 1  20 THR CG2  C   0.936   9.245   1.002 1.00 . A A .  20 THR CG2  1 1 
        3  5064 1 1  20 THR H    H   2.563   9.442   3.229 1.00 . A A .  20 THR H    1 1 
        3  5065 1 1  20 THR HA   H   4.201   8.093   1.402 1.00 . A A .  20 THR HA   1 1 
        3  5066 1 1  20 THR HB   H   1.852   7.466   1.780 1.00 . A A .  20 THR HB   1 1 
        3  5067 1 1  20 THR HG1  H   1.273   7.370  -0.576 1.00 . A A .  20 THR HG1  1 1 
        3  5068 1 1  20 THR HG21 H   0.872   9.742   1.961 1.00 . A A .  20 THR HG21 1 1 
        3  5069 1 1  20 THR HG22 H  -0.002   8.745   0.797 1.00 . A A .  20 THR HG22 1 1 
        3  5070 1 1  20 THR HG23 H   1.119   9.985   0.230 1.00 . A A .  20 THR HG23 1 1 
        3  5071 1 1  20 THR N    N   3.412   9.449   2.758 1.00 . A A .  20 THR N    1 1 
        3  5072 1 1  20 THR O    O   4.385   9.560  -0.739 1.00 . A A .  20 THR O    1 1 
        3  5073 1 1  20 THR OG1  O   2.162   7.553  -0.251 1.00 . A A .  20 THR OG1  1 1 
        3  5074 1 1  21 GLN C    C   5.507  12.575  -0.309 1.00 . A A .  21 GLN C    1 1 
        3  5075 1 1  21 GLN CA   C   3.990  12.331  -0.307 1.00 . A A .  21 GLN CA   1 1 
        3  5076 1 1  21 GLN CB   C   3.245  13.631   0.103 1.00 . A A .  21 GLN CB   1 1 
        3  5077 1 1  21 GLN CD   C   2.876  14.612  -2.249 1.00 . A A .  21 GLN CD   1 1 
        3  5078 1 1  21 GLN CG   C   3.439  14.836  -0.841 1.00 . A A .  21 GLN CG   1 1 
        3  5079 1 1  21 GLN H    H   3.278  11.443   1.497 1.00 . A A .  21 GLN H    1 1 
        3  5080 1 1  21 GLN HA   H   3.673  12.044  -1.306 1.00 . A A .  21 GLN HA   1 1 
        3  5081 1 1  21 GLN HB2  H   2.183  13.418   0.151 1.00 . A A .  21 GLN HB2  1 1 
        3  5082 1 1  21 GLN HB3  H   3.575  13.921   1.096 1.00 . A A .  21 GLN HB3  1 1 
        3  5083 1 1  21 GLN HE21 H   4.239  15.830  -3.026 1.00 . A A .  21 GLN HE21 1 1 
        3  5084 1 1  21 GLN HE22 H   3.124  15.127  -4.145 1.00 . A A .  21 GLN HE22 1 1 
        3  5085 1 1  21 GLN HG2  H   2.948  15.699  -0.408 1.00 . A A .  21 GLN HG2  1 1 
        3  5086 1 1  21 GLN HG3  H   4.504  15.042  -0.922 1.00 . A A .  21 GLN HG3  1 1 
        3  5087 1 1  21 GLN N    N   3.656  11.223   0.618 1.00 . A A .  21 GLN N    1 1 
        3  5088 1 1  21 GLN NE2  N   3.471  15.257  -3.239 1.00 . A A .  21 GLN NE2  1 1 
        3  5089 1 1  21 GLN O    O   6.113  12.784  -1.365 1.00 . A A .  21 GLN O    1 1 
        3  5090 1 1  21 GLN OE1  O   1.895  13.891  -2.438 1.00 . A A .  21 GLN OE1  1 1 
        3  5091 1 1  22 ASN C    C   8.370  11.542   1.121 1.00 . A A .  22 ASN C    1 1 
        3  5092 1 1  22 ASN CA   C   7.529  12.832   1.102 1.00 . A A .  22 ASN CA   1 1 
        3  5093 1 1  22 ASN CB   C   7.727  13.605   2.440 1.00 . A A .  22 ASN CB   1 1 
        3  5094 1 1  22 ASN CG   C   6.928  14.914   2.542 1.00 . A A .  22 ASN CG   1 1 
        3  5095 1 1  22 ASN H    H   5.565  12.240   1.665 1.00 . A A .  22 ASN H    1 1 
        3  5096 1 1  22 ASN HA   H   7.872  13.454   0.283 1.00 . A A .  22 ASN HA   1 1 
        3  5097 1 1  22 ASN HB2  H   7.425  12.965   3.263 1.00 . A A .  22 ASN HB2  1 1 
        3  5098 1 1  22 ASN HB3  H   8.777  13.846   2.558 1.00 . A A .  22 ASN HB3  1 1 
        3  5099 1 1  22 ASN HD21 H   6.914  14.794   4.532 1.00 . A A .  22 ASN HD21 1 1 
        3  5100 1 1  22 ASN HD22 H   6.102  16.160   3.855 1.00 . A A .  22 ASN HD22 1 1 
        3  5101 1 1  22 ASN N    N   6.099  12.527   0.892 1.00 . A A .  22 ASN N    1 1 
        3  5102 1 1  22 ASN ND2  N   6.617  15.335   3.766 1.00 . A A .  22 ASN ND2  1 1 
        3  5103 1 1  22 ASN O    O   9.603  11.608   1.030 1.00 . A A .  22 ASN O    1 1 
        3  5104 1 1  22 ASN OD1  O   6.605  15.554   1.536 1.00 . A A .  22 ASN OD1  1 1 
        3  5105 1 1  23 ASN C    C   9.002   9.148   2.912 1.00 . A A .  23 ASN C    1 1 
        3  5106 1 1  23 ASN CA   C   8.304   9.071   1.546 1.00 . A A .  23 ASN CA   1 1 
        3  5107 1 1  23 ASN CB   C   9.263   8.579   0.413 1.00 . A A .  23 ASN CB   1 1 
        3  5108 1 1  23 ASN CG   C   8.531   8.182  -0.868 1.00 . A A .  23 ASN CG   1 1 
        3  5109 1 1  23 ASN H    H   6.712  10.405   1.126 1.00 . A A .  23 ASN H    1 1 
        3  5110 1 1  23 ASN HA   H   7.488   8.364   1.639 1.00 . A A .  23 ASN HA   1 1 
        3  5111 1 1  23 ASN HB2  H   9.966   9.373   0.181 1.00 . A A .  23 ASN HB2  1 1 
        3  5112 1 1  23 ASN HB3  H   9.817   7.713   0.761 1.00 . A A .  23 ASN HB3  1 1 
        3  5113 1 1  23 ASN HD21 H  10.110   8.689  -1.968 1.00 . A A .  23 ASN HD21 1 1 
        3  5114 1 1  23 ASN HD22 H   8.746   8.097  -2.844 1.00 . A A .  23 ASN HD22 1 1 
        3  5115 1 1  23 ASN N    N   7.683  10.378   1.235 1.00 . A A .  23 ASN N    1 1 
        3  5116 1 1  23 ASN ND2  N   9.192   8.335  -2.011 1.00 . A A .  23 ASN ND2  1 1 
        3  5117 1 1  23 ASN O    O  10.056   8.551   3.116 1.00 . A A .  23 ASN O    1 1 
        3  5118 1 1  23 ASN OD1  O   7.383   7.728  -0.826 1.00 . A A .  23 ASN OD1  1 1 
        3  5119 1 1  24 GLY C    C   8.600   8.972   6.128 1.00 . A A .  24 GLY C    1 1 
        3  5120 1 1  24 GLY CA   C   8.912  10.112   5.183 1.00 . A A .  24 GLY CA   1 1 
        3  5121 1 1  24 GLY H    H   7.502  10.288   3.621 1.00 . A A .  24 GLY H    1 1 
        3  5122 1 1  24 GLY HA2  H   9.987  10.235   5.119 1.00 . A A .  24 GLY HA2  1 1 
        3  5123 1 1  24 GLY HA3  H   8.484  11.023   5.578 1.00 . A A .  24 GLY HA3  1 1 
        3  5124 1 1  24 GLY N    N   8.373   9.891   3.847 1.00 . A A .  24 GLY N    1 1 
        3  5125 1 1  24 GLY O    O   7.955   7.987   5.748 1.00 . A A .  24 GLY O    1 1 
        3  5126 1 1  25 THR C    C   7.910   8.681   9.483 1.00 . A A .  25 THR C    1 1 
        3  5127 1 1  25 THR CA   C   8.844   8.099   8.415 1.00 . A A .  25 THR CA   1 1 
        3  5128 1 1  25 THR CB   C  10.196   7.634   9.040 1.00 . A A .  25 THR CB   1 1 
        3  5129 1 1  25 THR CG2  C  10.003   6.598  10.164 1.00 . A A .  25 THR CG2  1 1 
        3  5130 1 1  25 THR H    H   9.611   9.889   7.585 1.00 . A A .  25 THR H    1 1 
        3  5131 1 1  25 THR HA   H   8.363   7.225   7.966 1.00 . A A .  25 THR HA   1 1 
        3  5132 1 1  25 THR HB   H  10.714   8.496   9.447 1.00 . A A .  25 THR HB   1 1 
        3  5133 1 1  25 THR HG1  H  10.466   6.512   7.434 1.00 . A A .  25 THR HG1  1 1 
        3  5134 1 1  25 THR HG21 H   9.475   5.736   9.781 1.00 . A A .  25 THR HG21 1 1 
        3  5135 1 1  25 THR HG22 H   9.430   7.034  10.974 1.00 . A A .  25 THR HG22 1 1 
        3  5136 1 1  25 THR HG23 H  10.969   6.283  10.542 1.00 . A A .  25 THR HG23 1 1 
        3  5137 1 1  25 THR N    N   9.084   9.092   7.363 1.00 . A A .  25 THR N    1 1 
        3  5138 1 1  25 THR O    O   8.196   9.735  10.057 1.00 . A A .  25 THR O    1 1 
        3  5139 1 1  25 THR OG1  O  11.013   7.067   8.002 1.00 . A A .  25 THR OG1  1 1 
        3  5140 1 1  26 GLU C    C   6.375   7.920  12.159 1.00 . A A .  26 GLU C    1 1 
        3  5141 1 1  26 GLU CA   C   5.826   8.359  10.780 1.00 . A A .  26 GLU CA   1 1 
        3  5142 1 1  26 GLU CB   C   4.476   7.632  10.508 1.00 . A A .  26 GLU CB   1 1 
        3  5143 1 1  26 GLU CD   C   2.303   6.829  11.697 1.00 . A A .  26 GLU CD   1 1 
        3  5144 1 1  26 GLU CG   C   3.336   7.957  11.509 1.00 . A A .  26 GLU CG   1 1 
        3  5145 1 1  26 GLU H    H   6.597   7.171   9.227 1.00 . A A .  26 GLU H    1 1 
        3  5146 1 1  26 GLU HA   H   5.674   9.432  10.758 1.00 . A A .  26 GLU HA   1 1 
        3  5147 1 1  26 GLU HB2  H   4.137   7.894   9.513 1.00 . A A .  26 GLU HB2  1 1 
        3  5148 1 1  26 GLU HB3  H   4.660   6.559  10.531 1.00 . A A .  26 GLU HB3  1 1 
        3  5149 1 1  26 GLU HG2  H   3.775   8.164  12.476 1.00 . A A .  26 GLU HG2  1 1 
        3  5150 1 1  26 GLU HG3  H   2.823   8.854  11.169 1.00 . A A .  26 GLU HG3  1 1 
        3  5151 1 1  26 GLU N    N   6.789   7.991   9.731 1.00 . A A .  26 GLU N    1 1 
        3  5152 1 1  26 GLU O    O   7.052   6.889  12.231 1.00 . A A .  26 GLU O    1 1 
        3  5153 1 1  26 GLU OE1  O   2.723   5.686  11.992 1.00 . A A .  26 GLU OE1  1 1 
        3  5154 1 1  26 GLU OE2  O   1.078   7.086  11.579 1.00 . A A .  26 GLU OE2  1 1 
        3  5155 1 1  27 PRO C    C   5.531   6.845  14.852 1.00 . A A .  27 PRO C    1 1 
        3  5156 1 1  27 PRO CA   C   6.315   8.176  14.650 1.00 . A A .  27 PRO CA   1 1 
        3  5157 1 1  27 PRO CB   C   5.759   9.312  15.551 1.00 . A A .  27 PRO CB   1 1 
        3  5158 1 1  27 PRO CD   C   5.662  10.109  13.275 1.00 . A A .  27 PRO CD   1 1 
        3  5159 1 1  27 PRO CG   C   5.866  10.551  14.710 1.00 . A A .  27 PRO CG   1 1 
        3  5160 1 1  27 PRO HA   H   7.369   8.015  14.855 1.00 . A A .  27 PRO HA   1 1 
        3  5161 1 1  27 PRO HB2  H   4.724   9.109  15.823 1.00 . A A .  27 PRO HB2  1 1 
        3  5162 1 1  27 PRO HB3  H   6.353   9.394  16.456 1.00 . A A .  27 PRO HB3  1 1 
        3  5163 1 1  27 PRO HD2  H   4.614  10.180  12.993 1.00 . A A .  27 PRO HD2  1 1 
        3  5164 1 1  27 PRO HD3  H   6.268  10.705  12.601 1.00 . A A .  27 PRO HD3  1 1 
        3  5165 1 1  27 PRO HG2  H   5.107  11.268  15.000 1.00 . A A .  27 PRO HG2  1 1 
        3  5166 1 1  27 PRO HG3  H   6.852  10.995  14.828 1.00 . A A .  27 PRO HG3  1 1 
        3  5167 1 1  27 PRO N    N   6.117   8.689  13.273 1.00 . A A .  27 PRO N    1 1 
        3  5168 1 1  27 PRO O    O   4.345   6.814  14.526 1.00 . A A .  27 PRO O    1 1 
        3  5169 1 1  28 PRO C    C   4.136   4.345  15.956 1.00 . A A .  28 PRO C    1 1 
        3  5170 1 1  28 PRO CA   C   5.580   4.375  15.400 1.00 . A A .  28 PRO CA   1 1 
        3  5171 1 1  28 PRO CB   C   6.560   3.573  16.305 1.00 . A A .  28 PRO CB   1 1 
        3  5172 1 1  28 PRO CD   C   7.533   5.747  15.983 1.00 . A A .  28 PRO CD   1 1 
        3  5173 1 1  28 PRO CG   C   7.873   4.275  16.127 1.00 . A A .  28 PRO CG   1 1 
        3  5174 1 1  28 PRO HA   H   5.582   3.940  14.402 1.00 . A A .  28 PRO HA   1 1 
        3  5175 1 1  28 PRO HB2  H   6.230   3.600  17.344 1.00 . A A .  28 PRO HB2  1 1 
        3  5176 1 1  28 PRO HB3  H   6.613   2.541  15.975 1.00 . A A .  28 PRO HB3  1 1 
        3  5177 1 1  28 PRO HD2  H   7.508   6.235  16.952 1.00 . A A .  28 PRO HD2  1 1 
        3  5178 1 1  28 PRO HD3  H   8.248   6.238  15.335 1.00 . A A .  28 PRO HD3  1 1 
        3  5179 1 1  28 PRO HG2  H   8.506   4.108  16.995 1.00 . A A .  28 PRO HG2  1 1 
        3  5180 1 1  28 PRO HG3  H   8.372   3.907  15.233 1.00 . A A .  28 PRO HG3  1 1 
        3  5181 1 1  28 PRO N    N   6.179   5.743  15.370 1.00 . A A .  28 PRO N    1 1 
        3  5182 1 1  28 PRO O    O   3.929   4.568  17.151 1.00 . A A .  28 PRO O    1 1 
        3  5183 1 1  29 PHE C    C   1.053   3.058  14.412 1.00 . A A .  29 PHE C    1 1 
        3  5184 1 1  29 PHE CA   C   1.727   4.020  15.402 1.00 . A A .  29 PHE CA   1 1 
        3  5185 1 1  29 PHE CB   C   1.034   5.411  15.375 1.00 . A A .  29 PHE CB   1 1 
        3  5186 1 1  29 PHE CD1  C  -0.867   5.026  17.022 1.00 . A A .  29 PHE CD1  1 1 
        3  5187 1 1  29 PHE CD2  C  -1.440   5.698  14.796 1.00 . A A .  29 PHE CD2  1 1 
        3  5188 1 1  29 PHE CE1  C  -2.208   4.987  17.354 1.00 . A A .  29 PHE CE1  1 1 
        3  5189 1 1  29 PHE CE2  C  -2.782   5.656  15.131 1.00 . A A .  29 PHE CE2  1 1 
        3  5190 1 1  29 PHE CG   C  -0.454   5.385  15.737 1.00 . A A .  29 PHE CG   1 1 
        3  5191 1 1  29 PHE CZ   C  -3.164   5.301  16.409 1.00 . A A .  29 PHE CZ   1 1 
        3  5192 1 1  29 PHE H    H   3.403   4.107  14.101 1.00 . A A .  29 PHE H    1 1 
        3  5193 1 1  29 PHE HA   H   1.653   3.601  16.408 1.00 . A A .  29 PHE HA   1 1 
        3  5194 1 1  29 PHE HB2  H   1.534   6.065  16.081 1.00 . A A .  29 PHE HB2  1 1 
        3  5195 1 1  29 PHE HB3  H   1.140   5.838  14.382 1.00 . A A .  29 PHE HB3  1 1 
        3  5196 1 1  29 PHE HD1  H  -0.123   4.777  17.773 1.00 . A A .  29 PHE HD1  1 1 
        3  5197 1 1  29 PHE HD2  H  -1.144   5.980  13.790 1.00 . A A .  29 PHE HD2  1 1 
        3  5198 1 1  29 PHE HE1  H  -2.507   4.711  18.355 1.00 . A A .  29 PHE HE1  1 1 
        3  5199 1 1  29 PHE HE2  H  -3.531   5.900  14.389 1.00 . A A .  29 PHE HE2  1 1 
        3  5200 1 1  29 PHE HZ   H  -4.217   5.267  16.671 1.00 . A A .  29 PHE HZ   1 1 
        3  5201 1 1  29 PHE N    N   3.156   4.145  15.054 1.00 . A A .  29 PHE N    1 1 
        3  5202 1 1  29 PHE O    O   0.271   2.185  14.799 1.00 . A A .  29 PHE O    1 1 
        3  5203 1 1  30 GLN C    C   2.195   1.648  11.464 1.00 . A A .  30 GLN C    1 1 
        3  5204 1 1  30 GLN CA   C   0.945   2.377  12.016 1.00 . A A .  30 GLN CA   1 1 
        3  5205 1 1  30 GLN CB   C   0.261   3.224  10.890 1.00 . A A .  30 GLN CB   1 1 
        3  5206 1 1  30 GLN CD   C  -2.118   3.584  11.913 1.00 . A A .  30 GLN CD   1 1 
        3  5207 1 1  30 GLN CG   C  -0.839   4.215  11.342 1.00 . A A .  30 GLN CG   1 1 
        3  5208 1 1  30 GLN H    H   1.893   4.048  12.898 1.00 . A A .  30 GLN H    1 1 
        3  5209 1 1  30 GLN HA   H   0.238   1.636  12.393 1.00 . A A .  30 GLN HA   1 1 
        3  5210 1 1  30 GLN HB2  H   1.025   3.803  10.380 1.00 . A A .  30 GLN HB2  1 1 
        3  5211 1 1  30 GLN HB3  H  -0.183   2.544  10.166 1.00 . A A .  30 GLN HB3  1 1 
        3  5212 1 1  30 GLN HE21 H  -3.192   5.140  11.300 1.00 . A A .  30 GLN HE21 1 1 
        3  5213 1 1  30 GLN HE22 H  -4.073   3.894  12.106 1.00 . A A .  30 GLN HE22 1 1 
        3  5214 1 1  30 GLN HG2  H  -0.423   4.850  12.118 1.00 . A A .  30 GLN HG2  1 1 
        3  5215 1 1  30 GLN HG3  H  -1.106   4.840  10.494 1.00 . A A .  30 GLN HG3  1 1 
        3  5216 1 1  30 GLN N    N   1.363   3.259  13.124 1.00 . A A .  30 GLN N    1 1 
        3  5217 1 1  30 GLN NE2  N  -3.242   4.274  11.754 1.00 . A A .  30 GLN NE2  1 1 
        3  5218 1 1  30 GLN O    O   2.261   1.308  10.283 1.00 . A A .  30 GLN O    1 1 
        3  5219 1 1  30 GLN OE1  O  -2.108   2.503  12.495 1.00 . A A .  30 GLN OE1  1 1 
        3  5220 1 1  31 ASN C    C   4.400  -0.700  11.751 1.00 . A A .  31 ASN C    1 1 
        3  5221 1 1  31 ASN CA   C   4.498   0.836  11.964 1.00 . A A .  31 ASN CA   1 1 
        3  5222 1 1  31 ASN CB   C   5.555   1.227  13.041 1.00 . A A .  31 ASN CB   1 1 
        3  5223 1 1  31 ASN CG   C   7.002   1.042  12.569 1.00 . A A .  31 ASN CG   1 1 
        3  5224 1 1  31 ASN H    H   3.017   1.592  13.292 1.00 . A A .  31 ASN H    1 1 
        3  5225 1 1  31 ASN HA   H   4.789   1.286  11.014 1.00 . A A .  31 ASN HA   1 1 
        3  5226 1 1  31 ASN HB2  H   5.421   2.270  13.309 1.00 . A A .  31 ASN HB2  1 1 
        3  5227 1 1  31 ASN HB3  H   5.402   0.624  13.933 1.00 . A A .  31 ASN HB3  1 1 
        3  5228 1 1  31 ASN HD21 H   7.012   2.846  11.725 1.00 . A A .  31 ASN HD21 1 1 
        3  5229 1 1  31 ASN HD22 H   8.478   1.939  11.593 1.00 . A A .  31 ASN HD22 1 1 
        3  5230 1 1  31 ASN N    N   3.183   1.401  12.349 1.00 . A A .  31 ASN N    1 1 
        3  5231 1 1  31 ASN ND2  N   7.549   2.041  11.892 1.00 . A A .  31 ASN ND2  1 1 
        3  5232 1 1  31 ASN O    O   3.353  -1.300  12.019 1.00 . A A .  31 ASN O    1 1 
        3  5233 1 1  31 ASN OD1  O   7.611  -0.007  12.780 1.00 . A A .  31 ASN OD1  1 1 
        3  5234 1 1  32 GLU C    C   5.183  -3.703  11.955 1.00 . A A .  32 GLU C    1 1 
        3  5235 1 1  32 GLU CA   C   5.549  -2.722  10.823 1.00 . A A .  32 GLU CA   1 1 
        3  5236 1 1  32 GLU CB   C   6.954  -3.120  10.226 1.00 . A A .  32 GLU CB   1 1 
        3  5237 1 1  32 GLU CD   C   6.984  -1.063   8.640 1.00 . A A .  32 GLU CD   1 1 
        3  5238 1 1  32 GLU CG   C   7.788  -2.003   9.546 1.00 . A A .  32 GLU CG   1 1 
        3  5239 1 1  32 GLU H    H   6.321  -0.787  11.196 1.00 . A A .  32 GLU H    1 1 
        3  5240 1 1  32 GLU HA   H   4.802  -2.818  10.035 1.00 . A A .  32 GLU HA   1 1 
        3  5241 1 1  32 GLU HB2  H   7.572  -3.531  11.021 1.00 . A A .  32 GLU HB2  1 1 
        3  5242 1 1  32 GLU HB3  H   6.792  -3.907   9.491 1.00 . A A .  32 GLU HB3  1 1 
        3  5243 1 1  32 GLU HG2  H   8.275  -1.417  10.322 1.00 . A A .  32 GLU HG2  1 1 
        3  5244 1 1  32 GLU HG3  H   8.565  -2.470   8.946 1.00 . A A .  32 GLU HG3  1 1 
        3  5245 1 1  32 GLU N    N   5.506  -1.313  11.273 1.00 . A A .  32 GLU N    1 1 
        3  5246 1 1  32 GLU O    O   4.620  -4.768  11.696 1.00 . A A .  32 GLU O    1 1 
        3  5247 1 1  32 GLU OE1  O   6.482  -1.517   7.602 1.00 . A A .  32 GLU OE1  1 1 
        3  5248 1 1  32 GLU OE2  O   6.831   0.126   8.993 1.00 . A A .  32 GLU OE2  1 1 
        3  5249 1 1  33 TYR C    C   3.721  -4.459  14.531 1.00 . A A .  33 TYR C    1 1 
        3  5250 1 1  33 TYR CA   C   5.222  -4.099  14.424 1.00 . A A .  33 TYR CA   1 1 
        3  5251 1 1  33 TYR CB   C   5.683  -3.312  15.689 1.00 . A A .  33 TYR CB   1 1 
        3  5252 1 1  33 TYR CD1  C   5.629  -5.175  17.445 1.00 . A A .  33 TYR CD1  1 1 
        3  5253 1 1  33 TYR CD2  C   4.326  -3.214  17.877 1.00 . A A .  33 TYR CD2  1 1 
        3  5254 1 1  33 TYR CE1  C   5.186  -5.732  18.633 1.00 . A A .  33 TYR CE1  1 1 
        3  5255 1 1  33 TYR CE2  C   3.890  -3.767  19.069 1.00 . A A .  33 TYR CE2  1 1 
        3  5256 1 1  33 TYR CG   C   5.211  -3.907  17.035 1.00 . A A .  33 TYR CG   1 1 
        3  5257 1 1  33 TYR CZ   C   4.320  -5.026  19.441 1.00 . A A .  33 TYR CZ   1 1 
        3  5258 1 1  33 TYR H    H   5.986  -2.464  13.305 1.00 . A A .  33 TYR H    1 1 
        3  5259 1 1  33 TYR HA   H   5.795  -5.018  14.362 1.00 . A A .  33 TYR HA   1 1 
        3  5260 1 1  33 TYR HB2  H   6.770  -3.288  15.706 1.00 . A A .  33 TYR HB2  1 1 
        3  5261 1 1  33 TYR HB3  H   5.322  -2.293  15.621 1.00 . A A .  33 TYR HB3  1 1 
        3  5262 1 1  33 TYR HD1  H   6.316  -5.733  16.815 1.00 . A A .  33 TYR HD1  1 1 
        3  5263 1 1  33 TYR HD2  H   3.990  -2.223  17.589 1.00 . A A .  33 TYR HD2  1 1 
        3  5264 1 1  33 TYR HE1  H   5.530  -6.715  18.926 1.00 . A A .  33 TYR HE1  1 1 
        3  5265 1 1  33 TYR HE2  H   3.210  -3.213  19.703 1.00 . A A .  33 TYR HE2  1 1 
        3  5266 1 1  33 TYR HH   H   2.911  -5.500  20.670 1.00 . A A .  33 TYR HH   1 1 
        3  5267 1 1  33 TYR N    N   5.517  -3.314  13.203 1.00 . A A .  33 TYR N    1 1 
        3  5268 1 1  33 TYR O    O   3.366  -5.564  14.949 1.00 . A A .  33 TYR O    1 1 
        3  5269 1 1  33 TYR OH   O   3.874  -5.586  20.621 1.00 . A A .  33 TYR OH   1 1 
        3  5270 1 1  34 TRP C    C   0.772  -4.671  13.354 1.00 . A A .  34 TRP C    1 1 
        3  5271 1 1  34 TRP CA   C   1.410  -3.628  14.294 1.00 . A A .  34 TRP CA   1 1 
        3  5272 1 1  34 TRP CB   C   0.762  -2.237  14.105 1.00 . A A .  34 TRP CB   1 1 
        3  5273 1 1  34 TRP CD1  C   2.300  -0.403  15.092 1.00 . A A .  34 TRP CD1  1 1 
        3  5274 1 1  34 TRP CD2  C   0.562  -0.950  16.395 1.00 . A A .  34 TRP CD2  1 1 
        3  5275 1 1  34 TRP CE2  C   1.307   0.054  17.037 1.00 . A A .  34 TRP CE2  1 1 
        3  5276 1 1  34 TRP CE3  C  -0.582  -1.450  17.029 1.00 . A A .  34 TRP CE3  1 1 
        3  5277 1 1  34 TRP CG   C   1.206  -1.224  15.140 1.00 . A A .  34 TRP CG   1 1 
        3  5278 1 1  34 TRP CH2  C  -0.165   0.057  18.883 1.00 . A A .  34 TRP CH2  1 1 
        3  5279 1 1  34 TRP CZ2  C   0.951   0.568  18.281 1.00 . A A .  34 TRP CZ2  1 1 
        3  5280 1 1  34 TRP CZ3  C  -0.932  -0.938  18.266 1.00 . A A .  34 TRP CZ3  1 1 
        3  5281 1 1  34 TRP H    H   3.222  -2.734  13.663 1.00 . A A .  34 TRP H    1 1 
        3  5282 1 1  34 TRP HA   H   1.227  -3.954  15.318 1.00 . A A .  34 TRP HA   1 1 
        3  5283 1 1  34 TRP HB2  H   1.023  -1.850  13.125 1.00 . A A .  34 TRP HB2  1 1 
        3  5284 1 1  34 TRP HB3  H  -0.317  -2.330  14.167 1.00 . A A .  34 TRP HB3  1 1 
        3  5285 1 1  34 TRP HD1  H   2.999  -0.369  14.269 1.00 . A A .  34 TRP HD1  1 1 
        3  5286 1 1  34 TRP HE1  H   3.043   1.046  16.416 1.00 . A A .  34 TRP HE1  1 1 
        3  5287 1 1  34 TRP HE3  H  -1.185  -2.222  16.570 1.00 . A A .  34 TRP HE3  1 1 
        3  5288 1 1  34 TRP HH2  H  -0.475   0.429  19.853 1.00 . A A .  34 TRP HH2  1 1 
        3  5289 1 1  34 TRP HZ2  H   1.534   1.340  18.767 1.00 . A A .  34 TRP HZ2  1 1 
        3  5290 1 1  34 TRP HZ3  H  -1.812  -1.319  18.777 1.00 . A A .  34 TRP HZ3  1 1 
        3  5291 1 1  34 TRP N    N   2.864  -3.522  14.117 1.00 . A A .  34 TRP N    1 1 
        3  5292 1 1  34 TRP NE1  N   2.359   0.375  16.220 1.00 . A A .  34 TRP NE1  1 1 
        3  5293 1 1  34 TRP O    O  -0.379  -5.060  13.574 1.00 . A A .  34 TRP O    1 1 
        3  5294 1 1  35 ASP C    C   2.016  -7.374  11.335 1.00 . A A .  35 ASP C    1 1 
        3  5295 1 1  35 ASP CA   C   1.030  -6.183  11.406 1.00 . A A .  35 ASP CA   1 1 
        3  5296 1 1  35 ASP CB   C   0.727  -5.584  10.002 1.00 . A A .  35 ASP CB   1 1 
        3  5297 1 1  35 ASP CG   C   1.916  -4.923   9.305 1.00 . A A .  35 ASP CG   1 1 
        3  5298 1 1  35 ASP H    H   2.404  -4.743  12.165 1.00 . A A .  35 ASP H    1 1 
        3  5299 1 1  35 ASP HA   H   0.093  -6.568  11.813 1.00 . A A .  35 ASP HA   1 1 
        3  5300 1 1  35 ASP HB2  H   0.340  -6.371   9.363 1.00 . A A .  35 ASP HB2  1 1 
        3  5301 1 1  35 ASP HB3  H  -0.047  -4.830  10.112 1.00 . A A .  35 ASP HB3  1 1 
        3  5302 1 1  35 ASP N    N   1.515  -5.130  12.322 1.00 . A A .  35 ASP N    1 1 
        3  5303 1 1  35 ASP O    O   1.700  -8.429  11.873 1.00 . A A .  35 ASP O    1 1 
        3  5304 1 1  35 ASP OD1  O   2.401  -3.873   9.783 1.00 . A A .  35 ASP OD1  1 1 
        3  5305 1 1  35 ASP OD2  O   2.403  -5.468   8.307 1.00 . A A .  35 ASP OD2  1 1 
        3  5306 1 1  36 HIS C    C   3.955  -9.616  10.469 1.00 . A A .  36 HIS C    1 1 
        3  5307 1 1  36 HIS CA   C   4.321  -8.094  10.443 1.00 . A A .  36 HIS CA   1 1 
        3  5308 1 1  36 HIS CB   C   5.544  -7.805  11.352 1.00 . A A .  36 HIS CB   1 1 
        3  5309 1 1  36 HIS CD2  C   7.713  -8.107   9.977 1.00 . A A .  36 HIS CD2  1 1 
        3  5310 1 1  36 HIS CE1  C   8.420  -9.959  10.887 1.00 . A A .  36 HIS CE1  1 1 
        3  5311 1 1  36 HIS CG   C   6.812  -8.470  10.915 1.00 . A A .  36 HIS CG   1 1 
        3  5312 1 1  36 HIS H    H   3.403  -6.194  10.544 1.00 . A A .  36 HIS H    1 1 
        3  5313 1 1  36 HIS HA   H   4.618  -7.854   9.423 1.00 . A A .  36 HIS HA   1 1 
        3  5314 1 1  36 HIS HB2  H   5.729  -6.737  11.368 1.00 . A A .  36 HIS HB2  1 1 
        3  5315 1 1  36 HIS HB3  H   5.325  -8.133  12.361 1.00 . A A .  36 HIS HB3  1 1 
        3  5316 1 1  36 HIS HD1  H   6.853 -10.154  12.177 1.00 . A A .  36 HIS HD1  1 1 
        3  5317 1 1  36 HIS HD2  H   7.662  -7.232   9.343 1.00 . A A .  36 HIS HD2  1 1 
        3  5318 1 1  36 HIS HE1  H   9.013 -10.841  11.099 1.00 . A A .  36 HIS HE1  1 1 
        3  5319 1 1  36 HIS HE2  H   9.460  -9.075   9.367 1.00 . A A .  36 HIS HE2  1 1 
        3  5320 1 1  36 HIS N    N   3.222  -7.127  10.767 1.00 . A A .  36 HIS N    1 1 
        3  5321 1 1  36 HIS ND1  N   7.286  -9.640  11.465 1.00 . A A .  36 HIS ND1  1 1 
        3  5322 1 1  36 HIS NE2  N   8.699  -9.048   9.983 1.00 . A A .  36 HIS NE2  1 1 
        3  5323 1 1  36 HIS O    O   3.916 -10.274   9.424 1.00 . A A .  36 HIS O    1 1 
        3  5324 1 1  37 LYS C    C   2.093 -12.014  11.326 1.00 . A A .  37 LYS C    1 1 
        3  5325 1 1  37 LYS CA   C   3.430 -11.570  11.946 1.00 . A A .  37 LYS CA   1 1 
        3  5326 1 1  37 LYS CB   C   3.350 -11.801  13.487 1.00 . A A .  37 LYS CB   1 1 
        3  5327 1 1  37 LYS CD   C   2.311 -13.287  15.339 1.00 . A A .  37 LYS CD   1 1 
        3  5328 1 1  37 LYS CE   C   0.946 -12.568  15.392 1.00 . A A .  37 LYS CE   1 1 
        3  5329 1 1  37 LYS CG   C   2.953 -13.243  13.930 1.00 . A A .  37 LYS CG   1 1 
        3  5330 1 1  37 LYS H    H   3.702  -9.528  12.444 1.00 . A A .  37 LYS H    1 1 
        3  5331 1 1  37 LYS HA   H   4.243 -12.162  11.541 1.00 . A A .  37 LYS HA   1 1 
        3  5332 1 1  37 LYS HB2  H   4.321 -11.574  13.923 1.00 . A A .  37 LYS HB2  1 1 
        3  5333 1 1  37 LYS HB3  H   2.626 -11.102  13.894 1.00 . A A .  37 LYS HB3  1 1 
        3  5334 1 1  37 LYS HD2  H   2.165 -14.321  15.626 1.00 . A A .  37 LYS HD2  1 1 
        3  5335 1 1  37 LYS HD3  H   2.985 -12.816  16.047 1.00 . A A .  37 LYS HD3  1 1 
        3  5336 1 1  37 LYS HE2  H   0.570 -12.597  16.405 1.00 . A A .  37 LYS HE2  1 1 
        3  5337 1 1  37 LYS HE3  H   1.077 -11.532  15.097 1.00 . A A .  37 LYS HE3  1 1 
        3  5338 1 1  37 LYS HG2  H   2.243 -13.653  13.219 1.00 . A A .  37 LYS HG2  1 1 
        3  5339 1 1  37 LYS HG3  H   3.844 -13.866  13.931 1.00 . A A .  37 LYS HG3  1 1 
        3  5340 1 1  37 LYS HZ1  H  -0.950 -12.657  14.512 1.00 . A A .  37 LYS HZ1  1 1 
        3  5341 1 1  37 LYS HZ2  H  -0.256 -14.171  14.801 1.00 . A A .  37 LYS HZ2  1 1 
        3  5342 1 1  37 LYS HZ3  H   0.296 -13.224  13.518 1.00 . A A .  37 LYS HZ3  1 1 
        3  5343 1 1  37 LYS N    N   3.712 -10.139  11.686 1.00 . A A .  37 LYS N    1 1 
        3  5344 1 1  37 LYS NZ   N  -0.060 -13.198  14.495 1.00 . A A .  37 LYS NZ   1 1 
        3  5345 1 1  37 LYS O    O   2.021 -13.052  10.670 1.00 . A A .  37 LYS O    1 1 
        3  5346 1 1  38 GLU C    C  -0.687 -11.950   9.931 1.00 . A A .  38 GLU C    1 1 
        3  5347 1 1  38 GLU CA   C  -0.363 -11.550  11.383 1.00 . A A .  38 GLU CA   1 1 
        3  5348 1 1  38 GLU CB   C  -1.252 -10.341  11.804 1.00 . A A .  38 GLU CB   1 1 
        3  5349 1 1  38 GLU CD   C  -2.980 -11.412  13.371 1.00 . A A .  38 GLU CD   1 1 
        3  5350 1 1  38 GLU CG   C  -2.747 -10.658  12.048 1.00 . A A .  38 GLU CG   1 1 
        3  5351 1 1  38 GLU H    H   1.267 -10.315  11.913 1.00 . A A .  38 GLU H    1 1 
        3  5352 1 1  38 GLU HA   H  -0.581 -12.387  12.039 1.00 . A A .  38 GLU HA   1 1 
        3  5353 1 1  38 GLU HB2  H  -0.851  -9.926  12.724 1.00 . A A .  38 GLU HB2  1 1 
        3  5354 1 1  38 GLU HB3  H  -1.189  -9.576  11.036 1.00 . A A .  38 GLU HB3  1 1 
        3  5355 1 1  38 GLU HG2  H  -3.302  -9.724  12.067 1.00 . A A .  38 GLU HG2  1 1 
        3  5356 1 1  38 GLU HG3  H  -3.122 -11.265  11.229 1.00 . A A .  38 GLU HG3  1 1 
        3  5357 1 1  38 GLU N    N   1.061 -11.202  11.578 1.00 . A A .  38 GLU N    1 1 
        3  5358 1 1  38 GLU O    O  -0.071 -11.437   8.988 1.00 . A A .  38 GLU O    1 1 
        3  5359 1 1  38 GLU OE1  O  -2.727 -12.631  13.441 1.00 . A A .  38 GLU OE1  1 1 
        3  5360 1 1  38 GLU OE2  O  -3.377 -10.774  14.363 1.00 . A A .  38 GLU OE2  1 1 
        3  5361 1 1  39 GLU C    C  -3.458 -12.338   8.215 1.00 . A A .  39 GLU C    1 1 
        3  5362 1 1  39 GLU CA   C  -2.216 -13.210   8.454 1.00 . A A .  39 GLU CA   1 1 
        3  5363 1 1  39 GLU CB   C  -2.560 -14.722   8.274 1.00 . A A .  39 GLU CB   1 1 
        3  5364 1 1  39 GLU CD   C  -2.834 -15.760  10.622 1.00 . A A .  39 GLU CD   1 1 
        3  5365 1 1  39 GLU CG   C  -3.526 -15.351   9.311 1.00 . A A .  39 GLU CG   1 1 
        3  5366 1 1  39 GLU H    H  -2.034 -13.300  10.571 1.00 . A A .  39 GLU H    1 1 
        3  5367 1 1  39 GLU HA   H  -1.463 -12.944   7.707 1.00 . A A .  39 GLU HA   1 1 
        3  5368 1 1  39 GLU HB2  H  -3.004 -14.853   7.292 1.00 . A A .  39 GLU HB2  1 1 
        3  5369 1 1  39 GLU HB3  H  -1.628 -15.281   8.294 1.00 . A A .  39 GLU HB3  1 1 
        3  5370 1 1  39 GLU HG2  H  -4.311 -14.632   9.533 1.00 . A A .  39 GLU HG2  1 1 
        3  5371 1 1  39 GLU HG3  H  -3.984 -16.231   8.870 1.00 . A A .  39 GLU HG3  1 1 
        3  5372 1 1  39 GLU N    N  -1.656 -12.876   9.771 1.00 . A A .  39 GLU N    1 1 
        3  5373 1 1  39 GLU O    O  -4.317 -12.181   9.098 1.00 . A A .  39 GLU O    1 1 
        3  5374 1 1  39 GLU OE1  O  -2.182 -16.825  10.648 1.00 . A A .  39 GLU OE1  1 1 
        3  5375 1 1  39 GLU OE2  O  -2.936 -15.030  11.626 1.00 . A A .  39 GLU OE2  1 1 
        3  5376 1 1  40 GLY C    C  -4.044  -9.878   5.592 1.00 . A A .  40 GLY C    1 1 
        3  5377 1 1  40 GLY CA   C  -4.545 -10.815   6.659 1.00 . A A .  40 GLY CA   1 1 
        3  5378 1 1  40 GLY H    H  -2.838 -12.017   6.360 1.00 . A A .  40 GLY H    1 1 
        3  5379 1 1  40 GLY HA2  H  -5.407 -11.352   6.288 1.00 . A A .  40 GLY HA2  1 1 
        3  5380 1 1  40 GLY HA3  H  -4.839 -10.234   7.530 1.00 . A A .  40 GLY HA3  1 1 
        3  5381 1 1  40 GLY N    N  -3.519 -11.766   7.020 1.00 . A A .  40 GLY N    1 1 
        3  5382 1 1  40 GLY O    O  -3.006 -10.139   4.972 1.00 . A A .  40 GLY O    1 1 
        3  5383 1 1  41 LEU C    C  -3.765  -6.546   4.890 1.00 . A A .  41 LEU C    1 1 
        3  5384 1 1  41 LEU CA   C  -4.424  -7.804   4.324 1.00 . A A .  41 LEU CA   1 1 
        3  5385 1 1  41 LEU CB   C  -5.703  -7.451   3.537 1.00 . A A .  41 LEU CB   1 1 
        3  5386 1 1  41 LEU CD1  C  -7.684  -8.305   2.196 1.00 . A A .  41 LEU CD1  1 1 
        3  5387 1 1  41 LEU CD2  C  -5.347  -8.980   1.513 1.00 . A A .  41 LEU CD2  1 1 
        3  5388 1 1  41 LEU CG   C  -6.276  -8.617   2.694 1.00 . A A .  41 LEU CG   1 1 
        3  5389 1 1  41 LEU H    H  -5.508  -8.565   5.975 1.00 . A A .  41 LEU H    1 1 
        3  5390 1 1  41 LEU HA   H  -3.713  -8.268   3.638 1.00 . A A .  41 LEU HA   1 1 
        3  5391 1 1  41 LEU HB2  H  -6.460  -7.125   4.249 1.00 . A A .  41 LEU HB2  1 1 
        3  5392 1 1  41 LEU HB3  H  -5.488  -6.617   2.870 1.00 . A A .  41 LEU HB3  1 1 
        3  5393 1 1  41 LEU HD11 H  -8.299  -7.966   3.021 1.00 . A A .  41 LEU HD11 1 1 
        3  5394 1 1  41 LEU HD12 H  -8.126  -9.217   1.796 1.00 . A A .  41 LEU HD12 1 1 
        3  5395 1 1  41 LEU HD13 H  -7.658  -7.547   1.421 1.00 . A A .  41 LEU HD13 1 1 
        3  5396 1 1  41 LEU HD21 H  -5.254  -8.136   0.841 1.00 . A A .  41 LEU HD21 1 1 
        3  5397 1 1  41 LEU HD22 H  -5.762  -9.823   0.974 1.00 . A A .  41 LEU HD22 1 1 
        3  5398 1 1  41 LEU HD23 H  -4.369  -9.248   1.892 1.00 . A A .  41 LEU HD23 1 1 
        3  5399 1 1  41 LEU HG   H  -6.354  -9.496   3.324 1.00 . A A .  41 LEU HG   1 1 
        3  5400 1 1  41 LEU N    N  -4.751  -8.769   5.385 1.00 . A A .  41 LEU N    1 1 
        3  5401 1 1  41 LEU O    O  -3.605  -6.382   6.107 1.00 . A A .  41 LEU O    1 1 
        3  5402 1 1  42 TYR C    C  -3.327  -3.414   3.233 1.00 . A A .  42 TYR C    1 1 
        3  5403 1 1  42 TYR CA   C  -2.734  -4.415   4.241 1.00 . A A .  42 TYR CA   1 1 
        3  5404 1 1  42 TYR CB   C  -1.194  -4.638   4.084 1.00 . A A .  42 TYR CB   1 1 
        3  5405 1 1  42 TYR CD1  C  -0.749  -3.366   6.260 1.00 . A A .  42 TYR CD1  1 1 
        3  5406 1 1  42 TYR CD2  C   1.051  -3.623   4.717 1.00 . A A .  42 TYR CD2  1 1 
        3  5407 1 1  42 TYR CE1  C   0.085  -2.686   7.120 1.00 . A A .  42 TYR CE1  1 1 
        3  5408 1 1  42 TYR CE2  C   1.885  -2.939   5.573 1.00 . A A .  42 TYR CE2  1 1 
        3  5409 1 1  42 TYR CG   C  -0.288  -3.847   5.034 1.00 . A A .  42 TYR CG   1 1 
        3  5410 1 1  42 TYR CZ   C   1.403  -2.472   6.768 1.00 . A A .  42 TYR CZ   1 1 
        3  5411 1 1  42 TYR H    H  -3.597  -5.881   3.028 1.00 . A A .  42 TYR H    1 1 
        3  5412 1 1  42 TYR HA   H  -2.970  -4.096   5.254 1.00 . A A .  42 TYR HA   1 1 
        3  5413 1 1  42 TYR HB2  H  -0.973  -5.686   4.256 1.00 . A A .  42 TYR HB2  1 1 
        3  5414 1 1  42 TYR HB3  H  -0.904  -4.394   3.070 1.00 . A A .  42 TYR HB3  1 1 
        3  5415 1 1  42 TYR HD1  H  -1.782  -3.527   6.536 1.00 . A A .  42 TYR HD1  1 1 
        3  5416 1 1  42 TYR HD2  H   1.438  -3.992   3.776 1.00 . A A .  42 TYR HD2  1 1 
        3  5417 1 1  42 TYR HE1  H  -0.296  -2.321   8.065 1.00 . A A .  42 TYR HE1  1 1 
        3  5418 1 1  42 TYR HE2  H   2.920  -2.770   5.296 1.00 . A A .  42 TYR HE2  1 1 
        3  5419 1 1  42 TYR HH   H   2.071  -2.074   8.531 1.00 . A A .  42 TYR HH   1 1 
        3  5420 1 1  42 TYR N    N  -3.402  -5.670   3.964 1.00 . A A .  42 TYR N    1 1 
        3  5421 1 1  42 TYR O    O  -3.118  -3.543   2.025 1.00 . A A .  42 TYR O    1 1 
        3  5422 1 1  42 TYR OH   O   2.249  -1.800   7.620 1.00 . A A .  42 TYR OH   1 1 
        3  5423 1 1  43 VAL C    C  -4.698  -0.133   3.141 1.00 . A A .  43 VAL C    1 1 
        3  5424 1 1  43 VAL CA   C  -4.995  -1.612   2.891 1.00 . A A .  43 VAL CA   1 1 
        3  5425 1 1  43 VAL CB   C  -6.524  -1.896   3.186 1.00 . A A .  43 VAL CB   1 1 
        3  5426 1 1  43 VAL CG1  C  -6.885  -3.385   2.944 1.00 . A A .  43 VAL CG1  1 1 
        3  5427 1 1  43 VAL CG2  C  -6.925  -1.449   4.614 1.00 . A A .  43 VAL CG2  1 1 
        3  5428 1 1  43 VAL H    H  -4.113  -2.297   4.693 1.00 . A A .  43 VAL H    1 1 
        3  5429 1 1  43 VAL HA   H  -4.800  -1.835   1.843 1.00 . A A .  43 VAL HA   1 1 
        3  5430 1 1  43 VAL HB   H  -7.109  -1.307   2.477 1.00 . A A .  43 VAL HB   1 1 
        3  5431 1 1  43 VAL HG11 H  -7.941  -3.546   3.132 1.00 . A A .  43 VAL HG11 1 1 
        3  5432 1 1  43 VAL HG12 H  -6.307  -4.016   3.611 1.00 . A A .  43 VAL HG12 1 1 
        3  5433 1 1  43 VAL HG13 H  -6.661  -3.655   1.918 1.00 . A A .  43 VAL HG13 1 1 
        3  5434 1 1  43 VAL HG21 H  -7.978  -1.643   4.779 1.00 . A A .  43 VAL HG21 1 1 
        3  5435 1 1  43 VAL HG22 H  -6.737  -0.387   4.731 1.00 . A A .  43 VAL HG22 1 1 
        3  5436 1 1  43 VAL HG23 H  -6.342  -1.994   5.346 1.00 . A A .  43 VAL HG23 1 1 
        3  5437 1 1  43 VAL N    N  -4.122  -2.461   3.731 1.00 . A A .  43 VAL N    1 1 
        3  5438 1 1  43 VAL O    O  -4.224   0.223   4.212 1.00 . A A .  43 VAL O    1 1 
        3  5439 1 1  44 ASP C    C  -6.030   2.635   3.326 1.00 . A A .  44 ASP C    1 1 
        3  5440 1 1  44 ASP CA   C  -4.939   2.181   2.328 1.00 . A A .  44 ASP CA   1 1 
        3  5441 1 1  44 ASP CB   C  -5.071   2.899   0.942 1.00 . A A .  44 ASP CB   1 1 
        3  5442 1 1  44 ASP CG   C  -6.371   2.586   0.153 1.00 . A A .  44 ASP CG   1 1 
        3  5443 1 1  44 ASP H    H  -5.365   0.354   1.323 1.00 . A A .  44 ASP H    1 1 
        3  5444 1 1  44 ASP HA   H  -3.964   2.411   2.750 1.00 . A A .  44 ASP HA   1 1 
        3  5445 1 1  44 ASP HB2  H  -5.020   3.970   1.103 1.00 . A A .  44 ASP HB2  1 1 
        3  5446 1 1  44 ASP HB3  H  -4.229   2.611   0.323 1.00 . A A .  44 ASP HB3  1 1 
        3  5447 1 1  44 ASP N    N  -5.023   0.719   2.168 1.00 . A A .  44 ASP N    1 1 
        3  5448 1 1  44 ASP O    O  -7.203   2.583   3.005 1.00 . A A .  44 ASP O    1 1 
        3  5449 1 1  44 ASP OD1  O  -6.663   1.404  -0.064 1.00 . A A .  44 ASP OD1  1 1 
        3  5450 1 1  44 ASP OD2  O  -7.089   3.527  -0.269 1.00 . A A .  44 ASP OD2  1 1 
        3  5451 1 1  45 ILE C    C  -7.622   4.432   5.254 1.00 . A A .  45 ILE C    1 1 
        3  5452 1 1  45 ILE CA   C  -6.583   3.364   5.684 1.00 . A A .  45 ILE CA   1 1 
        3  5453 1 1  45 ILE CB   C  -5.871   3.918   6.994 1.00 . A A .  45 ILE CB   1 1 
        3  5454 1 1  45 ILE CD1  C  -3.719   3.830   8.435 1.00 . A A .  45 ILE CD1  1 1 
        3  5455 1 1  45 ILE CG1  C  -4.457   3.324   7.202 1.00 . A A .  45 ILE CG1  1 1 
        3  5456 1 1  45 ILE CG2  C  -6.751   3.654   8.249 1.00 . A A .  45 ILE CG2  1 1 
        3  5457 1 1  45 ILE H    H  -4.666   3.002   4.751 1.00 . A A .  45 ILE H    1 1 
        3  5458 1 1  45 ILE HA   H  -7.110   2.452   5.941 1.00 . A A .  45 ILE HA   1 1 
        3  5459 1 1  45 ILE HB   H  -5.770   5.004   6.892 1.00 . A A .  45 ILE HB   1 1 
        3  5460 1 1  45 ILE HD11 H  -2.733   3.388   8.463 1.00 . A A .  45 ILE HD11 1 1 
        3  5461 1 1  45 ILE HD12 H  -4.263   3.553   9.328 1.00 . A A .  45 ILE HD12 1 1 
        3  5462 1 1  45 ILE HD13 H  -3.626   4.905   8.387 1.00 . A A .  45 ILE HD13 1 1 
        3  5463 1 1  45 ILE HG12 H  -4.524   2.250   7.290 1.00 . A A .  45 ILE HG12 1 1 
        3  5464 1 1  45 ILE HG13 H  -3.844   3.561   6.340 1.00 . A A .  45 ILE HG13 1 1 
        3  5465 1 1  45 ILE HG21 H  -6.285   4.086   9.128 1.00 . A A .  45 ILE HG21 1 1 
        3  5466 1 1  45 ILE HG22 H  -6.867   2.588   8.399 1.00 . A A .  45 ILE HG22 1 1 
        3  5467 1 1  45 ILE HG23 H  -7.727   4.101   8.112 1.00 . A A .  45 ILE HG23 1 1 
        3  5468 1 1  45 ILE N    N  -5.628   3.014   4.567 1.00 . A A .  45 ILE N    1 1 
        3  5469 1 1  45 ILE O    O  -8.752   4.462   5.750 1.00 . A A .  45 ILE O    1 1 
        3  5470 1 1  46 VAL C    C  -9.317   6.050   3.226 1.00 . A A .  46 VAL C    1 1 
        3  5471 1 1  46 VAL CA   C  -7.926   6.440   3.786 1.00 . A A .  46 VAL CA   1 1 
        3  5472 1 1  46 VAL CB   C  -7.080   7.117   2.641 1.00 . A A .  46 VAL CB   1 1 
        3  5473 1 1  46 VAL CG1  C  -5.816   7.813   3.179 1.00 . A A .  46 VAL CG1  1 1 
        3  5474 1 1  46 VAL CG2  C  -6.674   6.074   1.604 1.00 . A A .  46 VAL CG2  1 1 
        3  5475 1 1  46 VAL H    H  -6.273   5.146   3.993 1.00 . A A .  46 VAL H    1 1 
        3  5476 1 1  46 VAL HA   H  -8.061   7.168   4.584 1.00 . A A .  46 VAL HA   1 1 
        3  5477 1 1  46 VAL HB   H  -7.691   7.868   2.144 1.00 . A A .  46 VAL HB   1 1 
        3  5478 1 1  46 VAL HG11 H  -5.286   8.310   2.371 1.00 . A A .  46 VAL HG11 1 1 
        3  5479 1 1  46 VAL HG12 H  -5.159   7.084   3.637 1.00 . A A .  46 VAL HG12 1 1 
        3  5480 1 1  46 VAL HG13 H  -6.093   8.548   3.927 1.00 . A A .  46 VAL HG13 1 1 
        3  5481 1 1  46 VAL HG21 H  -6.078   6.534   0.827 1.00 . A A .  46 VAL HG21 1 1 
        3  5482 1 1  46 VAL HG22 H  -7.555   5.628   1.156 1.00 . A A .  46 VAL HG22 1 1 
        3  5483 1 1  46 VAL HG23 H  -6.088   5.293   2.078 1.00 . A A .  46 VAL HG23 1 1 
        3  5484 1 1  46 VAL N    N  -7.173   5.296   4.338 1.00 . A A .  46 VAL N    1 1 
        3  5485 1 1  46 VAL O    O -10.258   6.838   3.294 1.00 . A A .  46 VAL O    1 1 
        3  5486 1 1  47 SER C    C -10.947   2.908   2.479 1.00 . A A .  47 SER C    1 1 
        3  5487 1 1  47 SER CA   C -10.641   4.337   2.004 1.00 . A A .  47 SER CA   1 1 
        3  5488 1 1  47 SER CB   C -10.401   4.336   0.471 1.00 . A A .  47 SER CB   1 1 
        3  5489 1 1  47 SER H    H  -8.694   4.192   2.831 1.00 . A A .  47 SER H    1 1 
        3  5490 1 1  47 SER HA   H -11.481   4.985   2.247 1.00 . A A .  47 SER HA   1 1 
        3  5491 1 1  47 SER HB2  H  -9.795   3.484   0.191 1.00 . A A .  47 SER HB2  1 1 
        3  5492 1 1  47 SER HB3  H -11.352   4.278  -0.049 1.00 . A A .  47 SER HB3  1 1 
        3  5493 1 1  47 SER HG   H  -8.785   5.301  -0.021 1.00 . A A .  47 SER HG   1 1 
        3  5494 1 1  47 SER N    N  -9.430   4.820   2.700 1.00 . A A .  47 SER N    1 1 
        3  5495 1 1  47 SER O    O -12.104   2.540   2.708 1.00 . A A .  47 SER O    1 1 
        3  5496 1 1  47 SER OG   O  -9.727   5.497   0.036 1.00 . A A .  47 SER OG   1 1 
        3  5497 1 1  48 GLY C    C -10.084  -0.229   1.896 1.00 . A A .  48 GLY C    1 1 
        3  5498 1 1  48 GLY CA   C  -9.940   0.728   3.070 1.00 . A A .  48 GLY CA   1 1 
        3  5499 1 1  48 GLY H    H  -8.991   2.490   2.423 1.00 . A A .  48 GLY H    1 1 
        3  5500 1 1  48 GLY HA2  H  -9.030   0.495   3.606 1.00 . A A .  48 GLY HA2  1 1 
        3  5501 1 1  48 GLY HA3  H -10.781   0.597   3.744 1.00 . A A .  48 GLY HA3  1 1 
        3  5502 1 1  48 GLY N    N  -9.867   2.121   2.631 1.00 . A A .  48 GLY N    1 1 
        3  5503 1 1  48 GLY O    O -10.872  -1.181   1.959 1.00 . A A .  48 GLY O    1 1 
        3  5504 1 1  49 LYS C    C  -8.299  -1.869  -0.386 1.00 . A A .  49 LYS C    1 1 
        3  5505 1 1  49 LYS CA   C  -9.396  -0.788  -0.417 1.00 . A A .  49 LYS CA   1 1 
        3  5506 1 1  49 LYS CB   C  -9.237   0.113  -1.684 1.00 . A A .  49 LYS CB   1 1 
        3  5507 1 1  49 LYS CD   C -11.591   1.217  -1.426 1.00 . A A .  49 LYS CD   1 1 
        3  5508 1 1  49 LYS CE   C -12.375   0.651  -2.625 1.00 . A A .  49 LYS CE   1 1 
        3  5509 1 1  49 LYS CG   C -10.071   1.416  -1.679 1.00 . A A .  49 LYS CG   1 1 
        3  5510 1 1  49 LYS H    H  -8.602   0.689   0.885 1.00 . A A .  49 LYS H    1 1 
        3  5511 1 1  49 LYS HA   H -10.375  -1.272  -0.447 1.00 . A A .  49 LYS HA   1 1 
        3  5512 1 1  49 LYS HB2  H  -8.191   0.391  -1.788 1.00 . A A .  49 LYS HB2  1 1 
        3  5513 1 1  49 LYS HB3  H  -9.524  -0.468  -2.556 1.00 . A A .  49 LYS HB3  1 1 
        3  5514 1 1  49 LYS HD2  H -11.724   0.549  -0.582 1.00 . A A .  49 LYS HD2  1 1 
        3  5515 1 1  49 LYS HD3  H -12.015   2.184  -1.164 1.00 . A A .  49 LYS HD3  1 1 
        3  5516 1 1  49 LYS HE2  H -13.429   0.677  -2.395 1.00 . A A .  49 LYS HE2  1 1 
        3  5517 1 1  49 LYS HE3  H -12.189   1.276  -3.493 1.00 . A A .  49 LYS HE3  1 1 
        3  5518 1 1  49 LYS HG2  H  -9.682   2.063  -0.898 1.00 . A A .  49 LYS HG2  1 1 
        3  5519 1 1  49 LYS HG3  H  -9.937   1.914  -2.637 1.00 . A A .  49 LYS HG3  1 1 
        3  5520 1 1  49 LYS HZ1  H -11.032  -0.788  -3.307 1.00 . A A .  49 LYS HZ1  1 1 
        3  5521 1 1  49 LYS HZ2  H -12.639  -1.094  -3.721 1.00 . A A .  49 LYS HZ2  1 1 
        3  5522 1 1  49 LYS HZ3  H -12.108  -1.356  -2.137 1.00 . A A .  49 LYS HZ3  1 1 
        3  5523 1 1  49 LYS N    N  -9.305   0.008   0.822 1.00 . A A .  49 LYS N    1 1 
        3  5524 1 1  49 LYS NZ   N -12.014  -0.744  -2.968 1.00 . A A .  49 LYS NZ   1 1 
        3  5525 1 1  49 LYS O    O  -7.177  -1.578   0.038 1.00 . A A .  49 LYS O    1 1 
        3  5526 1 1  50 PRO C    C  -6.465  -3.931  -1.810 1.00 . A A .  50 PRO C    1 1 
        3  5527 1 1  50 PRO CA   C  -7.600  -4.233  -0.814 1.00 . A A .  50 PRO CA   1 1 
        3  5528 1 1  50 PRO CB   C  -8.431  -5.480  -1.245 1.00 . A A .  50 PRO CB   1 1 
        3  5529 1 1  50 PRO CD   C  -9.916  -3.602  -1.297 1.00 . A A .  50 PRO CD   1 1 
        3  5530 1 1  50 PRO CG   C  -9.862  -5.079  -1.034 1.00 . A A .  50 PRO CG   1 1 
        3  5531 1 1  50 PRO HA   H  -7.183  -4.389   0.183 1.00 . A A .  50 PRO HA   1 1 
        3  5532 1 1  50 PRO HB2  H  -8.241  -5.721  -2.288 1.00 . A A .  50 PRO HB2  1 1 
        3  5533 1 1  50 PRO HB3  H  -8.164  -6.333  -0.629 1.00 . A A .  50 PRO HB3  1 1 
        3  5534 1 1  50 PRO HD2  H -10.031  -3.396  -2.358 1.00 . A A .  50 PRO HD2  1 1 
        3  5535 1 1  50 PRO HD3  H -10.727  -3.145  -0.738 1.00 . A A .  50 PRO HD3  1 1 
        3  5536 1 1  50 PRO HG2  H -10.507  -5.614  -1.725 1.00 . A A .  50 PRO HG2  1 1 
        3  5537 1 1  50 PRO HG3  H -10.161  -5.294  -0.011 1.00 . A A .  50 PRO HG3  1 1 
        3  5538 1 1  50 PRO N    N  -8.601  -3.136  -0.806 1.00 . A A .  50 PRO N    1 1 
        3  5539 1 1  50 PRO O    O  -6.714  -3.769  -3.008 1.00 . A A .  50 PRO O    1 1 
        3  5540 1 1  51 LEU C    C  -3.052  -4.606  -2.223 1.00 . A A .  51 LEU C    1 1 
        3  5541 1 1  51 LEU CA   C  -4.048  -3.464  -2.129 1.00 . A A .  51 LEU CA   1 1 
        3  5542 1 1  51 LEU CB   C  -3.350  -2.228  -1.514 1.00 . A A .  51 LEU CB   1 1 
        3  5543 1 1  51 LEU CD1  C  -3.383   0.235  -0.887 1.00 . A A .  51 LEU CD1  1 1 
        3  5544 1 1  51 LEU CD2  C  -4.938  -0.660  -2.735 1.00 . A A .  51 LEU CD2  1 1 
        3  5545 1 1  51 LEU CG   C  -4.221  -0.956  -1.395 1.00 . A A .  51 LEU CG   1 1 
        3  5546 1 1  51 LEU H    H  -5.085  -4.014  -0.351 1.00 . A A .  51 LEU H    1 1 
        3  5547 1 1  51 LEU HA   H  -4.387  -3.212  -3.135 1.00 . A A .  51 LEU HA   1 1 
        3  5548 1 1  51 LEU HB2  H  -2.999  -2.496  -0.519 1.00 . A A .  51 LEU HB2  1 1 
        3  5549 1 1  51 LEU HB3  H  -2.481  -1.988  -2.124 1.00 . A A .  51 LEU HB3  1 1 
        3  5550 1 1  51 LEU HD11 H  -2.561   0.430  -1.568 1.00 . A A .  51 LEU HD11 1 1 
        3  5551 1 1  51 LEU HD12 H  -2.990   0.011   0.095 1.00 . A A .  51 LEU HD12 1 1 
        3  5552 1 1  51 LEU HD13 H  -4.009   1.116  -0.823 1.00 . A A .  51 LEU HD13 1 1 
        3  5553 1 1  51 LEU HD21 H  -5.577  -1.498  -2.992 1.00 . A A .  51 LEU HD21 1 1 
        3  5554 1 1  51 LEU HD22 H  -4.204  -0.524  -3.524 1.00 . A A .  51 LEU HD22 1 1 
        3  5555 1 1  51 LEU HD23 H  -5.540   0.232  -2.644 1.00 . A A .  51 LEU HD23 1 1 
        3  5556 1 1  51 LEU HG   H  -4.992  -1.136  -0.651 1.00 . A A .  51 LEU HG   1 1 
        3  5557 1 1  51 LEU N    N  -5.221  -3.847  -1.308 1.00 . A A .  51 LEU N    1 1 
        3  5558 1 1  51 LEU O    O  -2.524  -4.882  -3.285 1.00 . A A .  51 LEU O    1 1 
        3  5559 1 1  52 PHE C    C  -2.043  -6.997   0.430 1.00 . A A .  52 PHE C    1 1 
        3  5560 1 1  52 PHE CA   C  -1.801  -6.309  -0.915 1.00 . A A .  52 PHE CA   1 1 
        3  5561 1 1  52 PHE CB   C  -0.306  -5.819  -1.063 1.00 . A A .  52 PHE CB   1 1 
        3  5562 1 1  52 PHE CD1  C  -0.321  -3.881   0.598 1.00 . A A .  52 PHE CD1  1 1 
        3  5563 1 1  52 PHE CD2  C   0.451  -3.439  -1.617 1.00 . A A .  52 PHE CD2  1 1 
        3  5564 1 1  52 PHE CE1  C  -0.109  -2.561   0.928 1.00 . A A .  52 PHE CE1  1 1 
        3  5565 1 1  52 PHE CE2  C   0.665  -2.121  -1.283 1.00 . A A .  52 PHE CE2  1 1 
        3  5566 1 1  52 PHE CG   C  -0.048  -4.353  -0.679 1.00 . A A .  52 PHE CG   1 1 
        3  5567 1 1  52 PHE CZ   C   0.381  -1.683  -0.012 1.00 . A A .  52 PHE CZ   1 1 
        3  5568 1 1  52 PHE H    H  -3.223  -4.869  -0.265 1.00 . A A .  52 PHE H    1 1 
        3  5569 1 1  52 PHE HA   H  -2.014  -7.032  -1.699 1.00 . A A .  52 PHE HA   1 1 
        3  5570 1 1  52 PHE HB2  H   0.340  -6.433  -0.445 1.00 . A A .  52 PHE HB2  1 1 
        3  5571 1 1  52 PHE HB3  H  -0.003  -5.951  -2.099 1.00 . A A .  52 PHE HB3  1 1 
        3  5572 1 1  52 PHE HD1  H  -0.707  -4.565   1.349 1.00 . A A .  52 PHE HD1  1 1 
        3  5573 1 1  52 PHE HD2  H   0.676  -3.778  -2.619 1.00 . A A .  52 PHE HD2  1 1 
        3  5574 1 1  52 PHE HE1  H  -0.331  -2.210   1.929 1.00 . A A .  52 PHE HE1  1 1 
        3  5575 1 1  52 PHE HE2  H   1.053  -1.428  -2.021 1.00 . A A .  52 PHE HE2  1 1 
        3  5576 1 1  52 PHE HZ   H   0.549  -0.645   0.252 1.00 . A A .  52 PHE HZ   1 1 
        3  5577 1 1  52 PHE N    N  -2.764  -5.202  -1.067 1.00 . A A .  52 PHE N    1 1 
        3  5578 1 1  52 PHE O    O  -2.790  -6.483   1.272 1.00 . A A .  52 PHE O    1 1 
        3  5579 1 1  53 THR C    C  -0.291  -8.704   2.738 1.00 . A A .  53 THR C    1 1 
        3  5580 1 1  53 THR CA   C  -1.539  -8.929   1.868 1.00 . A A .  53 THR CA   1 1 
        3  5581 1 1  53 THR CB   C  -1.772 -10.468   1.588 1.00 . A A .  53 THR CB   1 1 
        3  5582 1 1  53 THR CG2  C  -0.795 -11.058   0.559 1.00 . A A .  53 THR CG2  1 1 
        3  5583 1 1  53 THR H    H  -0.879  -8.535  -0.104 1.00 . A A .  53 THR H    1 1 
        3  5584 1 1  53 THR HA   H  -2.407  -8.561   2.414 1.00 . A A .  53 THR HA   1 1 
        3  5585 1 1  53 THR HB   H  -2.780 -10.586   1.200 1.00 . A A .  53 THR HB   1 1 
        3  5586 1 1  53 THR HG1  H  -2.520 -11.182   3.276 1.00 . A A .  53 THR HG1  1 1 
        3  5587 1 1  53 THR HG21 H  -1.024 -12.104   0.390 1.00 . A A .  53 THR HG21 1 1 
        3  5588 1 1  53 THR HG22 H   0.220 -10.970   0.930 1.00 . A A .  53 THR HG22 1 1 
        3  5589 1 1  53 THR HG23 H  -0.879 -10.519  -0.376 1.00 . A A .  53 THR HG23 1 1 
        3  5590 1 1  53 THR N    N  -1.432  -8.170   0.618 1.00 . A A .  53 THR N    1 1 
        3  5591 1 1  53 THR O    O   0.816  -8.493   2.219 1.00 . A A .  53 THR O    1 1 
        3  5592 1 1  53 THR OG1  O  -1.681 -11.225   2.807 1.00 . A A .  53 THR OG1  1 1 
        3  5593 1 1  54 SER C    C   1.536  -9.904   4.945 1.00 . A A .  54 SER C    1 1 
        3  5594 1 1  54 SER CA   C   0.586  -8.680   5.080 1.00 . A A .  54 SER CA   1 1 
        3  5595 1 1  54 SER CB   C  -0.023  -8.597   6.507 1.00 . A A .  54 SER CB   1 1 
        3  5596 1 1  54 SER H    H  -1.431  -8.651   4.387 1.00 . A A .  54 SER H    1 1 
        3  5597 1 1  54 SER HA   H   1.159  -7.775   4.901 1.00 . A A .  54 SER HA   1 1 
        3  5598 1 1  54 SER HB2  H  -0.734  -7.781   6.552 1.00 . A A .  54 SER HB2  1 1 
        3  5599 1 1  54 SER HB3  H  -0.535  -9.520   6.736 1.00 . A A .  54 SER HB3  1 1 
        3  5600 1 1  54 SER HG   H   1.832  -8.638   7.156 1.00 . A A .  54 SER HG   1 1 
        3  5601 1 1  54 SER N    N  -0.502  -8.717   4.072 1.00 . A A .  54 SER N    1 1 
        3  5602 1 1  54 SER O    O   2.665  -9.877   5.443 1.00 . A A .  54 SER O    1 1 
        3  5603 1 1  54 SER OG   O   0.972  -8.372   7.496 1.00 . A A .  54 SER OG   1 1 
        3  5604 1 1  55 LYS C    C   2.888 -11.842   2.859 1.00 . A A .  55 LYS C    1 1 
        3  5605 1 1  55 LYS CA   C   1.838 -12.168   3.958 1.00 . A A .  55 LYS CA   1 1 
        3  5606 1 1  55 LYS CB   C   0.866 -13.326   3.542 1.00 . A A .  55 LYS CB   1 1 
        3  5607 1 1  55 LYS CD   C   2.521 -15.216   2.838 1.00 . A A .  55 LYS CD   1 1 
        3  5608 1 1  55 LYS CE   C   2.973 -16.664   3.086 1.00 . A A .  55 LYS CE   1 1 
        3  5609 1 1  55 LYS CG   C   1.379 -14.774   3.788 1.00 . A A .  55 LYS CG   1 1 
        3  5610 1 1  55 LYS H    H   0.127 -10.906   3.954 1.00 . A A .  55 LYS H    1 1 
        3  5611 1 1  55 LYS HA   H   2.360 -12.460   4.864 1.00 . A A .  55 LYS HA   1 1 
        3  5612 1 1  55 LYS HB2  H  -0.055 -13.216   4.106 1.00 . A A .  55 LYS HB2  1 1 
        3  5613 1 1  55 LYS HB3  H   0.626 -13.226   2.489 1.00 . A A .  55 LYS HB3  1 1 
        3  5614 1 1  55 LYS HD2  H   2.179 -15.128   1.812 1.00 . A A .  55 LYS HD2  1 1 
        3  5615 1 1  55 LYS HD3  H   3.369 -14.554   2.983 1.00 . A A .  55 LYS HD3  1 1 
        3  5616 1 1  55 LYS HE2  H   3.784 -16.901   2.408 1.00 . A A .  55 LYS HE2  1 1 
        3  5617 1 1  55 LYS HE3  H   3.323 -16.758   4.107 1.00 . A A .  55 LYS HE3  1 1 
        3  5618 1 1  55 LYS HG2  H   1.736 -14.838   4.809 1.00 . A A .  55 LYS HG2  1 1 
        3  5619 1 1  55 LYS HG3  H   0.542 -15.460   3.672 1.00 . A A .  55 LYS HG3  1 1 
        3  5620 1 1  55 LYS HZ1  H   2.199 -18.603   3.036 1.00 . A A .  55 LYS HZ1  1 1 
        3  5621 1 1  55 LYS HZ2  H   1.529 -17.570   1.880 1.00 . A A .  55 LYS HZ2  1 1 
        3  5622 1 1  55 LYS HZ3  H   1.078 -17.430   3.502 1.00 . A A .  55 LYS HZ3  1 1 
        3  5623 1 1  55 LYS N    N   1.053 -10.959   4.263 1.00 . A A .  55 LYS N    1 1 
        3  5624 1 1  55 LYS NZ   N   1.868 -17.633   2.861 1.00 . A A .  55 LYS NZ   1 1 
        3  5625 1 1  55 LYS O    O   4.037 -12.297   2.937 1.00 . A A .  55 LYS O    1 1 
        3  5626 1 1  56 ASP C    C   4.287  -9.405   1.163 1.00 . A A .  56 ASP C    1 1 
        3  5627 1 1  56 ASP CA   C   3.378 -10.582   0.736 1.00 . A A .  56 ASP CA   1 1 
        3  5628 1 1  56 ASP CB   C   2.533 -10.211  -0.526 1.00 . A A .  56 ASP CB   1 1 
        3  5629 1 1  56 ASP CG   C   3.373  -9.865  -1.780 1.00 . A A .  56 ASP CG   1 1 
        3  5630 1 1  56 ASP H    H   1.570 -10.669   1.882 1.00 . A A .  56 ASP H    1 1 
        3  5631 1 1  56 ASP HA   H   4.020 -11.424   0.485 1.00 . A A .  56 ASP HA   1 1 
        3  5632 1 1  56 ASP HB2  H   1.897 -11.053  -0.777 1.00 . A A .  56 ASP HB2  1 1 
        3  5633 1 1  56 ASP HB3  H   1.891  -9.365  -0.288 1.00 . A A .  56 ASP HB3  1 1 
        3  5634 1 1  56 ASP N    N   2.487 -11.014   1.859 1.00 . A A .  56 ASP N    1 1 
        3  5635 1 1  56 ASP O    O   5.107  -8.906   0.383 1.00 . A A .  56 ASP O    1 1 
        3  5636 1 1  56 ASP OD1  O   4.189 -10.709  -2.200 1.00 . A A .  56 ASP OD1  1 1 
        3  5637 1 1  56 ASP OD2  O   3.232  -8.757  -2.335 1.00 . A A .  56 ASP OD2  1 1 
        3  5638 1 1  57 LYS C    C   6.329  -8.565   3.486 1.00 . A A .  57 LYS C    1 1 
        3  5639 1 1  57 LYS CA   C   5.030  -7.939   2.972 1.00 . A A .  57 LYS CA   1 1 
        3  5640 1 1  57 LYS CB   C   4.320  -7.193   4.122 1.00 . A A .  57 LYS CB   1 1 
        3  5641 1 1  57 LYS CD   C   4.447  -5.382   5.922 1.00 . A A .  57 LYS CD   1 1 
        3  5642 1 1  57 LYS CE   C   5.345  -4.496   6.799 1.00 . A A .  57 LYS CE   1 1 
        3  5643 1 1  57 LYS CG   C   5.211  -6.159   4.845 1.00 . A A .  57 LYS CG   1 1 
        3  5644 1 1  57 LYS H    H   3.499  -9.396   3.003 1.00 . A A .  57 LYS H    1 1 
        3  5645 1 1  57 LYS HA   H   5.261  -7.222   2.179 1.00 . A A .  57 LYS HA   1 1 
        3  5646 1 1  57 LYS HB2  H   3.450  -6.678   3.721 1.00 . A A .  57 LYS HB2  1 1 
        3  5647 1 1  57 LYS HB3  H   3.981  -7.922   4.851 1.00 . A A .  57 LYS HB3  1 1 
        3  5648 1 1  57 LYS HD2  H   3.717  -4.750   5.432 1.00 . A A .  57 LYS HD2  1 1 
        3  5649 1 1  57 LYS HD3  H   3.924  -6.089   6.560 1.00 . A A .  57 LYS HD3  1 1 
        3  5650 1 1  57 LYS HE2  H   5.975  -5.121   7.418 1.00 . A A .  57 LYS HE2  1 1 
        3  5651 1 1  57 LYS HE3  H   5.970  -3.879   6.168 1.00 . A A .  57 LYS HE3  1 1 
        3  5652 1 1  57 LYS HG2  H   6.042  -6.680   5.314 1.00 . A A .  57 LYS HG2  1 1 
        3  5653 1 1  57 LYS HG3  H   5.602  -5.459   4.111 1.00 . A A .  57 LYS HG3  1 1 
        3  5654 1 1  57 LYS HZ1  H   5.171  -2.959   8.203 1.00 . A A .  57 LYS HZ1  1 1 
        3  5655 1 1  57 LYS HZ2  H   3.997  -4.168   8.367 1.00 . A A .  57 LYS HZ2  1 1 
        3  5656 1 1  57 LYS HZ3  H   3.882  -3.040   7.118 1.00 . A A .  57 LYS HZ3  1 1 
        3  5657 1 1  57 LYS N    N   4.163  -8.974   2.420 1.00 . A A .  57 LYS N    1 1 
        3  5658 1 1  57 LYS NZ   N   4.545  -3.605   7.684 1.00 . A A .  57 LYS NZ   1 1 
        3  5659 1 1  57 LYS O    O   6.292  -9.539   4.246 1.00 . A A .  57 LYS O    1 1 
        3  5660 1 1  58 PHE C    C   9.354  -6.853   4.057 1.00 . A A .  58 PHE C    1 1 
        3  5661 1 1  58 PHE CA   C   8.758  -8.227   3.721 1.00 . A A .  58 PHE CA   1 1 
        3  5662 1 1  58 PHE CB   C   9.717  -9.112   2.866 1.00 . A A .  58 PHE CB   1 1 
        3  5663 1 1  58 PHE CD1  C   9.313  -8.720   0.379 1.00 . A A .  58 PHE CD1  1 1 
        3  5664 1 1  58 PHE CD2  C  11.335  -7.869   1.334 1.00 . A A .  58 PHE CD2  1 1 
        3  5665 1 1  58 PHE CE1  C   9.693  -8.228  -0.856 1.00 . A A .  58 PHE CE1  1 1 
        3  5666 1 1  58 PHE CE2  C  11.713  -7.377   0.101 1.00 . A A .  58 PHE CE2  1 1 
        3  5667 1 1  58 PHE CG   C  10.126  -8.549   1.500 1.00 . A A .  58 PHE CG   1 1 
        3  5668 1 1  58 PHE CZ   C  10.892  -7.556  -0.994 1.00 . A A .  58 PHE CZ   1 1 
        3  5669 1 1  58 PHE H    H   7.445  -7.437   2.261 1.00 . A A .  58 PHE H    1 1 
        3  5670 1 1  58 PHE HA   H   8.569  -8.745   4.664 1.00 . A A .  58 PHE HA   1 1 
        3  5671 1 1  58 PHE HB2  H  10.624  -9.298   3.432 1.00 . A A .  58 PHE HB2  1 1 
        3  5672 1 1  58 PHE HB3  H   9.232 -10.069   2.696 1.00 . A A .  58 PHE HB3  1 1 
        3  5673 1 1  58 PHE HD1  H   8.369  -9.241   0.478 1.00 . A A .  58 PHE HD1  1 1 
        3  5674 1 1  58 PHE HD2  H  11.984  -7.723   2.188 1.00 . A A .  58 PHE HD2  1 1 
        3  5675 1 1  58 PHE HE1  H   9.049  -8.367  -1.719 1.00 . A A .  58 PHE HE1  1 1 
        3  5676 1 1  58 PHE HE2  H  12.653  -6.848  -0.008 1.00 . A A .  58 PHE HE2  1 1 
        3  5677 1 1  58 PHE HZ   H  11.189  -7.172  -1.960 1.00 . A A .  58 PHE HZ   1 1 
        3  5678 1 1  58 PHE N    N   7.469  -8.012   3.057 1.00 . A A .  58 PHE N    1 1 
        3  5679 1 1  58 PHE O    O   9.351  -5.936   3.226 1.00 . A A .  58 PHE O    1 1 
        3  5680 1 1  59 ASP C    C  11.895  -5.419   5.481 1.00 . A A .  59 ASP C    1 1 
        3  5681 1 1  59 ASP CA   C  10.399  -5.471   5.820 1.00 . A A .  59 ASP CA   1 1 
        3  5682 1 1  59 ASP CB   C  10.159  -5.371   7.358 1.00 . A A .  59 ASP CB   1 1 
        3  5683 1 1  59 ASP CG   C  10.827  -6.499   8.178 1.00 . A A .  59 ASP CG   1 1 
        3  5684 1 1  59 ASP H    H   9.794  -7.492   5.888 1.00 . A A .  59 ASP H    1 1 
        3  5685 1 1  59 ASP HA   H   9.899  -4.636   5.336 1.00 . A A .  59 ASP HA   1 1 
        3  5686 1 1  59 ASP HB2  H  10.533  -4.412   7.706 1.00 . A A .  59 ASP HB2  1 1 
        3  5687 1 1  59 ASP HB3  H   9.090  -5.404   7.546 1.00 . A A .  59 ASP HB3  1 1 
        3  5688 1 1  59 ASP N    N   9.825  -6.717   5.296 1.00 . A A .  59 ASP N    1 1 
        3  5689 1 1  59 ASP O    O  12.598  -6.434   5.583 1.00 . A A .  59 ASP O    1 1 
        3  5690 1 1  59 ASP OD1  O  10.464  -7.681   7.990 1.00 . A A .  59 ASP OD1  1 1 
        3  5691 1 1  59 ASP OD2  O  11.704  -6.214   9.027 1.00 . A A .  59 ASP OD2  1 1 
        3  5692 1 1  60 SER C    C  14.400  -3.044   5.725 1.00 . A A .  60 SER C    1 1 
        3  5693 1 1  60 SER CA   C  13.783  -4.023   4.710 1.00 . A A .  60 SER CA   1 1 
        3  5694 1 1  60 SER CB   C  13.919  -3.487   3.264 1.00 . A A .  60 SER CB   1 1 
        3  5695 1 1  60 SER H    H  11.734  -3.496   4.932 1.00 . A A .  60 SER H    1 1 
        3  5696 1 1  60 SER HA   H  14.312  -4.974   4.783 1.00 . A A .  60 SER HA   1 1 
        3  5697 1 1  60 SER HB2  H  14.966  -3.440   2.990 1.00 . A A .  60 SER HB2  1 1 
        3  5698 1 1  60 SER HB3  H  13.411  -4.160   2.582 1.00 . A A .  60 SER HB3  1 1 
        3  5699 1 1  60 SER HG   H  12.702  -2.043   3.798 1.00 . A A .  60 SER HG   1 1 
        3  5700 1 1  60 SER N    N  12.364  -4.244   5.038 1.00 . A A .  60 SER N    1 1 
        3  5701 1 1  60 SER O    O  13.702  -2.166   6.251 1.00 . A A .  60 SER O    1 1 
        3  5702 1 1  60 SER OG   O  13.360  -2.191   3.113 1.00 . A A .  60 SER OG   1 1 
        3  5703 1 1  61 GLN C    C  16.637  -0.902   6.419 1.00 . A A .  61 GLN C    1 1 
        3  5704 1 1  61 GLN CA   C  16.469  -2.356   6.946 1.00 . A A .  61 GLN CA   1 1 
        3  5705 1 1  61 GLN CB   C  17.839  -3.025   7.262 1.00 . A A .  61 GLN CB   1 1 
        3  5706 1 1  61 GLN CD   C  19.917  -3.140   8.790 1.00 . A A .  61 GLN CD   1 1 
        3  5707 1 1  61 GLN CG   C  18.629  -2.392   8.426 1.00 . A A .  61 GLN CG   1 1 
        3  5708 1 1  61 GLN H    H  16.200  -3.899   5.504 1.00 . A A .  61 GLN H    1 1 
        3  5709 1 1  61 GLN HA   H  15.889  -2.312   7.866 1.00 . A A .  61 GLN HA   1 1 
        3  5710 1 1  61 GLN HB2  H  17.660  -4.066   7.511 1.00 . A A .  61 GLN HB2  1 1 
        3  5711 1 1  61 GLN HB3  H  18.460  -2.990   6.369 1.00 . A A .  61 GLN HB3  1 1 
        3  5712 1 1  61 GLN HE21 H  20.762  -1.451   9.416 1.00 . A A .  61 GLN HE21 1 1 
        3  5713 1 1  61 GLN HE22 H  21.735  -2.871   9.539 1.00 . A A .  61 GLN HE22 1 1 
        3  5714 1 1  61 GLN HG2  H  18.879  -1.371   8.163 1.00 . A A .  61 GLN HG2  1 1 
        3  5715 1 1  61 GLN HG3  H  17.990  -2.380   9.303 1.00 . A A .  61 GLN HG3  1 1 
        3  5716 1 1  61 GLN N    N  15.713  -3.197   5.981 1.00 . A A .  61 GLN N    1 1 
        3  5717 1 1  61 GLN NE2  N  20.908  -2.415   9.295 1.00 . A A .  61 GLN NE2  1 1 
        3  5718 1 1  61 GLN O    O  17.070  -0.001   7.157 1.00 . A A .  61 GLN O    1 1 
        3  5719 1 1  61 GLN OE1  O  20.021  -4.360   8.624 1.00 . A A .  61 GLN OE1  1 1 
        3  5720 1 1  62 CYS C    C  15.134   1.524   5.287 1.00 . A A .  62 CYS C    1 1 
        3  5721 1 1  62 CYS CA   C  16.157   0.649   4.528 1.00 . A A .  62 CYS CA   1 1 
        3  5722 1 1  62 CYS CB   C  15.738   0.508   3.048 1.00 . A A .  62 CYS CB   1 1 
        3  5723 1 1  62 CYS H    H  16.050  -1.469   4.585 1.00 . A A .  62 CYS H    1 1 
        3  5724 1 1  62 CYS HA   H  17.135   1.118   4.579 1.00 . A A .  62 CYS HA   1 1 
        3  5725 1 1  62 CYS HB2  H  16.462  -0.107   2.533 1.00 . A A .  62 CYS HB2  1 1 
        3  5726 1 1  62 CYS HB3  H  14.765   0.026   2.993 1.00 . A A .  62 CYS HB3  1 1 
        3  5727 1 1  62 CYS HG   H  16.860   2.488   1.904 1.00 . A A .  62 CYS HG   1 1 
        3  5728 1 1  62 CYS N    N  16.260  -0.689   5.142 1.00 . A A .  62 CYS N    1 1 
        3  5729 1 1  62 CYS O    O  15.263   2.751   5.321 1.00 . A A .  62 CYS O    1 1 
        3  5730 1 1  62 CYS SG   S  15.623   2.073   2.148 1.00 . A A .  62 CYS SG   1 1 
        3  5731 1 1  63 GLY C    C  11.726   1.121   6.391 1.00 . A A .  63 GLY C    1 1 
        3  5732 1 1  63 GLY CA   C  13.145   1.522   6.765 1.00 . A A .  63 GLY CA   1 1 
        3  5733 1 1  63 GLY H    H  14.074  -0.105   5.783 1.00 . A A .  63 GLY H    1 1 
        3  5734 1 1  63 GLY HA2  H  13.338   1.245   7.794 1.00 . A A .  63 GLY HA2  1 1 
        3  5735 1 1  63 GLY HA3  H  13.239   2.599   6.677 1.00 . A A .  63 GLY HA3  1 1 
        3  5736 1 1  63 GLY N    N  14.136   0.863   5.912 1.00 . A A .  63 GLY N    1 1 
        3  5737 1 1  63 GLY O    O  10.940   0.680   7.239 1.00 . A A .  63 GLY O    1 1 
        3  5738 1 1  64 TRP C    C   9.916  -0.402   4.067 1.00 . A A .  64 TRP C    1 1 
        3  5739 1 1  64 TRP CA   C  10.074   1.061   4.534 1.00 . A A .  64 TRP CA   1 1 
        3  5740 1 1  64 TRP CB   C   9.855   2.067   3.356 1.00 . A A .  64 TRP CB   1 1 
        3  5741 1 1  64 TRP CD1  C   8.848   4.344   4.057 1.00 . A A .  64 TRP CD1  1 1 
        3  5742 1 1  64 TRP CD2  C  11.091   4.309   4.047 1.00 . A A .  64 TRP CD2  1 1 
        3  5743 1 1  64 TRP CE2  C  10.663   5.576   4.477 1.00 . A A .  64 TRP CE2  1 1 
        3  5744 1 1  64 TRP CE3  C  12.466   4.057   3.968 1.00 . A A .  64 TRP CE3  1 1 
        3  5745 1 1  64 TRP CG   C   9.909   3.520   3.794 1.00 . A A .  64 TRP CG   1 1 
        3  5746 1 1  64 TRP CH2  C  12.895   6.313   4.729 1.00 . A A .  64 TRP CH2  1 1 
        3  5747 1 1  64 TRP CZ2  C  11.560   6.587   4.813 1.00 . A A .  64 TRP CZ2  1 1 
        3  5748 1 1  64 TRP CZ3  C  13.353   5.065   4.300 1.00 . A A .  64 TRP CZ3  1 1 
        3  5749 1 1  64 TRP H    H  12.137   1.532   4.486 1.00 . A A .  64 TRP H    1 1 
        3  5750 1 1  64 TRP HA   H   9.342   1.259   5.310 1.00 . A A .  64 TRP HA   1 1 
        3  5751 1 1  64 TRP HB2  H  10.625   1.915   2.605 1.00 . A A .  64 TRP HB2  1 1 
        3  5752 1 1  64 TRP HB3  H   8.887   1.891   2.906 1.00 . A A .  64 TRP HB3  1 1 
        3  5753 1 1  64 TRP HD1  H   7.810   4.051   3.957 1.00 . A A .  64 TRP HD1  1 1 
        3  5754 1 1  64 TRP HE1  H   8.717   6.337   4.720 1.00 . A A .  64 TRP HE1  1 1 
        3  5755 1 1  64 TRP HE3  H  12.839   3.096   3.637 1.00 . A A .  64 TRP HE3  1 1 
        3  5756 1 1  64 TRP HH2  H  13.625   7.075   4.981 1.00 . A A .  64 TRP HH2  1 1 
        3  5757 1 1  64 TRP HZ2  H  11.220   7.562   5.144 1.00 . A A .  64 TRP HZ2  1 1 
        3  5758 1 1  64 TRP HZ3  H  14.421   4.883   4.244 1.00 . A A .  64 TRP HZ3  1 1 
        3  5759 1 1  64 TRP N    N  11.419   1.271   5.099 1.00 . A A .  64 TRP N    1 1 
        3  5760 1 1  64 TRP NE1  N   9.294   5.575   4.472 1.00 . A A .  64 TRP NE1  1 1 
        3  5761 1 1  64 TRP O    O  10.913  -1.038   3.702 1.00 . A A .  64 TRP O    1 1 
        3  5762 1 1  65 PRO C    C   8.473  -2.414   2.049 1.00 . A A .  65 PRO C    1 1 
        3  5763 1 1  65 PRO CA   C   8.423  -2.348   3.583 1.00 . A A .  65 PRO CA   1 1 
        3  5764 1 1  65 PRO CB   C   7.007  -2.673   4.106 1.00 . A A .  65 PRO CB   1 1 
        3  5765 1 1  65 PRO CD   C   7.412  -0.363   4.619 1.00 . A A .  65 PRO CD   1 1 
        3  5766 1 1  65 PRO CG   C   6.330  -1.338   4.178 1.00 . A A .  65 PRO CG   1 1 
        3  5767 1 1  65 PRO HA   H   9.138  -3.059   3.993 1.00 . A A .  65 PRO HA   1 1 
        3  5768 1 1  65 PRO HB2  H   6.491  -3.355   3.430 1.00 . A A .  65 PRO HB2  1 1 
        3  5769 1 1  65 PRO HB3  H   7.078  -3.136   5.087 1.00 . A A .  65 PRO HB3  1 1 
        3  5770 1 1  65 PRO HD2  H   7.242   0.614   4.183 1.00 . A A .  65 PRO HD2  1 1 
        3  5771 1 1  65 PRO HD3  H   7.444  -0.286   5.703 1.00 . A A .  65 PRO HD3  1 1 
        3  5772 1 1  65 PRO HG2  H   5.943  -1.063   3.200 1.00 . A A .  65 PRO HG2  1 1 
        3  5773 1 1  65 PRO HG3  H   5.522  -1.365   4.901 1.00 . A A .  65 PRO HG3  1 1 
        3  5774 1 1  65 PRO N    N   8.670  -0.979   4.092 1.00 . A A .  65 PRO N    1 1 
        3  5775 1 1  65 PRO O    O   8.458  -1.381   1.360 1.00 . A A .  65 PRO O    1 1 
        3  5776 1 1  66 SER C    C   7.669  -5.129  -0.200 1.00 . A A .  66 SER C    1 1 
        3  5777 1 1  66 SER CA   C   8.558  -3.912   0.102 1.00 . A A .  66 SER CA   1 1 
        3  5778 1 1  66 SER CB   C  10.013  -4.128  -0.374 1.00 . A A .  66 SER CB   1 1 
        3  5779 1 1  66 SER H    H   8.576  -4.402   2.144 1.00 . A A .  66 SER H    1 1 
        3  5780 1 1  66 SER HA   H   8.146  -3.047  -0.415 1.00 . A A .  66 SER HA   1 1 
        3  5781 1 1  66 SER HB2  H  10.440  -4.989   0.125 1.00 . A A .  66 SER HB2  1 1 
        3  5782 1 1  66 SER HB3  H  10.027  -4.298  -1.444 1.00 . A A .  66 SER HB3  1 1 
        3  5783 1 1  66 SER HG   H  10.268  -2.249   0.161 1.00 . A A .  66 SER HG   1 1 
        3  5784 1 1  66 SER N    N   8.539  -3.641   1.532 1.00 . A A .  66 SER N    1 1 
        3  5785 1 1  66 SER O    O   7.586  -6.067   0.602 1.00 . A A .  66 SER O    1 1 
        3  5786 1 1  66 SER OG   O  10.829  -2.998  -0.081 1.00 . A A .  66 SER OG   1 1 
        3  5787 1 1  67 PHE C    C   6.537  -6.596  -3.188 1.00 . A A .  67 PHE C    1 1 
        3  5788 1 1  67 PHE CA   C   6.058  -6.133  -1.807 1.00 . A A .  67 PHE CA   1 1 
        3  5789 1 1  67 PHE CB   C   4.592  -5.613  -1.888 1.00 . A A .  67 PHE CB   1 1 
        3  5790 1 1  67 PHE CD1  C   4.337  -3.698  -0.231 1.00 . A A .  67 PHE CD1  1 1 
        3  5791 1 1  67 PHE CD2  C   3.329  -5.795   0.320 1.00 . A A .  67 PHE CD2  1 1 
        3  5792 1 1  67 PHE CE1  C   3.890  -3.165   0.959 1.00 . A A .  67 PHE CE1  1 1 
        3  5793 1 1  67 PHE CE2  C   2.879  -5.255   1.509 1.00 . A A .  67 PHE CE2  1 1 
        3  5794 1 1  67 PHE CG   C   4.070  -5.024  -0.576 1.00 . A A .  67 PHE CG   1 1 
        3  5795 1 1  67 PHE CZ   C   3.163  -3.942   1.830 1.00 . A A .  67 PHE CZ   1 1 
        3  5796 1 1  67 PHE H    H   7.044  -4.262  -1.882 1.00 . A A .  67 PHE H    1 1 
        3  5797 1 1  67 PHE HA   H   6.105  -6.973  -1.118 1.00 . A A .  67 PHE HA   1 1 
        3  5798 1 1  67 PHE HB2  H   4.526  -4.846  -2.651 1.00 . A A .  67 PHE HB2  1 1 
        3  5799 1 1  67 PHE HB3  H   3.939  -6.433  -2.169 1.00 . A A .  67 PHE HB3  1 1 
        3  5800 1 1  67 PHE HD1  H   4.909  -3.078  -0.914 1.00 . A A .  67 PHE HD1  1 1 
        3  5801 1 1  67 PHE HD2  H   3.100  -6.826   0.073 1.00 . A A .  67 PHE HD2  1 1 
        3  5802 1 1  67 PHE HE1  H   4.111  -2.134   1.210 1.00 . A A .  67 PHE HE1  1 1 
        3  5803 1 1  67 PHE HE2  H   2.306  -5.866   2.195 1.00 . A A .  67 PHE HE2  1 1 
        3  5804 1 1  67 PHE HZ   H   2.817  -3.527   2.765 1.00 . A A .  67 PHE HZ   1 1 
        3  5805 1 1  67 PHE N    N   6.962  -5.066  -1.334 1.00 . A A .  67 PHE N    1 1 
        3  5806 1 1  67 PHE O    O   7.087  -5.791  -3.954 1.00 . A A .  67 PHE O    1 1 
        3  5807 1 1  68 THR C    C   5.615  -8.262  -5.836 1.00 . A A .  68 THR C    1 1 
        3  5808 1 1  68 THR CA   C   6.735  -8.462  -4.798 1.00 . A A .  68 THR CA   1 1 
        3  5809 1 1  68 THR CB   C   7.085  -9.986  -4.673 1.00 . A A .  68 THR CB   1 1 
        3  5810 1 1  68 THR CG2  C   7.610 -10.582  -6.004 1.00 . A A .  68 THR CG2  1 1 
        3  5811 1 1  68 THR H    H   5.880  -8.463  -2.849 1.00 . A A .  68 THR H    1 1 
        3  5812 1 1  68 THR HA   H   7.629  -7.939  -5.136 1.00 . A A .  68 THR HA   1 1 
        3  5813 1 1  68 THR HB   H   6.190 -10.525  -4.379 1.00 . A A .  68 THR HB   1 1 
        3  5814 1 1  68 THR HG1  H   7.782  -9.720  -2.843 1.00 . A A .  68 THR HG1  1 1 
        3  5815 1 1  68 THR HG21 H   8.503 -10.055  -6.316 1.00 . A A .  68 THR HG21 1 1 
        3  5816 1 1  68 THR HG22 H   6.852 -10.482  -6.775 1.00 . A A .  68 THR HG22 1 1 
        3  5817 1 1  68 THR HG23 H   7.844 -11.632  -5.871 1.00 . A A .  68 THR HG23 1 1 
        3  5818 1 1  68 THR N    N   6.333  -7.885  -3.500 1.00 . A A .  68 THR N    1 1 
        3  5819 1 1  68 THR O    O   5.883  -7.880  -6.978 1.00 . A A .  68 THR O    1 1 
        3  5820 1 1  68 THR OG1  O   8.077 -10.160  -3.649 1.00 . A A .  68 THR OG1  1 1 
        3  5821 1 1  69 LYS C    C   1.871  -8.171  -5.524 1.00 . A A .  69 LYS C    1 1 
        3  5822 1 1  69 LYS CA   C   3.182  -8.493  -6.299 1.00 . A A .  69 LYS CA   1 1 
        3  5823 1 1  69 LYS CB   C   3.101  -9.849  -7.110 1.00 . A A .  69 LYS CB   1 1 
        3  5824 1 1  69 LYS CD   C   2.811 -11.576  -5.188 1.00 . A A .  69 LYS CD   1 1 
        3  5825 1 1  69 LYS CE   C   3.334 -12.865  -4.542 1.00 . A A .  69 LYS CE   1 1 
        3  5826 1 1  69 LYS CG   C   3.624 -11.144  -6.420 1.00 . A A .  69 LYS CG   1 1 
        3  5827 1 1  69 LYS H    H   4.190  -8.479  -4.427 1.00 . A A .  69 LYS H    1 1 
        3  5828 1 1  69 LYS HA   H   3.329  -7.692  -7.019 1.00 . A A .  69 LYS HA   1 1 
        3  5829 1 1  69 LYS HB2  H   2.072 -10.021  -7.396 1.00 . A A .  69 LYS HB2  1 1 
        3  5830 1 1  69 LYS HB3  H   3.676  -9.719  -8.027 1.00 . A A .  69 LYS HB3  1 1 
        3  5831 1 1  69 LYS HD2  H   2.851 -10.781  -4.452 1.00 . A A .  69 LYS HD2  1 1 
        3  5832 1 1  69 LYS HD3  H   1.779 -11.727  -5.485 1.00 . A A .  69 LYS HD3  1 1 
        3  5833 1 1  69 LYS HE2  H   3.170 -13.698  -5.214 1.00 . A A .  69 LYS HE2  1 1 
        3  5834 1 1  69 LYS HE3  H   4.398 -12.765  -4.356 1.00 . A A .  69 LYS HE3  1 1 
        3  5835 1 1  69 LYS HG2  H   3.599 -11.950  -7.143 1.00 . A A .  69 LYS HG2  1 1 
        3  5836 1 1  69 LYS HG3  H   4.655 -10.975  -6.120 1.00 . A A .  69 LYS HG3  1 1 
        3  5837 1 1  69 LYS HZ1  H   2.818 -12.360  -2.591 1.00 . A A .  69 LYS HZ1  1 1 
        3  5838 1 1  69 LYS HZ2  H   3.027 -14.020  -2.835 1.00 . A A .  69 LYS HZ2  1 1 
        3  5839 1 1  69 LYS HZ3  H   1.635 -13.256  -3.402 1.00 . A A .  69 LYS HZ3  1 1 
        3  5840 1 1  69 LYS N    N   4.351  -8.454  -5.397 1.00 . A A .  69 LYS N    1 1 
        3  5841 1 1  69 LYS NZ   N   2.654 -13.148  -3.254 1.00 . A A .  69 LYS NZ   1 1 
        3  5842 1 1  69 LYS O    O   1.344  -9.013  -4.799 1.00 . A A .  69 LYS O    1 1 
        3  5843 1 1  70 PRO C    C  -1.153  -6.884  -5.905 1.00 . A A .  70 PRO C    1 1 
        3  5844 1 1  70 PRO CA   C   0.059  -6.525  -5.024 1.00 . A A .  70 PRO CA   1 1 
        3  5845 1 1  70 PRO CB   C   0.233  -5.003  -4.880 1.00 . A A .  70 PRO CB   1 1 
        3  5846 1 1  70 PRO CD   C   1.930  -5.778  -6.389 1.00 . A A .  70 PRO CD   1 1 
        3  5847 1 1  70 PRO CG   C   1.000  -4.610  -6.094 1.00 . A A .  70 PRO CG   1 1 
        3  5848 1 1  70 PRO HA   H  -0.066  -6.976  -4.043 1.00 . A A .  70 PRO HA   1 1 
        3  5849 1 1  70 PRO HB2  H  -0.739  -4.513  -4.830 1.00 . A A .  70 PRO HB2  1 1 
        3  5850 1 1  70 PRO HB3  H   0.786  -4.782  -3.969 1.00 . A A .  70 PRO HB3  1 1 
        3  5851 1 1  70 PRO HD2  H   1.958  -5.991  -7.452 1.00 . A A .  70 PRO HD2  1 1 
        3  5852 1 1  70 PRO HD3  H   2.934  -5.567  -6.032 1.00 . A A .  70 PRO HD3  1 1 
        3  5853 1 1  70 PRO HG2  H   0.319  -4.440  -6.926 1.00 . A A .  70 PRO HG2  1 1 
        3  5854 1 1  70 PRO HG3  H   1.573  -3.708  -5.902 1.00 . A A .  70 PRO HG3  1 1 
        3  5855 1 1  70 PRO N    N   1.335  -6.917  -5.644 1.00 . A A .  70 PRO N    1 1 
        3  5856 1 1  70 PRO O    O  -0.999  -7.378  -7.031 1.00 . A A .  70 PRO O    1 1 
        3  5857 1 1  71 ILE C    C  -3.687  -5.757  -7.213 1.00 . A A .  71 ILE C    1 1 
        3  5858 1 1  71 ILE CA   C  -3.618  -6.807  -6.080 1.00 . A A .  71 ILE CA   1 1 
        3  5859 1 1  71 ILE CB   C  -4.848  -6.690  -5.098 1.00 . A A .  71 ILE CB   1 1 
        3  5860 1 1  71 ILE CD1  C  -5.694  -7.487  -2.757 1.00 . A A .  71 ILE CD1  1 1 
        3  5861 1 1  71 ILE CG1  C  -4.660  -7.649  -3.865 1.00 . A A .  71 ILE CG1  1 1 
        3  5862 1 1  71 ILE CG2  C  -6.183  -6.976  -5.830 1.00 . A A .  71 ILE CG2  1 1 
        3  5863 1 1  71 ILE H    H  -2.385  -6.405  -4.417 1.00 . A A .  71 ILE H    1 1 
        3  5864 1 1  71 ILE HA   H  -3.627  -7.804  -6.517 1.00 . A A .  71 ILE HA   1 1 
        3  5865 1 1  71 ILE HB   H  -4.886  -5.672  -4.735 1.00 . A A .  71 ILE HB   1 1 
        3  5866 1 1  71 ILE HD11 H  -5.470  -8.169  -1.950 1.00 . A A .  71 ILE HD11 1 1 
        3  5867 1 1  71 ILE HD12 H  -6.682  -7.697  -3.145 1.00 . A A .  71 ILE HD12 1 1 
        3  5868 1 1  71 ILE HD13 H  -5.666  -6.470  -2.382 1.00 . A A .  71 ILE HD13 1 1 
        3  5869 1 1  71 ILE HG12 H  -4.707  -8.676  -4.196 1.00 . A A .  71 ILE HG12 1 1 
        3  5870 1 1  71 ILE HG13 H  -3.685  -7.470  -3.423 1.00 . A A .  71 ILE HG13 1 1 
        3  5871 1 1  71 ILE HG21 H  -6.176  -7.982  -6.237 1.00 . A A .  71 ILE HG21 1 1 
        3  5872 1 1  71 ILE HG22 H  -6.315  -6.269  -6.642 1.00 . A A .  71 ILE HG22 1 1 
        3  5873 1 1  71 ILE HG23 H  -7.009  -6.874  -5.139 1.00 . A A .  71 ILE HG23 1 1 
        3  5874 1 1  71 ILE N    N  -2.353  -6.655  -5.359 1.00 . A A .  71 ILE N    1 1 
        3  5875 1 1  71 ILE O    O  -3.797  -4.551  -6.965 1.00 . A A .  71 ILE O    1 1 
        3  5876 1 1  72 GLU C    C  -4.752  -4.629  -9.980 1.00 . A A .  72 GLU C    1 1 
        3  5877 1 1  72 GLU CA   C  -3.482  -5.450  -9.684 1.00 . A A .  72 GLU CA   1 1 
        3  5878 1 1  72 GLU CB   C  -3.176  -6.383 -10.883 1.00 . A A .  72 GLU CB   1 1 
        3  5879 1 1  72 GLU CD   C  -1.775  -8.333 -11.808 1.00 . A A .  72 GLU CD   1 1 
        3  5880 1 1  72 GLU CG   C  -1.950  -7.287 -10.690 1.00 . A A .  72 GLU CG   1 1 
        3  5881 1 1  72 GLU H    H  -3.776  -7.230  -8.549 1.00 . A A .  72 GLU H    1 1 
        3  5882 1 1  72 GLU HA   H  -2.645  -4.778  -9.536 1.00 . A A .  72 GLU HA   1 1 
        3  5883 1 1  72 GLU HB2  H  -4.039  -7.020 -11.060 1.00 . A A .  72 GLU HB2  1 1 
        3  5884 1 1  72 GLU HB3  H  -3.012  -5.774 -11.766 1.00 . A A .  72 GLU HB3  1 1 
        3  5885 1 1  72 GLU HG2  H  -1.066  -6.656 -10.648 1.00 . A A .  72 GLU HG2  1 1 
        3  5886 1 1  72 GLU HG3  H  -2.050  -7.806  -9.743 1.00 . A A .  72 GLU HG3  1 1 
        3  5887 1 1  72 GLU N    N  -3.640  -6.263  -8.455 1.00 . A A .  72 GLU N    1 1 
        3  5888 1 1  72 GLU O    O  -4.721  -3.678 -10.778 1.00 . A A .  72 GLU O    1 1 
        3  5889 1 1  72 GLU OE1  O  -2.710  -9.135 -12.034 1.00 . A A .  72 GLU OE1  1 1 
        3  5890 1 1  72 GLU OE2  O  -0.719  -8.358 -12.468 1.00 . A A .  72 GLU OE2  1 1 
        3  5891 1 1  73 GLU C    C  -7.174  -2.929  -9.185 1.00 . A A .  73 GLU C    1 1 
        3  5892 1 1  73 GLU CA   C  -7.188  -4.447  -9.480 1.00 . A A .  73 GLU CA   1 1 
        3  5893 1 1  73 GLU CB   C  -8.180  -5.184  -8.532 1.00 . A A .  73 GLU CB   1 1 
        3  5894 1 1  73 GLU CD   C -10.270  -4.997 -10.014 1.00 . A A .  73 GLU CD   1 1 
        3  5895 1 1  73 GLU CG   C  -9.654  -4.738  -8.631 1.00 . A A .  73 GLU CG   1 1 
        3  5896 1 1  73 GLU H    H  -5.749  -5.777  -8.696 1.00 . A A .  73 GLU H    1 1 
        3  5897 1 1  73 GLU HA   H  -7.505  -4.607 -10.507 1.00 . A A .  73 GLU HA   1 1 
        3  5898 1 1  73 GLU HB2  H  -8.139  -6.248  -8.745 1.00 . A A .  73 GLU HB2  1 1 
        3  5899 1 1  73 GLU HB3  H  -7.853  -5.034  -7.507 1.00 . A A .  73 GLU HB3  1 1 
        3  5900 1 1  73 GLU HG2  H -10.234  -5.278  -7.885 1.00 . A A .  73 GLU HG2  1 1 
        3  5901 1 1  73 GLU HG3  H  -9.711  -3.675  -8.408 1.00 . A A .  73 GLU HG3  1 1 
        3  5902 1 1  73 GLU N    N  -5.856  -5.036  -9.327 1.00 . A A .  73 GLU N    1 1 
        3  5903 1 1  73 GLU O    O  -7.728  -2.137  -9.953 1.00 . A A .  73 GLU O    1 1 
        3  5904 1 1  73 GLU OE1  O -10.689  -6.144 -10.280 1.00 . A A .  73 GLU OE1  1 1 
        3  5905 1 1  73 GLU OE2  O -10.331  -4.065 -10.845 1.00 . A A .  73 GLU OE2  1 1 
        3  5906 1 1  74 GLU C    C  -5.079  -0.613  -7.391 1.00 . A A .  74 GLU C    1 1 
        3  5907 1 1  74 GLU CA   C  -6.513  -1.130  -7.590 1.00 . A A .  74 GLU CA   1 1 
        3  5908 1 1  74 GLU CB   C  -7.374  -1.000  -6.302 1.00 . A A .  74 GLU CB   1 1 
        3  5909 1 1  74 GLU CD   C  -9.741  -1.103  -5.302 1.00 . A A .  74 GLU CD   1 1 
        3  5910 1 1  74 GLU CG   C  -8.862  -1.349  -6.526 1.00 . A A .  74 GLU CG   1 1 
        3  5911 1 1  74 GLU H    H  -6.062  -3.213  -7.533 1.00 . A A .  74 GLU H    1 1 
        3  5912 1 1  74 GLU HA   H  -6.966  -0.511  -8.364 1.00 . A A .  74 GLU HA   1 1 
        3  5913 1 1  74 GLU HB2  H  -6.980  -1.664  -5.539 1.00 . A A .  74 GLU HB2  1 1 
        3  5914 1 1  74 GLU HB3  H  -7.315   0.025  -5.940 1.00 . A A .  74 GLU HB3  1 1 
        3  5915 1 1  74 GLU HG2  H  -9.236  -0.749  -7.351 1.00 . A A .  74 GLU HG2  1 1 
        3  5916 1 1  74 GLU HG3  H  -8.935  -2.398  -6.807 1.00 . A A .  74 GLU HG3  1 1 
        3  5917 1 1  74 GLU N    N  -6.527  -2.536  -8.066 1.00 . A A .  74 GLU N    1 1 
        3  5918 1 1  74 GLU O    O  -4.854   0.379  -6.680 1.00 . A A .  74 GLU O    1 1 
        3  5919 1 1  74 GLU OE1  O  -9.850  -1.998  -4.435 1.00 . A A .  74 GLU OE1  1 1 
        3  5920 1 1  74 GLU OE2  O -10.344  -0.015  -5.203 1.00 . A A .  74 GLU OE2  1 1 
        3  5921 1 1  75 VAL C    C  -2.335  -0.576  -9.595 1.00 . A A .  75 VAL C    1 1 
        3  5922 1 1  75 VAL CA   C  -2.718  -0.817  -8.121 1.00 . A A .  75 VAL CA   1 1 
        3  5923 1 1  75 VAL CB   C  -1.704  -1.800  -7.425 1.00 . A A .  75 VAL CB   1 1 
        3  5924 1 1  75 VAL CG1  C  -0.242  -1.310  -7.622 1.00 . A A .  75 VAL CG1  1 1 
        3  5925 1 1  75 VAL CG2  C  -2.035  -1.943  -5.911 1.00 . A A .  75 VAL CG2  1 1 
        3  5926 1 1  75 VAL H    H  -4.342  -2.113  -8.504 1.00 . A A .  75 VAL H    1 1 
        3  5927 1 1  75 VAL HA   H  -2.657   0.138  -7.602 1.00 . A A .  75 VAL HA   1 1 
        3  5928 1 1  75 VAL HB   H  -1.802  -2.782  -7.886 1.00 . A A .  75 VAL HB   1 1 
        3  5929 1 1  75 VAL HG11 H  -0.145  -0.299  -7.239 1.00 . A A .  75 VAL HG11 1 1 
        3  5930 1 1  75 VAL HG12 H   0.012  -1.312  -8.678 1.00 . A A .  75 VAL HG12 1 1 
        3  5931 1 1  75 VAL HG13 H   0.439  -1.962  -7.093 1.00 . A A .  75 VAL HG13 1 1 
        3  5932 1 1  75 VAL HG21 H  -1.955  -0.974  -5.432 1.00 . A A .  75 VAL HG21 1 1 
        3  5933 1 1  75 VAL HG22 H  -1.338  -2.628  -5.444 1.00 . A A .  75 VAL HG22 1 1 
        3  5934 1 1  75 VAL HG23 H  -3.044  -2.320  -5.780 1.00 . A A .  75 VAL HG23 1 1 
        3  5935 1 1  75 VAL N    N  -4.109  -1.282  -8.045 1.00 . A A .  75 VAL N    1 1 
        3  5936 1 1  75 VAL O    O  -2.388  -1.489 -10.425 1.00 . A A .  75 VAL O    1 1 
        3  5937 1 1  76 GLU C    C  -0.181   1.773 -11.155 1.00 . A A .  76 GLU C    1 1 
        3  5938 1 1  76 GLU CA   C  -1.571   1.135 -11.236 1.00 . A A .  76 GLU CA   1 1 
        3  5939 1 1  76 GLU CB   C  -2.602   2.175 -11.755 1.00 . A A .  76 GLU CB   1 1 
        3  5940 1 1  76 GLU CD   C  -3.117   4.035 -13.441 1.00 . A A .  76 GLU CD   1 1 
        3  5941 1 1  76 GLU CG   C  -2.262   2.796 -13.123 1.00 . A A .  76 GLU CG   1 1 
        3  5942 1 1  76 GLU H    H  -1.920   1.326  -9.157 1.00 . A A .  76 GLU H    1 1 
        3  5943 1 1  76 GLU HA   H  -1.541   0.283 -11.913 1.00 . A A .  76 GLU HA   1 1 
        3  5944 1 1  76 GLU HB2  H  -3.571   1.694 -11.837 1.00 . A A .  76 GLU HB2  1 1 
        3  5945 1 1  76 GLU HB3  H  -2.682   2.979 -11.026 1.00 . A A .  76 GLU HB3  1 1 
        3  5946 1 1  76 GLU HG2  H  -1.213   3.080 -13.131 1.00 . A A .  76 GLU HG2  1 1 
        3  5947 1 1  76 GLU HG3  H  -2.423   2.047 -13.891 1.00 . A A .  76 GLU HG3  1 1 
        3  5948 1 1  76 GLU N    N  -1.955   0.675  -9.889 1.00 . A A .  76 GLU N    1 1 
        3  5949 1 1  76 GLU O    O   0.036   2.641 -10.327 1.00 . A A .  76 GLU O    1 1 
        3  5950 1 1  76 GLU OE1  O  -2.716   5.160 -13.076 1.00 . A A .  76 GLU OE1  1 1 
        3  5951 1 1  76 GLU OE2  O  -4.195   3.893 -14.048 1.00 . A A .  76 GLU OE2  1 1 
        3  5952 1 1  77 GLU C    C   2.181   3.036 -13.139 1.00 . A A .  77 GLU C    1 1 
        3  5953 1 1  77 GLU CA   C   2.112   1.928 -12.060 1.00 . A A .  77 GLU CA   1 1 
        3  5954 1 1  77 GLU CB   C   3.164   0.810 -12.314 1.00 . A A .  77 GLU CB   1 1 
        3  5955 1 1  77 GLU CD   C   4.014  -1.105 -13.814 1.00 . A A .  77 GLU CD   1 1 
        3  5956 1 1  77 GLU CG   C   2.904  -0.067 -13.553 1.00 . A A .  77 GLU CG   1 1 
        3  5957 1 1  77 GLU H    H   0.541   0.603 -12.613 1.00 . A A .  77 GLU H    1 1 
        3  5958 1 1  77 GLU HA   H   2.322   2.382 -11.090 1.00 . A A .  77 GLU HA   1 1 
        3  5959 1 1  77 GLU HB2  H   4.139   1.268 -12.426 1.00 . A A .  77 GLU HB2  1 1 
        3  5960 1 1  77 GLU HB3  H   3.192   0.160 -11.444 1.00 . A A .  77 GLU HB3  1 1 
        3  5961 1 1  77 GLU HG2  H   1.960  -0.583 -13.420 1.00 . A A .  77 GLU HG2  1 1 
        3  5962 1 1  77 GLU HG3  H   2.821   0.582 -14.423 1.00 . A A .  77 GLU HG3  1 1 
        3  5963 1 1  77 GLU N    N   0.757   1.339 -12.003 1.00 . A A .  77 GLU N    1 1 
        3  5964 1 1  77 GLU O    O   1.615   2.884 -14.224 1.00 . A A .  77 GLU O    1 1 
        3  5965 1 1  77 GLU OE1  O   5.017  -0.752 -14.464 1.00 . A A .  77 GLU OE1  1 1 
        3  5966 1 1  77 GLU OE2  O   3.881  -2.272 -13.368 1.00 . A A .  77 GLU OE2  1 1 
        3  5967 1 1  78 LYS C    C   4.513   5.812 -13.624 1.00 . A A .  78 LYS C    1 1 
        3  5968 1 1  78 LYS CA   C   3.067   5.301 -13.742 1.00 . A A .  78 LYS CA   1 1 
        3  5969 1 1  78 LYS CB   C   2.080   6.477 -13.480 1.00 . A A .  78 LYS CB   1 1 
        3  5970 1 1  78 LYS CD   C  -0.296   7.471 -13.819 1.00 . A A .  78 LYS CD   1 1 
        3  5971 1 1  78 LYS CE   C  -0.146   8.344 -15.088 1.00 . A A .  78 LYS CE   1 1 
        3  5972 1 1  78 LYS CG   C   0.590   6.187 -13.796 1.00 . A A .  78 LYS CG   1 1 
        3  5973 1 1  78 LYS H    H   3.248   4.223 -11.915 1.00 . A A .  78 LYS H    1 1 
        3  5974 1 1  78 LYS HA   H   2.916   4.938 -14.756 1.00 . A A .  78 LYS HA   1 1 
        3  5975 1 1  78 LYS HB2  H   2.152   6.764 -12.435 1.00 . A A .  78 LYS HB2  1 1 
        3  5976 1 1  78 LYS HB3  H   2.389   7.325 -14.086 1.00 . A A .  78 LYS HB3  1 1 
        3  5977 1 1  78 LYS HD2  H  -1.336   7.177 -13.736 1.00 . A A .  78 LYS HD2  1 1 
        3  5978 1 1  78 LYS HD3  H  -0.043   8.077 -12.953 1.00 . A A .  78 LYS HD3  1 1 
        3  5979 1 1  78 LYS HE2  H  -0.337   7.733 -15.961 1.00 . A A .  78 LYS HE2  1 1 
        3  5980 1 1  78 LYS HE3  H  -0.883   9.141 -15.055 1.00 . A A .  78 LYS HE3  1 1 
        3  5981 1 1  78 LYS HG2  H   0.523   5.696 -14.762 1.00 . A A .  78 LYS HG2  1 1 
        3  5982 1 1  78 LYS HG3  H   0.201   5.509 -13.038 1.00 . A A .  78 LYS HG3  1 1 
        3  5983 1 1  78 LYS HZ1  H   1.463   9.480 -14.382 1.00 . A A .  78 LYS HZ1  1 1 
        3  5984 1 1  78 LYS HZ2  H   1.206   9.609 -16.048 1.00 . A A .  78 LYS HZ2  1 1 
        3  5985 1 1  78 LYS HZ3  H   1.909   8.215 -15.412 1.00 . A A .  78 LYS HZ3  1 1 
        3  5986 1 1  78 LYS N    N   2.857   4.162 -12.812 1.00 . A A .  78 LYS N    1 1 
        3  5987 1 1  78 LYS NZ   N   1.200   8.955 -15.240 1.00 . A A .  78 LYS NZ   1 1 
        3  5988 1 1  78 LYS O    O   5.010   6.044 -12.524 1.00 . A A .  78 LYS O    1 1 
        3  5989 1 1  79 LEU C    C   6.754   7.893 -14.462 1.00 . A A .  79 LEU C    1 1 
        3  5990 1 1  79 LEU CA   C   6.561   6.417 -14.888 1.00 . A A .  79 LEU CA   1 1 
        3  5991 1 1  79 LEU CB   C   7.052   6.203 -16.343 1.00 . A A .  79 LEU CB   1 1 
        3  5992 1 1  79 LEU CD1  C   9.504   5.638 -15.844 1.00 . A A .  79 LEU CD1  1 1 
        3  5993 1 1  79 LEU CD2  C   8.816   6.481 -18.170 1.00 . A A .  79 LEU CD2  1 1 
        3  5994 1 1  79 LEU CG   C   8.544   6.549 -16.647 1.00 . A A .  79 LEU CG   1 1 
        3  5995 1 1  79 LEU H    H   4.668   5.821 -15.591 1.00 . A A .  79 LEU H    1 1 
        3  5996 1 1  79 LEU HA   H   7.146   5.780 -14.227 1.00 . A A .  79 LEU HA   1 1 
        3  5997 1 1  79 LEU HB2  H   6.892   5.159 -16.593 1.00 . A A .  79 LEU HB2  1 1 
        3  5998 1 1  79 LEU HB3  H   6.426   6.799 -16.998 1.00 . A A .  79 LEU HB3  1 1 
        3  5999 1 1  79 LEU HD11 H   9.377   4.609 -16.153 1.00 . A A .  79 LEU HD11 1 1 
        3  6000 1 1  79 LEU HD12 H   9.286   5.716 -14.781 1.00 . A A .  79 LEU HD12 1 1 
        3  6001 1 1  79 LEU HD13 H  10.526   5.942 -16.017 1.00 . A A .  79 LEU HD13 1 1 
        3  6002 1 1  79 LEU HD21 H   9.827   6.803 -18.376 1.00 . A A .  79 LEU HD21 1 1 
        3  6003 1 1  79 LEU HD22 H   8.126   7.131 -18.695 1.00 . A A .  79 LEU HD22 1 1 
        3  6004 1 1  79 LEU HD23 H   8.688   5.465 -18.524 1.00 . A A .  79 LEU HD23 1 1 
        3  6005 1 1  79 LEU HG   H   8.736   7.569 -16.330 1.00 . A A .  79 LEU HG   1 1 
        3  6006 1 1  79 LEU N    N   5.158   5.992 -14.776 1.00 . A A .  79 LEU N    1 1 
        3  6007 1 1  79 LEU O    O   5.907   8.752 -14.715 1.00 . A A .  79 LEU O    1 1 
        3  6008 1 1  80 ASP C    C   9.869   9.571 -13.457 1.00 . A A .  80 ASP C    1 1 
        3  6009 1 1  80 ASP CA   C   8.328   9.451 -13.309 1.00 . A A .  80 ASP CA   1 1 
        3  6010 1 1  80 ASP CB   C   7.880   9.573 -11.822 1.00 . A A .  80 ASP CB   1 1 
        3  6011 1 1  80 ASP CG   C   8.259  10.909 -11.163 1.00 . A A .  80 ASP CG   1 1 
        3  6012 1 1  80 ASP H    H   8.480   7.385 -13.660 1.00 . A A .  80 ASP H    1 1 
        3  6013 1 1  80 ASP HA   H   7.853  10.231 -13.903 1.00 . A A .  80 ASP HA   1 1 
        3  6014 1 1  80 ASP HB2  H   6.800   9.464 -11.771 1.00 . A A .  80 ASP HB2  1 1 
        3  6015 1 1  80 ASP HB3  H   8.326   8.760 -11.256 1.00 . A A .  80 ASP HB3  1 1 
        3  6016 1 1  80 ASP N    N   7.897   8.141 -13.823 1.00 . A A .  80 ASP N    1 1 
        3  6017 1 1  80 ASP O    O  10.541   8.563 -13.723 1.00 . A A .  80 ASP O    1 1 
        3  6018 1 1  80 ASP OD1  O   7.614  11.937 -11.459 1.00 . A A .  80 ASP OD1  1 1 
        3  6019 1 1  80 ASP OD2  O   9.228  10.944 -10.380 1.00 . A A .  80 ASP OD2  1 1 
        3  6020 1 1  81 THR C    C  12.341  10.742 -14.896 1.00 . A A .  81 THR C    1 1 
        3  6021 1 1  81 THR CA   C  11.874  11.102 -13.457 1.00 . A A .  81 THR CA   1 1 
        3  6022 1 1  81 THR CB   C  12.725  10.381 -12.341 1.00 . A A .  81 THR CB   1 1 
        3  6023 1 1  81 THR CG2  C  14.158  10.933 -12.219 1.00 . A A .  81 THR CG2  1 1 
        3  6024 1 1  81 THR H    H   9.820  11.550 -13.081 1.00 . A A .  81 THR H    1 1 
        3  6025 1 1  81 THR HA   H  11.990  12.173 -13.332 1.00 . A A .  81 THR HA   1 1 
        3  6026 1 1  81 THR HB   H  12.774   9.320 -12.566 1.00 . A A .  81 THR HB   1 1 
        3  6027 1 1  81 THR HG1  H  11.149  10.302 -11.143 1.00 . A A .  81 THR HG1  1 1 
        3  6028 1 1  81 THR HG21 H  14.687  10.792 -13.156 1.00 . A A .  81 THR HG21 1 1 
        3  6029 1 1  81 THR HG22 H  14.683  10.408 -11.433 1.00 . A A .  81 THR HG22 1 1 
        3  6030 1 1  81 THR HG23 H  14.125  11.989 -11.984 1.00 . A A .  81 THR HG23 1 1 
        3  6031 1 1  81 THR N    N  10.418  10.805 -13.306 1.00 . A A .  81 THR N    1 1 
        3  6032 1 1  81 THR O    O  13.486  10.357 -15.150 1.00 . A A .  81 THR O    1 1 
        3  6033 1 1  81 THR OG1  O  12.078  10.549 -11.066 1.00 . A A .  81 THR OG1  1 1 
        3  6034 1 1  82 SER C    C  12.622  11.360 -18.064 1.00 . A A .  82 SER C    1 1 
        3  6035 1 1  82 SER CA   C  11.535  10.593 -17.260 1.00 . A A .  82 SER CA   1 1 
        3  6036 1 1  82 SER CB   C  10.144  10.733 -17.914 1.00 . A A .  82 SER CB   1 1 
        3  6037 1 1  82 SER H    H  10.634  11.505 -15.582 1.00 . A A .  82 SER H    1 1 
        3  6038 1 1  82 SER HA   H  11.801   9.539 -17.265 1.00 . A A .  82 SER HA   1 1 
        3  6039 1 1  82 SER HB2  H  10.218  10.574 -18.982 1.00 . A A .  82 SER HB2  1 1 
        3  6040 1 1  82 SER HB3  H   9.471   9.994 -17.492 1.00 . A A .  82 SER HB3  1 1 
        3  6041 1 1  82 SER HG   H   8.646  11.999 -17.875 1.00 . A A .  82 SER HG   1 1 
        3  6042 1 1  82 SER N    N  11.430  11.003 -15.847 1.00 . A A .  82 SER N    1 1 
        3  6043 1 1  82 SER O    O  12.733  11.180 -19.280 1.00 . A A .  82 SER O    1 1 
        3  6044 1 1  82 SER OG   O   9.593  12.020 -17.682 1.00 . A A .  82 SER OG   1 1 
        3  6045 1 1  83 HIS C    C  15.782  12.156 -18.326 1.00 . A A .  83 HIS C    1 1 
        3  6046 1 1  83 HIS CA   C  14.506  13.005 -18.020 1.00 . A A .  83 HIS CA   1 1 
        3  6047 1 1  83 HIS CB   C  14.869  14.190 -17.079 1.00 . A A .  83 HIS CB   1 1 
        3  6048 1 1  83 HIS CD2  C  12.873  15.872 -17.242 1.00 . A A .  83 HIS CD2  1 1 
        3  6049 1 1  83 HIS CE1  C  12.182  15.745 -15.172 1.00 . A A .  83 HIS CE1  1 1 
        3  6050 1 1  83 HIS CG   C  13.687  14.996 -16.595 1.00 . A A .  83 HIS CG   1 1 
        3  6051 1 1  83 HIS H    H  13.312  12.275 -16.426 1.00 . A A .  83 HIS H    1 1 
        3  6052 1 1  83 HIS HA   H  14.125  13.406 -18.955 1.00 . A A .  83 HIS HA   1 1 
        3  6053 1 1  83 HIS HB2  H  15.379  13.805 -16.202 1.00 . A A .  83 HIS HB2  1 1 
        3  6054 1 1  83 HIS HB3  H  15.540  14.866 -17.597 1.00 . A A .  83 HIS HB3  1 1 
        3  6055 1 1  83 HIS HD1  H  13.613  14.415 -14.568 1.00 . A A .  83 HIS HD1  1 1 
        3  6056 1 1  83 HIS HD2  H  12.943  16.164 -18.282 1.00 . A A .  83 HIS HD2  1 1 
        3  6057 1 1  83 HIS HE1  H  11.617  15.905 -14.260 1.00 . A A .  83 HIS HE1  1 1 
        3  6058 1 1  83 HIS HE2  H  11.134  16.822 -16.555 1.00 . A A .  83 HIS HE2  1 1 
        3  6059 1 1  83 HIS N    N  13.432  12.196 -17.389 1.00 . A A .  83 HIS N    1 1 
        3  6060 1 1  83 HIS ND1  N  13.222  14.945 -15.299 1.00 . A A .  83 HIS ND1  1 1 
        3  6061 1 1  83 HIS NE2  N  11.949  16.320 -16.334 1.00 . A A .  83 HIS NE2  1 1 
        3  6062 1 1  83 HIS O    O  16.907  12.690 -18.338 1.00 . A A .  83 HIS O    1 1 
        3  6063 1 1  84 GLY C    C  16.942   8.923 -17.753 1.00 . A A .  84 GLY C    1 1 
        3  6064 1 1  84 GLY CA   C  16.730   9.935 -18.872 1.00 . A A .  84 GLY CA   1 1 
        3  6065 1 1  84 GLY H    H  14.698  10.486 -18.653 1.00 . A A .  84 GLY H    1 1 
        3  6066 1 1  84 GLY HA2  H  16.524   9.398 -19.786 1.00 . A A .  84 GLY HA2  1 1 
        3  6067 1 1  84 GLY HA3  H  17.647  10.506 -19.007 1.00 . A A .  84 GLY HA3  1 1 
        3  6068 1 1  84 GLY N    N  15.607  10.845 -18.608 1.00 . A A .  84 GLY N    1 1 
        3  6069 1 1  84 GLY O    O  18.041   8.366 -17.617 1.00 . A A .  84 GLY O    1 1 
        3  6070 1 1  85 MET C    C  14.634   7.026 -15.562 1.00 . A A .  85 MET C    1 1 
        3  6071 1 1  85 MET CA   C  15.969   7.756 -15.788 1.00 . A A .  85 MET CA   1 1 
        3  6072 1 1  85 MET CB   C  16.390   8.559 -14.518 1.00 . A A .  85 MET CB   1 1 
        3  6073 1 1  85 MET CE   C  18.915   8.723 -12.468 1.00 . A A .  85 MET CE   1 1 
        3  6074 1 1  85 MET CG   C  16.406   7.765 -13.202 1.00 . A A .  85 MET CG   1 1 
        3  6075 1 1  85 MET H    H  15.028   9.104 -17.145 1.00 . A A .  85 MET H    1 1 
        3  6076 1 1  85 MET HA   H  16.735   7.013 -16.004 1.00 . A A .  85 MET HA   1 1 
        3  6077 1 1  85 MET HB2  H  17.387   8.953 -14.678 1.00 . A A .  85 MET HB2  1 1 
        3  6078 1 1  85 MET HB3  H  15.714   9.400 -14.395 1.00 . A A .  85 MET HB3  1 1 
        3  6079 1 1  85 MET HE1  H  18.939   9.282 -13.391 1.00 . A A .  85 MET HE1  1 1 
        3  6080 1 1  85 MET HE2  H  19.279   7.722 -12.641 1.00 . A A .  85 MET HE2  1 1 
        3  6081 1 1  85 MET HE3  H  19.544   9.211 -11.737 1.00 . A A .  85 MET HE3  1 1 
        3  6082 1 1  85 MET HG2  H  15.386   7.559 -12.900 1.00 . A A .  85 MET HG2  1 1 
        3  6083 1 1  85 MET HG3  H  16.920   6.824 -13.362 1.00 . A A .  85 MET HG3  1 1 
        3  6084 1 1  85 MET N    N  15.885   8.668 -16.950 1.00 . A A .  85 MET N    1 1 
        3  6085 1 1  85 MET O    O  13.565   7.631 -15.669 1.00 . A A .  85 MET O    1 1 
        3  6086 1 1  85 MET SD   S  17.229   8.646 -11.855 1.00 . A A .  85 MET SD   1 1 
        3  6087 1 1  86 ILE C    C  13.287   5.018 -13.360 1.00 . A A .  86 ILE C    1 1 
        3  6088 1 1  86 ILE CA   C  13.528   4.915 -14.877 1.00 . A A .  86 ILE CA   1 1 
        3  6089 1 1  86 ILE CB   C  13.680   3.393 -15.281 1.00 . A A .  86 ILE CB   1 1 
        3  6090 1 1  86 ILE CD1  C  12.674   3.662 -17.658 1.00 . A A .  86 ILE CD1  1 1 
        3  6091 1 1  86 ILE CG1  C  13.871   3.241 -16.820 1.00 . A A .  86 ILE CG1  1 1 
        3  6092 1 1  86 ILE CG2  C  12.477   2.529 -14.781 1.00 . A A .  86 ILE CG2  1 1 
        3  6093 1 1  86 ILE H    H  15.588   5.284 -15.246 1.00 . A A .  86 ILE H    1 1 
        3  6094 1 1  86 ILE HA   H  12.666   5.321 -15.407 1.00 . A A .  86 ILE HA   1 1 
        3  6095 1 1  86 ILE HB   H  14.570   3.017 -14.789 1.00 . A A .  86 ILE HB   1 1 
        3  6096 1 1  86 ILE HD11 H  12.921   3.552 -18.700 1.00 . A A .  86 ILE HD11 1 1 
        3  6097 1 1  86 ILE HD12 H  12.431   4.697 -17.455 1.00 . A A .  86 ILE HD12 1 1 
        3  6098 1 1  86 ILE HD13 H  11.824   3.037 -17.422 1.00 . A A .  86 ILE HD13 1 1 
        3  6099 1 1  86 ILE HG12 H  14.714   3.845 -17.135 1.00 . A A .  86 ILE HG12 1 1 
        3  6100 1 1  86 ILE HG13 H  14.085   2.206 -17.051 1.00 . A A .  86 ILE HG13 1 1 
        3  6101 1 1  86 ILE HG21 H  12.619   1.498 -15.079 1.00 . A A .  86 ILE HG21 1 1 
        3  6102 1 1  86 ILE HG22 H  11.553   2.897 -15.207 1.00 . A A .  86 ILE HG22 1 1 
        3  6103 1 1  86 ILE HG23 H  12.410   2.580 -13.699 1.00 . A A .  86 ILE HG23 1 1 
        3  6104 1 1  86 ILE N    N  14.708   5.717 -15.243 1.00 . A A .  86 ILE N    1 1 
        3  6105 1 1  86 ILE O    O  14.098   4.544 -12.562 1.00 . A A .  86 ILE O    1 1 
        3  6106 1 1  87 ARG C    C  10.100   5.578 -11.823 1.00 . A A .  87 ARG C    1 1 
        3  6107 1 1  87 ARG CA   C  11.607   5.686 -11.632 1.00 . A A .  87 ARG CA   1 1 
        3  6108 1 1  87 ARG CB   C  11.935   7.000 -10.858 1.00 . A A .  87 ARG CB   1 1 
        3  6109 1 1  87 ARG CD   C  13.908   6.286  -9.325 1.00 . A A .  87 ARG CD   1 1 
        3  6110 1 1  87 ARG CG   C  13.418   7.219 -10.461 1.00 . A A .  87 ARG CG   1 1 
        3  6111 1 1  87 ARG CZ   C  14.927   4.010  -9.149 1.00 . A A .  87 ARG CZ   1 1 
        3  6112 1 1  87 ARG H    H  11.644   6.111 -13.686 1.00 . A A .  87 ARG H    1 1 
        3  6113 1 1  87 ARG HA   H  11.971   4.820 -11.075 1.00 . A A .  87 ARG HA   1 1 
        3  6114 1 1  87 ARG HB2  H  11.634   7.845 -11.471 1.00 . A A .  87 ARG HB2  1 1 
        3  6115 1 1  87 ARG HB3  H  11.341   7.021  -9.943 1.00 . A A .  87 ARG HB3  1 1 
        3  6116 1 1  87 ARG HD2  H  14.837   6.689  -8.932 1.00 . A A .  87 ARG HD2  1 1 
        3  6117 1 1  87 ARG HD3  H  13.173   6.276  -8.533 1.00 . A A .  87 ARG HD3  1 1 
        3  6118 1 1  87 ARG HE   H  13.726   4.626 -10.603 1.00 . A A .  87 ARG HE   1 1 
        3  6119 1 1  87 ARG HG2  H  14.041   7.055 -11.336 1.00 . A A .  87 ARG HG2  1 1 
        3  6120 1 1  87 ARG HG3  H  13.537   8.252 -10.140 1.00 . A A .  87 ARG HG3  1 1 
        3  6121 1 1  87 ARG HH11 H  15.346   5.185  -7.544 1.00 . A A .  87 ARG HH11 1 1 
        3  6122 1 1  87 ARG HH12 H  16.098   3.623  -7.534 1.00 . A A .  87 ARG HH12 1 1 
        3  6123 1 1  87 ARG HH21 H  14.722   2.614 -10.588 1.00 . A A .  87 ARG HH21 1 1 
        3  6124 1 1  87 ARG HH22 H  15.728   2.155  -9.245 1.00 . A A .  87 ARG HH22 1 1 
        3  6125 1 1  87 ARG N    N  12.174   5.662 -12.992 1.00 . A A .  87 ARG N    1 1 
        3  6126 1 1  87 ARG NE   N  14.146   4.898  -9.770 1.00 . A A .  87 ARG NE   1 1 
        3  6127 1 1  87 ARG NH1  N  15.499   4.294  -7.981 1.00 . A A .  87 ARG NH1  1 1 
        3  6128 1 1  87 ARG NH2  N  15.137   2.833  -9.704 1.00 . A A .  87 ARG NH2  1 1 
        3  6129 1 1  87 ARG O    O   9.573   6.189 -12.726 1.00 . A A .  87 ARG O    1 1 
        3  6130 1 1  88 THR C    C   7.245   4.787  -9.851 1.00 . A A .  88 THR C    1 1 
        3  6131 1 1  88 THR CA   C   7.966   4.563 -11.188 1.00 . A A .  88 THR CA   1 1 
        3  6132 1 1  88 THR CB   C   7.709   3.126 -11.762 1.00 . A A .  88 THR CB   1 1 
        3  6133 1 1  88 THR CG2  C   6.227   2.881 -12.101 1.00 . A A .  88 THR CG2  1 1 
        3  6134 1 1  88 THR H    H   9.878   4.354 -10.282 1.00 . A A .  88 THR H    1 1 
        3  6135 1 1  88 THR HA   H   7.576   5.290 -11.907 1.00 . A A .  88 THR HA   1 1 
        3  6136 1 1  88 THR HB   H   8.025   2.393 -11.027 1.00 . A A .  88 THR HB   1 1 
        3  6137 1 1  88 THR HG1  H   8.701   3.798 -13.335 1.00 . A A .  88 THR HG1  1 1 
        3  6138 1 1  88 THR HG21 H   5.902   3.600 -12.843 1.00 . A A .  88 THR HG21 1 1 
        3  6139 1 1  88 THR HG22 H   5.620   2.990 -11.209 1.00 . A A .  88 THR HG22 1 1 
        3  6140 1 1  88 THR HG23 H   6.100   1.883 -12.497 1.00 . A A .  88 THR HG23 1 1 
        3  6141 1 1  88 THR N    N   9.412   4.791 -11.019 1.00 . A A .  88 THR N    1 1 
        3  6142 1 1  88 THR O    O   7.795   4.518  -8.801 1.00 . A A .  88 THR O    1 1 
        3  6143 1 1  88 THR OG1  O   8.497   2.939 -12.952 1.00 . A A .  88 THR OG1  1 1 
        3  6144 1 1  89 GLU C    C   3.867   4.832  -8.935 1.00 . A A .  89 GLU C    1 1 
        3  6145 1 1  89 GLU CA   C   5.193   5.550  -8.706 1.00 . A A .  89 GLU CA   1 1 
        3  6146 1 1  89 GLU CB   C   4.951   7.059  -8.455 1.00 . A A .  89 GLU CB   1 1 
        3  6147 1 1  89 GLU CD   C   5.954   9.420  -8.308 1.00 . A A .  89 GLU CD   1 1 
        3  6148 1 1  89 GLU CG   C   6.234   7.910  -8.345 1.00 . A A .  89 GLU CG   1 1 
        3  6149 1 1  89 GLU H    H   5.753   5.731 -10.755 1.00 . A A .  89 GLU H    1 1 
        3  6150 1 1  89 GLU HA   H   5.687   5.117  -7.836 1.00 . A A .  89 GLU HA   1 1 
        3  6151 1 1  89 GLU HB2  H   4.360   7.456  -9.277 1.00 . A A .  89 GLU HB2  1 1 
        3  6152 1 1  89 GLU HB3  H   4.386   7.173  -7.535 1.00 . A A .  89 GLU HB3  1 1 
        3  6153 1 1  89 GLU HG2  H   6.760   7.614  -7.443 1.00 . A A .  89 GLU HG2  1 1 
        3  6154 1 1  89 GLU HG3  H   6.867   7.698  -9.203 1.00 . A A .  89 GLU HG3  1 1 
        3  6155 1 1  89 GLU N    N   6.053   5.369  -9.897 1.00 . A A .  89 GLU N    1 1 
        3  6156 1 1  89 GLU O    O   3.289   4.938 -10.025 1.00 . A A .  89 GLU O    1 1 
        3  6157 1 1  89 GLU OE1  O   5.329   9.932  -9.255 1.00 . A A .  89 GLU OE1  1 1 
        3  6158 1 1  89 GLU OE2  O   6.332  10.098  -7.328 1.00 . A A .  89 GLU OE2  1 1 
        3  6159 1 1  90 VAL C    C   0.983   4.316  -7.432 1.00 . A A .  90 VAL C    1 1 
        3  6160 1 1  90 VAL CA   C   2.083   3.416  -8.009 1.00 . A A .  90 VAL CA   1 1 
        3  6161 1 1  90 VAL CB   C   2.080   1.982  -7.353 1.00 . A A .  90 VAL CB   1 1 
        3  6162 1 1  90 VAL CG1  C   2.930   1.017  -8.206 1.00 . A A .  90 VAL CG1  1 1 
        3  6163 1 1  90 VAL CG2  C   2.567   1.995  -5.893 1.00 . A A .  90 VAL CG2  1 1 
        3  6164 1 1  90 VAL H    H   3.858   4.071  -7.069 1.00 . A A .  90 VAL H    1 1 
        3  6165 1 1  90 VAL HA   H   1.868   3.273  -9.075 1.00 . A A .  90 VAL HA   1 1 
        3  6166 1 1  90 VAL HB   H   1.055   1.612  -7.361 1.00 . A A .  90 VAL HB   1 1 
        3  6167 1 1  90 VAL HG11 H   3.957   1.370  -8.249 1.00 . A A .  90 VAL HG11 1 1 
        3  6168 1 1  90 VAL HG12 H   2.528   0.959  -9.212 1.00 . A A .  90 VAL HG12 1 1 
        3  6169 1 1  90 VAL HG13 H   2.914   0.026  -7.765 1.00 . A A .  90 VAL HG13 1 1 
        3  6170 1 1  90 VAL HG21 H   2.515   0.999  -5.474 1.00 . A A .  90 VAL HG21 1 1 
        3  6171 1 1  90 VAL HG22 H   1.946   2.663  -5.302 1.00 . A A .  90 VAL HG22 1 1 
        3  6172 1 1  90 VAL HG23 H   3.593   2.346  -5.850 1.00 . A A .  90 VAL HG23 1 1 
        3  6173 1 1  90 VAL N    N   3.375   4.102  -7.916 1.00 . A A .  90 VAL N    1 1 
        3  6174 1 1  90 VAL O    O   1.062   4.802  -6.300 1.00 . A A .  90 VAL O    1 1 
        3  6175 1 1  91 ARG C    C  -2.257   5.125  -8.976 1.00 . A A .  91 ARG C    1 1 
        3  6176 1 1  91 ARG CA   C  -1.117   5.468  -8.011 1.00 . A A .  91 ARG CA   1 1 
        3  6177 1 1  91 ARG CB   C  -0.630   6.940  -8.173 1.00 . A A .  91 ARG CB   1 1 
        3  6178 1 1  91 ARG CD   C  -0.808   8.289 -10.380 1.00 . A A .  91 ARG CD   1 1 
        3  6179 1 1  91 ARG CG   C   0.053   7.334  -9.518 1.00 . A A .  91 ARG CG   1 1 
        3  6180 1 1  91 ARG CZ   C  -3.210   8.088 -11.136 1.00 . A A .  91 ARG CZ   1 1 
        3  6181 1 1  91 ARG H    H  -0.046   4.060  -9.097 1.00 . A A .  91 ARG H    1 1 
        3  6182 1 1  91 ARG HA   H  -1.464   5.313  -6.990 1.00 . A A .  91 ARG HA   1 1 
        3  6183 1 1  91 ARG HB2  H  -1.477   7.596  -8.017 1.00 . A A .  91 ARG HB2  1 1 
        3  6184 1 1  91 ARG HB3  H   0.077   7.137  -7.370 1.00 . A A .  91 ARG HB3  1 1 
        3  6185 1 1  91 ARG HD2  H  -1.163   9.107  -9.759 1.00 . A A .  91 ARG HD2  1 1 
        3  6186 1 1  91 ARG HD3  H  -0.187   8.694 -11.170 1.00 . A A .  91 ARG HD3  1 1 
        3  6187 1 1  91 ARG HE   H  -1.789   6.711 -11.385 1.00 . A A .  91 ARG HE   1 1 
        3  6188 1 1  91 ARG HG2  H   0.999   7.823  -9.302 1.00 . A A .  91 ARG HG2  1 1 
        3  6189 1 1  91 ARG HG3  H   0.256   6.431 -10.088 1.00 . A A .  91 ARG HG3  1 1 
        3  6190 1 1  91 ARG HH11 H  -2.884   9.773 -10.060 1.00 . A A .  91 ARG HH11 1 1 
        3  6191 1 1  91 ARG HH12 H  -4.497   9.585 -10.674 1.00 . A A .  91 ARG HH12 1 1 
        3  6192 1 1  91 ARG HH21 H  -3.851   6.497 -12.221 1.00 . A A .  91 ARG HH21 1 1 
        3  6193 1 1  91 ARG HH22 H  -5.045   7.717 -11.914 1.00 . A A .  91 ARG HH22 1 1 
        3  6194 1 1  91 ARG N    N  -0.025   4.550  -8.263 1.00 . A A .  91 ARG N    1 1 
        3  6195 1 1  91 ARG NE   N  -1.968   7.601 -11.003 1.00 . A A .  91 ARG NE   1 1 
        3  6196 1 1  91 ARG NH1  N  -3.557   9.243 -10.584 1.00 . A A .  91 ARG NH1  1 1 
        3  6197 1 1  91 ARG NH2  N  -4.112   7.382 -11.812 1.00 . A A .  91 ARG NH2  1 1 
        3  6198 1 1  91 ARG O    O  -2.022   5.012 -10.176 1.00 . A A .  91 ARG O    1 1 
        3  6199 1 1  92 SER C    C  -5.538   5.954  -9.235 1.00 . A A .  92 SER C    1 1 
        3  6200 1 1  92 SER CA   C  -4.674   4.674  -9.274 1.00 . A A .  92 SER CA   1 1 
        3  6201 1 1  92 SER CB   C  -5.427   3.439  -8.772 1.00 . A A .  92 SER CB   1 1 
        3  6202 1 1  92 SER H    H  -3.540   4.770  -7.481 1.00 . A A .  92 SER H    1 1 
        3  6203 1 1  92 SER HA   H  -4.365   4.497 -10.306 1.00 . A A .  92 SER HA   1 1 
        3  6204 1 1  92 SER HB2  H  -5.754   3.598  -7.756 1.00 . A A .  92 SER HB2  1 1 
        3  6205 1 1  92 SER HB3  H  -6.290   3.254  -9.395 1.00 . A A .  92 SER HB3  1 1 
        3  6206 1 1  92 SER HG   H  -4.388   2.020  -7.904 1.00 . A A .  92 SER HG   1 1 
        3  6207 1 1  92 SER N    N  -3.459   4.868  -8.450 1.00 . A A .  92 SER N    1 1 
        3  6208 1 1  92 SER O    O  -5.077   6.975  -8.730 1.00 . A A .  92 SER O    1 1 
        3  6209 1 1  92 SER OG   O  -4.588   2.294  -8.805 1.00 . A A .  92 SER OG   1 1 
        3  6210 1 1  93 ARG C    C  -8.008   7.724  -8.551 1.00 . A A .  93 ARG C    1 1 
        3  6211 1 1  93 ARG CA   C  -7.601   7.144  -9.925 1.00 . A A .  93 ARG CA   1 1 
        3  6212 1 1  93 ARG CB   C  -8.859   6.867 -10.789 1.00 . A A .  93 ARG CB   1 1 
        3  6213 1 1  93 ARG CD   C -10.940   7.878 -11.941 1.00 . A A .  93 ARG CD   1 1 
        3  6214 1 1  93 ARG CG   C  -9.673   8.141 -11.114 1.00 . A A .  93 ARG CG   1 1 
        3  6215 1 1  93 ARG CZ   C -12.981   9.280 -12.333 1.00 . A A .  93 ARG CZ   1 1 
        3  6216 1 1  93 ARG H    H  -7.133   5.059 -10.081 1.00 . A A .  93 ARG H    1 1 
        3  6217 1 1  93 ARG HA   H  -6.983   7.883 -10.437 1.00 . A A .  93 ARG HA   1 1 
        3  6218 1 1  93 ARG HB2  H  -8.552   6.408 -11.724 1.00 . A A .  93 ARG HB2  1 1 
        3  6219 1 1  93 ARG HB3  H  -9.503   6.175 -10.258 1.00 . A A .  93 ARG HB3  1 1 
        3  6220 1 1  93 ARG HD2  H -10.666   7.412 -12.882 1.00 . A A .  93 ARG HD2  1 1 
        3  6221 1 1  93 ARG HD3  H -11.593   7.209 -11.385 1.00 . A A .  93 ARG HD3  1 1 
        3  6222 1 1  93 ARG HE   H -11.093   9.940 -12.332 1.00 . A A .  93 ARG HE   1 1 
        3  6223 1 1  93 ARG HG2  H  -9.971   8.610 -10.182 1.00 . A A .  93 ARG HG2  1 1 
        3  6224 1 1  93 ARG HG3  H  -9.037   8.828 -11.662 1.00 . A A .  93 ARG HG3  1 1 
        3  6225 1 1  93 ARG HH11 H -13.426   7.340 -11.958 1.00 . A A .  93 ARG HH11 1 1 
        3  6226 1 1  93 ARG HH12 H -14.789   8.364 -12.268 1.00 . A A .  93 ARG HH12 1 1 
        3  6227 1 1  93 ARG HH21 H -12.882  11.264 -12.731 1.00 . A A .  93 ARG HH21 1 1 
        3  6228 1 1  93 ARG HH22 H -14.481  10.589 -12.687 1.00 . A A .  93 ARG HH22 1 1 
        3  6229 1 1  93 ARG N    N  -6.772   5.918  -9.774 1.00 . A A .  93 ARG N    1 1 
        3  6230 1 1  93 ARG NE   N -11.654   9.137 -12.218 1.00 . A A .  93 ARG NE   1 1 
        3  6231 1 1  93 ARG NH1  N -13.796   8.247 -12.169 1.00 . A A .  93 ARG NH1  1 1 
        3  6232 1 1  93 ARG NH2  N -13.487  10.471 -12.606 1.00 . A A .  93 ARG NH2  1 1 
        3  6233 1 1  93 ARG O    O  -7.702   8.880  -8.238 1.00 . A A .  93 ARG O    1 1 
        3  6234 1 1  94 THR C    C  -7.794   7.034  -5.448 1.00 . A A .  94 THR C    1 1 
        3  6235 1 1  94 THR CA   C  -9.029   7.252  -6.348 1.00 . A A .  94 THR CA   1 1 
        3  6236 1 1  94 THR CB   C -10.233   6.387  -5.840 1.00 . A A .  94 THR CB   1 1 
        3  6237 1 1  94 THR CG2  C -10.631   6.728  -4.390 1.00 . A A .  94 THR CG2  1 1 
        3  6238 1 1  94 THR H    H  -8.970   6.032  -8.087 1.00 . A A .  94 THR H    1 1 
        3  6239 1 1  94 THR HA   H  -9.319   8.303  -6.316 1.00 . A A .  94 THR HA   1 1 
        3  6240 1 1  94 THR HB   H  -9.945   5.341  -5.882 1.00 . A A .  94 THR HB   1 1 
        3  6241 1 1  94 THR HG1  H -11.750   5.712  -6.933 1.00 . A A .  94 THR HG1  1 1 
        3  6242 1 1  94 THR HG21 H -11.472   6.117  -4.089 1.00 . A A .  94 THR HG21 1 1 
        3  6243 1 1  94 THR HG22 H -10.903   7.774  -4.321 1.00 . A A .  94 THR HG22 1 1 
        3  6244 1 1  94 THR HG23 H  -9.797   6.534  -3.728 1.00 . A A .  94 THR HG23 1 1 
        3  6245 1 1  94 THR N    N  -8.686   6.905  -7.741 1.00 . A A .  94 THR N    1 1 
        3  6246 1 1  94 THR O    O  -7.451   7.872  -4.610 1.00 . A A .  94 THR O    1 1 
        3  6247 1 1  94 THR OG1  O -11.365   6.573  -6.711 1.00 . A A .  94 THR OG1  1 1 
        3  6248 1 1  95 ALA C    C  -4.632   6.190  -5.165 1.00 . A A .  95 ALA C    1 1 
        3  6249 1 1  95 ALA CA   C  -5.962   5.429  -4.898 1.00 . A A .  95 ALA CA   1 1 
        3  6250 1 1  95 ALA CB   C  -5.808   3.911  -5.089 1.00 . A A .  95 ALA CB   1 1 
        3  6251 1 1  95 ALA H    H  -7.415   5.344  -6.437 1.00 . A A .  95 ALA H    1 1 
        3  6252 1 1  95 ALA HA   H  -6.213   5.589  -3.857 1.00 . A A .  95 ALA HA   1 1 
        3  6253 1 1  95 ALA HB1  H  -5.057   3.530  -4.406 1.00 . A A .  95 ALA HB1  1 1 
        3  6254 1 1  95 ALA HB2  H  -5.505   3.697  -6.104 1.00 . A A .  95 ALA HB2  1 1 
        3  6255 1 1  95 ALA HB3  H  -6.749   3.417  -4.889 1.00 . A A .  95 ALA HB3  1 1 
        3  6256 1 1  95 ALA N    N  -7.110   5.907  -5.694 1.00 . A A .  95 ALA N    1 1 
        3  6257 1 1  95 ALA O    O  -3.571   5.727  -4.735 1.00 . A A .  95 ALA O    1 1 
        3  6258 1 1  96 ASP C    C  -2.427   8.335  -5.243 1.00 . A A .  96 ASP C    1 1 
        3  6259 1 1  96 ASP CA   C  -3.532   8.144  -6.316 1.00 . A A .  96 ASP CA   1 1 
        3  6260 1 1  96 ASP CB   C  -4.045   9.523  -6.807 1.00 . A A .  96 ASP CB   1 1 
        3  6261 1 1  96 ASP CG   C  -2.924  10.522  -7.156 1.00 . A A .  96 ASP CG   1 1 
        3  6262 1 1  96 ASP H    H  -5.593   7.669  -6.109 1.00 . A A .  96 ASP H    1 1 
        3  6263 1 1  96 ASP HA   H  -3.100   7.629  -7.169 1.00 . A A .  96 ASP HA   1 1 
        3  6264 1 1  96 ASP HB2  H  -4.658   9.374  -7.691 1.00 . A A .  96 ASP HB2  1 1 
        3  6265 1 1  96 ASP HB3  H  -4.670   9.954  -6.033 1.00 . A A .  96 ASP HB3  1 1 
        3  6266 1 1  96 ASP N    N  -4.705   7.340  -5.867 1.00 . A A .  96 ASP N    1 1 
        3  6267 1 1  96 ASP O    O  -1.332   7.789  -5.362 1.00 . A A .  96 ASP O    1 1 
        3  6268 1 1  96 ASP OD1  O  -2.363  10.438  -8.268 1.00 . A A .  96 ASP OD1  1 1 
        3  6269 1 1  96 ASP OD2  O  -2.612  11.410  -6.325 1.00 . A A .  96 ASP OD2  1 1 
        3  6270 1 1  97 SER C    C  -1.701   8.196  -2.085 1.00 . A A .  97 SER C    1 1 
        3  6271 1 1  97 SER CA   C  -1.751   9.343  -3.104 1.00 . A A .  97 SER CA   1 1 
        3  6272 1 1  97 SER CB   C  -2.117  10.667  -2.416 1.00 . A A .  97 SER CB   1 1 
        3  6273 1 1  97 SER H    H  -3.643   9.414  -4.091 1.00 . A A .  97 SER H    1 1 
        3  6274 1 1  97 SER HA   H  -0.768   9.447  -3.557 1.00 . A A .  97 SER HA   1 1 
        3  6275 1 1  97 SER HB2  H  -3.080  10.569  -1.932 1.00 . A A .  97 SER HB2  1 1 
        3  6276 1 1  97 SER HB3  H  -1.367  10.912  -1.676 1.00 . A A .  97 SER HB3  1 1 
        3  6277 1 1  97 SER HG   H  -2.341  11.379  -4.240 1.00 . A A .  97 SER HG   1 1 
        3  6278 1 1  97 SER N    N  -2.737   9.056  -4.173 1.00 . A A .  97 SER N    1 1 
        3  6279 1 1  97 SER O    O  -0.827   8.146  -1.227 1.00 . A A .  97 SER O    1 1 
        3  6280 1 1  97 SER OG   O  -2.194  11.735  -3.354 1.00 . A A .  97 SER OG   1 1 
        3  6281 1 1  98 HIS C    C  -1.829   5.121  -1.287 1.00 . A A .  98 HIS C    1 1 
        3  6282 1 1  98 HIS CA   C  -2.907   6.217  -1.243 1.00 . A A .  98 HIS CA   1 1 
        3  6283 1 1  98 HIS CB   C  -4.303   5.591  -1.506 1.00 . A A .  98 HIS CB   1 1 
        3  6284 1 1  98 HIS CD2  C  -5.516   7.912  -1.450 1.00 . A A .  98 HIS CD2  1 1 
        3  6285 1 1  98 HIS CE1  C  -7.576   7.189  -1.625 1.00 . A A .  98 HIS CE1  1 1 
        3  6286 1 1  98 HIS CG   C  -5.463   6.559  -1.536 1.00 . A A .  98 HIS CG   1 1 
        3  6287 1 1  98 HIS H    H  -3.151   7.252  -3.063 1.00 . A A .  98 HIS H    1 1 
        3  6288 1 1  98 HIS HA   H  -2.907   6.676  -0.254 1.00 . A A .  98 HIS HA   1 1 
        3  6289 1 1  98 HIS HB2  H  -4.290   5.083  -2.461 1.00 . A A .  98 HIS HB2  1 1 
        3  6290 1 1  98 HIS HB3  H  -4.509   4.862  -0.731 1.00 . A A .  98 HIS HB3  1 1 
        3  6291 1 1  98 HIS HD1  H  -7.073   5.200  -1.715 1.00 . A A .  98 HIS HD1  1 1 
        3  6292 1 1  98 HIS HD2  H  -4.668   8.580  -1.361 1.00 . A A .  98 HIS HD2  1 1 
        3  6293 1 1  98 HIS HE1  H  -8.658   7.160  -1.680 1.00 . A A .  98 HIS HE1  1 1 
        3  6294 1 1  98 HIS HE2  H  -7.184   9.168  -1.283 1.00 . A A .  98 HIS HE2  1 1 
        3  6295 1 1  98 HIS N    N  -2.636   7.256  -2.234 1.00 . A A .  98 HIS N    1 1 
        3  6296 1 1  98 HIS ND1  N  -6.773   6.141  -1.647 1.00 . A A .  98 HIS ND1  1 1 
        3  6297 1 1  98 HIS NE2  N  -6.837   8.276  -1.504 1.00 . A A .  98 HIS NE2  1 1 
        3  6298 1 1  98 HIS O    O  -1.340   4.688  -0.235 1.00 . A A .  98 HIS O    1 1 
        3  6299 1 1  99 LEU C    C   0.865   3.839  -2.286 1.00 . A A .  99 LEU C    1 1 
        3  6300 1 1  99 LEU CA   C  -0.586   3.522  -2.716 1.00 . A A .  99 LEU CA   1 1 
        3  6301 1 1  99 LEU CB   C  -0.632   3.040  -4.196 1.00 . A A .  99 LEU CB   1 1 
        3  6302 1 1  99 LEU CD1  C  -1.952   2.238  -6.236 1.00 . A A .  99 LEU CD1  1 1 
        3  6303 1 1  99 LEU CD2  C  -2.952   2.008  -3.910 1.00 . A A .  99 LEU CD2  1 1 
        3  6304 1 1  99 LEU CG   C  -2.044   2.843  -4.825 1.00 . A A .  99 LEU CG   1 1 
        3  6305 1 1  99 LEU H    H  -1.928   5.077  -3.298 1.00 . A A .  99 LEU H    1 1 
        3  6306 1 1  99 LEU HA   H  -0.956   2.712  -2.090 1.00 . A A .  99 LEU HA   1 1 
        3  6307 1 1  99 LEU HB2  H  -0.097   3.765  -4.802 1.00 . A A .  99 LEU HB2  1 1 
        3  6308 1 1  99 LEU HB3  H  -0.098   2.094  -4.261 1.00 . A A .  99 LEU HB3  1 1 
        3  6309 1 1  99 LEU HD11 H  -2.943   2.143  -6.659 1.00 . A A .  99 LEU HD11 1 1 
        3  6310 1 1  99 LEU HD12 H  -1.488   1.260  -6.191 1.00 . A A .  99 LEU HD12 1 1 
        3  6311 1 1  99 LEU HD13 H  -1.356   2.883  -6.869 1.00 . A A .  99 LEU HD13 1 1 
        3  6312 1 1  99 LEU HD21 H  -2.490   1.050  -3.700 1.00 . A A .  99 LEU HD21 1 1 
        3  6313 1 1  99 LEU HD22 H  -3.908   1.848  -4.388 1.00 . A A .  99 LEU HD22 1 1 
        3  6314 1 1  99 LEU HD23 H  -3.117   2.538  -2.974 1.00 . A A .  99 LEU HD23 1 1 
        3  6315 1 1  99 LEU HG   H  -2.510   3.819  -4.931 1.00 . A A .  99 LEU HG   1 1 
        3  6316 1 1  99 LEU N    N  -1.489   4.674  -2.521 1.00 . A A .  99 LEU N    1 1 
        3  6317 1 1  99 LEU O    O   1.218   3.574  -1.145 1.00 . A A .  99 LEU O    1 1 
        3  6318 1 1 100 GLY C    C   3.994   4.806  -4.057 1.00 . A A . 100 GLY C    1 1 
        3  6319 1 1 100 GLY CA   C   3.102   4.691  -2.827 1.00 . A A . 100 GLY CA   1 1 
        3  6320 1 1 100 GLY H    H   1.306   4.849  -3.988 1.00 . A A . 100 GLY H    1 1 
        3  6321 1 1 100 GLY HA2  H   3.204   5.595  -2.243 1.00 . A A . 100 GLY HA2  1 1 
        3  6322 1 1 100 GLY HA3  H   3.448   3.853  -2.227 1.00 . A A . 100 GLY HA3  1 1 
        3  6323 1 1 100 GLY N    N   1.673   4.508  -3.142 1.00 . A A . 100 GLY N    1 1 
        3  6324 1 1 100 GLY O    O   3.539   5.147  -5.146 1.00 . A A . 100 GLY O    1 1 
        3  6325 1 1 101 HIS C    C   7.132   3.457  -5.037 1.00 . A A . 101 HIS C    1 1 
        3  6326 1 1 101 HIS CA   C   6.353   4.774  -4.874 1.00 . A A . 101 HIS CA   1 1 
        3  6327 1 1 101 HIS CB   C   7.302   5.928  -4.423 1.00 . A A . 101 HIS CB   1 1 
        3  6328 1 1 101 HIS CD2  C   5.643   7.604  -3.269 1.00 . A A . 101 HIS CD2  1 1 
        3  6329 1 1 101 HIS CE1  C   6.254   9.436  -4.277 1.00 . A A . 101 HIS CE1  1 1 
        3  6330 1 1 101 HIS CG   C   6.624   7.261  -4.149 1.00 . A A . 101 HIS CG   1 1 
        3  6331 1 1 101 HIS H    H   5.579   4.150  -3.003 1.00 . A A . 101 HIS H    1 1 
        3  6332 1 1 101 HIS HA   H   5.888   5.034  -5.818 1.00 . A A . 101 HIS HA   1 1 
        3  6333 1 1 101 HIS HB2  H   7.809   5.637  -3.511 1.00 . A A . 101 HIS HB2  1 1 
        3  6334 1 1 101 HIS HB3  H   8.046   6.091  -5.193 1.00 . A A . 101 HIS HB3  1 1 
        3  6335 1 1 101 HIS HD1  H   7.670   8.543  -5.462 1.00 . A A . 101 HIS HD1  1 1 
        3  6336 1 1 101 HIS HD2  H   5.118   6.929  -2.604 1.00 . A A . 101 HIS HD2  1 1 
        3  6337 1 1 101 HIS HE1  H   6.322  10.475  -4.573 1.00 . A A . 101 HIS HE1  1 1 
        3  6338 1 1 101 HIS HE2  H   4.889   9.488  -2.759 1.00 . A A . 101 HIS HE2  1 1 
        3  6339 1 1 101 HIS N    N   5.303   4.555  -3.858 1.00 . A A . 101 HIS N    1 1 
        3  6340 1 1 101 HIS ND1  N   6.983   8.443  -4.765 1.00 . A A . 101 HIS ND1  1 1 
        3  6341 1 1 101 HIS NE2  N   5.438   8.952  -3.370 1.00 . A A . 101 HIS NE2  1 1 
        3  6342 1 1 101 HIS O    O   7.262   2.699  -4.071 1.00 . A A . 101 HIS O    1 1 
        3  6343 1 1 102 VAL C    C   9.620   2.079  -7.285 1.00 . A A . 102 VAL C    1 1 
        3  6344 1 1 102 VAL CA   C   8.293   1.866  -6.537 1.00 . A A . 102 VAL CA   1 1 
        3  6345 1 1 102 VAL CB   C   7.361   0.868  -7.334 1.00 . A A . 102 VAL CB   1 1 
        3  6346 1 1 102 VAL CG1  C   6.017   0.662  -6.612 1.00 . A A . 102 VAL CG1  1 1 
        3  6347 1 1 102 VAL CG2  C   7.116   1.314  -8.782 1.00 . A A . 102 VAL CG2  1 1 
        3  6348 1 1 102 VAL H    H   7.613   3.845  -6.955 1.00 . A A . 102 VAL H    1 1 
        3  6349 1 1 102 VAL HA   H   8.531   1.395  -5.580 1.00 . A A . 102 VAL HA   1 1 
        3  6350 1 1 102 VAL HB   H   7.864  -0.096  -7.363 1.00 . A A . 102 VAL HB   1 1 
        3  6351 1 1 102 VAL HG11 H   5.426  -0.081  -7.136 1.00 . A A . 102 VAL HG11 1 1 
        3  6352 1 1 102 VAL HG12 H   5.465   1.596  -6.588 1.00 . A A . 102 VAL HG12 1 1 
        3  6353 1 1 102 VAL HG13 H   6.187   0.329  -5.596 1.00 . A A . 102 VAL HG13 1 1 
        3  6354 1 1 102 VAL HG21 H   8.059   1.380  -9.308 1.00 . A A . 102 VAL HG21 1 1 
        3  6355 1 1 102 VAL HG22 H   6.633   2.285  -8.792 1.00 . A A . 102 VAL HG22 1 1 
        3  6356 1 1 102 VAL HG23 H   6.478   0.598  -9.288 1.00 . A A . 102 VAL HG23 1 1 
        3  6357 1 1 102 VAL N    N   7.630   3.160  -6.250 1.00 . A A . 102 VAL N    1 1 
        3  6358 1 1 102 VAL O    O   9.796   3.047  -8.028 1.00 . A A . 102 VAL O    1 1 
        3  6359 1 1 103 PHE C    C  12.115   0.031  -8.577 1.00 . A A . 103 PHE C    1 1 
        3  6360 1 1 103 PHE CA   C  11.908   1.252  -7.680 1.00 . A A . 103 PHE CA   1 1 
        3  6361 1 1 103 PHE CB   C  13.005   1.347  -6.593 1.00 . A A . 103 PHE CB   1 1 
        3  6362 1 1 103 PHE CD1  C  12.842   3.824  -6.019 1.00 . A A . 103 PHE CD1  1 1 
        3  6363 1 1 103 PHE CD2  C  12.480   2.240  -4.260 1.00 . A A . 103 PHE CD2  1 1 
        3  6364 1 1 103 PHE CE1  C  12.617   4.859  -5.130 1.00 . A A . 103 PHE CE1  1 1 
        3  6365 1 1 103 PHE CE2  C  12.260   3.277  -3.372 1.00 . A A . 103 PHE CE2  1 1 
        3  6366 1 1 103 PHE CG   C  12.777   2.493  -5.600 1.00 . A A . 103 PHE CG   1 1 
        3  6367 1 1 103 PHE CZ   C  12.326   4.586  -3.807 1.00 . A A . 103 PHE CZ   1 1 
        3  6368 1 1 103 PHE H    H  10.416   0.483  -6.381 1.00 . A A . 103 PHE H    1 1 
        3  6369 1 1 103 PHE HA   H  11.950   2.149  -8.299 1.00 . A A . 103 PHE HA   1 1 
        3  6370 1 1 103 PHE HB2  H  13.045   0.412  -6.042 1.00 . A A . 103 PHE HB2  1 1 
        3  6371 1 1 103 PHE HB3  H  13.967   1.508  -7.070 1.00 . A A . 103 PHE HB3  1 1 
        3  6372 1 1 103 PHE HD1  H  13.072   4.048  -7.054 1.00 . A A . 103 PHE HD1  1 1 
        3  6373 1 1 103 PHE HD2  H  12.427   1.216  -3.912 1.00 . A A . 103 PHE HD2  1 1 
        3  6374 1 1 103 PHE HE1  H  12.673   5.888  -5.468 1.00 . A A . 103 PHE HE1  1 1 
        3  6375 1 1 103 PHE HE2  H  12.035   3.062  -2.336 1.00 . A A . 103 PHE HE2  1 1 
        3  6376 1 1 103 PHE HZ   H  12.146   5.398  -3.112 1.00 . A A . 103 PHE HZ   1 1 
        3  6377 1 1 103 PHE N    N  10.582   1.187  -7.043 1.00 . A A . 103 PHE N    1 1 
        3  6378 1 1 103 PHE O    O  11.596  -1.045  -8.296 1.00 . A A . 103 PHE O    1 1 
        3  6379 1 1 104 ASN C    C  14.383  -1.736 -10.212 1.00 . A A . 104 ASN C    1 1 
        3  6380 1 1 104 ASN CA   C  13.166  -0.864 -10.646 1.00 . A A . 104 ASN CA   1 1 
        3  6381 1 1 104 ASN CB   C  13.385  -0.194 -12.036 1.00 . A A . 104 ASN CB   1 1 
        3  6382 1 1 104 ASN CG   C  13.268  -1.157 -13.222 1.00 . A A . 104 ASN CG   1 1 
        3  6383 1 1 104 ASN H    H  13.349   1.068  -9.766 1.00 . A A . 104 ASN H    1 1 
        3  6384 1 1 104 ASN HA   H  12.287  -1.506 -10.697 1.00 . A A . 104 ASN HA   1 1 
        3  6385 1 1 104 ASN HB2  H  12.651   0.594 -12.171 1.00 . A A . 104 ASN HB2  1 1 
        3  6386 1 1 104 ASN HB3  H  14.371   0.260 -12.061 1.00 . A A . 104 ASN HB3  1 1 
        3  6387 1 1 104 ASN HD21 H  11.319  -0.785 -13.403 1.00 . A A . 104 ASN HD21 1 1 
        3  6388 1 1 104 ASN HD22 H  11.976  -1.918 -14.527 1.00 . A A . 104 ASN HD22 1 1 
        3  6389 1 1 104 ASN N    N  12.908   0.201  -9.646 1.00 . A A . 104 ASN N    1 1 
        3  6390 1 1 104 ASN ND2  N  12.065  -1.298 -13.773 1.00 . A A . 104 ASN ND2  1 1 
        3  6391 1 1 104 ASN O    O  14.894  -2.567 -10.967 1.00 . A A . 104 ASN O    1 1 
        3  6392 1 1 104 ASN OD1  O  14.251  -1.755 -13.653 1.00 . A A . 104 ASN OD1  1 1 
        3  6393 1 1 105 ASP C    C  15.511  -3.586  -7.681 1.00 . A A . 105 ASP C    1 1 
        3  6394 1 1 105 ASP CA   C  15.944  -2.259  -8.329 1.00 . A A . 105 ASP CA   1 1 
        3  6395 1 1 105 ASP CB   C  16.591  -1.348  -7.253 1.00 . A A . 105 ASP CB   1 1 
        3  6396 1 1 105 ASP CG   C  17.063   0.000  -7.813 1.00 . A A . 105 ASP CG   1 1 
        3  6397 1 1 105 ASP H    H  14.286  -0.943  -8.381 1.00 . A A . 105 ASP H    1 1 
        3  6398 1 1 105 ASP HA   H  16.678  -2.470  -9.106 1.00 . A A . 105 ASP HA   1 1 
        3  6399 1 1 105 ASP HB2  H  15.869  -1.161  -6.461 1.00 . A A . 105 ASP HB2  1 1 
        3  6400 1 1 105 ASP HB3  H  17.445  -1.864  -6.820 1.00 . A A . 105 ASP HB3  1 1 
        3  6401 1 1 105 ASP N    N  14.794  -1.560  -8.940 1.00 . A A . 105 ASP N    1 1 
        3  6402 1 1 105 ASP O    O  16.342  -4.304  -7.114 1.00 . A A . 105 ASP O    1 1 
        3  6403 1 1 105 ASP OD1  O  16.252   0.949  -7.859 1.00 . A A . 105 ASP OD1  1 1 
        3  6404 1 1 105 ASP OD2  O  18.244   0.120  -8.216 1.00 . A A . 105 ASP OD2  1 1 
        3  6405 1 1 106 GLY C    C  12.906  -6.021  -8.017 1.00 . A A . 106 GLY C    1 1 
        3  6406 1 1 106 GLY CA   C  13.631  -5.060  -7.087 1.00 . A A . 106 GLY CA   1 1 
        3  6407 1 1 106 GLY H    H  13.656  -3.388  -8.398 1.00 . A A . 106 GLY H    1 1 
        3  6408 1 1 106 GLY HA2  H  14.409  -5.602  -6.561 1.00 . A A . 106 GLY HA2  1 1 
        3  6409 1 1 106 GLY HA3  H  12.924  -4.690  -6.361 1.00 . A A . 106 GLY HA3  1 1 
        3  6410 1 1 106 GLY N    N  14.213  -3.916  -7.791 1.00 . A A . 106 GLY N    1 1 
        3  6411 1 1 106 GLY O    O  12.559  -5.641  -9.137 1.00 . A A . 106 GLY O    1 1 
        3  6412 1 1 107 PRO C    C  10.437  -8.238  -8.232 1.00 . A A . 107 PRO C    1 1 
        3  6413 1 1 107 PRO CA   C  11.979  -8.310  -8.376 1.00 . A A . 107 PRO CA   1 1 
        3  6414 1 1 107 PRO CB   C  12.567  -9.632  -7.818 1.00 . A A . 107 PRO CB   1 1 
        3  6415 1 1 107 PRO CD   C  13.056  -7.827  -6.241 1.00 . A A . 107 PRO CD   1 1 
        3  6416 1 1 107 PRO CG   C  12.958  -9.342  -6.390 1.00 . A A . 107 PRO CG   1 1 
        3  6417 1 1 107 PRO HA   H  12.240  -8.221  -9.431 1.00 . A A . 107 PRO HA   1 1 
        3  6418 1 1 107 PRO HB2  H  11.829 -10.430  -7.879 1.00 . A A . 107 PRO HB2  1 1 
        3  6419 1 1 107 PRO HB3  H  13.434  -9.917  -8.410 1.00 . A A . 107 PRO HB3  1 1 
        3  6420 1 1 107 PRO HD2  H  12.371  -7.471  -5.479 1.00 . A A . 107 PRO HD2  1 1 
        3  6421 1 1 107 PRO HD3  H  14.071  -7.537  -5.987 1.00 . A A . 107 PRO HD3  1 1 
        3  6422 1 1 107 PRO HG2  H  12.203  -9.737  -5.715 1.00 . A A . 107 PRO HG2  1 1 
        3  6423 1 1 107 PRO HG3  H  13.913  -9.806  -6.170 1.00 . A A . 107 PRO HG3  1 1 
        3  6424 1 1 107 PRO N    N  12.668  -7.290  -7.573 1.00 . A A . 107 PRO N    1 1 
        3  6425 1 1 107 PRO O    O   9.900  -8.188  -7.114 1.00 . A A . 107 PRO O    1 1 
        3  6426 1 1 108 GLY C    C   7.764  -8.642 -10.804 1.00 . A A . 108 GLY C    1 1 
        3  6427 1 1 108 GLY CA   C   8.288  -8.216  -9.434 1.00 . A A . 108 GLY CA   1 1 
        3  6428 1 1 108 GLY H    H  10.251  -8.183 -10.225 1.00 . A A . 108 GLY H    1 1 
        3  6429 1 1 108 GLY HA2  H   7.898  -8.897  -8.685 1.00 . A A . 108 GLY HA2  1 1 
        3  6430 1 1 108 GLY HA3  H   7.935  -7.217  -9.218 1.00 . A A . 108 GLY HA3  1 1 
        3  6431 1 1 108 GLY N    N   9.749  -8.217  -9.385 1.00 . A A . 108 GLY N    1 1 
        3  6432 1 1 108 GLY O    O   8.544  -9.159 -11.617 1.00 . A A . 108 GLY O    1 1 
        3  6433 1 1 109 PRO C    C   6.461  -8.076 -13.614 1.00 . A A . 109 PRO C    1 1 
        3  6434 1 1 109 PRO CA   C   5.808  -8.796 -12.410 1.00 . A A . 109 PRO CA   1 1 
        3  6435 1 1 109 PRO CB   C   4.322  -8.363 -12.235 1.00 . A A . 109 PRO CB   1 1 
        3  6436 1 1 109 PRO CD   C   5.430  -7.834 -10.179 1.00 . A A . 109 PRO CD   1 1 
        3  6437 1 1 109 PRO CG   C   4.112  -8.304 -10.754 1.00 . A A . 109 PRO CG   1 1 
        3  6438 1 1 109 PRO HA   H   5.860  -9.867 -12.571 1.00 . A A . 109 PRO HA   1 1 
        3  6439 1 1 109 PRO HB2  H   4.154  -7.391 -12.692 1.00 . A A . 109 PRO HB2  1 1 
        3  6440 1 1 109 PRO HB3  H   3.668  -9.092 -12.702 1.00 . A A . 109 PRO HB3  1 1 
        3  6441 1 1 109 PRO HD2  H   5.492  -6.749 -10.185 1.00 . A A . 109 PRO HD2  1 1 
        3  6442 1 1 109 PRO HD3  H   5.558  -8.208  -9.168 1.00 . A A . 109 PRO HD3  1 1 
        3  6443 1 1 109 PRO HG2  H   3.317  -7.605 -10.519 1.00 . A A . 109 PRO HG2  1 1 
        3  6444 1 1 109 PRO HG3  H   3.860  -9.290 -10.372 1.00 . A A . 109 PRO HG3  1 1 
        3  6445 1 1 109 PRO N    N   6.435  -8.430 -11.102 1.00 . A A . 109 PRO N    1 1 
        3  6446 1 1 109 PRO O    O   6.684  -8.676 -14.675 1.00 . A A . 109 PRO O    1 1 
        3  6447 1 1 110 ASN C    C   8.944  -5.802 -14.077 1.00 . A A . 110 ASN C    1 1 
        3  6448 1 1 110 ASN CA   C   7.446  -5.936 -14.425 1.00 . A A . 110 ASN CA   1 1 
        3  6449 1 1 110 ASN CB   C   6.769  -4.537 -14.477 1.00 . A A . 110 ASN CB   1 1 
        3  6450 1 1 110 ASN CG   C   7.416  -3.540 -15.443 1.00 . A A . 110 ASN CG   1 1 
        3  6451 1 1 110 ASN H    H   6.534  -6.388 -12.551 1.00 . A A . 110 ASN H    1 1 
        3  6452 1 1 110 ASN HA   H   7.356  -6.408 -15.398 1.00 . A A . 110 ASN HA   1 1 
        3  6453 1 1 110 ASN HB2  H   5.743  -4.659 -14.785 1.00 . A A . 110 ASN HB2  1 1 
        3  6454 1 1 110 ASN HB3  H   6.778  -4.110 -13.476 1.00 . A A . 110 ASN HB3  1 1 
        3  6455 1 1 110 ASN HD21 H   7.077  -2.057 -14.172 1.00 . A A . 110 ASN HD21 1 1 
        3  6456 1 1 110 ASN HD22 H   7.900  -1.626 -15.624 1.00 . A A . 110 ASN HD22 1 1 
        3  6457 1 1 110 ASN N    N   6.760  -6.786 -13.419 1.00 . A A . 110 ASN N    1 1 
        3  6458 1 1 110 ASN ND2  N   7.463  -2.279 -15.046 1.00 . A A . 110 ASN ND2  1 1 
        3  6459 1 1 110 ASN O    O   9.765  -5.432 -14.924 1.00 . A A . 110 ASN O    1 1 
        3  6460 1 1 110 ASN OD1  O   7.884  -3.906 -16.526 1.00 . A A . 110 ASN OD1  1 1 
        3  6461 1 1 111 GLY C    C  10.680  -4.642 -11.450 1.00 . A A . 111 GLY C    1 1 
        3  6462 1 1 111 GLY CA   C  10.631  -5.906 -12.289 1.00 . A A . 111 GLY CA   1 1 
        3  6463 1 1 111 GLY H    H   8.641  -6.621 -12.280 1.00 . A A . 111 GLY H    1 1 
        3  6464 1 1 111 GLY HA2  H  10.902  -6.744 -11.659 1.00 . A A . 111 GLY HA2  1 1 
        3  6465 1 1 111 GLY HA3  H  11.355  -5.831 -13.093 1.00 . A A . 111 GLY HA3  1 1 
        3  6466 1 1 111 GLY N    N   9.295  -6.154 -12.832 1.00 . A A . 111 GLY N    1 1 
        3  6467 1 1 111 GLY O    O  11.650  -3.877 -11.504 1.00 . A A . 111 GLY O    1 1 
        3  6468 1 1 112 LEU C    C   9.543  -3.798  -8.274 1.00 . A A . 112 LEU C    1 1 
        3  6469 1 1 112 LEU CA   C   9.493  -3.303  -9.728 1.00 . A A . 112 LEU CA   1 1 
        3  6470 1 1 112 LEU CB   C   8.187  -2.512  -9.999 1.00 . A A . 112 LEU CB   1 1 
        3  6471 1 1 112 LEU CD1  C   6.745  -1.121 -11.584 1.00 . A A . 112 LEU CD1  1 1 
        3  6472 1 1 112 LEU CD2  C   9.250  -0.726 -11.508 1.00 . A A . 112 LEU CD2  1 1 
        3  6473 1 1 112 LEU CG   C   8.118  -1.774 -11.376 1.00 . A A . 112 LEU CG   1 1 
        3  6474 1 1 112 LEU H    H   8.911  -5.102 -10.665 1.00 . A A . 112 LEU H    1 1 
        3  6475 1 1 112 LEU HA   H  10.339  -2.636  -9.889 1.00 . A A . 112 LEU HA   1 1 
        3  6476 1 1 112 LEU HB2  H   7.351  -3.204  -9.935 1.00 . A A . 112 LEU HB2  1 1 
        3  6477 1 1 112 LEU HB3  H   8.067  -1.766  -9.213 1.00 . A A . 112 LEU HB3  1 1 
        3  6478 1 1 112 LEU HD11 H   6.563  -0.382 -10.815 1.00 . A A . 112 LEU HD11 1 1 
        3  6479 1 1 112 LEU HD12 H   5.974  -1.877 -11.544 1.00 . A A . 112 LEU HD12 1 1 
        3  6480 1 1 112 LEU HD13 H   6.717  -0.642 -12.554 1.00 . A A . 112 LEU HD13 1 1 
        3  6481 1 1 112 LEU HD21 H   9.175   0.000 -10.705 1.00 . A A . 112 LEU HD21 1 1 
        3  6482 1 1 112 LEU HD22 H   9.168  -0.216 -12.461 1.00 . A A . 112 LEU HD22 1 1 
        3  6483 1 1 112 LEU HD23 H  10.211  -1.219 -11.457 1.00 . A A . 112 LEU HD23 1 1 
        3  6484 1 1 112 LEU HG   H   8.250  -2.501 -12.171 1.00 . A A . 112 LEU HG   1 1 
        3  6485 1 1 112 LEU N    N   9.617  -4.436 -10.660 1.00 . A A . 112 LEU N    1 1 
        3  6486 1 1 112 LEU O    O   9.403  -4.996  -8.002 1.00 . A A . 112 LEU O    1 1 
        3  6487 1 1 113 ARG C    C   8.850  -2.116  -5.227 1.00 . A A . 113 ARG C    1 1 
        3  6488 1 1 113 ARG CA   C   9.798  -3.091  -5.914 1.00 . A A . 113 ARG CA   1 1 
        3  6489 1 1 113 ARG CB   C  11.241  -2.883  -5.406 1.00 . A A . 113 ARG CB   1 1 
        3  6490 1 1 113 ARG CD   C  12.845  -2.723  -3.415 1.00 . A A . 113 ARG CD   1 1 
        3  6491 1 1 113 ARG CG   C  11.407  -2.991  -3.875 1.00 . A A . 113 ARG CG   1 1 
        3  6492 1 1 113 ARG CZ   C  13.988  -2.863  -1.193 1.00 . A A . 113 ARG CZ   1 1 
        3  6493 1 1 113 ARG H    H   9.817  -1.923  -7.665 1.00 . A A . 113 ARG H    1 1 
        3  6494 1 1 113 ARG HA   H   9.485  -4.117  -5.705 1.00 . A A . 113 ARG HA   1 1 
        3  6495 1 1 113 ARG HB2  H  11.876  -3.626  -5.867 1.00 . A A . 113 ARG HB2  1 1 
        3  6496 1 1 113 ARG HB3  H  11.580  -1.899  -5.720 1.00 . A A . 113 ARG HB3  1 1 
        3  6497 1 1 113 ARG HD2  H  13.476  -3.546  -3.733 1.00 . A A . 113 ARG HD2  1 1 
        3  6498 1 1 113 ARG HD3  H  13.198  -1.805  -3.875 1.00 . A A . 113 ARG HD3  1 1 
        3  6499 1 1 113 ARG HE   H  12.126  -2.219  -1.501 1.00 . A A . 113 ARG HE   1 1 
        3  6500 1 1 113 ARG HG2  H  10.751  -2.268  -3.401 1.00 . A A . 113 ARG HG2  1 1 
        3  6501 1 1 113 ARG HG3  H  11.117  -3.988  -3.561 1.00 . A A . 113 ARG HG3  1 1 
        3  6502 1 1 113 ARG HH11 H  15.119  -3.593  -2.709 1.00 . A A . 113 ARG HH11 1 1 
        3  6503 1 1 113 ARG HH12 H  15.871  -3.613  -1.146 1.00 . A A . 113 ARG HH12 1 1 
        3  6504 1 1 113 ARG HH21 H  13.116  -2.238   0.523 1.00 . A A . 113 ARG HH21 1 1 
        3  6505 1 1 113 ARG HH22 H  14.727  -2.854   0.687 1.00 . A A . 113 ARG HH22 1 1 
        3  6506 1 1 113 ARG N    N   9.728  -2.847  -7.356 1.00 . A A . 113 ARG N    1 1 
        3  6507 1 1 113 ARG NE   N  12.925  -2.577  -1.950 1.00 . A A . 113 ARG NE   1 1 
        3  6508 1 1 113 ARG NH1  N  15.079  -3.398  -1.727 1.00 . A A . 113 ARG NH1  1 1 
        3  6509 1 1 113 ARG NH2  N  13.941  -2.628   0.108 1.00 . A A . 113 ARG NH2  1 1 
        3  6510 1 1 113 ARG O    O   9.126  -0.912  -5.189 1.00 . A A . 113 ARG O    1 1 
        3  6511 1 1 114 TYR C    C   7.062  -1.317  -2.733 1.00 . A A . 114 TYR C    1 1 
        3  6512 1 1 114 TYR CA   C   6.676  -1.807  -4.128 1.00 . A A . 114 TYR CA   1 1 
        3  6513 1 1 114 TYR CB   C   5.345  -2.603  -4.141 1.00 . A A . 114 TYR CB   1 1 
        3  6514 1 1 114 TYR CD1  C   5.447  -4.053  -6.259 1.00 . A A . 114 TYR CD1  1 1 
        3  6515 1 1 114 TYR CD2  C   3.951  -2.186  -6.254 1.00 . A A . 114 TYR CD2  1 1 
        3  6516 1 1 114 TYR CE1  C   5.067  -4.350  -7.557 1.00 . A A . 114 TYR CE1  1 1 
        3  6517 1 1 114 TYR CE2  C   3.578  -2.481  -7.549 1.00 . A A . 114 TYR CE2  1 1 
        3  6518 1 1 114 TYR CG   C   4.894  -2.964  -5.572 1.00 . A A . 114 TYR CG   1 1 
        3  6519 1 1 114 TYR CZ   C   4.135  -3.556  -8.193 1.00 . A A . 114 TYR CZ   1 1 
        3  6520 1 1 114 TYR H    H   7.641  -3.609  -4.674 1.00 . A A . 114 TYR H    1 1 
        3  6521 1 1 114 TYR HA   H   6.553  -0.939  -4.770 1.00 . A A . 114 TYR HA   1 1 
        3  6522 1 1 114 TYR HB2  H   5.472  -3.523  -3.576 1.00 . A A . 114 TYR HB2  1 1 
        3  6523 1 1 114 TYR HB3  H   4.565  -2.011  -3.676 1.00 . A A . 114 TYR HB3  1 1 
        3  6524 1 1 114 TYR HD1  H   6.182  -4.677  -5.759 1.00 . A A . 114 TYR HD1  1 1 
        3  6525 1 1 114 TYR HD2  H   3.505  -1.334  -5.755 1.00 . A A . 114 TYR HD2  1 1 
        3  6526 1 1 114 TYR HE1  H   5.503  -5.200  -8.068 1.00 . A A . 114 TYR HE1  1 1 
        3  6527 1 1 114 TYR HE2  H   2.844  -1.861  -8.052 1.00 . A A . 114 TYR HE2  1 1 
        3  6528 1 1 114 TYR HH   H   3.463  -4.763  -9.521 1.00 . A A . 114 TYR HH   1 1 
        3  6529 1 1 114 TYR N    N   7.745  -2.634  -4.693 1.00 . A A . 114 TYR N    1 1 
        3  6530 1 1 114 TYR O    O   6.882  -2.034  -1.750 1.00 . A A . 114 TYR O    1 1 
        3  6531 1 1 114 TYR OH   O   3.749  -3.846  -9.477 1.00 . A A . 114 TYR OH   1 1 
        3  6532 1 1 115 CYS C    C   7.079   1.489  -0.912 1.00 . A A . 115 CYS C    1 1 
        3  6533 1 1 115 CYS CA   C   8.115   0.501  -1.422 1.00 . A A . 115 CYS CA   1 1 
        3  6534 1 1 115 CYS CB   C   9.481   1.173  -1.669 1.00 . A A . 115 CYS CB   1 1 
        3  6535 1 1 115 CYS H    H   7.557   0.497  -3.474 1.00 . A A . 115 CYS H    1 1 
        3  6536 1 1 115 CYS HA   H   8.244  -0.296  -0.687 1.00 . A A . 115 CYS HA   1 1 
        3  6537 1 1 115 CYS HB2  H   9.368   1.966  -2.397 1.00 . A A . 115 CYS HB2  1 1 
        3  6538 1 1 115 CYS HB3  H   9.856   1.590  -0.743 1.00 . A A . 115 CYS HB3  1 1 
        3  6539 1 1 115 CYS HG   H  10.528  -0.097  -3.605 1.00 . A A . 115 CYS HG   1 1 
        3  6540 1 1 115 CYS N    N   7.592  -0.074  -2.667 1.00 . A A . 115 CYS N    1 1 
        3  6541 1 1 115 CYS O    O   7.014   2.647  -1.337 1.00 . A A . 115 CYS O    1 1 
        3  6542 1 1 115 CYS SG   S  10.736   0.039  -2.304 1.00 . A A . 115 CYS SG   1 1 
        3  6543 1 1 116 ILE C    C   5.138   2.133   1.840 1.00 . A A . 116 ILE C    1 1 
        3  6544 1 1 116 ILE CA   C   5.008   1.665   0.385 1.00 . A A . 116 ILE CA   1 1 
        3  6545 1 1 116 ILE CB   C   3.788   0.678   0.220 1.00 . A A . 116 ILE CB   1 1 
        3  6546 1 1 116 ILE CD1  C   3.541   0.944  -2.374 1.00 . A A . 116 ILE CD1  1 1 
        3  6547 1 1 116 ILE CG1  C   3.772   0.003  -1.201 1.00 . A A . 116 ILE CG1  1 1 
        3  6548 1 1 116 ILE CG2  C   2.459   1.399   0.489 1.00 . A A . 116 ILE CG2  1 1 
        3  6549 1 1 116 ILE H    H   6.446   0.134   0.404 1.00 . A A . 116 ILE H    1 1 
        3  6550 1 1 116 ILE HA   H   4.847   2.528  -0.258 1.00 . A A . 116 ILE HA   1 1 
        3  6551 1 1 116 ILE HB   H   3.891  -0.106   0.967 1.00 . A A . 116 ILE HB   1 1 
        3  6552 1 1 116 ILE HD11 H   2.562   1.398  -2.291 1.00 . A A . 116 ILE HD11 1 1 
        3  6553 1 1 116 ILE HD12 H   3.600   0.384  -3.294 1.00 . A A . 116 ILE HD12 1 1 
        3  6554 1 1 116 ILE HD13 H   4.300   1.718  -2.377 1.00 . A A . 116 ILE HD13 1 1 
        3  6555 1 1 116 ILE HG12 H   4.721  -0.487  -1.370 1.00 . A A . 116 ILE HG12 1 1 
        3  6556 1 1 116 ILE HG13 H   2.990  -0.746  -1.225 1.00 . A A . 116 ILE HG13 1 1 
        3  6557 1 1 116 ILE HG21 H   2.343   2.221  -0.197 1.00 . A A . 116 ILE HG21 1 1 
        3  6558 1 1 116 ILE HG22 H   2.447   1.781   1.502 1.00 . A A . 116 ILE HG22 1 1 
        3  6559 1 1 116 ILE HG23 H   1.630   0.711   0.364 1.00 . A A . 116 ILE HG23 1 1 
        3  6560 1 1 116 ILE N    N   6.240   0.995  -0.015 1.00 . A A . 116 ILE N    1 1 
        3  6561 1 1 116 ILE O    O   5.741   1.442   2.658 1.00 . A A . 116 ILE O    1 1 
        3  6562 1 1 117 ASN C    C   3.545   3.274   4.383 1.00 . A A . 117 ASN C    1 1 
        3  6563 1 1 117 ASN CA   C   4.638   3.897   3.490 1.00 . A A . 117 ASN CA   1 1 
        3  6564 1 1 117 ASN CB   C   4.467   5.425   3.354 1.00 . A A . 117 ASN CB   1 1 
        3  6565 1 1 117 ASN CG   C   5.614   6.096   2.579 1.00 . A A . 117 ASN CG   1 1 
        3  6566 1 1 117 ASN H    H   4.070   3.784   1.473 1.00 . A A . 117 ASN H    1 1 
        3  6567 1 1 117 ASN HA   H   5.613   3.683   3.922 1.00 . A A . 117 ASN HA   1 1 
        3  6568 1 1 117 ASN HB2  H   3.536   5.636   2.840 1.00 . A A . 117 ASN HB2  1 1 
        3  6569 1 1 117 ASN HB3  H   4.422   5.865   4.342 1.00 . A A . 117 ASN HB3  1 1 
        3  6570 1 1 117 ASN HD21 H   4.656   5.879   0.844 1.00 . A A . 117 ASN HD21 1 1 
        3  6571 1 1 117 ASN HD22 H   6.205   6.642   0.759 1.00 . A A . 117 ASN HD22 1 1 
        3  6572 1 1 117 ASN N    N   4.574   3.304   2.156 1.00 . A A . 117 ASN N    1 1 
        3  6573 1 1 117 ASN ND2  N   5.477   6.216   1.261 1.00 . A A . 117 ASN ND2  1 1 
        3  6574 1 1 117 ASN O    O   2.354   3.415   4.086 1.00 . A A . 117 ASN O    1 1 
        3  6575 1 1 117 ASN OD1  O   6.613   6.508   3.166 1.00 . A A . 117 ASN OD1  1 1 
        3  6576 1 1 118 SER C    C   2.042   2.717   7.080 1.00 . A A . 118 SER C    1 1 
        3  6577 1 1 118 SER CA   C   3.059   1.817   6.347 1.00 . A A . 118 SER CA   1 1 
        3  6578 1 1 118 SER CB   C   3.866   1.004   7.371 1.00 . A A . 118 SER CB   1 1 
        3  6579 1 1 118 SER H    H   4.924   2.595   5.683 1.00 . A A . 118 SER H    1 1 
        3  6580 1 1 118 SER HA   H   2.513   1.121   5.714 1.00 . A A . 118 SER HA   1 1 
        3  6581 1 1 118 SER HB2  H   3.202   0.367   7.939 1.00 . A A . 118 SER HB2  1 1 
        3  6582 1 1 118 SER HB3  H   4.588   0.390   6.853 1.00 . A A . 118 SER HB3  1 1 
        3  6583 1 1 118 SER HG   H   4.842   1.313   9.029 1.00 . A A . 118 SER HG   1 1 
        3  6584 1 1 118 SER N    N   3.967   2.589   5.468 1.00 . A A . 118 SER N    1 1 
        3  6585 1 1 118 SER O    O   0.993   2.238   7.507 1.00 . A A . 118 SER O    1 1 
        3  6586 1 1 118 SER OG   O   4.554   1.843   8.277 1.00 . A A . 118 SER OG   1 1 
        3  6587 1 1 119 ALA C    C   0.177   5.158   6.977 1.00 . A A . 119 ALA C    1 1 
        3  6588 1 1 119 ALA CA   C   1.460   5.016   7.817 1.00 . A A . 119 ALA CA   1 1 
        3  6589 1 1 119 ALA CB   C   2.168   6.365   7.952 1.00 . A A . 119 ALA CB   1 1 
        3  6590 1 1 119 ALA H    H   3.255   4.301   6.924 1.00 . A A . 119 ALA H    1 1 
        3  6591 1 1 119 ALA HA   H   1.193   4.677   8.814 1.00 . A A . 119 ALA HA   1 1 
        3  6592 1 1 119 ALA HB1  H   2.445   6.734   6.974 1.00 . A A . 119 ALA HB1  1 1 
        3  6593 1 1 119 ALA HB2  H   3.062   6.243   8.550 1.00 . A A . 119 ALA HB2  1 1 
        3  6594 1 1 119 ALA HB3  H   1.515   7.083   8.434 1.00 . A A . 119 ALA HB3  1 1 
        3  6595 1 1 119 ALA N    N   2.370   4.014   7.223 1.00 . A A . 119 ALA N    1 1 
        3  6596 1 1 119 ALA O    O  -0.904   5.423   7.510 1.00 . A A . 119 ALA O    1 1 
        3  6597 1 1 120 ALA C    C  -1.616   3.702   4.724 1.00 . A A . 120 ALA C    1 1 
        3  6598 1 1 120 ALA CA   C  -0.808   5.013   4.703 1.00 . A A . 120 ALA CA   1 1 
        3  6599 1 1 120 ALA CB   C  -0.294   5.327   3.288 1.00 . A A . 120 ALA CB   1 1 
        3  6600 1 1 120 ALA H    H   1.210   4.762   5.301 1.00 . A A . 120 ALA H    1 1 
        3  6601 1 1 120 ALA HA   H  -1.463   5.827   5.005 1.00 . A A . 120 ALA HA   1 1 
        3  6602 1 1 120 ALA HB1  H   0.245   6.266   3.296 1.00 . A A . 120 ALA HB1  1 1 
        3  6603 1 1 120 ALA HB2  H  -1.128   5.403   2.602 1.00 . A A . 120 ALA HB2  1 1 
        3  6604 1 1 120 ALA HB3  H   0.371   4.538   2.960 1.00 . A A . 120 ALA HB3  1 1 
        3  6605 1 1 120 ALA N    N   0.318   4.964   5.650 1.00 . A A . 120 ALA N    1 1 
        3  6606 1 1 120 ALA O    O  -2.721   3.645   4.184 1.00 . A A . 120 ALA O    1 1 
        3  6607 1 1 121 LEU C    C  -2.161   0.839   6.693 1.00 . A A . 121 LEU C    1 1 
        3  6608 1 1 121 LEU CA   C  -1.573   1.285   5.343 1.00 . A A . 121 LEU CA   1 1 
        3  6609 1 1 121 LEU CB   C  -0.432   0.335   4.942 1.00 . A A . 121 LEU CB   1 1 
        3  6610 1 1 121 LEU CD1  C   1.468  -0.288   3.378 1.00 . A A . 121 LEU CD1  1 1 
        3  6611 1 1 121 LEU CD2  C  -0.618   0.876   2.447 1.00 . A A . 121 LEU CD2  1 1 
        3  6612 1 1 121 LEU CG   C   0.339   0.716   3.652 1.00 . A A . 121 LEU CG   1 1 
        3  6613 1 1 121 LEU H    H  -0.295   2.848   5.963 1.00 . A A . 121 LEU H    1 1 
        3  6614 1 1 121 LEU HA   H  -2.356   1.232   4.587 1.00 . A A . 121 LEU HA   1 1 
        3  6615 1 1 121 LEU HB2  H   0.281   0.293   5.762 1.00 . A A . 121 LEU HB2  1 1 
        3  6616 1 1 121 LEU HB3  H  -0.849  -0.662   4.805 1.00 . A A . 121 LEU HB3  1 1 
        3  6617 1 1 121 LEU HD11 H   1.053  -1.283   3.251 1.00 . A A . 121 LEU HD11 1 1 
        3  6618 1 1 121 LEU HD12 H   2.155  -0.294   4.214 1.00 . A A . 121 LEU HD12 1 1 
        3  6619 1 1 121 LEU HD13 H   2.002  -0.007   2.489 1.00 . A A . 121 LEU HD13 1 1 
        3  6620 1 1 121 LEU HD21 H  -0.052   1.143   1.563 1.00 . A A . 121 LEU HD21 1 1 
        3  6621 1 1 121 LEU HD22 H  -1.334   1.660   2.658 1.00 . A A . 121 LEU HD22 1 1 
        3  6622 1 1 121 LEU HD23 H  -1.145  -0.054   2.267 1.00 . A A . 121 LEU HD23 1 1 
        3  6623 1 1 121 LEU HG   H   0.816   1.683   3.812 1.00 . A A . 121 LEU HG   1 1 
        3  6624 1 1 121 LEU N    N  -1.066   2.668   5.393 1.00 . A A . 121 LEU N    1 1 
        3  6625 1 1 121 LEU O    O  -1.815   1.380   7.743 1.00 . A A . 121 LEU O    1 1 
        3  6626 1 1 122 ARG C    C  -3.819  -2.241   7.700 1.00 . A A . 122 ARG C    1 1 
        3  6627 1 1 122 ARG CA   C  -3.755  -0.721   7.805 1.00 . A A . 122 ARG CA   1 1 
        3  6628 1 1 122 ARG CB   C  -5.203  -0.162   7.871 1.00 . A A . 122 ARG CB   1 1 
        3  6629 1 1 122 ARG CD   C  -7.493  -0.178   9.040 1.00 . A A . 122 ARG CD   1 1 
        3  6630 1 1 122 ARG CG   C  -6.039  -0.667   9.074 1.00 . A A . 122 ARG CG   1 1 
        3  6631 1 1 122 ARG CZ   C  -9.348  -0.214   7.350 1.00 . A A . 122 ARG CZ   1 1 
        3  6632 1 1 122 ARG H    H  -3.180  -0.608   5.771 1.00 . A A . 122 ARG H    1 1 
        3  6633 1 1 122 ARG HA   H  -3.219  -0.444   8.714 1.00 . A A . 122 ARG HA   1 1 
        3  6634 1 1 122 ARG HB2  H  -5.152   0.921   7.930 1.00 . A A . 122 ARG HB2  1 1 
        3  6635 1 1 122 ARG HB3  H  -5.724  -0.429   6.954 1.00 . A A . 122 ARG HB3  1 1 
        3  6636 1 1 122 ARG HD2  H  -7.977  -0.469   9.965 1.00 . A A . 122 ARG HD2  1 1 
        3  6637 1 1 122 ARG HD3  H  -7.501   0.905   8.963 1.00 . A A . 122 ARG HD3  1 1 
        3  6638 1 1 122 ARG HE   H  -7.943  -1.623   7.577 1.00 . A A . 122 ARG HE   1 1 
        3  6639 1 1 122 ARG HG2  H  -6.042  -1.750   9.068 1.00 . A A . 122 ARG HG2  1 1 
        3  6640 1 1 122 ARG HG3  H  -5.573  -0.320   9.992 1.00 . A A . 122 ARG HG3  1 1 
        3  6641 1 1 122 ARG HH11 H  -9.299   1.506   8.430 1.00 . A A . 122 ARG HH11 1 1 
        3  6642 1 1 122 ARG HH12 H -10.618   1.371   7.309 1.00 . A A . 122 ARG HH12 1 1 
        3  6643 1 1 122 ARG HH21 H  -9.665  -1.780   6.106 1.00 . A A . 122 ARG HH21 1 1 
        3  6644 1 1 122 ARG HH22 H -10.817  -0.492   5.984 1.00 . A A . 122 ARG HH22 1 1 
        3  6645 1 1 122 ARG N    N  -3.030  -0.182   6.640 1.00 . A A . 122 ARG N    1 1 
        3  6646 1 1 122 ARG NE   N  -8.253  -0.754   7.911 1.00 . A A . 122 ARG NE   1 1 
        3  6647 1 1 122 ARG NH1  N  -9.788   0.987   7.723 1.00 . A A . 122 ARG NH1  1 1 
        3  6648 1 1 122 ARG NH2  N  -9.992  -0.882   6.402 1.00 . A A . 122 ARG NH2  1 1 
        3  6649 1 1 122 ARG O    O  -4.244  -2.771   6.666 1.00 . A A . 122 ARG O    1 1 
        3  6650 1 1 123 PHE C    C  -5.010  -4.724   9.107 1.00 . A A . 123 PHE C    1 1 
        3  6651 1 1 123 PHE CA   C  -3.544  -4.378   8.881 1.00 . A A . 123 PHE CA   1 1 
        3  6652 1 1 123 PHE CB   C  -2.655  -4.956  10.013 1.00 . A A . 123 PHE CB   1 1 
        3  6653 1 1 123 PHE CD1  C  -2.795  -3.261  11.924 1.00 . A A . 123 PHE CD1  1 1 
        3  6654 1 1 123 PHE CD2  C  -3.557  -5.489  12.350 1.00 . A A . 123 PHE CD2  1 1 
        3  6655 1 1 123 PHE CE1  C  -3.098  -2.908  13.227 1.00 . A A . 123 PHE CE1  1 1 
        3  6656 1 1 123 PHE CE2  C  -3.863  -5.133  13.650 1.00 . A A . 123 PHE CE2  1 1 
        3  6657 1 1 123 PHE CG   C  -3.018  -4.557  11.456 1.00 . A A . 123 PHE CG   1 1 
        3  6658 1 1 123 PHE CZ   C  -3.632  -3.845  14.088 1.00 . A A . 123 PHE CZ   1 1 
        3  6659 1 1 123 PHE H    H  -3.024  -2.437   9.517 1.00 . A A . 123 PHE H    1 1 
        3  6660 1 1 123 PHE HA   H  -3.220  -4.809   7.931 1.00 . A A . 123 PHE HA   1 1 
        3  6661 1 1 123 PHE HB2  H  -2.676  -6.039   9.951 1.00 . A A . 123 PHE HB2  1 1 
        3  6662 1 1 123 PHE HB3  H  -1.636  -4.635   9.835 1.00 . A A . 123 PHE HB3  1 1 
        3  6663 1 1 123 PHE HD1  H  -2.379  -2.519  11.252 1.00 . A A . 123 PHE HD1  1 1 
        3  6664 1 1 123 PHE HD2  H  -3.743  -6.503  12.014 1.00 . A A . 123 PHE HD2  1 1 
        3  6665 1 1 123 PHE HE1  H  -2.919  -1.897  13.571 1.00 . A A . 123 PHE HE1  1 1 
        3  6666 1 1 123 PHE HE2  H  -4.283  -5.869  14.328 1.00 . A A . 123 PHE HE2  1 1 
        3  6667 1 1 123 PHE HZ   H  -3.868  -3.570  15.110 1.00 . A A . 123 PHE HZ   1 1 
        3  6668 1 1 123 PHE N    N  -3.412  -2.927   8.773 1.00 . A A . 123 PHE N    1 1 
        3  6669 1 1 123 PHE O    O  -5.685  -4.113   9.950 1.00 . A A . 123 PHE O    1 1 
        3  6670 1 1 124 VAL C    C  -6.762  -7.668   8.684 1.00 . A A . 124 VAL C    1 1 
        3  6671 1 1 124 VAL CA   C  -6.876  -6.164   8.436 1.00 . A A . 124 VAL CA   1 1 
        3  6672 1 1 124 VAL CB   C  -7.741  -5.845   7.158 1.00 . A A . 124 VAL CB   1 1 
        3  6673 1 1 124 VAL CG1  C  -9.232  -6.207   7.386 1.00 . A A . 124 VAL CG1  1 1 
        3  6674 1 1 124 VAL CG2  C  -7.585  -4.360   6.743 1.00 . A A . 124 VAL CG2  1 1 
        3  6675 1 1 124 VAL H    H  -4.948  -6.050   7.617 1.00 . A A . 124 VAL H    1 1 
        3  6676 1 1 124 VAL HA   H  -7.352  -5.698   9.299 1.00 . A A . 124 VAL HA   1 1 
        3  6677 1 1 124 VAL HB   H  -7.369  -6.461   6.335 1.00 . A A . 124 VAL HB   1 1 
        3  6678 1 1 124 VAL HG11 H  -9.320  -7.265   7.625 1.00 . A A . 124 VAL HG11 1 1 
        3  6679 1 1 124 VAL HG12 H  -9.805  -6.002   6.492 1.00 . A A . 124 VAL HG12 1 1 
        3  6680 1 1 124 VAL HG13 H  -9.632  -5.626   8.209 1.00 . A A . 124 VAL HG13 1 1 
        3  6681 1 1 124 VAL HG21 H  -8.123  -4.172   5.823 1.00 . A A . 124 VAL HG21 1 1 
        3  6682 1 1 124 VAL HG22 H  -6.534  -4.130   6.596 1.00 . A A . 124 VAL HG22 1 1 
        3  6683 1 1 124 VAL HG23 H  -7.977  -3.714   7.523 1.00 . A A . 124 VAL HG23 1 1 
        3  6684 1 1 124 VAL N    N  -5.518  -5.662   8.311 1.00 . A A . 124 VAL N    1 1 
        3  6685 1 1 124 VAL O    O  -6.606  -8.434   7.730 1.00 . A A . 124 VAL O    1 1 
        3  6686 1 1 125 PRO C    C  -7.721 -10.406   9.818 1.00 . A A . 125 PRO C    1 1 
        3  6687 1 1 125 PRO CA   C  -6.578  -9.530  10.353 1.00 . A A . 125 PRO CA   1 1 
        3  6688 1 1 125 PRO CB   C  -6.565  -9.528  11.912 1.00 . A A . 125 PRO CB   1 1 
        3  6689 1 1 125 PRO CD   C  -6.843  -7.256  11.213 1.00 . A A . 125 PRO CD   1 1 
        3  6690 1 1 125 PRO CG   C  -6.217  -8.122  12.287 1.00 . A A . 125 PRO CG   1 1 
        3  6691 1 1 125 PRO HA   H  -5.632  -9.921   9.983 1.00 . A A . 125 PRO HA   1 1 
        3  6692 1 1 125 PRO HB2  H  -7.539  -9.815  12.301 1.00 . A A . 125 PRO HB2  1 1 
        3  6693 1 1 125 PRO HB3  H  -5.819 -10.228  12.272 1.00 . A A . 125 PRO HB3  1 1 
        3  6694 1 1 125 PRO HD2  H  -7.878  -7.039  11.444 1.00 . A A . 125 PRO HD2  1 1 
        3  6695 1 1 125 PRO HD3  H  -6.282  -6.331  11.097 1.00 . A A . 125 PRO HD3  1 1 
        3  6696 1 1 125 PRO HG2  H  -6.634  -7.883  13.259 1.00 . A A . 125 PRO HG2  1 1 
        3  6697 1 1 125 PRO HG3  H  -5.139  -7.988  12.303 1.00 . A A . 125 PRO HG3  1 1 
        3  6698 1 1 125 PRO N    N  -6.733  -8.105   9.992 1.00 . A A . 125 PRO N    1 1 
        3  6699 1 1 125 PRO O    O  -8.794  -9.908   9.471 1.00 . A A . 125 PRO O    1 1 
        3  6700 1 1 126 LYS C    C  -9.760 -12.657  10.207 1.00 . A A . 126 LYS C    1 1 
        3  6701 1 1 126 LYS CA   C  -8.409 -12.787   9.439 1.00 . A A . 126 LYS CA   1 1 
        3  6702 1 1 126 LYS CB   C  -7.745 -14.179   9.716 1.00 . A A . 126 LYS CB   1 1 
        3  6703 1 1 126 LYS CD   C  -6.199 -13.661  11.757 1.00 . A A . 126 LYS CD   1 1 
        3  6704 1 1 126 LYS CE   C  -5.849 -14.018  13.209 1.00 . A A . 126 LYS CE   1 1 
        3  6705 1 1 126 LYS CG   C  -7.382 -14.492  11.197 1.00 . A A . 126 LYS CG   1 1 
        3  6706 1 1 126 LYS H    H  -6.505 -11.968   9.875 1.00 . A A . 126 LYS H    1 1 
        3  6707 1 1 126 LYS HA   H  -8.618 -12.721   8.375 1.00 . A A . 126 LYS HA   1 1 
        3  6708 1 1 126 LYS HB2  H  -8.417 -14.957   9.368 1.00 . A A . 126 LYS HB2  1 1 
        3  6709 1 1 126 LYS HB3  H  -6.831 -14.249   9.126 1.00 . A A . 126 LYS HB3  1 1 
        3  6710 1 1 126 LYS HD2  H  -5.326 -13.834  11.135 1.00 . A A . 126 LYS HD2  1 1 
        3  6711 1 1 126 LYS HD3  H  -6.461 -12.605  11.706 1.00 . A A . 126 LYS HD3  1 1 
        3  6712 1 1 126 LYS HE2  H  -5.080 -13.344  13.563 1.00 . A A . 126 LYS HE2  1 1 
        3  6713 1 1 126 LYS HE3  H  -6.733 -13.899  13.826 1.00 . A A . 126 LYS HE3  1 1 
        3  6714 1 1 126 LYS HG2  H  -8.256 -14.300  11.815 1.00 . A A . 126 LYS HG2  1 1 
        3  6715 1 1 126 LYS HG3  H  -7.132 -15.545  11.275 1.00 . A A . 126 LYS HG3  1 1 
        3  6716 1 1 126 LYS HZ1  H  -4.507 -15.553  12.759 1.00 . A A . 126 LYS HZ1  1 1 
        3  6717 1 1 126 LYS HZ2  H  -6.083 -16.091  13.063 1.00 . A A . 126 LYS HZ2  1 1 
        3  6718 1 1 126 LYS HZ3  H  -5.097 -15.599  14.343 1.00 . A A . 126 LYS HZ3  1 1 
        3  6719 1 1 126 LYS N    N  -7.440 -11.711   9.752 1.00 . A A . 126 LYS N    1 1 
        3  6720 1 1 126 LYS NZ   N  -5.350 -15.411  13.351 1.00 . A A . 126 LYS NZ   1 1 
        3  6721 1 1 126 LYS O    O -10.783 -13.137   9.745 1.00 . A A . 126 LYS O    1 1 
        3  6722 1 1 127 HIS C    C -11.855 -10.726  11.488 1.00 . A A . 127 HIS C    1 1 
        3  6723 1 1 127 HIS CA   C -10.936 -11.741  12.206 1.00 . A A . 127 HIS CA   1 1 
        3  6724 1 1 127 HIS CB   C -10.505 -11.214  13.601 1.00 . A A . 127 HIS CB   1 1 
        3  6725 1 1 127 HIS CD2  C -12.198  -9.618  14.767 1.00 . A A . 127 HIS CD2  1 1 
        3  6726 1 1 127 HIS CE1  C -13.249 -11.101  15.982 1.00 . A A . 127 HIS CE1  1 1 
        3  6727 1 1 127 HIS CG   C -11.638 -10.823  14.512 1.00 . A A . 127 HIS CG   1 1 
        3  6728 1 1 127 HIS H    H  -8.852 -11.814  11.757 1.00 . A A . 127 HIS H    1 1 
        3  6729 1 1 127 HIS HA   H -11.484 -12.674  12.339 1.00 . A A . 127 HIS HA   1 1 
        3  6730 1 1 127 HIS HB2  H  -9.936 -11.982  14.113 1.00 . A A . 127 HIS HB2  1 1 
        3  6731 1 1 127 HIS HB3  H  -9.866 -10.346  13.469 1.00 . A A . 127 HIS HB3  1 1 
        3  6732 1 1 127 HIS HD1  H -12.148 -12.695  15.334 1.00 . A A . 127 HIS HD1  1 1 
        3  6733 1 1 127 HIS HD2  H -11.908  -8.672  14.326 1.00 . A A . 127 HIS HD2  1 1 
        3  6734 1 1 127 HIS HE1  H -13.946 -11.563  16.671 1.00 . A A . 127 HIS HE1  1 1 
        3  6735 1 1 127 HIS HE2  H -13.833  -9.134  15.989 1.00 . A A . 127 HIS HE2  1 1 
        3  6736 1 1 127 HIS N    N  -9.727 -12.036  11.393 1.00 . A A . 127 HIS N    1 1 
        3  6737 1 1 127 HIS ND1  N -12.320 -11.729  15.293 1.00 . A A . 127 HIS ND1  1 1 
        3  6738 1 1 127 HIS NE2  N -13.197  -9.819  15.681 1.00 . A A . 127 HIS NE2  1 1 
        3  6739 1 1 127 HIS O    O -13.076 -10.874  11.468 1.00 . A A . 127 HIS O    1 1 
        3  6740 1 1 128 LYS C    C -12.303  -8.782   8.849 1.00 . A A . 128 LYS C    1 1 
        3  6741 1 1 128 LYS CA   C -11.918  -8.558  10.313 1.00 . A A . 128 LYS CA   1 1 
        3  6742 1 1 128 LYS CB   C -11.028  -7.288  10.442 1.00 . A A . 128 LYS CB   1 1 
        3  6743 1 1 128 LYS CD   C -12.195  -6.326  12.556 1.00 . A A . 128 LYS CD   1 1 
        3  6744 1 1 128 LYS CE   C -12.986  -5.213  11.821 1.00 . A A . 128 LYS CE   1 1 
        3  6745 1 1 128 LYS CG   C -10.864  -6.741  11.871 1.00 . A A . 128 LYS CG   1 1 
        3  6746 1 1 128 LYS H    H -10.265  -9.774  10.789 1.00 . A A . 128 LYS H    1 1 
        3  6747 1 1 128 LYS HA   H -12.835  -8.392  10.881 1.00 . A A . 128 LYS HA   1 1 
        3  6748 1 1 128 LYS HB2  H -10.039  -7.517  10.059 1.00 . A A . 128 LYS HB2  1 1 
        3  6749 1 1 128 LYS HB3  H -11.454  -6.495   9.832 1.00 . A A . 128 LYS HB3  1 1 
        3  6750 1 1 128 LYS HD2  H -12.831  -7.200  12.636 1.00 . A A . 128 LYS HD2  1 1 
        3  6751 1 1 128 LYS HD3  H -11.959  -5.978  13.557 1.00 . A A . 128 LYS HD3  1 1 
        3  6752 1 1 128 LYS HE2  H -13.669  -4.755  12.521 1.00 . A A . 128 LYS HE2  1 1 
        3  6753 1 1 128 LYS HE3  H -12.292  -4.459  11.464 1.00 . A A . 128 LYS HE3  1 1 
        3  6754 1 1 128 LYS HG2  H -10.396  -7.505  12.481 1.00 . A A . 128 LYS HG2  1 1 
        3  6755 1 1 128 LYS HG3  H -10.206  -5.875  11.834 1.00 . A A . 128 LYS HG3  1 1 
        3  6756 1 1 128 LYS HZ1  H -13.154  -6.049   9.910 1.00 . A A . 128 LYS HZ1  1 1 
        3  6757 1 1 128 LYS HZ2  H -14.373  -4.946  10.290 1.00 . A A . 128 LYS HZ2  1 1 
        3  6758 1 1 128 LYS HZ3  H -14.396  -6.494  10.967 1.00 . A A . 128 LYS HZ3  1 1 
        3  6759 1 1 128 LYS N    N -11.229  -9.718  10.886 1.00 . A A . 128 LYS N    1 1 
        3  6760 1 1 128 LYS NZ   N -13.783  -5.712  10.668 1.00 . A A . 128 LYS NZ   1 1 
        3  6761 1 1 128 LYS O    O -13.305  -8.227   8.392 1.00 . A A . 128 LYS O    1 1 
        3  6762 1 1 129 LEU C    C -13.020 -10.202   6.208 1.00 . A A . 129 LEU C    1 1 
        3  6763 1 1 129 LEU CA   C -11.627  -9.755   6.670 1.00 . A A . 129 LEU CA   1 1 
        3  6764 1 1 129 LEU CB   C -10.573 -10.751   6.162 1.00 . A A . 129 LEU CB   1 1 
        3  6765 1 1 129 LEU CD1  C  -8.142 -11.429   5.923 1.00 . A A . 129 LEU CD1  1 1 
        3  6766 1 1 129 LEU CD2  C  -8.850  -9.062   5.403 1.00 . A A . 129 LEU CD2  1 1 
        3  6767 1 1 129 LEU CG   C  -9.102 -10.292   6.279 1.00 . A A . 129 LEU CG   1 1 
        3  6768 1 1 129 LEU H    H -10.866 -10.188   8.625 1.00 . A A . 129 LEU H    1 1 
        3  6769 1 1 129 LEU HA   H -11.418  -8.781   6.240 1.00 . A A . 129 LEU HA   1 1 
        3  6770 1 1 129 LEU HB2  H -10.692 -11.674   6.720 1.00 . A A . 129 LEU HB2  1 1 
        3  6771 1 1 129 LEU HB3  H -10.775 -10.966   5.116 1.00 . A A . 129 LEU HB3  1 1 
        3  6772 1 1 129 LEU HD11 H  -8.312 -11.735   4.895 1.00 . A A . 129 LEU HD11 1 1 
        3  6773 1 1 129 LEU HD12 H  -8.318 -12.275   6.577 1.00 . A A . 129 LEU HD12 1 1 
        3  6774 1 1 129 LEU HD13 H  -7.122 -11.094   6.033 1.00 . A A . 129 LEU HD13 1 1 
        3  6775 1 1 129 LEU HD21 H  -9.025  -9.308   4.363 1.00 . A A . 129 LEU HD21 1 1 
        3  6776 1 1 129 LEU HD22 H  -7.827  -8.730   5.524 1.00 . A A . 129 LEU HD22 1 1 
        3  6777 1 1 129 LEU HD23 H  -9.518  -8.259   5.696 1.00 . A A . 129 LEU HD23 1 1 
        3  6778 1 1 129 LEU HG   H  -8.900 -10.008   7.305 1.00 . A A . 129 LEU HG   1 1 
        3  6779 1 1 129 LEU N    N -11.525  -9.620   8.140 1.00 . A A . 129 LEU N    1 1 
        3  6780 1 1 129 LEU O    O -13.525  -9.721   5.194 1.00 . A A . 129 LEU O    1 1 
        3  6781 1 1 130 LYS C    C -16.054 -10.613   6.692 1.00 . A A . 130 LYS C    1 1 
        3  6782 1 1 130 LYS CA   C -14.956 -11.685   6.694 1.00 . A A . 130 LYS CA   1 1 
        3  6783 1 1 130 LYS CB   C -15.270 -12.793   7.735 1.00 . A A . 130 LYS CB   1 1 
        3  6784 1 1 130 LYS CD   C -15.270 -13.484  10.223 1.00 . A A . 130 LYS CD   1 1 
        3  6785 1 1 130 LYS CE   C -14.048 -14.419  10.112 1.00 . A A . 130 LYS CE   1 1 
        3  6786 1 1 130 LYS CG   C -15.218 -12.321   9.208 1.00 . A A . 130 LYS CG   1 1 
        3  6787 1 1 130 LYS H    H -13.184 -11.395   7.815 1.00 . A A . 130 LYS H    1 1 
        3  6788 1 1 130 LYS HA   H -14.904 -12.136   5.705 1.00 . A A . 130 LYS HA   1 1 
        3  6789 1 1 130 LYS HB2  H -16.262 -13.196   7.539 1.00 . A A . 130 LYS HB2  1 1 
        3  6790 1 1 130 LYS HB3  H -14.547 -13.592   7.607 1.00 . A A . 130 LYS HB3  1 1 
        3  6791 1 1 130 LYS HD2  H -15.300 -13.068  11.226 1.00 . A A . 130 LYS HD2  1 1 
        3  6792 1 1 130 LYS HD3  H -16.177 -14.060  10.054 1.00 . A A . 130 LYS HD3  1 1 
        3  6793 1 1 130 LYS HE2  H -14.043 -14.884   9.134 1.00 . A A . 130 LYS HE2  1 1 
        3  6794 1 1 130 LYS HE3  H -13.138 -13.841  10.236 1.00 . A A . 130 LYS HE3  1 1 
        3  6795 1 1 130 LYS HG2  H -14.301 -11.763   9.367 1.00 . A A . 130 LYS HG2  1 1 
        3  6796 1 1 130 LYS HG3  H -16.063 -11.661   9.389 1.00 . A A . 130 LYS HG3  1 1 
        3  6797 1 1 130 LYS HZ1  H -14.881 -16.125  10.976 1.00 . A A . 130 LYS HZ1  1 1 
        3  6798 1 1 130 LYS HZ2  H -14.145 -15.080  12.083 1.00 . A A . 130 LYS HZ2  1 1 
        3  6799 1 1 130 LYS HZ3  H -13.195 -16.052  11.084 1.00 . A A . 130 LYS HZ3  1 1 
        3  6800 1 1 130 LYS N    N -13.631 -11.101   6.989 1.00 . A A . 130 LYS N    1 1 
        3  6801 1 1 130 LYS NZ   N -14.070 -15.493  11.134 1.00 . A A . 130 LYS NZ   1 1 
        3  6802 1 1 130 LYS O    O -17.009 -10.686   5.911 1.00 . A A . 130 LYS O    1 1 
        3  6803 1 1 131 GLU C    C -16.612  -7.477   6.580 1.00 . A A . 131 GLU C    1 1 
        3  6804 1 1 131 GLU CA   C -16.812  -8.489   7.718 1.00 . A A . 131 GLU CA   1 1 
        3  6805 1 1 131 GLU CB   C -16.595  -7.834   9.107 1.00 . A A . 131 GLU CB   1 1 
        3  6806 1 1 131 GLU CD   C -16.295  -8.233  11.634 1.00 . A A . 131 GLU CD   1 1 
        3  6807 1 1 131 GLU CG   C -16.695  -8.835  10.277 1.00 . A A . 131 GLU CG   1 1 
        3  6808 1 1 131 GLU H    H -15.050  -9.588   8.093 1.00 . A A . 131 GLU H    1 1 
        3  6809 1 1 131 GLU HA   H -17.830  -8.888   7.662 1.00 . A A . 131 GLU HA   1 1 
        3  6810 1 1 131 GLU HB2  H -15.608  -7.372   9.134 1.00 . A A . 131 GLU HB2  1 1 
        3  6811 1 1 131 GLU HB3  H -17.344  -7.059   9.258 1.00 . A A . 131 GLU HB3  1 1 
        3  6812 1 1 131 GLU HG2  H -17.717  -9.198  10.334 1.00 . A A . 131 GLU HG2  1 1 
        3  6813 1 1 131 GLU HG3  H -16.042  -9.679  10.066 1.00 . A A . 131 GLU HG3  1 1 
        3  6814 1 1 131 GLU N    N -15.871  -9.601   7.552 1.00 . A A . 131 GLU N    1 1 
        3  6815 1 1 131 GLU O    O -17.568  -6.848   6.121 1.00 . A A . 131 GLU O    1 1 
        3  6816 1 1 131 GLU OE1  O -15.079  -8.102  11.888 1.00 . A A . 131 GLU OE1  1 1 
        3  6817 1 1 131 GLU OE2  O -17.182  -7.898  12.447 1.00 . A A . 131 GLU OE2  1 1 
        3  6818 1 1 132 GLU C    C -15.272  -7.255   3.604 1.00 . A A . 132 GLU C    1 1 
        3  6819 1 1 132 GLU CA   C -14.995  -6.528   4.946 1.00 . A A . 132 GLU CA   1 1 
        3  6820 1 1 132 GLU CB   C -13.504  -6.074   5.045 1.00 . A A . 132 GLU CB   1 1 
        3  6821 1 1 132 GLU CD   C -13.467  -5.081   7.455 1.00 . A A . 132 GLU CD   1 1 
        3  6822 1 1 132 GLU CG   C -13.249  -4.843   5.949 1.00 . A A . 132 GLU CG   1 1 
        3  6823 1 1 132 GLU H    H -14.632  -7.865   6.553 1.00 . A A . 132 GLU H    1 1 
        3  6824 1 1 132 GLU HA   H -15.626  -5.638   4.971 1.00 . A A . 132 GLU HA   1 1 
        3  6825 1 1 132 GLU HB2  H -12.902  -6.901   5.411 1.00 . A A . 132 GLU HB2  1 1 
        3  6826 1 1 132 GLU HB3  H -13.150  -5.821   4.050 1.00 . A A . 132 GLU HB3  1 1 
        3  6827 1 1 132 GLU HG2  H -12.227  -4.511   5.794 1.00 . A A . 132 GLU HG2  1 1 
        3  6828 1 1 132 GLU HG3  H -13.913  -4.046   5.627 1.00 . A A . 132 GLU HG3  1 1 
        3  6829 1 1 132 GLU N    N -15.355  -7.365   6.108 1.00 . A A . 132 GLU N    1 1 
        3  6830 1 1 132 GLU O    O -14.849  -6.781   2.542 1.00 . A A . 132 GLU O    1 1 
        3  6831 1 1 132 GLU OE1  O -14.620  -4.984   7.941 1.00 . A A . 132 GLU OE1  1 1 
        3  6832 1 1 132 GLU OE2  O -12.482  -5.341   8.169 1.00 . A A . 132 GLU OE2  1 1 
        3  6833 1 1 133 GLY C    C -15.842 -10.333   2.039 1.00 . A A . 133 GLY C    1 1 
        3  6834 1 1 133 GLY CA   C -16.532  -9.039   2.451 1.00 . A A . 133 GLY CA   1 1 
        3  6835 1 1 133 GLY H    H -16.092  -8.896   4.484 1.00 . A A . 133 GLY H    1 1 
        3  6836 1 1 133 GLY HA2  H -17.570  -9.260   2.660 1.00 . A A . 133 GLY HA2  1 1 
        3  6837 1 1 133 GLY HA3  H -16.496  -8.348   1.614 1.00 . A A . 133 GLY HA3  1 1 
        3  6838 1 1 133 GLY N    N -15.962  -8.412   3.647 1.00 . A A . 133 GLY N    1 1 
        3  6839 1 1 133 GLY O    O -16.315 -10.972   1.102 1.00 . A A . 133 GLY O    1 1 
        3  6840 1 1 134 TYR C    C -13.225 -12.151   1.206 1.00 . A A . 134 TYR C    1 1 
        3  6841 1 1 134 TYR CA   C -13.941 -11.974   2.587 1.00 . A A . 134 TYR CA   1 1 
        3  6842 1 1 134 TYR CB   C -14.754 -13.258   3.005 1.00 . A A . 134 TYR CB   1 1 
        3  6843 1 1 134 TYR CD1  C -14.831 -15.057   1.160 1.00 . A A . 134 TYR CD1  1 1 
        3  6844 1 1 134 TYR CD2  C -16.829 -13.825   1.594 1.00 . A A . 134 TYR CD2  1 1 
        3  6845 1 1 134 TYR CE1  C -15.486 -15.779   0.181 1.00 . A A . 134 TYR CE1  1 1 
        3  6846 1 1 134 TYR CE2  C -17.486 -14.546   0.616 1.00 . A A . 134 TYR CE2  1 1 
        3  6847 1 1 134 TYR CG   C -15.487 -14.054   1.893 1.00 . A A . 134 TYR CG   1 1 
        3  6848 1 1 134 TYR CZ   C -16.817 -15.518  -0.089 1.00 . A A . 134 TYR CZ   1 1 
        3  6849 1 1 134 TYR H    H -14.430 -10.086   3.449 1.00 . A A . 134 TYR H    1 1 
        3  6850 1 1 134 TYR HA   H -13.138 -11.866   3.312 1.00 . A A . 134 TYR HA   1 1 
        3  6851 1 1 134 TYR HB2  H -14.074 -13.949   3.481 1.00 . A A . 134 TYR HB2  1 1 
        3  6852 1 1 134 TYR HB3  H -15.494 -12.971   3.744 1.00 . A A . 134 TYR HB3  1 1 
        3  6853 1 1 134 TYR HD1  H -13.787 -15.263   1.370 1.00 . A A . 134 TYR HD1  1 1 
        3  6854 1 1 134 TYR HD2  H -17.367 -13.060   2.149 1.00 . A A . 134 TYR HD2  1 1 
        3  6855 1 1 134 TYR HE1  H -14.954 -16.550  -0.366 1.00 . A A . 134 TYR HE1  1 1 
        3  6856 1 1 134 TYR HE2  H -18.529 -14.340   0.406 1.00 . A A . 134 TYR HE2  1 1 
        3  6857 1 1 134 TYR HH   H -17.914 -15.584  -1.669 1.00 . A A . 134 TYR HH   1 1 
        3  6858 1 1 134 TYR N    N -14.739 -10.706   2.751 1.00 . A A . 134 TYR N    1 1 
        3  6859 1 1 134 TYR O    O -12.144 -12.733   1.146 1.00 . A A . 134 TYR O    1 1 
        3  6860 1 1 134 TYR OH   O -17.479 -16.215  -1.075 1.00 . A A . 134 TYR OH   1 1 
        3  6861 1 1 135 GLU C    C -11.883 -11.343  -1.490 1.00 . A A . 135 GLU C    1 1 
        3  6862 1 1 135 GLU CA   C -13.345 -11.755  -1.281 1.00 . A A . 135 GLU CA   1 1 
        3  6863 1 1 135 GLU CB   C -14.250 -10.885  -2.206 1.00 . A A . 135 GLU CB   1 1 
        3  6864 1 1 135 GLU CD   C -15.737 -12.711  -3.185 1.00 . A A . 135 GLU CD   1 1 
        3  6865 1 1 135 GLU CG   C -15.685 -11.407  -2.378 1.00 . A A . 135 GLU CG   1 1 
        3  6866 1 1 135 GLU H    H -14.591 -11.090   0.272 1.00 . A A . 135 GLU H    1 1 
        3  6867 1 1 135 GLU HA   H -13.457 -12.797  -1.563 1.00 . A A . 135 GLU HA   1 1 
        3  6868 1 1 135 GLU HB2  H -14.303  -9.884  -1.791 1.00 . A A . 135 GLU HB2  1 1 
        3  6869 1 1 135 GLU HB3  H -13.794 -10.819  -3.195 1.00 . A A . 135 GLU HB3  1 1 
        3  6870 1 1 135 GLU HG2  H -16.117 -11.574  -1.395 1.00 . A A . 135 GLU HG2  1 1 
        3  6871 1 1 135 GLU HG3  H -16.276 -10.649  -2.891 1.00 . A A . 135 GLU HG3  1 1 
        3  6872 1 1 135 GLU N    N -13.809 -11.615   0.127 1.00 . A A . 135 GLU N    1 1 
        3  6873 1 1 135 GLU O    O -11.214 -11.844  -2.385 1.00 . A A . 135 GLU O    1 1 
        3  6874 1 1 135 GLU OE1  O -15.686 -12.646  -4.435 1.00 . A A . 135 GLU OE1  1 1 
        3  6875 1 1 135 GLU OE2  O -15.803 -13.807  -2.592 1.00 . A A . 135 GLU OE2  1 1 
        3  6876 1 1 136 SER C    C  -8.925 -10.551  -0.456 1.00 . A A . 136 SER C    1 1 
        3  6877 1 1 136 SER CA   C -10.184  -9.717  -0.794 1.00 . A A . 136 SER CA   1 1 
        3  6878 1 1 136 SER CB   C -10.296  -8.482   0.103 1.00 . A A . 136 SER CB   1 1 
        3  6879 1 1 136 SER H    H -11.878 -10.391   0.238 1.00 . A A . 136 SER H    1 1 
        3  6880 1 1 136 SER HA   H -10.134  -9.396  -1.833 1.00 . A A . 136 SER HA   1 1 
        3  6881 1 1 136 SER HB2  H -10.183  -8.768   1.142 1.00 . A A . 136 SER HB2  1 1 
        3  6882 1 1 136 SER HB3  H  -9.519  -7.776  -0.159 1.00 . A A . 136 SER HB3  1 1 
        3  6883 1 1 136 SER HG   H -11.918  -8.051  -0.915 1.00 . A A . 136 SER HG   1 1 
        3  6884 1 1 136 SER N    N -11.405 -10.481  -0.608 1.00 . A A . 136 SER N    1 1 
        3  6885 1 1 136 SER O    O  -7.881 -10.407  -1.088 1.00 . A A . 136 SER O    1 1 
        3  6886 1 1 136 SER OG   O -11.554  -7.842  -0.047 1.00 . A A . 136 SER OG   1 1 
        3  6887 1 1 137 TYR C    C  -8.432 -13.751   0.794 1.00 . A A . 137 TYR C    1 1 
        3  6888 1 1 137 TYR CA   C  -7.963 -12.313   0.999 1.00 . A A . 137 TYR CA   1 1 
        3  6889 1 1 137 TYR CB   C  -7.586 -12.073   2.476 1.00 . A A . 137 TYR CB   1 1 
        3  6890 1 1 137 TYR CD1  C  -5.088 -12.526   2.833 1.00 . A A . 137 TYR CD1  1 1 
        3  6891 1 1 137 TYR CD2  C  -6.642 -14.074   3.785 1.00 . A A . 137 TYR CD2  1 1 
        3  6892 1 1 137 TYR CE1  C  -4.041 -13.265   3.353 1.00 . A A . 137 TYR CE1  1 1 
        3  6893 1 1 137 TYR CE2  C  -5.596 -14.805   4.308 1.00 . A A . 137 TYR CE2  1 1 
        3  6894 1 1 137 TYR CG   C  -6.416 -12.913   3.033 1.00 . A A . 137 TYR CG   1 1 
        3  6895 1 1 137 TYR CZ   C  -4.296 -14.401   4.089 1.00 . A A . 137 TYR CZ   1 1 
        3  6896 1 1 137 TYR H    H  -9.816 -11.258   1.165 1.00 . A A . 137 TYR H    1 1 
        3  6897 1 1 137 TYR HA   H  -7.085 -12.138   0.378 1.00 . A A . 137 TYR HA   1 1 
        3  6898 1 1 137 TYR HB2  H  -7.323 -11.031   2.600 1.00 . A A . 137 TYR HB2  1 1 
        3  6899 1 1 137 TYR HB3  H  -8.460 -12.263   3.097 1.00 . A A . 137 TYR HB3  1 1 
        3  6900 1 1 137 TYR HD1  H  -4.881 -11.633   2.253 1.00 . A A . 137 TYR HD1  1 1 
        3  6901 1 1 137 TYR HD2  H  -7.662 -14.400   3.954 1.00 . A A . 137 TYR HD2  1 1 
        3  6902 1 1 137 TYR HE1  H  -3.023 -12.949   3.180 1.00 . A A . 137 TYR HE1  1 1 
        3  6903 1 1 137 TYR HE2  H  -5.800 -15.700   4.887 1.00 . A A . 137 TYR HE2  1 1 
        3  6904 1 1 137 TYR HH   H  -3.378 -16.066   4.404 1.00 . A A . 137 TYR HH   1 1 
        3  6905 1 1 137 TYR N    N  -9.024 -11.358   0.604 1.00 . A A . 137 TYR N    1 1 
        3  6906 1 1 137 TYR O    O  -7.773 -14.550   0.150 1.00 . A A . 137 TYR O    1 1 
        3  6907 1 1 137 TYR OH   O  -3.248 -15.134   4.612 1.00 . A A . 137 TYR OH   1 1 
        3  6908 1 1 138 LEU C    C -10.404 -16.074   0.129 1.00 . A A . 138 LEU C    1 1 
        3  6909 1 1 138 LEU CA   C -10.063 -15.449   1.495 1.00 . A A . 138 LEU CA   1 1 
        3  6910 1 1 138 LEU CB   C -11.273 -15.515   2.473 1.00 . A A . 138 LEU CB   1 1 
        3  6911 1 1 138 LEU CD1  C -10.648 -13.574   4.093 1.00 . A A . 138 LEU CD1  1 1 
        3  6912 1 1 138 LEU CD2  C -12.219 -15.401   4.848 1.00 . A A . 138 LEU CD2  1 1 
        3  6913 1 1 138 LEU CG   C -11.009 -15.075   3.958 1.00 . A A . 138 LEU CG   1 1 
        3  6914 1 1 138 LEU H    H -10.198 -13.343   1.616 1.00 . A A . 138 LEU H    1 1 
        3  6915 1 1 138 LEU HA   H  -9.240 -16.016   1.932 1.00 . A A . 138 LEU HA   1 1 
        3  6916 1 1 138 LEU HB2  H -12.065 -14.891   2.073 1.00 . A A . 138 LEU HB2  1 1 
        3  6917 1 1 138 LEU HB3  H -11.633 -16.542   2.489 1.00 . A A . 138 LEU HB3  1 1 
        3  6918 1 1 138 LEU HD11 H -10.502 -13.320   5.138 1.00 . A A . 138 LEU HD11 1 1 
        3  6919 1 1 138 LEU HD12 H -11.445 -12.963   3.692 1.00 . A A . 138 LEU HD12 1 1 
        3  6920 1 1 138 LEU HD13 H  -9.734 -13.359   3.546 1.00 . A A . 138 LEU HD13 1 1 
        3  6921 1 1 138 LEU HD21 H -12.431 -16.460   4.814 1.00 . A A . 138 LEU HD21 1 1 
        3  6922 1 1 138 LEU HD22 H -13.084 -14.845   4.506 1.00 . A A . 138 LEU HD22 1 1 
        3  6923 1 1 138 LEU HD23 H -11.994 -15.115   5.870 1.00 . A A . 138 LEU HD23 1 1 
        3  6924 1 1 138 LEU HG   H -10.167 -15.639   4.340 1.00 . A A . 138 LEU HG   1 1 
        3  6925 1 1 138 LEU N    N  -9.601 -14.063   1.334 1.00 . A A . 138 LEU N    1 1 
        3  6926 1 1 138 LEU O    O -10.282 -17.277  -0.041 1.00 . A A . 138 LEU O    1 1 
        3  6927 1 1 139 HIS C    C  -9.719 -15.472  -3.060 1.00 . A A . 139 HIS C    1 1 
        3  6928 1 1 139 HIS CA   C -11.029 -15.670  -2.237 1.00 . A A . 139 HIS CA   1 1 
        3  6929 1 1 139 HIS CB   C -12.239 -14.936  -2.880 1.00 . A A . 139 HIS CB   1 1 
        3  6930 1 1 139 HIS CD2  C -12.257 -16.471  -5.011 1.00 . A A . 139 HIS CD2  1 1 
        3  6931 1 1 139 HIS CE1  C -14.179 -15.836  -5.836 1.00 . A A . 139 HIS CE1  1 1 
        3  6932 1 1 139 HIS CG   C -12.770 -15.542  -4.166 1.00 . A A . 139 HIS CG   1 1 
        3  6933 1 1 139 HIS H    H -11.055 -14.321  -0.595 1.00 . A A . 139 HIS H    1 1 
        3  6934 1 1 139 HIS HA   H -11.252 -16.734  -2.221 1.00 . A A . 139 HIS HA   1 1 
        3  6935 1 1 139 HIS HB2  H -13.059 -14.925  -2.169 1.00 . A A . 139 HIS HB2  1 1 
        3  6936 1 1 139 HIS HB3  H -11.961 -13.910  -3.094 1.00 . A A . 139 HIS HB3  1 1 
        3  6937 1 1 139 HIS HD1  H -14.600 -14.525  -4.333 1.00 . A A . 139 HIS HD1  1 1 
        3  6938 1 1 139 HIS HD2  H -11.318 -16.995  -4.891 1.00 . A A . 139 HIS HD2  1 1 
        3  6939 1 1 139 HIS HE1  H -15.048 -15.744  -6.479 1.00 . A A . 139 HIS HE1  1 1 
        3  6940 1 1 139 HIS HE2  H -13.126 -17.363  -6.694 1.00 . A A . 139 HIS HE2  1 1 
        3  6941 1 1 139 HIS N    N -10.846 -15.242  -0.835 1.00 . A A . 139 HIS N    1 1 
        3  6942 1 1 139 HIS ND1  N -13.976 -15.171  -4.717 1.00 . A A . 139 HIS ND1  1 1 
        3  6943 1 1 139 HIS NE2  N -13.149 -16.630  -6.040 1.00 . A A . 139 HIS NE2  1 1 
        3  6944 1 1 139 HIS O    O  -9.274 -16.400  -3.741 1.00 . A A . 139 HIS O    1 1 
        3  6945 1 1 140 LEU C    C  -6.680 -14.697  -3.497 1.00 . A A . 140 LEU C    1 1 
        3  6946 1 1 140 LEU CA   C  -7.950 -13.897  -3.869 1.00 . A A . 140 LEU CA   1 1 
        3  6947 1 1 140 LEU CB   C  -7.642 -12.378  -3.806 1.00 . A A . 140 LEU CB   1 1 
        3  6948 1 1 140 LEU CD1  C  -8.305  -9.941  -4.219 1.00 . A A . 140 LEU CD1  1 1 
        3  6949 1 1 140 LEU CD2  C  -9.214 -11.772  -5.745 1.00 . A A . 140 LEU CD2  1 1 
        3  6950 1 1 140 LEU CG   C  -8.758 -11.412  -4.316 1.00 . A A . 140 LEU CG   1 1 
        3  6951 1 1 140 LEU H    H  -9.487 -13.580  -2.402 1.00 . A A . 140 LEU H    1 1 
        3  6952 1 1 140 LEU HA   H  -8.223 -14.145  -4.893 1.00 . A A . 140 LEU HA   1 1 
        3  6953 1 1 140 LEU HB2  H  -7.426 -12.125  -2.772 1.00 . A A . 140 LEU HB2  1 1 
        3  6954 1 1 140 LEU HB3  H  -6.744 -12.187  -4.394 1.00 . A A . 140 LEU HB3  1 1 
        3  6955 1 1 140 LEU HD11 H  -9.103  -9.291  -4.548 1.00 . A A . 140 LEU HD11 1 1 
        3  6956 1 1 140 LEU HD12 H  -7.431  -9.779  -4.837 1.00 . A A . 140 LEU HD12 1 1 
        3  6957 1 1 140 LEU HD13 H  -8.061  -9.707  -3.185 1.00 . A A . 140 LEU HD13 1 1 
        3  6958 1 1 140 LEU HD21 H  -9.633 -12.766  -5.751 1.00 . A A . 140 LEU HD21 1 1 
        3  6959 1 1 140 LEU HD22 H  -8.370 -11.730  -6.424 1.00 . A A . 140 LEU HD22 1 1 
        3  6960 1 1 140 LEU HD23 H  -9.971 -11.070  -6.073 1.00 . A A . 140 LEU HD23 1 1 
        3  6961 1 1 140 LEU HG   H  -9.621 -11.513  -3.667 1.00 . A A . 140 LEU HG   1 1 
        3  6962 1 1 140 LEU N    N  -9.122 -14.254  -3.009 1.00 . A A . 140 LEU N    1 1 
        3  6963 1 1 140 LEU O    O  -6.051 -15.317  -4.362 1.00 . A A . 140 LEU O    1 1 
        3  6964 1 1 141 PHE C    C  -5.439 -16.934  -1.643 1.00 . A A . 141 PHE C    1 1 
        3  6965 1 1 141 PHE CA   C  -5.152 -15.416  -1.677 1.00 . A A . 141 PHE CA   1 1 
        3  6966 1 1 141 PHE CB   C  -4.785 -14.881  -0.260 1.00 . A A . 141 PHE CB   1 1 
        3  6967 1 1 141 PHE CD1  C  -3.442 -16.632   1.032 1.00 . A A . 141 PHE CD1  1 1 
        3  6968 1 1 141 PHE CD2  C  -2.293 -14.687   0.245 1.00 . A A . 141 PHE CD2  1 1 
        3  6969 1 1 141 PHE CE1  C  -2.265 -17.105   1.583 1.00 . A A . 141 PHE CE1  1 1 
        3  6970 1 1 141 PHE CE2  C  -1.119 -15.163   0.801 1.00 . A A . 141 PHE CE2  1 1 
        3  6971 1 1 141 PHE CG   C  -3.480 -15.414   0.347 1.00 . A A . 141 PHE CG   1 1 
        3  6972 1 1 141 PHE CZ   C  -1.105 -16.369   1.468 1.00 . A A . 141 PHE CZ   1 1 
        3  6973 1 1 141 PHE H    H  -6.884 -14.170  -1.590 1.00 . A A . 141 PHE H    1 1 
        3  6974 1 1 141 PHE HA   H  -4.320 -15.229  -2.352 1.00 . A A . 141 PHE HA   1 1 
        3  6975 1 1 141 PHE HB2  H  -4.710 -13.802  -0.310 1.00 . A A . 141 PHE HB2  1 1 
        3  6976 1 1 141 PHE HB3  H  -5.594 -15.126   0.424 1.00 . A A . 141 PHE HB3  1 1 
        3  6977 1 1 141 PHE HD1  H  -4.350 -17.218   1.126 1.00 . A A . 141 PHE HD1  1 1 
        3  6978 1 1 141 PHE HD2  H  -2.291 -13.737  -0.276 1.00 . A A . 141 PHE HD2  1 1 
        3  6979 1 1 141 PHE HE1  H  -2.254 -18.051   2.110 1.00 . A A . 141 PHE HE1  1 1 
        3  6980 1 1 141 PHE HE2  H  -0.209 -14.584   0.714 1.00 . A A . 141 PHE HE2  1 1 
        3  6981 1 1 141 PHE HZ   H  -0.184 -16.737   1.903 1.00 . A A . 141 PHE HZ   1 1 
        3  6982 1 1 141 PHE N    N  -6.332 -14.691  -2.202 1.00 . A A . 141 PHE N    1 1 
        3  6983 1 1 141 PHE O    O  -4.592 -17.733  -2.050 1.00 . A A . 141 PHE O    1 1 
        3  6984 1 1 142 ASN C    C  -8.005 -19.020  -2.363 1.00 . A A . 142 ASN C    1 1 
        3  6985 1 1 142 ASN CA   C  -7.050 -18.759  -1.188 1.00 . A A . 142 ASN CA   1 1 
        3  6986 1 1 142 ASN CB   C  -7.677 -19.184   0.175 1.00 . A A . 142 ASN CB   1 1 
        3  6987 1 1 142 ASN CG   C  -7.857 -20.710   0.299 1.00 . A A . 142 ASN CG   1 1 
        3  6988 1 1 142 ASN H    H  -7.297 -16.652  -0.901 1.00 . A A . 142 ASN H    1 1 
        3  6989 1 1 142 ASN HA   H  -6.149 -19.357  -1.348 1.00 . A A . 142 ASN HA   1 1 
        3  6990 1 1 142 ASN HB2  H  -7.032 -18.847   0.980 1.00 . A A . 142 ASN HB2  1 1 
        3  6991 1 1 142 ASN HB3  H  -8.644 -18.711   0.290 1.00 . A A . 142 ASN HB3  1 1 
        3  6992 1 1 142 ASN HD21 H  -9.642 -20.647  -0.581 1.00 . A A . 142 ASN HD21 1 1 
        3  6993 1 1 142 ASN HD22 H  -9.084 -22.222  -0.127 1.00 . A A . 142 ASN HD22 1 1 
        3  6994 1 1 142 ASN N    N  -6.653 -17.329  -1.206 1.00 . A A . 142 ASN N    1 1 
        3  6995 1 1 142 ASN ND2  N  -8.977 -21.245  -0.178 1.00 . A A . 142 ASN ND2  1 1 
        3  6996 1 1 142 ASN O    O  -9.233 -19.047  -2.208 1.00 . A A . 142 ASN O    1 1 
        3  6997 1 1 142 ASN OD1  O  -6.980 -21.408   0.807 1.00 . A A . 142 ASN OD1  1 1 
        3  6998 1 1 143 LYS C    C  -8.506 -20.870  -5.029 1.00 . A A . 143 LYS C    1 1 
        3  6999 1 1 143 LYS CA   C  -8.126 -19.385  -4.827 1.00 . A A . 143 LYS CA   1 1 
        3  7000 1 1 143 LYS CB   C  -7.240 -18.858  -5.989 1.00 . A A . 143 LYS CB   1 1 
        3  7001 1 1 143 LYS CD   C  -4.897 -18.833  -7.085 1.00 . A A . 143 LYS CD   1 1 
        3  7002 1 1 143 LYS CE   C  -4.513 -17.414  -6.606 1.00 . A A . 143 LYS CE   1 1 
        3  7003 1 1 143 LYS CG   C  -5.858 -19.552  -6.110 1.00 . A A . 143 LYS CG   1 1 
        3  7004 1 1 143 LYS H    H  -6.426 -19.143  -3.579 1.00 . A A . 143 LYS H    1 1 
        3  7005 1 1 143 LYS HA   H  -9.040 -18.799  -4.799 1.00 . A A . 143 LYS HA   1 1 
        3  7006 1 1 143 LYS HB2  H  -7.774 -18.990  -6.927 1.00 . A A . 143 LYS HB2  1 1 
        3  7007 1 1 143 LYS HB3  H  -7.078 -17.795  -5.837 1.00 . A A . 143 LYS HB3  1 1 
        3  7008 1 1 143 LYS HD2  H  -3.989 -19.420  -7.179 1.00 . A A . 143 LYS HD2  1 1 
        3  7009 1 1 143 LYS HD3  H  -5.373 -18.761  -8.061 1.00 . A A . 143 LYS HD3  1 1 
        3  7010 1 1 143 LYS HE2  H  -5.403 -16.797  -6.567 1.00 . A A . 143 LYS HE2  1 1 
        3  7011 1 1 143 LYS HE3  H  -4.082 -17.477  -5.614 1.00 . A A . 143 LYS HE3  1 1 
        3  7012 1 1 143 LYS HG2  H  -5.396 -19.579  -5.130 1.00 . A A . 143 LYS HG2  1 1 
        3  7013 1 1 143 LYS HG3  H  -6.008 -20.573  -6.453 1.00 . A A . 143 LYS HG3  1 1 
        3  7014 1 1 143 LYS HZ1  H  -3.882 -16.780  -8.488 1.00 . A A . 143 LYS HZ1  1 1 
        3  7015 1 1 143 LYS HZ2  H  -2.621 -17.259  -7.473 1.00 . A A . 143 LYS HZ2  1 1 
        3  7016 1 1 143 LYS HZ3  H  -3.388 -15.769  -7.229 1.00 . A A . 143 LYS HZ3  1 1 
        3  7017 1 1 143 LYS N    N  -7.405 -19.171  -3.553 1.00 . A A . 143 LYS N    1 1 
        3  7018 1 1 143 LYS NZ   N  -3.531 -16.761  -7.509 1.00 . A A . 143 LYS NZ   1 1 
        3  7019 1 1 143 LYS O    O  -9.094 -21.238  -6.060 1.00 . A A . 143 LYS O    1 1 
        3  7020 1 1 144 LEU C    C  -9.043 -23.492  -2.618 1.00 . A A . 144 LEU C    1 1 
        3  7021 1 1 144 LEU CA   C  -8.508 -23.140  -4.021 1.00 . A A . 144 LEU CA   1 1 
        3  7022 1 1 144 LEU CB   C  -7.255 -24.001  -4.410 1.00 . A A . 144 LEU CB   1 1 
        3  7023 1 1 144 LEU CD1  C  -7.905 -26.412  -3.703 1.00 . A A . 144 LEU CD1  1 1 
        3  7024 1 1 144 LEU CD2  C  -8.500 -25.550  -6.032 1.00 . A A . 144 LEU CD2  1 1 
        3  7025 1 1 144 LEU CG   C  -7.492 -25.485  -4.866 1.00 . A A . 144 LEU CG   1 1 
        3  7026 1 1 144 LEU H    H  -7.656 -21.351  -3.280 1.00 . A A . 144 LEU H    1 1 
        3  7027 1 1 144 LEU HA   H  -9.303 -23.312  -4.751 1.00 . A A . 144 LEU HA   1 1 
        3  7028 1 1 144 LEU HB2  H  -6.747 -23.491  -5.223 1.00 . A A . 144 LEU HB2  1 1 
        3  7029 1 1 144 LEU HB3  H  -6.574 -24.017  -3.566 1.00 . A A . 144 LEU HB3  1 1 
        3  7030 1 1 144 LEU HD11 H  -7.127 -26.406  -2.951 1.00 . A A . 144 LEU HD11 1 1 
        3  7031 1 1 144 LEU HD12 H  -8.038 -27.421  -4.068 1.00 . A A . 144 LEU HD12 1 1 
        3  7032 1 1 144 LEU HD13 H  -8.831 -26.061  -3.262 1.00 . A A . 144 LEU HD13 1 1 
        3  7033 1 1 144 LEU HD21 H  -8.137 -24.945  -6.852 1.00 . A A . 144 LEU HD21 1 1 
        3  7034 1 1 144 LEU HD22 H  -9.467 -25.176  -5.712 1.00 . A A . 144 LEU HD22 1 1 
        3  7035 1 1 144 LEU HD23 H  -8.604 -26.572  -6.369 1.00 . A A . 144 LEU HD23 1 1 
        3  7036 1 1 144 LEU HG   H  -6.553 -25.872  -5.241 1.00 . A A . 144 LEU HG   1 1 
        3  7037 1 1 144 LEU N    N  -8.166 -21.712  -4.034 1.00 . A A . 144 LEU N    1 1 
        3  7038 1 1 144 LEU O    O  -8.268 -23.676  -1.678 1.00 . A A . 144 LEU O    1 1 
        3  7039 1 1 145 GLU C    C -11.270 -25.529  -1.387 1.00 . A A . 145 GLU C    1 1 
        3  7040 1 1 145 GLU CA   C -11.054 -24.011  -1.274 1.00 . A A . 145 GLU CA   1 1 
        3  7041 1 1 145 GLU CB   C -12.412 -23.280  -1.064 1.00 . A A . 145 GLU CB   1 1 
        3  7042 1 1 145 GLU CD   C -14.529 -23.037   0.389 1.00 . A A . 145 GLU CD   1 1 
        3  7043 1 1 145 GLU CG   C -13.206 -23.783   0.165 1.00 . A A . 145 GLU CG   1 1 
        3  7044 1 1 145 GLU H    H -10.922 -23.236  -3.236 1.00 . A A . 145 GLU H    1 1 
        3  7045 1 1 145 GLU HA   H -10.412 -23.801  -0.423 1.00 . A A . 145 GLU HA   1 1 
        3  7046 1 1 145 GLU HB2  H -12.222 -22.221  -0.933 1.00 . A A . 145 GLU HB2  1 1 
        3  7047 1 1 145 GLU HB3  H -13.027 -23.411  -1.947 1.00 . A A . 145 GLU HB3  1 1 
        3  7048 1 1 145 GLU HG2  H -13.419 -24.843   0.029 1.00 . A A . 145 GLU HG2  1 1 
        3  7049 1 1 145 GLU HG3  H -12.582 -23.667   1.044 1.00 . A A . 145 GLU HG3  1 1 
        3  7050 1 1 145 GLU N    N -10.375 -23.532  -2.486 1.00 . A A . 145 GLU N    1 1 
        3  7051 1 1 145 GLU O    O -11.997 -25.988  -2.277 1.00 . A A . 145 GLU O    1 1 
        3  7052 1 1 145 GLU OE1  O -14.524 -21.991   1.071 1.00 . A A . 145 GLU OE1  1 1 
        3  7053 1 1 145 GLU OE2  O -15.584 -23.492  -0.117 1.00 . A A . 145 GLU OE2  1 1 
        3  7054 1 1 146 HIS C    C -10.793 -28.174   1.074 1.00 . A A . 146 HIS C    1 1 
        3  7055 1 1 146 HIS CA   C -10.806 -27.753  -0.401 1.00 . A A . 146 HIS CA   1 1 
        3  7056 1 1 146 HIS CB   C  -9.716 -28.513  -1.200 1.00 . A A . 146 HIS CB   1 1 
        3  7057 1 1 146 HIS CD2  C -10.805 -30.806  -1.804 1.00 . A A . 146 HIS CD2  1 1 
        3  7058 1 1 146 HIS CE1  C  -9.489 -32.106  -0.632 1.00 . A A . 146 HIS CE1  1 1 
        3  7059 1 1 146 HIS CG   C  -9.899 -30.014  -1.186 1.00 . A A . 146 HIS CG   1 1 
        3  7060 1 1 146 HIS H    H -10.013 -25.865   0.137 1.00 . A A . 146 HIS H    1 1 
        3  7061 1 1 146 HIS HA   H -11.782 -28.002  -0.825 1.00 . A A . 146 HIS HA   1 1 
        3  7062 1 1 146 HIS HB2  H  -9.740 -28.183  -2.232 1.00 . A A . 146 HIS HB2  1 1 
        3  7063 1 1 146 HIS HB3  H  -8.742 -28.289  -0.784 1.00 . A A . 146 HIS HB3  1 1 
        3  7064 1 1 146 HIS HD1  H  -8.336 -30.592   0.102 1.00 . A A . 146 HIS HD1  1 1 
        3  7065 1 1 146 HIS HD2  H -11.604 -30.479  -2.460 1.00 . A A . 146 HIS HD2  1 1 
        3  7066 1 1 146 HIS HE1  H  -9.040 -32.980  -0.184 1.00 . A A . 146 HIS HE1  1 1 
        3  7067 1 1 146 HIS HE2  H -10.996 -32.904  -1.771 1.00 . A A . 146 HIS HE2  1 1 
        3  7068 1 1 146 HIS N    N -10.625 -26.299  -0.493 1.00 . A A . 146 HIS N    1 1 
        3  7069 1 1 146 HIS ND1  N  -9.090 -30.863  -0.462 1.00 . A A . 146 HIS ND1  1 1 
        3  7070 1 1 146 HIS NE2  N -10.527 -32.099  -1.443 1.00 . A A . 146 HIS NE2  1 1 
        3  7071 1 1 146 HIS O    O  -9.739 -28.190   1.722 1.00 . A A . 146 HIS O    1 1 
        3  7072 1 1 147 HIS C    C -12.800 -30.461   2.734 1.00 . A A . 147 HIS C    1 1 
        3  7073 1 1 147 HIS CA   C -12.177 -29.058   2.930 1.00 . A A . 147 HIS CA   1 1 
        3  7074 1 1 147 HIS CB   C -13.064 -28.130   3.809 1.00 . A A . 147 HIS CB   1 1 
        3  7075 1 1 147 HIS CD2  C -12.766 -28.421   6.388 1.00 . A A . 147 HIS CD2  1 1 
        3  7076 1 1 147 HIS CE1  C -14.382 -29.862   6.723 1.00 . A A . 147 HIS CE1  1 1 
        3  7077 1 1 147 HIS CG   C -13.352 -28.664   5.190 1.00 . A A . 147 HIS CG   1 1 
        3  7078 1 1 147 HIS H    H -12.781 -28.288   1.063 1.00 . A A . 147 HIS H    1 1 
        3  7079 1 1 147 HIS HA   H -11.199 -29.164   3.407 1.00 . A A . 147 HIS HA   1 1 
        3  7080 1 1 147 HIS HB2  H -12.565 -27.178   3.925 1.00 . A A . 147 HIS HB2  1 1 
        3  7081 1 1 147 HIS HB3  H -14.014 -27.966   3.310 1.00 . A A . 147 HIS HB3  1 1 
        3  7082 1 1 147 HIS HD1  H -14.964 -29.953   4.767 1.00 . A A . 147 HIS HD1  1 1 
        3  7083 1 1 147 HIS HD2  H -11.933 -27.753   6.572 1.00 . A A . 147 HIS HD2  1 1 
        3  7084 1 1 147 HIS HE1  H -15.066 -30.551   7.202 1.00 . A A . 147 HIS HE1  1 1 
        3  7085 1 1 147 HIS HE2  H -13.322 -29.093   8.303 1.00 . A A . 147 HIS HE2  1 1 
        3  7086 1 1 147 HIS N    N -11.985 -28.470   1.600 1.00 . A A . 147 HIS N    1 1 
        3  7087 1 1 147 HIS ND1  N -14.358 -29.574   5.440 1.00 . A A . 147 HIS ND1  1 1 
        3  7088 1 1 147 HIS NE2  N -13.428 -29.175   7.325 1.00 . A A . 147 HIS NE2  1 1 
        3  7089 1 1 147 HIS O    O -14.030 -30.558   2.536 1.00 . A A . 147 HIS O    1 1 
        4  7090 1 1   1 MET C    C -16.924  13.763  18.035 1.00 . A A .   1 MET C    1 1 
        4  7091 1 1   1 MET CA   C -16.438  14.721  19.129 1.00 . A A .   1 MET CA   1 1 
        4  7092 1 1   1 MET CB   C -14.982  14.379  19.552 1.00 . A A .   1 MET CB   1 1 
        4  7093 1 1   1 MET CE   C -12.107  16.272  21.939 1.00 . A A .   1 MET CE   1 1 
        4  7094 1 1   1 MET CG   C -14.341  15.354  20.544 1.00 . A A .   1 MET CG   1 1 
        4  7095 1 1   1 MET H1   H -17.040  15.283  21.047 1.00 . A A .   1 MET H1   1 1 
        4  7096 1 1   1 MET H2   H -17.403  13.680  20.652 1.00 . A A .   1 MET H2   1 1 
        4  7097 1 1   1 MET H3   H -18.314  14.940  19.992 1.00 . A A .   1 MET H3   1 1 
        4  7098 1 1   1 MET HA   H -16.466  15.735  18.742 1.00 . A A .   1 MET HA   1 1 
        4  7099 1 1   1 MET HB2  H -14.971  13.397  20.008 1.00 . A A .   1 MET HB2  1 1 
        4  7100 1 1   1 MET HB3  H -14.357  14.353  18.667 1.00 . A A .   1 MET HB3  1 1 
        4  7101 1 1   1 MET HE1  H -11.078  16.129  22.230 1.00 . A A .   1 MET HE1  1 1 
        4  7102 1 1   1 MET HE2  H -12.722  16.342  22.822 1.00 . A A .   1 MET HE2  1 1 
        4  7103 1 1   1 MET HE3  H -12.196  17.183  21.367 1.00 . A A .   1 MET HE3  1 1 
        4  7104 1 1   1 MET HG2  H -14.332  16.343  20.112 1.00 . A A .   1 MET HG2  1 1 
        4  7105 1 1   1 MET HG3  H -14.923  15.363  21.459 1.00 . A A .   1 MET HG3  1 1 
        4  7106 1 1   1 MET N    N -17.359  14.655  20.286 1.00 . A A .   1 MET N    1 1 
        4  7107 1 1   1 MET O    O -16.726  12.547  18.133 1.00 . A A .   1 MET O    1 1 
        4  7108 1 1   1 MET SD   S -12.640  14.883  20.944 1.00 . A A .   1 MET SD   1 1 
        4  7109 1 1   2 ALA C    C -17.035  13.076  14.954 1.00 . A A .   2 ALA C    1 1 
        4  7110 1 1   2 ALA CA   C -18.157  13.535  15.900 1.00 . A A .   2 ALA CA   1 1 
        4  7111 1 1   2 ALA CB   C -19.224  14.362  15.159 1.00 . A A .   2 ALA CB   1 1 
        4  7112 1 1   2 ALA H    H -17.696  15.292  16.992 1.00 . A A .   2 ALA H    1 1 
        4  7113 1 1   2 ALA HA   H -18.649  12.657  16.319 1.00 . A A .   2 ALA HA   1 1 
        4  7114 1 1   2 ALA HB1  H -19.993  14.670  15.855 1.00 . A A .   2 ALA HB1  1 1 
        4  7115 1 1   2 ALA HB2  H -19.673  13.768  14.374 1.00 . A A .   2 ALA HB2  1 1 
        4  7116 1 1   2 ALA HB3  H -18.766  15.243  14.724 1.00 . A A .   2 ALA HB3  1 1 
        4  7117 1 1   2 ALA N    N -17.591  14.319  17.009 1.00 . A A .   2 ALA N    1 1 
        4  7118 1 1   2 ALA O    O -16.625  13.814  14.051 1.00 . A A .   2 ALA O    1 1 
        4  7119 1 1   3 TYR C    C -16.106  10.460  13.253 1.00 . A A .   3 TYR C    1 1 
        4  7120 1 1   3 TYR CA   C -15.456  11.263  14.389 1.00 . A A .   3 TYR CA   1 1 
        4  7121 1 1   3 TYR CB   C -14.497  10.391  15.244 1.00 . A A .   3 TYR CB   1 1 
        4  7122 1 1   3 TYR CD1  C -12.712  12.169  15.654 1.00 . A A .   3 TYR CD1  1 1 
        4  7123 1 1   3 TYR CD2  C -13.618  11.049  17.562 1.00 . A A .   3 TYR CD2  1 1 
        4  7124 1 1   3 TYR CE1  C -11.893  12.917  16.479 1.00 . A A .   3 TYR CE1  1 1 
        4  7125 1 1   3 TYR CE2  C -12.797  11.795  18.385 1.00 . A A .   3 TYR CE2  1 1 
        4  7126 1 1   3 TYR CG   C -13.594  11.215  16.177 1.00 . A A .   3 TYR CG   1 1 
        4  7127 1 1   3 TYR CZ   C -11.938  12.728  17.842 1.00 . A A .   3 TYR CZ   1 1 
        4  7128 1 1   3 TYR H    H -16.802  11.389  16.026 1.00 . A A .   3 TYR H    1 1 
        4  7129 1 1   3 TYR HA   H -14.870  12.067  13.940 1.00 . A A .   3 TYR HA   1 1 
        4  7130 1 1   3 TYR HB2  H -15.079   9.702  15.848 1.00 . A A .   3 TYR HB2  1 1 
        4  7131 1 1   3 TYR HB3  H -13.854   9.813  14.588 1.00 . A A .   3 TYR HB3  1 1 
        4  7132 1 1   3 TYR HD1  H -12.674  12.320  14.582 1.00 . A A .   3 TYR HD1  1 1 
        4  7133 1 1   3 TYR HD2  H -14.291  10.315  17.999 1.00 . A A .   3 TYR HD2  1 1 
        4  7134 1 1   3 TYR HE1  H -11.221  13.650  16.051 1.00 . A A .   3 TYR HE1  1 1 
        4  7135 1 1   3 TYR HE2  H -12.834  11.647  19.455 1.00 . A A .   3 TYR HE2  1 1 
        4  7136 1 1   3 TYR HH   H -11.188  14.399  18.428 1.00 . A A .   3 TYR HH   1 1 
        4  7137 1 1   3 TYR N    N -16.493  11.875  15.227 1.00 . A A .   3 TYR N    1 1 
        4  7138 1 1   3 TYR O    O -16.451   9.284  13.407 1.00 . A A .   3 TYR O    1 1 
        4  7139 1 1   3 TYR OH   O -11.122  13.470  18.667 1.00 . A A .   3 TYR OH   1 1 
        4  7140 1 1   4 ASN C    C -15.730   9.833  10.135 1.00 . A A .   4 ASN C    1 1 
        4  7141 1 1   4 ASN CA   C -16.848  10.582  10.880 1.00 . A A .   4 ASN CA   1 1 
        4  7142 1 1   4 ASN CB   C -17.389  11.713   9.954 1.00 . A A .   4 ASN CB   1 1 
        4  7143 1 1   4 ASN CG   C -18.481  12.592  10.569 1.00 . A A .   4 ASN CG   1 1 
        4  7144 1 1   4 ASN H    H -16.117  12.109  12.146 1.00 . A A .   4 ASN H    1 1 
        4  7145 1 1   4 ASN HA   H -17.652   9.894  11.123 1.00 . A A .   4 ASN HA   1 1 
        4  7146 1 1   4 ASN HB2  H -16.570  12.363   9.679 1.00 . A A .   4 ASN HB2  1 1 
        4  7147 1 1   4 ASN HB3  H -17.787  11.258   9.049 1.00 . A A .   4 ASN HB3  1 1 
        4  7148 1 1   4 ASN HD21 H -19.238  12.974   8.767 1.00 . A A .   4 ASN HD21 1 1 
        4  7149 1 1   4 ASN HD22 H -20.049  13.724  10.097 1.00 . A A .   4 ASN HD22 1 1 
        4  7150 1 1   4 ASN N    N -16.318  11.156  12.130 1.00 . A A .   4 ASN N    1 1 
        4  7151 1 1   4 ASN ND2  N -19.343  13.152   9.728 1.00 . A A .   4 ASN ND2  1 1 
        4  7152 1 1   4 ASN O    O -14.546   9.976  10.471 1.00 . A A .   4 ASN O    1 1 
        4  7153 1 1   4 ASN OD1  O -18.534  12.799  11.782 1.00 . A A .   4 ASN OD1  1 1 
        4  7154 1 1   5 LYS C    C -14.345   9.599   7.456 1.00 . A A .   5 LYS C    1 1 
        4  7155 1 1   5 LYS CA   C -15.154   8.475   8.142 1.00 . A A .   5 LYS CA   1 1 
        4  7156 1 1   5 LYS CB   C -15.893   7.584   7.099 1.00 . A A .   5 LYS CB   1 1 
        4  7157 1 1   5 LYS CD   C -17.782   7.365   5.310 1.00 . A A .   5 LYS CD   1 1 
        4  7158 1 1   5 LYS CE   C -17.044   7.226   3.960 1.00 . A A .   5 LYS CE   1 1 
        4  7159 1 1   5 LYS CG   C -17.057   8.277   6.342 1.00 . A A .   5 LYS CG   1 1 
        4  7160 1 1   5 LYS H    H -17.064   8.829   9.011 1.00 . A A .   5 LYS H    1 1 
        4  7161 1 1   5 LYS HA   H -14.462   7.854   8.704 1.00 . A A .   5 LYS HA   1 1 
        4  7162 1 1   5 LYS HB2  H -15.173   7.236   6.364 1.00 . A A .   5 LYS HB2  1 1 
        4  7163 1 1   5 LYS HB3  H -16.294   6.719   7.614 1.00 . A A .   5 LYS HB3  1 1 
        4  7164 1 1   5 LYS HD2  H -17.900   6.377   5.739 1.00 . A A .   5 LYS HD2  1 1 
        4  7165 1 1   5 LYS HD3  H -18.770   7.777   5.122 1.00 . A A .   5 LYS HD3  1 1 
        4  7166 1 1   5 LYS HE2  H -17.639   6.609   3.300 1.00 . A A .   5 LYS HE2  1 1 
        4  7167 1 1   5 LYS HE3  H -16.936   8.210   3.516 1.00 . A A .   5 LYS HE3  1 1 
        4  7168 1 1   5 LYS HG2  H -17.785   8.614   7.073 1.00 . A A .   5 LYS HG2  1 1 
        4  7169 1 1   5 LYS HG3  H -16.664   9.150   5.825 1.00 . A A .   5 LYS HG3  1 1 
        4  7170 1 1   5 LYS HZ1  H -15.049   7.256   4.573 1.00 . A A .   5 LYS HZ1  1 1 
        4  7171 1 1   5 LYS HZ2  H -15.313   6.421   3.125 1.00 . A A .   5 LYS HZ2  1 1 
        4  7172 1 1   5 LYS HZ3  H -15.751   5.716   4.597 1.00 . A A .   5 LYS HZ3  1 1 
        4  7173 1 1   5 LYS N    N -16.113   9.052   9.108 1.00 . A A .   5 LYS N    1 1 
        4  7174 1 1   5 LYS NZ   N -15.697   6.609   4.073 1.00 . A A .   5 LYS NZ   1 1 
        4  7175 1 1   5 LYS O    O -13.143   9.457   7.246 1.00 . A A .   5 LYS O    1 1 
        4  7176 1 1   6 GLU C    C -13.404  12.542   7.586 1.00 . A A .   6 GLU C    1 1 
        4  7177 1 1   6 GLU CA   C -14.401  11.934   6.583 1.00 . A A .   6 GLU CA   1 1 
        4  7178 1 1   6 GLU CB   C -15.469  12.991   6.210 1.00 . A A .   6 GLU CB   1 1 
        4  7179 1 1   6 GLU CD   C -15.981  15.366   5.385 1.00 . A A .   6 GLU CD   1 1 
        4  7180 1 1   6 GLU CG   C -14.907  14.292   5.595 1.00 . A A .   6 GLU CG   1 1 
        4  7181 1 1   6 GLU H    H -16.006  10.694   7.273 1.00 . A A .   6 GLU H    1 1 
        4  7182 1 1   6 GLU HA   H -13.865  11.642   5.683 1.00 . A A .   6 GLU HA   1 1 
        4  7183 1 1   6 GLU HB2  H -16.156  12.550   5.493 1.00 . A A .   6 GLU HB2  1 1 
        4  7184 1 1   6 GLU HB3  H -16.029  13.249   7.105 1.00 . A A .   6 GLU HB3  1 1 
        4  7185 1 1   6 GLU HG2  H -14.130  14.686   6.249 1.00 . A A .   6 GLU HG2  1 1 
        4  7186 1 1   6 GLU HG3  H -14.457  14.054   4.635 1.00 . A A .   6 GLU HG3  1 1 
        4  7187 1 1   6 GLU N    N -15.033  10.718   7.141 1.00 . A A .   6 GLU N    1 1 
        4  7188 1 1   6 GLU O    O -12.276  12.874   7.223 1.00 . A A .   6 GLU O    1 1 
        4  7189 1 1   6 GLU OE1  O -16.764  15.249   4.423 1.00 . A A .   6 GLU OE1  1 1 
        4  7190 1 1   6 GLU OE2  O -16.066  16.318   6.194 1.00 . A A .   6 GLU OE2  1 1 
        4  7191 1 1   7 GLU C    C -11.769  12.413  10.196 1.00 . A A .   7 GLU C    1 1 
        4  7192 1 1   7 GLU CA   C -13.047  13.251   9.950 1.00 . A A .   7 GLU CA   1 1 
        4  7193 1 1   7 GLU CB   C -13.911  13.356  11.236 1.00 . A A .   7 GLU CB   1 1 
        4  7194 1 1   7 GLU CD   C -12.854  15.548  12.104 1.00 . A A .   7 GLU CD   1 1 
        4  7195 1 1   7 GLU CG   C -13.262  14.094  12.425 1.00 . A A .   7 GLU CG   1 1 
        4  7196 1 1   7 GLU H    H -14.783  12.426   9.041 1.00 . A A .   7 GLU H    1 1 
        4  7197 1 1   7 GLU HA   H -12.748  14.253   9.652 1.00 . A A .   7 GLU HA   1 1 
        4  7198 1 1   7 GLU HB2  H -14.835  13.870  10.991 1.00 . A A .   7 GLU HB2  1 1 
        4  7199 1 1   7 GLU HB3  H -14.162  12.350  11.564 1.00 . A A .   7 GLU HB3  1 1 
        4  7200 1 1   7 GLU HG2  H -13.968  14.109  13.252 1.00 . A A .   7 GLU HG2  1 1 
        4  7201 1 1   7 GLU HG3  H -12.381  13.539  12.736 1.00 . A A .   7 GLU HG3  1 1 
        4  7202 1 1   7 GLU N    N -13.859  12.687   8.848 1.00 . A A .   7 GLU N    1 1 
        4  7203 1 1   7 GLU O    O -10.742  12.938  10.651 1.00 . A A .   7 GLU O    1 1 
        4  7204 1 1   7 GLU OE1  O -13.726  16.446  12.125 1.00 . A A .   7 GLU OE1  1 1 
        4  7205 1 1   7 GLU OE2  O -11.659  15.801  11.827 1.00 . A A .   7 GLU OE2  1 1 
        4  7206 1 1   8 LYS C    C  -9.682  10.595   8.830 1.00 . A A .   8 LYS C    1 1 
        4  7207 1 1   8 LYS CA   C -10.691  10.204   9.921 1.00 . A A .   8 LYS CA   1 1 
        4  7208 1 1   8 LYS CB   C -11.123   8.720   9.753 1.00 . A A .   8 LYS CB   1 1 
        4  7209 1 1   8 LYS CD   C  -9.642   7.332  11.443 1.00 . A A .   8 LYS CD   1 1 
        4  7210 1 1   8 LYS CE   C  -8.787   8.414  12.136 1.00 . A A .   8 LYS CE   1 1 
        4  7211 1 1   8 LYS CG   C -10.003   7.642   9.950 1.00 . A A .   8 LYS CG   1 1 
        4  7212 1 1   8 LYS H    H -12.712  10.772   9.552 1.00 . A A .   8 LYS H    1 1 
        4  7213 1 1   8 LYS HA   H -10.221  10.324  10.894 1.00 . A A .   8 LYS HA   1 1 
        4  7214 1 1   8 LYS HB2  H -11.915   8.515  10.462 1.00 . A A .   8 LYS HB2  1 1 
        4  7215 1 1   8 LYS HB3  H -11.532   8.601   8.755 1.00 . A A .   8 LYS HB3  1 1 
        4  7216 1 1   8 LYS HD2  H -10.560   7.213  12.008 1.00 . A A .   8 LYS HD2  1 1 
        4  7217 1 1   8 LYS HD3  H  -9.097   6.393  11.475 1.00 . A A .   8 LYS HD3  1 1 
        4  7218 1 1   8 LYS HE2  H  -7.829   8.483  11.638 1.00 . A A .   8 LYS HE2  1 1 
        4  7219 1 1   8 LYS HE3  H  -9.293   9.366  12.069 1.00 . A A .   8 LYS HE3  1 1 
        4  7220 1 1   8 LYS HG2  H -10.334   6.718   9.489 1.00 . A A .   8 LYS HG2  1 1 
        4  7221 1 1   8 LYS HG3  H  -9.107   7.975   9.438 1.00 . A A .   8 LYS HG3  1 1 
        4  7222 1 1   8 LYS HZ1  H  -8.045   8.894  14.021 1.00 . A A .   8 LYS HZ1  1 1 
        4  7223 1 1   8 LYS HZ2  H  -7.978   7.245  13.654 1.00 . A A .   8 LYS HZ2  1 1 
        4  7224 1 1   8 LYS HZ3  H  -9.455   7.962  14.054 1.00 . A A .   8 LYS HZ3  1 1 
        4  7225 1 1   8 LYS N    N -11.848  11.112   9.865 1.00 . A A .   8 LYS N    1 1 
        4  7226 1 1   8 LYS NZ   N  -8.548   8.106  13.564 1.00 . A A .   8 LYS NZ   1 1 
        4  7227 1 1   8 LYS O    O  -8.503  10.776   9.117 1.00 . A A .   8 LYS O    1 1 
        4  7228 1 1   9 ILE C    C  -8.605  12.386   6.540 1.00 . A A .   9 ILE C    1 1 
        4  7229 1 1   9 ILE CA   C  -9.396  11.073   6.386 1.00 . A A .   9 ILE CA   1 1 
        4  7230 1 1   9 ILE CB   C -10.308  11.155   5.098 1.00 . A A .   9 ILE CB   1 1 
        4  7231 1 1   9 ILE CD1  C -10.260   8.573   4.921 1.00 . A A .   9 ILE CD1  1 1 
        4  7232 1 1   9 ILE CG1  C -11.102   9.830   4.889 1.00 . A A .   9 ILE CG1  1 1 
        4  7233 1 1   9 ILE CG2  C  -9.498  11.504   3.826 1.00 . A A .   9 ILE CG2  1 1 
        4  7234 1 1   9 ILE H    H -11.168  10.668   7.488 1.00 . A A .   9 ILE H    1 1 
        4  7235 1 1   9 ILE HA   H  -8.688  10.259   6.247 1.00 . A A .   9 ILE HA   1 1 
        4  7236 1 1   9 ILE HB   H -11.023  11.959   5.256 1.00 . A A .   9 ILE HB   1 1 
        4  7237 1 1   9 ILE HD11 H  -9.426   8.670   4.236 1.00 . A A .   9 ILE HD11 1 1 
        4  7238 1 1   9 ILE HD12 H -10.868   7.730   4.628 1.00 . A A .   9 ILE HD12 1 1 
        4  7239 1 1   9 ILE HD13 H  -9.885   8.412   5.920 1.00 . A A .   9 ILE HD13 1 1 
        4  7240 1 1   9 ILE HG12 H -11.841   9.737   5.667 1.00 . A A .   9 ILE HG12 1 1 
        4  7241 1 1   9 ILE HG13 H -11.613   9.862   3.933 1.00 . A A .   9 ILE HG13 1 1 
        4  7242 1 1   9 ILE HG21 H -10.160  11.562   2.972 1.00 . A A .   9 ILE HG21 1 1 
        4  7243 1 1   9 ILE HG22 H  -8.750  10.739   3.643 1.00 . A A .   9 ILE HG22 1 1 
        4  7244 1 1   9 ILE HG23 H  -8.999  12.458   3.955 1.00 . A A .   9 ILE HG23 1 1 
        4  7245 1 1   9 ILE N    N -10.198  10.764   7.594 1.00 . A A .   9 ILE N    1 1 
        4  7246 1 1   9 ILE O    O  -7.464  12.474   6.094 1.00 . A A .   9 ILE O    1 1 
        4  7247 1 1  10 LYS C    C  -7.276  14.605   8.152 1.00 . A A .  10 LYS C    1 1 
        4  7248 1 1  10 LYS CA   C  -8.627  14.719   7.408 1.00 . A A .  10 LYS CA   1 1 
        4  7249 1 1  10 LYS CB   C  -9.635  15.594   8.202 1.00 . A A .  10 LYS CB   1 1 
        4  7250 1 1  10 LYS CD   C -12.043  16.513   8.358 1.00 . A A .  10 LYS CD   1 1 
        4  7251 1 1  10 LYS CE   C -11.614  17.846   8.999 1.00 . A A .  10 LYS CE   1 1 
        4  7252 1 1  10 LYS CG   C -10.957  15.890   7.452 1.00 . A A .  10 LYS CG   1 1 
        4  7253 1 1  10 LYS H    H -10.149  13.250   7.479 1.00 . A A .  10 LYS H    1 1 
        4  7254 1 1  10 LYS HA   H  -8.459  15.174   6.435 1.00 . A A .  10 LYS HA   1 1 
        4  7255 1 1  10 LYS HB2  H  -9.879  15.088   9.131 1.00 . A A .  10 LYS HB2  1 1 
        4  7256 1 1  10 LYS HB3  H  -9.165  16.544   8.440 1.00 . A A .  10 LYS HB3  1 1 
        4  7257 1 1  10 LYS HD2  H -12.932  16.686   7.761 1.00 . A A .  10 LYS HD2  1 1 
        4  7258 1 1  10 LYS HD3  H -12.284  15.805   9.146 1.00 . A A .  10 LYS HD3  1 1 
        4  7259 1 1  10 LYS HE2  H -10.679  17.703   9.523 1.00 . A A .  10 LYS HE2  1 1 
        4  7260 1 1  10 LYS HE3  H -11.478  18.592   8.224 1.00 . A A .  10 LYS HE3  1 1 
        4  7261 1 1  10 LYS HG2  H -10.751  16.572   6.633 1.00 . A A .  10 LYS HG2  1 1 
        4  7262 1 1  10 LYS HG3  H -11.337  14.959   7.043 1.00 . A A .  10 LYS HG3  1 1 
        4  7263 1 1  10 LYS HZ1  H -13.523  18.534   9.491 1.00 . A A .  10 LYS HZ1  1 1 
        4  7264 1 1  10 LYS HZ2  H -12.285  19.224  10.418 1.00 . A A .  10 LYS HZ2  1 1 
        4  7265 1 1  10 LYS HZ3  H -12.782  17.632  10.714 1.00 . A A .  10 LYS HZ3  1 1 
        4  7266 1 1  10 LYS N    N  -9.228  13.387   7.175 1.00 . A A .  10 LYS N    1 1 
        4  7267 1 1  10 LYS NZ   N -12.621  18.344   9.971 1.00 . A A .  10 LYS NZ   1 1 
        4  7268 1 1  10 LYS O    O  -6.232  15.038   7.638 1.00 . A A .  10 LYS O    1 1 
        4  7269 1 1  11 SER C    C  -5.146  12.789   9.421 1.00 . A A .  11 SER C    1 1 
        4  7270 1 1  11 SER CA   C  -6.125  13.714  10.163 1.00 . A A .  11 SER CA   1 1 
        4  7271 1 1  11 SER CB   C  -6.568  13.073  11.498 1.00 . A A .  11 SER CB   1 1 
        4  7272 1 1  11 SER H    H  -8.186  13.652   9.658 1.00 . A A .  11 SER H    1 1 
        4  7273 1 1  11 SER HA   H  -5.640  14.665  10.371 1.00 . A A .  11 SER HA   1 1 
        4  7274 1 1  11 SER HB2  H  -7.010  12.102  11.309 1.00 . A A .  11 SER HB2  1 1 
        4  7275 1 1  11 SER HB3  H  -5.712  12.955  12.152 1.00 . A A .  11 SER HB3  1 1 
        4  7276 1 1  11 SER HG   H  -8.005  13.350  12.798 1.00 . A A .  11 SER HG   1 1 
        4  7277 1 1  11 SER N    N  -7.316  13.967   9.332 1.00 . A A .  11 SER N    1 1 
        4  7278 1 1  11 SER O    O  -3.946  13.069   9.319 1.00 . A A .  11 SER O    1 1 
        4  7279 1 1  11 SER OG   O  -7.528  13.879  12.152 1.00 . A A .  11 SER OG   1 1 
        4  7280 1 1  12 LEU C    C  -4.112  11.146   7.020 1.00 . A A .  12 LEU C    1 1 
        4  7281 1 1  12 LEU CA   C  -4.997  10.635   8.176 1.00 . A A .  12 LEU CA   1 1 
        4  7282 1 1  12 LEU CB   C  -6.063   9.681   7.613 1.00 . A A .  12 LEU CB   1 1 
        4  7283 1 1  12 LEU CD1  C  -4.797   7.499   7.925 1.00 . A A .  12 LEU CD1  1 1 
        4  7284 1 1  12 LEU CD2  C  -6.740   7.662   6.263 1.00 . A A .  12 LEU CD2  1 1 
        4  7285 1 1  12 LEU CG   C  -5.563   8.396   6.927 1.00 . A A .  12 LEU CG   1 1 
        4  7286 1 1  12 LEU H    H  -6.628  11.462   9.179 1.00 . A A .  12 LEU H    1 1 
        4  7287 1 1  12 LEU HA   H  -4.384  10.083   8.879 1.00 . A A .  12 LEU HA   1 1 
        4  7288 1 1  12 LEU HB2  H  -6.724   9.394   8.430 1.00 . A A .  12 LEU HB2  1 1 
        4  7289 1 1  12 LEU HB3  H  -6.658  10.240   6.893 1.00 . A A .  12 LEU HB3  1 1 
        4  7290 1 1  12 LEU HD11 H  -5.451   7.206   8.739 1.00 . A A .  12 LEU HD11 1 1 
        4  7291 1 1  12 LEU HD12 H  -3.949   8.041   8.324 1.00 . A A .  12 LEU HD12 1 1 
        4  7292 1 1  12 LEU HD13 H  -4.438   6.614   7.416 1.00 . A A .  12 LEU HD13 1 1 
        4  7293 1 1  12 LEU HD21 H  -7.466   7.365   7.010 1.00 . A A .  12 LEU HD21 1 1 
        4  7294 1 1  12 LEU HD22 H  -6.378   6.781   5.748 1.00 . A A .  12 LEU HD22 1 1 
        4  7295 1 1  12 LEU HD23 H  -7.218   8.315   5.540 1.00 . A A .  12 LEU HD23 1 1 
        4  7296 1 1  12 LEU HG   H  -4.864   8.666   6.142 1.00 . A A .  12 LEU HG   1 1 
        4  7297 1 1  12 LEU N    N  -5.703  11.678   8.933 1.00 . A A .  12 LEU N    1 1 
        4  7298 1 1  12 LEU O    O  -2.973  10.730   6.900 1.00 . A A .  12 LEU O    1 1 
        4  7299 1 1  13 ASN C    C  -2.798  13.443   5.323 1.00 . A A .  13 ASN C    1 1 
        4  7300 1 1  13 ASN CA   C  -3.952  12.507   4.955 1.00 . A A .  13 ASN CA   1 1 
        4  7301 1 1  13 ASN CB   C  -4.928  13.196   3.961 1.00 . A A .  13 ASN CB   1 1 
        4  7302 1 1  13 ASN CG   C  -5.781  12.217   3.137 1.00 . A A .  13 ASN CG   1 1 
        4  7303 1 1  13 ASN H    H  -5.539  12.390   6.376 1.00 . A A .  13 ASN H    1 1 
        4  7304 1 1  13 ASN HA   H  -3.524  11.631   4.463 1.00 . A A .  13 ASN HA   1 1 
        4  7305 1 1  13 ASN HB2  H  -5.602  13.834   4.517 1.00 . A A .  13 ASN HB2  1 1 
        4  7306 1 1  13 ASN HB3  H  -4.359  13.810   3.269 1.00 . A A .  13 ASN HB3  1 1 
        4  7307 1 1  13 ASN HD21 H  -6.107  11.015   4.700 1.00 . A A .  13 ASN HD21 1 1 
        4  7308 1 1  13 ASN HD22 H  -6.825  10.529   3.209 1.00 . A A .  13 ASN HD22 1 1 
        4  7309 1 1  13 ASN N    N  -4.655  12.028   6.171 1.00 . A A .  13 ASN N    1 1 
        4  7310 1 1  13 ASN ND2  N  -6.284  11.147   3.749 1.00 . A A .  13 ASN ND2  1 1 
        4  7311 1 1  13 ASN O    O  -1.808  13.526   4.596 1.00 . A A .  13 ASN O    1 1 
        4  7312 1 1  13 ASN OD1  O  -6.019  12.443   1.949 1.00 . A A .  13 ASN OD1  1 1 
        4  7313 1 1  14 ARG C    C  -0.622  14.104   7.356 1.00 . A A .  14 ARG C    1 1 
        4  7314 1 1  14 ARG CA   C  -1.853  14.973   7.016 1.00 . A A .  14 ARG CA   1 1 
        4  7315 1 1  14 ARG CB   C  -2.339  15.755   8.266 1.00 . A A .  14 ARG CB   1 1 
        4  7316 1 1  14 ARG CD   C  -1.036  18.013   8.074 1.00 . A A .  14 ARG CD   1 1 
        4  7317 1 1  14 ARG CG   C  -1.298  16.726   8.898 1.00 . A A .  14 ARG CG   1 1 
        4  7318 1 1  14 ARG CZ   C   0.738  18.258   6.312 1.00 . A A .  14 ARG CZ   1 1 
        4  7319 1 1  14 ARG H    H  -3.781  14.082   6.943 1.00 . A A .  14 ARG H    1 1 
        4  7320 1 1  14 ARG HA   H  -1.565  15.688   6.244 1.00 . A A .  14 ARG HA   1 1 
        4  7321 1 1  14 ARG HB2  H  -3.217  16.334   7.991 1.00 . A A .  14 ARG HB2  1 1 
        4  7322 1 1  14 ARG HB3  H  -2.636  15.036   9.021 1.00 . A A .  14 ARG HB3  1 1 
        4  7323 1 1  14 ARG HD2  H  -1.980  18.524   7.923 1.00 . A A .  14 ARG HD2  1 1 
        4  7324 1 1  14 ARG HD3  H  -0.382  18.662   8.653 1.00 . A A .  14 ARG HD3  1 1 
        4  7325 1 1  14 ARG HE   H  -0.928  17.176   6.142 1.00 . A A .  14 ARG HE   1 1 
        4  7326 1 1  14 ARG HG2  H  -1.659  17.019   9.878 1.00 . A A .  14 ARG HG2  1 1 
        4  7327 1 1  14 ARG HG3  H  -0.359  16.196   9.020 1.00 . A A .  14 ARG HG3  1 1 
        4  7328 1 1  14 ARG HH11 H   1.103  19.397   7.951 1.00 . A A .  14 ARG HH11 1 1 
        4  7329 1 1  14 ARG HH12 H   2.317  19.463   6.716 1.00 . A A .  14 ARG HH12 1 1 
        4  7330 1 1  14 ARG HH21 H   0.670  17.279   4.538 1.00 . A A .  14 ARG HH21 1 1 
        4  7331 1 1  14 ARG HH22 H   2.076  18.264   4.794 1.00 . A A .  14 ARG HH22 1 1 
        4  7332 1 1  14 ARG N    N  -2.931  14.134   6.462 1.00 . A A .  14 ARG N    1 1 
        4  7333 1 1  14 ARG NE   N  -0.430  17.764   6.745 1.00 . A A .  14 ARG NE   1 1 
        4  7334 1 1  14 ARG NH1  N   1.438  19.112   7.050 1.00 . A A .  14 ARG NH1  1 1 
        4  7335 1 1  14 ARG NH2  N   1.193  17.914   5.117 1.00 . A A .  14 ARG NH2  1 1 
        4  7336 1 1  14 ARG O    O   0.512  14.580   7.339 1.00 . A A .  14 ARG O    1 1 
        4  7337 1 1  15 MET C    C   0.640  11.198   6.583 1.00 . A A .  15 MET C    1 1 
        4  7338 1 1  15 MET CA   C   0.169  11.827   7.915 1.00 . A A .  15 MET CA   1 1 
        4  7339 1 1  15 MET CB   C  -0.364  10.741   8.889 1.00 . A A .  15 MET CB   1 1 
        4  7340 1 1  15 MET CE   C  -2.294  11.006  12.620 1.00 . A A .  15 MET CE   1 1 
        4  7341 1 1  15 MET CG   C  -0.926  11.303  10.204 1.00 . A A .  15 MET CG   1 1 
        4  7342 1 1  15 MET H    H  -1.810  12.521   7.716 1.00 . A A .  15 MET H    1 1 
        4  7343 1 1  15 MET HA   H   1.012  12.335   8.388 1.00 . A A .  15 MET HA   1 1 
        4  7344 1 1  15 MET HB2  H  -1.151  10.178   8.398 1.00 . A A .  15 MET HB2  1 1 
        4  7345 1 1  15 MET HB3  H   0.444  10.063   9.133 1.00 . A A .  15 MET HB3  1 1 
        4  7346 1 1  15 MET HE1  H  -3.051  11.658  12.211 1.00 . A A .  15 MET HE1  1 1 
        4  7347 1 1  15 MET HE2  H  -1.528  11.600  13.091 1.00 . A A .  15 MET HE2  1 1 
        4  7348 1 1  15 MET HE3  H  -2.738  10.347  13.355 1.00 . A A .  15 MET HE3  1 1 
        4  7349 1 1  15 MET HG2  H  -0.132  11.839  10.719 1.00 . A A .  15 MET HG2  1 1 
        4  7350 1 1  15 MET HG3  H  -1.730  11.993   9.975 1.00 . A A .  15 MET HG3  1 1 
        4  7351 1 1  15 MET N    N  -0.878  12.818   7.661 1.00 . A A .  15 MET N    1 1 
        4  7352 1 1  15 MET O    O   1.765  11.445   6.152 1.00 . A A .  15 MET O    1 1 
        4  7353 1 1  15 MET SD   S  -1.573  10.024  11.301 1.00 . A A .  15 MET SD   1 1 
        4  7354 1 1  16 GLN C    C   0.510  10.455   3.520 1.00 . A A .  16 GLN C    1 1 
        4  7355 1 1  16 GLN CA   C   0.054   9.627   4.727 1.00 . A A .  16 GLN CA   1 1 
        4  7356 1 1  16 GLN CB   C  -1.164   8.794   4.281 1.00 . A A .  16 GLN CB   1 1 
        4  7357 1 1  16 GLN CD   C  -2.931   7.056   4.759 1.00 . A A .  16 GLN CD   1 1 
        4  7358 1 1  16 GLN CG   C  -1.777   7.871   5.340 1.00 . A A .  16 GLN CG   1 1 
        4  7359 1 1  16 GLN H    H  -1.202  10.504   6.190 1.00 . A A .  16 GLN H    1 1 
        4  7360 1 1  16 GLN HA   H   0.850   8.950   5.025 1.00 . A A .  16 GLN HA   1 1 
        4  7361 1 1  16 GLN HB2  H  -1.945   9.475   3.953 1.00 . A A .  16 GLN HB2  1 1 
        4  7362 1 1  16 GLN HB3  H  -0.871   8.178   3.432 1.00 . A A .  16 GLN HB3  1 1 
        4  7363 1 1  16 GLN HE21 H  -2.658   5.588   6.049 1.00 . A A .  16 GLN HE21 1 1 
        4  7364 1 1  16 GLN HE22 H  -3.922   5.352   4.898 1.00 . A A .  16 GLN HE22 1 1 
        4  7365 1 1  16 GLN HG2  H  -1.010   7.193   5.696 1.00 . A A .  16 GLN HG2  1 1 
        4  7366 1 1  16 GLN HG3  H  -2.146   8.465   6.164 1.00 . A A .  16 GLN HG3  1 1 
        4  7367 1 1  16 GLN N    N  -0.274  10.471   5.899 1.00 . A A .  16 GLN N    1 1 
        4  7368 1 1  16 GLN NE2  N  -3.205   5.889   5.298 1.00 . A A .  16 GLN NE2  1 1 
        4  7369 1 1  16 GLN O    O   1.541  10.174   2.937 1.00 . A A .  16 GLN O    1 1 
        4  7370 1 1  16 GLN OE1  O  -3.580   7.503   3.836 1.00 . A A .  16 GLN OE1  1 1 
        4  7371 1 1  17 TYR C    C   1.283  13.017   2.090 1.00 . A A .  17 TYR C    1 1 
        4  7372 1 1  17 TYR CA   C  -0.057  12.268   1.928 1.00 . A A .  17 TYR CA   1 1 
        4  7373 1 1  17 TYR CB   C  -1.223  13.249   1.607 1.00 . A A .  17 TYR CB   1 1 
        4  7374 1 1  17 TYR CD1  C  -1.363  13.520  -0.940 1.00 . A A .  17 TYR CD1  1 1 
        4  7375 1 1  17 TYR CD2  C  -0.457  15.342   0.323 1.00 . A A .  17 TYR CD2  1 1 
        4  7376 1 1  17 TYR CE1  C  -1.146  14.231  -2.108 1.00 . A A .  17 TYR CE1  1 1 
        4  7377 1 1  17 TYR CE2  C  -0.245  16.051  -0.843 1.00 . A A .  17 TYR CE2  1 1 
        4  7378 1 1  17 TYR CG   C  -1.018  14.057   0.306 1.00 . A A .  17 TYR CG   1 1 
        4  7379 1 1  17 TYR CZ   C  -0.590  15.494  -2.054 1.00 . A A .  17 TYR CZ   1 1 
        4  7380 1 1  17 TYR H    H  -1.143  11.566   3.660 1.00 . A A .  17 TYR H    1 1 
        4  7381 1 1  17 TYR HA   H   0.040  11.575   1.091 1.00 . A A .  17 TYR HA   1 1 
        4  7382 1 1  17 TYR HB2  H  -2.147  12.685   1.512 1.00 . A A .  17 TYR HB2  1 1 
        4  7383 1 1  17 TYR HB3  H  -1.331  13.949   2.425 1.00 . A A .  17 TYR HB3  1 1 
        4  7384 1 1  17 TYR HD1  H  -1.798  12.524  -0.988 1.00 . A A .  17 TYR HD1  1 1 
        4  7385 1 1  17 TYR HD2  H  -0.180  15.783   1.271 1.00 . A A .  17 TYR HD2  1 1 
        4  7386 1 1  17 TYR HE1  H  -1.421  13.798  -3.061 1.00 . A A .  17 TYR HE1  1 1 
        4  7387 1 1  17 TYR HE2  H   0.193  17.039  -0.800 1.00 . A A .  17 TYR HE2  1 1 
        4  7388 1 1  17 TYR HH   H  -1.135  16.117  -3.792 1.00 . A A .  17 TYR HH   1 1 
        4  7389 1 1  17 TYR N    N  -0.324  11.440   3.131 1.00 . A A .  17 TYR N    1 1 
        4  7390 1 1  17 TYR O    O   2.043  13.120   1.138 1.00 . A A .  17 TYR O    1 1 
        4  7391 1 1  17 TYR OH   O  -0.364  16.195  -3.221 1.00 . A A .  17 TYR OH   1 1 
        4  7392 1 1  18 GLU C    C   4.022  13.163   3.545 1.00 . A A .  18 GLU C    1 1 
        4  7393 1 1  18 GLU CA   C   2.838  14.159   3.676 1.00 . A A .  18 GLU CA   1 1 
        4  7394 1 1  18 GLU CB   C   2.769  14.702   5.125 1.00 . A A .  18 GLU CB   1 1 
        4  7395 1 1  18 GLU CD   C   4.012  15.753   7.110 1.00 . A A .  18 GLU CD   1 1 
        4  7396 1 1  18 GLU CG   C   4.031  15.448   5.605 1.00 . A A .  18 GLU CG   1 1 
        4  7397 1 1  18 GLU H    H   0.832  13.502   3.991 1.00 . A A .  18 GLU H    1 1 
        4  7398 1 1  18 GLU HA   H   2.999  14.992   2.991 1.00 . A A .  18 GLU HA   1 1 
        4  7399 1 1  18 GLU HB2  H   1.927  15.385   5.200 1.00 . A A .  18 GLU HB2  1 1 
        4  7400 1 1  18 GLU HB3  H   2.589  13.868   5.795 1.00 . A A .  18 GLU HB3  1 1 
        4  7401 1 1  18 GLU HG2  H   4.902  14.841   5.378 1.00 . A A .  18 GLU HG2  1 1 
        4  7402 1 1  18 GLU HG3  H   4.112  16.381   5.058 1.00 . A A .  18 GLU HG3  1 1 
        4  7403 1 1  18 GLU N    N   1.546  13.526   3.316 1.00 . A A .  18 GLU N    1 1 
        4  7404 1 1  18 GLU O    O   5.106  13.531   3.081 1.00 . A A .  18 GLU O    1 1 
        4  7405 1 1  18 GLU OE1  O   3.439  16.784   7.519 1.00 . A A .  18 GLU OE1  1 1 
        4  7406 1 1  18 GLU OE2  O   4.573  14.961   7.894 1.00 . A A .  18 GLU OE2  1 1 
        4  7407 1 1  19 VAL C    C   5.142  10.525   2.419 1.00 . A A .  19 VAL C    1 1 
        4  7408 1 1  19 VAL CA   C   4.795  10.825   3.896 1.00 . A A .  19 VAL CA   1 1 
        4  7409 1 1  19 VAL CB   C   4.313   9.513   4.648 1.00 . A A .  19 VAL CB   1 1 
        4  7410 1 1  19 VAL CG1  C   5.149   8.282   4.252 1.00 . A A .  19 VAL CG1  1 1 
        4  7411 1 1  19 VAL CG2  C   4.355   9.687   6.182 1.00 . A A .  19 VAL CG2  1 1 
        4  7412 1 1  19 VAL H    H   2.877  11.717   4.297 1.00 . A A .  19 VAL H    1 1 
        4  7413 1 1  19 VAL HA   H   5.694  11.188   4.397 1.00 . A A .  19 VAL HA   1 1 
        4  7414 1 1  19 VAL HB   H   3.281   9.318   4.360 1.00 . A A .  19 VAL HB   1 1 
        4  7415 1 1  19 VAL HG11 H   4.775   7.404   4.769 1.00 . A A .  19 VAL HG11 1 1 
        4  7416 1 1  19 VAL HG12 H   6.185   8.440   4.520 1.00 . A A .  19 VAL HG12 1 1 
        4  7417 1 1  19 VAL HG13 H   5.081   8.116   3.182 1.00 . A A .  19 VAL HG13 1 1 
        4  7418 1 1  19 VAL HG21 H   3.968   8.790   6.659 1.00 . A A .  19 VAL HG21 1 1 
        4  7419 1 1  19 VAL HG22 H   3.750  10.535   6.475 1.00 . A A .  19 VAL HG22 1 1 
        4  7420 1 1  19 VAL HG23 H   5.379   9.848   6.501 1.00 . A A .  19 VAL HG23 1 1 
        4  7421 1 1  19 VAL N    N   3.782  11.905   3.961 1.00 . A A .  19 VAL N    1 1 
        4  7422 1 1  19 VAL O    O   6.258  10.783   1.972 1.00 . A A .  19 VAL O    1 1 
        4  7423 1 1  20 THR C    C   4.596  10.825  -0.677 1.00 . A A .  20 THR C    1 1 
        4  7424 1 1  20 THR CA   C   4.252   9.635   0.266 1.00 . A A .  20 THR CA   1 1 
        4  7425 1 1  20 THR CB   C   2.920   8.924  -0.171 1.00 . A A .  20 THR CB   1 1 
        4  7426 1 1  20 THR CG2  C   3.050   8.169  -1.509 1.00 . A A .  20 THR CG2  1 1 
        4  7427 1 1  20 THR H    H   3.257  10.012   2.082 1.00 . A A .  20 THR H    1 1 
        4  7428 1 1  20 THR HA   H   5.058   8.908   0.212 1.00 . A A .  20 THR HA   1 1 
        4  7429 1 1  20 THR HB   H   2.138   9.672  -0.264 1.00 . A A .  20 THR HB   1 1 
        4  7430 1 1  20 THR HG1  H   1.658   7.623   0.639 1.00 . A A .  20 THR HG1  1 1 
        4  7431 1 1  20 THR HG21 H   3.319   8.862  -2.296 1.00 . A A .  20 THR HG21 1 1 
        4  7432 1 1  20 THR HG22 H   2.103   7.702  -1.757 1.00 . A A .  20 THR HG22 1 1 
        4  7433 1 1  20 THR HG23 H   3.811   7.404  -1.428 1.00 . A A .  20 THR HG23 1 1 
        4  7434 1 1  20 THR N    N   4.133  10.066   1.671 1.00 . A A .  20 THR N    1 1 
        4  7435 1 1  20 THR O    O   4.990  10.619  -1.831 1.00 . A A .  20 THR O    1 1 
        4  7436 1 1  20 THR OG1  O   2.527   7.986   0.850 1.00 . A A .  20 THR OG1  1 1 
        4  7437 1 1  21 GLN C    C   6.383  13.267  -1.218 1.00 . A A .  21 GLN C    1 1 
        4  7438 1 1  21 GLN CA   C   4.875  13.296  -0.882 1.00 . A A .  21 GLN CA   1 1 
        4  7439 1 1  21 GLN CB   C   4.518  14.546  -0.036 1.00 . A A .  21 GLN CB   1 1 
        4  7440 1 1  21 GLN CD   C   4.410  17.086   0.185 1.00 . A A .  21 GLN CD   1 1 
        4  7441 1 1  21 GLN CG   C   4.869  15.904  -0.667 1.00 . A A .  21 GLN CG   1 1 
        4  7442 1 1  21 GLN H    H   4.080  12.161   0.740 1.00 . A A .  21 GLN H    1 1 
        4  7443 1 1  21 GLN HA   H   4.310  13.332  -1.809 1.00 . A A .  21 GLN HA   1 1 
        4  7444 1 1  21 GLN HB2  H   3.447  14.534   0.151 1.00 . A A .  21 GLN HB2  1 1 
        4  7445 1 1  21 GLN HB3  H   5.027  14.471   0.921 1.00 . A A .  21 GLN HB3  1 1 
        4  7446 1 1  21 GLN HE21 H   6.084  17.013   1.257 1.00 . A A .  21 GLN HE21 1 1 
        4  7447 1 1  21 GLN HE22 H   4.961  18.245   1.695 1.00 . A A .  21 GLN HE22 1 1 
        4  7448 1 1  21 GLN HG2  H   5.945  15.967  -0.796 1.00 . A A .  21 GLN HG2  1 1 
        4  7449 1 1  21 GLN HG3  H   4.395  15.971  -1.639 1.00 . A A .  21 GLN HG3  1 1 
        4  7450 1 1  21 GLN N    N   4.470  12.067  -0.161 1.00 . A A .  21 GLN N    1 1 
        4  7451 1 1  21 GLN NE2  N   5.233  17.489   1.143 1.00 . A A .  21 GLN NE2  1 1 
        4  7452 1 1  21 GLN O    O   6.792  13.674  -2.308 1.00 . A A .  21 GLN O    1 1 
        4  7453 1 1  21 GLN OE1  O   3.310  17.611   0.005 1.00 . A A .  21 GLN OE1  1 1 
        4  7454 1 1  22 ASN C    C   9.125  11.239   0.083 1.00 . A A .  22 ASN C    1 1 
        4  7455 1 1  22 ASN CA   C   8.657  12.614  -0.454 1.00 . A A .  22 ASN CA   1 1 
        4  7456 1 1  22 ASN CB   C   9.374  13.813   0.250 1.00 . A A .  22 ASN CB   1 1 
        4  7457 1 1  22 ASN CG   C  10.841  14.000  -0.170 1.00 . A A .  22 ASN CG   1 1 
        4  7458 1 1  22 ASN H    H   6.797  12.421   0.560 1.00 . A A .  22 ASN H    1 1 
        4  7459 1 1  22 ASN HA   H   8.875  12.648  -1.521 1.00 . A A .  22 ASN HA   1 1 
        4  7460 1 1  22 ASN HB2  H   8.840  14.723   0.008 1.00 . A A .  22 ASN HB2  1 1 
        4  7461 1 1  22 ASN HB3  H   9.337  13.668   1.323 1.00 . A A .  22 ASN HB3  1 1 
        4  7462 1 1  22 ASN HD21 H  11.484  12.880   1.344 1.00 . A A .  22 ASN HD21 1 1 
        4  7463 1 1  22 ASN HD22 H  12.709  13.523   0.315 1.00 . A A .  22 ASN HD22 1 1 
        4  7464 1 1  22 ASN N    N   7.193  12.741  -0.280 1.00 . A A .  22 ASN N    1 1 
        4  7465 1 1  22 ASN ND2  N  11.773  13.411   0.571 1.00 . A A .  22 ASN ND2  1 1 
        4  7466 1 1  22 ASN O    O  10.270  11.078   0.518 1.00 . A A .  22 ASN O    1 1 
        4  7467 1 1  22 ASN OD1  O  11.134  14.677  -1.155 1.00 . A A .  22 ASN OD1  1 1 
        4  7468 1 1  23 ASN C    C   9.106   8.652   1.786 1.00 . A A .  23 ASN C    1 1 
        4  7469 1 1  23 ASN CA   C   8.419   8.815   0.405 1.00 . A A .  23 ASN CA   1 1 
        4  7470 1 1  23 ASN CB   C   9.162   8.018  -0.726 1.00 . A A .  23 ASN CB   1 1 
        4  7471 1 1  23 ASN CG   C  10.645   8.377  -0.958 1.00 . A A .  23 ASN CG   1 1 
        4  7472 1 1  23 ASN H    H   7.298  10.492  -0.278 1.00 . A A .  23 ASN H    1 1 
        4  7473 1 1  23 ASN HA   H   7.428   8.386   0.503 1.00 . A A .  23 ASN HA   1 1 
        4  7474 1 1  23 ASN HB2  H   9.116   6.959  -0.492 1.00 . A A .  23 ASN HB2  1 1 
        4  7475 1 1  23 ASN HB3  H   8.630   8.167  -1.663 1.00 . A A .  23 ASN HB3  1 1 
        4  7476 1 1  23 ASN HD21 H  10.150   9.808  -2.247 1.00 . A A .  23 ASN HD21 1 1 
        4  7477 1 1  23 ASN HD22 H  11.841   9.606  -1.970 1.00 . A A .  23 ASN HD22 1 1 
        4  7478 1 1  23 ASN N    N   8.197  10.244   0.025 1.00 . A A .  23 ASN N    1 1 
        4  7479 1 1  23 ASN ND2  N  10.904   9.363  -1.812 1.00 . A A .  23 ASN ND2  1 1 
        4  7480 1 1  23 ASN O    O   9.800   7.656   2.032 1.00 . A A .  23 ASN O    1 1 
        4  7481 1 1  23 ASN OD1  O  11.551   7.766  -0.383 1.00 . A A .  23 ASN OD1  1 1 
        4  7482 1 1  24 GLY C    C   9.073   8.597   4.964 1.00 . A A .  24 GLY C    1 1 
        4  7483 1 1  24 GLY CA   C   9.506   9.683   4.002 1.00 . A A .  24 GLY CA   1 1 
        4  7484 1 1  24 GLY H    H   8.134  10.260   2.503 1.00 . A A .  24 GLY H    1 1 
        4  7485 1 1  24 GLY HA2  H  10.579   9.622   3.859 1.00 . A A .  24 GLY HA2  1 1 
        4  7486 1 1  24 GLY HA3  H   9.274  10.644   4.444 1.00 . A A .  24 GLY HA3  1 1 
        4  7487 1 1  24 GLY N    N   8.833   9.607   2.704 1.00 . A A .  24 GLY N    1 1 
        4  7488 1 1  24 GLY O    O   8.204   7.785   4.651 1.00 . A A .  24 GLY O    1 1 
        4  7489 1 1  25 THR C    C   8.348   8.312   8.152 1.00 . A A .  25 THR C    1 1 
        4  7490 1 1  25 THR CA   C   9.338   7.629   7.201 1.00 . A A .  25 THR CA   1 1 
        4  7491 1 1  25 THR CB   C  10.600   7.155   7.989 1.00 . A A .  25 THR CB   1 1 
        4  7492 1 1  25 THR CG2  C  10.277   6.033   9.001 1.00 . A A .  25 THR CG2  1 1 
        4  7493 1 1  25 THR H    H  10.403   9.225   6.307 1.00 . A A .  25 THR H    1 1 
        4  7494 1 1  25 THR HA   H   8.865   6.752   6.749 1.00 . A A .  25 THR HA   1 1 
        4  7495 1 1  25 THR HB   H  11.016   8.004   8.525 1.00 . A A .  25 THR HB   1 1 
        4  7496 1 1  25 THR HG1  H  11.163   6.482   6.223 1.00 . A A .  25 THR HG1  1 1 
        4  7497 1 1  25 THR HG21 H   9.537   6.380   9.712 1.00 . A A .  25 THR HG21 1 1 
        4  7498 1 1  25 THR HG22 H  11.178   5.754   9.535 1.00 . A A .  25 THR HG22 1 1 
        4  7499 1 1  25 THR HG23 H   9.892   5.165   8.482 1.00 . A A .  25 THR HG23 1 1 
        4  7500 1 1  25 THR N    N   9.698   8.568   6.139 1.00 . A A .  25 THR N    1 1 
        4  7501 1 1  25 THR O    O   8.536   9.483   8.522 1.00 . A A .  25 THR O    1 1 
        4  7502 1 1  25 THR OG1  O  11.587   6.687   7.061 1.00 . A A .  25 THR OG1  1 1 
        4  7503 1 1  26 GLU C    C   6.996   7.859  10.942 1.00 . A A .  26 GLU C    1 1 
        4  7504 1 1  26 GLU CA   C   6.338   8.010   9.546 1.00 . A A .  26 GLU CA   1 1 
        4  7505 1 1  26 GLU CB   C   5.002   7.193   9.452 1.00 . A A .  26 GLU CB   1 1 
        4  7506 1 1  26 GLU CD   C   5.780   4.964   8.343 1.00 . A A .  26 GLU CD   1 1 
        4  7507 1 1  26 GLU CG   C   5.109   5.646   9.558 1.00 . A A .  26 GLU CG   1 1 
        4  7508 1 1  26 GLU H    H   7.154   6.709   8.115 1.00 . A A .  26 GLU H    1 1 
        4  7509 1 1  26 GLU HA   H   6.121   9.064   9.370 1.00 . A A .  26 GLU HA   1 1 
        4  7510 1 1  26 GLU HB2  H   4.341   7.527  10.244 1.00 . A A .  26 GLU HB2  1 1 
        4  7511 1 1  26 GLU HB3  H   4.528   7.431   8.502 1.00 . A A .  26 GLU HB3  1 1 
        4  7512 1 1  26 GLU HG2  H   5.673   5.404  10.452 1.00 . A A .  26 GLU HG2  1 1 
        4  7513 1 1  26 GLU HG3  H   4.108   5.238   9.667 1.00 . A A .  26 GLU HG3  1 1 
        4  7514 1 1  26 GLU N    N   7.294   7.585   8.517 1.00 . A A .  26 GLU N    1 1 
        4  7515 1 1  26 GLU O    O   7.789   6.927  11.139 1.00 . A A .  26 GLU O    1 1 
        4  7516 1 1  26 GLU OE1  O   5.296   5.146   7.208 1.00 . A A .  26 GLU OE1  1 1 
        4  7517 1 1  26 GLU OE2  O   6.804   4.268   8.511 1.00 . A A .  26 GLU OE2  1 1 
        4  7518 1 1  27 PRO C    C   7.332   7.474  13.996 1.00 . A A .  27 PRO C    1 1 
        4  7519 1 1  27 PRO CA   C   7.359   8.833  13.249 1.00 . A A .  27 PRO CA   1 1 
        4  7520 1 1  27 PRO CB   C   6.567   9.934  14.027 1.00 . A A .  27 PRO CB   1 1 
        4  7521 1 1  27 PRO CD   C   5.740   9.912  11.772 1.00 . A A .  27 PRO CD   1 1 
        4  7522 1 1  27 PRO CG   C   5.347  10.204  13.198 1.00 . A A .  27 PRO CG   1 1 
        4  7523 1 1  27 PRO HA   H   8.389   9.151  13.144 1.00 . A A .  27 PRO HA   1 1 
        4  7524 1 1  27 PRO HB2  H   6.297   9.590  15.023 1.00 . A A .  27 PRO HB2  1 1 
        4  7525 1 1  27 PRO HB3  H   7.180  10.826  14.122 1.00 . A A .  27 PRO HB3  1 1 
        4  7526 1 1  27 PRO HD2  H   4.875   9.613  11.190 1.00 . A A .  27 PRO HD2  1 1 
        4  7527 1 1  27 PRO HD3  H   6.217  10.772  11.313 1.00 . A A .  27 PRO HD3  1 1 
        4  7528 1 1  27 PRO HG2  H   4.538   9.550  13.510 1.00 . A A .  27 PRO HG2  1 1 
        4  7529 1 1  27 PRO HG3  H   5.041  11.239  13.301 1.00 . A A .  27 PRO HG3  1 1 
        4  7530 1 1  27 PRO N    N   6.705   8.797  11.912 1.00 . A A .  27 PRO N    1 1 
        4  7531 1 1  27 PRO O    O   6.279   6.826  14.068 1.00 . A A .  27 PRO O    1 1 
        4  7532 1 1  28 PRO C    C   7.857   6.000  16.700 1.00 . A A .  28 PRO C    1 1 
        4  7533 1 1  28 PRO CA   C   8.577   5.787  15.351 1.00 . A A .  28 PRO CA   1 1 
        4  7534 1 1  28 PRO CB   C  10.100   5.540  15.515 1.00 . A A .  28 PRO CB   1 1 
        4  7535 1 1  28 PRO CD   C   9.856   7.645  14.389 1.00 . A A .  28 PRO CD   1 1 
        4  7536 1 1  28 PRO CG   C  10.718   6.904  15.389 1.00 . A A .  28 PRO CG   1 1 
        4  7537 1 1  28 PRO HA   H   8.125   4.946  14.827 1.00 . A A .  28 PRO HA   1 1 
        4  7538 1 1  28 PRO HB2  H  10.307   5.089  16.482 1.00 . A A .  28 PRO HB2  1 1 
        4  7539 1 1  28 PRO HB3  H  10.452   4.872  14.733 1.00 . A A .  28 PRO HB3  1 1 
        4  7540 1 1  28 PRO HD2  H   9.815   8.704  14.627 1.00 . A A .  28 PRO HD2  1 1 
        4  7541 1 1  28 PRO HD3  H  10.232   7.507  13.379 1.00 . A A .  28 PRO HD3  1 1 
        4  7542 1 1  28 PRO HG2  H  10.704   7.405  16.355 1.00 . A A .  28 PRO HG2  1 1 
        4  7543 1 1  28 PRO HG3  H  11.736   6.825  15.030 1.00 . A A .  28 PRO HG3  1 1 
        4  7544 1 1  28 PRO N    N   8.509   7.013  14.538 1.00 . A A .  28 PRO N    1 1 
        4  7545 1 1  28 PRO O    O   8.420   6.569  17.646 1.00 . A A .  28 PRO O    1 1 
        4  7546 1 1  29 PHE C    C   6.177   4.962  19.125 1.00 . A A .  29 PHE C    1 1 
        4  7547 1 1  29 PHE CA   C   5.703   5.784  17.914 1.00 . A A .  29 PHE CA   1 1 
        4  7548 1 1  29 PHE CB   C   4.242   5.416  17.557 1.00 . A A .  29 PHE CB   1 1 
        4  7549 1 1  29 PHE CD1  C   3.500   7.560  16.420 1.00 . A A .  29 PHE CD1  1 1 
        4  7550 1 1  29 PHE CD2  C   3.349   5.524  15.177 1.00 . A A .  29 PHE CD2  1 1 
        4  7551 1 1  29 PHE CE1  C   3.002   8.252  15.336 1.00 . A A .  29 PHE CE1  1 1 
        4  7552 1 1  29 PHE CE2  C   2.851   6.218  14.093 1.00 . A A .  29 PHE CE2  1 1 
        4  7553 1 1  29 PHE CG   C   3.683   6.180  16.360 1.00 . A A .  29 PHE CG   1 1 
        4  7554 1 1  29 PHE CZ   C   2.679   7.581  14.172 1.00 . A A .  29 PHE CZ   1 1 
        4  7555 1 1  29 PHE H    H   6.220   5.117  15.960 1.00 . A A .  29 PHE H    1 1 
        4  7556 1 1  29 PHE HA   H   5.743   6.840  18.172 1.00 . A A .  29 PHE HA   1 1 
        4  7557 1 1  29 PHE HB2  H   4.189   4.353  17.337 1.00 . A A .  29 PHE HB2  1 1 
        4  7558 1 1  29 PHE HB3  H   3.602   5.623  18.408 1.00 . A A .  29 PHE HB3  1 1 
        4  7559 1 1  29 PHE HD1  H   3.753   8.094  17.327 1.00 . A A .  29 PHE HD1  1 1 
        4  7560 1 1  29 PHE HD2  H   3.481   4.450  15.110 1.00 . A A .  29 PHE HD2  1 1 
        4  7561 1 1  29 PHE HE1  H   2.863   9.324  15.398 1.00 . A A .  29 PHE HE1  1 1 
        4  7562 1 1  29 PHE HE2  H   2.597   5.691  13.183 1.00 . A A .  29 PHE HE2  1 1 
        4  7563 1 1  29 PHE HZ   H   2.288   8.127  13.324 1.00 . A A .  29 PHE HZ   1 1 
        4  7564 1 1  29 PHE N    N   6.583   5.578  16.747 1.00 . A A .  29 PHE N    1 1 
        4  7565 1 1  29 PHE O    O   5.918   5.340  20.271 1.00 . A A .  29 PHE O    1 1 
        4  7566 1 1  30 GLN C    C   6.155   2.355  20.674 1.00 . A A .  30 GLN C    1 1 
        4  7567 1 1  30 GLN CA   C   7.356   2.862  19.844 1.00 . A A .  30 GLN CA   1 1 
        4  7568 1 1  30 GLN CB   C   8.501   3.460  20.713 1.00 . A A .  30 GLN CB   1 1 
        4  7569 1 1  30 GLN CD   C  10.279   3.049  18.885 1.00 . A A .  30 GLN CD   1 1 
        4  7570 1 1  30 GLN CG   C   9.683   4.038  19.897 1.00 . A A .  30 GLN CG   1 1 
        4  7571 1 1  30 GLN H    H   7.144   3.691  17.905 1.00 . A A .  30 GLN H    1 1 
        4  7572 1 1  30 GLN HA   H   7.752   2.016  19.286 1.00 . A A .  30 GLN HA   1 1 
        4  7573 1 1  30 GLN HB2  H   8.090   4.256  21.326 1.00 . A A .  30 GLN HB2  1 1 
        4  7574 1 1  30 GLN HB3  H   8.885   2.684  21.370 1.00 . A A .  30 GLN HB3  1 1 
        4  7575 1 1  30 GLN HE21 H  11.556   2.372  20.248 1.00 . A A .  30 GLN HE21 1 1 
        4  7576 1 1  30 GLN HE22 H  11.667   1.640  18.688 1.00 . A A .  30 GLN HE22 1 1 
        4  7577 1 1  30 GLN HG2  H   9.333   4.910  19.355 1.00 . A A .  30 GLN HG2  1 1 
        4  7578 1 1  30 GLN HG3  H  10.463   4.346  20.586 1.00 . A A .  30 GLN HG3  1 1 
        4  7579 1 1  30 GLN N    N   6.897   3.848  18.838 1.00 . A A .  30 GLN N    1 1 
        4  7580 1 1  30 GLN NE2  N  11.263   2.273  19.316 1.00 . A A .  30 GLN NE2  1 1 
        4  7581 1 1  30 GLN O    O   6.248   2.102  21.876 1.00 . A A .  30 GLN O    1 1 
        4  7582 1 1  30 GLN OE1  O   9.850   2.982  17.727 1.00 . A A .  30 GLN OE1  1 1 
        4  7583 1 1  31 ASN C    C   3.338   0.419  20.205 1.00 . A A .  31 ASN C    1 1 
        4  7584 1 1  31 ASN CA   C   3.708   1.885  20.507 1.00 . A A .  31 ASN CA   1 1 
        4  7585 1 1  31 ASN CB   C   2.689   2.884  19.873 1.00 . A A .  31 ASN CB   1 1 
        4  7586 1 1  31 ASN CG   C   1.271   2.775  20.429 1.00 . A A .  31 ASN CG   1 1 
        4  7587 1 1  31 ASN H    H   5.123   2.225  18.978 1.00 . A A .  31 ASN H    1 1 
        4  7588 1 1  31 ASN HA   H   3.734   2.031  21.583 1.00 . A A .  31 ASN HA   1 1 
        4  7589 1 1  31 ASN HB2  H   3.036   3.898  20.042 1.00 . A A .  31 ASN HB2  1 1 
        4  7590 1 1  31 ASN HB3  H   2.650   2.717  18.803 1.00 . A A .  31 ASN HB3  1 1 
        4  7591 1 1  31 ASN HD21 H   1.673   4.138  21.818 1.00 . A A .  31 ASN HD21 1 1 
        4  7592 1 1  31 ASN HD22 H   0.071   3.502  21.829 1.00 . A A .  31 ASN HD22 1 1 
        4  7593 1 1  31 ASN N    N   5.040   2.174  19.951 1.00 . A A .  31 ASN N    1 1 
        4  7594 1 1  31 ASN ND2  N   0.975   3.547  21.464 1.00 . A A .  31 ASN ND2  1 1 
        4  7595 1 1  31 ASN O    O   3.879  -0.174  19.266 1.00 . A A .  31 ASN O    1 1 
        4  7596 1 1  31 ASN OD1  O   0.450   2.016  19.923 1.00 . A A .  31 ASN OD1  1 1 
        4  7597 1 1  32 GLU C    C   1.275  -1.826  19.543 1.00 . A A .  32 GLU C    1 1 
        4  7598 1 1  32 GLU CA   C   2.004  -1.575  20.885 1.00 . A A .  32 GLU CA   1 1 
        4  7599 1 1  32 GLU CB   C   1.096  -1.951  22.087 1.00 . A A .  32 GLU CB   1 1 
        4  7600 1 1  32 GLU CD   C   0.834  -2.085  24.650 1.00 . A A .  32 GLU CD   1 1 
        4  7601 1 1  32 GLU CG   C   1.770  -1.774  23.466 1.00 . A A .  32 GLU CG   1 1 
        4  7602 1 1  32 GLU H    H   2.051   0.379  21.738 1.00 . A A .  32 GLU H    1 1 
        4  7603 1 1  32 GLU HA   H   2.899  -2.195  20.918 1.00 . A A .  32 GLU HA   1 1 
        4  7604 1 1  32 GLU HB2  H   0.207  -1.329  22.061 1.00 . A A .  32 GLU HB2  1 1 
        4  7605 1 1  32 GLU HB3  H   0.793  -2.991  21.988 1.00 . A A .  32 GLU HB3  1 1 
        4  7606 1 1  32 GLU HG2  H   2.632  -2.431  23.515 1.00 . A A .  32 GLU HG2  1 1 
        4  7607 1 1  32 GLU HG3  H   2.115  -0.747  23.551 1.00 . A A .  32 GLU HG3  1 1 
        4  7608 1 1  32 GLU N    N   2.437  -0.160  21.015 1.00 . A A .  32 GLU N    1 1 
        4  7609 1 1  32 GLU O    O   1.499  -2.844  18.886 1.00 . A A .  32 GLU O    1 1 
        4  7610 1 1  32 GLU OE1  O   0.027  -1.209  25.030 1.00 . A A .  32 GLU OE1  1 1 
        4  7611 1 1  32 GLU OE2  O   0.889  -3.211  25.191 1.00 . A A .  32 GLU OE2  1 1 
        4  7612 1 1  33 TYR C    C   0.548  -0.608  16.669 1.00 . A A .  33 TYR C    1 1 
        4  7613 1 1  33 TYR CA   C  -0.354  -0.912  17.888 1.00 . A A .  33 TYR CA   1 1 
        4  7614 1 1  33 TYR CB   C  -1.532   0.098  17.957 1.00 . A A .  33 TYR CB   1 1 
        4  7615 1 1  33 TYR CD1  C  -2.939  -1.278  19.598 1.00 . A A .  33 TYR CD1  1 1 
        4  7616 1 1  33 TYR CD2  C  -2.688   1.059  20.026 1.00 . A A .  33 TYR CD2  1 1 
        4  7617 1 1  33 TYR CE1  C  -3.713  -1.403  20.735 1.00 . A A .  33 TYR CE1  1 1 
        4  7618 1 1  33 TYR CE2  C  -3.458   0.933  21.165 1.00 . A A .  33 TYR CE2  1 1 
        4  7619 1 1  33 TYR CG   C  -2.408  -0.043  19.215 1.00 . A A .  33 TYR CG   1 1 
        4  7620 1 1  33 TYR CZ   C  -3.968  -0.298  21.516 1.00 . A A .  33 TYR CZ   1 1 
        4  7621 1 1  33 TYR H    H   0.312  -0.078  19.731 1.00 . A A .  33 TYR H    1 1 
        4  7622 1 1  33 TYR HA   H  -0.760  -1.916  17.780 1.00 . A A .  33 TYR HA   1 1 
        4  7623 1 1  33 TYR HB2  H  -1.132   1.108  17.934 1.00 . A A .  33 TYR HB2  1 1 
        4  7624 1 1  33 TYR HB3  H  -2.173  -0.039  17.095 1.00 . A A .  33 TYR HB3  1 1 
        4  7625 1 1  33 TYR HD1  H  -2.742  -2.151  18.985 1.00 . A A .  33 TYR HD1  1 1 
        4  7626 1 1  33 TYR HD2  H  -2.291   2.033  19.753 1.00 . A A .  33 TYR HD2  1 1 
        4  7627 1 1  33 TYR HE1  H  -4.114  -2.371  21.009 1.00 . A A .  33 TYR HE1  1 1 
        4  7628 1 1  33 TYR HE2  H  -3.660   1.807  21.774 1.00 . A A .  33 TYR HE2  1 1 
        4  7629 1 1  33 TYR HH   H  -4.432  -1.196  23.159 1.00 . A A .  33 TYR HH   1 1 
        4  7630 1 1  33 TYR N    N   0.426  -0.860  19.148 1.00 . A A .  33 TYR N    1 1 
        4  7631 1 1  33 TYR O    O   0.288  -1.073  15.555 1.00 . A A .  33 TYR O    1 1 
        4  7632 1 1  33 TYR OH   O  -4.731  -0.426  22.654 1.00 . A A .  33 TYR OH   1 1 
        4  7633 1 1  34 TRP C    C   3.512  -0.763  15.664 1.00 . A A .  34 TRP C    1 1 
        4  7634 1 1  34 TRP CA   C   2.658   0.497  15.928 1.00 . A A .  34 TRP CA   1 1 
        4  7635 1 1  34 TRP CB   C   3.498   1.687  16.471 1.00 . A A .  34 TRP CB   1 1 
        4  7636 1 1  34 TRP CD1  C   6.058   1.925  16.370 1.00 . A A .  34 TRP CD1  1 1 
        4  7637 1 1  34 TRP CD2  C   5.038   2.383  14.428 1.00 . A A .  34 TRP CD2  1 1 
        4  7638 1 1  34 TRP CE2  C   6.423   2.574  14.276 1.00 . A A .  34 TRP CE2  1 1 
        4  7639 1 1  34 TRP CE3  C   4.202   2.616  13.328 1.00 . A A .  34 TRP CE3  1 1 
        4  7640 1 1  34 TRP CG   C   4.819   1.980  15.790 1.00 . A A .  34 TRP CG   1 1 
        4  7641 1 1  34 TRP CH2  C   6.157   3.187  12.013 1.00 . A A .  34 TRP CH2  1 1 
        4  7642 1 1  34 TRP CZ2  C   6.995   2.967  13.070 1.00 . A A .  34 TRP CZ2  1 1 
        4  7643 1 1  34 TRP CZ3  C   4.772   3.002  12.130 1.00 . A A .  34 TRP CZ3  1 1 
        4  7644 1 1  34 TRP H    H   1.658   0.614  17.792 1.00 . A A .  34 TRP H    1 1 
        4  7645 1 1  34 TRP HA   H   2.182   0.797  14.995 1.00 . A A .  34 TRP HA   1 1 
        4  7646 1 1  34 TRP HB2  H   2.903   2.590  16.402 1.00 . A A .  34 TRP HB2  1 1 
        4  7647 1 1  34 TRP HB3  H   3.702   1.507  17.525 1.00 . A A .  34 TRP HB3  1 1 
        4  7648 1 1  34 TRP HD1  H   6.235   1.654  17.403 1.00 . A A .  34 TRP HD1  1 1 
        4  7649 1 1  34 TRP HE1  H   7.982   2.345  15.667 1.00 . A A .  34 TRP HE1  1 1 
        4  7650 1 1  34 TRP HE3  H   3.133   2.482  13.404 1.00 . A A .  34 TRP HE3  1 1 
        4  7651 1 1  34 TRP HH2  H   6.559   3.492  11.053 1.00 . A A .  34 TRP HH2  1 1 
        4  7652 1 1  34 TRP HZ2  H   8.066   3.110  12.963 1.00 . A A .  34 TRP HZ2  1 1 
        4  7653 1 1  34 TRP HZ3  H   4.143   3.184  11.264 1.00 . A A .  34 TRP HZ3  1 1 
        4  7654 1 1  34 TRP N    N   1.596   0.197  16.910 1.00 . A A .  34 TRP N    1 1 
        4  7655 1 1  34 TRP NE1  N   7.016   2.301  15.478 1.00 . A A .  34 TRP NE1  1 1 
        4  7656 1 1  34 TRP O    O   3.993  -0.978  14.541 1.00 . A A .  34 TRP O    1 1 
        4  7657 1 1  35 ASP C    C   3.295  -4.035  16.342 1.00 . A A .  35 ASP C    1 1 
        4  7658 1 1  35 ASP CA   C   4.334  -2.915  16.594 1.00 . A A .  35 ASP CA   1 1 
        4  7659 1 1  35 ASP CB   C   5.174  -3.159  17.882 1.00 . A A .  35 ASP CB   1 1 
        4  7660 1 1  35 ASP CG   C   6.114  -4.380  17.796 1.00 . A A .  35 ASP CG   1 1 
        4  7661 1 1  35 ASP H    H   3.230  -1.378  17.555 1.00 . A A .  35 ASP H    1 1 
        4  7662 1 1  35 ASP HA   H   5.009  -2.876  15.739 1.00 . A A .  35 ASP HA   1 1 
        4  7663 1 1  35 ASP HB2  H   5.784  -2.282  18.074 1.00 . A A .  35 ASP HB2  1 1 
        4  7664 1 1  35 ASP HB3  H   4.497  -3.291  18.720 1.00 . A A .  35 ASP HB3  1 1 
        4  7665 1 1  35 ASP N    N   3.636  -1.621  16.694 1.00 . A A .  35 ASP N    1 1 
        4  7666 1 1  35 ASP O    O   3.345  -5.119  16.940 1.00 . A A .  35 ASP O    1 1 
        4  7667 1 1  35 ASP OD1  O   6.971  -4.417  16.886 1.00 . A A .  35 ASP OD1  1 1 
        4  7668 1 1  35 ASP OD2  O   5.996  -5.311  18.626 1.00 . A A .  35 ASP OD2  1 1 
        4  7669 1 1  36 HIS C    C   1.969  -5.899  14.245 1.00 . A A .  36 HIS C    1 1 
        4  7670 1 1  36 HIS CA   C   1.321  -4.714  14.989 1.00 . A A .  36 HIS CA   1 1 
        4  7671 1 1  36 HIS CB   C   0.267  -4.002  14.100 1.00 . A A .  36 HIS CB   1 1 
        4  7672 1 1  36 HIS CD2  C   0.951  -3.742  11.584 1.00 . A A .  36 HIS CD2  1 1 
        4  7673 1 1  36 HIS CE1  C   1.726  -1.694  11.662 1.00 . A A .  36 HIS CE1  1 1 
        4  7674 1 1  36 HIS CG   C   0.818  -3.309  12.865 1.00 . A A .  36 HIS CG   1 1 
        4  7675 1 1  36 HIS H    H   2.353  -2.861  15.017 1.00 . A A .  36 HIS H    1 1 
        4  7676 1 1  36 HIS HA   H   0.829  -5.086  15.885 1.00 . A A .  36 HIS HA   1 1 
        4  7677 1 1  36 HIS HB2  H  -0.469  -4.727  13.770 1.00 . A A .  36 HIS HB2  1 1 
        4  7678 1 1  36 HIS HB3  H  -0.241  -3.252  14.697 1.00 . A A .  36 HIS HB3  1 1 
        4  7679 1 1  36 HIS HD1  H   1.342  -1.415  13.656 1.00 . A A .  36 HIS HD1  1 1 
        4  7680 1 1  36 HIS HD2  H   0.655  -4.710  11.201 1.00 . A A .  36 HIS HD2  1 1 
        4  7681 1 1  36 HIS HE1  H   2.163  -0.745  11.371 1.00 . A A .  36 HIS HE1  1 1 
        4  7682 1 1  36 HIS HE2  H   1.639  -2.714   9.886 1.00 . A A .  36 HIS HE2  1 1 
        4  7683 1 1  36 HIS N    N   2.353  -3.752  15.419 1.00 . A A .  36 HIS N    1 1 
        4  7684 1 1  36 HIS ND1  N   1.314  -2.016  12.876 1.00 . A A .  36 HIS ND1  1 1 
        4  7685 1 1  36 HIS NE2  N   1.517  -2.721  10.862 1.00 . A A .  36 HIS NE2  1 1 
        4  7686 1 1  36 HIS O    O   2.719  -5.700  13.283 1.00 . A A .  36 HIS O    1 1 
        4  7687 1 1  37 LYS C    C   1.259  -9.357  13.717 1.00 . A A .  37 LYS C    1 1 
        4  7688 1 1  37 LYS CA   C   2.335  -8.343  14.139 1.00 . A A .  37 LYS CA   1 1 
        4  7689 1 1  37 LYS CB   C   3.340  -8.943  15.179 1.00 . A A .  37 LYS CB   1 1 
        4  7690 1 1  37 LYS CD   C   5.494  -8.538  13.785 1.00 . A A .  37 LYS CD   1 1 
        4  7691 1 1  37 LYS CE   C   6.267  -7.547  14.693 1.00 . A A .  37 LYS CE   1 1 
        4  7692 1 1  37 LYS CG   C   4.614  -9.565  14.557 1.00 . A A .  37 LYS CG   1 1 
        4  7693 1 1  37 LYS H    H   1.053  -7.233  15.431 1.00 . A A .  37 LYS H    1 1 
        4  7694 1 1  37 LYS HA   H   2.883  -8.058  13.244 1.00 . A A .  37 LYS HA   1 1 
        4  7695 1 1  37 LYS HB2  H   3.659  -8.156  15.860 1.00 . A A .  37 LYS HB2  1 1 
        4  7696 1 1  37 LYS HB3  H   2.841  -9.708  15.765 1.00 . A A .  37 LYS HB3  1 1 
        4  7697 1 1  37 LYS HD2  H   6.220  -9.086  13.194 1.00 . A A .  37 LYS HD2  1 1 
        4  7698 1 1  37 LYS HD3  H   4.861  -7.971  13.112 1.00 . A A .  37 LYS HD3  1 1 
        4  7699 1 1  37 LYS HE2  H   6.871  -8.112  15.390 1.00 . A A .  37 LYS HE2  1 1 
        4  7700 1 1  37 LYS HE3  H   6.924  -6.952  14.070 1.00 . A A .  37 LYS HE3  1 1 
        4  7701 1 1  37 LYS HG2  H   5.209 -10.011  15.348 1.00 . A A .  37 LYS HG2  1 1 
        4  7702 1 1  37 LYS HG3  H   4.309 -10.348  13.869 1.00 . A A .  37 LYS HG3  1 1 
        4  7703 1 1  37 LYS HZ1  H   4.765  -6.097  14.837 1.00 . A A .  37 LYS HZ1  1 1 
        4  7704 1 1  37 LYS HZ2  H   5.982  -5.949  16.002 1.00 . A A .  37 LYS HZ2  1 1 
        4  7705 1 1  37 LYS HZ3  H   4.818  -7.162  16.152 1.00 . A A .  37 LYS HZ3  1 1 
        4  7706 1 1  37 LYS N    N   1.701  -7.129  14.701 1.00 . A A .  37 LYS N    1 1 
        4  7707 1 1  37 LYS NZ   N   5.396  -6.626  15.475 1.00 . A A .  37 LYS NZ   1 1 
        4  7708 1 1  37 LYS O    O   1.519 -10.559  13.608 1.00 . A A .  37 LYS O    1 1 
        4  7709 1 1  38 GLU C    C  -1.029  -9.894  11.517 1.00 . A A .  38 GLU C    1 1 
        4  7710 1 1  38 GLU CA   C  -1.103  -9.633  13.028 1.00 . A A .  38 GLU CA   1 1 
        4  7711 1 1  38 GLU CB   C  -2.426  -8.907  13.410 1.00 . A A .  38 GLU CB   1 1 
        4  7712 1 1  38 GLU CD   C  -1.658  -7.934  15.703 1.00 . A A .  38 GLU CD   1 1 
        4  7713 1 1  38 GLU CG   C  -2.699  -8.773  14.931 1.00 . A A .  38 GLU CG   1 1 
        4  7714 1 1  38 GLU H    H  -0.059  -7.868  13.546 1.00 . A A .  38 GLU H    1 1 
        4  7715 1 1  38 GLU HA   H  -1.063 -10.590  13.548 1.00 . A A .  38 GLU HA   1 1 
        4  7716 1 1  38 GLU HB2  H  -2.413  -7.910  12.981 1.00 . A A .  38 GLU HB2  1 1 
        4  7717 1 1  38 GLU HB3  H  -3.257  -9.454  12.972 1.00 . A A .  38 GLU HB3  1 1 
        4  7718 1 1  38 GLU HG2  H  -3.671  -8.307  15.063 1.00 . A A .  38 GLU HG2  1 1 
        4  7719 1 1  38 GLU HG3  H  -2.742  -9.772  15.361 1.00 . A A .  38 GLU HG3  1 1 
        4  7720 1 1  38 GLU N    N   0.057  -8.836  13.452 1.00 . A A .  38 GLU N    1 1 
        4  7721 1 1  38 GLU O    O  -0.369  -9.154  10.777 1.00 . A A .  38 GLU O    1 1 
        4  7722 1 1  38 GLU OE1  O  -1.684  -6.688  15.598 1.00 . A A .  38 GLU OE1  1 1 
        4  7723 1 1  38 GLU OE2  O  -0.800  -8.515  16.400 1.00 . A A .  38 GLU OE2  1 1 
        4  7724 1 1  39 GLU C    C  -3.084 -11.340   9.046 1.00 . A A .  39 GLU C    1 1 
        4  7725 1 1  39 GLU CA   C  -1.682 -11.417   9.683 1.00 . A A .  39 GLU CA   1 1 
        4  7726 1 1  39 GLU CB   C  -1.091 -12.858   9.652 1.00 . A A .  39 GLU CB   1 1 
        4  7727 1 1  39 GLU CD   C  -1.201 -15.262  10.589 1.00 . A A .  39 GLU CD   1 1 
        4  7728 1 1  39 GLU CG   C  -1.887 -13.890  10.463 1.00 . A A .  39 GLU CG   1 1 
        4  7729 1 1  39 GLU H    H  -2.367 -11.364  11.690 1.00 . A A .  39 GLU H    1 1 
        4  7730 1 1  39 GLU HA   H  -1.020 -10.759   9.120 1.00 . A A .  39 GLU HA   1 1 
        4  7731 1 1  39 GLU HB2  H  -1.041 -13.192   8.623 1.00 . A A .  39 GLU HB2  1 1 
        4  7732 1 1  39 GLU HB3  H  -0.079 -12.822  10.048 1.00 . A A .  39 GLU HB3  1 1 
        4  7733 1 1  39 GLU HG2  H  -2.056 -13.484  11.458 1.00 . A A .  39 GLU HG2  1 1 
        4  7734 1 1  39 GLU HG3  H  -2.853 -14.030   9.984 1.00 . A A .  39 GLU HG3  1 1 
        4  7735 1 1  39 GLU N    N  -1.741 -10.931  11.068 1.00 . A A .  39 GLU N    1 1 
        4  7736 1 1  39 GLU O    O  -4.106 -11.401   9.742 1.00 . A A .  39 GLU O    1 1 
        4  7737 1 1  39 GLU OE1  O  -1.049 -15.954   9.566 1.00 . A A .  39 GLU OE1  1 1 
        4  7738 1 1  39 GLU OE2  O  -0.843 -15.674  11.720 1.00 . A A .  39 GLU OE2  1 1 
        4  7739 1 1  40 GLY C    C  -3.960  -9.972   5.807 1.00 . A A .  40 GLY C    1 1 
        4  7740 1 1  40 GLY CA   C  -4.310 -10.884   6.969 1.00 . A A .  40 GLY CA   1 1 
        4  7741 1 1  40 GLY H    H  -2.283 -11.435   7.226 1.00 . A A .  40 GLY H    1 1 
        4  7742 1 1  40 GLY HA2  H  -4.763 -11.791   6.589 1.00 . A A .  40 GLY HA2  1 1 
        4  7743 1 1  40 GLY HA3  H  -5.022 -10.380   7.622 1.00 . A A .  40 GLY HA3  1 1 
        4  7744 1 1  40 GLY N    N  -3.106 -11.232   7.718 1.00 . A A .  40 GLY N    1 1 
        4  7745 1 1  40 GLY O    O  -3.002 -10.255   5.085 1.00 . A A .  40 GLY O    1 1 
        4  7746 1 1  41 LEU C    C  -3.739  -6.634   5.037 1.00 . A A .  41 LEU C    1 1 
        4  7747 1 1  41 LEU CA   C  -4.461  -7.890   4.541 1.00 . A A .  41 LEU CA   1 1 
        4  7748 1 1  41 LEU CB   C  -5.813  -7.483   3.881 1.00 . A A .  41 LEU CB   1 1 
        4  7749 1 1  41 LEU CD1  C  -7.901  -8.195   2.565 1.00 . A A .  41 LEU CD1  1 1 
        4  7750 1 1  41 LEU CD2  C  -5.623  -8.880   1.747 1.00 . A A .  41 LEU CD2  1 1 
        4  7751 1 1  41 LEU CG   C  -6.477  -8.573   2.989 1.00 . A A .  41 LEU CG   1 1 
        4  7752 1 1  41 LEU H    H  -5.392  -8.640   6.303 1.00 . A A .  41 LEU H    1 1 
        4  7753 1 1  41 LEU HA   H  -3.839  -8.371   3.787 1.00 . A A .  41 LEU HA   1 1 
        4  7754 1 1  41 LEU HB2  H  -6.509  -7.217   4.675 1.00 . A A .  41 LEU HB2  1 1 
        4  7755 1 1  41 LEU HB3  H  -5.656  -6.597   3.267 1.00 . A A .  41 LEU HB3  1 1 
        4  7756 1 1  41 LEU HD11 H  -8.345  -9.034   2.029 1.00 . A A .  41 LEU HD11 1 1 
        4  7757 1 1  41 LEU HD12 H  -7.881  -7.328   1.914 1.00 . A A .  41 LEU HD12 1 1 
        4  7758 1 1  41 LEU HD13 H  -8.498  -7.981   3.438 1.00 . A A .  41 LEU HD13 1 1 
        4  7759 1 1  41 LEU HD21 H  -6.115  -9.631   1.142 1.00 . A A .  41 LEU HD21 1 1 
        4  7760 1 1  41 LEU HD22 H  -4.657  -9.254   2.057 1.00 . A A .  41 LEU HD22 1 1 
        4  7761 1 1  41 LEU HD23 H  -5.485  -7.980   1.159 1.00 . A A .  41 LEU HD23 1 1 
        4  7762 1 1  41 LEU HG   H  -6.549  -9.490   3.562 1.00 . A A .  41 LEU HG   1 1 
        4  7763 1 1  41 LEU N    N  -4.690  -8.854   5.644 1.00 . A A .  41 LEU N    1 1 
        4  7764 1 1  41 LEU O    O  -3.639  -6.388   6.239 1.00 . A A .  41 LEU O    1 1 
        4  7765 1 1  42 TYR C    C  -3.569  -3.629   3.234 1.00 . A A .  42 TYR C    1 1 
        4  7766 1 1  42 TYR CA   C  -2.816  -4.465   4.278 1.00 . A A .  42 TYR CA   1 1 
        4  7767 1 1  42 TYR CB   C  -1.270  -4.260   4.203 1.00 . A A .  42 TYR CB   1 1 
        4  7768 1 1  42 TYR CD1  C  -0.182  -5.817   2.496 1.00 . A A .  42 TYR CD1  1 1 
        4  7769 1 1  42 TYR CD2  C  -0.410  -3.517   1.906 1.00 . A A .  42 TYR CD2  1 1 
        4  7770 1 1  42 TYR CE1  C   0.415  -6.061   1.281 1.00 . A A .  42 TYR CE1  1 1 
        4  7771 1 1  42 TYR CE2  C   0.182  -3.760   0.687 1.00 . A A .  42 TYR CE2  1 1 
        4  7772 1 1  42 TYR CG   C  -0.609  -4.541   2.841 1.00 . A A .  42 TYR CG   1 1 
        4  7773 1 1  42 TYR CZ   C   0.591  -5.034   0.381 1.00 . A A .  42 TYR CZ   1 1 
        4  7774 1 1  42 TYR H    H  -3.156  -6.229   3.165 1.00 . A A .  42 TYR H    1 1 
        4  7775 1 1  42 TYR HA   H  -3.160  -4.157   5.271 1.00 . A A .  42 TYR HA   1 1 
        4  7776 1 1  42 TYR HB2  H  -1.041  -3.235   4.473 1.00 . A A .  42 TYR HB2  1 1 
        4  7777 1 1  42 TYR HB3  H  -0.804  -4.909   4.936 1.00 . A A .  42 TYR HB3  1 1 
        4  7778 1 1  42 TYR HD1  H  -0.323  -6.629   3.197 1.00 . A A .  42 TYR HD1  1 1 
        4  7779 1 1  42 TYR HD2  H  -0.737  -2.514   2.149 1.00 . A A .  42 TYR HD2  1 1 
        4  7780 1 1  42 TYR HE1  H   0.740  -7.065   1.032 1.00 . A A .  42 TYR HE1  1 1 
        4  7781 1 1  42 TYR HE2  H   0.324  -2.953  -0.021 1.00 . A A .  42 TYR HE2  1 1 
        4  7782 1 1  42 TYR HH   H   1.924  -4.687  -0.956 1.00 . A A .  42 TYR HH   1 1 
        4  7783 1 1  42 TYR N    N  -3.229  -5.856   4.071 1.00 . A A .  42 TYR N    1 1 
        4  7784 1 1  42 TYR O    O  -3.534  -3.930   2.026 1.00 . A A .  42 TYR O    1 1 
        4  7785 1 1  42 TYR OH   O   1.191  -5.291  -0.828 1.00 . A A .  42 TYR OH   1 1 
        4  7786 1 1  43 VAL C    C  -4.863  -0.336   3.082 1.00 . A A .  43 VAL C    1 1 
        4  7787 1 1  43 VAL CA   C  -5.213  -1.810   2.883 1.00 . A A .  43 VAL CA   1 1 
        4  7788 1 1  43 VAL CB   C  -6.733  -2.085   3.244 1.00 . A A .  43 VAL CB   1 1 
        4  7789 1 1  43 VAL CG1  C  -7.056  -3.604   3.178 1.00 . A A .  43 VAL CG1  1 1 
        4  7790 1 1  43 VAL CG2  C  -7.125  -1.493   4.626 1.00 . A A .  43 VAL CG2  1 1 
        4  7791 1 1  43 VAL H    H  -4.259  -2.426   4.668 1.00 . A A .  43 VAL H    1 1 
        4  7792 1 1  43 VAL HA   H  -5.058  -2.058   1.835 1.00 . A A .  43 VAL HA   1 1 
        4  7793 1 1  43 VAL HB   H  -7.345  -1.594   2.487 1.00 . A A .  43 VAL HB   1 1 
        4  7794 1 1  43 VAL HG11 H  -6.743  -4.006   2.219 1.00 . A A .  43 VAL HG11 1 1 
        4  7795 1 1  43 VAL HG12 H  -8.118  -3.759   3.298 1.00 . A A .  43 VAL HG12 1 1 
        4  7796 1 1  43 VAL HG13 H  -6.526  -4.125   3.967 1.00 . A A .  43 VAL HG13 1 1 
        4  7797 1 1  43 VAL HG21 H  -6.965  -0.422   4.621 1.00 . A A .  43 VAL HG21 1 1 
        4  7798 1 1  43 VAL HG22 H  -6.521  -1.943   5.401 1.00 . A A .  43 VAL HG22 1 1 
        4  7799 1 1  43 VAL HG23 H  -8.173  -1.691   4.828 1.00 . A A .  43 VAL HG23 1 1 
        4  7800 1 1  43 VAL N    N  -4.315  -2.632   3.712 1.00 . A A .  43 VAL N    1 1 
        4  7801 1 1  43 VAL O    O  -4.316   0.020   4.129 1.00 . A A .  43 VAL O    1 1 
        4  7802 1 1  44 ASP C    C  -6.086   2.551   3.059 1.00 . A A .  44 ASP C    1 1 
        4  7803 1 1  44 ASP CA   C  -4.924   1.967   2.244 1.00 . A A .  44 ASP CA   1 1 
        4  7804 1 1  44 ASP CB   C  -4.764   2.694   0.884 1.00 . A A .  44 ASP CB   1 1 
        4  7805 1 1  44 ASP CG   C  -3.996   4.039   0.978 1.00 . A A .  44 ASP CG   1 1 
        4  7806 1 1  44 ASP H    H  -5.587   0.191   1.279 1.00 . A A .  44 ASP H    1 1 
        4  7807 1 1  44 ASP HA   H  -4.003   2.082   2.816 1.00 . A A .  44 ASP HA   1 1 
        4  7808 1 1  44 ASP HB2  H  -4.229   2.039   0.204 1.00 . A A .  44 ASP HB2  1 1 
        4  7809 1 1  44 ASP HB3  H  -5.743   2.894   0.464 1.00 . A A .  44 ASP HB3  1 1 
        4  7810 1 1  44 ASP N    N  -5.170   0.525   2.095 1.00 . A A .  44 ASP N    1 1 
        4  7811 1 1  44 ASP O    O  -7.242   2.519   2.616 1.00 . A A .  44 ASP O    1 1 
        4  7812 1 1  44 ASP OD1  O  -4.151   4.778   1.987 1.00 . A A .  44 ASP OD1  1 1 
        4  7813 1 1  44 ASP OD2  O  -3.268   4.373   0.019 1.00 . A A .  44 ASP OD2  1 1 
        4  7814 1 1  45 ILE C    C  -7.746   4.511   4.746 1.00 . A A .  45 ILE C    1 1 
        4  7815 1 1  45 ILE CA   C  -6.713   3.493   5.296 1.00 . A A .  45 ILE CA   1 1 
        4  7816 1 1  45 ILE CB   C  -5.977   4.133   6.544 1.00 . A A .  45 ILE CB   1 1 
        4  7817 1 1  45 ILE CD1  C  -3.859   3.921   8.038 1.00 . A A .  45 ILE CD1  1 1 
        4  7818 1 1  45 ILE CG1  C  -4.695   3.338   6.914 1.00 . A A .  45 ILE CG1  1 1 
        4  7819 1 1  45 ILE CG2  C  -6.921   4.253   7.778 1.00 . A A .  45 ILE CG2  1 1 
        4  7820 1 1  45 ILE H    H  -4.785   3.024   4.481 1.00 . A A .  45 ILE H    1 1 
        4  7821 1 1  45 ILE HA   H  -7.246   2.610   5.638 1.00 . A A .  45 ILE HA   1 1 
        4  7822 1 1  45 ILE HB   H  -5.678   5.144   6.265 1.00 . A A .  45 ILE HB   1 1 
        4  7823 1 1  45 ILE HD11 H  -3.541   4.923   7.770 1.00 . A A .  45 ILE HD11 1 1 
        4  7824 1 1  45 ILE HD12 H  -2.991   3.300   8.190 1.00 . A A .  45 ILE HD12 1 1 
        4  7825 1 1  45 ILE HD13 H  -4.439   3.958   8.947 1.00 . A A .  45 ILE HD13 1 1 
        4  7826 1 1  45 ILE HG12 H  -4.972   2.344   7.213 1.00 . A A .  45 ILE HG12 1 1 
        4  7827 1 1  45 ILE HG13 H  -4.060   3.272   6.040 1.00 . A A .  45 ILE HG13 1 1 
        4  7828 1 1  45 ILE HG21 H  -7.253   3.267   8.086 1.00 . A A .  45 ILE HG21 1 1 
        4  7829 1 1  45 ILE HG22 H  -7.785   4.852   7.522 1.00 . A A .  45 ILE HG22 1 1 
        4  7830 1 1  45 ILE HG23 H  -6.397   4.732   8.598 1.00 . A A .  45 ILE HG23 1 1 
        4  7831 1 1  45 ILE N    N  -5.744   3.037   4.262 1.00 . A A .  45 ILE N    1 1 
        4  7832 1 1  45 ILE O    O  -8.875   4.583   5.242 1.00 . A A .  45 ILE O    1 1 
        4  7833 1 1  46 VAL C    C  -9.493   5.841   2.492 1.00 . A A .  46 VAL C    1 1 
        4  7834 1 1  46 VAL CA   C  -8.172   6.352   3.102 1.00 . A A .  46 VAL CA   1 1 
        4  7835 1 1  46 VAL CB   C  -7.382   7.131   1.994 1.00 . A A .  46 VAL CB   1 1 
        4  7836 1 1  46 VAL CG1  C  -6.220   7.943   2.606 1.00 . A A .  46 VAL CG1  1 1 
        4  7837 1 1  46 VAL CG2  C  -6.885   6.154   0.895 1.00 . A A .  46 VAL CG2  1 1 
        4  7838 1 1  46 VAL H    H  -6.420   5.150   3.371 1.00 . A A .  46 VAL H    1 1 
        4  7839 1 1  46 VAL HA   H  -8.417   7.059   3.890 1.00 . A A .  46 VAL HA   1 1 
        4  7840 1 1  46 VAL HB   H  -8.059   7.843   1.526 1.00 . A A .  46 VAL HB   1 1 
        4  7841 1 1  46 VAL HG11 H  -5.541   7.269   3.109 1.00 . A A .  46 VAL HG11 1 1 
        4  7842 1 1  46 VAL HG12 H  -6.595   8.666   3.329 1.00 . A A .  46 VAL HG12 1 1 
        4  7843 1 1  46 VAL HG13 H  -5.681   8.469   1.831 1.00 . A A .  46 VAL HG13 1 1 
        4  7844 1 1  46 VAL HG21 H  -7.738   5.704   0.404 1.00 . A A .  46 VAL HG21 1 1 
        4  7845 1 1  46 VAL HG22 H  -6.274   5.366   1.335 1.00 . A A .  46 VAL HG22 1 1 
        4  7846 1 1  46 VAL HG23 H  -6.296   6.687   0.158 1.00 . A A .  46 VAL HG23 1 1 
        4  7847 1 1  46 VAL N    N  -7.335   5.288   3.718 1.00 . A A .  46 VAL N    1 1 
        4  7848 1 1  46 VAL O    O -10.448   6.612   2.338 1.00 . A A .  46 VAL O    1 1 
        4  7849 1 1  47 SER C    C -10.979   2.541   1.870 1.00 . A A .  47 SER C    1 1 
        4  7850 1 1  47 SER CA   C -10.684   3.976   1.411 1.00 . A A .  47 SER CA   1 1 
        4  7851 1 1  47 SER CB   C -10.385   4.015  -0.110 1.00 . A A .  47 SER CB   1 1 
        4  7852 1 1  47 SER H    H  -8.779   3.986   2.365 1.00 . A A .  47 SER H    1 1 
        4  7853 1 1  47 SER HA   H -11.566   4.584   1.609 1.00 . A A .  47 SER HA   1 1 
        4  7854 1 1  47 SER HB2  H -10.196   5.038  -0.411 1.00 . A A .  47 SER HB2  1 1 
        4  7855 1 1  47 SER HB3  H  -9.506   3.416  -0.319 1.00 . A A .  47 SER HB3  1 1 
        4  7856 1 1  47 SER HG   H -12.190   3.249  -0.319 1.00 . A A .  47 SER HG   1 1 
        4  7857 1 1  47 SER N    N  -9.538   4.559   2.135 1.00 . A A .  47 SER N    1 1 
        4  7858 1 1  47 SER O    O -12.052   2.010   1.560 1.00 . A A .  47 SER O    1 1 
        4  7859 1 1  47 SER OG   O -11.463   3.514  -0.892 1.00 . A A .  47 SER OG   1 1 
        4  7860 1 1  48 GLY C    C -10.047  -0.428   1.794 1.00 . A A .  48 GLY C    1 1 
        4  7861 1 1  48 GLY CA   C -10.153   0.508   2.990 1.00 . A A .  48 GLY CA   1 1 
        4  7862 1 1  48 GLY H    H  -9.255   2.425   2.913 1.00 . A A .  48 GLY H    1 1 
        4  7863 1 1  48 GLY HA2  H  -9.361   0.275   3.685 1.00 . A A .  48 GLY HA2  1 1 
        4  7864 1 1  48 GLY HA3  H -11.107   0.350   3.485 1.00 . A A .  48 GLY HA3  1 1 
        4  7865 1 1  48 GLY N    N -10.037   1.920   2.607 1.00 . A A .  48 GLY N    1 1 
        4  7866 1 1  48 GLY O    O -10.705  -1.473   1.746 1.00 . A A .  48 GLY O    1 1 
        4  7867 1 1  49 LYS C    C  -7.837  -1.764  -0.286 1.00 . A A .  49 LYS C    1 1 
        4  7868 1 1  49 LYS CA   C  -9.007  -0.771  -0.436 1.00 . A A .  49 LYS CA   1 1 
        4  7869 1 1  49 LYS CB   C  -8.754   0.207  -1.623 1.00 . A A .  49 LYS CB   1 1 
        4  7870 1 1  49 LYS CD   C -11.083  -0.067  -2.668 1.00 . A A .  49 LYS CD   1 1 
        4  7871 1 1  49 LYS CE   C -12.305   0.631  -3.284 1.00 . A A .  49 LYS CE   1 1 
        4  7872 1 1  49 LYS CG   C -10.014   0.927  -2.153 1.00 . A A .  49 LYS CG   1 1 
        4  7873 1 1  49 LYS H    H  -8.661   0.770   0.988 1.00 . A A .  49 LYS H    1 1 
        4  7874 1 1  49 LYS HA   H  -9.918  -1.333  -0.636 1.00 . A A .  49 LYS HA   1 1 
        4  7875 1 1  49 LYS HB2  H  -8.043   0.963  -1.308 1.00 . A A .  49 LYS HB2  1 1 
        4  7876 1 1  49 LYS HB3  H  -8.315  -0.347  -2.450 1.00 . A A .  49 LYS HB3  1 1 
        4  7877 1 1  49 LYS HD2  H -10.632  -0.700  -3.423 1.00 . A A .  49 LYS HD2  1 1 
        4  7878 1 1  49 LYS HD3  H -11.412  -0.685  -1.835 1.00 . A A .  49 LYS HD3  1 1 
        4  7879 1 1  49 LYS HE2  H -13.014  -0.122  -3.600 1.00 . A A .  49 LYS HE2  1 1 
        4  7880 1 1  49 LYS HE3  H -12.770   1.260  -2.535 1.00 . A A .  49 LYS HE3  1 1 
        4  7881 1 1  49 LYS HG2  H -10.443   1.527  -1.356 1.00 . A A .  49 LYS HG2  1 1 
        4  7882 1 1  49 LYS HG3  H  -9.719   1.581  -2.971 1.00 . A A .  49 LYS HG3  1 1 
        4  7883 1 1  49 LYS HZ1  H -11.331   2.256  -4.166 1.00 . A A .  49 LYS HZ1  1 1 
        4  7884 1 1  49 LYS HZ2  H -12.809   1.867  -4.894 1.00 . A A .  49 LYS HZ2  1 1 
        4  7885 1 1  49 LYS HZ3  H -11.444   0.902  -5.169 1.00 . A A .  49 LYS HZ3  1 1 
        4  7886 1 1  49 LYS N    N  -9.203  -0.031   0.822 1.00 . A A .  49 LYS N    1 1 
        4  7887 1 1  49 LYS NZ   N -11.947   1.473  -4.459 1.00 . A A .  49 LYS NZ   1 1 
        4  7888 1 1  49 LYS O    O  -6.706  -1.333  -0.022 1.00 . A A .  49 LYS O    1 1 
        4  7889 1 1  50 PRO C    C  -5.969  -3.898  -1.464 1.00 . A A .  50 PRO C    1 1 
        4  7890 1 1  50 PRO CA   C  -7.041  -4.148  -0.383 1.00 . A A .  50 PRO CA   1 1 
        4  7891 1 1  50 PRO CB   C  -7.817  -5.477  -0.619 1.00 . A A .  50 PRO CB   1 1 
        4  7892 1 1  50 PRO CD   C  -9.443  -3.730  -0.563 1.00 . A A .  50 PRO CD   1 1 
        4  7893 1 1  50 PRO CG   C  -9.119  -5.044  -1.227 1.00 . A A .  50 PRO CG   1 1 
        4  7894 1 1  50 PRO HA   H  -6.565  -4.173   0.596 1.00 . A A .  50 PRO HA   1 1 
        4  7895 1 1  50 PRO HB2  H  -7.264  -6.131  -1.284 1.00 . A A .  50 PRO HB2  1 1 
        4  7896 1 1  50 PRO HB3  H  -7.974  -5.989   0.330 1.00 . A A .  50 PRO HB3  1 1 
        4  7897 1 1  50 PRO HD2  H -10.088  -3.127  -1.198 1.00 . A A .  50 PRO HD2  1 1 
        4  7898 1 1  50 PRO HD3  H  -9.908  -3.882   0.408 1.00 . A A .  50 PRO HD3  1 1 
        4  7899 1 1  50 PRO HG2  H  -9.003  -4.913  -2.299 1.00 . A A .  50 PRO HG2  1 1 
        4  7900 1 1  50 PRO HG3  H  -9.894  -5.773  -1.026 1.00 . A A .  50 PRO HG3  1 1 
        4  7901 1 1  50 PRO N    N  -8.099  -3.110  -0.411 1.00 . A A .  50 PRO N    1 1 
        4  7902 1 1  50 PRO O    O  -6.282  -3.786  -2.658 1.00 . A A .  50 PRO O    1 1 
        4  7903 1 1  51 LEU C    C  -2.782  -4.832  -2.095 1.00 . A A .  51 LEU C    1 1 
        4  7904 1 1  51 LEU CA   C  -3.561  -3.529  -1.898 1.00 . A A .  51 LEU CA   1 1 
        4  7905 1 1  51 LEU CB   C  -2.679  -2.400  -1.305 1.00 . A A .  51 LEU CB   1 1 
        4  7906 1 1  51 LEU CD1  C  -2.481   0.013  -0.471 1.00 . A A .  51 LEU CD1  1 1 
        4  7907 1 1  51 LEU CD2  C  -4.123  -0.551  -2.360 1.00 . A A .  51 LEU CD2  1 1 
        4  7908 1 1  51 LEU CG   C  -3.425  -1.048  -1.064 1.00 . A A .  51 LEU CG   1 1 
        4  7909 1 1  51 LEU H    H  -4.551  -3.860  -0.051 1.00 . A A .  51 LEU H    1 1 
        4  7910 1 1  51 LEU HA   H  -3.936  -3.200  -2.869 1.00 . A A .  51 LEU HA   1 1 
        4  7911 1 1  51 LEU HB2  H  -2.276  -2.744  -0.354 1.00 . A A .  51 LEU HB2  1 1 
        4  7912 1 1  51 LEU HB3  H  -1.848  -2.216  -1.981 1.00 . A A .  51 LEU HB3  1 1 
        4  7913 1 1  51 LEU HD11 H  -1.672   0.217  -1.162 1.00 . A A .  51 LEU HD11 1 1 
        4  7914 1 1  51 LEU HD12 H  -2.074  -0.347   0.462 1.00 . A A .  51 LEU HD12 1 1 
        4  7915 1 1  51 LEU HD13 H  -3.033   0.930  -0.283 1.00 . A A .  51 LEU HD13 1 1 
        4  7916 1 1  51 LEU HD21 H  -3.385  -0.378  -3.134 1.00 . A A .  51 LEU HD21 1 1 
        4  7917 1 1  51 LEU HD22 H  -4.655   0.369  -2.159 1.00 . A A .  51 LEU HD22 1 1 
        4  7918 1 1  51 LEU HD23 H  -4.830  -1.298  -2.705 1.00 . A A .  51 LEU HD23 1 1 
        4  7919 1 1  51 LEU HG   H  -4.204  -1.216  -0.326 1.00 . A A .  51 LEU HG   1 1 
        4  7920 1 1  51 LEU N    N  -4.712  -3.773  -1.016 1.00 . A A .  51 LEU N    1 1 
        4  7921 1 1  51 LEU O    O  -2.187  -5.031  -3.147 1.00 . A A .  51 LEU O    1 1 
        4  7922 1 1  52 PHE C    C  -2.483  -7.686   0.330 1.00 . A A .  52 PHE C    1 1 
        4  7923 1 1  52 PHE CA   C  -2.398  -7.106  -1.093 1.00 . A A .  52 PHE CA   1 1 
        4  7924 1 1  52 PHE CB   C  -1.009  -7.414  -1.772 1.00 . A A .  52 PHE CB   1 1 
        4  7925 1 1  52 PHE CD1  C  -1.705  -9.163  -3.478 1.00 . A A .  52 PHE CD1  1 1 
        4  7926 1 1  52 PHE CD2  C  -0.070  -9.799  -1.870 1.00 . A A .  52 PHE CD2  1 1 
        4  7927 1 1  52 PHE CE1  C  -1.659 -10.423  -4.028 1.00 . A A .  52 PHE CE1  1 1 
        4  7928 1 1  52 PHE CE2  C  -0.024 -11.065  -2.432 1.00 . A A .  52 PHE CE2  1 1 
        4  7929 1 1  52 PHE CG   C  -0.915  -8.819  -2.388 1.00 . A A .  52 PHE CG   1 1 
        4  7930 1 1  52 PHE CZ   C  -0.822 -11.377  -3.504 1.00 . A A .  52 PHE CZ   1 1 
        4  7931 1 1  52 PHE H    H  -3.035  -5.288  -0.164 1.00 . A A .  52 PHE H    1 1 
        4  7932 1 1  52 PHE HA   H  -3.185  -7.579  -1.676 1.00 . A A .  52 PHE HA   1 1 
        4  7933 1 1  52 PHE HB2  H  -0.838  -6.697  -2.564 1.00 . A A .  52 PHE HB2  1 1 
        4  7934 1 1  52 PHE HB3  H  -0.217  -7.308  -1.038 1.00 . A A .  52 PHE HB3  1 1 
        4  7935 1 1  52 PHE HD1  H  -2.366  -8.423  -3.904 1.00 . A A .  52 PHE HD1  1 1 
        4  7936 1 1  52 PHE HD2  H   0.565  -9.563  -1.023 1.00 . A A .  52 PHE HD2  1 1 
        4  7937 1 1  52 PHE HE1  H  -2.285 -10.664  -4.876 1.00 . A A .  52 PHE HE1  1 1 
        4  7938 1 1  52 PHE HE2  H   0.639 -11.813  -2.018 1.00 . A A .  52 PHE HE2  1 1 
        4  7939 1 1  52 PHE HZ   H  -0.787 -12.370  -3.936 1.00 . A A .  52 PHE HZ   1 1 
        4  7940 1 1  52 PHE N    N  -2.752  -5.662  -1.032 1.00 . A A .  52 PHE N    1 1 
        4  7941 1 1  52 PHE O    O  -2.859  -6.975   1.276 1.00 . A A .  52 PHE O    1 1 
        4  7942 1 1  53 THR C    C  -0.612  -9.523   2.309 1.00 . A A .  53 THR C    1 1 
        4  7943 1 1  53 THR CA   C  -2.054  -9.643   1.765 1.00 . A A .  53 THR CA   1 1 
        4  7944 1 1  53 THR CB   C  -2.458 -11.151   1.675 1.00 . A A .  53 THR CB   1 1 
        4  7945 1 1  53 THR CG2  C  -1.639 -11.922   0.634 1.00 . A A .  53 THR CG2  1 1 
        4  7946 1 1  53 THR H    H  -2.000  -9.506  -0.332 1.00 . A A .  53 THR H    1 1 
        4  7947 1 1  53 THR HA   H  -2.736  -9.159   2.467 1.00 . A A .  53 THR HA   1 1 
        4  7948 1 1  53 THR HB   H  -3.505 -11.206   1.394 1.00 . A A .  53 THR HB   1 1 
        4  7949 1 1  53 THR HG1  H  -3.082 -11.608   3.490 1.00 . A A .  53 THR HG1  1 1 
        4  7950 1 1  53 THR HG21 H  -1.783 -11.479  -0.345 1.00 . A A .  53 THR HG21 1 1 
        4  7951 1 1  53 THR HG22 H  -1.959 -12.957   0.608 1.00 . A A .  53 THR HG22 1 1 
        4  7952 1 1  53 THR HG23 H  -0.587 -11.881   0.892 1.00 . A A .  53 THR HG23 1 1 
        4  7953 1 1  53 THR N    N  -2.189  -8.982   0.468 1.00 . A A .  53 THR N    1 1 
        4  7954 1 1  53 THR O    O   0.366  -9.459   1.550 1.00 . A A .  53 THR O    1 1 
        4  7955 1 1  53 THR OG1  O  -2.307 -11.788   2.950 1.00 . A A .  53 THR OG1  1 1 
        4  7956 1 1  54 SER C    C   1.473 -10.904   4.215 1.00 . A A .  54 SER C    1 1 
        4  7957 1 1  54 SER CA   C   0.737  -9.551   4.420 1.00 . A A .  54 SER CA   1 1 
        4  7958 1 1  54 SER CB   C   0.437  -9.305   5.925 1.00 . A A .  54 SER CB   1 1 
        4  7959 1 1  54 SER H    H  -1.346  -9.338   4.140 1.00 . A A .  54 SER H    1 1 
        4  7960 1 1  54 SER HA   H   1.382  -8.755   4.062 1.00 . A A .  54 SER HA   1 1 
        4  7961 1 1  54 SER HB2  H  -0.158  -8.406   6.036 1.00 . A A .  54 SER HB2  1 1 
        4  7962 1 1  54 SER HB3  H  -0.116 -10.145   6.326 1.00 . A A .  54 SER HB3  1 1 
        4  7963 1 1  54 SER HG   H   2.106  -9.976   6.720 1.00 . A A .  54 SER HG   1 1 
        4  7964 1 1  54 SER N    N  -0.522  -9.483   3.647 1.00 . A A .  54 SER N    1 1 
        4  7965 1 1  54 SER O    O   2.620 -11.055   4.619 1.00 . A A .  54 SER O    1 1 
        4  7966 1 1  54 SER OG   O   1.630  -9.143   6.684 1.00 . A A .  54 SER OG   1 1 
        4  7967 1 1  55 LYS C    C   2.457 -13.162   2.219 1.00 . A A .  55 LYS C    1 1 
        4  7968 1 1  55 LYS CA   C   1.354 -13.229   3.317 1.00 . A A .  55 LYS CA   1 1 
        4  7969 1 1  55 LYS CB   C   0.227 -14.227   2.905 1.00 . A A .  55 LYS CB   1 1 
        4  7970 1 1  55 LYS CD   C  -1.104 -13.869   5.122 1.00 . A A .  55 LYS CD   1 1 
        4  7971 1 1  55 LYS CE   C  -1.947 -14.550   6.213 1.00 . A A .  55 LYS CE   1 1 
        4  7972 1 1  55 LYS CG   C  -0.556 -14.874   4.078 1.00 . A A .  55 LYS CG   1 1 
        4  7973 1 1  55 LYS H    H  -0.160 -11.725   3.405 1.00 . A A .  55 LYS H    1 1 
        4  7974 1 1  55 LYS HA   H   1.816 -13.596   4.229 1.00 . A A .  55 LYS HA   1 1 
        4  7975 1 1  55 LYS HB2  H  -0.486 -13.709   2.271 1.00 . A A .  55 LYS HB2  1 1 
        4  7976 1 1  55 LYS HB3  H   0.665 -15.035   2.320 1.00 . A A .  55 LYS HB3  1 1 
        4  7977 1 1  55 LYS HD2  H  -0.267 -13.363   5.591 1.00 . A A .  55 LYS HD2  1 1 
        4  7978 1 1  55 LYS HD3  H  -1.719 -13.133   4.611 1.00 . A A .  55 LYS HD3  1 1 
        4  7979 1 1  55 LYS HE2  H  -2.164 -13.829   6.993 1.00 . A A .  55 LYS HE2  1 1 
        4  7980 1 1  55 LYS HE3  H  -2.879 -14.885   5.779 1.00 . A A .  55 LYS HE3  1 1 
        4  7981 1 1  55 LYS HG2  H  -1.392 -15.430   3.666 1.00 . A A .  55 LYS HG2  1 1 
        4  7982 1 1  55 LYS HG3  H   0.106 -15.572   4.582 1.00 . A A .  55 LYS HG3  1 1 
        4  7983 1 1  55 LYS HZ1  H  -0.355 -15.439   7.250 1.00 . A A .  55 LYS HZ1  1 1 
        4  7984 1 1  55 LYS HZ2  H  -1.083 -16.457   6.111 1.00 . A A .  55 LYS HZ2  1 1 
        4  7985 1 1  55 LYS HZ3  H  -1.859 -16.130   7.581 1.00 . A A .  55 LYS HZ3  1 1 
        4  7986 1 1  55 LYS N    N   0.778 -11.895   3.630 1.00 . A A .  55 LYS N    1 1 
        4  7987 1 1  55 LYS NZ   N  -1.262 -15.724   6.828 1.00 . A A .  55 LYS NZ   1 1 
        4  7988 1 1  55 LYS O    O   3.187 -14.143   2.024 1.00 . A A .  55 LYS O    1 1 
        4  7989 1 1  56 ASP C    C   4.687 -10.779   1.105 1.00 . A A .  56 ASP C    1 1 
        4  7990 1 1  56 ASP CA   C   3.643 -11.761   0.515 1.00 . A A .  56 ASP CA   1 1 
        4  7991 1 1  56 ASP CB   C   3.036 -11.220  -0.809 1.00 . A A .  56 ASP CB   1 1 
        4  7992 1 1  56 ASP CG   C   4.035 -11.177  -1.989 1.00 . A A .  56 ASP CG   1 1 
        4  7993 1 1  56 ASP H    H   1.895 -11.304   1.652 1.00 . A A .  56 ASP H    1 1 
        4  7994 1 1  56 ASP HA   H   4.144 -12.703   0.307 1.00 . A A .  56 ASP HA   1 1 
        4  7995 1 1  56 ASP HB2  H   2.206 -11.862  -1.096 1.00 . A A .  56 ASP HB2  1 1 
        4  7996 1 1  56 ASP HB3  H   2.641 -10.220  -0.643 1.00 . A A .  56 ASP HB3  1 1 
        4  7997 1 1  56 ASP N    N   2.561 -12.012   1.507 1.00 . A A .  56 ASP N    1 1 
        4  7998 1 1  56 ASP O    O   5.535 -10.232   0.389 1.00 . A A .  56 ASP O    1 1 
        4  7999 1 1  56 ASP OD1  O   4.329 -12.248  -2.563 1.00 . A A .  56 ASP OD1  1 1 
        4  8000 1 1  56 ASP OD2  O   4.534 -10.084  -2.340 1.00 . A A .  56 ASP OD2  1 1 
        4  8001 1 1  57 LYS C    C   6.968 -10.409   3.194 1.00 . A A .  57 LYS C    1 1 
        4  8002 1 1  57 LYS CA   C   5.608  -9.706   3.110 1.00 . A A .  57 LYS CA   1 1 
        4  8003 1 1  57 LYS CB   C   5.133  -9.283   4.531 1.00 . A A .  57 LYS CB   1 1 
        4  8004 1 1  57 LYS CD   C   6.276  -6.979   4.493 1.00 . A A .  57 LYS CD   1 1 
        4  8005 1 1  57 LYS CE   C   7.370  -6.095   5.098 1.00 . A A .  57 LYS CE   1 1 
        4  8006 1 1  57 LYS CG   C   6.097  -8.315   5.255 1.00 . A A .  57 LYS CG   1 1 
        4  8007 1 1  57 LYS H    H   3.961 -11.038   2.963 1.00 . A A .  57 LYS H    1 1 
        4  8008 1 1  57 LYS HA   H   5.712  -8.806   2.503 1.00 . A A .  57 LYS HA   1 1 
        4  8009 1 1  57 LYS HB2  H   4.165  -8.798   4.443 1.00 . A A .  57 LYS HB2  1 1 
        4  8010 1 1  57 LYS HB3  H   5.014 -10.173   5.145 1.00 . A A .  57 LYS HB3  1 1 
        4  8011 1 1  57 LYS HD2  H   6.541  -7.193   3.461 1.00 . A A .  57 LYS HD2  1 1 
        4  8012 1 1  57 LYS HD3  H   5.335  -6.437   4.510 1.00 . A A .  57 LYS HD3  1 1 
        4  8013 1 1  57 LYS HE2  H   8.317  -6.612   5.023 1.00 . A A .  57 LYS HE2  1 1 
        4  8014 1 1  57 LYS HE3  H   7.428  -5.170   4.535 1.00 . A A .  57 LYS HE3  1 1 
        4  8015 1 1  57 LYS HG2  H   5.709  -8.106   6.248 1.00 . A A .  57 LYS HG2  1 1 
        4  8016 1 1  57 LYS HG3  H   7.064  -8.802   5.350 1.00 . A A .  57 LYS HG3  1 1 
        4  8017 1 1  57 LYS HZ1  H   7.890  -5.161   6.888 1.00 . A A .  57 LYS HZ1  1 1 
        4  8018 1 1  57 LYS HZ2  H   7.099  -6.640   7.094 1.00 . A A .  57 LYS HZ2  1 1 
        4  8019 1 1  57 LYS HZ3  H   6.222  -5.267   6.640 1.00 . A A .  57 LYS HZ3  1 1 
        4  8020 1 1  57 LYS N    N   4.647 -10.579   2.435 1.00 . A A .  57 LYS N    1 1 
        4  8021 1 1  57 LYS NZ   N   7.124  -5.768   6.527 1.00 . A A .  57 LYS NZ   1 1 
        4  8022 1 1  57 LYS O    O   7.107 -11.455   3.844 1.00 . A A .  57 LYS O    1 1 
        4  8023 1 1  58 PHE C    C  10.083  -9.098   3.342 1.00 . A A .  58 PHE C    1 1 
        4  8024 1 1  58 PHE CA   C   9.354 -10.224   2.602 1.00 . A A .  58 PHE CA   1 1 
        4  8025 1 1  58 PHE CB   C   9.959 -10.498   1.206 1.00 . A A .  58 PHE CB   1 1 
        4  8026 1 1  58 PHE CD1  C   9.517 -12.974   0.823 1.00 . A A .  58 PHE CD1  1 1 
        4  8027 1 1  58 PHE CD2  C   8.323 -11.404  -0.529 1.00 . A A .  58 PHE CD2  1 1 
        4  8028 1 1  58 PHE CE1  C   8.869 -14.013   0.189 1.00 . A A .  58 PHE CE1  1 1 
        4  8029 1 1  58 PHE CE2  C   7.677 -12.448  -1.163 1.00 . A A .  58 PHE CE2  1 1 
        4  8030 1 1  58 PHE CG   C   9.257 -11.646   0.478 1.00 . A A .  58 PHE CG   1 1 
        4  8031 1 1  58 PHE CZ   C   7.950 -13.750  -0.803 1.00 . A A .  58 PHE CZ   1 1 
        4  8032 1 1  58 PHE H    H   7.702  -9.172   1.809 1.00 . A A .  58 PHE H    1 1 
        4  8033 1 1  58 PHE HA   H   9.423 -11.132   3.205 1.00 . A A .  58 PHE HA   1 1 
        4  8034 1 1  58 PHE HB2  H   9.882  -9.601   0.598 1.00 . A A .  58 PHE HB2  1 1 
        4  8035 1 1  58 PHE HB3  H  11.005 -10.755   1.312 1.00 . A A .  58 PHE HB3  1 1 
        4  8036 1 1  58 PHE HD1  H  10.239 -13.190   1.603 1.00 . A A .  58 PHE HD1  1 1 
        4  8037 1 1  58 PHE HD2  H   8.103 -10.382  -0.819 1.00 . A A .  58 PHE HD2  1 1 
        4  8038 1 1  58 PHE HE1  H   9.084 -15.036   0.469 1.00 . A A .  58 PHE HE1  1 1 
        4  8039 1 1  58 PHE HE2  H   6.954 -12.243  -1.943 1.00 . A A .  58 PHE HE2  1 1 
        4  8040 1 1  58 PHE HZ   H   7.441 -14.567  -1.302 1.00 . A A .  58 PHE HZ   1 1 
        4  8041 1 1  58 PHE N    N   7.942  -9.856   2.471 1.00 . A A .  58 PHE N    1 1 
        4  8042 1 1  58 PHE O    O   9.551  -7.983   3.456 1.00 . A A .  58 PHE O    1 1 
        4  8043 1 1  59 ASP C    C  12.234  -7.101   4.157 1.00 . A A .  59 ASP C    1 1 
        4  8044 1 1  59 ASP CA   C  12.028  -8.514   4.756 1.00 . A A .  59 ASP CA   1 1 
        4  8045 1 1  59 ASP CB   C  13.377  -9.171   5.164 1.00 . A A .  59 ASP CB   1 1 
        4  8046 1 1  59 ASP CG   C  14.393  -9.291   4.014 1.00 . A A .  59 ASP CG   1 1 
        4  8047 1 1  59 ASP H    H  11.698 -10.249   3.581 1.00 . A A .  59 ASP H    1 1 
        4  8048 1 1  59 ASP HA   H  11.415  -8.418   5.651 1.00 . A A .  59 ASP HA   1 1 
        4  8049 1 1  59 ASP HB2  H  13.822  -8.595   5.968 1.00 . A A .  59 ASP HB2  1 1 
        4  8050 1 1  59 ASP HB3  H  13.176 -10.168   5.541 1.00 . A A .  59 ASP HB3  1 1 
        4  8051 1 1  59 ASP N    N  11.288  -9.398   3.839 1.00 . A A .  59 ASP N    1 1 
        4  8052 1 1  59 ASP O    O  12.747  -6.947   3.043 1.00 . A A .  59 ASP O    1 1 
        4  8053 1 1  59 ASP OD1  O  14.193 -10.133   3.113 1.00 . A A .  59 ASP OD1  1 1 
        4  8054 1 1  59 ASP OD2  O  15.388  -8.535   3.998 1.00 . A A .  59 ASP OD2  1 1 
        4  8055 1 1  60 SER C    C  12.989  -4.006   5.305 1.00 . A A .  60 SER C    1 1 
        4  8056 1 1  60 SER CA   C  11.876  -4.680   4.487 1.00 . A A .  60 SER CA   1 1 
        4  8057 1 1  60 SER CB   C  10.510  -3.969   4.651 1.00 . A A .  60 SER CB   1 1 
        4  8058 1 1  60 SER H    H  11.312  -6.281   5.738 1.00 . A A .  60 SER H    1 1 
        4  8059 1 1  60 SER HA   H  12.159  -4.647   3.436 1.00 . A A .  60 SER HA   1 1 
        4  8060 1 1  60 SER HB2  H  10.619  -2.909   4.448 1.00 . A A .  60 SER HB2  1 1 
        4  8061 1 1  60 SER HB3  H   9.803  -4.388   3.947 1.00 . A A .  60 SER HB3  1 1 
        4  8062 1 1  60 SER HG   H  10.583  -3.735   6.602 1.00 . A A .  60 SER HG   1 1 
        4  8063 1 1  60 SER N    N  11.757  -6.081   4.887 1.00 . A A .  60 SER N    1 1 
        4  8064 1 1  60 SER O    O  12.726  -3.250   6.246 1.00 . A A .  60 SER O    1 1 
        4  8065 1 1  60 SER OG   O   9.974  -4.122   5.961 1.00 . A A .  60 SER OG   1 1 
        4  8066 1 1  61 GLN C    C  15.703  -2.321   5.247 1.00 . A A .  61 GLN C    1 1 
        4  8067 1 1  61 GLN CA   C  15.440  -3.793   5.639 1.00 . A A .  61 GLN CA   1 1 
        4  8068 1 1  61 GLN CB   C  16.674  -4.685   5.357 1.00 . A A .  61 GLN CB   1 1 
        4  8069 1 1  61 GLN CD   C  18.240  -5.762   3.659 1.00 . A A .  61 GLN CD   1 1 
        4  8070 1 1  61 GLN CG   C  17.062  -4.813   3.876 1.00 . A A .  61 GLN CG   1 1 
        4  8071 1 1  61 GLN H    H  14.371  -4.981   4.232 1.00 . A A .  61 GLN H    1 1 
        4  8072 1 1  61 GLN HA   H  15.244  -3.817   6.707 1.00 . A A .  61 GLN HA   1 1 
        4  8073 1 1  61 GLN HB2  H  17.526  -4.288   5.896 1.00 . A A .  61 GLN HB2  1 1 
        4  8074 1 1  61 GLN HB3  H  16.464  -5.682   5.738 1.00 . A A .  61 GLN HB3  1 1 
        4  8075 1 1  61 GLN HE21 H  17.003  -7.299   3.516 1.00 . A A .  61 GLN HE21 1 1 
        4  8076 1 1  61 GLN HE22 H  18.676  -7.668   3.336 1.00 . A A .  61 GLN HE22 1 1 
        4  8077 1 1  61 GLN HG2  H  16.209  -5.185   3.318 1.00 . A A .  61 GLN HG2  1 1 
        4  8078 1 1  61 GLN HG3  H  17.330  -3.835   3.502 1.00 . A A .  61 GLN HG3  1 1 
        4  8079 1 1  61 GLN N    N  14.245  -4.338   4.959 1.00 . A A .  61 GLN N    1 1 
        4  8080 1 1  61 GLN NE2  N  17.946  -7.039   3.490 1.00 . A A .  61 GLN NE2  1 1 
        4  8081 1 1  61 GLN O    O  16.545  -1.652   5.855 1.00 . A A .  61 GLN O    1 1 
        4  8082 1 1  61 GLN OE1  O  19.400  -5.351   3.658 1.00 . A A .  61 GLN OE1  1 1 
        4  8083 1 1  62 CYS C    C  14.012   0.385   4.860 1.00 . A A .  62 CYS C    1 1 
        4  8084 1 1  62 CYS CA   C  14.926  -0.396   3.883 1.00 . A A .  62 CYS CA   1 1 
        4  8085 1 1  62 CYS CB   C  14.422  -0.234   2.435 1.00 . A A .  62 CYS CB   1 1 
        4  8086 1 1  62 CYS H    H  14.458  -2.460   3.679 1.00 . A A .  62 CYS H    1 1 
        4  8087 1 1  62 CYS HA   H  15.932   0.003   3.949 1.00 . A A .  62 CYS HA   1 1 
        4  8088 1 1  62 CYS HB2  H  13.419  -0.642   2.351 1.00 . A A .  62 CYS HB2  1 1 
        4  8089 1 1  62 CYS HB3  H  14.400   0.813   2.170 1.00 . A A .  62 CYS HB3  1 1 
        4  8090 1 1  62 CYS HG   H  16.307  -0.186   0.715 1.00 . A A .  62 CYS HG   1 1 
        4  8091 1 1  62 CYS N    N  14.974  -1.831   4.228 1.00 . A A .  62 CYS N    1 1 
        4  8092 1 1  62 CYS O    O  14.033   1.619   4.889 1.00 . A A .  62 CYS O    1 1 
        4  8093 1 1  62 CYS SG   S  15.445  -1.071   1.207 1.00 . A A .  62 CYS SG   1 1 
        4  8094 1 1  63 GLY C    C  10.842   0.208   6.105 1.00 . A A .  63 GLY C    1 1 
        4  8095 1 1  63 GLY CA   C  12.272   0.233   6.621 1.00 . A A .  63 GLY CA   1 1 
        4  8096 1 1  63 GLY H    H  13.259  -1.330   5.585 1.00 . A A .  63 GLY H    1 1 
        4  8097 1 1  63 GLY HA2  H  12.328  -0.334   7.541 1.00 . A A .  63 GLY HA2  1 1 
        4  8098 1 1  63 GLY HA3  H  12.554   1.260   6.833 1.00 . A A .  63 GLY HA3  1 1 
        4  8099 1 1  63 GLY N    N  13.210  -0.355   5.655 1.00 . A A .  63 GLY N    1 1 
        4  8100 1 1  63 GLY O    O   9.926  -0.260   6.790 1.00 . A A .  63 GLY O    1 1 
        4  8101 1 1  64 TRP C    C   8.958  -0.633   3.694 1.00 . A A .  64 TRP C    1 1 
        4  8102 1 1  64 TRP CA   C   9.354   0.777   4.209 1.00 . A A .  64 TRP CA   1 1 
        4  8103 1 1  64 TRP CB   C   9.396   1.798   3.041 1.00 . A A .  64 TRP CB   1 1 
        4  8104 1 1  64 TRP CD1  C   8.941   4.104   4.087 1.00 . A A .  64 TRP CD1  1 1 
        4  8105 1 1  64 TRP CD2  C  11.034   3.842   3.329 1.00 . A A .  64 TRP CD2  1 1 
        4  8106 1 1  64 TRP CE2  C  10.909   5.131   3.873 1.00 . A A .  64 TRP CE2  1 1 
        4  8107 1 1  64 TRP CE3  C  12.262   3.455   2.783 1.00 . A A .  64 TRP CE3  1 1 
        4  8108 1 1  64 TRP CG   C   9.759   3.197   3.475 1.00 . A A .  64 TRP CG   1 1 
        4  8109 1 1  64 TRP CH2  C  13.164   5.630   3.364 1.00 . A A .  64 TRP CH2  1 1 
        4  8110 1 1  64 TRP CZ2  C  11.972   6.033   3.902 1.00 . A A .  64 TRP CZ2  1 1 
        4  8111 1 1  64 TRP CZ3  C  13.316   4.351   2.811 1.00 . A A .  64 TRP CZ3  1 1 
        4  8112 1 1  64 TRP H    H  11.434   1.119   4.426 1.00 . A A .  64 TRP H    1 1 
        4  8113 1 1  64 TRP HA   H   8.620   1.111   4.935 1.00 . A A .  64 TRP HA   1 1 
        4  8114 1 1  64 TRP HB2  H  10.127   1.478   2.307 1.00 . A A .  64 TRP HB2  1 1 
        4  8115 1 1  64 TRP HB3  H   8.422   1.839   2.566 1.00 . A A .  64 TRP HB3  1 1 
        4  8116 1 1  64 TRP HD1  H   7.904   3.921   4.337 1.00 . A A .  64 TRP HD1  1 1 
        4  8117 1 1  64 TRP HE1  H   9.247   6.056   4.760 1.00 . A A .  64 TRP HE1  1 1 
        4  8118 1 1  64 TRP HE3  H  12.394   2.472   2.352 1.00 . A A .  64 TRP HE3  1 1 
        4  8119 1 1  64 TRP HH2  H  14.014   6.299   3.365 1.00 . A A .  64 TRP HH2  1 1 
        4  8120 1 1  64 TRP HZ2  H  11.868   7.025   4.331 1.00 . A A .  64 TRP HZ2  1 1 
        4  8121 1 1  64 TRP HZ3  H  14.278   4.066   2.395 1.00 . A A .  64 TRP HZ3  1 1 
        4  8122 1 1  64 TRP N    N  10.661   0.730   4.884 1.00 . A A .  64 TRP N    1 1 
        4  8123 1 1  64 TRP NE1  N   9.623   5.262   4.332 1.00 . A A .  64 TRP NE1  1 1 
        4  8124 1 1  64 TRP O    O   9.731  -1.231   2.929 1.00 . A A .  64 TRP O    1 1 
        4  8125 1 1  65 PRO C    C   7.409  -2.816   2.197 1.00 . A A .  65 PRO C    1 1 
        4  8126 1 1  65 PRO CA   C   7.232  -2.510   3.708 1.00 . A A .  65 PRO CA   1 1 
        4  8127 1 1  65 PRO CB   C   5.738  -2.401   4.081 1.00 . A A .  65 PRO CB   1 1 
        4  8128 1 1  65 PRO CD   C   6.861  -0.569   5.167 1.00 . A A .  65 PRO CD   1 1 
        4  8129 1 1  65 PRO CG   C   5.735  -1.574   5.332 1.00 . A A .  65 PRO CG   1 1 
        4  8130 1 1  65 PRO HA   H   7.688  -3.311   4.288 1.00 . A A .  65 PRO HA   1 1 
        4  8131 1 1  65 PRO HB2  H   5.183  -1.916   3.278 1.00 . A A .  65 PRO HB2  1 1 
        4  8132 1 1  65 PRO HB3  H   5.322  -3.389   4.256 1.00 . A A .  65 PRO HB3  1 1 
        4  8133 1 1  65 PRO HD2  H   6.474   0.383   4.809 1.00 . A A .  65 PRO HD2  1 1 
        4  8134 1 1  65 PRO HD3  H   7.385  -0.423   6.108 1.00 . A A .  65 PRO HD3  1 1 
        4  8135 1 1  65 PRO HG2  H   4.782  -1.066   5.442 1.00 . A A .  65 PRO HG2  1 1 
        4  8136 1 1  65 PRO HG3  H   5.917  -2.203   6.199 1.00 . A A .  65 PRO HG3  1 1 
        4  8137 1 1  65 PRO N    N   7.768  -1.188   4.146 1.00 . A A .  65 PRO N    1 1 
        4  8138 1 1  65 PRO O    O   6.870  -2.105   1.344 1.00 . A A .  65 PRO O    1 1 
        4  8139 1 1  66 SER C    C   7.822  -5.597   0.152 1.00 . A A .  66 SER C    1 1 
        4  8140 1 1  66 SER CA   C   8.531  -4.278   0.519 1.00 . A A .  66 SER CA   1 1 
        4  8141 1 1  66 SER CB   C  10.066  -4.428   0.395 1.00 . A A .  66 SER CB   1 1 
        4  8142 1 1  66 SER H    H   8.537  -4.416   2.631 1.00 . A A .  66 SER H    1 1 
        4  8143 1 1  66 SER HA   H   8.198  -3.494  -0.163 1.00 . A A .  66 SER HA   1 1 
        4  8144 1 1  66 SER HB2  H  10.410  -5.238   1.025 1.00 . A A .  66 SER HB2  1 1 
        4  8145 1 1  66 SER HB3  H  10.332  -4.639  -0.636 1.00 . A A .  66 SER HB3  1 1 
        4  8146 1 1  66 SER HG   H  10.106  -2.663   1.271 1.00 . A A .  66 SER HG   1 1 
        4  8147 1 1  66 SER N    N   8.185  -3.877   1.896 1.00 . A A .  66 SER N    1 1 
        4  8148 1 1  66 SER O    O   7.821  -6.554   0.943 1.00 . A A .  66 SER O    1 1 
        4  8149 1 1  66 SER OG   O  10.728  -3.234   0.797 1.00 . A A .  66 SER OG   1 1 
        4  8150 1 1  67 PHE C    C   6.793  -7.047  -3.009 1.00 . A A .  67 PHE C    1 1 
        4  8151 1 1  67 PHE CA   C   6.420  -6.773  -1.546 1.00 . A A .  67 PHE CA   1 1 
        4  8152 1 1  67 PHE CB   C   4.895  -6.485  -1.438 1.00 . A A .  67 PHE CB   1 1 
        4  8153 1 1  67 PHE CD1  C   4.069  -7.021   0.900 1.00 . A A .  67 PHE CD1  1 1 
        4  8154 1 1  67 PHE CD2  C   4.369  -4.719   0.318 1.00 . A A .  67 PHE CD2  1 1 
        4  8155 1 1  67 PHE CE1  C   3.661  -6.642   2.162 1.00 . A A .  67 PHE CE1  1 1 
        4  8156 1 1  67 PHE CE2  C   3.964  -4.342   1.579 1.00 . A A .  67 PHE CE2  1 1 
        4  8157 1 1  67 PHE CG   C   4.427  -6.068  -0.046 1.00 . A A .  67 PHE CG   1 1 
        4  8158 1 1  67 PHE CZ   C   3.614  -5.303   2.505 1.00 . A A .  67 PHE CZ   1 1 
        4  8159 1 1  67 PHE H    H   7.302  -4.849  -1.637 1.00 . A A .  67 PHE H    1 1 
        4  8160 1 1  67 PHE HA   H   6.667  -7.650  -0.950 1.00 . A A .  67 PHE HA   1 1 
        4  8161 1 1  67 PHE HB2  H   4.637  -5.684  -2.123 1.00 . A A .  67 PHE HB2  1 1 
        4  8162 1 1  67 PHE HB3  H   4.342  -7.375  -1.724 1.00 . A A .  67 PHE HB3  1 1 
        4  8163 1 1  67 PHE HD1  H   4.104  -8.072   0.639 1.00 . A A .  67 PHE HD1  1 1 
        4  8164 1 1  67 PHE HD2  H   4.644  -3.958  -0.406 1.00 . A A .  67 PHE HD2  1 1 
        4  8165 1 1  67 PHE HE1  H   3.384  -7.397   2.889 1.00 . A A .  67 PHE HE1  1 1 
        4  8166 1 1  67 PHE HE2  H   3.922  -3.294   1.843 1.00 . A A .  67 PHE HE2  1 1 
        4  8167 1 1  67 PHE HZ   H   3.296  -5.008   3.497 1.00 . A A .  67 PHE HZ   1 1 
        4  8168 1 1  67 PHE N    N   7.209  -5.627  -1.049 1.00 . A A .  67 PHE N    1 1 
        4  8169 1 1  67 PHE O    O   7.245  -6.146  -3.725 1.00 . A A .  67 PHE O    1 1 
        4  8170 1 1  68 THR C    C   5.572  -8.928  -5.631 1.00 . A A .  68 THR C    1 1 
        4  8171 1 1  68 THR CA   C   6.876  -8.717  -4.828 1.00 . A A .  68 THR CA   1 1 
        4  8172 1 1  68 THR CB   C   7.731 -10.019  -4.829 1.00 . A A .  68 THR CB   1 1 
        4  8173 1 1  68 THR CG2  C   9.203  -9.756  -4.438 1.00 . A A .  68 THR CG2  1 1 
        4  8174 1 1  68 THR H    H   6.280  -8.961  -2.794 1.00 . A A .  68 THR H    1 1 
        4  8175 1 1  68 THR HA   H   7.448  -7.935  -5.325 1.00 . A A .  68 THR HA   1 1 
        4  8176 1 1  68 THR HB   H   7.721 -10.440  -5.827 1.00 . A A .  68 THR HB   1 1 
        4  8177 1 1  68 THR HG1  H   6.330 -10.626  -3.543 1.00 . A A .  68 THR HG1  1 1 
        4  8178 1 1  68 THR HG21 H   9.252  -9.354  -3.433 1.00 . A A .  68 THR HG21 1 1 
        4  8179 1 1  68 THR HG22 H   9.641  -9.042  -5.129 1.00 . A A .  68 THR HG22 1 1 
        4  8180 1 1  68 THR HG23 H   9.768 -10.678  -4.479 1.00 . A A .  68 THR HG23 1 1 
        4  8181 1 1  68 THR N    N   6.605  -8.291  -3.440 1.00 . A A .  68 THR N    1 1 
        4  8182 1 1  68 THR O    O   5.622  -9.239  -6.826 1.00 . A A .  68 THR O    1 1 
        4  8183 1 1  68 THR OG1  O   7.148 -10.979  -3.933 1.00 . A A .  68 THR OG1  1 1 
        4  8184 1 1  69 LYS C    C   2.064  -7.986  -4.948 1.00 . A A .  69 LYS C    1 1 
        4  8185 1 1  69 LYS CA   C   3.096  -8.940  -5.598 1.00 . A A .  69 LYS CA   1 1 
        4  8186 1 1  69 LYS CB   C   2.644 -10.425  -5.467 1.00 . A A .  69 LYS CB   1 1 
        4  8187 1 1  69 LYS CD   C   1.534 -10.587  -7.796 1.00 . A A .  69 LYS CD   1 1 
        4  8188 1 1  69 LYS CE   C   0.342 -11.142  -8.597 1.00 . A A .  69 LYS CE   1 1 
        4  8189 1 1  69 LYS CG   C   1.376 -10.803  -6.271 1.00 . A A .  69 LYS CG   1 1 
        4  8190 1 1  69 LYS H    H   4.445  -8.546  -4.005 1.00 . A A .  69 LYS H    1 1 
        4  8191 1 1  69 LYS HA   H   3.190  -8.697  -6.654 1.00 . A A .  69 LYS HA   1 1 
        4  8192 1 1  69 LYS HB2  H   3.454 -11.065  -5.802 1.00 . A A .  69 LYS HB2  1 1 
        4  8193 1 1  69 LYS HB3  H   2.456 -10.642  -4.417 1.00 . A A .  69 LYS HB3  1 1 
        4  8194 1 1  69 LYS HD2  H   1.625  -9.523  -7.991 1.00 . A A .  69 LYS HD2  1 1 
        4  8195 1 1  69 LYS HD3  H   2.441 -11.084  -8.128 1.00 . A A .  69 LYS HD3  1 1 
        4  8196 1 1  69 LYS HE2  H  -0.570 -10.673  -8.245 1.00 . A A .  69 LYS HE2  1 1 
        4  8197 1 1  69 LYS HE3  H   0.477 -10.907  -9.647 1.00 . A A .  69 LYS HE3  1 1 
        4  8198 1 1  69 LYS HG2  H   1.157 -11.848  -6.088 1.00 . A A .  69 LYS HG2  1 1 
        4  8199 1 1  69 LYS HG3  H   0.546 -10.201  -5.914 1.00 . A A .  69 LYS HG3  1 1 
        4  8200 1 1  69 LYS HZ1  H   1.084 -13.089  -8.760 1.00 . A A .  69 LYS HZ1  1 1 
        4  8201 1 1  69 LYS HZ2  H  -0.581 -12.968  -9.021 1.00 . A A .  69 LYS HZ2  1 1 
        4  8202 1 1  69 LYS HZ3  H   0.036 -12.861  -7.454 1.00 . A A .  69 LYS HZ3  1 1 
        4  8203 1 1  69 LYS N    N   4.412  -8.764  -4.967 1.00 . A A .  69 LYS N    1 1 
        4  8204 1 1  69 LYS NZ   N   0.212 -12.616  -8.448 1.00 . A A .  69 LYS NZ   1 1 
        4  8205 1 1  69 LYS O    O   1.812  -8.089  -3.748 1.00 . A A .  69 LYS O    1 1 
        4  8206 1 1  70 PRO C    C  -0.971  -6.749  -5.934 1.00 . A A .  70 PRO C    1 1 
        4  8207 1 1  70 PRO CA   C   0.341  -6.190  -5.327 1.00 . A A .  70 PRO CA   1 1 
        4  8208 1 1  70 PRO CB   C   0.697  -4.809  -5.915 1.00 . A A .  70 PRO CB   1 1 
        4  8209 1 1  70 PRO CD   C   2.068  -6.495  -7.015 1.00 . A A .  70 PRO CD   1 1 
        4  8210 1 1  70 PRO CG   C   1.406  -5.125  -7.207 1.00 . A A .  70 PRO CG   1 1 
        4  8211 1 1  70 PRO HA   H   0.232  -6.118  -4.251 1.00 . A A .  70 PRO HA   1 1 
        4  8212 1 1  70 PRO HB2  H  -0.205  -4.218  -6.074 1.00 . A A .  70 PRO HB2  1 1 
        4  8213 1 1  70 PRO HB3  H   1.349  -4.278  -5.226 1.00 . A A .  70 PRO HB3  1 1 
        4  8214 1 1  70 PRO HD2  H   1.793  -7.171  -7.820 1.00 . A A .  70 PRO HD2  1 1 
        4  8215 1 1  70 PRO HD3  H   3.145  -6.397  -6.966 1.00 . A A .  70 PRO HD3  1 1 
        4  8216 1 1  70 PRO HG2  H   0.686  -5.164  -8.020 1.00 . A A .  70 PRO HG2  1 1 
        4  8217 1 1  70 PRO HG3  H   2.154  -4.368  -7.416 1.00 . A A .  70 PRO HG3  1 1 
        4  8218 1 1  70 PRO N    N   1.524  -6.989  -5.717 1.00 . A A .  70 PRO N    1 1 
        4  8219 1 1  70 PRO O    O  -0.968  -7.800  -6.585 1.00 . A A .  70 PRO O    1 1 
        4  8220 1 1  71 ILE C    C  -3.457  -5.300  -7.517 1.00 . A A .  71 ILE C    1 1 
        4  8221 1 1  71 ILE CA   C  -3.377  -6.294  -6.351 1.00 . A A .  71 ILE CA   1 1 
        4  8222 1 1  71 ILE CB   C  -4.628  -6.147  -5.392 1.00 . A A .  71 ILE CB   1 1 
        4  8223 1 1  71 ILE CD1  C  -5.710  -7.152  -3.239 1.00 . A A .  71 ILE CD1  1 1 
        4  8224 1 1  71 ILE CG1  C  -4.591  -7.234  -4.268 1.00 . A A .  71 ILE CG1  1 1 
        4  8225 1 1  71 ILE CG2  C  -5.959  -6.228  -6.188 1.00 . A A .  71 ILE CG2  1 1 
        4  8226 1 1  71 ILE H    H  -2.017  -5.289  -5.074 1.00 . A A .  71 ILE H    1 1 
        4  8227 1 1  71 ILE HA   H  -3.368  -7.313  -6.751 1.00 . A A .  71 ILE HA   1 1 
        4  8228 1 1  71 ILE HB   H  -4.580  -5.165  -4.928 1.00 . A A .  71 ILE HB   1 1 
        4  8229 1 1  71 ILE HD11 H  -5.578  -7.931  -2.502 1.00 . A A .  71 ILE HD11 1 1 
        4  8230 1 1  71 ILE HD12 H  -6.666  -7.277  -3.727 1.00 . A A .  71 ILE HD12 1 1 
        4  8231 1 1  71 ILE HD13 H  -5.680  -6.188  -2.745 1.00 . A A .  71 ILE HD13 1 1 
        4  8232 1 1  71 ILE HG12 H  -4.642  -8.217  -4.717 1.00 . A A .  71 ILE HG12 1 1 
        4  8233 1 1  71 ILE HG13 H  -3.652  -7.151  -3.729 1.00 . A A .  71 ILE HG13 1 1 
        4  8234 1 1  71 ILE HG21 H  -6.800  -6.120  -5.514 1.00 . A A .  71 ILE HG21 1 1 
        4  8235 1 1  71 ILE HG22 H  -6.029  -7.185  -6.688 1.00 . A A .  71 ILE HG22 1 1 
        4  8236 1 1  71 ILE HG23 H  -5.993  -5.438  -6.931 1.00 . A A .  71 ILE HG23 1 1 
        4  8237 1 1  71 ILE N    N  -2.090  -6.050  -5.677 1.00 . A A .  71 ILE N    1 1 
        4  8238 1 1  71 ILE O    O  -3.620  -4.096  -7.310 1.00 . A A .  71 ILE O    1 1 
        4  8239 1 1  72 GLU C    C  -4.477  -4.254 -10.322 1.00 . A A .  72 GLU C    1 1 
        4  8240 1 1  72 GLU CA   C  -3.197  -5.064  -9.976 1.00 . A A .  72 GLU CA   1 1 
        4  8241 1 1  72 GLU CB   C  -2.825  -6.045 -11.123 1.00 . A A .  72 GLU CB   1 1 
        4  8242 1 1  72 GLU CD   C  -2.177  -6.388 -13.585 1.00 . A A .  72 GLU CD   1 1 
        4  8243 1 1  72 GLU CG   C  -2.368  -5.384 -12.435 1.00 . A A .  72 GLU CG   1 1 
        4  8244 1 1  72 GLU H    H  -3.515  -6.810  -8.804 1.00 . A A .  72 GLU H    1 1 
        4  8245 1 1  72 GLU HA   H  -2.373  -4.372  -9.820 1.00 . A A .  72 GLU HA   1 1 
        4  8246 1 1  72 GLU HB2  H  -2.018  -6.685 -10.780 1.00 . A A .  72 GLU HB2  1 1 
        4  8247 1 1  72 GLU HB3  H  -3.685  -6.672 -11.338 1.00 . A A .  72 GLU HB3  1 1 
        4  8248 1 1  72 GLU HG2  H  -3.112  -4.647 -12.727 1.00 . A A .  72 GLU HG2  1 1 
        4  8249 1 1  72 GLU HG3  H  -1.428  -4.869 -12.256 1.00 . A A .  72 GLU HG3  1 1 
        4  8250 1 1  72 GLU N    N  -3.381  -5.840  -8.735 1.00 . A A .  72 GLU N    1 1 
        4  8251 1 1  72 GLU O    O  -4.435  -3.303 -11.108 1.00 . A A .  72 GLU O    1 1 
        4  8252 1 1  72 GLU OE1  O  -1.072  -6.964 -13.717 1.00 . A A .  72 GLU OE1  1 1 
        4  8253 1 1  72 GLU OE2  O  -3.142  -6.616 -14.351 1.00 . A A .  72 GLU OE2  1 1 
        4  8254 1 1  73 GLU C    C  -7.064  -2.651  -9.360 1.00 . A A .  73 GLU C    1 1 
        4  8255 1 1  73 GLU CA   C  -6.923  -4.058  -9.964 1.00 . A A .  73 GLU CA   1 1 
        4  8256 1 1  73 GLU CB   C  -8.042  -4.998  -9.455 1.00 . A A .  73 GLU CB   1 1 
        4  8257 1 1  73 GLU CD   C  -9.270  -7.226  -9.746 1.00 . A A .  73 GLU CD   1 1 
        4  8258 1 1  73 GLU CG   C  -8.029  -6.395 -10.102 1.00 . A A .  73 GLU CG   1 1 
        4  8259 1 1  73 GLU H    H  -5.519  -5.321  -8.992 1.00 . A A .  73 GLU H    1 1 
        4  8260 1 1  73 GLU HA   H  -7.020  -3.972 -11.045 1.00 . A A .  73 GLU HA   1 1 
        4  8261 1 1  73 GLU HB2  H  -7.944  -5.119  -8.382 1.00 . A A .  73 GLU HB2  1 1 
        4  8262 1 1  73 GLU HB3  H  -9.005  -4.542  -9.667 1.00 . A A .  73 GLU HB3  1 1 
        4  8263 1 1  73 GLU HG2  H  -7.984  -6.278 -11.181 1.00 . A A .  73 GLU HG2  1 1 
        4  8264 1 1  73 GLU HG3  H  -7.138  -6.925  -9.776 1.00 . A A .  73 GLU HG3  1 1 
        4  8265 1 1  73 GLU N    N  -5.601  -4.638  -9.689 1.00 . A A .  73 GLU N    1 1 
        4  8266 1 1  73 GLU O    O  -7.633  -1.758 -10.005 1.00 . A A .  73 GLU O    1 1 
        4  8267 1 1  73 GLU OE1  O -10.322  -7.035 -10.400 1.00 . A A .  73 GLU OE1  1 1 
        4  8268 1 1  73 GLU OE2  O  -9.213  -8.046  -8.805 1.00 . A A .  73 GLU OE2  1 1 
        4  8269 1 1  74 GLU C    C  -5.310  -0.357  -7.594 1.00 . A A .  74 GLU C    1 1 
        4  8270 1 1  74 GLU CA   C  -6.626  -1.128  -7.454 1.00 . A A .  74 GLU CA   1 1 
        4  8271 1 1  74 GLU CB   C  -6.991  -1.309  -5.960 1.00 . A A .  74 GLU CB   1 1 
        4  8272 1 1  74 GLU CD   C  -8.689   0.634  -5.900 1.00 . A A .  74 GLU CD   1 1 
        4  8273 1 1  74 GLU CG   C  -7.447  -0.016  -5.247 1.00 . A A .  74 GLU CG   1 1 
        4  8274 1 1  74 GLU H    H  -6.095  -3.183  -7.664 1.00 . A A .  74 GLU H    1 1 
        4  8275 1 1  74 GLU HA   H  -7.418  -0.554  -7.935 1.00 . A A .  74 GLU HA   1 1 
        4  8276 1 1  74 GLU HB2  H  -7.799  -2.030  -5.891 1.00 . A A .  74 GLU HB2  1 1 
        4  8277 1 1  74 GLU HB3  H  -6.132  -1.708  -5.428 1.00 . A A .  74 GLU HB3  1 1 
        4  8278 1 1  74 GLU HG2  H  -7.687  -0.252  -4.215 1.00 . A A .  74 GLU HG2  1 1 
        4  8279 1 1  74 GLU HG3  H  -6.626   0.694  -5.258 1.00 . A A .  74 GLU HG3  1 1 
        4  8280 1 1  74 GLU N    N  -6.542  -2.441  -8.131 1.00 . A A .  74 GLU N    1 1 
        4  8281 1 1  74 GLU O    O  -5.299   0.877  -7.597 1.00 . A A .  74 GLU O    1 1 
        4  8282 1 1  74 GLU OE1  O  -9.794   0.066  -5.785 1.00 . A A .  74 GLU OE1  1 1 
        4  8283 1 1  74 GLU OE2  O  -8.571   1.711  -6.528 1.00 . A A .  74 GLU OE2  1 1 
        4  8284 1 1  75 VAL C    C  -2.466  -0.403  -9.291 1.00 . A A .  75 VAL C    1 1 
        4  8285 1 1  75 VAL CA   C  -2.855  -0.542  -7.817 1.00 . A A .  75 VAL CA   1 1 
        4  8286 1 1  75 VAL CB   C  -1.842  -1.472  -7.063 1.00 . A A .  75 VAL CB   1 1 
        4  8287 1 1  75 VAL CG1  C  -0.386  -1.029  -7.290 1.00 . A A .  75 VAL CG1  1 1 
        4  8288 1 1  75 VAL CG2  C  -2.182  -1.527  -5.554 1.00 . A A .  75 VAL CG2  1 1 
        4  8289 1 1  75 VAL H    H  -4.291  -2.061  -7.912 1.00 . A A .  75 VAL H    1 1 
        4  8290 1 1  75 VAL HA   H  -2.846   0.438  -7.340 1.00 . A A .  75 VAL HA   1 1 
        4  8291 1 1  75 VAL HB   H  -1.948  -2.478  -7.462 1.00 . A A .  75 VAL HB   1 1 
        4  8292 1 1  75 VAL HG11 H   0.290  -1.702  -6.782 1.00 . A A .  75 VAL HG11 1 1 
        4  8293 1 1  75 VAL HG12 H  -0.252  -0.028  -6.903 1.00 . A A .  75 VAL HG12 1 1 
        4  8294 1 1  75 VAL HG13 H  -0.163  -1.031  -8.355 1.00 . A A .  75 VAL HG13 1 1 
        4  8295 1 1  75 VAL HG21 H  -3.190  -1.904  -5.419 1.00 . A A .  75 VAL HG21 1 1 
        4  8296 1 1  75 VAL HG22 H  -2.119  -0.528  -5.139 1.00 . A A .  75 VAL HG22 1 1 
        4  8297 1 1  75 VAL HG23 H  -1.485  -2.174  -5.039 1.00 . A A .  75 VAL HG23 1 1 
        4  8298 1 1  75 VAL N    N  -4.207  -1.099  -7.751 1.00 . A A .  75 VAL N    1 1 
        4  8299 1 1  75 VAL O    O  -2.490  -1.389 -10.035 1.00 . A A .  75 VAL O    1 1 
        4  8300 1 1  76 GLU C    C  -0.320   1.550 -11.243 1.00 . A A .  76 GLU C    1 1 
        4  8301 1 1  76 GLU CA   C  -1.787   1.109 -11.120 1.00 . A A .  76 GLU CA   1 1 
        4  8302 1 1  76 GLU CB   C  -2.742   2.181 -11.718 1.00 . A A .  76 GLU CB   1 1 
        4  8303 1 1  76 GLU CD   C  -2.546   1.342 -14.151 1.00 . A A .  76 GLU CD   1 1 
        4  8304 1 1  76 GLU CG   C  -2.483   2.552 -13.195 1.00 . A A .  76 GLU CG   1 1 
        4  8305 1 1  76 GLU H    H  -2.086   1.549  -9.053 1.00 . A A .  76 GLU H    1 1 
        4  8306 1 1  76 GLU HA   H  -1.913   0.188 -11.696 1.00 . A A .  76 GLU HA   1 1 
        4  8307 1 1  76 GLU HB2  H  -3.760   1.815 -11.637 1.00 . A A .  76 GLU HB2  1 1 
        4  8308 1 1  76 GLU HB3  H  -2.662   3.085 -11.122 1.00 . A A .  76 GLU HB3  1 1 
        4  8309 1 1  76 GLU HG2  H  -3.230   3.279 -13.501 1.00 . A A .  76 GLU HG2  1 1 
        4  8310 1 1  76 GLU HG3  H  -1.503   3.014 -13.270 1.00 . A A .  76 GLU HG3  1 1 
        4  8311 1 1  76 GLU N    N  -2.125   0.821  -9.713 1.00 . A A .  76 GLU N    1 1 
        4  8312 1 1  76 GLU O    O   0.134   2.436 -10.521 1.00 . A A .  76 GLU O    1 1 
        4  8313 1 1  76 GLU OE1  O  -3.656   0.969 -14.580 1.00 . A A .  76 GLU OE1  1 1 
        4  8314 1 1  76 GLU OE2  O  -1.492   0.747 -14.467 1.00 . A A .  76 GLU OE2  1 1 
        4  8315 1 1  77 GLU C    C   1.879   2.400 -13.446 1.00 . A A .  77 GLU C    1 1 
        4  8316 1 1  77 GLU CA   C   1.793   1.185 -12.496 1.00 . A A .  77 GLU CA   1 1 
        4  8317 1 1  77 GLU CB   C   2.381  -0.116 -13.128 1.00 . A A .  77 GLU CB   1 1 
        4  8318 1 1  77 GLU CD   C   4.120   0.332 -15.019 1.00 . A A .  77 GLU CD   1 1 
        4  8319 1 1  77 GLU CG   C   3.872  -0.078 -13.551 1.00 . A A .  77 GLU CG   1 1 
        4  8320 1 1  77 GLU H    H  -0.084   0.275 -12.753 1.00 . A A .  77 GLU H    1 1 
        4  8321 1 1  77 GLU HA   H   2.315   1.406 -11.568 1.00 . A A .  77 GLU HA   1 1 
        4  8322 1 1  77 GLU HB2  H   2.269  -0.916 -12.400 1.00 . A A .  77 GLU HB2  1 1 
        4  8323 1 1  77 GLU HB3  H   1.787  -0.376 -13.996 1.00 . A A .  77 GLU HB3  1 1 
        4  8324 1 1  77 GLU HG2  H   4.397   0.616 -12.905 1.00 . A A .  77 GLU HG2  1 1 
        4  8325 1 1  77 GLU HG3  H   4.302  -1.068 -13.398 1.00 . A A .  77 GLU HG3  1 1 
        4  8326 1 1  77 GLU N    N   0.385   0.923 -12.188 1.00 . A A .  77 GLU N    1 1 
        4  8327 1 1  77 GLU O    O   1.366   2.343 -14.571 1.00 . A A .  77 GLU O    1 1 
        4  8328 1 1  77 GLU OE1  O   4.072  -0.547 -15.910 1.00 . A A .  77 GLU OE1  1 1 
        4  8329 1 1  77 GLU OE2  O   4.357   1.527 -15.290 1.00 . A A .  77 GLU OE2  1 1 
        4  8330 1 1  78 LYS C    C   4.006   5.357 -13.708 1.00 . A A .  78 LYS C    1 1 
        4  8331 1 1  78 LYS CA   C   2.578   4.778 -13.749 1.00 . A A .  78 LYS CA   1 1 
        4  8332 1 1  78 LYS CB   C   1.566   5.806 -13.163 1.00 . A A .  78 LYS CB   1 1 
        4  8333 1 1  78 LYS CD   C  -0.905   6.417 -12.660 1.00 . A A .  78 LYS CD   1 1 
        4  8334 1 1  78 LYS CE   C  -1.071   7.672 -13.554 1.00 . A A .  78 LYS CE   1 1 
        4  8335 1 1  78 LYS CG   C   0.085   5.362 -13.208 1.00 . A A .  78 LYS CG   1 1 
        4  8336 1 1  78 LYS H    H   2.954   3.474 -12.105 1.00 . A A .  78 LYS H    1 1 
        4  8337 1 1  78 LYS HA   H   2.310   4.576 -14.785 1.00 . A A .  78 LYS HA   1 1 
        4  8338 1 1  78 LYS HB2  H   1.827   6.000 -12.126 1.00 . A A .  78 LYS HB2  1 1 
        4  8339 1 1  78 LYS HB3  H   1.656   6.735 -13.718 1.00 . A A .  78 LYS HB3  1 1 
        4  8340 1 1  78 LYS HD2  H  -1.878   5.950 -12.548 1.00 . A A .  78 LYS HD2  1 1 
        4  8341 1 1  78 LYS HD3  H  -0.564   6.734 -11.679 1.00 . A A .  78 LYS HD3  1 1 
        4  8342 1 1  78 LYS HE2  H  -1.298   7.353 -14.564 1.00 . A A .  78 LYS HE2  1 1 
        4  8343 1 1  78 LYS HE3  H  -1.901   8.255 -13.181 1.00 . A A .  78 LYS HE3  1 1 
        4  8344 1 1  78 LYS HG2  H  -0.182   5.137 -14.235 1.00 . A A .  78 LYS HG2  1 1 
        4  8345 1 1  78 LYS HG3  H  -0.016   4.451 -12.618 1.00 . A A .  78 LYS HG3  1 1 
        4  8346 1 1  78 LYS HZ1  H   0.482   8.739 -12.642 1.00 . A A .  78 LYS HZ1  1 1 
        4  8347 1 1  78 LYS HZ2  H  -0.095   9.446 -14.061 1.00 . A A .  78 LYS HZ2  1 1 
        4  8348 1 1  78 LYS HZ3  H   0.892   8.079 -14.145 1.00 . A A .  78 LYS HZ3  1 1 
        4  8349 1 1  78 LYS N    N   2.511   3.509 -12.985 1.00 . A A .  78 LYS N    1 1 
        4  8350 1 1  78 LYS NZ   N   0.135   8.542 -13.600 1.00 . A A .  78 LYS NZ   1 1 
        4  8351 1 1  78 LYS O    O   4.481   5.753 -12.646 1.00 . A A .  78 LYS O    1 1 
        4  8352 1 1  79 LEU C    C   6.093   7.439 -14.773 1.00 . A A .  79 LEU C    1 1 
        4  8353 1 1  79 LEU CA   C   6.051   5.911 -14.994 1.00 . A A .  79 LEU CA   1 1 
        4  8354 1 1  79 LEU CB   C   6.618   5.548 -16.391 1.00 . A A .  79 LEU CB   1 1 
        4  8355 1 1  79 LEU CD1  C   9.028   5.064 -15.670 1.00 . A A .  79 LEU CD1  1 1 
        4  8356 1 1  79 LEU CD2  C   8.535   5.630 -18.092 1.00 . A A .  79 LEU CD2  1 1 
        4  8357 1 1  79 LEU CG   C   8.128   5.868 -16.624 1.00 . A A .  79 LEU CG   1 1 
        4  8358 1 1  79 LEU H    H   4.217   5.129 -15.680 1.00 . A A .  79 LEU H    1 1 
        4  8359 1 1  79 LEU HA   H   6.654   5.420 -14.231 1.00 . A A .  79 LEU HA   1 1 
        4  8360 1 1  79 LEU HB2  H   6.467   4.482 -16.548 1.00 . A A .  79 LEU HB2  1 1 
        4  8361 1 1  79 LEU HB3  H   6.038   6.077 -17.138 1.00 . A A .  79 LEU HB3  1 1 
        4  8362 1 1  79 LEU HD11 H   8.763   5.288 -14.647 1.00 . A A .  79 LEU HD11 1 1 
        4  8363 1 1  79 LEU HD12 H  10.062   5.330 -15.832 1.00 . A A .  79 LEU HD12 1 1 
        4  8364 1 1  79 LEU HD13 H   8.897   4.003 -15.850 1.00 . A A .  79 LEU HD13 1 1 
        4  8365 1 1  79 LEU HD21 H   8.386   4.589 -18.349 1.00 . A A .  79 LEU HD21 1 1 
        4  8366 1 1  79 LEU HD22 H   9.578   5.886 -18.222 1.00 . A A .  79 LEU HD22 1 1 
        4  8367 1 1  79 LEU HD23 H   7.932   6.249 -18.741 1.00 . A A .  79 LEU HD23 1 1 
        4  8368 1 1  79 LEU HG   H   8.296   6.918 -16.411 1.00 . A A .  79 LEU HG   1 1 
        4  8369 1 1  79 LEU N    N   4.672   5.414 -14.871 1.00 . A A .  79 LEU N    1 1 
        4  8370 1 1  79 LEU O    O   5.341   8.182 -15.411 1.00 . A A .  79 LEU O    1 1 
        4  8371 1 1  80 ASP C    C   8.556   9.804 -13.789 1.00 . A A .  80 ASP C    1 1 
        4  8372 1 1  80 ASP CA   C   7.137   9.295 -13.472 1.00 . A A .  80 ASP CA   1 1 
        4  8373 1 1  80 ASP CB   C   6.854   9.454 -11.956 1.00 . A A .  80 ASP CB   1 1 
        4  8374 1 1  80 ASP CG   C   6.944  10.916 -11.471 1.00 . A A .  80 ASP CG   1 1 
        4  8375 1 1  80 ASP H    H   7.593   7.237 -13.488 1.00 . A A .  80 ASP H    1 1 
        4  8376 1 1  80 ASP HA   H   6.417   9.893 -14.030 1.00 . A A .  80 ASP HA   1 1 
        4  8377 1 1  80 ASP HB2  H   5.857   9.079 -11.740 1.00 . A A .  80 ASP HB2  1 1 
        4  8378 1 1  80 ASP HB3  H   7.568   8.855 -11.396 1.00 . A A .  80 ASP HB3  1 1 
        4  8379 1 1  80 ASP N    N   6.989   7.883 -13.878 1.00 . A A .  80 ASP N    1 1 
        4  8380 1 1  80 ASP O    O   9.527   9.041 -13.748 1.00 . A A .  80 ASP O    1 1 
        4  8381 1 1  80 ASP OD1  O   5.945  11.648 -11.586 1.00 . A A .  80 ASP OD1  1 1 
        4  8382 1 1  80 ASP OD2  O   8.026  11.348 -10.997 1.00 . A A .  80 ASP OD2  1 1 
        4  8383 1 1  81 THR C    C   9.903  13.212 -13.629 1.00 . A A .  81 THR C    1 1 
        4  8384 1 1  81 THR CA   C   9.919  11.824 -14.319 1.00 . A A .  81 THR CA   1 1 
        4  8385 1 1  81 THR CB   C  10.197  11.999 -15.857 1.00 . A A .  81 THR CB   1 1 
        4  8386 1 1  81 THR CG2  C  10.637  10.687 -16.538 1.00 . A A .  81 THR CG2  1 1 
        4  8387 1 1  81 THR H    H   7.824  11.613 -14.171 1.00 . A A .  81 THR H    1 1 
        4  8388 1 1  81 THR HA   H  10.729  11.244 -13.886 1.00 . A A .  81 THR HA   1 1 
        4  8389 1 1  81 THR HB   H  10.992  12.731 -15.987 1.00 . A A .  81 THR HB   1 1 
        4  8390 1 1  81 THR HG1  H   8.327  11.820 -16.478 1.00 . A A .  81 THR HG1  1 1 
        4  8391 1 1  81 THR HG21 H  10.840  10.871 -17.586 1.00 . A A .  81 THR HG21 1 1 
        4  8392 1 1  81 THR HG22 H   9.850   9.948 -16.452 1.00 . A A .  81 THR HG22 1 1 
        4  8393 1 1  81 THR HG23 H  11.535  10.308 -16.065 1.00 . A A .  81 THR HG23 1 1 
        4  8394 1 1  81 THR N    N   8.651  11.108 -14.093 1.00 . A A .  81 THR N    1 1 
        4  8395 1 1  81 THR O    O  10.947  13.874 -13.542 1.00 . A A .  81 THR O    1 1 
        4  8396 1 1  81 THR OG1  O   9.012  12.496 -16.508 1.00 . A A .  81 THR OG1  1 1 
        4  8397 1 1  82 SER C    C   9.301  15.205 -11.248 1.00 . A A .  82 SER C    1 1 
        4  8398 1 1  82 SER CA   C   8.528  14.998 -12.565 1.00 . A A .  82 SER CA   1 1 
        4  8399 1 1  82 SER CB   C   7.029  15.285 -12.332 1.00 . A A .  82 SER CB   1 1 
        4  8400 1 1  82 SER H    H   7.962  13.015 -13.100 1.00 . A A .  82 SER H    1 1 
        4  8401 1 1  82 SER HA   H   8.901  15.704 -13.302 1.00 . A A .  82 SER HA   1 1 
        4  8402 1 1  82 SER HB2  H   6.894  16.317 -12.023 1.00 . A A .  82 SER HB2  1 1 
        4  8403 1 1  82 SER HB3  H   6.481  15.120 -13.252 1.00 . A A .  82 SER HB3  1 1 
        4  8404 1 1  82 SER HG   H   6.842  13.551 -11.432 1.00 . A A .  82 SER HG   1 1 
        4  8405 1 1  82 SER N    N   8.722  13.637 -13.114 1.00 . A A .  82 SER N    1 1 
        4  8406 1 1  82 SER O    O   9.748  16.317 -10.952 1.00 . A A .  82 SER O    1 1 
        4  8407 1 1  82 SER OG   O   6.490  14.443 -11.327 1.00 . A A .  82 SER OG   1 1 
        4  8408 1 1  83 HIS C    C  11.654  14.059  -9.215 1.00 . A A .  83 HIS C    1 1 
        4  8409 1 1  83 HIS CA   C  10.107  14.162  -9.137 1.00 . A A .  83 HIS CA   1 1 
        4  8410 1 1  83 HIS CB   C   9.483  13.050  -8.248 1.00 . A A .  83 HIS CB   1 1 
        4  8411 1 1  83 HIS CD2  C   7.410  14.218  -7.185 1.00 . A A .  83 HIS CD2  1 1 
        4  8412 1 1  83 HIS CE1  C   5.844  13.021  -8.137 1.00 . A A .  83 HIS CE1  1 1 
        4  8413 1 1  83 HIS CG   C   8.021  13.288  -7.960 1.00 . A A .  83 HIS CG   1 1 
        4  8414 1 1  83 HIS H    H   9.183  13.244 -10.826 1.00 . A A .  83 HIS H    1 1 
        4  8415 1 1  83 HIS HA   H   9.869  15.128  -8.695 1.00 . A A .  83 HIS HA   1 1 
        4  8416 1 1  83 HIS HB2  H   9.577  12.092  -8.747 1.00 . A A .  83 HIS HB2  1 1 
        4  8417 1 1  83 HIS HB3  H  10.005  13.004  -7.300 1.00 . A A .  83 HIS HB3  1 1 
        4  8418 1 1  83 HIS HD1  H   7.124  11.780  -9.123 1.00 . A A .  83 HIS HD1  1 1 
        4  8419 1 1  83 HIS HD2  H   7.899  14.966  -6.572 1.00 . A A .  83 HIS HD2  1 1 
        4  8420 1 1  83 HIS HE1  H   4.875  12.637  -8.429 1.00 . A A .  83 HIS HE1  1 1 
        4  8421 1 1  83 HIS HE2  H   5.363  14.528  -6.841 1.00 . A A .  83 HIS HE2  1 1 
        4  8422 1 1  83 HIS N    N   9.482  14.115 -10.479 1.00 . A A .  83 HIS N    1 1 
        4  8423 1 1  83 HIS ND1  N   7.006  12.556  -8.534 1.00 . A A .  83 HIS ND1  1 1 
        4  8424 1 1  83 HIS NE2  N   6.061  14.031  -7.321 1.00 . A A .  83 HIS NE2  1 1 
        4  8425 1 1  83 HIS O    O  12.299  13.533  -8.299 1.00 . A A .  83 HIS O    1 1 
        4  8426 1 1  84 GLY C    C  14.389  13.354 -10.783 1.00 . A A .  84 GLY C    1 1 
        4  8427 1 1  84 GLY CA   C  13.698  14.687 -10.495 1.00 . A A .  84 GLY CA   1 1 
        4  8428 1 1  84 GLY H    H  11.657  14.941 -11.032 1.00 . A A .  84 GLY H    1 1 
        4  8429 1 1  84 GLY HA2  H  13.893  15.353 -11.326 1.00 . A A .  84 GLY HA2  1 1 
        4  8430 1 1  84 GLY HA3  H  14.130  15.123  -9.603 1.00 . A A .  84 GLY HA3  1 1 
        4  8431 1 1  84 GLY N    N  12.236  14.592 -10.321 1.00 . A A .  84 GLY N    1 1 
        4  8432 1 1  84 GLY O    O  15.619  13.300 -10.948 1.00 . A A .  84 GLY O    1 1 
        4  8433 1 1  85 MET C    C  13.285  10.191 -12.110 1.00 . A A .  85 MET C    1 1 
        4  8434 1 1  85 MET CA   C  14.089  10.905 -11.023 1.00 . A A .  85 MET CA   1 1 
        4  8435 1 1  85 MET CB   C  13.932  10.115  -9.686 1.00 . A A .  85 MET CB   1 1 
        4  8436 1 1  85 MET CE   C  16.659   8.646  -8.493 1.00 . A A .  85 MET CE   1 1 
        4  8437 1 1  85 MET CG   C  14.716  10.674  -8.494 1.00 . A A .  85 MET CG   1 1 
        4  8438 1 1  85 MET H    H  12.624  12.414 -10.856 1.00 . A A .  85 MET H    1 1 
        4  8439 1 1  85 MET HA   H  15.140  10.932 -11.303 1.00 . A A .  85 MET HA   1 1 
        4  8440 1 1  85 MET HB2  H  12.881  10.093  -9.411 1.00 . A A .  85 MET HB2  1 1 
        4  8441 1 1  85 MET HB3  H  14.263   9.095  -9.845 1.00 . A A .  85 MET HB3  1 1 
        4  8442 1 1  85 MET HE1  H  16.241   8.319  -7.550 1.00 . A A .  85 MET HE1  1 1 
        4  8443 1 1  85 MET HE2  H  17.704   8.373  -8.543 1.00 . A A .  85 MET HE2  1 1 
        4  8444 1 1  85 MET HE3  H  16.129   8.169  -9.305 1.00 . A A .  85 MET HE3  1 1 
        4  8445 1 1  85 MET HG2  H  14.521  11.737  -8.411 1.00 . A A .  85 MET HG2  1 1 
        4  8446 1 1  85 MET HG3  H  14.374  10.185  -7.589 1.00 . A A .  85 MET HG3  1 1 
        4  8447 1 1  85 MET N    N  13.592  12.278 -10.869 1.00 . A A .  85 MET N    1 1 
        4  8448 1 1  85 MET O    O  12.058  10.352 -12.177 1.00 . A A .  85 MET O    1 1 
        4  8449 1 1  85 MET SD   S  16.505  10.433  -8.635 1.00 . A A .  85 MET SD   1 1 
        4  8450 1 1  86 ILE C    C  12.959   7.216 -12.802 1.00 . A A .  86 ILE C    1 1 
        4  8451 1 1  86 ILE CA   C  13.317   8.370 -13.764 1.00 . A A .  86 ILE CA   1 1 
        4  8452 1 1  86 ILE CB   C  14.198   7.882 -14.990 1.00 . A A .  86 ILE CB   1 1 
        4  8453 1 1  86 ILE CD1  C  12.116   7.193 -16.373 1.00 . A A .  86 ILE CD1  1 1 
        4  8454 1 1  86 ILE CG1  C  13.465   6.769 -15.817 1.00 . A A .  86 ILE CG1  1 1 
        4  8455 1 1  86 ILE CG2  C  15.608   7.428 -14.555 1.00 . A A .  86 ILE CG2  1 1 
        4  8456 1 1  86 ILE H    H  14.937   9.527 -13.044 1.00 . A A .  86 ILE H    1 1 
        4  8457 1 1  86 ILE HA   H  12.395   8.799 -14.159 1.00 . A A .  86 ILE HA   1 1 
        4  8458 1 1  86 ILE HB   H  14.333   8.745 -15.637 1.00 . A A .  86 ILE HB   1 1 
        4  8459 1 1  86 ILE HD11 H  11.685   6.376 -16.937 1.00 . A A .  86 ILE HD11 1 1 
        4  8460 1 1  86 ILE HD12 H  12.247   8.048 -17.023 1.00 . A A .  86 ILE HD12 1 1 
        4  8461 1 1  86 ILE HD13 H  11.456   7.455 -15.558 1.00 . A A .  86 ILE HD13 1 1 
        4  8462 1 1  86 ILE HG12 H  14.079   6.480 -16.662 1.00 . A A .  86 ILE HG12 1 1 
        4  8463 1 1  86 ILE HG13 H  13.301   5.899 -15.191 1.00 . A A .  86 ILE HG13 1 1 
        4  8464 1 1  86 ILE HG21 H  16.193   7.149 -15.425 1.00 . A A .  86 ILE HG21 1 1 
        4  8465 1 1  86 ILE HG22 H  15.529   6.575 -13.895 1.00 . A A .  86 ILE HG22 1 1 
        4  8466 1 1  86 ILE HG23 H  16.108   8.235 -14.033 1.00 . A A .  86 ILE HG23 1 1 
        4  8467 1 1  86 ILE N    N  13.973   9.402 -12.957 1.00 . A A .  86 ILE N    1 1 
        4  8468 1 1  86 ILE O    O  13.834   6.545 -12.243 1.00 . A A .  86 ILE O    1 1 
        4  8469 1 1  87 ARG C    C   9.707   5.787 -11.897 1.00 . A A .  87 ARG C    1 1 
        4  8470 1 1  87 ARG CA   C  11.124   6.187 -11.517 1.00 . A A .  87 ARG CA   1 1 
        4  8471 1 1  87 ARG CB   C  11.131   6.962 -10.154 1.00 . A A .  87 ARG CB   1 1 
        4  8472 1 1  87 ARG CD   C  10.263   9.020  -8.811 1.00 . A A .  87 ARG CD   1 1 
        4  8473 1 1  87 ARG CG   C  10.039   8.069 -10.011 1.00 . A A .  87 ARG CG   1 1 
        4  8474 1 1  87 ARG CZ   C  10.113   8.455  -6.354 1.00 . A A .  87 ARG CZ   1 1 
        4  8475 1 1  87 ARG H    H  11.013   7.499 -13.173 1.00 . A A .  87 ARG H    1 1 
        4  8476 1 1  87 ARG HA   H  11.741   5.293 -11.442 1.00 . A A .  87 ARG HA   1 1 
        4  8477 1 1  87 ARG HB2  H  10.985   6.247  -9.350 1.00 . A A .  87 ARG HB2  1 1 
        4  8478 1 1  87 ARG HB3  H  12.103   7.422 -10.028 1.00 . A A .  87 ARG HB3  1 1 
        4  8479 1 1  87 ARG HD2  H  11.041   9.733  -9.066 1.00 . A A .  87 ARG HD2  1 1 
        4  8480 1 1  87 ARG HD3  H   9.340   9.564  -8.624 1.00 . A A .  87 ARG HD3  1 1 
        4  8481 1 1  87 ARG HE   H  11.457   7.721  -7.650 1.00 . A A .  87 ARG HE   1 1 
        4  8482 1 1  87 ARG HG2  H  10.022   8.661 -10.920 1.00 . A A .  87 ARG HG2  1 1 
        4  8483 1 1  87 ARG HG3  H   9.074   7.584  -9.896 1.00 . A A .  87 ARG HG3  1 1 
        4  8484 1 1  87 ARG HH11 H   8.545   9.608  -6.963 1.00 . A A .  87 ARG HH11 1 1 
        4  8485 1 1  87 ARG HH12 H   8.606   9.268  -5.265 1.00 . A A .  87 ARG HH12 1 1 
        4  8486 1 1  87 ARG HH21 H  11.499   7.291  -5.441 1.00 . A A .  87 ARG HH21 1 1 
        4  8487 1 1  87 ARG HH22 H  10.277   7.940  -4.400 1.00 . A A .  87 ARG HH22 1 1 
        4  8488 1 1  87 ARG N    N  11.660   7.043 -12.581 1.00 . A A .  87 ARG N    1 1 
        4  8489 1 1  87 ARG NE   N  10.672   8.314  -7.572 1.00 . A A .  87 ARG NE   1 1 
        4  8490 1 1  87 ARG NH1  N   9.000   9.168  -6.180 1.00 . A A .  87 ARG NH1  1 1 
        4  8491 1 1  87 ARG NH2  N  10.670   7.849  -5.316 1.00 . A A .  87 ARG NH2  1 1 
        4  8492 1 1  87 ARG O    O   9.141   6.358 -12.816 1.00 . A A .  87 ARG O    1 1 
        4  8493 1 1  88 THR C    C   6.988   4.682 -10.037 1.00 . A A .  88 THR C    1 1 
        4  8494 1 1  88 THR CA   C   7.720   4.468 -11.371 1.00 . A A .  88 THR CA   1 1 
        4  8495 1 1  88 THR CB   C   7.569   3.003 -11.884 1.00 . A A .  88 THR CB   1 1 
        4  8496 1 1  88 THR CG2  C   6.115   2.682 -12.285 1.00 . A A .  88 THR CG2  1 1 
        4  8497 1 1  88 THR H    H   9.668   4.333 -10.533 1.00 . A A .  88 THR H    1 1 
        4  8498 1 1  88 THR HA   H   7.283   5.137 -12.115 1.00 . A A .  88 THR HA   1 1 
        4  8499 1 1  88 THR HB   H   7.871   2.322 -11.096 1.00 . A A .  88 THR HB   1 1 
        4  8500 1 1  88 THR HG1  H   9.364   2.819 -12.715 1.00 . A A .  88 THR HG1  1 1 
        4  8501 1 1  88 THR HG21 H   5.799   3.343 -13.081 1.00 . A A .  88 THR HG21 1 1 
        4  8502 1 1  88 THR HG22 H   5.462   2.815 -11.429 1.00 . A A .  88 THR HG22 1 1 
        4  8503 1 1  88 THR HG23 H   6.048   1.658 -12.624 1.00 . A A .  88 THR HG23 1 1 
        4  8504 1 1  88 THR N    N   9.132   4.825 -11.195 1.00 . A A .  88 THR N    1 1 
        4  8505 1 1  88 THR O    O   7.577   4.518  -8.970 1.00 . A A .  88 THR O    1 1 
        4  8506 1 1  88 THR OG1  O   8.441   2.797 -13.013 1.00 . A A .  88 THR OG1  1 1 
        4  8507 1 1  89 GLU C    C   3.600   4.624  -9.050 1.00 . A A .  89 GLU C    1 1 
        4  8508 1 1  89 GLU CA   C   4.913   5.387  -8.904 1.00 . A A .  89 GLU CA   1 1 
        4  8509 1 1  89 GLU CB   C   4.664   6.911  -8.714 1.00 . A A .  89 GLU CB   1 1 
        4  8510 1 1  89 GLU CD   C   5.765   9.226  -8.362 1.00 . A A .  89 GLU CD   1 1 
        4  8511 1 1  89 GLU CG   C   5.947   7.766  -8.801 1.00 . A A .  89 GLU CG   1 1 
        4  8512 1 1  89 GLU H    H   5.377   5.385 -10.975 1.00 . A A .  89 GLU H    1 1 
        4  8513 1 1  89 GLU HA   H   5.444   5.005  -8.029 1.00 . A A .  89 GLU HA   1 1 
        4  8514 1 1  89 GLU HB2  H   3.976   7.259  -9.477 1.00 . A A .  89 GLU HB2  1 1 
        4  8515 1 1  89 GLU HB3  H   4.213   7.071  -7.738 1.00 . A A .  89 GLU HB3  1 1 
        4  8516 1 1  89 GLU HG2  H   6.703   7.300  -8.176 1.00 . A A .  89 GLU HG2  1 1 
        4  8517 1 1  89 GLU HG3  H   6.295   7.757  -9.828 1.00 . A A .  89 GLU HG3  1 1 
        4  8518 1 1  89 GLU N    N   5.741   5.153 -10.098 1.00 . A A .  89 GLU N    1 1 
        4  8519 1 1  89 GLU O    O   3.008   4.611 -10.140 1.00 . A A .  89 GLU O    1 1 
        4  8520 1 1  89 GLU OE1  O   4.748   9.846  -8.720 1.00 . A A .  89 GLU OE1  1 1 
        4  8521 1 1  89 GLU OE2  O   6.640   9.755  -7.641 1.00 . A A .  89 GLU OE2  1 1 
        4  8522 1 1  90 VAL C    C   0.798   4.201  -7.434 1.00 . A A .  90 VAL C    1 1 
        4  8523 1 1  90 VAL CA   C   1.869   3.263  -7.963 1.00 . A A .  90 VAL CA   1 1 
        4  8524 1 1  90 VAL CB   C   1.894   1.911  -7.158 1.00 . A A .  90 VAL CB   1 1 
        4  8525 1 1  90 VAL CG1  C   2.659   0.830  -7.944 1.00 . A A .  90 VAL CG1  1 1 
        4  8526 1 1  90 VAL CG2  C   2.486   2.085  -5.739 1.00 . A A .  90 VAL CG2  1 1 
        4  8527 1 1  90 VAL H    H   3.670   4.003  -7.132 1.00 . A A .  90 VAL H    1 1 
        4  8528 1 1  90 VAL HA   H   1.625   3.019  -9.003 1.00 . A A .  90 VAL HA   1 1 
        4  8529 1 1  90 VAL HB   H   0.864   1.562  -7.050 1.00 . A A .  90 VAL HB   1 1 
        4  8530 1 1  90 VAL HG11 H   3.679   1.157  -8.113 1.00 . A A .  90 VAL HG11 1 1 
        4  8531 1 1  90 VAL HG12 H   2.175   0.661  -8.895 1.00 . A A .  90 VAL HG12 1 1 
        4  8532 1 1  90 VAL HG13 H   2.666  -0.094  -7.379 1.00 . A A .  90 VAL HG13 1 1 
        4  8533 1 1  90 VAL HG21 H   2.470   1.138  -5.210 1.00 . A A .  90 VAL HG21 1 1 
        4  8534 1 1  90 VAL HG22 H   1.903   2.813  -5.186 1.00 . A A .  90 VAL HG22 1 1 
        4  8535 1 1  90 VAL HG23 H   3.508   2.434  -5.812 1.00 . A A .  90 VAL HG23 1 1 
        4  8536 1 1  90 VAL N    N   3.153   3.967  -7.966 1.00 . A A .  90 VAL N    1 1 
        4  8537 1 1  90 VAL O    O   0.938   4.790  -6.351 1.00 . A A .  90 VAL O    1 1 
        4  8538 1 1  91 ARG C    C  -2.679   4.530  -8.117 1.00 . A A .  91 ARG C    1 1 
        4  8539 1 1  91 ARG CA   C  -1.356   5.284  -7.942 1.00 . A A .  91 ARG CA   1 1 
        4  8540 1 1  91 ARG CB   C  -1.277   6.541  -8.851 1.00 . A A .  91 ARG CB   1 1 
        4  8541 1 1  91 ARG CD   C   0.085   8.624  -9.535 1.00 . A A .  91 ARG CD   1 1 
        4  8542 1 1  91 ARG CG   C   0.030   7.352  -8.681 1.00 . A A .  91 ARG CG   1 1 
        4  8543 1 1  91 ARG CZ   C  -0.713  10.967  -9.136 1.00 . A A .  91 ARG CZ   1 1 
        4  8544 1 1  91 ARG H    H  -0.321   3.833  -9.048 1.00 . A A .  91 ARG H    1 1 
        4  8545 1 1  91 ARG HA   H  -1.272   5.596  -6.899 1.00 . A A .  91 ARG HA   1 1 
        4  8546 1 1  91 ARG HB2  H  -1.356   6.230  -9.886 1.00 . A A .  91 ARG HB2  1 1 
        4  8547 1 1  91 ARG HB3  H  -2.113   7.192  -8.617 1.00 . A A .  91 ARG HB3  1 1 
        4  8548 1 1  91 ARG HD2  H   1.082   9.050  -9.461 1.00 . A A .  91 ARG HD2  1 1 
        4  8549 1 1  91 ARG HD3  H  -0.101   8.361 -10.572 1.00 . A A .  91 ARG HD3  1 1 
        4  8550 1 1  91 ARG HE   H  -1.790   9.300  -8.820 1.00 . A A .  91 ARG HE   1 1 
        4  8551 1 1  91 ARG HG2  H   0.129   7.639  -7.639 1.00 . A A .  91 ARG HG2  1 1 
        4  8552 1 1  91 ARG HG3  H   0.868   6.714  -8.947 1.00 . A A .  91 ARG HG3  1 1 
        4  8553 1 1  91 ARG HH11 H   1.210  10.885  -9.780 1.00 . A A .  91 ARG HH11 1 1 
        4  8554 1 1  91 ARG HH12 H   0.584  12.477  -9.507 1.00 . A A .  91 ARG HH12 1 1 
        4  8555 1 1  91 ARG HH21 H  -2.578  11.402  -8.497 1.00 . A A .  91 ARG HH21 1 1 
        4  8556 1 1  91 ARG HH22 H  -1.545  12.776  -8.777 1.00 . A A .  91 ARG HH22 1 1 
        4  8557 1 1  91 ARG N    N  -0.258   4.370  -8.232 1.00 . A A .  91 ARG N    1 1 
        4  8558 1 1  91 ARG NE   N  -0.912   9.635  -9.123 1.00 . A A .  91 ARG NE   1 1 
        4  8559 1 1  91 ARG NH1  N   0.451  11.482  -9.507 1.00 . A A .  91 ARG NH1  1 1 
        4  8560 1 1  91 ARG NH2  N  -1.688  11.777  -8.782 1.00 . A A .  91 ARG NH2  1 1 
        4  8561 1 1  91 ARG O    O  -2.851   3.777  -9.070 1.00 . A A .  91 ARG O    1 1 
        4  8562 1 1  92 SER C    C  -5.974   4.825  -7.780 1.00 . A A .  92 SER C    1 1 
        4  8563 1 1  92 SER CA   C  -4.868   4.012  -7.101 1.00 . A A .  92 SER CA   1 1 
        4  8564 1 1  92 SER CB   C  -5.190   3.721  -5.628 1.00 . A A .  92 SER CB   1 1 
        4  8565 1 1  92 SER H    H  -3.382   5.446  -6.518 1.00 . A A .  92 SER H    1 1 
        4  8566 1 1  92 SER HA   H  -4.766   3.065  -7.627 1.00 . A A .  92 SER HA   1 1 
        4  8567 1 1  92 SER HB2  H  -4.466   3.023  -5.236 1.00 . A A .  92 SER HB2  1 1 
        4  8568 1 1  92 SER HB3  H  -5.132   4.638  -5.055 1.00 . A A .  92 SER HB3  1 1 
        4  8569 1 1  92 SER HG   H  -6.549   2.362  -5.974 1.00 . A A .  92 SER HG   1 1 
        4  8570 1 1  92 SER N    N  -3.584   4.733  -7.171 1.00 . A A .  92 SER N    1 1 
        4  8571 1 1  92 SER O    O  -5.743   5.951  -8.224 1.00 . A A .  92 SER O    1 1 
        4  8572 1 1  92 SER OG   O  -6.472   3.163  -5.440 1.00 . A A .  92 SER OG   1 1 
        4  8573 1 1  93 ARG C    C  -8.877   5.858  -7.306 1.00 . A A .  93 ARG C    1 1 
        4  8574 1 1  93 ARG CA   C  -8.331   4.955  -8.428 1.00 . A A .  93 ARG CA   1 1 
        4  8575 1 1  93 ARG CB   C  -9.431   3.999  -8.980 1.00 . A A .  93 ARG CB   1 1 
        4  8576 1 1  93 ARG CD   C  -7.774   3.243 -10.867 1.00 . A A .  93 ARG CD   1 1 
        4  8577 1 1  93 ARG CG   C  -8.941   2.855  -9.927 1.00 . A A .  93 ARG CG   1 1 
        4  8578 1 1  93 ARG CZ   C  -7.110   5.018 -12.503 1.00 . A A .  93 ARG CZ   1 1 
        4  8579 1 1  93 ARG H    H  -7.220   3.255  -7.759 1.00 . A A .  93 ARG H    1 1 
        4  8580 1 1  93 ARG HA   H  -7.986   5.590  -9.246 1.00 . A A .  93 ARG HA   1 1 
        4  8581 1 1  93 ARG HB2  H  -9.940   3.532  -8.139 1.00 . A A .  93 ARG HB2  1 1 
        4  8582 1 1  93 ARG HB3  H -10.159   4.595  -9.523 1.00 . A A .  93 ARG HB3  1 1 
        4  8583 1 1  93 ARG HD2  H  -6.891   3.418 -10.263 1.00 . A A .  93 ARG HD2  1 1 
        4  8584 1 1  93 ARG HD3  H  -7.577   2.407 -11.533 1.00 . A A .  93 ARG HD3  1 1 
        4  8585 1 1  93 ARG HE   H  -8.909   4.864 -11.616 1.00 . A A .  93 ARG HE   1 1 
        4  8586 1 1  93 ARG HG2  H  -8.614   2.020  -9.315 1.00 . A A .  93 ARG HG2  1 1 
        4  8587 1 1  93 ARG HG3  H  -9.781   2.526 -10.534 1.00 . A A .  93 ARG HG3  1 1 
        4  8588 1 1  93 ARG HH11 H  -5.650   3.651 -12.161 1.00 . A A .  93 ARG HH11 1 1 
        4  8589 1 1  93 ARG HH12 H  -5.234   4.915 -13.269 1.00 . A A .  93 ARG HH12 1 1 
        4  8590 1 1  93 ARG HH21 H  -8.330   6.526 -13.081 1.00 . A A .  93 ARG HH21 1 1 
        4  8591 1 1  93 ARG HH22 H  -6.750   6.535 -13.791 1.00 . A A .  93 ARG HH22 1 1 
        4  8592 1 1  93 ARG N    N  -7.164   4.222  -7.928 1.00 . A A .  93 ARG N    1 1 
        4  8593 1 1  93 ARG NE   N  -8.020   4.448 -11.686 1.00 . A A .  93 ARG NE   1 1 
        4  8594 1 1  93 ARG NH1  N  -5.899   4.487 -12.655 1.00 . A A .  93 ARG NH1  1 1 
        4  8595 1 1  93 ARG NH2  N  -7.422   6.114 -13.178 1.00 . A A .  93 ARG NH2  1 1 
        4  8596 1 1  93 ARG O    O  -8.969   7.081  -7.469 1.00 . A A .  93 ARG O    1 1 
        4  8597 1 1  94 THR C    C  -8.534   6.481  -4.109 1.00 . A A .  94 THR C    1 1 
        4  8598 1 1  94 THR CA   C  -9.709   5.962  -4.973 1.00 . A A .  94 THR CA   1 1 
        4  8599 1 1  94 THR CB   C -10.637   5.049  -4.102 1.00 . A A .  94 THR CB   1 1 
        4  8600 1 1  94 THR CG2  C -11.474   5.874  -3.105 1.00 . A A .  94 THR CG2  1 1 
        4  8601 1 1  94 THR H    H  -9.167   4.260  -6.120 1.00 . A A .  94 THR H    1 1 
        4  8602 1 1  94 THR HA   H -10.298   6.812  -5.319 1.00 . A A .  94 THR HA   1 1 
        4  8603 1 1  94 THR HB   H -10.027   4.347  -3.543 1.00 . A A .  94 THR HB   1 1 
        4  8604 1 1  94 THR HG1  H -11.487   4.614  -5.849 1.00 . A A .  94 THR HG1  1 1 
        4  8605 1 1  94 THR HG21 H -12.103   5.214  -2.520 1.00 . A A .  94 THR HG21 1 1 
        4  8606 1 1  94 THR HG22 H -12.100   6.576  -3.642 1.00 . A A .  94 THR HG22 1 1 
        4  8607 1 1  94 THR HG23 H -10.818   6.419  -2.439 1.00 . A A .  94 THR HG23 1 1 
        4  8608 1 1  94 THR N    N  -9.221   5.237  -6.162 1.00 . A A .  94 THR N    1 1 
        4  8609 1 1  94 THR O    O  -8.437   7.670  -3.812 1.00 . A A .  94 THR O    1 1 
        4  8610 1 1  94 THR OG1  O -11.524   4.286  -4.940 1.00 . A A .  94 THR OG1  1 1 
        4  8611 1 1  95 ALA C    C  -5.285   6.514  -3.408 1.00 . A A .  95 ALA C    1 1 
        4  8612 1 1  95 ALA CA   C  -6.508   5.770  -2.795 1.00 . A A .  95 ALA CA   1 1 
        4  8613 1 1  95 ALA CB   C  -6.109   4.407  -2.196 1.00 . A A .  95 ALA CB   1 1 
        4  8614 1 1  95 ALA H    H  -7.680   4.682  -4.199 1.00 . A A .  95 ALA H    1 1 
        4  8615 1 1  95 ALA HA   H  -6.893   6.382  -1.986 1.00 . A A .  95 ALA HA   1 1 
        4  8616 1 1  95 ALA HB1  H  -6.981   3.929  -1.768 1.00 . A A .  95 ALA HB1  1 1 
        4  8617 1 1  95 ALA HB2  H  -5.369   4.548  -1.420 1.00 . A A .  95 ALA HB2  1 1 
        4  8618 1 1  95 ALA HB3  H  -5.697   3.769  -2.969 1.00 . A A .  95 ALA HB3  1 1 
        4  8619 1 1  95 ALA N    N  -7.621   5.560  -3.766 1.00 . A A .  95 ALA N    1 1 
        4  8620 1 1  95 ALA O    O  -4.212   6.555  -2.805 1.00 . A A .  95 ALA O    1 1 
        4  8621 1 1  96 ASP C    C  -3.092   7.851  -5.148 1.00 . A A .  96 ASP C    1 1 
        4  8622 1 1  96 ASP CA   C  -4.529   7.483  -5.610 1.00 . A A .  96 ASP CA   1 1 
        4  8623 1 1  96 ASP CB   C  -5.135   8.633  -6.461 1.00 . A A .  96 ASP CB   1 1 
        4  8624 1 1  96 ASP CG   C  -4.222   9.161  -7.576 1.00 . A A .  96 ASP CG   1 1 
        4  8625 1 1  96 ASP H    H  -6.439   7.464  -4.714 1.00 . A A .  96 ASP H    1 1 
        4  8626 1 1  96 ASP HA   H  -4.465   6.609  -6.242 1.00 . A A .  96 ASP HA   1 1 
        4  8627 1 1  96 ASP HB2  H  -6.053   8.274  -6.918 1.00 . A A .  96 ASP HB2  1 1 
        4  8628 1 1  96 ASP HB3  H  -5.389   9.455  -5.796 1.00 . A A .  96 ASP HB3  1 1 
        4  8629 1 1  96 ASP N    N  -5.519   7.162  -4.557 1.00 . A A .  96 ASP N    1 1 
        4  8630 1 1  96 ASP O    O  -2.149   7.099  -5.405 1.00 . A A .  96 ASP O    1 1 
        4  8631 1 1  96 ASP OD1  O  -4.020   8.451  -8.569 1.00 . A A .  96 ASP OD1  1 1 
        4  8632 1 1  96 ASP OD2  O  -3.706  10.292  -7.461 1.00 . A A .  96 ASP OD2  1 1 
        4  8633 1 1  97 SER C    C  -1.000   9.015  -2.846 1.00 . A A .  97 SER C    1 1 
        4  8634 1 1  97 SER CA   C  -1.622   9.564  -4.145 1.00 . A A .  97 SER CA   1 1 
        4  8635 1 1  97 SER CB   C  -1.768  11.102  -4.063 1.00 . A A .  97 SER CB   1 1 
        4  8636 1 1  97 SER H    H  -3.747   9.395  -4.105 1.00 . A A .  97 SER H    1 1 
        4  8637 1 1  97 SER HA   H  -0.950   9.330  -4.967 1.00 . A A .  97 SER HA   1 1 
        4  8638 1 1  97 SER HB2  H  -2.376  11.368  -3.204 1.00 . A A .  97 SER HB2  1 1 
        4  8639 1 1  97 SER HB3  H  -0.793  11.562  -3.961 1.00 . A A .  97 SER HB3  1 1 
        4  8640 1 1  97 SER HG   H  -2.340  10.974  -5.945 1.00 . A A .  97 SER HG   1 1 
        4  8641 1 1  97 SER N    N  -2.946   8.960  -4.441 1.00 . A A .  97 SER N    1 1 
        4  8642 1 1  97 SER O    O   0.163   9.303  -2.542 1.00 . A A .  97 SER O    1 1 
        4  8643 1 1  97 SER OG   O  -2.396  11.622  -5.231 1.00 . A A .  97 SER OG   1 1 
        4  8644 1 1  98 HIS C    C  -0.541   6.472  -0.791 1.00 . A A .  98 HIS C    1 1 
        4  8645 1 1  98 HIS CA   C  -1.373   7.771  -0.736 1.00 . A A .  98 HIS CA   1 1 
        4  8646 1 1  98 HIS CB   C  -2.609   7.562   0.174 1.00 . A A .  98 HIS CB   1 1 
        4  8647 1 1  98 HIS CD2  C  -3.639   9.919   0.588 1.00 . A A .  98 HIS CD2  1 1 
        4  8648 1 1  98 HIS CE1  C  -5.456   9.653  -0.607 1.00 . A A .  98 HIS CE1  1 1 
        4  8649 1 1  98 HIS CG   C  -3.623   8.660   0.084 1.00 . A A .  98 HIS CG   1 1 
        4  8650 1 1  98 HIS H    H  -2.677   8.014  -2.412 1.00 . A A .  98 HIS H    1 1 
        4  8651 1 1  98 HIS HA   H  -0.754   8.549  -0.286 1.00 . A A .  98 HIS HA   1 1 
        4  8652 1 1  98 HIS HB2  H  -3.106   6.637  -0.099 1.00 . A A .  98 HIS HB2  1 1 
        4  8653 1 1  98 HIS HB3  H  -2.286   7.491   1.207 1.00 . A A .  98 HIS HB3  1 1 
        4  8654 1 1  98 HIS HD1  H  -5.063   7.723  -1.121 1.00 . A A .  98 HIS HD1  1 1 
        4  8655 1 1  98 HIS HD2  H  -2.886  10.371   1.220 1.00 . A A .  98 HIS HD2  1 1 
        4  8656 1 1  98 HIS HE1  H  -6.399   9.842  -1.104 1.00 . A A .  98 HIS HE1  1 1 
        4  8657 1 1  98 HIS HE2  H  -5.149  11.369   0.455 1.00 . A A .  98 HIS HE2  1 1 
        4  8658 1 1  98 HIS N    N  -1.784   8.243  -2.078 1.00 . A A .  98 HIS N    1 1 
        4  8659 1 1  98 HIS ND1  N  -4.778   8.532  -0.653 1.00 . A A .  98 HIS ND1  1 1 
        4  8660 1 1  98 HIS NE2  N  -4.792  10.512   0.141 1.00 . A A .  98 HIS NE2  1 1 
        4  8661 1 1  98 HIS O    O   0.194   6.205   0.166 1.00 . A A .  98 HIS O    1 1 
        4  8662 1 1  99 LEU C    C   1.474   4.341  -1.710 1.00 . A A .  99 LEU C    1 1 
        4  8663 1 1  99 LEU CA   C  -0.050   4.320  -1.988 1.00 . A A .  99 LEU CA   1 1 
        4  8664 1 1  99 LEU CB   C  -0.275   3.660  -3.394 1.00 . A A .  99 LEU CB   1 1 
        4  8665 1 1  99 LEU CD1  C  -1.720   2.584  -5.197 1.00 . A A .  99 LEU CD1  1 1 
        4  8666 1 1  99 LEU CD2  C  -2.608   2.753  -2.837 1.00 . A A .  99 LEU CD2  1 1 
        4  8667 1 1  99 LEU CG   C  -1.731   3.424  -3.898 1.00 . A A .  99 LEU CG   1 1 
        4  8668 1 1  99 LEU H    H  -1.207   6.000  -2.646 1.00 . A A .  99 LEU H    1 1 
        4  8669 1 1  99 LEU HA   H  -0.527   3.698  -1.239 1.00 . A A .  99 LEU HA   1 1 
        4  8670 1 1  99 LEU HB2  H   0.221   4.286  -4.130 1.00 . A A .  99 LEU HB2  1 1 
        4  8671 1 1  99 LEU HB3  H   0.236   2.695  -3.392 1.00 . A A .  99 LEU HB3  1 1 
        4  8672 1 1  99 LEU HD11 H  -1.272   1.616  -5.008 1.00 . A A .  99 LEU HD11 1 1 
        4  8673 1 1  99 LEU HD12 H  -1.150   3.099  -5.959 1.00 . A A .  99 LEU HD12 1 1 
        4  8674 1 1  99 LEU HD13 H  -2.732   2.447  -5.548 1.00 . A A .  99 LEU HD13 1 1 
        4  8675 1 1  99 LEU HD21 H  -3.595   2.577  -3.242 1.00 . A A .  99 LEU HD21 1 1 
        4  8676 1 1  99 LEU HD22 H  -2.688   3.394  -1.972 1.00 . A A .  99 LEU HD22 1 1 
        4  8677 1 1  99 LEU HD23 H  -2.170   1.806  -2.543 1.00 . A A .  99 LEU HD23 1 1 
        4  8678 1 1  99 LEU HG   H  -2.180   4.384  -4.136 1.00 . A A .  99 LEU HG   1 1 
        4  8679 1 1  99 LEU N    N  -0.664   5.679  -1.901 1.00 . A A .  99 LEU N    1 1 
        4  8680 1 1  99 LEU O    O   1.914   4.082  -0.588 1.00 . A A .  99 LEU O    1 1 
        4  8681 1 1 100 GLY C    C   4.360   4.689  -3.992 1.00 . A A . 100 GLY C    1 1 
        4  8682 1 1 100 GLY CA   C   3.714   4.647  -2.631 1.00 . A A . 100 GLY CA   1 1 
        4  8683 1 1 100 GLY H    H   1.857   5.037  -3.567 1.00 . A A . 100 GLY H    1 1 
        4  8684 1 1 100 GLY HA2  H   4.076   5.483  -2.046 1.00 . A A . 100 GLY HA2  1 1 
        4  8685 1 1 100 GLY HA3  H   3.992   3.722  -2.134 1.00 . A A . 100 GLY HA3  1 1 
        4  8686 1 1 100 GLY N    N   2.266   4.732  -2.724 1.00 . A A . 100 GLY N    1 1 
        4  8687 1 1 100 GLY O    O   3.747   5.137  -4.973 1.00 . A A . 100 GLY O    1 1 
        4  8688 1 1 101 HIS C    C   7.180   3.019  -5.448 1.00 . A A . 101 HIS C    1 1 
        4  8689 1 1 101 HIS CA   C   6.453   4.344  -5.262 1.00 . A A . 101 HIS CA   1 1 
        4  8690 1 1 101 HIS CB   C   7.462   5.521  -5.135 1.00 . A A . 101 HIS CB   1 1 
        4  8691 1 1 101 HIS CD2  C   6.778   7.291  -3.352 1.00 . A A . 101 HIS CD2  1 1 
        4  8692 1 1 101 HIS CE1  C   5.575   8.585  -4.636 1.00 . A A . 101 HIS CE1  1 1 
        4  8693 1 1 101 HIS CG   C   6.834   6.786  -4.608 1.00 . A A . 101 HIS CG   1 1 
        4  8694 1 1 101 HIS H    H   5.992   3.766  -3.281 1.00 . A A . 101 HIS H    1 1 
        4  8695 1 1 101 HIS HA   H   5.808   4.513  -6.121 1.00 . A A . 101 HIS HA   1 1 
        4  8696 1 1 101 HIS HB2  H   8.263   5.244  -4.458 1.00 . A A . 101 HIS HB2  1 1 
        4  8697 1 1 101 HIS HB3  H   7.887   5.744  -6.109 1.00 . A A . 101 HIS HB3  1 1 
        4  8698 1 1 101 HIS HD1  H   5.927   7.534  -6.338 1.00 . A A . 101 HIS HD1  1 1 
        4  8699 1 1 101 HIS HD2  H   7.274   6.893  -2.481 1.00 . A A . 101 HIS HD2  1 1 
        4  8700 1 1 101 HIS HE1  H   4.935   9.383  -4.981 1.00 . A A . 101 HIS HE1  1 1 
        4  8701 1 1 101 HIS HE2  H   5.927   9.080  -2.691 1.00 . A A . 101 HIS HE2  1 1 
        4  8702 1 1 101 HIS N    N   5.618   4.238  -4.058 1.00 . A A . 101 HIS N    1 1 
        4  8703 1 1 101 HIS ND1  N   6.074   7.624  -5.383 1.00 . A A . 101 HIS ND1  1 1 
        4  8704 1 1 101 HIS NE2  N   5.984   8.406  -3.399 1.00 . A A . 101 HIS NE2  1 1 
        4  8705 1 1 101 HIS O    O   7.428   2.288  -4.478 1.00 . A A . 101 HIS O    1 1 
        4  8706 1 1 102 VAL C    C   9.368   1.687  -7.946 1.00 . A A . 102 VAL C    1 1 
        4  8707 1 1 102 VAL CA   C   8.143   1.432  -7.057 1.00 . A A . 102 VAL CA   1 1 
        4  8708 1 1 102 VAL CB   C   7.119   0.452  -7.746 1.00 . A A . 102 VAL CB   1 1 
        4  8709 1 1 102 VAL CG1  C   5.914   0.159  -6.832 1.00 . A A . 102 VAL CG1  1 1 
        4  8710 1 1 102 VAL CG2  C   6.631   0.987  -9.090 1.00 . A A . 102 VAL CG2  1 1 
        4  8711 1 1 102 VAL H    H   7.469   3.399  -7.382 1.00 . A A . 102 VAL H    1 1 
        4  8712 1 1 102 VAL HA   H   8.493   0.953  -6.138 1.00 . A A . 102 VAL HA   1 1 
        4  8713 1 1 102 VAL HB   H   7.633  -0.493  -7.926 1.00 . A A . 102 VAL HB   1 1 
        4  8714 1 1 102 VAL HG11 H   5.361   1.077  -6.654 1.00 . A A . 102 VAL HG11 1 1 
        4  8715 1 1 102 VAL HG12 H   6.251  -0.241  -5.887 1.00 . A A . 102 VAL HG12 1 1 
        4  8716 1 1 102 VAL HG13 H   5.261  -0.563  -7.309 1.00 . A A . 102 VAL HG13 1 1 
        4  8717 1 1 102 VAL HG21 H   6.157   1.952  -8.952 1.00 . A A . 102 VAL HG21 1 1 
        4  8718 1 1 102 VAL HG22 H   5.924   0.296  -9.533 1.00 . A A . 102 VAL HG22 1 1 
        4  8719 1 1 102 VAL HG23 H   7.479   1.100  -9.757 1.00 . A A . 102 VAL HG23 1 1 
        4  8720 1 1 102 VAL N    N   7.537   2.712  -6.695 1.00 . A A . 102 VAL N    1 1 
        4  8721 1 1 102 VAL O    O   9.339   2.507  -8.869 1.00 . A A . 102 VAL O    1 1 
        4  8722 1 1 103 PHE C    C  11.966   0.230  -9.411 1.00 . A A . 103 PHE C    1 1 
        4  8723 1 1 103 PHE CA   C  11.754   1.230  -8.279 1.00 . A A . 103 PHE CA   1 1 
        4  8724 1 1 103 PHE CB   C  12.895   1.109  -7.241 1.00 . A A . 103 PHE CB   1 1 
        4  8725 1 1 103 PHE CD1  C  13.115   3.378  -6.119 1.00 . A A . 103 PHE CD1  1 1 
        4  8726 1 1 103 PHE CD2  C  12.219   1.567  -4.830 1.00 . A A . 103 PHE CD2  1 1 
        4  8727 1 1 103 PHE CE1  C  12.975   4.218  -5.031 1.00 . A A . 103 PHE CE1  1 1 
        4  8728 1 1 103 PHE CE2  C  12.080   2.408  -3.744 1.00 . A A . 103 PHE CE2  1 1 
        4  8729 1 1 103 PHE CG   C  12.741   2.036  -6.038 1.00 . A A . 103 PHE CG   1 1 
        4  8730 1 1 103 PHE CZ   C  12.459   3.733  -3.843 1.00 . A A . 103 PHE CZ   1 1 
        4  8731 1 1 103 PHE H    H  10.381   0.296  -6.967 1.00 . A A . 103 PHE H    1 1 
        4  8732 1 1 103 PHE HA   H  11.761   2.238  -8.693 1.00 . A A . 103 PHE HA   1 1 
        4  8733 1 1 103 PHE HB2  H  12.942   0.087  -6.878 1.00 . A A . 103 PHE HB2  1 1 
        4  8734 1 1 103 PHE HB3  H  13.840   1.345  -7.723 1.00 . A A . 103 PHE HB3  1 1 
        4  8735 1 1 103 PHE HD1  H  13.523   3.765  -7.046 1.00 . A A . 103 PHE HD1  1 1 
        4  8736 1 1 103 PHE HD2  H  11.921   0.529  -4.746 1.00 . A A . 103 PHE HD2  1 1 
        4  8737 1 1 103 PHE HE1  H  13.271   5.256  -5.108 1.00 . A A . 103 PHE HE1  1 1 
        4  8738 1 1 103 PHE HE2  H  11.675   2.031  -2.815 1.00 . A A . 103 PHE HE2  1 1 
        4  8739 1 1 103 PHE HZ   H  12.349   4.392  -2.995 1.00 . A A . 103 PHE HZ   1 1 
        4  8740 1 1 103 PHE N    N  10.454   0.995  -7.641 1.00 . A A . 103 PHE N    1 1 
        4  8741 1 1 103 PHE O    O  11.491  -0.902  -9.344 1.00 . A A . 103 PHE O    1 1 
        4  8742 1 1 104 ASN C    C  14.402  -1.016 -11.203 1.00 . A A . 104 ASN C    1 1 
        4  8743 1 1 104 ASN CA   C  13.123  -0.216 -11.557 1.00 . A A . 104 ASN CA   1 1 
        4  8744 1 1 104 ASN CB   C  13.345   0.657 -12.834 1.00 . A A . 104 ASN CB   1 1 
        4  8745 1 1 104 ASN CG   C  12.133   1.527 -13.232 1.00 . A A . 104 ASN CG   1 1 
        4  8746 1 1 104 ASN H    H  13.057   1.569 -10.414 1.00 . A A . 104 ASN H    1 1 
        4  8747 1 1 104 ASN HA   H  12.316  -0.922 -11.747 1.00 . A A . 104 ASN HA   1 1 
        4  8748 1 1 104 ASN HB2  H  14.185   1.321 -12.667 1.00 . A A . 104 ASN HB2  1 1 
        4  8749 1 1 104 ASN HB3  H  13.584   0.004 -13.666 1.00 . A A . 104 ASN HB3  1 1 
        4  8750 1 1 104 ASN HD21 H  12.517   1.261 -15.163 1.00 . A A . 104 ASN HD21 1 1 
        4  8751 1 1 104 ASN HD22 H  11.141   2.239 -14.803 1.00 . A A . 104 ASN HD22 1 1 
        4  8752 1 1 104 ASN N    N  12.735   0.643 -10.422 1.00 . A A . 104 ASN N    1 1 
        4  8753 1 1 104 ASN ND2  N  11.909   1.693 -14.529 1.00 . A A . 104 ASN ND2  1 1 
        4  8754 1 1 104 ASN O    O  15.030  -1.631 -12.068 1.00 . A A . 104 ASN O    1 1 
        4  8755 1 1 104 ASN OD1  O  11.394   2.033 -12.384 1.00 . A A . 104 ASN OD1  1 1 
        4  8756 1 1 105 ASP C    C  15.680  -2.843  -8.503 1.00 . A A . 105 ASP C    1 1 
        4  8757 1 1 105 ASP CA   C  15.979  -1.581  -9.335 1.00 . A A . 105 ASP CA   1 1 
        4  8758 1 1 105 ASP CB   C  16.653  -0.504  -8.437 1.00 . A A . 105 ASP CB   1 1 
        4  8759 1 1 105 ASP CG   C  16.867   0.836  -9.157 1.00 . A A . 105 ASP CG   1 1 
        4  8760 1 1 105 ASP H    H  14.117  -0.614  -9.274 1.00 . A A . 105 ASP H    1 1 
        4  8761 1 1 105 ASP HA   H  16.654  -1.844 -10.146 1.00 . A A . 105 ASP HA   1 1 
        4  8762 1 1 105 ASP HB2  H  16.032  -0.329  -7.559 1.00 . A A . 105 ASP HB2  1 1 
        4  8763 1 1 105 ASP HB3  H  17.618  -0.881  -8.099 1.00 . A A . 105 ASP HB3  1 1 
        4  8764 1 1 105 ASP N    N  14.738  -1.022  -9.896 1.00 . A A . 105 ASP N    1 1 
        4  8765 1 1 105 ASP O    O  16.442  -3.196  -7.595 1.00 . A A . 105 ASP O    1 1 
        4  8766 1 1 105 ASP OD1  O  15.929   1.667  -9.181 1.00 . A A . 105 ASP OD1  1 1 
        4  8767 1 1 105 ASP OD2  O  17.958   1.062  -9.715 1.00 . A A . 105 ASP OD2  1 1 
        4  8768 1 1 106 GLY C    C  13.206  -5.579  -8.944 1.00 . A A . 106 GLY C    1 1 
        4  8769 1 1 106 GLY CA   C  14.165  -4.735  -8.115 1.00 . A A . 106 GLY CA   1 1 
        4  8770 1 1 106 GLY H    H  14.020  -3.193  -9.573 1.00 . A A . 106 GLY H    1 1 
        4  8771 1 1 106 GLY HA2  H  15.046  -5.322  -7.878 1.00 . A A . 106 GLY HA2  1 1 
        4  8772 1 1 106 GLY HA3  H  13.674  -4.453  -7.194 1.00 . A A . 106 GLY HA3  1 1 
        4  8773 1 1 106 GLY N    N  14.571  -3.518  -8.825 1.00 . A A . 106 GLY N    1 1 
        4  8774 1 1 106 GLY O    O  12.503  -5.028  -9.789 1.00 . A A . 106 GLY O    1 1 
        4  8775 1 1 107 PRO C    C  10.827  -7.879  -8.997 1.00 . A A . 107 PRO C    1 1 
        4  8776 1 1 107 PRO CA   C  12.285  -7.831  -9.524 1.00 . A A . 107 PRO CA   1 1 
        4  8777 1 1 107 PRO CB   C  13.007  -9.191  -9.373 1.00 . A A . 107 PRO CB   1 1 
        4  8778 1 1 107 PRO CD   C  13.937  -7.686  -7.710 1.00 . A A . 107 PRO CD   1 1 
        4  8779 1 1 107 PRO CG   C  13.606  -9.151  -7.991 1.00 . A A . 107 PRO CG   1 1 
        4  8780 1 1 107 PRO HA   H  12.275  -7.542 -10.572 1.00 . A A . 107 PRO HA   1 1 
        4  8781 1 1 107 PRO HB2  H  12.298 -10.008  -9.484 1.00 . A A . 107 PRO HB2  1 1 
        4  8782 1 1 107 PRO HB3  H  13.773  -9.282 -10.137 1.00 . A A . 107 PRO HB3  1 1 
        4  8783 1 1 107 PRO HD2  H  13.631  -7.409  -6.708 1.00 . A A . 107 PRO HD2  1 1 
        4  8784 1 1 107 PRO HD3  H  15.000  -7.507  -7.836 1.00 . A A . 107 PRO HD3  1 1 
        4  8785 1 1 107 PRO HG2  H  12.888  -9.526  -7.265 1.00 . A A . 107 PRO HG2  1 1 
        4  8786 1 1 107 PRO HG3  H  14.506  -9.757  -7.958 1.00 . A A . 107 PRO HG3  1 1 
        4  8787 1 1 107 PRO N    N  13.152  -6.929  -8.732 1.00 . A A . 107 PRO N    1 1 
        4  8788 1 1 107 PRO O    O  10.587  -7.848  -7.781 1.00 . A A . 107 PRO O    1 1 
        4  8789 1 1 108 GLY C    C   7.564  -8.277 -10.825 1.00 . A A . 108 GLY C    1 1 
        4  8790 1 1 108 GLY CA   C   8.440  -8.030  -9.596 1.00 . A A . 108 GLY CA   1 1 
        4  8791 1 1 108 GLY H    H  10.124  -7.940 -10.879 1.00 . A A . 108 GLY H    1 1 
        4  8792 1 1 108 GLY HA2  H   8.282  -8.839  -8.889 1.00 . A A . 108 GLY HA2  1 1 
        4  8793 1 1 108 GLY HA3  H   8.143  -7.098  -9.134 1.00 . A A . 108 GLY HA3  1 1 
        4  8794 1 1 108 GLY N    N   9.862  -7.951  -9.934 1.00 . A A . 108 GLY N    1 1 
        4  8795 1 1 108 GLY O    O   8.083  -8.746 -11.845 1.00 . A A . 108 GLY O    1 1 
        4  8796 1 1 109 PRO C    C   5.768  -7.570 -13.245 1.00 . A A . 109 PRO C    1 1 
        4  8797 1 1 109 PRO CA   C   5.262  -8.137 -11.891 1.00 . A A . 109 PRO CA   1 1 
        4  8798 1 1 109 PRO CB   C   4.015  -7.356 -11.399 1.00 . A A . 109 PRO CB   1 1 
        4  8799 1 1 109 PRO CD   C   5.529  -7.439  -9.542 1.00 . A A . 109 PRO CD   1 1 
        4  8800 1 1 109 PRO CG   C   4.062  -7.474  -9.910 1.00 . A A . 109 PRO CG   1 1 
        4  8801 1 1 109 PRO HA   H   5.005  -9.182 -12.023 1.00 . A A . 109 PRO HA   1 1 
        4  8802 1 1 109 PRO HB2  H   4.075  -6.315 -11.714 1.00 . A A . 109 PRO HB2  1 1 
        4  8803 1 1 109 PRO HB3  H   3.114  -7.800 -11.805 1.00 . A A . 109 PRO HB3  1 1 
        4  8804 1 1 109 PRO HD2  H   5.847  -6.422  -9.326 1.00 . A A . 109 PRO HD2  1 1 
        4  8805 1 1 109 PRO HD3  H   5.721  -8.073  -8.685 1.00 . A A . 109 PRO HD3  1 1 
        4  8806 1 1 109 PRO HG2  H   3.533  -6.641  -9.456 1.00 . A A . 109 PRO HG2  1 1 
        4  8807 1 1 109 PRO HG3  H   3.612  -8.412  -9.593 1.00 . A A . 109 PRO HG3  1 1 
        4  8808 1 1 109 PRO N    N   6.223  -7.965 -10.757 1.00 . A A . 109 PRO N    1 1 
        4  8809 1 1 109 PRO O    O   5.752  -8.250 -14.274 1.00 . A A . 109 PRO O    1 1 
        4  8810 1 1 110 ASN C    C   8.332  -5.614 -14.357 1.00 . A A . 110 ASN C    1 1 
        4  8811 1 1 110 ASN CA   C   6.783  -5.615 -14.403 1.00 . A A . 110 ASN CA   1 1 
        4  8812 1 1 110 ASN CB   C   6.219  -4.163 -14.436 1.00 . A A . 110 ASN CB   1 1 
        4  8813 1 1 110 ASN CG   C   6.705  -3.297 -15.607 1.00 . A A . 110 ASN CG   1 1 
        4  8814 1 1 110 ASN H    H   6.213  -5.839 -12.361 1.00 . A A . 110 ASN H    1 1 
        4  8815 1 1 110 ASN HA   H   6.463  -6.142 -15.297 1.00 . A A . 110 ASN HA   1 1 
        4  8816 1 1 110 ASN HB2  H   5.144  -4.210 -14.505 1.00 . A A . 110 ASN HB2  1 1 
        4  8817 1 1 110 ASN HB3  H   6.482  -3.671 -13.503 1.00 . A A . 110 ASN HB3  1 1 
        4  8818 1 1 110 ASN HD21 H   6.558  -1.676 -14.492 1.00 . A A . 110 ASN HD21 1 1 
        4  8819 1 1 110 ASN HD22 H   7.185  -1.433 -16.067 1.00 . A A . 110 ASN HD22 1 1 
        4  8820 1 1 110 ASN N    N   6.228  -6.315 -13.216 1.00 . A A . 110 ASN N    1 1 
        4  8821 1 1 110 ASN ND2  N   6.812  -2.001 -15.371 1.00 . A A . 110 ASN ND2  1 1 
        4  8822 1 1 110 ASN O    O   9.000  -5.208 -15.313 1.00 . A A . 110 ASN O    1 1 
        4  8823 1 1 110 ASN OD1  O   6.984  -3.789 -16.707 1.00 . A A . 110 ASN OD1  1 1 
        4  8824 1 1 111 GLY C    C  10.536  -4.680 -12.148 1.00 . A A . 111 GLY C    1 1 
        4  8825 1 1 111 GLY CA   C  10.312  -5.957 -12.938 1.00 . A A . 111 GLY CA   1 1 
        4  8826 1 1 111 GLY H    H   8.320  -6.613 -12.621 1.00 . A A . 111 GLY H    1 1 
        4  8827 1 1 111 GLY HA2  H  10.633  -6.802 -12.344 1.00 . A A . 111 GLY HA2  1 1 
        4  8828 1 1 111 GLY HA3  H  10.896  -5.925 -13.851 1.00 . A A . 111 GLY HA3  1 1 
        4  8829 1 1 111 GLY N    N   8.891  -6.122 -13.249 1.00 . A A . 111 GLY N    1 1 
        4  8830 1 1 111 GLY O    O  11.531  -3.968 -12.338 1.00 . A A . 111 GLY O    1 1 
        4  8831 1 1 112 LEU C    C   9.649  -3.750  -8.905 1.00 . A A . 112 LEU C    1 1 
        4  8832 1 1 112 LEU CA   C   9.593  -3.240 -10.352 1.00 . A A . 112 LEU CA   1 1 
        4  8833 1 1 112 LEU CB   C   8.375  -2.319 -10.559 1.00 . A A . 112 LEU CB   1 1 
        4  8834 1 1 112 LEU CD1  C   6.929  -0.938 -12.132 1.00 . A A . 112 LEU CD1  1 1 
        4  8835 1 1 112 LEU CD2  C   9.431  -0.666 -12.184 1.00 . A A . 112 LEU CD2  1 1 
        4  8836 1 1 112 LEU CG   C   8.270  -1.647 -11.960 1.00 . A A . 112 LEU CG   1 1 
        4  8837 1 1 112 LEU H    H   8.793  -4.980 -11.241 1.00 . A A . 112 LEU H    1 1 
        4  8838 1 1 112 LEU HA   H  10.499  -2.668 -10.544 1.00 . A A . 112 LEU HA   1 1 
        4  8839 1 1 112 LEU HB2  H   7.479  -2.904 -10.389 1.00 . A A . 112 LEU HB2  1 1 
        4  8840 1 1 112 LEU HB3  H   8.408  -1.531  -9.808 1.00 . A A . 112 LEU HB3  1 1 
        4  8841 1 1 112 LEU HD11 H   6.121  -1.646 -12.005 1.00 . A A . 112 LEU HD11 1 1 
        4  8842 1 1 112 LEU HD12 H   6.871  -0.512 -13.126 1.00 . A A . 112 LEU HD12 1 1 
        4  8843 1 1 112 LEU HD13 H   6.831  -0.144 -11.403 1.00 . A A . 112 LEU HD13 1 1 
        4  8844 1 1 112 LEU HD21 H   9.422   0.093 -11.407 1.00 . A A . 112 LEU HD21 1 1 
        4  8845 1 1 112 LEU HD22 H   9.332  -0.190 -13.151 1.00 . A A . 112 LEU HD22 1 1 
        4  8846 1 1 112 LEU HD23 H  10.369  -1.201 -12.149 1.00 . A A . 112 LEU HD23 1 1 
        4  8847 1 1 112 LEU HG   H   8.332  -2.414 -12.727 1.00 . A A . 112 LEU HG   1 1 
        4  8848 1 1 112 LEU N    N   9.553  -4.373 -11.289 1.00 . A A . 112 LEU N    1 1 
        4  8849 1 1 112 LEU O    O   9.430  -4.939  -8.646 1.00 . A A . 112 LEU O    1 1 
        4  8850 1 1 113 ARG C    C   8.967  -2.400  -5.767 1.00 . A A . 113 ARG C    1 1 
        4  8851 1 1 113 ARG CA   C  10.055  -3.153  -6.545 1.00 . A A . 113 ARG CA   1 1 
        4  8852 1 1 113 ARG CB   C  11.506  -2.774  -6.097 1.00 . A A . 113 ARG CB   1 1 
        4  8853 1 1 113 ARG CD   C  11.410  -2.118  -3.597 1.00 . A A . 113 ARG CD   1 1 
        4  8854 1 1 113 ARG CG   C  11.904  -3.138  -4.637 1.00 . A A . 113 ARG CG   1 1 
        4  8855 1 1 113 ARG CZ   C  12.697  -1.595  -1.525 1.00 . A A . 113 ARG CZ   1 1 
        4  8856 1 1 113 ARG H    H   9.964  -1.888  -8.249 1.00 . A A . 113 ARG H    1 1 
        4  8857 1 1 113 ARG HA   H   9.914  -4.223  -6.406 1.00 . A A . 113 ARG HA   1 1 
        4  8858 1 1 113 ARG HB2  H  12.201  -3.279  -6.760 1.00 . A A . 113 ARG HB2  1 1 
        4  8859 1 1 113 ARG HB3  H  11.639  -1.703  -6.232 1.00 . A A . 113 ARG HB3  1 1 
        4  8860 1 1 113 ARG HD2  H  11.741  -1.128  -3.896 1.00 . A A . 113 ARG HD2  1 1 
        4  8861 1 1 113 ARG HD3  H  10.325  -2.128  -3.588 1.00 . A A . 113 ARG HD3  1 1 
        4  8862 1 1 113 ARG HE   H  11.549  -3.220  -1.806 1.00 . A A . 113 ARG HE   1 1 
        4  8863 1 1 113 ARG HG2  H  11.493  -4.109  -4.390 1.00 . A A . 113 ARG HG2  1 1 
        4  8864 1 1 113 ARG HG3  H  12.987  -3.193  -4.575 1.00 . A A . 113 ARG HG3  1 1 
        4  8865 1 1 113 ARG HH11 H  13.051  -0.285  -3.038 1.00 . A A . 113 ARG HH11 1 1 
        4  8866 1 1 113 ARG HH12 H  13.856   0.073  -1.548 1.00 . A A . 113 ARG HH12 1 1 
        4  8867 1 1 113 ARG HH21 H  12.579  -2.703   0.161 1.00 . A A . 113 ARG HH21 1 1 
        4  8868 1 1 113 ARG HH22 H  13.585  -1.297   0.260 1.00 . A A . 113 ARG HH22 1 1 
        4  8869 1 1 113 ARG N    N   9.901  -2.834  -7.969 1.00 . A A . 113 ARG N    1 1 
        4  8870 1 1 113 ARG NE   N  11.887  -2.400  -2.233 1.00 . A A . 113 ARG NE   1 1 
        4  8871 1 1 113 ARG NH1  N  13.242  -0.514  -2.083 1.00 . A A . 113 ARG NH1  1 1 
        4  8872 1 1 113 ARG NH2  N  12.975  -1.887  -0.269 1.00 . A A . 113 ARG NH2  1 1 
        4  8873 1 1 113 ARG O    O   9.048  -1.176  -5.638 1.00 . A A . 113 ARG O    1 1 
        4  8874 1 1 114 TYR C    C   7.134  -2.101  -3.157 1.00 . A A . 114 TYR C    1 1 
        4  8875 1 1 114 TYR CA   C   6.778  -2.539  -4.593 1.00 . A A . 114 TYR CA   1 1 
        4  8876 1 1 114 TYR CB   C   5.599  -3.561  -4.635 1.00 . A A . 114 TYR CB   1 1 
        4  8877 1 1 114 TYR CD1  C   3.560  -2.069  -5.061 1.00 . A A . 114 TYR CD1  1 1 
        4  8878 1 1 114 TYR CD2  C   3.533  -3.457  -3.116 1.00 . A A . 114 TYR CD2  1 1 
        4  8879 1 1 114 TYR CE1  C   2.303  -1.591  -4.736 1.00 . A A . 114 TYR CE1  1 1 
        4  8880 1 1 114 TYR CE2  C   2.275  -2.982  -2.794 1.00 . A A . 114 TYR CE2  1 1 
        4  8881 1 1 114 TYR CG   C   4.208  -3.014  -4.256 1.00 . A A . 114 TYR CG   1 1 
        4  8882 1 1 114 TYR CZ   C   1.664  -2.048  -3.604 1.00 . A A . 114 TYR CZ   1 1 
        4  8883 1 1 114 TYR H    H   8.038  -4.115  -5.267 1.00 . A A . 114 TYR H    1 1 
        4  8884 1 1 114 TYR HA   H   6.493  -1.661  -5.164 1.00 . A A . 114 TYR HA   1 1 
        4  8885 1 1 114 TYR HB2  H   5.520  -3.952  -5.642 1.00 . A A . 114 TYR HB2  1 1 
        4  8886 1 1 114 TYR HB3  H   5.832  -4.390  -3.973 1.00 . A A . 114 TYR HB3  1 1 
        4  8887 1 1 114 TYR HD1  H   4.058  -1.706  -5.953 1.00 . A A . 114 TYR HD1  1 1 
        4  8888 1 1 114 TYR HD2  H   4.008  -4.186  -2.472 1.00 . A A . 114 TYR HD2  1 1 
        4  8889 1 1 114 TYR HE1  H   1.826  -0.855  -5.372 1.00 . A A . 114 TYR HE1  1 1 
        4  8890 1 1 114 TYR HE2  H   1.777  -3.341  -1.901 1.00 . A A . 114 TYR HE2  1 1 
        4  8891 1 1 114 TYR HH   H   0.386  -1.351  -2.343 1.00 . A A . 114 TYR HH   1 1 
        4  8892 1 1 114 TYR N    N   7.967  -3.135  -5.240 1.00 . A A . 114 TYR N    1 1 
        4  8893 1 1 114 TYR O    O   7.175  -2.929  -2.245 1.00 . A A . 114 TYR O    1 1 
        4  8894 1 1 114 TYR OH   O   0.414  -1.569  -3.280 1.00 . A A . 114 TYR OH   1 1 
        4  8895 1 1 115 CYS C    C   6.893   0.790  -1.190 1.00 . A A . 115 CYS C    1 1 
        4  8896 1 1 115 CYS CA   C   7.903  -0.242  -1.695 1.00 . A A . 115 CYS CA   1 1 
        4  8897 1 1 115 CYS CB   C   9.300   0.389  -1.863 1.00 . A A . 115 CYS CB   1 1 
        4  8898 1 1 115 CYS H    H   7.315  -0.169  -3.730 1.00 . A A . 115 CYS H    1 1 
        4  8899 1 1 115 CYS HA   H   7.974  -1.056  -0.969 1.00 . A A . 115 CYS HA   1 1 
        4  8900 1 1 115 CYS HB2  H   9.971  -0.346  -2.282 1.00 . A A . 115 CYS HB2  1 1 
        4  8901 1 1 115 CYS HB3  H   9.240   1.234  -2.537 1.00 . A A . 115 CYS HB3  1 1 
        4  8902 1 1 115 CYS HG   H   9.511   0.260   0.671 1.00 . A A . 115 CYS HG   1 1 
        4  8903 1 1 115 CYS N    N   7.433  -0.793  -2.977 1.00 . A A . 115 CYS N    1 1 
        4  8904 1 1 115 CYS O    O   6.795   1.903  -1.722 1.00 . A A . 115 CYS O    1 1 
        4  8905 1 1 115 CYS SG   S  10.041   0.967  -0.319 1.00 . A A . 115 CYS SG   1 1 
        4  8906 1 1 116 ILE C    C   5.424   1.571   1.845 1.00 . A A . 116 ILE C    1 1 
        4  8907 1 1 116 ILE CA   C   5.050   1.221   0.400 1.00 . A A . 116 ILE CA   1 1 
        4  8908 1 1 116 ILE CB   C   3.668   0.470   0.356 1.00 . A A . 116 ILE CB   1 1 
        4  8909 1 1 116 ILE CD1  C   3.297   0.977  -2.170 1.00 . A A . 116 ILE CD1  1 1 
        4  8910 1 1 116 ILE CG1  C   3.369  -0.074  -1.072 1.00 . A A . 116 ILE CG1  1 1 
        4  8911 1 1 116 ILE CG2  C   2.517   1.380   0.831 1.00 . A A . 116 ILE CG2  1 1 
        4  8912 1 1 116 ILE H    H   6.272  -0.492   0.205 1.00 . A A . 116 ILE H    1 1 
        4  8913 1 1 116 ILE HA   H   4.961   2.144  -0.177 1.00 . A A . 116 ILE HA   1 1 
        4  8914 1 1 116 ILE HB   H   3.722  -0.375   1.038 1.00 . A A . 116 ILE HB   1 1 
        4  8915 1 1 116 ILE HD11 H   3.056   0.497  -3.108 1.00 . A A . 116 ILE HD11 1 1 
        4  8916 1 1 116 ILE HD12 H   4.253   1.477  -2.260 1.00 . A A . 116 ILE HD12 1 1 
        4  8917 1 1 116 ILE HD13 H   2.532   1.702  -1.933 1.00 . A A . 116 ILE HD13 1 1 
        4  8918 1 1 116 ILE HG12 H   4.144  -0.774  -1.354 1.00 . A A . 116 ILE HG12 1 1 
        4  8919 1 1 116 ILE HG13 H   2.420  -0.599  -1.061 1.00 . A A . 116 ILE HG13 1 1 
        4  8920 1 1 116 ILE HG21 H   1.577   0.850   0.763 1.00 . A A . 116 ILE HG21 1 1 
        4  8921 1 1 116 ILE HG22 H   2.471   2.262   0.211 1.00 . A A . 116 ILE HG22 1 1 
        4  8922 1 1 116 ILE HG23 H   2.684   1.678   1.860 1.00 . A A . 116 ILE HG23 1 1 
        4  8923 1 1 116 ILE N    N   6.113   0.395  -0.181 1.00 . A A . 116 ILE N    1 1 
        4  8924 1 1 116 ILE O    O   6.164   0.832   2.488 1.00 . A A . 116 ILE O    1 1 
        4  8925 1 1 117 ASN C    C   4.113   2.585   4.675 1.00 . A A . 117 ASN C    1 1 
        4  8926 1 1 117 ASN CA   C   5.157   3.176   3.707 1.00 . A A . 117 ASN CA   1 1 
        4  8927 1 1 117 ASN CB   C   5.125   4.720   3.723 1.00 . A A . 117 ASN CB   1 1 
        4  8928 1 1 117 ASN CG   C   3.770   5.303   3.309 1.00 . A A . 117 ASN CG   1 1 
        4  8929 1 1 117 ASN H    H   4.336   3.237   1.752 1.00 . A A . 117 ASN H    1 1 
        4  8930 1 1 117 ASN HA   H   6.149   2.842   4.017 1.00 . A A . 117 ASN HA   1 1 
        4  8931 1 1 117 ASN HB2  H   5.355   5.069   4.726 1.00 . A A . 117 ASN HB2  1 1 
        4  8932 1 1 117 ASN HB3  H   5.882   5.098   3.047 1.00 . A A . 117 ASN HB3  1 1 
        4  8933 1 1 117 ASN HD21 H   4.251   5.207   1.379 1.00 . A A . 117 ASN HD21 1 1 
        4  8934 1 1 117 ASN HD22 H   2.686   5.847   1.729 1.00 . A A . 117 ASN HD22 1 1 
        4  8935 1 1 117 ASN N    N   4.914   2.701   2.335 1.00 . A A . 117 ASN N    1 1 
        4  8936 1 1 117 ASN ND2  N   3.548   5.464   2.007 1.00 . A A . 117 ASN ND2  1 1 
        4  8937 1 1 117 ASN O    O   3.012   2.217   4.253 1.00 . A A . 117 ASN O    1 1 
        4  8938 1 1 117 ASN OD1  O   2.931   5.595   4.152 1.00 . A A . 117 ASN OD1  1 1 
        4  8939 1 1 118 SER C    C   2.389   2.770   7.364 1.00 . A A . 118 SER C    1 1 
        4  8940 1 1 118 SER CA   C   3.617   1.893   7.011 1.00 . A A . 118 SER CA   1 1 
        4  8941 1 1 118 SER CB   C   4.459   1.613   8.281 1.00 . A A . 118 SER CB   1 1 
        4  8942 1 1 118 SER H    H   5.289   2.974   6.260 1.00 . A A . 118 SER H    1 1 
        4  8943 1 1 118 SER HA   H   3.262   0.945   6.614 1.00 . A A . 118 SER HA   1 1 
        4  8944 1 1 118 SER HB2  H   4.681   2.546   8.789 1.00 . A A . 118 SER HB2  1 1 
        4  8945 1 1 118 SER HB3  H   3.903   0.968   8.952 1.00 . A A . 118 SER HB3  1 1 
        4  8946 1 1 118 SER HG   H   6.345   1.642   7.719 1.00 . A A . 118 SER HG   1 1 
        4  8947 1 1 118 SER N    N   4.458   2.535   5.977 1.00 . A A . 118 SER N    1 1 
        4  8948 1 1 118 SER O    O   1.360   2.248   7.818 1.00 . A A . 118 SER O    1 1 
        4  8949 1 1 118 SER OG   O   5.690   0.975   7.959 1.00 . A A . 118 SER OG   1 1 
        4  8950 1 1 119 ALA C    C   0.259   4.910   6.500 1.00 . A A . 119 ALA C    1 1 
        4  8951 1 1 119 ALA CA   C   1.459   5.081   7.431 1.00 . A A . 119 ALA CA   1 1 
        4  8952 1 1 119 ALA CB   C   2.009   6.513   7.321 1.00 . A A . 119 ALA CB   1 1 
        4  8953 1 1 119 ALA H    H   3.357   4.422   6.745 1.00 . A A . 119 ALA H    1 1 
        4  8954 1 1 119 ALA HA   H   1.132   4.923   8.458 1.00 . A A . 119 ALA HA   1 1 
        4  8955 1 1 119 ALA HB1  H   2.340   6.704   6.307 1.00 . A A . 119 ALA HB1  1 1 
        4  8956 1 1 119 ALA HB2  H   2.845   6.625   7.995 1.00 . A A . 119 ALA HB2  1 1 
        4  8957 1 1 119 ALA HB3  H   1.242   7.229   7.586 1.00 . A A . 119 ALA HB3  1 1 
        4  8958 1 1 119 ALA N    N   2.516   4.096   7.135 1.00 . A A . 119 ALA N    1 1 
        4  8959 1 1 119 ALA O    O  -0.883   5.082   6.930 1.00 . A A . 119 ALA O    1 1 
        4  8960 1 1 120 ALA C    C  -1.372   3.167   4.493 1.00 . A A . 120 ALA C    1 1 
        4  8961 1 1 120 ALA CA   C  -0.495   4.390   4.193 1.00 . A A . 120 ALA CA   1 1 
        4  8962 1 1 120 ALA CB   C   0.152   4.256   2.808 1.00 . A A . 120 ALA CB   1 1 
        4  8963 1 1 120 ALA H    H   1.482   4.376   4.986 1.00 . A A . 120 ALA H    1 1 
        4  8964 1 1 120 ALA HA   H  -1.116   5.281   4.196 1.00 . A A . 120 ALA HA   1 1 
        4  8965 1 1 120 ALA HB1  H   0.778   3.371   2.779 1.00 . A A . 120 ALA HB1  1 1 
        4  8966 1 1 120 ALA HB2  H   0.761   5.128   2.605 1.00 . A A . 120 ALA HB2  1 1 
        4  8967 1 1 120 ALA HB3  H  -0.615   4.174   2.047 1.00 . A A . 120 ALA HB3  1 1 
        4  8968 1 1 120 ALA N    N   0.543   4.557   5.229 1.00 . A A . 120 ALA N    1 1 
        4  8969 1 1 120 ALA O    O  -2.570   3.136   4.188 1.00 . A A . 120 ALA O    1 1 
        4  8970 1 1 121 LEU C    C  -2.052   0.647   6.596 1.00 . A A . 121 LEU C    1 1 
        4  8971 1 1 121 LEU CA   C  -1.308   0.837   5.280 1.00 . A A . 121 LEU CA   1 1 
        4  8972 1 1 121 LEU CB   C  -0.168  -0.192   5.154 1.00 . A A . 121 LEU CB   1 1 
        4  8973 1 1 121 LEU CD1  C   1.797  -1.105   3.802 1.00 . A A . 121 LEU CD1  1 1 
        4  8974 1 1 121 LEU CD2  C  -0.179  -0.012   2.606 1.00 . A A . 121 LEU CD2  1 1 
        4  8975 1 1 121 LEU CG   C   0.699  -0.038   3.874 1.00 . A A . 121 LEU CG   1 1 
        4  8976 1 1 121 LEU H    H   0.106   2.365   5.560 1.00 . A A . 121 LEU H    1 1 
        4  8977 1 1 121 LEU HA   H  -2.006   0.673   4.458 1.00 . A A . 121 LEU HA   1 1 
        4  8978 1 1 121 LEU HB2  H   0.480  -0.098   6.022 1.00 . A A . 121 LEU HB2  1 1 
        4  8979 1 1 121 LEU HB3  H  -0.599  -1.191   5.155 1.00 . A A . 121 LEU HB3  1 1 
        4  8980 1 1 121 LEU HD11 H   1.354  -2.094   3.793 1.00 . A A . 121 LEU HD11 1 1 
        4  8981 1 1 121 LEU HD12 H   2.443  -1.004   4.664 1.00 . A A . 121 LEU HD12 1 1 
        4  8982 1 1 121 LEU HD13 H   2.382  -0.957   2.905 1.00 . A A . 121 LEU HD13 1 1 
        4  8983 1 1 121 LEU HD21 H  -0.802  -0.898   2.561 1.00 . A A . 121 LEU HD21 1 1 
        4  8984 1 1 121 LEU HD22 H   0.454   0.033   1.728 1.00 . A A . 121 LEU HD22 1 1 
        4  8985 1 1 121 LEU HD23 H  -0.803   0.870   2.624 1.00 . A A . 121 LEU HD23 1 1 
        4  8986 1 1 121 LEU HG   H   1.207   0.919   3.924 1.00 . A A . 121 LEU HG   1 1 
        4  8987 1 1 121 LEU N    N  -0.756   2.178   5.144 1.00 . A A . 121 LEU N    1 1 
        4  8988 1 1 121 LEU O    O  -1.773   1.312   7.596 1.00 . A A . 121 LEU O    1 1 
        4  8989 1 1 122 ARG C    C  -3.856  -2.231   7.680 1.00 . A A . 122 ARG C    1 1 
        4  8990 1 1 122 ARG CA   C  -3.795  -0.713   7.703 1.00 . A A . 122 ARG CA   1 1 
        4  8991 1 1 122 ARG CB   C  -5.230  -0.128   7.610 1.00 . A A . 122 ARG CB   1 1 
        4  8992 1 1 122 ARG CD   C  -7.445   0.456   8.752 1.00 . A A . 122 ARG CD   1 1 
        4  8993 1 1 122 ARG CG   C  -6.061  -0.203   8.909 1.00 . A A . 122 ARG CG   1 1 
        4  8994 1 1 122 ARG CZ   C  -9.316   1.240  10.221 1.00 . A A . 122 ARG CZ   1 1 
        4  8995 1 1 122 ARG H    H  -3.147  -0.742   5.698 1.00 . A A . 122 ARG H    1 1 
        4  8996 1 1 122 ARG HA   H  -3.317  -0.374   8.623 1.00 . A A . 122 ARG HA   1 1 
        4  8997 1 1 122 ARG HB2  H  -5.153   0.910   7.326 1.00 . A A . 122 ARG HB2  1 1 
        4  8998 1 1 122 ARG HB3  H  -5.772  -0.648   6.825 1.00 . A A . 122 ARG HB3  1 1 
        4  8999 1 1 122 ARG HD2  H  -7.324   1.418   8.265 1.00 . A A . 122 ARG HD2  1 1 
        4  9000 1 1 122 ARG HD3  H  -8.069  -0.180   8.131 1.00 . A A . 122 ARG HD3  1 1 
        4  9001 1 1 122 ARG HE   H  -7.614   0.394  10.852 1.00 . A A . 122 ARG HE   1 1 
        4  9002 1 1 122 ARG HG2  H  -6.196  -1.245   9.180 1.00 . A A . 122 ARG HG2  1 1 
        4  9003 1 1 122 ARG HG3  H  -5.516   0.302   9.701 1.00 . A A . 122 ARG HG3  1 1 
        4  9004 1 1 122 ARG HH11 H  -9.746   1.442   8.249 1.00 . A A . 122 ARG HH11 1 1 
        4  9005 1 1 122 ARG HH12 H -10.960   2.026   9.343 1.00 . A A . 122 ARG HH12 1 1 
        4  9006 1 1 122 ARG HH21 H  -9.212   1.207  12.242 1.00 . A A . 122 ARG HH21 1 1 
        4  9007 1 1 122 ARG HH22 H -10.659   1.891  11.574 1.00 . A A . 122 ARG HH22 1 1 
        4  9008 1 1 122 ARG N    N  -2.989  -0.295   6.558 1.00 . A A . 122 ARG N    1 1 
        4  9009 1 1 122 ARG NE   N  -8.113   0.668  10.048 1.00 . A A . 122 ARG NE   1 1 
        4  9010 1 1 122 ARG NH1  N -10.065   1.601   9.187 1.00 . A A . 122 ARG NH1  1 1 
        4  9011 1 1 122 ARG NH2  N  -9.765   1.465  11.443 1.00 . A A . 122 ARG NH2  1 1 
        4  9012 1 1 122 ARG O    O  -4.373  -2.812   6.714 1.00 . A A . 122 ARG O    1 1 
        4  9013 1 1 123 PHE C    C  -4.839  -4.647   9.235 1.00 . A A . 123 PHE C    1 1 
        4  9014 1 1 123 PHE CA   C  -3.386  -4.307   8.872 1.00 . A A . 123 PHE CA   1 1 
        4  9015 1 1 123 PHE CB   C  -2.381  -4.802   9.962 1.00 . A A . 123 PHE CB   1 1 
        4  9016 1 1 123 PHE CD1  C  -2.723  -3.169  11.901 1.00 . A A . 123 PHE CD1  1 1 
        4  9017 1 1 123 PHE CD2  C  -3.313  -5.466  12.239 1.00 . A A . 123 PHE CD2  1 1 
        4  9018 1 1 123 PHE CE1  C  -3.150  -2.876  13.181 1.00 . A A . 123 PHE CE1  1 1 
        4  9019 1 1 123 PHE CE2  C  -3.732  -5.167  13.517 1.00 . A A . 123 PHE CE2  1 1 
        4  9020 1 1 123 PHE CG   C  -2.799  -4.474  11.402 1.00 . A A . 123 PHE CG   1 1 
        4  9021 1 1 123 PHE CZ   C  -3.650  -3.878  13.986 1.00 . A A . 123 PHE CZ   1 1 
        4  9022 1 1 123 PHE H    H  -2.881  -2.343   9.411 1.00 . A A . 123 PHE H    1 1 
        4  9023 1 1 123 PHE HA   H  -3.134  -4.765   7.913 1.00 . A A . 123 PHE HA   1 1 
        4  9024 1 1 123 PHE HB2  H  -2.266  -5.878   9.874 1.00 . A A . 123 PHE HB2  1 1 
        4  9025 1 1 123 PHE HB3  H  -1.417  -4.342   9.782 1.00 . A A . 123 PHE HB3  1 1 
        4  9026 1 1 123 PHE HD1  H  -2.328  -2.379  11.272 1.00 . A A . 123 PHE HD1  1 1 
        4  9027 1 1 123 PHE HD2  H  -3.380  -6.483  11.878 1.00 . A A . 123 PHE HD2  1 1 
        4  9028 1 1 123 PHE HE1  H  -3.087  -1.863  13.557 1.00 . A A . 123 PHE HE1  1 1 
        4  9029 1 1 123 PHE HE2  H  -4.126  -5.950  14.153 1.00 . A A . 123 PHE HE2  1 1 
        4  9030 1 1 123 PHE HZ   H  -3.984  -3.647  14.990 1.00 . A A . 123 PHE HZ   1 1 
        4  9031 1 1 123 PHE N    N  -3.311  -2.863   8.715 1.00 . A A . 123 PHE N    1 1 
        4  9032 1 1 123 PHE O    O  -5.432  -4.007  10.121 1.00 . A A . 123 PHE O    1 1 
        4  9033 1 1 124 VAL C    C  -6.667  -7.548   9.088 1.00 . A A . 124 VAL C    1 1 
        4  9034 1 1 124 VAL CA   C  -6.786  -6.047   8.803 1.00 . A A . 124 VAL CA   1 1 
        4  9035 1 1 124 VAL CB   C  -7.800  -5.750   7.638 1.00 . A A . 124 VAL CB   1 1 
        4  9036 1 1 124 VAL CG1  C  -9.250  -6.097   8.074 1.00 . A A . 124 VAL CG1  1 1 
        4  9037 1 1 124 VAL CG2  C  -7.689  -4.272   7.168 1.00 . A A . 124 VAL CG2  1 1 
        4  9038 1 1 124 VAL H    H  -4.964  -5.961   7.751 1.00 . A A . 124 VAL H    1 1 
        4  9039 1 1 124 VAL HA   H  -7.149  -5.546   9.703 1.00 . A A . 124 VAL HA   1 1 
        4  9040 1 1 124 VAL HB   H  -7.542  -6.390   6.798 1.00 . A A . 124 VAL HB   1 1 
        4  9041 1 1 124 VAL HG11 H  -9.940  -5.900   7.260 1.00 . A A . 124 VAL HG11 1 1 
        4  9042 1 1 124 VAL HG12 H  -9.528  -5.494   8.927 1.00 . A A . 124 VAL HG12 1 1 
        4  9043 1 1 124 VAL HG13 H  -9.314  -7.149   8.348 1.00 . A A . 124 VAL HG13 1 1 
        4  9044 1 1 124 VAL HG21 H  -8.358  -4.101   6.334 1.00 . A A . 124 VAL HG21 1 1 
        4  9045 1 1 124 VAL HG22 H  -6.667  -4.062   6.857 1.00 . A A . 124 VAL HG22 1 1 
        4  9046 1 1 124 VAL HG23 H  -7.951  -3.610   7.983 1.00 . A A . 124 VAL HG23 1 1 
        4  9047 1 1 124 VAL N    N  -5.441  -5.570   8.505 1.00 . A A . 124 VAL N    1 1 
        4  9048 1 1 124 VAL O    O  -6.459  -8.331   8.151 1.00 . A A . 124 VAL O    1 1 
        4  9049 1 1 125 PRO C    C  -7.643 -10.280  10.251 1.00 . A A . 125 PRO C    1 1 
        4  9050 1 1 125 PRO CA   C  -6.518  -9.379  10.795 1.00 . A A . 125 PRO CA   1 1 
        4  9051 1 1 125 PRO CB   C  -6.514  -9.332  12.350 1.00 . A A . 125 PRO CB   1 1 
        4  9052 1 1 125 PRO CD   C  -6.886  -7.089  11.594 1.00 . A A . 125 PRO CD   1 1 
        4  9053 1 1 125 PRO CG   C  -7.238  -8.066  12.695 1.00 . A A . 125 PRO CG   1 1 
        4  9054 1 1 125 PRO HA   H  -5.560  -9.757  10.445 1.00 . A A . 125 PRO HA   1 1 
        4  9055 1 1 125 PRO HB2  H  -7.011 -10.210  12.762 1.00 . A A . 125 PRO HB2  1 1 
        4  9056 1 1 125 PRO HB3  H  -5.488  -9.309  12.710 1.00 . A A . 125 PRO HB3  1 1 
        4  9057 1 1 125 PRO HD2  H  -7.694  -6.383  11.435 1.00 . A A . 125 PRO HD2  1 1 
        4  9058 1 1 125 PRO HD3  H  -5.968  -6.555  11.823 1.00 . A A . 125 PRO HD3  1 1 
        4  9059 1 1 125 PRO HG2  H  -8.311  -8.245  12.719 1.00 . A A . 125 PRO HG2  1 1 
        4  9060 1 1 125 PRO HG3  H  -6.906  -7.692  13.656 1.00 . A A . 125 PRO HG3  1 1 
        4  9061 1 1 125 PRO N    N  -6.695  -7.964  10.400 1.00 . A A . 125 PRO N    1 1 
        4  9062 1 1 125 PRO O    O  -8.729  -9.800   9.922 1.00 . A A . 125 PRO O    1 1 
        4  9063 1 1 126 LYS C    C  -9.694 -12.544  10.246 1.00 . A A . 126 LYS C    1 1 
        4  9064 1 1 126 LYS CA   C  -8.248 -12.645   9.660 1.00 . A A . 126 LYS CA   1 1 
        4  9065 1 1 126 LYS CB   C  -7.595 -14.011  10.016 1.00 . A A . 126 LYS CB   1 1 
        4  9066 1 1 126 LYS CD   C  -6.507 -15.412  11.918 1.00 . A A . 126 LYS CD   1 1 
        4  9067 1 1 126 LYS CE   C  -5.031 -15.126  11.599 1.00 . A A . 126 LYS CE   1 1 
        4  9068 1 1 126 LYS CG   C  -7.433 -14.243  11.538 1.00 . A A . 126 LYS CG   1 1 
        4  9069 1 1 126 LYS H    H  -6.414 -11.840  10.358 1.00 . A A . 126 LYS H    1 1 
        4  9070 1 1 126 LYS HA   H  -8.301 -12.563   8.578 1.00 . A A . 126 LYS HA   1 1 
        4  9071 1 1 126 LYS HB2  H  -8.207 -14.811   9.610 1.00 . A A . 126 LYS HB2  1 1 
        4  9072 1 1 126 LYS HB3  H  -6.615 -14.061   9.551 1.00 . A A . 126 LYS HB3  1 1 
        4  9073 1 1 126 LYS HD2  H  -6.599 -15.593  12.985 1.00 . A A . 126 LYS HD2  1 1 
        4  9074 1 1 126 LYS HD3  H  -6.820 -16.302  11.384 1.00 . A A . 126 LYS HD3  1 1 
        4  9075 1 1 126 LYS HE2  H  -4.879 -15.175  10.528 1.00 . A A . 126 LYS HE2  1 1 
        4  9076 1 1 126 LYS HE3  H  -4.774 -14.133  11.947 1.00 . A A . 126 LYS HE3  1 1 
        4  9077 1 1 126 LYS HG2  H  -7.038 -13.336  11.984 1.00 . A A . 126 LYS HG2  1 1 
        4  9078 1 1 126 LYS HG3  H  -8.418 -14.426  11.960 1.00 . A A . 126 LYS HG3  1 1 
        4  9079 1 1 126 LYS HZ1  H  -3.130 -15.852  12.058 1.00 . A A . 126 LYS HZ1  1 1 
        4  9080 1 1 126 LYS HZ2  H  -4.305 -17.059  11.893 1.00 . A A . 126 LYS HZ2  1 1 
        4  9081 1 1 126 LYS HZ3  H  -4.272 -16.095  13.282 1.00 . A A . 126 LYS HZ3  1 1 
        4  9082 1 1 126 LYS N    N  -7.334 -11.576  10.143 1.00 . A A . 126 LYS N    1 1 
        4  9083 1 1 126 LYS NZ   N  -4.122 -16.101  12.251 1.00 . A A . 126 LYS NZ   1 1 
        4  9084 1 1 126 LYS O    O -10.685 -12.699   9.521 1.00 . A A . 126 LYS O    1 1 
        4  9085 1 1 127 HIS C    C -11.856 -10.934  11.961 1.00 . A A . 127 HIS C    1 1 
        4  9086 1 1 127 HIS CA   C -11.036 -12.181  12.338 1.00 . A A . 127 HIS CA   1 1 
        4  9087 1 1 127 HIS CB   C -10.695 -12.190  13.859 1.00 . A A . 127 HIS CB   1 1 
        4  9088 1 1 127 HIS CD2  C -12.439 -13.322  15.430 1.00 . A A . 127 HIS CD2  1 1 
        4  9089 1 1 127 HIS CE1  C -13.617 -11.545  15.937 1.00 . A A . 127 HIS CE1  1 1 
        4  9090 1 1 127 HIS CG   C -11.889 -12.269  14.778 1.00 . A A . 127 HIS CG   1 1 
        4  9091 1 1 127 HIS H    H  -8.931 -12.099  12.032 1.00 . A A . 127 HIS H    1 1 
        4  9092 1 1 127 HIS HA   H -11.623 -13.068  12.107 1.00 . A A . 127 HIS HA   1 1 
        4  9093 1 1 127 HIS HB2  H -10.067 -13.047  14.073 1.00 . A A . 127 HIS HB2  1 1 
        4  9094 1 1 127 HIS HB3  H -10.144 -11.291  14.108 1.00 . A A . 127 HIS HB3  1 1 
        4  9095 1 1 127 HIS HD1  H -12.515 -10.255  14.796 1.00 . A A . 127 HIS HD1  1 1 
        4  9096 1 1 127 HIS HD2  H -12.091 -14.350  15.398 1.00 . A A . 127 HIS HD2  1 1 
        4  9097 1 1 127 HIS HE1  H -14.367 -10.894  16.371 1.00 . A A . 127 HIS HE1  1 1 
        4  9098 1 1 127 HIS HE2  H -14.156 -13.390  16.643 1.00 . A A . 127 HIS HE2  1 1 
        4  9099 1 1 127 HIS N    N  -9.774 -12.249  11.558 1.00 . A A . 127 HIS N    1 1 
        4  9100 1 1 127 HIS ND1  N -12.652 -11.171  15.123 1.00 . A A . 127 HIS ND1  1 1 
        4  9101 1 1 127 HIS NE2  N -13.517 -12.846  16.135 1.00 . A A . 127 HIS NE2  1 1 
        4  9102 1 1 127 HIS O    O -13.077 -10.902  12.122 1.00 . A A . 127 HIS O    1 1 
        4  9103 1 1 128 LYS C    C -12.067  -8.653   9.542 1.00 . A A . 128 LYS C    1 1 
        4  9104 1 1 128 LYS CA   C -11.760  -8.647  11.050 1.00 . A A . 128 LYS CA   1 1 
        4  9105 1 1 128 LYS CB   C -10.799  -7.483  11.422 1.00 . A A . 128 LYS CB   1 1 
        4  9106 1 1 128 LYS CD   C -12.591  -5.831  12.222 1.00 . A A . 128 LYS CD   1 1 
        4  9107 1 1 128 LYS CE   C -13.241  -4.461  12.006 1.00 . A A . 128 LYS CE   1 1 
        4  9108 1 1 128 LYS CG   C -11.396  -6.070  11.274 1.00 . A A . 128 LYS CG   1 1 
        4  9109 1 1 128 LYS H    H -10.202 -10.044  11.302 1.00 . A A . 128 LYS H    1 1 
        4  9110 1 1 128 LYS HA   H -12.697  -8.518  11.597 1.00 . A A . 128 LYS HA   1 1 
        4  9111 1 1 128 LYS HB2  H -10.488  -7.607  12.455 1.00 . A A . 128 LYS HB2  1 1 
        4  9112 1 1 128 LYS HB3  H  -9.914  -7.545  10.794 1.00 . A A . 128 LYS HB3  1 1 
        4  9113 1 1 128 LYS HD2  H -13.336  -6.601  12.050 1.00 . A A . 128 LYS HD2  1 1 
        4  9114 1 1 128 LYS HD3  H -12.244  -5.898  13.250 1.00 . A A . 128 LYS HD3  1 1 
        4  9115 1 1 128 LYS HE2  H -13.576  -4.387  10.978 1.00 . A A . 128 LYS HE2  1 1 
        4  9116 1 1 128 LYS HE3  H -14.100  -4.375  12.660 1.00 . A A . 128 LYS HE3  1 1 
        4  9117 1 1 128 LYS HG2  H -10.624  -5.339  11.495 1.00 . A A . 128 LYS HG2  1 1 
        4  9118 1 1 128 LYS HG3  H -11.723  -5.935  10.248 1.00 . A A . 128 LYS HG3  1 1 
        4  9119 1 1 128 LYS HZ1  H -11.470  -3.394  11.676 1.00 . A A . 128 LYS HZ1  1 1 
        4  9120 1 1 128 LYS HZ2  H -12.007  -3.356  13.281 1.00 . A A . 128 LYS HZ2  1 1 
        4  9121 1 1 128 LYS HZ3  H -12.785  -2.422  12.103 1.00 . A A . 128 LYS HZ3  1 1 
        4  9122 1 1 128 LYS N    N -11.160  -9.922  11.446 1.00 . A A . 128 LYS N    1 1 
        4  9123 1 1 128 LYS NZ   N -12.310  -3.331  12.286 1.00 . A A . 128 LYS NZ   1 1 
        4  9124 1 1 128 LYS O    O -12.887  -7.866   9.082 1.00 . A A . 128 LYS O    1 1 
        4  9125 1 1 129 LEU C    C -13.059 -10.008   6.971 1.00 . A A . 129 LEU C    1 1 
        4  9126 1 1 129 LEU CA   C -11.611  -9.641   7.319 1.00 . A A . 129 LEU CA   1 1 
        4  9127 1 1 129 LEU CB   C -10.600 -10.634   6.702 1.00 . A A . 129 LEU CB   1 1 
        4  9128 1 1 129 LEU CD1  C  -8.163 -11.247   6.213 1.00 . A A . 129 LEU CD1  1 1 
        4  9129 1 1 129 LEU CD2  C  -8.959  -8.865   5.898 1.00 . A A . 129 LEU CD2  1 1 
        4  9130 1 1 129 LEU CG   C  -9.117 -10.155   6.714 1.00 . A A . 129 LEU CG   1 1 
        4  9131 1 1 129 LEU H    H -10.787 -10.190   9.199 1.00 . A A . 129 LEU H    1 1 
        4  9132 1 1 129 LEU HA   H -11.408  -8.651   6.915 1.00 . A A . 129 LEU HA   1 1 
        4  9133 1 1 129 LEU HB2  H -10.662 -11.570   7.252 1.00 . A A . 129 LEU HB2  1 1 
        4  9134 1 1 129 LEU HB3  H -10.883 -10.828   5.671 1.00 . A A . 129 LEU HB3  1 1 
        4  9135 1 1 129 LEU HD11 H  -8.414 -11.506   5.189 1.00 . A A . 129 LEU HD11 1 1 
        4  9136 1 1 129 LEU HD12 H  -8.261 -12.122   6.840 1.00 . A A . 129 LEU HD12 1 1 
        4  9137 1 1 129 LEU HD13 H  -7.144 -10.889   6.255 1.00 . A A . 129 LEU HD13 1 1 
        4  9138 1 1 129 LEU HD21 H  -9.587  -8.094   6.315 1.00 . A A . 129 LEU HD21 1 1 
        4  9139 1 1 129 LEU HD22 H  -9.245  -9.045   4.868 1.00 . A A . 129 LEU HD22 1 1 
        4  9140 1 1 129 LEU HD23 H  -7.928  -8.537   5.931 1.00 . A A . 129 LEU HD23 1 1 
        4  9141 1 1 129 LEU HG   H  -8.830  -9.927   7.734 1.00 . A A . 129 LEU HG   1 1 
        4  9142 1 1 129 LEU N    N -11.419  -9.560   8.777 1.00 . A A . 129 LEU N    1 1 
        4  9143 1 1 129 LEU O    O -13.662  -9.381   6.101 1.00 . A A . 129 LEU O    1 1 
        4  9144 1 1 130 LYS C    C -16.050 -10.249   7.864 1.00 . A A . 130 LYS C    1 1 
        4  9145 1 1 130 LYS CA   C -15.048 -11.384   7.529 1.00 . A A . 130 LYS CA   1 1 
        4  9146 1 1 130 LYS CB   C -15.331 -12.696   8.331 1.00 . A A . 130 LYS CB   1 1 
        4  9147 1 1 130 LYS CD   C -15.832 -11.863  10.754 1.00 . A A . 130 LYS CD   1 1 
        4  9148 1 1 130 LYS CE   C -17.273 -12.398  10.831 1.00 . A A . 130 LYS CE   1 1 
        4  9149 1 1 130 LYS CG   C -14.917 -12.700   9.830 1.00 . A A . 130 LYS CG   1 1 
        4  9150 1 1 130 LYS H    H -13.123 -11.418   8.415 1.00 . A A . 130 LYS H    1 1 
        4  9151 1 1 130 LYS HA   H -15.173 -11.609   6.472 1.00 . A A . 130 LYS HA   1 1 
        4  9152 1 1 130 LYS HB2  H -16.391 -12.924   8.272 1.00 . A A . 130 LYS HB2  1 1 
        4  9153 1 1 130 LYS HB3  H -14.794 -13.503   7.842 1.00 . A A . 130 LYS HB3  1 1 
        4  9154 1 1 130 LYS HD2  H -15.410 -11.861  11.753 1.00 . A A . 130 LYS HD2  1 1 
        4  9155 1 1 130 LYS HD3  H -15.857 -10.839  10.385 1.00 . A A . 130 LYS HD3  1 1 
        4  9156 1 1 130 LYS HE2  H -17.865 -11.717  11.427 1.00 . A A . 130 LYS HE2  1 1 
        4  9157 1 1 130 LYS HE3  H -17.689 -12.443   9.831 1.00 . A A . 130 LYS HE3  1 1 
        4  9158 1 1 130 LYS HG2  H -14.924 -13.722  10.187 1.00 . A A . 130 LYS HG2  1 1 
        4  9159 1 1 130 LYS HG3  H -13.904 -12.314   9.901 1.00 . A A . 130 LYS HG3  1 1 
        4  9160 1 1 130 LYS HZ1  H -16.999 -13.728  12.427 1.00 . A A . 130 LYS HZ1  1 1 
        4  9161 1 1 130 LYS HZ2  H -16.782 -14.431  10.902 1.00 . A A . 130 LYS HZ2  1 1 
        4  9162 1 1 130 LYS HZ3  H -18.337 -14.087  11.456 1.00 . A A . 130 LYS HZ3  1 1 
        4  9163 1 1 130 LYS N    N -13.638 -10.971   7.710 1.00 . A A . 130 LYS N    1 1 
        4  9164 1 1 130 LYS NZ   N -17.350 -13.756  11.447 1.00 . A A . 130 LYS NZ   1 1 
        4  9165 1 1 130 LYS O    O -17.230 -10.342   7.520 1.00 . A A . 130 LYS O    1 1 
        4  9166 1 1 131 GLU C    C -16.187  -7.016   7.598 1.00 . A A . 131 GLU C    1 1 
        4  9167 1 1 131 GLU CA   C -16.339  -7.967   8.798 1.00 . A A . 131 GLU CA   1 1 
        4  9168 1 1 131 GLU CB   C -15.828  -7.245  10.077 1.00 . A A . 131 GLU CB   1 1 
        4  9169 1 1 131 GLU CD   C -17.473  -8.157  11.817 1.00 . A A . 131 GLU CD   1 1 
        4  9170 1 1 131 GLU CG   C -16.003  -8.027  11.389 1.00 . A A . 131 GLU CG   1 1 
        4  9171 1 1 131 GLU H    H -14.667  -9.244   8.927 1.00 . A A . 131 GLU H    1 1 
        4  9172 1 1 131 GLU HA   H -17.389  -8.224   8.931 1.00 . A A . 131 GLU HA   1 1 
        4  9173 1 1 131 GLU HB2  H -14.769  -7.034   9.955 1.00 . A A . 131 GLU HB2  1 1 
        4  9174 1 1 131 GLU HB3  H -16.354  -6.300  10.176 1.00 . A A . 131 GLU HB3  1 1 
        4  9175 1 1 131 GLU HG2  H -15.575  -9.018  11.263 1.00 . A A . 131 GLU HG2  1 1 
        4  9176 1 1 131 GLU HG3  H -15.455  -7.513  12.174 1.00 . A A . 131 GLU HG3  1 1 
        4  9177 1 1 131 GLU N    N -15.573  -9.203   8.565 1.00 . A A . 131 GLU N    1 1 
        4  9178 1 1 131 GLU O    O -17.156  -6.403   7.141 1.00 . A A . 131 GLU O    1 1 
        4  9179 1 1 131 GLU OE1  O -18.031  -7.169  12.343 1.00 . A A . 131 GLU OE1  1 1 
        4  9180 1 1 131 GLU OE2  O -18.077  -9.234  11.639 1.00 . A A . 131 GLU OE2  1 1 
        4  9181 1 1 132 GLU C    C -14.545  -6.256   4.706 1.00 . A A . 132 GLU C    1 1 
        4  9182 1 1 132 GLU CA   C -14.527  -5.830   6.176 1.00 . A A . 132 GLU CA   1 1 
        4  9183 1 1 132 GLU CB   C -13.098  -5.342   6.564 1.00 . A A . 132 GLU CB   1 1 
        4  9184 1 1 132 GLU CD   C -13.898  -3.625   8.314 1.00 . A A . 132 GLU CD   1 1 
        4  9185 1 1 132 GLU CG   C -12.969  -4.812   8.005 1.00 . A A . 132 GLU CG   1 1 
        4  9186 1 1 132 GLU H    H -14.274  -7.608   7.304 1.00 . A A . 132 GLU H    1 1 
        4  9187 1 1 132 GLU HA   H -15.217  -4.998   6.294 1.00 . A A . 132 GLU HA   1 1 
        4  9188 1 1 132 GLU HB2  H -12.403  -6.173   6.455 1.00 . A A . 132 GLU HB2  1 1 
        4  9189 1 1 132 GLU HB3  H -12.795  -4.549   5.884 1.00 . A A . 132 GLU HB3  1 1 
        4  9190 1 1 132 GLU HG2  H -13.188  -5.624   8.692 1.00 . A A . 132 GLU HG2  1 1 
        4  9191 1 1 132 GLU HG3  H -11.940  -4.501   8.167 1.00 . A A . 132 GLU HG3  1 1 
        4  9192 1 1 132 GLU N    N -14.943  -6.915   7.087 1.00 . A A . 132 GLU N    1 1 
        4  9193 1 1 132 GLU O    O -14.153  -5.464   3.843 1.00 . A A . 132 GLU O    1 1 
        4  9194 1 1 132 GLU OE1  O -13.529  -2.474   7.994 1.00 . A A . 132 GLU OE1  1 1 
        4  9195 1 1 132 GLU OE2  O -14.992  -3.830   8.888 1.00 . A A . 132 GLU OE2  1 1 
        4  9196 1 1 133 GLY C    C -13.966  -9.060   2.765 1.00 . A A . 133 GLY C    1 1 
        4  9197 1 1 133 GLY CA   C -14.973  -7.957   3.014 1.00 . A A . 133 GLY CA   1 1 
        4  9198 1 1 133 GLY H    H -15.300  -8.089   5.109 1.00 . A A . 133 GLY H    1 1 
        4  9199 1 1 133 GLY HA2  H -15.956  -8.342   2.787 1.00 . A A . 133 GLY HA2  1 1 
        4  9200 1 1 133 GLY HA3  H -14.768  -7.128   2.339 1.00 . A A . 133 GLY HA3  1 1 
        4  9201 1 1 133 GLY N    N -14.983  -7.488   4.402 1.00 . A A . 133 GLY N    1 1 
        4  9202 1 1 133 GLY O    O -13.055  -8.882   1.953 1.00 . A A . 133 GLY O    1 1 
        4  9203 1 1 134 TYR C    C -12.866 -11.813   2.001 1.00 . A A . 134 TYR C    1 1 
        4  9204 1 1 134 TYR CA   C -13.234 -11.392   3.442 1.00 . A A . 134 TYR CA   1 1 
        4  9205 1 1 134 TYR CB   C -13.962 -12.572   4.159 1.00 . A A . 134 TYR CB   1 1 
        4  9206 1 1 134 TYR CD1  C -16.467 -12.227   3.720 1.00 . A A . 134 TYR CD1  1 1 
        4  9207 1 1 134 TYR CD2  C -15.416 -14.135   2.736 1.00 . A A . 134 TYR CD2  1 1 
        4  9208 1 1 134 TYR CE1  C -17.673 -12.596   3.145 1.00 . A A . 134 TYR CE1  1 1 
        4  9209 1 1 134 TYR CE2  C -16.617 -14.502   2.158 1.00 . A A . 134 TYR CE2  1 1 
        4  9210 1 1 134 TYR CG   C -15.310 -12.989   3.533 1.00 . A A . 134 TYR CG   1 1 
        4  9211 1 1 134 TYR CZ   C -17.743 -13.728   2.363 1.00 . A A . 134 TYR CZ   1 1 
        4  9212 1 1 134 TYR H    H -14.748 -10.175   4.260 1.00 . A A . 134 TYR H    1 1 
        4  9213 1 1 134 TYR HA   H -12.314 -11.188   3.985 1.00 . A A . 134 TYR HA   1 1 
        4  9214 1 1 134 TYR HB2  H -13.313 -13.442   4.162 1.00 . A A . 134 TYR HB2  1 1 
        4  9215 1 1 134 TYR HB3  H -14.149 -12.295   5.192 1.00 . A A . 134 TYR HB3  1 1 
        4  9216 1 1 134 TYR HD1  H -16.417 -11.332   4.337 1.00 . A A . 134 TYR HD1  1 1 
        4  9217 1 1 134 TYR HD2  H -14.534 -14.746   2.574 1.00 . A A . 134 TYR HD2  1 1 
        4  9218 1 1 134 TYR HE1  H -18.557 -11.991   3.310 1.00 . A A . 134 TYR HE1  1 1 
        4  9219 1 1 134 TYR HE2  H -16.669 -15.396   1.549 1.00 . A A . 134 TYR HE2  1 1 
        4  9220 1 1 134 TYR HH   H -19.306 -13.325   1.306 1.00 . A A . 134 TYR HH   1 1 
        4  9221 1 1 134 TYR N    N -14.077 -10.162   3.542 1.00 . A A . 134 TYR N    1 1 
        4  9222 1 1 134 TYR O    O -11.815 -12.386   1.772 1.00 . A A . 134 TYR O    1 1 
        4  9223 1 1 134 TYR OH   O -18.941 -14.085   1.781 1.00 . A A . 134 TYR OH   1 1 
        4  9224 1 1 135 GLU C    C -12.260 -11.144  -0.980 1.00 . A A . 135 GLU C    1 1 
        4  9225 1 1 135 GLU CA   C -13.563 -11.768  -0.394 1.00 . A A . 135 GLU CA   1 1 
        4  9226 1 1 135 GLU CB   C -14.825 -11.304  -1.165 1.00 . A A . 135 GLU CB   1 1 
        4  9227 1 1 135 GLU CD   C -17.376 -11.608  -1.469 1.00 . A A . 135 GLU CD   1 1 
        4  9228 1 1 135 GLU CG   C -16.124 -11.977  -0.661 1.00 . A A . 135 GLU CG   1 1 
        4  9229 1 1 135 GLU H    H -14.578 -11.070   1.335 1.00 . A A . 135 GLU H    1 1 
        4  9230 1 1 135 GLU HA   H -13.484 -12.843  -0.500 1.00 . A A . 135 GLU HA   1 1 
        4  9231 1 1 135 GLU HB2  H -14.930 -10.228  -1.060 1.00 . A A . 135 GLU HB2  1 1 
        4  9232 1 1 135 GLU HB3  H -14.705 -11.543  -2.216 1.00 . A A . 135 GLU HB3  1 1 
        4  9233 1 1 135 GLU HG2  H -15.990 -13.053  -0.703 1.00 . A A . 135 GLU HG2  1 1 
        4  9234 1 1 135 GLU HG3  H -16.277 -11.695   0.380 1.00 . A A . 135 GLU HG3  1 1 
        4  9235 1 1 135 GLU N    N -13.747 -11.501   1.050 1.00 . A A . 135 GLU N    1 1 
        4  9236 1 1 135 GLU O    O -11.849 -11.488  -2.089 1.00 . A A . 135 GLU O    1 1 
        4  9237 1 1 135 GLU OE1  O -17.635 -12.257  -2.506 1.00 . A A . 135 GLU OE1  1 1 
        4  9238 1 1 135 GLU OE2  O -18.112 -10.680  -1.071 1.00 . A A . 135 GLU OE2  1 1 
        4  9239 1 1 136 SER C    C  -9.116 -10.361  -0.299 1.00 . A A . 136 SER C    1 1 
        4  9240 1 1 136 SER CA   C -10.398  -9.538  -0.625 1.00 . A A . 136 SER CA   1 1 
        4  9241 1 1 136 SER CB   C -10.353  -8.174   0.077 1.00 . A A . 136 SER CB   1 1 
        4  9242 1 1 136 SER H    H -11.950 -10.102   0.692 1.00 . A A . 136 SER H    1 1 
        4  9243 1 1 136 SER HA   H -10.441  -9.377  -1.704 1.00 . A A . 136 SER HA   1 1 
        4  9244 1 1 136 SER HB2  H -10.260  -8.314   1.144 1.00 . A A . 136 SER HB2  1 1 
        4  9245 1 1 136 SER HB3  H  -9.502  -7.609  -0.282 1.00 . A A . 136 SER HB3  1 1 
        4  9246 1 1 136 SER HG   H -11.923  -7.173   0.675 1.00 . A A . 136 SER HG   1 1 
        4  9247 1 1 136 SER N    N -11.622 -10.243  -0.216 1.00 . A A . 136 SER N    1 1 
        4  9248 1 1 136 SER O    O  -8.096 -10.221  -0.976 1.00 . A A . 136 SER O    1 1 
        4  9249 1 1 136 SER OG   O -11.524  -7.423  -0.168 1.00 . A A . 136 SER OG   1 1 
        4  9250 1 1 137 TYR C    C  -8.523 -13.554   0.865 1.00 . A A . 137 TYR C    1 1 
        4  9251 1 1 137 TYR CA   C  -8.063 -12.121   1.109 1.00 . A A . 137 TYR CA   1 1 
        4  9252 1 1 137 TYR CB   C  -7.595 -11.971   2.587 1.00 . A A . 137 TYR CB   1 1 
        4  9253 1 1 137 TYR CD1  C  -5.330 -13.134   2.437 1.00 . A A . 137 TYR CD1  1 1 
        4  9254 1 1 137 TYR CD2  C  -6.881 -13.973   4.037 1.00 . A A . 137 TYR CD2  1 1 
        4  9255 1 1 137 TYR CE1  C  -4.435 -14.109   2.804 1.00 . A A . 137 TYR CE1  1 1 
        4  9256 1 1 137 TYR CE2  C  -5.988 -14.958   4.398 1.00 . A A . 137 TYR CE2  1 1 
        4  9257 1 1 137 TYR CG   C  -6.575 -13.035   3.041 1.00 . A A . 137 TYR CG   1 1 
        4  9258 1 1 137 TYR CZ   C  -4.767 -15.016   3.780 1.00 . A A . 137 TYR CZ   1 1 
        4  9259 1 1 137 TYR H    H  -9.902 -11.045   1.405 1.00 . A A . 137 TYR H    1 1 
        4  9260 1 1 137 TYR HA   H  -7.215 -11.913   0.457 1.00 . A A . 137 TYR HA   1 1 
        4  9261 1 1 137 TYR HB2  H  -7.137 -11.004   2.714 1.00 . A A . 137 TYR HB2  1 1 
        4  9262 1 1 137 TYR HB3  H  -8.462 -12.027   3.239 1.00 . A A . 137 TYR HB3  1 1 
        4  9263 1 1 137 TYR HD1  H  -5.058 -12.424   1.664 1.00 . A A . 137 TYR HD1  1 1 
        4  9264 1 1 137 TYR HD2  H  -7.842 -13.920   4.529 1.00 . A A . 137 TYR HD2  1 1 
        4  9265 1 1 137 TYR HE1  H  -3.465 -14.159   2.319 1.00 . A A . 137 TYR HE1  1 1 
        4  9266 1 1 137 TYR HE2  H  -6.246 -15.674   5.168 1.00 . A A . 137 TYR HE2  1 1 
        4  9267 1 1 137 TYR HH   H  -2.983 -15.720   3.902 1.00 . A A . 137 TYR HH   1 1 
        4  9268 1 1 137 TYR N    N  -9.151 -11.158   0.786 1.00 . A A . 137 TYR N    1 1 
        4  9269 1 1 137 TYR O    O  -7.977 -14.270   0.024 1.00 . A A . 137 TYR O    1 1 
        4  9270 1 1 137 TYR OH   O  -3.874 -16.005   4.116 1.00 . A A . 137 TYR OH   1 1 
        4  9271 1 1 138 LEU C    C -10.499 -15.911   0.423 1.00 . A A . 138 LEU C    1 1 
        4  9272 1 1 138 LEU CA   C  -9.997 -15.326   1.767 1.00 . A A . 138 LEU CA   1 1 
        4  9273 1 1 138 LEU CB   C -11.090 -15.415   2.883 1.00 . A A . 138 LEU CB   1 1 
        4  9274 1 1 138 LEU CD1  C -10.410 -13.507   4.544 1.00 . A A . 138 LEU CD1  1 1 
        4  9275 1 1 138 LEU CD2  C -11.701 -15.482   5.393 1.00 . A A . 138 LEU CD2  1 1 
        4  9276 1 1 138 LEU CG   C -10.659 -15.021   4.357 1.00 . A A . 138 LEU CG   1 1 
        4  9277 1 1 138 LEU H    H -10.062 -13.245   2.080 1.00 . A A . 138 LEU H    1 1 
        4  9278 1 1 138 LEU HA   H  -9.134 -15.904   2.089 1.00 . A A . 138 LEU HA   1 1 
        4  9279 1 1 138 LEU HB2  H -11.915 -14.772   2.594 1.00 . A A . 138 LEU HB2  1 1 
        4  9280 1 1 138 LEU HB3  H -11.453 -16.435   2.904 1.00 . A A . 138 LEU HB3  1 1 
        4  9281 1 1 138 LEU HD11 H -11.317 -12.957   4.341 1.00 . A A . 138 LEU HD11 1 1 
        4  9282 1 1 138 LEU HD12 H  -9.634 -13.166   3.869 1.00 . A A . 138 LEU HD12 1 1 
        4  9283 1 1 138 LEU HD13 H -10.102 -13.307   5.566 1.00 . A A . 138 LEU HD13 1 1 
        4  9284 1 1 138 LEU HD21 H -12.655 -15.011   5.181 1.00 . A A . 138 LEU HD21 1 1 
        4  9285 1 1 138 LEU HD22 H -11.376 -15.191   6.388 1.00 . A A . 138 LEU HD22 1 1 
        4  9286 1 1 138 LEU HD23 H -11.812 -16.556   5.354 1.00 . A A . 138 LEU HD23 1 1 
        4  9287 1 1 138 LEU HG   H  -9.731 -15.526   4.586 1.00 . A A . 138 LEU HG   1 1 
        4  9288 1 1 138 LEU N    N  -9.554 -13.936   1.611 1.00 . A A . 138 LEU N    1 1 
        4  9289 1 1 138 LEU O    O -10.478 -17.128   0.232 1.00 . A A . 138 LEU O    1 1 
        4  9290 1 1 139 HIS C    C -10.022 -15.179  -2.805 1.00 . A A . 139 HIS C    1 1 
        4  9291 1 1 139 HIS CA   C -11.260 -15.401  -1.893 1.00 . A A . 139 HIS CA   1 1 
        4  9292 1 1 139 HIS CB   C -12.478 -14.622  -2.430 1.00 . A A . 139 HIS CB   1 1 
        4  9293 1 1 139 HIS CD2  C -13.294 -15.942  -4.535 1.00 . A A . 139 HIS CD2  1 1 
        4  9294 1 1 139 HIS CE1  C -13.013 -14.362  -6.025 1.00 . A A . 139 HIS CE1  1 1 
        4  9295 1 1 139 HIS CG   C -12.800 -14.856  -3.887 1.00 . A A . 139 HIS CG   1 1 
        4  9296 1 1 139 HIS H    H -11.161 -14.117  -0.195 1.00 . A A . 139 HIS H    1 1 
        4  9297 1 1 139 HIS HA   H -11.507 -16.462  -1.909 1.00 . A A . 139 HIS HA   1 1 
        4  9298 1 1 139 HIS HB2  H -13.355 -14.895  -1.855 1.00 . A A . 139 HIS HB2  1 1 
        4  9299 1 1 139 HIS HB3  H -12.301 -13.565  -2.298 1.00 . A A . 139 HIS HB3  1 1 
        4  9300 1 1 139 HIS HD1  H -12.294 -12.980  -4.704 1.00 . A A . 139 HIS HD1  1 1 
        4  9301 1 1 139 HIS HD2  H -13.548 -16.897  -4.092 1.00 . A A . 139 HIS HD2  1 1 
        4  9302 1 1 139 HIS HE1  H -12.998 -13.823  -6.961 1.00 . A A . 139 HIS HE1  1 1 
        4  9303 1 1 139 HIS HE2  H -13.734 -16.200  -6.578 1.00 . A A . 139 HIS HE2  1 1 
        4  9304 1 1 139 HIS N    N -10.985 -15.034  -0.483 1.00 . A A . 139 HIS N    1 1 
        4  9305 1 1 139 HIS ND1  N -12.630 -13.888  -4.855 1.00 . A A . 139 HIS ND1  1 1 
        4  9306 1 1 139 HIS NE2  N -13.418 -15.603  -5.858 1.00 . A A . 139 HIS NE2  1 1 
        4  9307 1 1 139 HIS O    O  -9.535 -16.131  -3.416 1.00 . A A . 139 HIS O    1 1 
        4  9308 1 1 140 LEU C    C  -7.194 -14.288  -3.767 1.00 . A A . 140 LEU C    1 1 
        4  9309 1 1 140 LEU CA   C  -8.507 -13.488  -3.895 1.00 . A A . 140 LEU CA   1 1 
        4  9310 1 1 140 LEU CB   C  -8.190 -11.966  -3.763 1.00 . A A . 140 LEU CB   1 1 
        4  9311 1 1 140 LEU CD1  C  -8.834  -9.502  -3.998 1.00 . A A . 140 LEU CD1  1 1 
        4  9312 1 1 140 LEU CD2  C  -9.768 -11.226  -5.636 1.00 . A A . 140 LEU CD2  1 1 
        4  9313 1 1 140 LEU CG   C  -9.307 -10.966  -4.188 1.00 . A A . 140 LEU CG   1 1 
        4  9314 1 1 140 LEU H    H  -9.880 -13.233  -2.265 1.00 . A A . 140 LEU H    1 1 
        4  9315 1 1 140 LEU HA   H  -8.929 -13.667  -4.880 1.00 . A A . 140 LEU HA   1 1 
        4  9316 1 1 140 LEU HB2  H  -7.947 -11.770  -2.722 1.00 . A A . 140 LEU HB2  1 1 
        4  9317 1 1 140 LEU HB3  H  -7.305 -11.748  -4.356 1.00 . A A . 140 LEU HB3  1 1 
        4  9318 1 1 140 LEU HD11 H  -8.574  -9.340  -2.952 1.00 . A A . 140 LEU HD11 1 1 
        4  9319 1 1 140 LEU HD12 H  -9.629  -8.822  -4.270 1.00 . A A . 140 LEU HD12 1 1 
        4  9320 1 1 140 LEU HD13 H  -7.966  -9.308  -4.614 1.00 . A A . 140 LEU HD13 1 1 
        4  9321 1 1 140 LEU HD21 H -10.181 -12.224  -5.712 1.00 . A A . 140 LEU HD21 1 1 
        4  9322 1 1 140 LEU HD22 H  -8.928 -11.131  -6.317 1.00 . A A . 140 LEU HD22 1 1 
        4  9323 1 1 140 LEU HD23 H -10.531 -10.510  -5.909 1.00 . A A . 140 LEU HD23 1 1 
        4  9324 1 1 140 LEU HG   H -10.167 -11.108  -3.541 1.00 . A A . 140 LEU HG   1 1 
        4  9325 1 1 140 LEU N    N  -9.537 -13.906  -2.891 1.00 . A A . 140 LEU N    1 1 
        4  9326 1 1 140 LEU O    O  -6.692 -14.835  -4.752 1.00 . A A . 140 LEU O    1 1 
        4  9327 1 1 141 PHE C    C  -5.833 -16.601  -2.000 1.00 . A A . 141 PHE C    1 1 
        4  9328 1 1 141 PHE CA   C  -5.451 -15.131  -2.245 1.00 . A A . 141 PHE CA   1 1 
        4  9329 1 1 141 PHE CB   C  -4.742 -14.536  -1.004 1.00 . A A . 141 PHE CB   1 1 
        4  9330 1 1 141 PHE CD1  C  -2.244 -14.711  -1.439 1.00 . A A . 141 PHE CD1  1 1 
        4  9331 1 1 141 PHE CD2  C  -3.168 -16.057   0.314 1.00 . A A . 141 PHE CD2  1 1 
        4  9332 1 1 141 PHE CE1  C  -0.988 -15.214  -1.161 1.00 . A A . 141 PHE CE1  1 1 
        4  9333 1 1 141 PHE CE2  C  -1.913 -16.561   0.589 1.00 . A A . 141 PHE CE2  1 1 
        4  9334 1 1 141 PHE CG   C  -3.360 -15.120  -0.706 1.00 . A A . 141 PHE CG   1 1 
        4  9335 1 1 141 PHE CZ   C  -0.822 -16.137  -0.149 1.00 . A A . 141 PHE CZ   1 1 
        4  9336 1 1 141 PHE H    H  -7.105 -13.845  -1.828 1.00 . A A . 141 PHE H    1 1 
        4  9337 1 1 141 PHE HA   H  -4.784 -15.072  -3.102 1.00 . A A . 141 PHE HA   1 1 
        4  9338 1 1 141 PHE HB2  H  -4.622 -13.469  -1.151 1.00 . A A . 141 PHE HB2  1 1 
        4  9339 1 1 141 PHE HB3  H  -5.368 -14.688  -0.130 1.00 . A A . 141 PHE HB3  1 1 
        4  9340 1 1 141 PHE HD1  H  -2.363 -13.985  -2.234 1.00 . A A . 141 PHE HD1  1 1 
        4  9341 1 1 141 PHE HD2  H  -4.019 -16.391   0.895 1.00 . A A . 141 PHE HD2  1 1 
        4  9342 1 1 141 PHE HE1  H  -0.135 -14.884  -1.740 1.00 . A A . 141 PHE HE1  1 1 
        4  9343 1 1 141 PHE HE2  H  -1.782 -17.286   1.384 1.00 . A A . 141 PHE HE2  1 1 
        4  9344 1 1 141 PHE HZ   H   0.164 -16.530   0.070 1.00 . A A . 141 PHE HZ   1 1 
        4  9345 1 1 141 PHE N    N  -6.663 -14.351  -2.544 1.00 . A A . 141 PHE N    1 1 
        4  9346 1 1 141 PHE O    O  -5.155 -17.520  -2.482 1.00 . A A . 141 PHE O    1 1 
        4  9347 1 1 142 ASN C    C  -6.391 -18.916  -0.132 1.00 . A A . 142 ASN C    1 1 
        4  9348 1 1 142 ASN CA   C  -7.486 -18.072  -0.816 1.00 . A A . 142 ASN CA   1 1 
        4  9349 1 1 142 ASN CB   C  -8.206 -18.851  -1.955 1.00 . A A . 142 ASN CB   1 1 
        4  9350 1 1 142 ASN CG   C  -8.890 -20.139  -1.463 1.00 . A A . 142 ASN CG   1 1 
        4  9351 1 1 142 ASN H    H  -7.473 -15.972  -1.043 1.00 . A A . 142 ASN H    1 1 
        4  9352 1 1 142 ASN HA   H  -8.231 -17.829  -0.060 1.00 . A A . 142 ASN HA   1 1 
        4  9353 1 1 142 ASN HB2  H  -8.958 -18.210  -2.401 1.00 . A A . 142 ASN HB2  1 1 
        4  9354 1 1 142 ASN HB3  H  -7.483 -19.113  -2.719 1.00 . A A . 142 ASN HB3  1 1 
        4  9355 1 1 142 ASN HD21 H -10.449 -19.104  -0.785 1.00 . A A . 142 ASN HD21 1 1 
        4  9356 1 1 142 ASN HD22 H -10.522 -20.815  -0.559 1.00 . A A . 142 ASN HD22 1 1 
        4  9357 1 1 142 ASN N    N  -6.963 -16.775  -1.280 1.00 . A A . 142 ASN N    1 1 
        4  9358 1 1 142 ASN ND2  N -10.073 -20.004  -0.878 1.00 . A A . 142 ASN ND2  1 1 
        4  9359 1 1 142 ASN O    O  -5.701 -19.715  -0.781 1.00 . A A . 142 ASN O    1 1 
        4  9360 1 1 142 ASN OD1  O  -8.348 -21.240  -1.578 1.00 . A A . 142 ASN OD1  1 1 
        4  9361 1 1 143 LYS C    C  -5.574 -20.906   2.076 1.00 . A A . 143 LYS C    1 1 
        4  9362 1 1 143 LYS CA   C  -5.247 -19.400   2.015 1.00 . A A . 143 LYS CA   1 1 
        4  9363 1 1 143 LYS CB   C  -5.252 -18.818   3.450 1.00 . A A . 143 LYS CB   1 1 
        4  9364 1 1 143 LYS CD   C  -4.408 -19.198   5.862 1.00 . A A . 143 LYS CD   1 1 
        4  9365 1 1 143 LYS CE   C  -5.580 -20.097   6.297 1.00 . A A . 143 LYS CE   1 1 
        4  9366 1 1 143 LYS CG   C  -4.102 -19.330   4.355 1.00 . A A . 143 LYS CG   1 1 
        4  9367 1 1 143 LYS H    H  -6.822 -18.042   1.616 1.00 . A A . 143 LYS H    1 1 
        4  9368 1 1 143 LYS HA   H  -4.263 -19.260   1.574 1.00 . A A . 143 LYS HA   1 1 
        4  9369 1 1 143 LYS HB2  H  -5.173 -17.736   3.384 1.00 . A A . 143 LYS HB2  1 1 
        4  9370 1 1 143 LYS HB3  H  -6.202 -19.058   3.920 1.00 . A A . 143 LYS HB3  1 1 
        4  9371 1 1 143 LYS HD2  H  -3.523 -19.480   6.422 1.00 . A A . 143 LYS HD2  1 1 
        4  9372 1 1 143 LYS HD3  H  -4.651 -18.163   6.085 1.00 . A A . 143 LYS HD3  1 1 
        4  9373 1 1 143 LYS HE2  H  -6.486 -19.754   5.820 1.00 . A A . 143 LYS HE2  1 1 
        4  9374 1 1 143 LYS HE3  H  -5.382 -21.117   5.987 1.00 . A A . 143 LYS HE3  1 1 
        4  9375 1 1 143 LYS HG2  H  -3.913 -20.375   4.132 1.00 . A A . 143 LYS HG2  1 1 
        4  9376 1 1 143 LYS HG3  H  -3.204 -18.760   4.129 1.00 . A A . 143 LYS HG3  1 1 
        4  9377 1 1 143 LYS HZ1  H  -6.605 -20.693   8.004 1.00 . A A . 143 LYS HZ1  1 1 
        4  9378 1 1 143 LYS HZ2  H  -5.991 -19.122   8.084 1.00 . A A . 143 LYS HZ2  1 1 
        4  9379 1 1 143 LYS HZ3  H  -4.953 -20.444   8.253 1.00 . A A . 143 LYS HZ3  1 1 
        4  9380 1 1 143 LYS N    N  -6.233 -18.694   1.183 1.00 . A A . 143 LYS N    1 1 
        4  9381 1 1 143 LYS NZ   N  -5.796 -20.086   7.760 1.00 . A A . 143 LYS NZ   1 1 
        4  9382 1 1 143 LYS O    O  -4.664 -21.738   2.187 1.00 . A A . 143 LYS O    1 1 
        4  9383 1 1 144 LEU C    C  -6.670 -23.542   1.166 1.00 . A A . 144 LEU C    1 1 
        4  9384 1 1 144 LEU CA   C  -7.453 -22.572   2.074 1.00 . A A . 144 LEU CA   1 1 
        4  9385 1 1 144 LEU CB   C  -8.955 -22.541   1.660 1.00 . A A . 144 LEU CB   1 1 
        4  9386 1 1 144 LEU CD1  C  -9.706 -24.662   2.916 1.00 . A A . 144 LEU CD1  1 1 
        4  9387 1 1 144 LEU CD2  C -11.104 -23.764   0.966 1.00 . A A . 144 LEU CD2  1 1 
        4  9388 1 1 144 LEU CG   C  -9.682 -23.925   1.555 1.00 . A A . 144 LEU CG   1 1 
        4  9389 1 1 144 LEU H    H  -7.527 -20.458   1.951 1.00 . A A . 144 LEU H    1 1 
        4  9390 1 1 144 LEU HA   H  -7.386 -22.911   3.100 1.00 . A A . 144 LEU HA   1 1 
        4  9391 1 1 144 LEU HB2  H  -9.491 -21.930   2.381 1.00 . A A . 144 LEU HB2  1 1 
        4  9392 1 1 144 LEU HB3  H  -9.026 -22.050   0.692 1.00 . A A . 144 LEU HB3  1 1 
        4  9393 1 1 144 LEU HD11 H -10.253 -24.076   3.645 1.00 . A A . 144 LEU HD11 1 1 
        4  9394 1 1 144 LEU HD12 H  -8.693 -24.811   3.263 1.00 . A A . 144 LEU HD12 1 1 
        4  9395 1 1 144 LEU HD13 H -10.184 -25.625   2.799 1.00 . A A . 144 LEU HD13 1 1 
        4  9396 1 1 144 LEU HD21 H -11.708 -23.146   1.619 1.00 . A A . 144 LEU HD21 1 1 
        4  9397 1 1 144 LEU HD22 H -11.570 -24.737   0.865 1.00 . A A . 144 LEU HD22 1 1 
        4  9398 1 1 144 LEU HD23 H -11.043 -23.299  -0.010 1.00 . A A . 144 LEU HD23 1 1 
        4  9399 1 1 144 LEU HG   H  -9.123 -24.551   0.872 1.00 . A A . 144 LEU HG   1 1 
        4  9400 1 1 144 LEU N    N  -6.897 -21.206   2.025 1.