NMR Restraints Grid

Result table
 (Save to zip file containing files for each block)

image mrblock_id pdb_id bmrb_id cing stage program type subtype item_count
432338 2js1 15350 cing 4-filtered-FRED STAR entry full 2048


data_FRED_restraints_with_modified_coordinates_PDB_code_2js1

# This FRED archive file contains, for PDB entry <2js1>:
# 
# - Coordinates and sequence information from the PDB mmCIF file
# - NMR restraints from the PDB MR file
# 
# In this file, the coordinates and NMR restraints share the same atom names,
# and in this way can differ from the data deposited at the wwPDB. To achieve
# this aim, the NMR restraints were parsed from their original format files, and
# the coordinates and NMR restraints information were subsequently harmonized.
# 
# Due to the complexity of this harmonization process and the filtering process
# used in creating these files, the NMR restraints information in these files
# may differ significantly from that in the originally deposited file. Other 
# modifications could have occurred to the NMR restraints information, or data 
# could have been lost because of parsing or conversion errors. The PDB file 
# remains the authoritative reference for the atomic coordinates and the 
# originally deposited restraints files remain the primary reference for these 
# data.
# 
# This file is generated at the BioMagResBank (BMRB) in collaboration with the 
# PDBe (formerly MSD) group at the European Bioinformatics Institute (EBI) and 
# the CMBI/IMM group at the Radboud University of Nijmegen.
# 
# Several software packages were used to produce this file:
# 
# - Wattos (BMRB and CMBI/IMM).
# - FormatConverter and NMRStarExport (PDBe).
# - CCPN framework (http://www.ccpn.ac.uk/).
# 
# More information about this process can be found in the references below.
# Please cite the original reference for this PDB entry.
# 
# JF Doreleijers, A Nederveen, W Vranken, J Lin, AM Bonvin, R Kaptein, JL
# Markley, and EL Ulrich (2005). BioMagResBank databases DOCR and FRED
# containing converted and filtered sets of experimental NMR restraints and
# coordinates from over 500 protein PDB structures. J. Biomol. NMR 32, 1-12.
# 
# WF Vranken, W Boucher, TJ Stevens, RH Fogh, A Pajon, M Llinas, EL Ulrich, JL
# Markley, J Ionides, ED Laue (2005). The CCPN data model for NMR spectroscopy:
# development of a software pipeline. Proteins 59, 687-696. 
# 
# JF Doreleijers, W Vranken, C Penkett, J Lin, CF Schulte, G Vuister, G Vriend,
# JL Markley, EL Ulrich. BioMagResBank database `NMR Restraints Grid` with
# curated sets of experimental NMR restraints for over 4,000 protein and nucleic
# acid PDB entries. (in preparation)




save_Conversion_project_for_entry_Name_1
    _Study_list.Sf_category  study_list
    _Study_list.Entry_ID     1
    _Study_list.ID           1

    loop_
       _Study.ID
       _Study.Name
       _Study.Type
       _Study.Details
       _Study.Entry_ID
       _Study.Study_list_ID

       1 "Conversion project for entry 1" NMR . 1 1 
    stop_

save_


save_originalConstraints_1
    _Entry.Sf_category          entry_information
    _Entry.ID                   1
    _Entry.Title                "Data for entry 1"
    _Entry.NMR_STAR_version     3.1.0.8
    _Entry.Experimental_method  NMR
    _Entry.Details              .

save_


save_assembly_2js1
    _Assembly.Sf_category           assembly
    _Assembly.Entry_ID              1
    _Assembly.ID                    1
    _Assembly.Name                  2js1
    _Assembly.Number_of_components  2
    _Assembly.Organic_ligands       .
    _Assembly.Metal_ions            .
    _Assembly.Paramagnetic          .
    _Assembly.Thiol_state           "not present"
    _Assembly.Molecular_mass        19059.51

    loop_
       _Entity_assembly.ID
       _Entity_assembly.Entity_assembly_name
       _Entity_assembly.Entity_ID
       _Entity_assembly.Entity_label
       _Entity_assembly.Asym_ID
       _Entity_assembly.Details
       _Entity_assembly.Entry_ID
       _Entity_assembly.Assembly_ID

       1 . 1 $Uncharacterized_protein_yvfG A . 1 1 
       2 . 1 $Uncharacterized_protein_yvfG B . 1 1 
    stop_

save_


save_Uncharacterized_protein_yvfG
    _Entity.Sf_category                  entity
    _Entity.Entry_ID                     1
    _Entity.ID                           1
    _Entity.Name                         "Uncharacterized protein yvfG"
    _Entity.Type                         polymer
    _Entity.Polymer_type                 polypeptide(L)
    _Entity.Polymer_seq_one_letter_code  MSELFSVPYFIENLKQHIEMNQSEDKIHAMNSYYRSVVSTLVQDQLTKNAVVLKRIQHLDEAYNKVKRGESKLEHHHHHH
    _Entity.Number_of_monomers           80

    loop_
       _Entity_comp_index.ID
       _Entity_comp_index.Comp_ID
       _Entity_comp_index.Comp_label
       _Entity_comp_index.Entry_ID
       _Entity_comp_index.Entity_ID

        1 MET . 1 1 
        2 SER . 1 1 
        3 GLU . 1 1 
        4 LEU . 1 1 
        5 PHE . 1 1 
        6 SER . 1 1 
        7 VAL . 1 1 
        8 PRO . 1 1 
        9 TYR . 1 1 
       10 PHE . 1 1 
       11 ILE . 1 1 
       12 GLU . 1 1 
       13 ASN . 1 1 
       14 LEU . 1 1 
       15 LYS . 1 1 
       16 GLN . 1 1 
       17 HIS . 1 1 
       18 ILE . 1 1 
       19 GLU . 1 1 
       20 MET . 1 1 
       21 ASN . 1 1 
       22 GLN . 1 1 
       23 SER . 1 1 
       24 GLU . 1 1 
       25 ASP . 1 1 
       26 LYS . 1 1 
       27 ILE . 1 1 
       28 HIS . 1 1 
       29 ALA . 1 1 
       30 MET . 1 1 
       31 ASN . 1 1 
       32 SER . 1 1 
       33 TYR . 1 1 
       34 TYR . 1 1 
       35 ARG . 1 1 
       36 SER . 1 1 
       37 VAL . 1 1 
       38 VAL . 1 1 
       39 SER . 1 1 
       40 THR . 1 1 
       41 LEU . 1 1 
       42 VAL . 1 1 
       43 GLN . 1 1 
       44 ASP . 1 1 
       45 GLN . 1 1 
       46 LEU . 1 1 
       47 THR . 1 1 
       48 LYS . 1 1 
       49 ASN . 1 1 
       50 ALA . 1 1 
       51 VAL . 1 1 
       52 VAL . 1 1 
       53 LEU . 1 1 
       54 LYS . 1 1 
       55 ARG . 1 1 
       56 ILE . 1 1 
       57 GLN . 1 1 
       58 HIS . 1 1 
       59 LEU . 1 1 
       60 ASP . 1 1 
       61 GLU . 1 1 
       62 ALA . 1 1 
       63 TYR . 1 1 
       64 ASN . 1 1 
       65 LYS . 1 1 
       66 VAL . 1 1 
       67 LYS . 1 1 
       68 ARG . 1 1 
       69 GLY . 1 1 
       70 GLU . 1 1 
       71 SER . 1 1 
       72 LYS . 1 1 
       73 LEU . 1 1 
       74 GLU . 1 1 
       75 HIS . 1 1 
       76 HIS . 1 1 
       77 HIS . 1 1 
       78 HIS . 1 1 
       79 HIS . 1 1 
       80 HIS . 1 1 
    stop_

    loop_
       _Entity_poly_seq.Mon_ID
       _Entity_poly_seq.Num
       _Entity_poly_seq.Comp_index_ID
       _Entity_poly_seq.Entry_ID
       _Entity_poly_seq.Entity_ID

       MET  1  1 1 1 
       SER  2  2 1 1 
       GLU  3  3 1 1 
       LEU  4  4 1 1 
       PHE  5  5 1 1 
       SER  6  6 1 1 
       VAL  7  7 1 1 
       PRO  8  8 1 1 
       TYR  9  9 1 1 
       PHE 10 10 1 1 
       ILE 11 11 1 1 
       GLU 12 12 1 1 
       ASN 13 13 1 1 
       LEU 14 14 1 1 
       LYS 15 15 1 1 
       GLN 16 16 1 1 
       HIS 17 17 1 1 
       ILE 18 18 1 1 
       GLU 19 19 1 1 
       MET 20 20 1 1 
       ASN 21 21 1 1 
       GLN 22 22 1 1 
       SER 23 23 1 1 
       GLU 24 24 1 1 
       ASP 25 25 1 1 
       LYS 26 26 1 1 
       ILE 27 27 1 1 
       HIS 28 28 1 1 
       ALA 29 29 1 1 
       MET 30 30 1 1 
       ASN 31 31 1 1 
       SER 32 32 1 1 
       TYR 33 33 1 1 
       TYR 34 34 1 1 
       ARG 35 35 1 1 
       SER 36 36 1 1 
       VAL 37 37 1 1 
       VAL 38 38 1 1 
       SER 39 39 1 1 
       THR 40 40 1 1 
       LEU 41 41 1 1 
       VAL 42 42 1 1 
       GLN 43 43 1 1 
       ASP 44 44 1 1 
       GLN 45 45 1 1 
       LEU 46 46 1 1 
       THR 47 47 1 1 
       LYS 48 48 1 1 
       ASN 49 49 1 1 
       ALA 50 50 1 1 
       VAL 51 51 1 1 
       VAL 52 52 1 1 
       LEU 53 53 1 1 
       LYS 54 54 1 1 
       ARG 55 55 1 1 
       ILE 56 56 1 1 
       GLN 57 57 1 1 
       HIS 58 58 1 1 
       LEU 59 59 1 1 
       ASP 60 60 1 1 
       GLU 61 61 1 1 
       ALA 62 62 1 1 
       TYR 63 63 1 1 
       ASN 64 64 1 1 
       LYS 65 65 1 1 
       VAL 66 66 1 1 
       LYS 67 67 1 1 
       ARG 68 68 1 1 
       GLY 69 69 1 1 
       GLU 70 70 1 1 
       SER 71 71 1 1 
       LYS 72 72 1 1 
       LEU 73 73 1 1 
       GLU 74 74 1 1 
       HIS 75 75 1 1 
       HIS 76 76 1 1 
       HIS 77 77 1 1 
       HIS 78 78 1 1 
       HIS 79 79 1 1 
       HIS 80 80 1 1 
    stop_

save_


save_CNS/XPLOR_distance_constraints_3_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  1
    _Distance_constraint_list.Constraint_type     NOE
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

          1 1 . . . 1 1 
          2 1 . . . 1 1 
          3 1 . . . 1 1 
          4 1 . . . 1 1 
          5 1 . . . 1 1 
          6 1 . . . 1 1 
          7 1 . . . 1 1 
          8 1 . . . 1 1 
          9 1 . . . 1 1 
         10 1 . . . 1 1 
         11 1 . . . 1 1 
         12 1 . . . 1 1 
         13 1 . . . 1 1 
         14 1 . . . 1 1 
         15 1 . . . 1 1 
         16 1 . . . 1 1 
         17 1 . . . 1 1 
         18 1 . . . 1 1 
         19 1 . . . 1 1 
         20 1 . . . 1 1 
         21 1 . . . 1 1 
         22 1 . . . 1 1 
         23 1 . . . 1 1 
         24 1 . . . 1 1 
         25 1 . . . 1 1 
         26 1 . . . 1 1 
         27 1 . . . 1 1 
         28 1 . . . 1 1 
         29 1 . . . 1 1 
         30 1 . . . 1 1 
         31 1 . . . 1 1 
         32 1 . . . 1 1 
         33 1 . . . 1 1 
         34 1 . . . 1 1 
         35 1 . . . 1 1 
         36 1 . . . 1 1 
         37 1 . . . 1 1 
         38 1 . . . 1 1 
         39 1 . . . 1 1 
         40 1 . . . 1 1 
         41 1 . . . 1 1 
         42 1 . . . 1 1 
         43 1 . . . 1 1 
         44 1 . . . 1 1 
         45 1 . . . 1 1 
         46 1 . . . 1 1 
         47 1 . . . 1 1 
         48 1 . . . 1 1 
         49 1 . . . 1 1 
         50 1 . . . 1 1 
         51 1 . . . 1 1 
         52 1 . . . 1 1 
         53 1 . . . 1 1 
         54 1 . . . 1 1 
         55 1 . . . 1 1 
         56 1 . . . 1 1 
         57 1 . . . 1 1 
         58 1 . . . 1 1 
         59 1 . . . 1 1 
         60 1 . . . 1 1 
         61 1 . . . 1 1 
         62 1 . . . 1 1 
         63 1 . . . 1 1 
         64 1 . . . 1 1 
         65 1 . . . 1 1 
         66 1 . . . 1 1 
         67 1 . . . 1 1 
         68 1 . . . 1 1 
         69 1 . . . 1 1 
         70 1 . . . 1 1 
         71 1 . . . 1 1 
         72 1 . . . 1 1 
         73 1 . . . 1 1 
         74 1 . . . 1 1 
         75 1 . . . 1 1 
         76 1 . . . 1 1 
         77 1 . . . 1 1 
         78 1 . . . 1 1 
         79 1 . . . 1 1 
         80 1 . . . 1 1 
         81 1 . . . 1 1 
         82 1 . . . 1 1 
         83 1 . . . 1 1 
         84 1 . . . 1 1 
         85 1 . . . 1 1 
         86 1 . . . 1 1 
         87 1 . . . 1 1 
         88 1 . . . 1 1 
         89 1 . . . 1 1 
         90 1 . . . 1 1 
         91 1 . . . 1 1 
         92 1 . . . 1 1 
         93 1 . . . 1 1 
         94 1 . . . 1 1 
         95 1 . . . 1 1 
         96 1 . . . 1 1 
         97 1 . . . 1 1 
         98 1 . . . 1 1 
         99 1 . . . 1 1 
        100 1 . . . 1 1 
        101 1 . . . 1 1 
        102 1 . . . 1 1 
        103 1 . . . 1 1 
        104 1 . . . 1 1 
        105 1 . . . 1 1 
        106 1 . . . 1 1 
        107 1 . . . 1 1 
        108 1 . . . 1 1 
        109 1 . . . 1 1 
        110 1 . . . 1 1 
        111 1 . . . 1 1 
        112 1 . . . 1 1 
        113 1 . . . 1 1 
        114 1 . . . 1 1 
        115 1 . . . 1 1 
        116 1 . . . 1 1 
        117 1 . . . 1 1 
        118 1 . . . 1 1 
        119 1 . . . 1 1 
        120 1 . . . 1 1 
        121 1 . . . 1 1 
        122 1 . . . 1 1 
        123 1 . . . 1 1 
        124 1 . . . 1 1 
        125 1 . . . 1 1 
        126 1 . . . 1 1 
        127 1 . . . 1 1 
        128 1 . . . 1 1 
        129 1 . . . 1 1 
        130 1 . . . 1 1 
        131 1 . . . 1 1 
        132 1 . . . 1 1 
        133 1 . . . 1 1 
        134 1 . . . 1 1 
        135 1 . . . 1 1 
        136 1 . . . 1 1 
        137 1 . . . 1 1 
        138 1 . . . 1 1 
        139 1 . . . 1 1 
        140 1 . . . 1 1 
        141 1 . . . 1 1 
        142 1 . . . 1 1 
        143 1 . . . 1 1 
        144 1 . . . 1 1 
        145 1 . . . 1 1 
        146 1 . . . 1 1 
        147 1 . . . 1 1 
        148 1 . . . 1 1 
        149 1 . . . 1 1 
        150 1 . . . 1 1 
        151 1 . . . 1 1 
        152 1 . . . 1 1 
        153 1 . . . 1 1 
        154 1 . . . 1 1 
        155 1 . . . 1 1 
        156 1 . . . 1 1 
        157 1 . . . 1 1 
        158 1 . . . 1 1 
        159 1 . . . 1 1 
        160 1 . . . 1 1 
        161 1 . . . 1 1 
        162 1 . . . 1 1 
        163 1 . . . 1 1 
        164 1 . . . 1 1 
        165 1 . . . 1 1 
        166 1 . . . 1 1 
        167 1 . . . 1 1 
        168 1 . . . 1 1 
        169 1 . . . 1 1 
        170 1 . . . 1 1 
        171 1 . . . 1 1 
        172 1 . . . 1 1 
        173 1 . . . 1 1 
        174 1 . . . 1 1 
        175 1 . . . 1 1 
        176 1 . . . 1 1 
        177 1 . . . 1 1 
        178 1 . . . 1 1 
        179 1 . . . 1 1 
        180 1 . . . 1 1 
        181 1 . . . 1 1 
        182 1 . . . 1 1 
        183 1 . . . 1 1 
        184 1 . . . 1 1 
        185 1 . . . 1 1 
        186 1 . . . 1 1 
        187 1 . . . 1 1 
        188 1 . . . 1 1 
        189 1 . . . 1 1 
        190 1 . . . 1 1 
        191 1 . . . 1 1 
        192 1 . . . 1 1 
        193 1 . . . 1 1 
        194 1 . . . 1 1 
        195 1 . . . 1 1 
        196 1 . . . 1 1 
        197 1 . . . 1 1 
        198 1 . . . 1 1 
        199 1 . . . 1 1 
        200 1 . . . 1 1 
        201 1 . . . 1 1 
        202 1 . . . 1 1 
        203 1 . . . 1 1 
        204 1 . . . 1 1 
        205 1 . . . 1 1 
        206 1 . . . 1 1 
        207 1 . . . 1 1 
        208 1 . . . 1 1 
        209 1 . . . 1 1 
        210 1 . . . 1 1 
        211 1 . . . 1 1 
        212 1 . . . 1 1 
        213 1 . . . 1 1 
        214 1 . . . 1 1 
        215 1 . . . 1 1 
        216 1 . . . 1 1 
        217 1 . . . 1 1 
        218 1 . . . 1 1 
        219 1 . . . 1 1 
        220 1 . . . 1 1 
        221 1 . . . 1 1 
        222 1 . . . 1 1 
        223 1 . . . 1 1 
        224 1 . . . 1 1 
        225 1 . . . 1 1 
        226 1 . . . 1 1 
        227 1 . . . 1 1 
        228 1 . . . 1 1 
        229 1 . . . 1 1 
        230 1 . . . 1 1 
        231 1 . . . 1 1 
        232 1 . . . 1 1 
        233 1 . . . 1 1 
        234 1 . . . 1 1 
        235 1 . . . 1 1 
        236 1 . . . 1 1 
        237 1 . . . 1 1 
        238 1 . . . 1 1 
        239 1 . . . 1 1 
        240 1 . . . 1 1 
        241 1 . . . 1 1 
        242 1 . . . 1 1 
        243 1 . . . 1 1 
        244 1 . . . 1 1 
        245 1 . . . 1 1 
        246 1 . . . 1 1 
        247 1 . . . 1 1 
        248 1 . . . 1 1 
        249 1 . . . 1 1 
        250 1 . . . 1 1 
        251 1 . . . 1 1 
        252 1 . . . 1 1 
        253 1 . . . 1 1 
        254 1 . . . 1 1 
        255 1 . . . 1 1 
        256 1 . . . 1 1 
        257 1 . . . 1 1 
        258 1 . . . 1 1 
        259 1 . . . 1 1 
        260 1 . . . 1 1 
        261 1 . . . 1 1 
        262 1 . . . 1 1 
        263 1 . . . 1 1 
        264 1 . . . 1 1 
        265 1 . . . 1 1 
        266 1 . . . 1 1 
        267 1 . . . 1 1 
        268 1 . . . 1 1 
        269 1 . . . 1 1 
        270 1 . . . 1 1 
        271 1 . . . 1 1 
        272 1 . . . 1 1 
        273 1 . . . 1 1 
        274 1 . . . 1 1 
        275 1 . . . 1 1 
        276 1 . . . 1 1 
        277 1 . . . 1 1 
        278 1 . . . 1 1 
        279 1 . . . 1 1 
        280 1 . . . 1 1 
        281 1 . . . 1 1 
        282 1 . . . 1 1 
        283 1 . . . 1 1 
        284 1 . . . 1 1 
        285 1 . . . 1 1 
        286 1 . . . 1 1 
        287 1 . . . 1 1 
        288 1 . . . 1 1 
        289 1 . . . 1 1 
        290 1 . . . 1 1 
        291 1 . . . 1 1 
        292 1 . . . 1 1 
        293 1 . . . 1 1 
        294 1 . . . 1 1 
        295 1 . . . 1 1 
        296 1 . . . 1 1 
        297 1 . . . 1 1 
        298 1 . . . 1 1 
        299 1 . . . 1 1 
        300 1 . . . 1 1 
        301 1 . . . 1 1 
        302 1 . . . 1 1 
        303 1 . . . 1 1 
        304 1 . . . 1 1 
        305 1 . . . 1 1 
        306 1 . . . 1 1 
        307 1 . . . 1 1 
        308 1 . . . 1 1 
        309 1 . . . 1 1 
        310 1 . . . 1 1 
        311 1 . . . 1 1 
        312 1 . . . 1 1 
        313 1 . . . 1 1 
        314 1 . . . 1 1 
        315 1 . . . 1 1 
        316 1 . . . 1 1 
        317 1 . . . 1 1 
        318 1 . . . 1 1 
        319 1 . . . 1 1 
        320 1 . . . 1 1 
        321 1 . . . 1 1 
        322 1 . . . 1 1 
        323 1 . . . 1 1 
        324 1 . . . 1 1 
        325 1 . . . 1 1 
        326 1 . . . 1 1 
        327 1 . . . 1 1 
        328 1 . . . 1 1 
        329 1 . . . 1 1 
        330 1 . . . 1 1 
        331 1 . . . 1 1 
        332 1 . . . 1 1 
        333 1 . . . 1 1 
        334 1 . . . 1 1 
        335 1 . . . 1 1 
        336 1 . . . 1 1 
        337 1 . . . 1 1 
        338 1 . . . 1 1 
        339 1 . . . 1 1 
        340 1 . . . 1 1 
        341 1 . . . 1 1 
        342 1 . . . 1 1 
        343 1 . . . 1 1 
        344 1 . . . 1 1 
        345 1 . . . 1 1 
        346 1 . . . 1 1 
        347 1 . . . 1 1 
        348 1 . . . 1 1 
        349 1 . . . 1 1 
        350 1 . . . 1 1 
        351 1 . . . 1 1 
        352 1 . . . 1 1 
        353 1 . . . 1 1 
        354 1 . . . 1 1 
        355 1 . . . 1 1 
        356 1 . . . 1 1 
        357 1 . . . 1 1 
        358 1 . . . 1 1 
        359 1 . . . 1 1 
        360 1 . . . 1 1 
        361 1 . . . 1 1 
        362 1 . . . 1 1 
        363 1 . . . 1 1 
        364 1 . . . 1 1 
        365 1 . . . 1 1 
        366 1 . . . 1 1 
        367 1 . . . 1 1 
        368 1 . . . 1 1 
        369 1 . . . 1 1 
        370 1 . . . 1 1 
        371 1 . . . 1 1 
        372 1 . . . 1 1 
        373 1 . . . 1 1 
        374 1 . . . 1 1 
        375 1 . . . 1 1 
        376 1 . . . 1 1 
        377 1 . . . 1 1 
        378 1 . . . 1 1 
        379 1 . . . 1 1 
        380 1 . . . 1 1 
        381 1 . . . 1 1 
        382 1 . . . 1 1 
        383 1 . . . 1 1 
        384 1 . . . 1 1 
        385 1 . . . 1 1 
        386 1 . . . 1 1 
        387 1 . . . 1 1 
        388 1 . . . 1 1 
        389 1 . . . 1 1 
        390 1 . . . 1 1 
        391 1 . . . 1 1 
        392 1 . . . 1 1 
        393 1 . . . 1 1 
        394 1 . . . 1 1 
        395 1 . . . 1 1 
        396 1 . . . 1 1 
        397 1 . . . 1 1 
        398 1 . . . 1 1 
        399 1 . . . 1 1 
        400 1 . . . 1 1 
        401 1 . . . 1 1 
        402 1 . . . 1 1 
        403 1 . . . 1 1 
        404 1 . . . 1 1 
        405 1 . . . 1 1 
        406 1 . . . 1 1 
        407 1 . . . 1 1 
        408 1 . . . 1 1 
        409 1 . . . 1 1 
        410 1 . . . 1 1 
        411 1 . . . 1 1 
        412 1 . . . 1 1 
        413 1 . . . 1 1 
        414 1 . . . 1 1 
        415 1 . . . 1 1 
        416 1 . . . 1 1 
        417 1 . . . 1 1 
        418 1 . . . 1 1 
        419 1 . . . 1 1 
        420 1 . . . 1 1 
        421 1 . . . 1 1 
        422 1 . . . 1 1 
        423 1 . . . 1 1 
        424 1 . . . 1 1 
        425 1 . . . 1 1 
        426 1 . . . 1 1 
        427 1 . . . 1 1 
        428 1 . . . 1 1 
        429 1 . . . 1 1 
        430 1 . . . 1 1 
        431 1 . . . 1 1 
        432 1 . . . 1 1 
        433 1 . . . 1 1 
        434 1 . . . 1 1 
        435 1 . . . 1 1 
        436 1 . . . 1 1 
        437 1 . . . 1 1 
        438 1 . . . 1 1 
        439 1 . . . 1 1 
        440 1 . . . 1 1 
        441 1 . . . 1 1 
        442 1 . . . 1 1 
        443 1 . . . 1 1 
        444 1 . . . 1 1 
        445 1 . . . 1 1 
        446 1 . . . 1 1 
        447 1 . . . 1 1 
        448 1 . . . 1 1 
        449 1 . . . 1 1 
        450 1 . . . 1 1 
        451 1 . . . 1 1 
        452 1 . . . 1 1 
        453 1 . . . 1 1 
        454 1 . . . 1 1 
        455 1 . . . 1 1 
        456 1 . . . 1 1 
        457 1 . . . 1 1 
        458 1 . . . 1 1 
        459 1 . . . 1 1 
        460 1 . . . 1 1 
        461 1 . . . 1 1 
        462 1 . . . 1 1 
        463 1 . . . 1 1 
        464 1 . . . 1 1 
        465 1 . . . 1 1 
        466 1 . . . 1 1 
        467 1 . . . 1 1 
        468 1 . . . 1 1 
        469 1 . . . 1 1 
        470 1 . . . 1 1 
        471 1 . . . 1 1 
        472 1 . . . 1 1 
        473 1 . . . 1 1 
        474 1 . . . 1 1 
        475 1 . . . 1 1 
        476 1 . . . 1 1 
        477 1 . . . 1 1 
        478 1 . . . 1 1 
        479 1 . . . 1 1 
        480 1 . . . 1 1 
        481 1 . . . 1 1 
        482 1 . . . 1 1 
        483 1 . . . 1 1 
        484 1 . . . 1 1 
        485 1 . . . 1 1 
        486 1 . . . 1 1 
        487 1 . . . 1 1 
        488 1 . . . 1 1 
        489 1 . . . 1 1 
        490 1 . . . 1 1 
        491 1 . . . 1 1 
        492 1 . . . 1 1 
        493 1 . . . 1 1 
        494 1 . . . 1 1 
        495 1 . . . 1 1 
        496 1 . . . 1 1 
        497 1 . . . 1 1 
        498 1 . . . 1 1 
        499 1 . . . 1 1 
        500 1 . . . 1 1 
        501 1 . . . 1 1 
        502 1 . . . 1 1 
        503 1 . . . 1 1 
        504 1 . . . 1 1 
        505 1 . . . 1 1 
        506 1 . . . 1 1 
        507 1 . . . 1 1 
        508 1 . . . 1 1 
        509 1 . . . 1 1 
        510 1 . . . 1 1 
        511 1 . . . 1 1 
        512 1 . . . 1 1 
        513 1 . . . 1 1 
        514 1 . . . 1 1 
        515 1 . . . 1 1 
        516 1 . . . 1 1 
        517 1 . . . 1 1 
        518 1 . . . 1 1 
        519 1 . . . 1 1 
        520 1 . . . 1 1 
        521 1 . . . 1 1 
        522 1 . . . 1 1 
        523 1 . . . 1 1 
        524 1 . . . 1 1 
        525 1 . . . 1 1 
        526 1 . . . 1 1 
        527 1 . . . 1 1 
        528 1 . . . 1 1 
        529 1 . . . 1 1 
        530 1 . . . 1 1 
        531 1 . . . 1 1 
        532 1 . . . 1 1 
        533 1 . . . 1 1 
        534 1 . . . 1 1 
        535 1 . . . 1 1 
        536 1 . . . 1 1 
        537 1 . . . 1 1 
        538 1 . . . 1 1 
        539 1 . . . 1 1 
        540 1 . . . 1 1 
        541 1 . . . 1 1 
        542 1 . . . 1 1 
        543 1 . . . 1 1 
        544 1 . . . 1 1 
        545 1 . . . 1 1 
        546 1 . . . 1 1 
        547 1 . . . 1 1 
        548 1 . . . 1 1 
        549 1 . . . 1 1 
        550 1 . . . 1 1 
        551 1 . . . 1 1 
        552 1 . . . 1 1 
        553 1 . . . 1 1 
        554 1 . . . 1 1 
        555 1 . . . 1 1 
        556 1 . . . 1 1 
        557 1 . . . 1 1 
        558 1 . . . 1 1 
        559 1 . . . 1 1 
        560 1 . . . 1 1 
        561 1 . . . 1 1 
        562 1 . . . 1 1 
        563 1 . . . 1 1 
        564 1 . . . 1 1 
        565 1 . . . 1 1 
        566 1 . . . 1 1 
        567 1 . . . 1 1 
        568 1 . . . 1 1 
        569 1 . . . 1 1 
        570 1 . . . 1 1 
        571 1 . . . 1 1 
        572 1 . . . 1 1 
        573 1 . . . 1 1 
        574 1 . . . 1 1 
        575 1 . . . 1 1 
        576 1 . . . 1 1 
        577 1 . . . 1 1 
        578 1 . . . 1 1 
        579 1 . . . 1 1 
        580 1 . . . 1 1 
        581 1 . . . 1 1 
        582 1 . . . 1 1 
        583 1 . . . 1 1 
        584 1 . . . 1 1 
        585 1 . . . 1 1 
        586 1 . . . 1 1 
        587 1 . . . 1 1 
        588 1 . . . 1 1 
        589 1 . . . 1 1 
        590 1 . . . 1 1 
        591 1 . . . 1 1 
        592 1 . . . 1 1 
        593 1 . . . 1 1 
        594 1 . . . 1 1 
        595 1 . . . 1 1 
        596 1 . . . 1 1 
        597 1 . . . 1 1 
        598 1 . . . 1 1 
        599 1 . . . 1 1 
        600 1 . . . 1 1 
        601 1 . . . 1 1 
        602 1 . . . 1 1 
        603 1 . . . 1 1 
        604 1 . . . 1 1 
        605 1 . . . 1 1 
        606 1 . . . 1 1 
        607 1 . . . 1 1 
        608 1 . . . 1 1 
        609 1 . . . 1 1 
        610 1 . . . 1 1 
        611 1 . . . 1 1 
        612 1 . . . 1 1 
        613 1 . . . 1 1 
        614 1 . . . 1 1 
        615 1 . . . 1 1 
        616 1 . . . 1 1 
        617 1 . . . 1 1 
        618 1 . . . 1 1 
        619 1 . . . 1 1 
        620 1 . . . 1 1 
        621 1 . . . 1 1 
        622 1 . . . 1 1 
        623 1 . . . 1 1 
        624 1 . . . 1 1 
        625 1 . . . 1 1 
        626 1 . . . 1 1 
        627 1 . . . 1 1 
        628 1 . . . 1 1 
        629 1 . . . 1 1 
        630 1 . . . 1 1 
        631 1 . . . 1 1 
        632 1 . . . 1 1 
        633 1 . . . 1 1 
        634 1 . . . 1 1 
        635 1 . . . 1 1 
        636 1 . . . 1 1 
        637 1 . . . 1 1 
        638 1 . . . 1 1 
        639 1 . . . 1 1 
        640 1 . . . 1 1 
        641 1 . . . 1 1 
        642 1 . . . 1 1 
        643 1 . . . 1 1 
        644 1 . . . 1 1 
        645 1 . . . 1 1 
        646 1 . . . 1 1 
        647 1 . . . 1 1 
        648 1 . . . 1 1 
        649 1 . . . 1 1 
        650 1 . . . 1 1 
        651 1 . . . 1 1 
        652 1 . . . 1 1 
        653 1 . . . 1 1 
        654 1 . . . 1 1 
        655 1 . . . 1 1 
        656 1 . . . 1 1 
        657 1 . . . 1 1 
        658 1 . . . 1 1 
        659 1 . . . 1 1 
        660 1 . . . 1 1 
        661 1 . . . 1 1 
        662 1 . . . 1 1 
        663 1 . . . 1 1 
        664 1 . . . 1 1 
        665 1 . . . 1 1 
        666 1 . . . 1 1 
        667 1 . . . 1 1 
        668 1 . . . 1 1 
        669 1 . . . 1 1 
        670 1 . . . 1 1 
        671 1 . . . 1 1 
        672 1 . . . 1 1 
        673 1 . . . 1 1 
        674 1 . . . 1 1 
        675 1 . . . 1 1 
        676 1 . . . 1 1 
        677 1 . . . 1 1 
        678 1 . . . 1 1 
        679 1 . . . 1 1 
        680 1 . . . 1 1 
        681 1 . . . 1 1 
        682 1 . . . 1 1 
        683 1 . . . 1 1 
        684 1 . . . 1 1 
        685 1 . . . 1 1 
        686 1 . . . 1 1 
        687 1 . . . 1 1 
        688 1 . . . 1 1 
        689 1 . . . 1 1 
        690 1 . . . 1 1 
        691 1 . . . 1 1 
        692 1 . . . 1 1 
        693 1 . . . 1 1 
        694 1 . . . 1 1 
        695 1 . . . 1 1 
        696 1 . . . 1 1 
        697 1 . . . 1 1 
        698 1 . . . 1 1 
        699 1 . . . 1 1 
        700 1 . . . 1 1 
        701 1 . . . 1 1 
        702 1 . . . 1 1 
        703 1 . . . 1 1 
        704 1 . . . 1 1 
        705 1 . . . 1 1 
        706 1 . . . 1 1 
        707 1 . . . 1 1 
        708 1 . . . 1 1 
        709 1 . . . 1 1 
        710 1 . . . 1 1 
        711 1 . . . 1 1 
        712 1 . . . 1 1 
        713 1 . . . 1 1 
        714 1 . . . 1 1 
        715 1 . . . 1 1 
        716 1 . . . 1 1 
        717 1 . . . 1 1 
        718 1 . . . 1 1 
        719 1 . . . 1 1 
        720 1 . . . 1 1 
        721 1 . . . 1 1 
        722 1 . . . 1 1 
        723 1 . . . 1 1 
        724 1 . . . 1 1 
        725 1 . . . 1 1 
        726 1 . . . 1 1 
        727 1 . . . 1 1 
        728 1 . . . 1 1 
        729 1 . . . 1 1 
        730 1 . . . 1 1 
        731 1 . . . 1 1 
        732 1 . . . 1 1 
        733 1 . . . 1 1 
        734 1 . . . 1 1 
        735 1 . . . 1 1 
        736 1 . . . 1 1 
        737 1 . . . 1 1 
        738 1 . . . 1 1 
        739 1 . . . 1 1 
        740 1 . . . 1 1 
        741 1 . . . 1 1 
        742 1 . . . 1 1 
        743 1 . . . 1 1 
        744 1 . . . 1 1 
        745 1 . . . 1 1 
        746 1 . . . 1 1 
        747 1 . . . 1 1 
        748 1 . . . 1 1 
        749 1 . . . 1 1 
        750 1 . . . 1 1 
        751 1 . . . 1 1 
        752 1 . . . 1 1 
        753 1 . . . 1 1 
        754 1 . . . 1 1 
        755 1 . . . 1 1 
        756 1 . . . 1 1 
        757 1 . . . 1 1 
        758 1 . . . 1 1 
        759 1 . . . 1 1 
        760 1 . . . 1 1 
        761 1 . . . 1 1 
        762 1 . . . 1 1 
        763 1 . . . 1 1 
        764 1 . . . 1 1 
        765 1 . . . 1 1 
        766 1 . . . 1 1 
        767 1 . . . 1 1 
        768 1 . . . 1 1 
        769 1 . . . 1 1 
        770 1 . . . 1 1 
        771 1 . . . 1 1 
        772 1 . . . 1 1 
        773 1 . . . 1 1 
        774 1 . . . 1 1 
        775 1 . . . 1 1 
        776 1 . . . 1 1 
        777 1 . . . 1 1 
        778 1 . . . 1 1 
        779 1 . . . 1 1 
        780 1 . . . 1 1 
        781 1 . . . 1 1 
        782 1 . . . 1 1 
        783 1 . . . 1 1 
        784 1 . . . 1 1 
        785 1 . . . 1 1 
        786 1 . . . 1 1 
        787 1 . . . 1 1 
        788 1 . . . 1 1 
        789 1 . . . 1 1 
        790 1 . . . 1 1 
        791 1 . . . 1 1 
        792 1 . . . 1 1 
        793 1 . . . 1 1 
        794 1 . . . 1 1 
        795 1 . . . 1 1 
        796 1 . . . 1 1 
        797 1 . . . 1 1 
        798 1 . . . 1 1 
        799 1 . . . 1 1 
        800 1 . . . 1 1 
        801 1 . . . 1 1 
        802 1 . . . 1 1 
        803 1 . . . 1 1 
        804 1 . . . 1 1 
        805 1 . . . 1 1 
        806 1 . . . 1 1 
        807 1 . . . 1 1 
        808 1 . . . 1 1 
        809 1 . . . 1 1 
        810 1 . . . 1 1 
        811 1 . . . 1 1 
        812 1 . . . 1 1 
        813 1 . . . 1 1 
        814 1 . . . 1 1 
        815 1 . . . 1 1 
        816 1 . . . 1 1 
        817 1 . . . 1 1 
        818 1 . . . 1 1 
        819 1 . . . 1 1 
        820 1 . . . 1 1 
        821 1 . . . 1 1 
        822 1 . . . 1 1 
        823 1 . . . 1 1 
        824 1 . . . 1 1 
        825 1 . . . 1 1 
        826 1 . . . 1 1 
        827 1 . . . 1 1 
        828 1 . . . 1 1 
        829 1 . . . 1 1 
        830 1 . . . 1 1 
        831 1 . . . 1 1 
        832 1 . . . 1 1 
        833 1 . . . 1 1 
        834 1 . . . 1 1 
        835 1 . . . 1 1 
        836 1 . . . 1 1 
        837 1 . . . 1 1 
        838 1 . . . 1 1 
        839 1 . . . 1 1 
        840 1 . . . 1 1 
        841 1 . . . 1 1 
        842 1 . . . 1 1 
        843 1 . . . 1 1 
        844 1 . . . 1 1 
        845 1 . . . 1 1 
        846 1 . . . 1 1 
        847 1 . . . 1 1 
        848 1 . . . 1 1 
        849 1 . . . 1 1 
        850 1 . . . 1 1 
        851 1 . . . 1 1 
        852 1 . . . 1 1 
        853 1 . . . 1 1 
        854 1 . . . 1 1 
        855 1 . . . 1 1 
        856 1 . . . 1 1 
        857 1 . . . 1 1 
        858 1 . . . 1 1 
        859 1 . . . 1 1 
        860 1 . . . 1 1 
        861 1 . . . 1 1 
        862 1 . . . 1 1 
        863 1 . . . 1 1 
        864 1 . . . 1 1 
        865 1 . . . 1 1 
        866 1 . . . 1 1 
        867 1 . . . 1 1 
        868 1 . . . 1 1 
        869 1 . . . 1 1 
        870 1 . . . 1 1 
        871 1 . . . 1 1 
        872 1 . . . 1 1 
        873 1 . . . 1 1 
        874 1 . . . 1 1 
        875 1 . . . 1 1 
        876 1 . . . 1 1 
        877 1 . . . 1 1 
        878 1 . . . 1 1 
        879 1 . . . 1 1 
        880 1 . . . 1 1 
        881 1 . . . 1 1 
        882 1 . . . 1 1 
        883 1 . . . 1 1 
        884 1 . . . 1 1 
        885 1 . . . 1 1 
        886 1 . . . 1 1 
        887 1 . . . 1 1 
        888 1 . . . 1 1 
        889 1 . . . 1 1 
        890 1 . . . 1 1 
        891 1 . . . 1 1 
        892 1 . . . 1 1 
        893 1 . . . 1 1 
        894 1 . . . 1 1 
        895 1 . . . 1 1 
        896 1 . . . 1 1 
        897 1 . . . 1 1 
        898 1 . . . 1 1 
        899 1 . . . 1 1 
        900 1 . . . 1 1 
        901 1 . . . 1 1 
        902 1 . . . 1 1 
        903 1 . . . 1 1 
        904 1 . . . 1 1 
        905 1 . . . 1 1 
        906 1 . . . 1 1 
        907 1 . . . 1 1 
        908 1 . . . 1 1 
        909 1 . . . 1 1 
        910 1 . . . 1 1 
        911 1 . . . 1 1 
        912 1 . . . 1 1 
        913 1 . . . 1 1 
        914 1 . . . 1 1 
        915 1 . . . 1 1 
        916 1 . . . 1 1 
        917 1 . . . 1 1 
        918 1 . . . 1 1 
        919 1 . . . 1 1 
        920 1 . . . 1 1 
        921 1 . . . 1 1 
        922 1 . . . 1 1 
        923 1 . . . 1 1 
        924 1 . . . 1 1 
        925 1 . . . 1 1 
        926 1 . . . 1 1 
        927 1 . . . 1 1 
        928 1 . . . 1 1 
        929 1 . . . 1 1 
        930 1 . . . 1 1 
        931 1 . . . 1 1 
        932 1 . . . 1 1 
        933 1 . . . 1 1 
        934 1 . . . 1 1 
        935 1 . . . 1 1 
        936 1 . . . 1 1 
        937 1 . . . 1 1 
        938 1 . . . 1 1 
        939 1 . . . 1 1 
        940 1 . . . 1 1 
        941 1 . . . 1 1 
        942 1 . . . 1 1 
        943 1 . . . 1 1 
        944 1 . . . 1 1 
        945 1 . . . 1 1 
        946 1 . . . 1 1 
        947 1 . . . 1 1 
        948 1 . . . 1 1 
        949 1 . . . 1 1 
        950 1 . . . 1 1 
        951 1 . . . 1 1 
        952 1 . . . 1 1 
        953 1 . . . 1 1 
        954 1 . . . 1 1 
        955 1 . . . 1 1 
        956 1 . . . 1 1 
        957 1 . . . 1 1 
        958 1 . . . 1 1 
        959 1 . . . 1 1 
        960 1 . . . 1 1 
        961 1 . . . 1 1 
        962 1 . . . 1 1 
        963 1 . . . 1 1 
        964 1 . . . 1 1 
        965 1 . . . 1 1 
        966 1 . . . 1 1 
        967 1 . . . 1 1 
        968 1 . . . 1 1 
        969 1 . . . 1 1 
        970 1 . . . 1 1 
        971 1 . . . 1 1 
        972 1 . . . 1 1 
        973 1 . . . 1 1 
        974 1 . . . 1 1 
        975 1 . . . 1 1 
        976 1 . . . 1 1 
        977 1 . . . 1 1 
        978 1 . . . 1 1 
        979 1 . . . 1 1 
        980 1 . . . 1 1 
        981 1 . . . 1 1 
        982 1 . . . 1 1 
        983 1 . . . 1 1 
        984 1 . . . 1 1 
        985 1 . . . 1 1 
        986 1 . . . 1 1 
        987 1 . . . 1 1 
        988 1 . . . 1 1 
        989 1 . . . 1 1 
        990 1 . . . 1 1 
        991 1 . . . 1 1 
        992 1 . . . 1 1 
        993 1 . . . 1 1 
        994 1 . . . 1 1 
        995 1 . . . 1 1 
        996 1 . . . 1 1 
        997 1 . . . 1 1 
        998 1 . . . 1 1 
        999 1 . . . 1 1 
       1000 1 . . . 1 1 
       1001 1 . . . 1 1 
       1002 1 . . . 1 1 
       1003 1 . . . 1 1 
       1004 1 . . . 1 1 
       1005 1 . . . 1 1 
       1006 1 . . . 1 1 
       1007 1 . . . 1 1 
       1008 1 . . . 1 1 
       1009 1 . . . 1 1 
       1010 1 . . . 1 1 
       1011 1 . . . 1 1 
       1012 1 . . . 1 1 
       1013 1 . . . 1 1 
       1014 1 . . . 1 1 
       1015 1 . . . 1 1 
       1016 1 . . . 1 1 
       1017 1 . . . 1 1 
       1018 1 . . . 1 1 
       1019 1 . . . 1 1 
       1020 1 . . . 1 1 
       1021 1 . . . 1 1 
       1022 1 . . . 1 1 
       1023 1 . . . 1 1 
       1024 1 . . . 1 1 
       1025 1 . . . 1 1 
       1026 1 . . . 1 1 
       1027 1 . . . 1 1 
       1028 1 . . . 1 1 
       1029 1 . . . 1 1 
       1030 1 . . . 1 1 
       1031 1 . . . 1 1 
       1032 1 . . . 1 1 
       1033 1 . . . 1 1 
       1034 1 . . . 1 1 
       1035 1 . . . 1 1 
       1036 1 . . . 1 1 
       1037 1 . . . 1 1 
       1038 1 . . . 1 1 
       1039 1 . . . 1 1 
       1040 1 . . . 1 1 
       1041 1 . . . 1 1 
       1042 1 . . . 1 1 
       1043 1 . . . 1 1 
       1044 1 . . . 1 1 
       1045 1 . . . 1 1 
       1046 1 . . . 1 1 
       1047 1 . . . 1 1 
       1048 1 . . . 1 1 
       1049 1 . . . 1 1 
       1050 1 . . . 1 1 
       1051 1 . . . 1 1 
       1052 1 . . . 1 1 
       1053 1 . . . 1 1 
       1054 1 . . . 1 1 
       1055 1 . . . 1 1 
       1056 1 . . . 1 1 
       1057 1 . . . 1 1 
       1058 1 . . . 1 1 
       1059 1 . . . 1 1 
       1060 1 . . . 1 1 
       1061 1 . . . 1 1 
       1062 1 . . . 1 1 
       1063 1 . . . 1 1 
       1064 1 . . . 1 1 
       1065 1 . . . 1 1 
       1066 1 . . . 1 1 
       1067 1 . . . 1 1 
       1068 1 . . . 1 1 
       1069 1 . . . 1 1 
       1070 1 . . . 1 1 
       1071 1 . . . 1 1 
       1072 1 . . . 1 1 
       1073 1 . . . 1 1 
       1074 1 . . . 1 1 
       1075 1 . . . 1 1 
       1076 1 . . . 1 1 
       1077 1 . . . 1 1 
       1078 1 . . . 1 1 
       1079 1 . . . 1 1 
       1080 1 . . . 1 1 
       1081 1 . . . 1 1 
       1082 1 . . . 1 1 
       1083 1 . . . 1 1 
       1084 1 . . . 1 1 
       1085 1 . . . 1 1 
       1086 1 . . . 1 1 
       1087 1 . . . 1 1 
       1088 1 . . . 1 1 
       1089 1 . . . 1 1 
       1090 1 . . . 1 1 
       1091 1 . . . 1 1 
       1092 1 . . . 1 1 
       1093 1 . . . 1 1 
       1094 1 . . . 1 1 
       1095 1 . . . 1 1 
       1096 1 . . . 1 1 
       1097 1 . . . 1 1 
       1098 1 . . . 1 1 
       1099 1 . . . 1 1 
       1100 1 . . . 1 1 
       1101 1 . . . 1 1 
       1102 1 . . . 1 1 
       1103 1 . . . 1 1 
       1104 1 . . . 1 1 
       1105 1 . . . 1 1 
       1106 1 . . . 1 1 
       1107 1 . . . 1 1 
       1108 1 . . . 1 1 
       1109 1 . . . 1 1 
       1110 1 . . . 1 1 
       1111 1 . . . 1 1 
       1112 1 . . . 1 1 
       1113 1 . . . 1 1 
       1114 1 . . . 1 1 
       1115 1 . . . 1 1 
       1116 1 . . . 1 1 
       1117 1 . . . 1 1 
       1118 1 . . . 1 1 
       1119 1 . . . 1 1 
       1120 1 . . . 1 1 
       1121 1 . . . 1 1 
       1122 1 . . . 1 1 
       1123 1 . . . 1 1 
       1124 1 . . . 1 1 
       1125 1 . . . 1 1 
       1126 1 . . . 1 1 
       1127 1 . . . 1 1 
       1128 1 . . . 1 1 
       1129 1 . . . 1 1 
       1130 1 . . . 1 1 
       1131 1 . . . 1 1 
       1132 1 . . . 1 1 
       1133 1 . . . 1 1 
       1134 1 . . . 1 1 
       1135 1 . . . 1 1 
       1136 1 . . . 1 1 
       1137 1 . . . 1 1 
       1138 1 . . . 1 1 
       1139 1 . . . 1 1 
       1140 1 . . . 1 1 
       1141 1 . . . 1 1 
       1142 1 . . . 1 1 
       1143 1 . . . 1 1 
       1144 1 . . . 1 1 
       1145 1 . . . 1 1 
       1146 1 . . . 1 1 
       1147 1 . . . 1 1 
       1148 1 . . . 1 1 
       1149 1 . . . 1 1 
       1150 1 . . . 1 1 
       1151 1 . . . 1 1 
       1152 1 . . . 1 1 
       1153 1 . . . 1 1 
       1154 1 . . . 1 1 
       1155 1 . . . 1 1 
       1156 1 . . . 1 1 
       1157 1 . . . 1 1 
       1158 1 . . . 1 1 
       1159 1 . . . 1 1 
       1160 1 . . . 1 1 
       1161 1 . . . 1 1 
       1162 1 . . . 1 1 
       1163 1 . . . 1 1 
       1164 1 . . . 1 1 
       1165 1 . . . 1 1 
       1166 1 . . . 1 1 
       1167 1 . . . 1 1 
       1168 1 . . . 1 1 
       1169 1 . . . 1 1 
       1170 1 . . . 1 1 
       1171 1 . . . 1 1 
       1172 1 . . . 1 1 
       1173 1 . . . 1 1 
       1174 1 . . . 1 1 
       1175 1 . . . 1 1 
       1176 1 . . . 1 1 
       1177 1 . . . 1 1 
       1178 1 . . . 1 1 
       1179 1 . . . 1 1 
       1180 1 . . . 1 1 
       1181 1 . . . 1 1 
       1182 1 . . . 1 1 
       1183 1 . . . 1 1 
       1184 1 . . . 1 1 
       1185 1 . . . 1 1 
       1186 1 . . . 1 1 
       1187 1 . . . 1 1 
       1188 1 . . . 1 1 
       1189 1 . . . 1 1 
       1190 1 . . . 1 1 
       1191 1 . . . 1 1 
       1192 1 . . . 1 1 
       1193 1 . . . 1 1 
       1194 1 . . . 1 1 
       1195 1 . . . 1 1 
       1196 1 . . . 1 1 
       1197 1 . . . 1 1 
       1198 1 . . . 1 1 
       1199 1 . . . 1 1 
       1200 1 . . . 1 1 
       1201 1 . . . 1 1 
       1202 1 . . . 1 1 
       1203 1 . . . 1 1 
       1204 1 . . . 1 1 
       1205 1 . . . 1 1 
       1206 1 . . . 1 1 
       1207 1 . . . 1 1 
       1208 1 . . . 1 1 
       1209 1 . . . 1 1 
       1210 1 . . . 1 1 
       1211 1 . . . 1 1 
       1212 1 . . . 1 1 
       1213 1 . . . 1 1 
       1214 1 . . . 1 1 
       1215 1 . . . 1 1 
       1216 1 . . . 1 1 
       1217 1 . . . 1 1 
       1218 1 . . . 1 1 
       1219 1 . . . 1 1 
       1220 1 . . . 1 1 
       1221 1 . . . 1 1 
       1222 1 . . . 1 1 
       1223 1 . . . 1 1 
       1224 1 . . . 1 1 
       1225 1 . . . 1 1 
       1226 1 . . . 1 1 
       1227 1 . . . 1 1 
       1228 1 . . . 1 1 
       1229 1 . . . 1 1 
       1230 1 . . . 1 1 
       1231 1 . . . 1 1 
       1232 1 . . . 1 1 
       1233 1 . . . 1 1 
       1234 1 . . . 1 1 
       1235 1 . . . 1 1 
       1236 1 . . . 1 1 
       1237 1 . . . 1 1 
       1238 1 . . . 1 1 
       1239 1 . . . 1 1 
       1240 1 . . . 1 1 
       1241 1 . . . 1 1 
       1242 1 . . . 1 1 
       1243 1 . . . 1 1 
       1244 1 . . . 1 1 
       1245 1 . . . 1 1 
       1246 1 . . . 1 1 
       1247 1 . . . 1 1 
       1248 1 . . . 1 1 
       1249 1 . . . 1 1 
       1250 1 . . . 1 1 
       1251 1 . . . 1 1 
       1252 1 . . . 1 1 
       1253 1 . . . 1 1 
       1254 1 . . . 1 1 
       1255 1 . . . 1 1 
       1256 1 . . . 1 1 
       1257 1 . . . 1 1 
       1258 1 . . . 1 1 
       1259 1 . . . 1 1 
       1260 1 . . . 1 1 
       1261 1 . . . 1 1 
       1262 1 . . . 1 1 
       1263 1 . . . 1 1 
       1264 1 . . . 1 1 
       1265 1 . . . 1 1 
       1266 1 . . . 1 1 
       1267 1 . . . 1 1 
       1268 1 . . . 1 1 
       1269 1 . . . 1 1 
       1270 1 . . . 1 1 
       1271 1 . . . 1 1 
       1272 1 . . . 1 1 
       1273 1 . . . 1 1 
       1274 1 . . . 1 1 
       1275 1 . . . 1 1 
       1276 1 . . . 1 1 
       1277 1 . . . 1 1 
       1278 1 . . . 1 1 
       1279 1 . . . 1 1 
       1280 1 . . . 1 1 
       1281 1 . . . 1 1 
       1282 1 . . . 1 1 
       1283 1 . . . 1 1 
       1284 1 . . . 1 1 
       1285 1 . . . 1 1 
       1286 1 . . . 1 1 
       1287 1 . . . 1 1 
       1288 1 . . . 1 1 
       1289 1 . . . 1 1 
       1290 1 . . . 1 1 
       1291 1 . . . 1 1 
       1292 1 . . . 1 1 
       1293 1 . . . 1 1 
       1294 1 . . . 1 1 
       1295 1 . . . 1 1 
       1296 1 . . . 1 1 
       1297 1 . . . 1 1 
       1298 1 . . . 1 1 
       1299 1 . . . 1 1 
       1300 1 . . . 1 1 
       1301 1 . . . 1 1 
       1302 1 . . . 1 1 
       1303 1 . . . 1 1 
       1304 1 . . . 1 1 
       1305 1 . . . 1 1 
       1306 1 . . . 1 1 
       1307 1 . . . 1 1 
       1308 1 . . . 1 1 
       1309 1 . . . 1 1 
       1310 1 . . . 1 1 
       1311 1 . . . 1 1 
       1312 1 . . . 1 1 
       1313 1 . . . 1 1 
       1314 1 . . . 1 1 
       1315 1 . . . 1 1 
       1316 1 . . . 1 1 
       1317 1 . . . 1 1 
       1318 1 . . . 1 1 
       1319 1 . . . 1 1 
       1320 1 . . . 1 1 
       1321 1 . . . 1 1 
       1322 1 . . . 1 1 
       1323 1 . . . 1 1 
       1324 1 . . . 1 1 
       1325 1 . . . 1 1 
       1326 1 . . . 1 1 
       1327 1 . . . 1 1 
       1328 1 . . . 1 1 
       1329 1 . . . 1 1 
       1330 1 . . . 1 1 
       1331 1 . . . 1 1 
       1332 1 . . . 1 1 
       1333 1 . . . 1 1 
       1334 1 . . . 1 1 
       1335 1 . . . 1 1 
       1336 1 . . . 1 1 
       1337 1 . . . 1 1 
       1338 1 . . . 1 1 
       1339 1 . . . 1 1 
       1340 1 . . . 1 1 
       1341 1 . . . 1 1 
       1342 1 . . . 1 1 
       1343 1 . . . 1 1 
       1344 1 . . . 1 1 
       1345 1 . . . 1 1 
       1346 1 . . . 1 1 
       1347 1 . . . 1 1 
       1348 1 . . . 1 1 
       1349 1 . . . 1 1 
       1350 1 . . . 1 1 
       1351 1 . . . 1 1 
       1352 1 . . . 1 1 
       1353 1 . . . 1 1 
       1354 1 . . . 1 1 
       1355 1 . . . 1 1 
       1356 1 . . . 1 1 
       1357 1 . . . 1 1 
       1358 1 . . . 1 1 
       1359 1 . . . 1 1 
       1360 1 . . . 1 1 
       1361 1 . . . 1 1 
       1362 1 . . . 1 1 
       1363 1 . . . 1 1 
       1364 1 . . . 1 1 
       1365 1 . . . 1 1 
       1366 1 . . . 1 1 
       1367 1 . . . 1 1 
       1368 1 . . . 1 1 
       1369 1 . . . 1 1 
       1370 1 . . . 1 1 
       1371 1 . . . 1 1 
       1372 1 . . . 1 1 
       1373 1 . . . 1 1 
       1374 1 . . . 1 1 
       1375 1 . . . 1 1 
       1376 1 . . . 1 1 
       1377 1 . . . 1 1 
       1378 1 . . . 1 1 
       1379 1 . . . 1 1 
       1380 1 . . . 1 1 
       1381 1 . . . 1 1 
       1382 1 . . . 1 1 
       1383 1 . . . 1 1 
       1384 1 . . . 1 1 
       1385 1 . . . 1 1 
       1386 1 . . . 1 1 
       1387 1 . . . 1 1 
       1388 1 . . . 1 1 
       1389 1 . . . 1 1 
       1390 1 . . . 1 1 
       1391 1 . . . 1 1 
       1392 1 . . . 1 1 
       1393 1 . . . 1 1 
       1394 1 . . . 1 1 
       1395 1 . . . 1 1 
       1396 1 . . . 1 1 
       1397 1 . . . 1 1 
       1398 1 . . . 1 1 
       1399 1 . . . 1 1 
       1400 1 . . . 1 1 
       1401 1 . . . 1 1 
       1402 1 . . . 1 1 
       1403 1 . . . 1 1 
       1404 1 . . . 1 1 
       1405 1 . . . 1 1 
       1406 1 . . . 1 1 
       1407 1 . . . 1 1 
       1408 1 . . . 1 1 
       1409 1 . . . 1 1 
       1410 1 . . . 1 1 
       1411 1 . . . 1 1 
       1412 1 . . . 1 1 
       1413 1 . . . 1 1 
       1414 1 . . . 1 1 
       1415 1 . . . 1 1 
       1416 1 . . . 1 1 
       1417 1 . . . 1 1 
       1418 1 . . . 1 1 
       1419 1 . . . 1 1 
       1420 1 . . . 1 1 
       1421 1 . . . 1 1 
       1422 1 . . . 1 1 
       1423 1 . . . 1 1 
       1424 1 . . . 1 1 
       1425 1 . . . 1 1 
       1426 1 . . . 1 1 
       1427 1 . . . 1 1 
       1428 1 . . . 1 1 
       1429 1 . . . 1 1 
       1430 1 . . . 1 1 
       1431 1 . . . 1 1 
       1432 1 . . . 1 1 
       1433 1 . . . 1 1 
       1434 1 . . . 1 1 
       1435 1 . . . 1 1 
       1436 1 . . . 1 1 
       1437 1 . . . 1 1 
       1438 1 . . . 1 1 
       1439 1 . . . 1 1 
       1440 1 . . . 1 1 
       1441 1 . . . 1 1 
       1442 1 . . . 1 1 
       1443 1 . . . 1 1 
       1444 1 . . . 1 1 
       1445 1 . . . 1 1 
       1446 1 . . . 1 1 
       1447 1 . . . 1 1 
       1448 1 . . . 1 1 
       1449 1 . . . 1 1 
       1450 1 . . . 1 1 
       1451 1 . . . 1 1 
       1452 1 . . . 1 1 
       1453 1 . . . 1 1 
       1454 1 . . . 1 1 
       1455 1 . . . 1 1 
       1456 1 . . . 1 1 
       1457 1 . . . 1 1 
       1458 1 . . . 1 1 
       1459 1 . . . 1 1 
       1460 1 . . . 1 1 
       1461 1 . . . 1 1 
       1462 1 . . . 1 1 
       1463 1 . . . 1 1 
       1464 1 . . . 1 1 
       1465 1 . . . 1 1 
       1466 1 . . . 1 1 
       1467 1 . . . 1 1 
       1468 1 . . . 1 1 
       1469 1 . . . 1 1 
       1470 1 . . . 1 1 
       1471 1 . . . 1 1 
       1472 1 . . . 1 1 
       1473 1 . . . 1 1 
       1474 1 . . . 1 1 
       1475 1 . . . 1 1 
       1476 1 . . . 1 1 
       1477 1 . . . 1 1 
       1478 1 . . . 1 1 
       1479 1 . . . 1 1 
       1480 1 . . . 1 1 
       1481 1 . . . 1 1 
       1482 1 . . . 1 1 
       1483 1 . . . 1 1 
       1484 1 . . . 1 1 
       1485 1 . . . 1 1 
       1486 1 . . . 1 1 
       1487 1 . . . 1 1 
       1488 1 . . . 1 1 
       1489 1 . . . 1 1 
       1490 1 . . . 1 1 
       1491 1 . . . 1 1 
       1492 1 . . . 1 1 
       1493 1 . . . 1 1 
       1494 1 . . . 1 1 
       1495 1 . . . 1 1 
       1496 1 . . . 1 1 
       1497 1 . . . 1 1 
       1498 1 . . . 1 1 
       1499 1 . . . 1 1 
       1500 1 . . . 1 1 
       1501 1 . . . 1 1 
       1502 1 . . . 1 1 
       1503 1 . . . 1 1 
       1504 1 . . . 1 1 
       1505 1 . . . 1 1 
       1506 1 . . . 1 1 
       1507 1 . . . 1 1 
       1508 1 . . . 1 1 
       1509 1 . . . 1 1 
       1510 1 . . . 1 1 
       1511 1 . . . 1 1 
       1512 1 . . . 1 1 
       1513 1 . . . 1 1 
       1514 1 . . . 1 1 
       1515 1 . . . 1 1 
       1516 1 . . . 1 1 
       1517 1 . . . 1 1 
       1518 1 . . . 1 1 
       1519 1 . . . 1 1 
       1520 1 . . . 1 1 
       1521 1 . . . 1 1 
       1522 1 . . . 1 1 
       1523 1 . . . 1 1 
       1524 1 . . . 1 1 
       1525 1 . . . 1 1 
       1526 1 . . . 1 1 
       1527 1 . . . 1 1 
       1528 1 . . . 1 1 
       1529 1 . . . 1 1 
       1530 1 . . . 1 1 
       1531 1 . . . 1 1 
       1532 1 . . . 1 1 
       1533 1 . . . 1 1 
       1534 1 . . . 1 1 
       1535 1 . . . 1 1 
       1536 1 . . . 1 1 
       1537 1 . . . 1 1 
       1538 1 . . . 1 1 
       1539 1 . . . 1 1 
       1540 1 . . . 1 1 
       1541 1 . . . 1 1 
       1542 1 . . . 1 1 
       1543 1 . . . 1 1 
       1544 1 . . . 1 1 
       1545 1 . . . 1 1 
       1546 1 . . . 1 1 
       1547 1 . . . 1 1 
       1548 1 . . . 1 1 
       1549 1 . . . 1 1 
       1550 1 . . . 1 1 
       1551 1 . . . 1 1 
       1552 1 . . . 1 1 
       1553 1 . . . 1 1 
       1554 1 . . . 1 1 
       1555 1 . . . 1 1 
       1556 1 . . . 1 1 
       1557 1 . . . 1 1 
       1558 1 . . . 1 1 
       1559 1 . . . 1 1 
       1560 1 . . . 1 1 
       1561 1 . . . 1 1 
       1562 1 . . . 1 1 
       1563 1 . . . 1 1 
       1564 1 . . . 1 1 
       1565 1 . . . 1 1 
       1566 1 . . . 1 1 
       1567 1 . . . 1 1 
       1568 1 . . . 1 1 
       1569 1 . . . 1 1 
       1570 1 . . . 1 1 
       1571 1 . . . 1 1 
       1572 1 . . . 1 1 
       1573 1 . . . 1 1 
       1574 1 . . . 1 1 
       1575 1 . . . 1 1 
       1576 1 . . . 1 1 
       1577 1 . . . 1 1 
       1578 1 . . . 1 1 
       1579 1 . . . 1 1 
       1580 1 . . . 1 1 
       1581 1 . . . 1 1 
       1582 1 . . . 1 1 
       1583 1 . . . 1 1 
       1584 1 . . . 1 1 
       1585 1 . . . 1 1 
       1586 1 . . . 1 1 
       1587 1 . . . 1 1 
       1588 1 . . . 1 1 
       1589 1 . . . 1 1 
       1590 1 . . . 1 1 
       1591 1 . . . 1 1 
       1592 1 . . . 1 1 
       1593 1 . . . 1 1 
       1594 1 . . . 1 1 
       1595 1 . . . 1 1 
       1596 1 . . . 1 1 
       1597 1 . . . 1 1 
       1598 1 . . . 1 1 
       1599 1 . . . 1 1 
       1600 1 . . . 1 1 
       1601 1 . . . 1 1 
       1602 1 . . . 1 1 
       1603 1 . . . 1 1 
       1604 1 . . . 1 1 
       1605 1 . . . 1 1 
       1606 1 . . . 1 1 
       1607 1 . . . 1 1 
       1608 1 . . . 1 1 
       1609 1 . . . 1 1 
       1610 1 . . . 1 1 
       1611 1 . . . 1 1 
       1612 1 . . . 1 1 
       1613 1 . . . 1 1 
       1614 1 . . . 1 1 
       1615 1 . . . 1 1 
       1616 1 . . . 1 1 
       1617 1 . . . 1 1 
       1618 1 . . . 1 1 
       1619 1 . . . 1 1 
       1620 1 . . . 1 1 
       1621 1 . . . 1 1 
       1622 1 . . . 1 1 
       1623 1 . . . 1 1 
       1624 1 . . . 1 1 
       1625 1 . . . 1 1 
       1626 1 . . . 1 1 
       1627 1 . . . 1 1 
       1628 1 . . . 1 1 
       1629 1 . . . 1 1 
       1630 1 . . . 1 1 
       1631 1 . . . 1 1 
       1632 1 . . . 1 1 
       1633 1 . . . 1 1 
       1634 1 . . . 1 1 
       1635 1 . . . 1 1 
       1636 1 . . . 1 1 
       1637 1 . . . 1 1 
       1638 1 . . . 1 1 
       1639 1 . . . 1 1 
       1640 1 . . . 1 1 
       1641 1 . . . 1 1 
       1642 1 . . . 1 1 
       1643 1 . . . 1 1 
       1644 1 . . . 1 1 
       1645 1 . . . 1 1 
       1646 1 . . . 1 1 
       1647 1 . . . 1 1 
       1648 1 . . . 1 1 
       1649 1 . . . 1 1 
       1650 1 . . . 1 1 
       1651 1 . . . 1 1 
       1652 1 . . . 1 1 
       1653 1 . . . 1 1 
       1654 1 . . . 1 1 
       1655 1 . . . 1 1 
       1656 1 . . . 1 1 
       1657 1 . . . 1 1 
       1658 1 . . . 1 1 
       1659 1 . . . 1 1 
       1660 1 . . . 1 1 
       1661 1 . . . 1 1 
       1662 1 . . . 1 1 
       1663 1 . . . 1 1 
       1664 1 . . . 1 1 
       1665 1 . . . 1 1 
       1666 1 . . . 1 1 
       1667 1 . . . 1 1 
       1668 1 . . . 1 1 
       1669 1 . . . 1 1 
       1670 1 . . . 1 1 
       1671 1 . . . 1 1 
       1672 1 . . . 1 1 
       1673 1 . . . 1 1 
       1674 1 . . . 1 1 
       1675 1 . . . 1 1 
       1676 1 . . . 1 1 
       1677 1 . . . 1 1 
       1678 1 . . . 1 1 
       1679 1 . . . 1 1 
       1680 1 . . . 1 1 
       1681 1 . . . 1 1 
       1682 1 . . . 1 1 
       1683 1 . . . 1 1 
       1684 1 . . . 1 1 
       1685 1 . . . 1 1 
       1686 1 . . . 1 1 
       1687 1 . . . 1 1 
       1688 1 . . . 1 1 
       1689 1 . . . 1 1 
       1690 1 . . . 1 1 
       1691 1 . . . 1 1 
       1692 1 . . . 1 1 
       1693 1 . . . 1 1 
       1694 1 . . . 1 1 
       1695 1 . . . 1 1 
       1696 1 . . . 1 1 
       1697 1 . . . 1 1 
       1698 1 . . . 1 1 
       1699 1 . . . 1 1 
       1700 1 . . . 1 1 
       1701 1 . . . 1 1 
       1702 1 . . . 1 1 
       1703 1 . . . 1 1 
       1704 1 . . . 1 1 
       1705 1 . . . 1 1 
       1706 1 . . . 1 1 
       1707 1 . . . 1 1 
       1708 1 . . . 1 1 
       1709 1 . . . 1 1 
       1710 1 . . . 1 1 
       1711 1 . . . 1 1 
       1712 1 . . . 1 1 
       1713 1 . . . 1 1 
       1714 1 . . . 1 1 
       1715 1 . . . 1 1 
       1716 1 . . . 1 1 
       1717 1 . . . 1 1 
       1718 1 . . . 1 1 
       1719 1 . . . 1 1 
       1720 1 . . . 1 1 
       1721 1 . . . 1 1 
       1722 1 . . . 1 1 
       1723 1 . . . 1 1 
       1724 1 . . . 1 1 
       1725 1 . . . 1 1 
       1726 1 . . . 1 1 
       1727 1 . . . 1 1 
       1728 1 . . . 1 1 
       1729 1 . . . 1 1 
       1730 1 . . . 1 1 
       1731 1 . . . 1 1 
       1732 1 . . . 1 1 
       1733 1 . . . 1 1 
       1734 1 . . . 1 1 
       1735 1 . . . 1 1 
       1736 1 . . . 1 1 
       1737 1 . . . 1 1 
       1738 1 . . . 1 1 
       1739 1 . . . 1 1 
       1740 1 . . . 1 1 
       1741 1 . . . 1 1 
       1742 1 . . . 1 1 
       1743 1 . . . 1 1 
       1744 1 . . . 1 1 
       1745 1 . . . 1 1 
       1746 1 . . . 1 1 
       1747 1 . . . 1 1 
       1748 1 . . . 1 1 
       1749 1 . . . 1 1 
       1750 1 . . . 1 1 
       1751 1 . . . 1 1 
       1752 1 . . . 1 1 
       1753 1 . . . 1 1 
       1754 1 . . . 1 1 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

          1 1 1 1 1  2 SER QB  .   2 . HB#  1 1 
          1 1 2 1 1  3 GLU H   .   3 . HN   1 1 
          2 1 1 1 1  2 SER HB2 .   2 . HB2  1 1 
          2 1 2 1 1  3 GLU H   .   3 . HN   1 1 
          3 1 1 1 1  2 SER HB3 .   2 . HB1  1 1 
          3 1 2 1 1  3 GLU H   .   3 . HN   1 1 
          4 1 1 1 1  3 GLU H   .   3 . HN   1 1 
          4 1 2 1 1  4 LEU H   .   4 . HN   1 1 
          5 1 1 1 1  3 GLU HA  .   3 . HA   1 1 
          5 1 2 1 1  4 LEU H   .   4 . HN   1 1 
          6 1 1 1 1  3 GLU HA  .   3 . HA   1 1 
          6 1 2 1 1  4 LEU HA  .   4 . HA   1 1 
          7 1 1 1 1  3 GLU HA  .   3 . HA   1 1 
          7 1 2 1 1  4 LEU QB  .   4 . HB#  1 1 
          8 1 1 1 1  3 GLU QG  .   3 . HG#  1 1 
          8 1 2 1 1  4 LEU H   .   4 . HN   1 1 
          9 1 1 1 1  3 GLU QG  .   3 . HG#  1 1 
          9 1 2 1 1  4 LEU QD  .   4 . HD#  1 1 
         10 1 1 1 1  4 LEU H   .   4 . HN   1 1 
         10 1 2 1 1  4 LEU QB  .   4 . HB#  1 1 
         11 1 1 1 1  4 LEU H   .   4 . HN   1 1 
         11 1 2 1 1  4 LEU QD  .   4 . HD#  1 1 
         12 1 1 1 1  4 LEU H   .   4 . HN   1 1 
         12 1 2 1 1  4 LEU HG  .   4 . HG   1 1 
         13 1 1 1 1  4 LEU H   .   4 . HN   1 1 
         13 1 2 1 1  6 SER H   .   6 . HN   1 1 
         14 1 1 1 1  4 LEU H   .   4 . HN   1 1 
         14 1 2 1 1  9 TYR QD  .   9 . HD#  1 1 
         15 1 1 1 1  4 LEU H   .   4 . HN   1 1 
         15 1 2 1 1  9 TYR QE  .   9 . HE#  1 1 
         16 1 1 1 1  4 LEU HA  .   4 . HA   1 1 
         16 1 2 1 1  4 LEU MD1 .   4 . HD1# 1 1 
         17 1 1 1 1  4 LEU HA  .   4 . HA   1 1 
         17 1 2 1 1  4 LEU QD  .   4 . HD#  1 1 
         18 1 1 1 1  4 LEU HA  .   4 . HA   1 1 
         18 1 2 1 1  4 LEU MD2 .   4 . HD2# 1 1 
         19 1 1 1 1  4 LEU HA  .   4 . HA   1 1 
         19 1 2 1 1  6 SER H   .   6 . HN   1 1 
         20 1 1 1 1  4 LEU HA  .   4 . HA   1 1 
         20 1 2 1 1  9 TYR QD  .   9 . HD#  1 1 
         21 1 1 1 1  4 LEU HA  .   4 . HA   1 1 
         21 1 2 1 1  9 TYR QE  .   9 . HE#  1 1 
         22 1 1 1 1  4 LEU QB  .   4 . HB#  1 1 
         22 1 2 1 1  4 LEU QD  .   4 . HD#  1 1 
         23 1 1 1 1  4 LEU QD  .   4 . HD#  1 1 
         23 1 2 1 1  9 TYR QD  .   9 . HD#  1 1 
         24 1 1 1 1  4 LEU QD  .   4 . HD#  1 1 
         24 1 2 1 1  9 TYR QE  .   9 . HE#  1 1 
         25 1 1 1 1  4 LEU QD  .   4 . HD#  1 1 
         25 1 2 1 1 10 PHE QE  .  10 . HE#  1 1 
         26 1 1 1 1  4 LEU MD1 .   4 . HD1# 1 1 
         26 1 2 1 1  9 TYR QD  .   9 . HD#  1 1 
         27 1 1 1 1  4 LEU MD1 .   4 . HD1# 1 1 
         27 1 2 1 1  9 TYR QE  .   9 . HE#  1 1 
         28 1 1 1 1  4 LEU MD1 .   4 . HD1# 1 1 
         28 1 2 1 1 10 PHE QD  .  10 . HD#  1 1 
         29 1 1 1 1  4 LEU MD1 .   4 . HD1# 1 1 
         29 1 2 1 1 10 PHE QE  .  10 . HE#  1 1 
         30 1 1 1 1  4 LEU MD2 .   4 . HD2# 1 1 
         30 1 2 1 1  9 TYR QD  .   9 . HD#  1 1 
         31 1 1 1 1  4 LEU MD2 .   4 . HD2# 1 1 
         31 1 2 1 1  9 TYR QE  .   9 . HE#  1 1 
         32 1 1 1 1  4 LEU MD2 .   4 . HD2# 1 1 
         32 1 2 1 1 10 PHE QD  .  10 . HD#  1 1 
         33 1 1 1 1  4 LEU MD2 .   4 . HD2# 1 1 
         33 1 2 1 1 10 PHE QE  .  10 . HE#  1 1 
         34 1 1 1 1  6 SER H   .   6 . HN   1 1 
         34 1 2 1 1  7 VAL H   .   7 . HN   1 1 
         35 1 1 1 1  7 VAL H   .   7 . HN   1 1 
         35 1 2 1 1  7 VAL HB  .   7 . HB   1 1 
         36 1 1 1 1  7 VAL H   .   7 . HN   1 1 
         36 1 2 1 1  7 VAL QG  .   7 . HG#  1 1 
         37 1 1 1 1  7 VAL H   .   7 . HN   1 1 
         37 1 2 1 1 10 PHE H   .  10 . HN   1 1 
         38 1 1 1 1  7 VAL HA  .   7 . HA   1 1 
         38 1 2 1 1  9 TYR H   .   9 . HN   1 1 
         39 1 1 1 1  7 VAL HB  .   7 . HB   1 1 
         39 1 2 1 1  8 PRO HA  .   8 . HA   1 1 
         40 1 1 1 1  7 VAL HB  .   7 . HB   1 1 
         40 1 2 1 1  9 TYR H   .   9 . HN   1 1 
         41 1 1 1 1  7 VAL QG  .   7 . HG#  1 1 
         41 1 2 1 1 10 PHE H   .  10 . HN   1 1 
         42 1 1 1 1  7 VAL QG  .   7 . HG#  1 1 
         42 1 2 1 1 61 GLU H   .  61 . HN   1 1 
         43 1 1 1 1  7 VAL QG  .   7 . HG#  1 1 
         43 1 2 1 1 61 GLU QG  .  61 . HG#  1 1 
         44 1 1 1 1  7 VAL QG  .   7 . HG#  1 1 
         44 1 2 1 1 62 ALA H   .  62 . HN   1 1 
         45 1 1 1 1  7 VAL MG1 .   7 . HG1# 1 1 
         45 1 2 1 1 61 GLU HG2 .  61 . HG2  1 1 
         46 1 1 1 1  7 VAL MG1 .   7 . HG1# 1 1 
         46 1 2 1 1 61 GLU HG3 .  61 . HG1  1 1 
         47 1 1 1 1  7 VAL MG2 .   7 . HG2# 1 1 
         47 1 2 1 1 61 GLU HG2 .  61 . HG2  1 1 
         48 1 1 1 1  7 VAL MG2 .   7 . HG2# 1 1 
         48 1 2 1 1 61 GLU HG3 .  61 . HG1  1 1 
         49 1 1 1 1  8 PRO HA  .   8 . HA   1 1 
         49 1 2 1 1 10 PHE H   .  10 . HN   1 1 
         50 1 1 1 1  8 PRO HA  .   8 . HA   1 1 
         50 1 2 1 1 11 ILE H   .  11 . HN   1 1 
         51 1 1 1 1  8 PRO HA  .   8 . HA   1 1 
         51 1 2 1 1 11 ILE HB  .  11 . HB   1 1 
         52 1 1 1 1  8 PRO HA  .   8 . HA   1 1 
         52 1 2 1 1 11 ILE MD  .  11 . HD1# 1 1 
         53 1 1 1 1  8 PRO HA  .   8 . HA   1 1 
         53 1 2 1 1 11 ILE MG  .  11 . HG2# 1 1 
         54 1 1 1 1  8 PRO HA  .   8 . HA   1 1 
         54 1 2 1 1 12 GLU H   .  12 . HN   1 1 
         55 1 1 1 1  8 PRO QB  .   8 . HB#  1 1 
         55 1 2 1 1  9 TYR H   .   9 . HN   1 1 
         56 1 1 1 1  8 PRO QB  .   8 . HB#  1 1 
         56 1 2 1 1 11 ILE H   .  11 . HN   1 1 
         57 1 1 1 1  8 PRO QB  .   8 . HB#  1 1 
         57 1 2 1 1 11 ILE MG  .  11 . HG2# 1 1 
         58 1 1 1 1  9 TYR H   .   9 . HN   1 1 
         58 1 2 1 1  9 TYR QD  .   9 . HD#  1 1 
         59 1 1 1 1  9 TYR H   .   9 . HN   1 1 
         59 1 2 1 1 10 PHE H   .  10 . HN   1 1 
         60 1 1 1 1  9 TYR QD  .   9 . HD#  1 1 
         60 1 2 1 1 10 PHE H   .  10 . HN   1 1 
         61 1 1 1 1  9 TYR QD  .   9 . HD#  1 1 
         61 1 2 1 1 10 PHE QE  .  10 . HE#  1 1 
         62 1 1 1 1  9 TYR QD  .   9 . HD#  1 1 
         62 1 2 1 1 10 PHE HZ  .  10 . HZ   1 1 
         63 1 1 1 1  9 TYR QE  .   9 . HE#  1 1 
         63 1 2 1 1 10 PHE QD  .  10 . HD#  1 1 
         64 1 1 1 1  9 TYR QE  .   9 . HE#  1 1 
         64 1 2 1 1 10 PHE QE  .  10 . HE#  1 1 
         65 1 1 1 1 10 PHE H   .  10 . HN   1 1 
         65 1 2 1 1 11 ILE H   .  11 . HN   1 1 
         66 1 1 1 1 10 PHE H   .  10 . HN   1 1 
         66 1 2 1 1 12 GLU H   .  12 . HN   1 1 
         67 1 1 1 1 10 PHE QB  .  10 . HB#  1 1 
         67 1 2 1 1 37 VAL QG  .  37 . HG#  1 1 
         68 1 1 1 1 10 PHE QB  .  10 . HB#  1 1 
         68 1 2 1 1 59 LEU QD  .  59 . HD#  1 1 
         69 1 1 1 1 10 PHE QB  .  10 . HB#  1 1 
         69 1 2 1 1 62 ALA H   .  62 . HN   1 1 
         70 1 1 1 1 10 PHE QB  .  10 . HB#  1 1 
         70 1 2 1 1 62 ALA MB  .  62 . HB#  1 1 
         71 1 1 1 1 10 PHE QD  .  10 . HD#  1 1 
         71 1 2 1 1 33 TYR QE  .  33 . HE#  1 1 
         72 1 1 1 1 10 PHE QD  .  10 . HD#  1 1 
         72 1 2 1 1 37 VAL HB  .  37 . HB   1 1 
         73 1 1 1 1 10 PHE QD  .  10 . HD#  1 1 
         73 1 2 1 1 37 VAL QG  .  37 . HG#  1 1 
         74 1 1 1 1 10 PHE QD  .  10 . HD#  1 1 
         74 1 2 1 1 59 LEU HB2 .  59 . HB2  1 1 
         75 1 1 1 1 10 PHE QE  .  10 . HE#  1 1 
         75 1 2 1 1 37 VAL MG1 .  37 . HG1# 1 1 
         76 1 1 1 1 10 PHE QE  .  10 . HE#  1 1 
         76 1 2 1 1 37 VAL QG  .  37 . HG#  1 1 
         77 1 1 1 1 10 PHE QE  .  10 . HE#  1 1 
         77 1 2 1 1 37 VAL MG2 .  37 . HG2# 1 1 
         78 1 1 1 1 10 PHE QE  .  10 . HE#  1 1 
         78 1 2 1 1 59 LEU QD  .  59 . HD#  1 1 
         79 1 1 1 1 10 PHE HZ  .  10 . HZ   1 1 
         79 1 2 1 1 37 VAL MG1 .  37 . HG1# 1 1 
         80 1 1 1 1 10 PHE HZ  .  10 . HZ   1 1 
         80 1 2 1 1 37 VAL QG  .  37 . HG#  1 1 
         81 1 1 1 1 10 PHE HZ  .  10 . HZ   1 1 
         81 1 2 1 1 37 VAL MG2 .  37 . HG2# 1 1 
         82 1 1 1 1 11 ILE H   .  11 . HN   1 1 
         82 1 2 1 1 11 ILE HB  .  11 . HB   1 1 
         83 1 1 1 1 11 ILE H   .  11 . HN   1 1 
         83 1 2 1 1 11 ILE MD  .  11 . HD1# 1 1 
         84 1 1 1 1 11 ILE H   .  11 . HN   1 1 
         84 1 2 1 1 11 ILE QG  .  11 . HG1# 1 1 
         85 1 1 1 1 11 ILE H   .  11 . HN   1 1 
         85 1 2 1 1 11 ILE MG  .  11 . HG2# 1 1 
         86 1 1 1 1 11 ILE H   .  11 . HN   1 1 
         86 1 2 1 1 12 GLU H   .  12 . HN   1 1 
         87 1 1 1 1 11 ILE H   .  11 . HN   1 1 
         87 1 2 1 1 13 ASN H   .  13 . HN   1 1 
         88 1 1 1 1 11 ILE H   .  11 . HN   1 1 
         88 1 2 1 1 61 GLU QG  .  61 . HG#  1 1 
         89 1 1 1 1 11 ILE H   .  11 . HN   1 1 
         89 1 2 1 1 62 ALA HA  .  62 . HA   1 1 
         90 1 1 1 1 11 ILE H   .  11 . HN   1 1 
         90 1 2 1 1 62 ALA MB  .  62 . HB#  1 1 
         91 1 1 1 1 11 ILE HA  .  11 . HA   1 1 
         91 1 2 1 1 14 LEU MD1 .  14 . HD1# 1 1 
         92 1 1 1 1 11 ILE HA  .  11 . HA   1 1 
         92 1 2 1 1 14 LEU MD2 .  14 . HD2# 1 1 
         93 1 1 1 1 11 ILE HA  .  11 . HA   1 1 
         93 1 2 1 1 15 LYS H   .  15 . HN   1 1 
         94 1 1 1 1 11 ILE HA  .  11 . HA   1 1 
         94 1 2 1 1 62 ALA MB  .  62 . HB#  1 1 
         95 1 1 1 1 11 ILE HB  .  11 . HB   1 1 
         95 1 2 1 1 11 ILE MD  .  11 . HD1# 1 1 
         96 1 1 1 1 11 ILE HB  .  11 . HB   1 1 
         96 1 2 1 1 12 GLU H   .  12 . HN   1 1 
         97 1 1 1 1 11 ILE HB  .  11 . HB   1 1 
         97 1 2 1 1 61 GLU QG  .  61 . HG#  1 1 
         98 1 1 1 1 11 ILE MD  .  11 . HD1# 1 1 
         98 1 2 1 1 14 LEU QD  .  14 . HD#  1 1 
         99 1 1 1 1 11 ILE MD  .  11 . HD1# 1 1 
         99 1 2 1 1 61 GLU H   .  61 . HN   1 1 
        100 1 1 1 1 11 ILE MD  .  11 . HD1# 1 1 
        100 1 2 1 1 61 GLU QB  .  61 . HB#  1 1 
        101 1 1 1 1 11 ILE MD  .  11 . HD1# 1 1 
        101 1 2 1 1 61 GLU QG  .  61 . HG#  1 1 
        102 1 1 1 1 11 ILE MD  .  11 . HD1# 1 1 
        102 1 2 1 1 62 ALA HA  .  62 . HA   1 1 
        103 1 1 1 1 11 ILE MD  .  11 . HD1# 1 1 
        103 1 2 1 1 62 ALA MB  .  62 . HB#  1 1 
        104 1 1 1 1 11 ILE MD  .  11 . HD1# 1 1 
        104 1 2 1 1 63 TYR H   .  63 . HN   1 1 
        105 1 1 1 1 11 ILE MD  .  11 . HD1# 1 1 
        105 1 2 1 1 64 ASN H   .  64 . HN   1 1 
        106 1 1 1 1 11 ILE QG  .  11 . HG1# 1 1 
        106 1 2 1 1 13 ASN H   .  13 . HN   1 1 
        107 1 1 1 1 11 ILE QG  .  11 . HG1# 1 1 
        107 1 2 1 1 61 GLU QG  .  61 . HG#  1 1 
        108 1 1 1 1 11 ILE QG  .  11 . HG1# 1 1 
        108 1 2 1 1 62 ALA H   .  62 . HN   1 1 
        109 1 1 1 1 11 ILE QG  .  11 . HG1# 1 1 
        109 1 2 1 1 62 ALA HA  .  62 . HA   1 1 
        110 1 1 1 1 11 ILE MG  .  11 . HG2# 1 1 
        110 1 2 1 1 12 GLU H   .  12 . HN   1 1 
        111 1 1 1 1 11 ILE MG  .  11 . HG2# 1 1 
        111 1 2 1 1 12 GLU QG  .  12 . HG#  1 1 
        112 1 1 1 1 11 ILE MG  .  11 . HG2# 1 1 
        112 1 2 1 1 13 ASN H   .  13 . HN   1 1 
        113 1 1 1 1 11 ILE MG  .  11 . HG2# 1 1 
        113 1 2 1 1 14 LEU H   .  14 . HN   1 1 
        114 1 1 1 1 11 ILE MG  .  11 . HG2# 1 1 
        114 1 2 1 1 14 LEU HA  .  14 . HA   1 1 
        115 1 1 1 1 11 ILE MG  .  11 . HG2# 1 1 
        115 1 2 1 1 14 LEU QD  .  14 . HD#  1 1 
        116 1 1 1 1 11 ILE MG  .  11 . HG2# 1 1 
        116 1 2 1 1 62 ALA HA  .  62 . HA   1 1 
        117 1 1 1 1 11 ILE MG  .  11 . HG2# 1 1 
        117 1 2 1 1 62 ALA MB  .  62 . HB#  1 1 
        118 1 1 1 1 12 GLU H   .  12 . HN   1 1 
        118 1 2 1 1 12 GLU QB  .  12 . HB#  1 1 
        119 1 1 1 1 12 GLU H   .  12 . HN   1 1 
        119 1 2 1 1 12 GLU QG  .  12 . HG#  1 1 
        120 1 1 1 1 12 GLU H   .  12 . HN   1 1 
        120 1 2 1 1 13 ASN H   .  13 . HN   1 1 
        121 1 1 1 1 12 GLU H   .  12 . HN   1 1 
        121 1 2 1 1 13 ASN QB  .  13 . HB#  1 1 
        122 1 1 1 1 12 GLU H   .  12 . HN   1 1 
        122 1 2 1 1 14 LEU H   .  14 . HN   1 1 
        123 1 1 1 1 12 GLU H   .  12 . HN   1 1 
        123 1 2 1 1 14 LEU QD  .  14 . HD#  1 1 
        124 1 1 1 1 12 GLU HA  .  12 . HA   1 1 
        124 1 2 1 1 12 GLU QG  .  12 . HG#  1 1 
        125 1 1 1 1 12 GLU QG  .  12 . HG#  1 1 
        125 1 2 1 1 13 ASN H   .  13 . HN   1 1 
        126 1 1 1 1 13 ASN H   .  13 . HN   1 1 
        126 1 2 1 1 14 LEU H   .  14 . HN   1 1 
        127 1 1 1 1 13 ASN H   .  13 . HN   1 1 
        127 1 2 1 1 14 LEU QD  .  14 . HD#  1 1 
        128 1 1 1 1 13 ASN H   .  13 . HN   1 1 
        128 1 2 1 1 15 LYS H   .  15 . HN   1 1 
        129 1 1 1 1 13 ASN H   .  13 . HN   1 1 
        129 1 2 1 1 33 TYR QE  .  33 . HE#  1 1 
        130 1 1 1 1 13 ASN QB  .  13 . HB#  1 1 
        130 1 2 1 1 15 LYS H   .  15 . HN   1 1 
        131 1 1 1 1 13 ASN QB  .  13 . HB#  1 1 
        131 1 2 1 1 33 TYR QE  .  33 . HE#  1 1 
        132 1 1 1 1 14 LEU H   .  14 . HN   1 1 
        132 1 2 1 1 14 LEU QB  .  14 . HB#  1 1 
        133 1 1 1 1 14 LEU H   .  14 . HN   1 1 
        133 1 2 1 1 14 LEU MD1 .  14 . HD1# 1 1 
        134 1 1 1 1 14 LEU H   .  14 . HN   1 1 
        134 1 2 1 1 14 LEU QD  .  14 . HD#  1 1 
        135 1 1 1 1 14 LEU H   .  14 . HN   1 1 
        135 1 2 1 1 14 LEU MD2 .  14 . HD2# 1 1 
        136 1 1 1 1 14 LEU H   .  14 . HN   1 1 
        136 1 2 1 1 14 LEU HG  .  14 . HG   1 1 
        137 1 1 1 1 14 LEU H   .  14 . HN   1 1 
        137 1 2 1 1 15 LYS H   .  15 . HN   1 1 
        138 1 1 1 1 14 LEU H   .  14 . HN   1 1 
        138 1 2 1 1 15 LYS HA  .  15 . HA   1 1 
        139 1 1 1 1 14 LEU H   .  14 . HN   1 1 
        139 1 2 1 1 16 GLN H   .  16 . HN   1 1 
        140 1 1 1 1 14 LEU H   .  14 . HN   1 1 
        140 1 2 1 1 33 TYR QB  .  33 . HB#  1 1 
        141 1 1 1 1 14 LEU H   .  14 . HN   1 1 
        141 1 2 1 1 33 TYR QE  .  33 . HE#  1 1 
        142 1 1 1 1 14 LEU HA  .  14 . HA   1 1 
        142 1 2 1 1 18 ILE MD  .  18 . HD1# 1 1 
        143 1 1 1 1 14 LEU HA  .  14 . HA   1 1 
        143 1 2 1 1 18 ILE QG  .  18 . HG1# 1 1 
        144 1 1 1 1 14 LEU HA  .  14 . HA   1 1 
        144 1 2 1 1 29 ALA MB  .  29 . HB#  1 1 
        145 1 1 1 1 14 LEU HA  .  14 . HA   1 1 
        145 1 2 1 1 33 TYR QB  .  33 . HB#  1 1 
        146 1 1 1 1 14 LEU QB  .  14 . HB#  1 1 
        146 1 2 1 1 18 ILE MD  .  18 . HD1# 1 1 
        147 1 1 1 1 14 LEU QB  .  14 . HB#  1 1 
        147 1 2 1 1 18 ILE MG  .  18 . HG2# 1 1 
        148 1 1 1 1 14 LEU QD  .  14 . HD#  1 1 
        148 1 2 1 1 15 LYS H   .  15 . HN   1 1 
        149 1 1 1 1 14 LEU QD  .  14 . HD#  1 1 
        149 1 2 1 1 17 HIS H   .  17 . HN   1 1 
        150 1 1 1 1 14 LEU QD  .  14 . HD#  1 1 
        150 1 2 1 1 29 ALA H   .  29 . HN   1 1 
        151 1 1 1 1 14 LEU QD  .  14 . HD#  1 1 
        151 1 2 1 1 29 ALA MB  .  29 . HB#  1 1 
        152 1 1 1 1 14 LEU QD  .  14 . HD#  1 1 
        152 1 2 1 1 30 MET H   .  30 . HN   1 1 
        153 1 1 1 1 14 LEU QD  .  14 . HD#  1 1 
        153 1 2 1 1 30 MET HA  .  30 . HA   1 1 
        154 1 1 1 1 14 LEU QD  .  14 . HD#  1 1 
        154 1 2 1 1 33 TYR H   .  33 . HN   1 1 
        155 1 1 1 1 14 LEU QD  .  14 . HD#  1 1 
        155 1 2 1 1 33 TYR QB  .  33 . HB#  1 1 
        156 1 1 1 1 14 LEU QD  .  14 . HD#  1 1 
        156 1 2 1 1 33 TYR QD  .  33 . HD#  1 1 
        157 1 1 1 1 14 LEU QD  .  14 . HD#  1 1 
        157 1 2 1 1 33 TYR QE  .  33 . HE#  1 1 
        158 1 1 1 1 14 LEU QD  .  14 . HD#  1 1 
        158 1 2 1 1 34 TYR H   .  34 . HN   1 1 
        159 1 1 1 1 14 LEU QD  .  14 . HD#  1 1 
        159 1 2 1 1 59 LEU QD  .  59 . HD#  1 1 
        160 1 1 1 1 14 LEU QD  .  14 . HD#  1 1 
        160 1 2 1 1 61 GLU QG  .  61 . HG#  1 1 
        161 1 1 1 1 14 LEU QD  .  14 . HD#  1 1 
        161 1 2 1 1 62 ALA HA  .  62 . HA   1 1 
        162 1 1 1 1 14 LEU QD  .  14 . HD#  1 1 
        162 1 2 1 1 62 ALA MB  .  62 . HB#  1 1 
        163 1 1 1 1 14 LEU QD  .  14 . HD#  1 1 
        163 1 2 1 1 63 TYR H   .  63 . HN   1 1 
        164 1 1 1 1 14 LEU QD  .  14 . HD#  1 1 
        164 1 2 1 1 63 TYR HA  .  63 . HA   1 1 
        165 1 1 1 1 14 LEU QD  .  14 . HD#  1 1 
        165 1 2 1 1 66 VAL H   .  66 . HN   1 1 
        166 1 1 1 1 14 LEU QD  .  14 . HD#  1 1 
        166 1 2 1 1 66 VAL HB  .  66 . HB   1 1 
        167 1 1 1 1 14 LEU MD1 .  14 . HD1# 1 1 
        167 1 2 1 1 62 ALA H   .  62 . HN   1 1 
        168 1 1 1 1 14 LEU MD1 .  14 . HD1# 1 1 
        168 1 2 1 1 62 ALA MB  .  62 . HB#  1 1 
        169 1 1 1 1 14 LEU MD2 .  14 . HD2# 1 1 
        169 1 2 1 1 62 ALA MB  .  62 . HB#  1 1 
        170 1 1 1 1 14 LEU HG  .  14 . HG   1 1 
        170 1 2 1 1 33 TYR QD  .  33 . HD#  1 1 
        171 1 1 1 1 14 LEU HG  .  14 . HG   1 1 
        171 1 2 1 1 33 TYR QE  .  33 . HE#  1 1 
        172 1 1 1 1 15 LYS H   .  15 . HN   1 1 
        172 1 2 1 1 15 LYS QB  .  15 . HB#  1 1 
        173 1 1 1 1 15 LYS H   .  15 . HN   1 1 
        173 1 2 1 1 16 GLN H   .  16 . HN   1 1 
        174 1 1 1 1 15 LYS H   .  15 . HN   1 1 
        174 1 2 1 1 18 ILE MD  .  18 . HD1# 1 1 
        175 1 1 1 1 15 LYS H   .  15 . HN   1 1 
        175 1 2 1 1 18 ILE MG  .  18 . HG2# 1 1 
        176 1 1 1 1 15 LYS HA  .  15 . HA   1 1 
        176 1 2 1 1 18 ILE H   .  18 . HN   1 1 
        177 1 1 1 1 15 LYS HA  .  15 . HA   1 1 
        177 1 2 1 1 18 ILE MD  .  18 . HD1# 1 1 
        178 1 1 1 1 15 LYS HA  .  15 . HA   1 1 
        178 1 2 1 1 18 ILE QG  .  18 . HG1# 1 1 
        179 1 1 1 1 15 LYS HA  .  15 . HA   1 1 
        179 1 2 1 1 18 ILE MG  .  18 . HG2# 1 1 
        180 1 1 1 1 15 LYS QB  .  15 . HB#  1 1 
        180 1 2 1 1 16 GLN H   .  16 . HN   1 1 
        181 1 1 1 1 16 GLN H   .  16 . HN   1 1 
        181 1 2 1 1 20 MET H   .  20 . HN   1 1 
        182 1 1 1 1 16 GLN HA  .  16 . HA   1 1 
        182 1 2 1 1 16 GLN QG  .  16 . HG#  1 1 
        183 1 1 1 1 16 GLN HA  .  16 . HA   1 1 
        183 1 2 1 1 20 MET ME  .  20 . HE#  1 1 
        184 1 1 1 1 16 GLN HA  .  16 . HA   1 1 
        184 1 2 1 1 22 GLN H   .  22 . HN   1 1 
        185 1 1 1 1 16 GLN QG  .  16 . HG#  1 1 
        185 1 2 1 1 17 HIS HA  .  17 . HA   1 1 
        186 1 1 1 1 16 GLN QG  .  16 . HG#  1 1 
        186 1 2 1 1 18 ILE H   .  18 . HN   1 1 
        187 1 1 1 1 16 GLN QG  .  16 . HG#  1 1 
        187 1 2 1 1 20 MET H   .  20 . HN   1 1 
        188 1 1 1 1 16 GLN QG  .  16 . HG#  1 1 
        188 1 2 1 1 21 ASN H   .  21 . HN   1 1 
        189 1 1 1 1 16 GLN QG  .  16 . HG#  1 1 
        189 1 2 1 1 22 GLN H   .  22 . HN   1 1 
        190 1 1 1 1 16 GLN HG2 .  16 . HG2  1 1 
        190 1 2 1 1 17 HIS H   .  17 . HN   1 1 
        191 1 1 1 1 16 GLN HG2 .  16 . HG2  1 1 
        191 1 2 1 1 21 ASN H   .  21 . HN   1 1 
        192 1 1 1 1 16 GLN HG3 .  16 . HG1  1 1 
        192 1 2 1 1 17 HIS H   .  17 . HN   1 1 
        193 1 1 1 1 16 GLN HG3 .  16 . HG1  1 1 
        193 1 2 1 1 21 ASN H   .  21 . HN   1 1 
        194 1 1 1 1 17 HIS H   .  17 . HN   1 1 
        194 1 2 1 1 19 GLU H   .  19 . HN   1 1 
        195 1 1 1 1 17 HIS H   .  17 . HN   1 1 
        195 1 2 1 1 20 MET ME  .  20 . HE#  1 1 
        196 1 1 1 1 17 HIS H   .  17 . HN   1 1 
        196 1 2 1 1 24 GLU HB3 .  24 . HB1  1 1 
        197 1 1 1 1 17 HIS H   .  17 . HN   1 1 
        197 1 2 1 1 24 GLU HG2 .  24 . HG2  1 1 
        198 1 1 1 1 17 HIS HA  .  17 . HA   1 1 
        198 1 2 1 1 19 GLU H   .  19 . HN   1 1 
        199 1 1 1 1 17 HIS HA  .  17 . HA   1 1 
        199 1 2 1 1 20 MET H   .  20 . HN   1 1 
        200 1 1 1 1 17 HIS HA  .  17 . HA   1 1 
        200 1 2 1 1 20 MET QG  .  20 . HG#  1 1 
        201 1 1 1 1 17 HIS HA  .  17 . HA   1 1 
        201 1 2 1 1 25 ASP H   .  25 . HN   1 1 
        202 1 1 1 1 17 HIS QB  .  17 . HB#  1 1 
        202 1 2 1 1 18 ILE MG  .  18 . HG2# 1 1 
        203 1 1 1 1 17 HIS QB  .  17 . HB#  1 1 
        203 1 2 1 1 19 GLU H   .  19 . HN   1 1 
        204 1 1 1 1 18 ILE H   .  18 . HN   1 1 
        204 1 2 1 1 18 ILE MD  .  18 . HD1# 1 1 
        205 1 1 1 1 18 ILE H   .  18 . HN   1 1 
        205 1 2 1 1 18 ILE QG  .  18 . HG1# 1 1 
        206 1 1 1 1 18 ILE H   .  18 . HN   1 1 
        206 1 2 1 1 18 ILE MG  .  18 . HG2# 1 1 
        207 1 1 1 1 18 ILE H   .  18 . HN   1 1 
        207 1 2 1 1 19 GLU H   .  19 . HN   1 1 
        208 1 1 1 1 18 ILE H   .  18 . HN   1 1 
        208 1 2 1 1 20 MET H   .  20 . HN   1 1 
        209 1 1 1 1 18 ILE H   .  18 . HN   1 1 
        209 1 2 1 1 25 ASP H   .  25 . HN   1 1 
        210 1 1 1 1 18 ILE H   .  18 . HN   1 1 
        210 1 2 1 1 29 ALA MB  .  29 . HB#  1 1 
        211 1 1 1 1 18 ILE HA  .  18 . HA   1 1 
        211 1 2 1 1 18 ILE MD  .  18 . HD1# 1 1 
        212 1 1 1 1 18 ILE HA  .  18 . HA   1 1 
        212 1 2 1 1 26 LYS QB  .  26 . HB#  1 1 
        213 1 1 1 1 18 ILE HA  .  18 . HA   1 1 
        213 1 2 1 1 26 LYS QG  .  26 . HG#  1 1 
        214 1 1 1 1 18 ILE HB  .  18 . HB   1 1 
        214 1 2 1 1 19 GLU HA  .  19 . HA   1 1 
        215 1 1 1 1 18 ILE MD  .  18 . HD1# 1 1 
        215 1 2 1 1 19 GLU HA  .  19 . HA   1 1 
        216 1 1 1 1 18 ILE MD  .  18 . HD1# 1 1 
        216 1 2 1 1 26 LYS HA  .  26 . HA   1 1 
        217 1 1 1 1 18 ILE MD  .  18 . HD1# 1 1 
        217 1 2 1 1 26 LYS QG  .  26 . HG#  1 1 
        218 1 1 1 1 18 ILE MD  .  18 . HD1# 1 1 
        218 1 2 1 1 29 ALA MB  .  29 . HB#  1 1 
        219 1 1 1 1 18 ILE MD  .  18 . HD1# 1 1 
        219 1 2 1 1 69 GLY H   .  69 . HN   1 1 
        220 1 1 1 1 18 ILE MD  .  18 . HD1# 1 1 
        220 1 2 1 1 70 GLU QG  .  70 . HG#  1 1 
        221 1 1 1 1 18 ILE QG  .  18 . HG1# 1 1 
        221 1 2 1 1 18 ILE MG  .  18 . HG2# 1 1 
        222 1 1 1 1 18 ILE QG  .  18 . HG1# 1 1 
        222 1 2 1 1 29 ALA MB  .  29 . HB#  1 1 
        223 1 1 1 1 18 ILE MG  .  18 . HG2# 1 1 
        223 1 2 1 1 19 GLU H   .  19 . HN   1 1 
        224 1 1 1 1 18 ILE MG  .  18 . HG2# 1 1 
        224 1 2 1 1 24 GLU QG  .  24 . HG#  1 1 
        225 1 1 1 1 18 ILE MG  .  18 . HG2# 1 1 
        225 1 2 1 1 26 LYS HA  .  26 . HA   1 1 
        226 1 1 1 1 18 ILE MG  .  18 . HG2# 1 1 
        226 1 2 1 1 26 LYS QG  .  26 . HG#  1 1 
        227 1 1 1 1 18 ILE MG  .  18 . HG2# 1 1 
        227 1 2 1 1 29 ALA MB  .  29 . HB#  1 1 
        228 1 1 1 1 18 ILE MG  .  18 . HG2# 1 1 
        228 1 2 1 1 30 MET H   .  30 . HN   1 1 
        229 1 1 1 1 19 GLU H   .  19 . HN   1 1 
        229 1 2 1 1 19 GLU QG  .  19 . HG#  1 1 
        230 1 1 1 1 19 GLU H   .  19 . HN   1 1 
        230 1 2 1 1 20 MET ME  .  20 . HE#  1 1 
        231 1 1 1 1 19 GLU H   .  19 . HN   1 1 
        231 1 2 1 1 26 LYS QG  .  26 . HG#  1 1 
        232 1 1 1 1 19 GLU HA  .  19 . HA   1 1 
        232 1 2 1 1 19 GLU QG  .  19 . HG#  1 1 
        233 1 1 1 1 20 MET H   .  20 . HN   1 1 
        233 1 2 1 1 21 ASN HA  .  21 . HA   1 1 
        234 1 1 1 1 20 MET H   .  20 . HN   1 1 
        234 1 2 1 1 21 ASN QB  .  21 . HB#  1 1 
        235 1 1 1 1 20 MET HA  .  20 . HA   1 1 
        235 1 2 1 1 20 MET QG  .  20 . HG#  1 1 
        236 1 1 1 1 20 MET QB  .  20 . HB#  1 1 
        236 1 2 1 1 21 ASN H   .  21 . HN   1 1 
        237 1 1 1 1 20 MET QB  .  20 . HB#  1 1 
        237 1 2 1 1 22 GLN H   .  22 . HN   1 1 
        238 1 1 1 1 21 ASN H   .  21 . HN   1 1 
        238 1 2 1 1 21 ASN QB  .  21 . HB#  1 1 
        239 1 1 1 1 21 ASN H   .  21 . HN   1 1 
        239 1 2 1 1 22 GLN H   .  22 . HN   1 1 
        240 1 1 1 1 21 ASN H   .  21 . HN   1 1 
        240 1 2 1 1 22 GLN HA  .  22 . HA   1 1 
        241 1 1 1 1 21 ASN H   .  21 . HN   1 1 
        241 1 2 1 1 22 GLN QB  .  22 . HB#  1 1 
        242 1 1 1 1 21 ASN HA  .  21 . HA   1 1 
        242 1 2 1 1 22 GLN H   .  22 . HN   1 1 
        243 1 1 1 1 21 ASN HA  .  21 . HA   1 1 
        243 1 2 1 1 22 GLN QB  .  22 . HB#  1 1 
        244 1 1 1 1 21 ASN HA  .  21 . HA   1 1 
        244 1 2 1 1 23 SER H   .  23 . HN   1 1 
        245 1 1 1 1 21 ASN HA  .  21 . HA   1 1 
        245 1 2 1 1 24 GLU H   .  24 . HN   1 1 
        246 1 1 1 1 21 ASN HA  .  21 . HA   1 1 
        246 1 2 1 1 24 GLU HB2 .  24 . HB2  1 1 
        247 1 1 1 1 21 ASN QB  .  21 . HB#  1 1 
        247 1 2 1 1 24 GLU H   .  24 . HN   1 1 
        248 1 1 1 1 22 GLN H   .  22 . HN   1 1 
        248 1 2 1 1 22 GLN QB  .  22 . HB#  1 1 
        249 1 1 1 1 22 GLN H   .  22 . HN   1 1 
        249 1 2 1 1 22 GLN QG  .  22 . HG#  1 1 
        250 1 1 1 1 22 GLN H   .  22 . HN   1 1 
        250 1 2 1 1 24 GLU H   .  24 . HN   1 1 
        251 1 1 1 1 22 GLN HA  .  22 . HA   1 1 
        251 1 2 1 1 22 GLN QG  .  22 . HG#  1 1 
        252 1 1 1 1 22 GLN HA  .  22 . HA   1 1 
        252 1 2 1 1 23 SER H   .  23 . HN   1 1 
        253 1 1 1 1 22 GLN QB  .  22 . HB#  1 1 
        253 1 2 1 1 23 SER H   .  23 . HN   1 1 
        254 1 1 1 1 22 GLN HB2 .  22 . HB2  1 1 
        254 1 2 1 1 23 SER H   .  23 . HN   1 1 
        255 1 1 1 1 22 GLN HB3 .  22 . HB1  1 1 
        255 1 2 1 1 23 SER H   .  23 . HN   1 1 
        256 1 1 1 1 22 GLN QG  .  22 . HG#  1 1 
        256 1 2 1 1 23 SER H   .  23 . HN   1 1 
        257 1 1 1 1 23 SER H   .  23 . HN   1 1 
        257 1 2 1 1 24 GLU H   .  24 . HN   1 1 
        258 1 1 1 1 23 SER H   .  23 . HN   1 1 
        258 1 2 1 1 24 GLU HA  .  24 . HA   1 1 
        259 1 1 1 1 23 SER H   .  23 . HN   1 1 
        259 1 2 1 1 24 GLU HB2 .  24 . HB2  1 1 
        260 1 1 1 1 24 GLU H   .  24 . HN   1 1 
        260 1 2 1 1 24 GLU HB2 .  24 . HB2  1 1 
        261 1 1 1 1 24 GLU H   .  24 . HN   1 1 
        261 1 2 1 1 24 GLU QG  .  24 . HG#  1 1 
        262 1 1 1 1 24 GLU H   .  24 . HN   1 1 
        262 1 2 1 1 25 ASP H   .  25 . HN   1 1 
        263 1 1 1 1 24 GLU HA  .  24 . HA   1 1 
        263 1 2 1 1 24 GLU QG  .  24 . HG#  1 1 
        264 1 1 1 1 24 GLU HA  .  24 . HA   1 1 
        264 1 2 1 1 25 ASP HB3 .  25 . HB1  1 1 
        265 1 1 1 1 24 GLU HB2 .  24 . HB2  1 1 
        265 1 2 1 1 25 ASP H   .  25 . HN   1 1 
        266 1 1 1 1 24 GLU HB3 .  24 . HB1  1 1 
        266 1 2 1 1 25 ASP H   .  25 . HN   1 1 
        267 1 1 1 1 24 GLU HB3 .  24 . HB1  1 1 
        267 1 2 1 1 29 ALA MB  .  29 . HB#  1 1 
        268 1 1 1 1 24 GLU QG  .  24 . HG#  1 1 
        268 1 2 1 1 29 ALA H   .  29 . HN   1 1 
        269 1 1 1 1 24 GLU QG  .  24 . HG#  1 1 
        269 1 2 1 1 29 ALA MB  .  29 . HB#  1 1 
        270 1 1 1 1 24 GLU QG  .  24 . HG#  1 1 
        270 1 2 1 1 32 SER H   .  32 . HN   1 1 
        271 1 1 1 1 24 GLU QG  .  24 . HG#  1 1 
        271 1 2 1 1 33 TYR H   .  33 . HN   1 1 
        272 1 1 1 1 25 ASP H   .  25 . HN   1 1 
        272 1 2 1 1 26 LYS HA  .  26 . HA   1 1 
        273 1 1 1 1 25 ASP H   .  25 . HN   1 1 
        273 1 2 1 1 28 HIS H   .  28 . HN   1 1 
        274 1 1 1 1 25 ASP H   .  25 . HN   1 1 
        274 1 2 1 1 29 ALA MB  .  29 . HB#  1 1 
        275 1 1 1 1 25 ASP HA  .  25 . HA   1 1 
        275 1 2 1 1 26 LYS QB  .  26 . HB#  1 1 
        276 1 1 1 1 25 ASP HB2 .  25 . HB2  1 1 
        276 1 2 1 1 28 HIS H   .  28 . HN   1 1 
        277 1 1 1 1 25 ASP HB2 .  25 . HB2  1 1 
        277 1 2 1 1 29 ALA H   .  29 . HN   1 1 
        278 1 1 1 1 25 ASP HB2 .  25 . HB2  1 1 
        278 1 2 1 1 30 MET H   .  30 . HN   1 1 
        279 1 1 1 1 25 ASP HB3 .  25 . HB1  1 1 
        279 1 2 1 1 26 LYS H   .  26 . HN   1 1 
        280 1 1 1 1 26 LYS H   .  26 . HN   1 1 
        280 1 2 1 1 26 LYS HB2 .  26 . HB2  1 1 
        281 1 1 1 1 26 LYS H   .  26 . HN   1 1 
        281 1 2 1 1 26 LYS QB  .  26 . HB#  1 1 
        282 1 1 1 1 26 LYS H   .  26 . HN   1 1 
        282 1 2 1 1 26 LYS HB3 .  26 . HB1  1 1 
        283 1 1 1 1 26 LYS H   .  26 . HN   1 1 
        283 1 2 1 1 26 LYS HG2 .  26 . HG2  1 1 
        284 1 1 1 1 26 LYS H   .  26 . HN   1 1 
        284 1 2 1 1 26 LYS QG  .  26 . HG#  1 1 
        285 1 1 1 1 26 LYS H   .  26 . HN   1 1 
        285 1 2 1 1 26 LYS HG3 .  26 . HG1  1 1 
        286 1 1 1 1 26 LYS H   .  26 . HN   1 1 
        286 1 2 1 1 27 ILE H   .  27 . HN   1 1 
        287 1 1 1 1 26 LYS H   .  26 . HN   1 1 
        287 1 2 1 1 27 ILE MG  .  27 . HG2# 1 1 
        288 1 1 1 1 26 LYS HA  .  26 . HA   1 1 
        288 1 2 1 1 26 LYS QG  .  26 . HG#  1 1 
        289 1 1 1 1 26 LYS HA  .  26 . HA   1 1 
        289 1 2 1 1 29 ALA H   .  29 . HN   1 1 
        290 1 1 1 1 26 LYS HA  .  26 . HA   1 1 
        290 1 2 1 1 29 ALA MB  .  29 . HB#  1 1 
        291 1 1 1 1 26 LYS QB  .  26 . HB#  1 1 
        291 1 2 1 1 27 ILE QG  .  27 . HG1# 1 1 
        292 1 1 1 1 26 LYS QB  .  26 . HB#  1 1 
        292 1 2 1 1 29 ALA H   .  29 . HN   1 1 
        293 1 1 1 1 26 LYS QG  .  26 . HG#  1 1 
        293 1 2 1 1 27 ILE H   .  27 . HN   1 1 
        294 1 1 1 1 26 LYS QG  .  26 . HG#  1 1 
        294 1 2 1 1 29 ALA H   .  29 . HN   1 1 
        295 1 1 1 1 26 LYS HG2 .  26 . HG2  1 1 
        295 1 2 1 1 27 ILE H   .  27 . HN   1 1 
        296 1 1 1 1 26 LYS HG3 .  26 . HG1  1 1 
        296 1 2 1 1 27 ILE H   .  27 . HN   1 1 
        297 1 1 1 1 27 ILE H   .  27 . HN   1 1 
        297 1 2 1 1 27 ILE MD  .  27 . HD1# 1 1 
        298 1 1 1 1 27 ILE H   .  27 . HN   1 1 
        298 1 2 1 1 27 ILE MG  .  27 . HG2# 1 1 
        299 1 1 1 1 27 ILE H   .  27 . HN   1 1 
        299 1 2 1 1 28 HIS H   .  28 . HN   1 1 
        300 1 1 1 1 27 ILE H   .  27 . HN   1 1 
        300 1 2 1 1 29 ALA H   .  29 . HN   1 1 
        301 1 1 1 1 27 ILE HA  .  27 . HA   1 1 
        301 1 2 1 1 27 ILE MD  .  27 . HD1# 1 1 
        302 1 1 1 1 27 ILE HA  .  27 . HA   1 1 
        302 1 2 1 1 66 VAL QG  .  66 . HG#  1 1 
        303 1 1 1 1 27 ILE HA  .  27 . HA   1 1 
        303 1 2 1 1 67 LYS QD  .  67 . HD#  1 1 
        304 1 1 1 1 27 ILE HB  .  27 . HB   1 1 
        304 1 2 1 1 27 ILE MD  .  27 . HD1# 1 1 
        305 1 1 1 1 27 ILE HB  .  27 . HB   1 1 
        305 1 2 1 1 29 ALA H   .  29 . HN   1 1 
        306 1 1 1 1 27 ILE MD  .  27 . HD1# 1 1 
        306 1 2 1 1 63 TYR QE  .  63 . HE#  1 1 
        307 1 1 1 1 27 ILE MD  .  27 . HD1# 1 1 
        307 1 2 1 1 67 LYS H   .  67 . HN   1 1 
        308 1 1 1 1 27 ILE MD  .  27 . HD1# 1 1 
        308 1 2 1 1 67 LYS HA  .  67 . HA   1 1 
        309 1 1 1 1 27 ILE MD  .  27 . HD1# 1 1 
        309 1 2 1 1 67 LYS HB3 .  67 . HB1  1 1 
        310 1 1 1 1 27 ILE MD  .  27 . HD1# 1 1 
        310 1 2 1 1 67 LYS QD  .  67 . HD#  1 1 
        311 1 1 1 1 27 ILE MD  .  27 . HD1# 1 1 
        311 1 2 1 1 67 LYS HG3 .  67 . HG1  1 1 
        312 1 1 1 1 27 ILE MD  .  27 . HD1# 1 1 
        312 1 2 1 1 68 ARG H   .  68 . HN   1 1 
        313 1 1 1 1 27 ILE MD  .  27 . HD1# 1 1 
        313 1 2 1 1 69 GLY H   .  69 . HN   1 1 
        314 1 1 1 1 27 ILE MD  .  27 . HD1# 1 1 
        314 1 2 1 1 70 GLU H   .  70 . HN   1 1 
        315 1 1 1 1 27 ILE MD  .  27 . HD1# 1 1 
        315 1 2 1 1 70 GLU QB  .  70 . HB#  1 1 
        316 1 1 1 1 27 ILE MD  .  27 . HD1# 1 1 
        316 1 2 1 1 70 GLU QG  .  70 . HG#  1 1 
        317 1 1 1 1 27 ILE MD  .  27 . HD1# 1 1 
        317 1 2 1 1 71 SER H   .  71 . HN   1 1 
        318 1 1 1 1 27 ILE QG  .  27 . HG1# 1 1 
        318 1 2 1 1 27 ILE MG  .  27 . HG2# 1 1 
        319 1 1 1 1 27 ILE QG  .  27 . HG1# 1 1 
        319 1 2 1 1 71 SER H   .  71 . HN   1 1 
        320 1 1 1 1 27 ILE MG  .  27 . HG2# 1 1 
        320 1 2 1 1 28 HIS H   .  28 . HN   1 1 
        321 1 1 1 1 27 ILE MG  .  27 . HG2# 1 1 
        321 1 2 1 1 29 ALA H   .  29 . HN   1 1 
        322 1 1 1 1 27 ILE MG  .  27 . HG2# 1 1 
        322 1 2 1 1 29 ALA MB  .  29 . HB#  1 1 
        323 1 1 1 1 27 ILE MG  .  27 . HG2# 1 1 
        323 1 2 1 1 30 MET H   .  30 . HN   1 1 
        324 1 1 1 1 27 ILE MG  .  27 . HG2# 1 1 
        324 1 2 1 1 31 ASN H   .  31 . HN   1 1 
        325 1 1 1 1 27 ILE MG  .  27 . HG2# 1 1 
        325 1 2 1 1 67 LYS QD  .  67 . HD#  1 1 
        326 1 1 1 1 28 HIS H   .  28 . HN   1 1 
        326 1 2 1 1 29 ALA H   .  29 . HN   1 1 
        327 1 1 1 1 28 HIS H   .  28 . HN   1 1 
        327 1 2 1 1 30 MET H   .  30 . HN   1 1 
        328 1 1 1 1 29 ALA H   .  29 . HN   1 1 
        328 1 2 1 1 30 MET H   .  30 . HN   1 1 
        329 1 1 1 1 29 ALA H   .  29 . HN   1 1 
        329 1 2 1 1 31 ASN H   .  31 . HN   1 1 
        330 1 1 1 1 29 ALA H   .  29 . HN   1 1 
        330 1 2 1 1 66 VAL QG  .  66 . HG#  1 1 
        331 1 1 1 1 29 ALA MB  .  29 . HB#  1 1 
        331 1 2 1 1 30 MET HA  .  30 . HA   1 1 
        332 1 1 1 1 29 ALA MB  .  29 . HB#  1 1 
        332 1 2 1 1 31 ASN H   .  31 . HN   1 1 
        333 1 1 1 1 29 ALA MB  .  29 . HB#  1 1 
        333 1 2 1 1 33 TYR H   .  33 . HN   1 1 
        334 1 1 1 1 29 ALA MB  .  29 . HB#  1 1 
        334 1 2 1 1 33 TYR QB  .  33 . HB#  1 1 
        335 1 1 1 1 29 ALA MB  .  29 . HB#  1 1 
        335 1 2 1 1 66 VAL HB  .  66 . HB   1 1 
        336 1 1 1 1 30 MET H   .  30 . HN   1 1 
        336 1 2 1 1 31 ASN H   .  31 . HN   1 1 
        337 1 1 1 1 30 MET H   .  30 . HN   1 1 
        337 1 2 1 1 32 SER H   .  32 . HN   1 1 
        338 1 1 1 1 30 MET H   .  30 . HN   1 1 
        338 1 2 1 1 33 TYR QB  .  33 . HB#  1 1 
        339 1 1 1 1 30 MET H   .  30 . HN   1 1 
        339 1 2 1 1 33 TYR QD  .  33 . HD#  1 1 
        340 1 1 1 1 30 MET H   .  30 . HN   1 1 
        340 1 2 1 1 66 VAL HB  .  66 . HB   1 1 
        341 1 1 1 1 30 MET H   .  30 . HN   1 1 
        341 1 2 1 1 66 VAL MG1 .  66 . HG1# 1 1 
        342 1 1 1 1 30 MET H   .  30 . HN   1 1 
        342 1 2 1 1 66 VAL MG2 .  66 . HG2# 1 1 
        343 1 1 1 1 30 MET H   .  30 . HN   1 1 
        343 1 2 1 1 67 LYS QD  .  67 . HD#  1 1 
        344 1 1 1 1 30 MET HA  .  30 . HA   1 1 
        344 1 2 1 1 33 TYR H   .  33 . HN   1 1 
        345 1 1 1 1 30 MET HA  .  30 . HA   1 1 
        345 1 2 1 1 33 TYR QB  .  33 . HB#  1 1 
        346 1 1 1 1 30 MET HA  .  30 . HA   1 1 
        346 1 2 1 1 34 TYR H   .  34 . HN   1 1 
        347 1 1 1 1 30 MET HA  .  30 . HA   1 1 
        347 1 2 1 1 66 VAL MG1 .  66 . HG1# 1 1 
        348 1 1 1 1 30 MET HA  .  30 . HA   1 1 
        348 1 2 1 1 66 VAL QG  .  66 . HG#  1 1 
        349 1 1 1 1 30 MET HA  .  30 . HA   1 1 
        349 1 2 1 1 66 VAL MG2 .  66 . HG2# 1 1 
        350 1 1 1 1 30 MET ME  .  30 . HE#  1 1 
        350 1 2 1 1 31 ASN H   .  31 . HN   1 1 
        351 1 1 1 1 31 ASN H   .  31 . HN   1 1 
        351 1 2 1 1 32 SER H   .  32 . HN   1 1 
        352 1 1 1 1 31 ASN H   .  31 . HN   1 1 
        352 1 2 1 1 33 TYR H   .  33 . HN   1 1 
        353 1 1 1 1 31 ASN H   .  31 . HN   1 1 
        353 1 2 1 1 33 TYR QB  .  33 . HB#  1 1 
        354 1 1 1 1 32 SER H   .  32 . HN   1 1 
        354 1 2 1 1 33 TYR H   .  33 . HN   1 1 
        355 1 1 1 1 32 SER H   .  32 . HN   1 1 
        355 1 2 1 1 33 TYR QB  .  33 . HB#  1 1 
        356 1 1 1 1 32 SER H   .  32 . HN   1 1 
        356 1 2 1 1 34 TYR H   .  34 . HN   1 1 
        357 1 1 1 1 33 TYR H   .  33 . HN   1 1 
        357 1 2 1 1 33 TYR HB2 .  33 . HB2  1 1 
        358 1 1 1 1 33 TYR H   .  33 . HN   1 1 
        358 1 2 1 1 33 TYR QB  .  33 . HB#  1 1 
        359 1 1 1 1 33 TYR H   .  33 . HN   1 1 
        359 1 2 1 1 33 TYR HB3 .  33 . HB1  1 1 
        360 1 1 1 1 33 TYR H   .  33 . HN   1 1 
        360 1 2 1 1 33 TYR QD  .  33 . HD#  1 1 
        361 1 1 1 1 33 TYR H   .  33 . HN   1 1 
        361 1 2 1 1 34 TYR H   .  34 . HN   1 1 
        362 1 1 1 1 33 TYR H   .  33 . HN   1 1 
        362 1 2 1 1 37 VAL H   .  37 . HN   1 1 
        363 1 1 1 1 33 TYR QB  .  33 . HB#  1 1 
        363 1 2 1 1 34 TYR H   .  34 . HN   1 1 
        364 1 1 1 1 33 TYR QB  .  33 . HB#  1 1 
        364 1 2 1 1 35 ARG H   .  35 . HN   1 1 
        365 1 1 1 1 33 TYR QD  .  33 . HD#  1 1 
        365 1 2 1 1 34 TYR H   .  34 . HN   1 1 
        366 1 1 1 1 33 TYR QD  .  33 . HD#  1 1 
        366 1 2 1 1 37 VAL H   .  37 . HN   1 1 
        367 1 1 1 1 33 TYR QD  .  33 . HD#  1 1 
        367 1 2 1 1 37 VAL QG  .  37 . HG#  1 1 
        368 1 1 1 1 33 TYR QD  .  33 . HD#  1 1 
        368 1 2 1 1 38 VAL H   .  38 . HN   1 1 
        369 1 1 1 1 33 TYR QD  .  33 . HD#  1 1 
        369 1 2 1 1 59 LEU QD  .  59 . HD#  1 1 
        370 1 1 1 1 33 TYR QD  .  33 . HD#  1 1 
        370 1 2 1 1 62 ALA MB  .  62 . HB#  1 1 
        371 1 1 1 1 33 TYR QE  .  33 . HE#  1 1 
        371 1 2 1 1 34 TYR H   .  34 . HN   1 1 
        372 1 1 1 1 33 TYR QE  .  33 . HE#  1 1 
        372 1 2 1 1 37 VAL H   .  37 . HN   1 1 
        373 1 1 1 1 33 TYR QE  .  33 . HE#  1 1 
        373 1 2 1 1 37 VAL QG  .  37 . HG#  1 1 
        374 1 1 1 1 33 TYR QE  .  33 . HE#  1 1 
        374 1 2 1 1 38 VAL H   .  38 . HN   1 1 
        375 1 1 1 1 33 TYR QE  .  33 . HE#  1 1 
        375 1 2 1 1 59 LEU QD  .  59 . HD#  1 1 
        376 1 1 1 1 33 TYR QE  .  33 . HE#  1 1 
        376 1 2 1 1 59 LEU HG  .  59 . HG   1 1 
        377 1 1 1 1 34 TYR H   .  34 . HN   1 1 
        377 1 2 1 1 34 TYR QD  .  34 . HD#  1 1 
        378 1 1 1 1 34 TYR H   .  34 . HN   1 1 
        378 1 2 1 1 35 ARG H   .  35 . HN   1 1 
        379 1 1 1 1 34 TYR H   .  34 . HN   1 1 
        379 1 2 1 1 36 SER H   .  36 . HN   1 1 
        380 1 1 1 1 34 TYR H   .  34 . HN   1 1 
        380 1 2 1 1 38 VAL QG  .  38 . HG#  1 1 
        381 1 1 1 1 34 TYR HA  .  34 . HA   1 1 
        381 1 2 1 1 34 TYR QD  .  34 . HD#  1 1 
        382 1 1 1 1 34 TYR HA  .  34 . HA   1 1 
        382 1 2 1 1 34 TYR QE  .  34 . HE#  1 1 
        383 1 1 1 1 34 TYR QB  .  34 . HB#  1 1 
        383 1 2 1 1 38 VAL QG  .  38 . HG#  1 1 
        384 1 1 1 1 34 TYR QD  .  34 . HD#  1 1 
        384 1 2 1 1 38 VAL QG  .  38 . HG#  1 1 
        385 1 1 1 1 34 TYR QD  .  34 . HD#  1 1 
        385 1 2 1 1 59 LEU MD1 .  59 . HD1# 1 1 
        386 1 1 1 1 34 TYR QD  .  34 . HD#  1 1 
        386 1 2 1 1 59 LEU QD  .  59 . HD#  1 1 
        387 1 1 1 1 34 TYR QD  .  34 . HD#  1 1 
        387 1 2 1 1 59 LEU MD2 .  59 . HD2# 1 1 
        388 1 1 1 1 34 TYR QD  .  34 . HD#  1 1 
        388 1 2 1 1 63 TYR H   .  63 . HN   1 1 
        389 1 1 1 1 34 TYR QD  .  34 . HD#  1 1 
        389 1 2 1 1 63 TYR HA  .  63 . HA   1 1 
        390 1 1 1 1 34 TYR QD  .  34 . HD#  1 1 
        390 1 2 1 1 63 TYR QB  .  63 . HB#  1 1 
        391 1 1 1 1 34 TYR QE  .  34 . HE#  1 1 
        391 1 2 1 1 37 VAL QG  .  37 . HG#  1 1 
        392 1 1 1 1 34 TYR QE  .  34 . HE#  1 1 
        392 1 2 1 1 38 VAL H   .  38 . HN   1 1 
        393 1 1 1 1 34 TYR QE  .  34 . HE#  1 1 
        393 1 2 1 1 38 VAL QG  .  38 . HG#  1 1 
        394 1 1 1 1 34 TYR QE  .  34 . HE#  1 1 
        394 1 2 1 1 60 ASP H   .  60 . HN   1 1 
        395 1 1 1 1 34 TYR QE  .  34 . HE#  1 1 
        395 1 2 1 1 60 ASP QB  .  60 . HB#  1 1 
        396 1 1 1 1 34 TYR QE  .  34 . HE#  1 1 
        396 1 2 1 1 63 TYR H   .  63 . HN   1 1 
        397 1 1 1 1 34 TYR QE  .  34 . HE#  1 1 
        397 1 2 1 1 63 TYR QB  .  63 . HB#  1 1 
        398 1 1 1 1 35 ARG H   .  35 . HN   1 1 
        398 1 2 1 1 35 ARG QB  .  35 . HB#  1 1 
        399 1 1 1 1 35 ARG H   .  35 . HN   1 1 
        399 1 2 1 1 36 SER H   .  36 . HN   1 1 
        400 1 1 1 1 36 SER H   .  36 . HN   1 1 
        400 1 2 1 1 37 VAL H   .  37 . HN   1 1 
        401 1 1 1 1 36 SER H   .  36 . HN   1 1 
        401 1 2 1 1 37 VAL QG  .  37 . HG#  1 1 
        402 1 1 1 1 36 SER H   .  36 . HN   1 1 
        402 1 2 1 1 38 VAL H   .  38 . HN   1 1 
        403 1 1 1 1 37 VAL H   .  37 . HN   1 1 
        403 1 2 1 1 37 VAL HB  .  37 . HB   1 1 
        404 1 1 1 1 37 VAL H   .  37 . HN   1 1 
        404 1 2 1 1 37 VAL QG  .  37 . HG#  1 1 
        405 1 1 1 1 37 VAL H   .  37 . HN   1 1 
        405 1 2 1 1 38 VAL H   .  38 . HN   1 1 
        406 1 1 1 1 37 VAL H   .  37 . HN   1 1 
        406 1 2 1 1 38 VAL QG  .  38 . HG#  1 1 
        407 1 1 1 1 37 VAL H   .  37 . HN   1 1 
        407 1 2 1 1 59 LEU MD1 .  59 . HD1# 1 1 
        408 1 1 1 1 37 VAL H   .  37 . HN   1 1 
        408 1 2 1 1 59 LEU QD  .  59 . HD#  1 1 
        409 1 1 1 1 37 VAL H   .  37 . HN   1 1 
        409 1 2 1 1 59 LEU MD2 .  59 . HD2# 1 1 
        410 1 1 1 1 37 VAL HA  .  37 . HA   1 1 
        410 1 2 1 1 37 VAL MG1 .  37 . HG1# 1 1 
        411 1 1 1 1 37 VAL HA  .  37 . HA   1 1 
        411 1 2 1 1 37 VAL QG  .  37 . HG#  1 1 
        412 1 1 1 1 37 VAL HA  .  37 . HA   1 1 
        412 1 2 1 1 37 VAL MG2 .  37 . HG2# 1 1 
        413 1 1 1 1 37 VAL HA  .  37 . HA   1 1 
        413 1 2 1 1 40 THR HB  .  40 . HB   1 1 
        414 1 1 1 1 37 VAL HA  .  37 . HA   1 1 
        414 1 2 1 1 40 THR MG  .  40 . HG2# 1 1 
        415 1 1 1 1 37 VAL HA  .  37 . HA   1 1 
        415 1 2 1 1 41 LEU HG  .  41 . HG   1 1 
        416 1 1 1 1 37 VAL HB  .  37 . HB   1 1 
        416 1 2 1 1 38 VAL H   .  38 . HN   1 1 
        417 1 1 1 1 37 VAL HB  .  37 . HB   1 1 
        417 1 2 1 1 38 VAL QG  .  38 . HG#  1 1 
        418 1 1 1 1 37 VAL HB  .  37 . HB   1 1 
        418 1 2 1 1 59 LEU QD  .  59 . HD#  1 1 
        419 1 1 1 1 37 VAL QG  .  37 . HG#  1 1 
        419 1 2 1 1 38 VAL H   .  38 . HN   1 1 
        420 1 1 1 1 37 VAL QG  .  37 . HG#  1 1 
        420 1 2 1 1 38 VAL HA  .  38 . HA   1 1 
        421 1 1 1 1 37 VAL QG  .  37 . HG#  1 1 
        421 1 2 1 1 40 THR HB  .  40 . HB   1 1 
        422 1 1 1 1 37 VAL QG  .  37 . HG#  1 1 
        422 1 2 1 1 40 THR MG  .  40 . HG2# 1 1 
        423 1 1 1 1 37 VAL QG  .  37 . HG#  1 1 
        423 1 2 1 1 41 LEU H   .  41 . HN   1 1 
        424 1 1 1 1 37 VAL QG  .  37 . HG#  1 1 
        424 1 2 1 1 41 LEU QB  .  41 . HB#  1 1 
        425 1 1 1 1 37 VAL QG  .  37 . HG#  1 1 
        425 1 2 1 1 41 LEU QD  .  41 . HD#  1 1 
        426 1 1 1 1 37 VAL QG  .  37 . HG#  1 1 
        426 1 2 1 1 42 VAL H   .  42 . HN   1 1 
        427 1 1 1 1 37 VAL QG  .  37 . HG#  1 1 
        427 1 2 1 1 56 ILE HA  .  56 . HA   1 1 
        428 1 1 1 1 37 VAL QG  .  37 . HG#  1 1 
        428 1 2 1 1 59 LEU H   .  59 . HN   1 1 
        429 1 1 1 1 37 VAL QG  .  37 . HG#  1 1 
        429 1 2 1 1 59 LEU QD  .  59 . HD#  1 1 
        430 1 1 1 1 37 VAL MG1 .  37 . HG1# 1 1 
        430 1 2 1 1 38 VAL H   .  38 . HN   1 1 
        431 1 1 1 1 37 VAL MG1 .  37 . HG1# 1 1 
        431 1 2 1 1 40 THR HB  .  40 . HB   1 1 
        432 1 1 1 1 37 VAL MG2 .  37 . HG2# 1 1 
        432 1 2 1 1 38 VAL H   .  38 . HN   1 1 
        433 1 1 1 1 37 VAL MG2 .  37 . HG2# 1 1 
        433 1 2 1 1 40 THR HB  .  40 . HB   1 1 
        434 1 1 1 1 38 VAL H   .  38 . HN   1 1 
        434 1 2 1 1 38 VAL QG  .  38 . HG#  1 1 
        435 1 1 1 1 38 VAL H   .  38 . HN   1 1 
        435 1 2 1 1 39 SER H   .  39 . HN   1 1 
        436 1 1 1 1 38 VAL H   .  38 . HN   1 1 
        436 1 2 1 1 39 SER QB  .  39 . HB#  1 1 
        437 1 1 1 1 38 VAL H   .  38 . HN   1 1 
        437 1 2 1 1 40 THR H   .  40 . HN   1 1 
        438 1 1 1 1 38 VAL H   .  38 . HN   1 1 
        438 1 2 1 1 40 THR HB  .  40 . HB   1 1 
        439 1 1 1 1 38 VAL H   .  38 . HN   1 1 
        439 1 2 1 1 41 LEU H   .  41 . HN   1 1 
        440 1 1 1 1 38 VAL H   .  38 . HN   1 1 
        440 1 2 1 1 41 LEU QD  .  41 . HD#  1 1 
        441 1 1 1 1 38 VAL HA  .  38 . HA   1 1 
        441 1 2 1 1 41 LEU H   .  41 . HN   1 1 
        442 1 1 1 1 38 VAL HA  .  38 . HA   1 1 
        442 1 2 1 1 41 LEU QD  .  41 . HD#  1 1 
        443 1 1 1 1 38 VAL HA  .  38 . HA   1 1 
        443 1 2 1 1 41 LEU HG  .  41 . HG   1 1 
        444 1 1 1 1 38 VAL HA  .  38 . HA   1 1 
        444 1 2 1 1 42 VAL QG  .  42 . HG#  1 1 
        445 1 1 1 1 38 VAL HA  .  38 . HA   1 1 
        445 1 2 1 1 56 ILE MG  .  56 . HG2# 1 1 
        446 1 1 1 1 38 VAL QG  .  38 . HG#  1 1 
        446 1 2 1 1 39 SER H   .  39 . HN   1 1 
        447 1 1 1 1 38 VAL QG  .  38 . HG#  1 1 
        447 1 2 1 1 59 LEU HB2 .  59 . HB2  1 1 
        448 1 1 1 1 38 VAL QG  .  38 . HG#  1 1 
        448 1 2 1 1 59 LEU QD  .  59 . HD#  1 1 
        449 1 1 1 1 39 SER H   .  39 . HN   1 1 
        449 1 2 1 1 39 SER QB  .  39 . HB#  1 1 
        450 1 1 1 1 39 SER H   .  39 . HN   1 1 
        450 1 2 1 1 40 THR H   .  40 . HN   1 1 
        451 1 1 1 1 39 SER H   .  39 . HN   1 1 
        451 1 2 1 1 40 THR HB  .  40 . HB   1 1 
        452 1 1 1 1 39 SER H   .  39 . HN   1 1 
        452 1 2 1 1 41 LEU H   .  41 . HN   1 1 
        453 1 1 1 1 39 SER H   .  39 . HN   1 1 
        453 1 2 1 1 42 VAL HB  .  42 . HB   1 1 
        454 1 1 1 1 39 SER H   .  39 . HN   1 1 
        454 1 2 1 1 42 VAL QG  .  42 . HG#  1 1 
        455 1 1 1 1 39 SER HA  .  39 . HA   1 1 
        455 1 2 1 1 42 VAL QG  .  42 . HG#  1 1 
        456 1 1 1 1 39 SER QB  .  39 . HB#  1 1 
        456 1 2 1 1 40 THR H   .  40 . HN   1 1 
        457 1 1 1 1 39 SER QB  .  39 . HB#  1 1 
        457 1 2 1 1 40 THR MG  .  40 . HG2# 1 1 
        458 1 1 1 1 39 SER QB  .  39 . HB#  1 1 
        458 1 2 1 1 41 LEU H   .  41 . HN   1 1 
        459 1 1 1 1 39 SER QB  .  39 . HB#  1 1 
        459 1 2 1 1 42 VAL H   .  42 . HN   1 1 
        460 1 1 1 1 40 THR H   .  40 . HN   1 1 
        460 1 2 1 1 40 THR MG  .  40 . HG2# 1 1 
        461 1 1 1 1 40 THR H   .  40 . HN   1 1 
        461 1 2 1 1 41 LEU H   .  41 . HN   1 1 
        462 1 1 1 1 40 THR H   .  40 . HN   1 1 
        462 1 2 1 1 41 LEU QB  .  41 . HB#  1 1 
        463 1 1 1 1 40 THR H   .  40 . HN   1 1 
        463 1 2 1 1 41 LEU QD  .  41 . HD#  1 1 
        464 1 1 1 1 40 THR H   .  40 . HN   1 1 
        464 1 2 1 1 42 VAL H   .  42 . HN   1 1 
        465 1 1 1 1 40 THR H   .  40 . HN   1 1 
        465 1 2 1 1 42 VAL QG  .  42 . HG#  1 1 
        466 1 1 1 1 40 THR H   .  40 . HN   1 1 
        466 1 2 1 1 43 GLN QB  .  43 . HB#  1 1 
        467 1 1 1 1 40 THR HA  .  40 . HA   1 1 
        467 1 2 1 1 40 THR MG  .  40 . HG2# 1 1 
        468 1 1 1 1 40 THR HB  .  40 . HB   1 1 
        468 1 2 1 1 41 LEU H   .  41 . HN   1 1 
        469 1 1 1 1 40 THR HB  .  40 . HB   1 1 
        469 1 2 1 1 41 LEU QD  .  41 . HD#  1 1 
        470 1 1 1 1 40 THR MG  .  40 . HG2# 1 1 
        470 1 2 1 1 41 LEU H   .  41 . HN   1 1 
        471 1 1 1 1 40 THR MG  .  40 . HG2# 1 1 
        471 1 2 1 1 41 LEU QB  .  41 . HB#  1 1 
        472 1 1 1 1 40 THR MG  .  40 . HG2# 1 1 
        472 1 2 1 1 41 LEU QD  .  41 . HD#  1 1 
        473 1 1 1 1 40 THR MG  .  40 . HG2# 1 1 
        473 1 2 1 1 42 VAL H   .  42 . HN   1 1 
        474 1 1 1 1 40 THR MG  .  40 . HG2# 1 1 
        474 1 2 1 1 43 GLN H   .  43 . HN   1 1 
        475 1 1 1 1 40 THR MG  .  40 . HG2# 1 1 
        475 1 2 1 1 43 GLN QB  .  43 . HB#  1 1 
        476 1 1 1 1 40 THR MG  .  40 . HG2# 1 1 
        476 1 2 1 1 43 GLN QG  .  43 . HG#  1 1 
        477 1 1 1 1 40 THR MG  .  40 . HG2# 1 1 
        477 1 2 1 1 44 ASP H   .  44 . HN   1 1 
        478 1 1 1 1 41 LEU H   .  41 . HN   1 1 
        478 1 2 1 1 41 LEU QB  .  41 . HB#  1 1 
        479 1 1 1 1 41 LEU H   .  41 . HN   1 1 
        479 1 2 1 1 41 LEU QD  .  41 . HD#  1 1 
        480 1 1 1 1 41 LEU H   .  41 . HN   1 1 
        480 1 2 1 1 42 VAL H   .  42 . HN   1 1 
        481 1 1 1 1 41 LEU H   .  41 . HN   1 1 
        481 1 2 1 1 43 GLN H   .  43 . HN   1 1 
        482 1 1 1 1 41 LEU HA  .  41 . HA   1 1 
        482 1 2 1 1 41 LEU QD  .  41 . HD#  1 1 
        483 1 1 1 1 41 LEU HA  .  41 . HA   1 1 
        483 1 2 1 1 43 GLN H   .  43 . HN   1 1 
        484 1 1 1 1 41 LEU HA  .  41 . HA   1 1 
        484 1 2 1 1 44 ASP H   .  44 . HN   1 1 
        485 1 1 1 1 41 LEU QD  .  41 . HD#  1 1 
        485 1 2 1 1 42 VAL H   .  42 . HN   1 1 
        486 1 1 1 1 41 LEU QD  .  41 . HD#  1 1 
        486 1 2 1 1 52 VAL HA  .  52 . HA   1 1 
        487 1 1 1 1 41 LEU QD  .  41 . HD#  1 1 
        487 1 2 1 1 55 ARG H   .  55 . HN   1 1 
        488 1 1 1 1 41 LEU QD  .  41 . HD#  1 1 
        488 1 2 1 1 55 ARG HA  .  55 . HA   1 1 
        489 1 1 1 1 41 LEU QD  .  41 . HD#  1 1 
        489 1 2 1 1 56 ILE H   .  56 . HN   1 1 
        490 1 1 1 1 41 LEU HG  .  41 . HG   1 1 
        490 1 2 1 1 59 LEU QD  .  59 . HD#  1 1 
        491 1 1 1 1 42 VAL H   .  42 . HN   1 1 
        491 1 2 1 1 42 VAL MG1 .  42 . HG1# 1 1 
        492 1 1 1 1 42 VAL H   .  42 . HN   1 1 
        492 1 2 1 1 42 VAL QG  .  42 . HG#  1 1 
        493 1 1 1 1 42 VAL H   .  42 . HN   1 1 
        493 1 2 1 1 42 VAL MG2 .  42 . HG2# 1 1 
        494 1 1 1 1 42 VAL H   .  42 . HN   1 1 
        494 1 2 1 1 43 GLN H   .  43 . HN   1 1 
        495 1 1 1 1 42 VAL H   .  42 . HN   1 1 
        495 1 2 1 1 44 ASP H   .  44 . HN   1 1 
        496 1 1 1 1 42 VAL H   .  42 . HN   1 1 
        496 1 2 1 1 44 ASP QB  .  44 . HB#  1 1 
        497 1 1 1 1 42 VAL HA  .  42 . HA   1 1 
        497 1 2 1 1 42 VAL QG  .  42 . HG#  1 1 
        498 1 1 1 1 42 VAL HA  .  42 . HA   1 1 
        498 1 2 1 1 52 VAL QG  .  52 . HG#  1 1 
        499 1 1 1 1 42 VAL HB  .  42 . HB   1 1 
        499 1 2 1 1 43 GLN H   .  43 . HN   1 1 
        500 1 1 1 1 42 VAL HB  .  42 . HB   1 1 
        500 1 2 1 1 44 ASP H   .  44 . HN   1 1 
        501 1 1 1 1 42 VAL HB  .  42 . HB   1 1 
        501 1 2 1 1 52 VAL QG  .  52 . HG#  1 1 
        502 1 1 1 1 42 VAL HB  .  42 . HB   1 1 
        502 1 2 1 1 56 ILE MD  .  56 . HD1# 1 1 
        503 1 1 1 1 42 VAL QG  .  42 . HG#  1 1 
        503 1 2 1 1 43 GLN H   .  43 . HN   1 1 
        504 1 1 1 1 42 VAL QG  .  42 . HG#  1 1 
        504 1 2 1 1 43 GLN QB  .  43 . HB#  1 1 
        505 1 1 1 1 42 VAL QG  .  42 . HG#  1 1 
        505 1 2 1 1 43 GLN QG  .  43 . HG#  1 1 
        506 1 1 1 1 42 VAL QG  .  42 . HG#  1 1 
        506 1 2 1 1 44 ASP H   .  44 . HN   1 1 
        507 1 1 1 1 42 VAL QG  .  42 . HG#  1 1 
        507 1 2 1 1 44 ASP QB  .  44 . HB#  1 1 
        508 1 1 1 1 42 VAL QG  .  42 . HG#  1 1 
        508 1 2 1 1 52 VAL H   .  52 . HN   1 1 
        509 1 1 1 1 42 VAL QG  .  42 . HG#  1 1 
        509 1 2 1 1 56 ILE QG  .  56 . HG1# 1 1 
        510 1 1 1 1 42 VAL QG  .  42 . HG#  1 1 
        510 1 2 2 1 56 ILE MD  . 156 . HD1# 1 1 
        511 1 1 1 1 42 VAL QG  .  42 . HG#  1 1 
        511 1 2 2 1 57 GLN HA  . 157 . HA   1 1 
        512 1 1 1 1 42 VAL QG  .  42 . HG#  1 1 
        512 1 2 2 1 57 GLN QG  . 157 . HG#  1 1 
        513 1 1 1 1 42 VAL MG1 .  42 . HG1# 1 1 
        513 1 2 1 1 43 GLN H   .  43 . HN   1 1 
        514 1 1 1 1 42 VAL MG2 .  42 . HG2# 1 1 
        514 1 2 1 1 43 GLN H   .  43 . HN   1 1 
        515 1 1 1 1 43 GLN H   .  43 . HN   1 1 
        515 1 2 1 1 44 ASP H   .  44 . HN   1 1 
        516 1 1 1 1 43 GLN H   .  43 . HN   1 1 
        516 1 2 1 1 44 ASP QB  .  44 . HB#  1 1 
        517 1 1 1 1 43 GLN HA  .  43 . HA   1 1 
        517 1 2 1 1 43 GLN QB  .  43 . HB#  1 1 
        518 1 1 1 1 43 GLN HA  .  43 . HA   1 1 
        518 1 2 1 1 43 GLN QG  .  43 . HG#  1 1 
        519 1 1 1 1 44 ASP H   .  44 . HN   1 1 
        519 1 2 1 1 44 ASP QB  .  44 . HB#  1 1 
        520 1 1 1 1 44 ASP H   .  44 . HN   1 1 
        520 1 2 1 1 45 GLN H   .  45 . HN   1 1 
        521 1 1 1 1 44 ASP QB  .  44 . HB#  1 1 
        521 1 2 1 1 46 LEU H   .  46 . HN   1 1 
        522 1 1 1 1 45 GLN H   .  45 . HN   1 1 
        522 1 2 1 1 45 GLN QG  .  45 . HG#  1 1 
        523 1 1 1 1 45 GLN H   .  45 . HN   1 1 
        523 1 2 1 1 46 LEU QB  .  46 . HB#  1 1 
        524 1 1 1 1 45 GLN H   .  45 . HN   1 1 
        524 1 2 1 1 46 LEU HG  .  46 . HG   1 1 
        525 1 1 1 1 45 GLN HA  .  45 . HA   1 1 
        525 1 2 1 1 45 GLN QG  .  45 . HG#  1 1 
        526 1 1 1 1 45 GLN QG  .  45 . HG#  1 1 
        526 1 2 1 1 46 LEU H   .  46 . HN   1 1 
        527 1 1 1 1 45 GLN QG  .  45 . HG#  1 1 
        527 1 2 1 1 46 LEU HA  .  46 . HA   1 1 
        528 1 1 1 1 45 GLN QG  .  45 . HG#  1 1 
        528 1 2 1 1 46 LEU QB  .  46 . HB#  1 1 
        529 1 1 1 1 45 GLN QG  .  45 . HG#  1 1 
        529 1 2 1 1 46 LEU HG  .  46 . HG   1 1 
        530 1 1 1 1 45 GLN QG  .  45 . HG#  1 1 
        530 1 2 1 1 47 THR H   .  47 . HN   1 1 
        531 1 1 1 1 45 GLN QG  .  45 . HG#  1 1 
        531 1 2 1 1 48 LYS H   .  48 . HN   1 1 
        532 1 1 1 1 45 GLN QG  .  45 . HG#  1 1 
        532 1 2 1 1 51 VAL QG  .  51 . HG#  1 1 
        533 1 1 1 1 45 GLN QG  .  45 . HG#  1 1 
        533 1 2 1 1 52 VAL H   .  52 . HN   1 1 
        534 1 1 1 1 46 LEU H   .  46 . HN   1 1 
        534 1 2 1 1 46 LEU HA  .  46 . HA   1 1 
        535 1 1 1 1 46 LEU H   .  46 . HN   1 1 
        535 1 2 1 1 46 LEU QB  .  46 . HB#  1 1 
        536 1 1 1 1 46 LEU H   .  46 . HN   1 1 
        536 1 2 1 1 46 LEU MD1 .  46 . HD1# 1 1 
        537 1 1 1 1 46 LEU H   .  46 . HN   1 1 
        537 1 2 1 1 46 LEU MD2 .  46 . HD2# 1 1 
        538 1 1 1 1 46 LEU H   .  46 . HN   1 1 
        538 1 2 1 1 46 LEU HG  .  46 . HG   1 1 
        539 1 1 1 1 46 LEU H   .  46 . HN   1 1 
        539 1 2 1 1 47 THR H   .  47 . HN   1 1 
        540 1 1 1 1 46 LEU H   .  46 . HN   1 1 
        540 1 2 1 1 47 THR HA  .  47 . HA   1 1 
        541 1 1 1 1 46 LEU H   .  46 . HN   1 1 
        541 1 2 1 1 47 THR HB  .  47 . HB   1 1 
        542 1 1 1 1 46 LEU H   .  46 . HN   1 1 
        542 1 2 1 1 47 THR MG  .  47 . HG2# 1 1 
        543 1 1 1 1 46 LEU HA  .  46 . HA   1 1 
        543 1 2 1 1 46 LEU QD  .  46 . HD#  1 1 
        544 1 1 1 1 46 LEU HA  .  46 . HA   1 1 
        544 1 2 1 1 47 THR H   .  47 . HN   1 1 
        545 1 1 1 1 46 LEU HA  .  46 . HA   1 1 
        545 1 2 1 1 48 LYS H   .  48 . HN   1 1 
        546 1 1 1 1 46 LEU HA  .  46 . HA   1 1 
        546 1 2 1 1 52 VAL H   .  52 . HN   1 1 
        547 1 1 1 1 46 LEU QB  .  46 . HB#  1 1 
        547 1 2 1 1 46 LEU QD  .  46 . HD#  1 1 
        548 1 1 1 1 46 LEU QB  .  46 . HB#  1 1 
        548 1 2 1 1 47 THR HA  .  47 . HA   1 1 
        549 1 1 1 1 46 LEU HB2 .  46 . HB2  1 1 
        549 1 2 1 1 46 LEU MD1 .  46 . HD1# 1 1 
        550 1 1 1 1 46 LEU HB2 .  46 . HB2  1 1 
        550 1 2 1 1 46 LEU MD2 .  46 . HD2# 1 1 
        551 1 1 1 1 46 LEU HB3 .  46 . HB1  1 1 
        551 1 2 1 1 46 LEU MD1 .  46 . HD1# 1 1 
        552 1 1 1 1 46 LEU HB3 .  46 . HB1  1 1 
        552 1 2 1 1 46 LEU MD2 .  46 . HD2# 1 1 
        553 1 1 1 1 46 LEU QD  .  46 . HD#  1 1 
        553 1 2 1 1 48 LYS H   .  48 . HN   1 1 
        554 1 1 1 1 46 LEU HG  .  46 . HG   1 1 
        554 1 2 1 1 48 LYS H   .  48 . HN   1 1 
        555 1 1 1 1 47 THR H   .  47 . HN   1 1 
        555 1 2 1 1 47 THR HB  .  47 . HB   1 1 
        556 1 1 1 1 47 THR H   .  47 . HN   1 1 
        556 1 2 1 1 47 THR MG  .  47 . HG2# 1 1 
        557 1 1 1 1 47 THR H   .  47 . HN   1 1 
        557 1 2 1 1 48 LYS H   .  48 . HN   1 1 
        558 1 1 1 1 47 THR H   .  47 . HN   1 1 
        558 1 2 1 1 51 VAL MG1 .  51 . HG1# 1 1 
        559 1 1 1 1 47 THR H   .  47 . HN   1 1 
        559 1 2 1 1 51 VAL QG  .  51 . HG#  1 1 
        560 1 1 1 1 47 THR H   .  47 . HN   1 1 
        560 1 2 1 1 51 VAL MG2 .  51 . HG2# 1 1 
        561 1 1 1 1 47 THR HA  .  47 . HA   1 1 
        561 1 2 1 1 47 THR MG  .  47 . HG2# 1 1 
        562 1 1 1 1 47 THR HA  .  47 . HA   1 1 
        562 1 2 1 1 48 LYS H   .  48 . HN   1 1 
        563 1 1 1 1 47 THR HA  .  47 . HA   1 1 
        563 1 2 1 1 48 LYS QB  .  48 . HB#  1 1 
        564 1 1 1 1 47 THR HA  .  47 . HA   1 1 
        564 1 2 1 1 51 VAL QG  .  51 . HG#  1 1 
        565 1 1 1 1 47 THR HB  .  47 . HB   1 1 
        565 1 2 1 1 48 LYS H   .  48 . HN   1 1 
        566 1 1 1 1 47 THR HB  .  47 . HB   1 1 
        566 1 2 1 1 51 VAL QG  .  51 . HG#  1 1 
        567 1 1 1 1 47 THR HB  .  47 . HB   1 1 
        567 1 2 1 1 52 VAL QG  .  52 . HG#  1 1 
        568 1 1 1 1 47 THR MG  .  47 . HG2# 1 1 
        568 1 2 1 1 48 LYS H   .  48 . HN   1 1 
        569 1 1 1 1 47 THR MG  .  47 . HG2# 1 1 
        569 1 2 1 1 48 LYS QB  .  48 . HB#  1 1 
        570 1 1 1 1 47 THR MG  .  47 . HG2# 1 1 
        570 1 2 1 1 50 ALA H   .  50 . HN   1 1 
        571 1 1 1 1 47 THR MG  .  47 . HG2# 1 1 
        571 1 2 1 1 51 VAL H   .  51 . HN   1 1 
        572 1 1 1 1 47 THR MG  .  47 . HG2# 1 1 
        572 1 2 1 1 51 VAL MG1 .  51 . HG1# 1 1 
        573 1 1 1 1 47 THR MG  .  47 . HG2# 1 1 
        573 1 2 1 1 51 VAL QG  .  51 . HG#  1 1 
        574 1 1 1 1 47 THR MG  .  47 . HG2# 1 1 
        574 1 2 1 1 51 VAL MG2 .  51 . HG2# 1 1 
        575 1 1 1 1 47 THR MG  .  47 . HG2# 1 1 
        575 1 2 1 1 52 VAL H   .  52 . HN   1 1 
        576 1 1 1 1 48 LYS H   .  48 . HN   1 1 
        576 1 2 1 1 48 LYS QB  .  48 . HB#  1 1 
        577 1 1 1 1 48 LYS H   .  48 . HN   1 1 
        577 1 2 1 1 48 LYS QG  .  48 . HG#  1 1 
        578 1 1 1 1 48 LYS H   .  48 . HN   1 1 
        578 1 2 1 1 49 ASN H   .  49 . HN   1 1 
        579 1 1 1 1 48 LYS H   .  48 . HN   1 1 
        579 1 2 1 1 51 VAL H   .  51 . HN   1 1 
        580 1 1 1 1 48 LYS H   .  48 . HN   1 1 
        580 1 2 1 1 51 VAL HB  .  51 . HB   1 1 
        581 1 1 1 1 48 LYS H   .  48 . HN   1 1 
        581 1 2 1 1 51 VAL MG1 .  51 . HG1# 1 1 
        582 1 1 1 1 48 LYS H   .  48 . HN   1 1 
        582 1 2 1 1 51 VAL QG  .  51 . HG#  1 1 
        583 1 1 1 1 48 LYS H   .  48 . HN   1 1 
        583 1 2 1 1 51 VAL MG2 .  51 . HG2# 1 1 
        584 1 1 1 1 48 LYS H   .  48 . HN   1 1 
        584 1 2 1 1 52 VAL QG  .  52 . HG#  1 1 
        585 1 1 1 1 48 LYS HA  .  48 . HA   1 1 
        585 1 2 1 1 49 ASN H   .  49 . HN   1 1 
        586 1 1 1 1 48 LYS HA  .  48 . HA   1 1 
        586 1 2 1 1 51 VAL H   .  51 . HN   1 1 
        587 1 1 1 1 48 LYS QB  .  48 . HB#  1 1 
        587 1 2 1 1 49 ASN H   .  49 . HN   1 1 
        588 1 1 1 1 48 LYS QB  .  48 . HB#  1 1 
        588 1 2 1 1 50 ALA H   .  50 . HN   1 1 
        589 1 1 1 1 48 LYS QB  .  48 . HB#  1 1 
        589 1 2 1 1 50 ALA MB  .  50 . HB#  1 1 
        590 1 1 1 1 48 LYS QB  .  48 . HB#  1 1 
        590 1 2 1 1 51 VAL QG  .  51 . HG#  1 1 
        591 1 1 1 1 48 LYS QE  .  48 . HE#  1 1 
        591 1 2 1 1 48 LYS QG  .  48 . HG#  1 1 
        592 1 1 1 1 48 LYS QE  .  48 . HE#  1 1 
        592 1 2 1 1 49 ASN H   .  49 . HN   1 1 
        593 1 1 1 1 48 LYS QE  .  48 . HE#  1 1 
        593 1 2 1 1 49 ASN HA  .  49 . HA   1 1 
        594 1 1 1 1 48 LYS QE  .  48 . HE#  1 1 
        594 1 2 1 1 50 ALA H   .  50 . HN   1 1 
        595 1 1 1 1 48 LYS QE  .  48 . HE#  1 1 
        595 1 2 1 1 50 ALA MB  .  50 . HB#  1 1 
        596 1 1 1 1 48 LYS HE2 .  48 . HE2  1 1 
        596 1 2 1 1 50 ALA MB  .  50 . HB#  1 1 
        597 1 1 1 1 48 LYS HE3 .  48 . HE1  1 1 
        597 1 2 1 1 50 ALA MB  .  50 . HB#  1 1 
        598 1 1 1 1 48 LYS QG  .  48 . HG#  1 1 
        598 1 2 1 1 49 ASN H   .  49 . HN   1 1 
        599 1 1 1 1 48 LYS QG  .  48 . HG#  1 1 
        599 1 2 1 1 50 ALA H   .  50 . HN   1 1 
        600 1 1 1 1 48 LYS QG  .  48 . HG#  1 1 
        600 1 2 1 1 50 ALA HA  .  50 . HA   1 1 
        601 1 1 1 1 48 LYS QG  .  48 . HG#  1 1 
        601 1 2 1 1 51 VAL H   .  51 . HN   1 1 
        602 1 1 1 1 48 LYS QG  .  48 . HG#  1 1 
        602 1 2 1 1 51 VAL QG  .  51 . HG#  1 1 
        603 1 1 1 1 48 LYS QG  .  48 . HG#  1 1 
        603 1 2 1 1 52 VAL H   .  52 . HN   1 1 
        604 1 1 1 1 49 ASN H   .  49 . HN   1 1 
        604 1 2 1 1 49 ASN HB2 .  49 . HB2  1 1 
        605 1 1 1 1 49 ASN H   .  49 . HN   1 1 
        605 1 2 1 1 49 ASN QB  .  49 . HB#  1 1 
        606 1 1 1 1 49 ASN H   .  49 . HN   1 1 
        606 1 2 1 1 49 ASN HB3 .  49 . HB1  1 1 
        607 1 1 1 1 49 ASN H   .  49 . HN   1 1 
        607 1 2 1 1 50 ALA H   .  50 . HN   1 1 
        608 1 1 1 1 49 ASN H   .  49 . HN   1 1 
        608 1 2 1 1 50 ALA HA  .  50 . HA   1 1 
        609 1 1 1 1 49 ASN HA  .  49 . HA   1 1 
        609 1 2 1 1 50 ALA MB  .  50 . HB#  1 1 
        610 1 1 1 1 49 ASN HA  .  49 . HA   1 1 
        610 1 2 1 1 52 VAL H   .  52 . HN   1 1 
        611 1 1 1 1 49 ASN HA  .  49 . HA   1 1 
        611 1 2 1 1 52 VAL QG  .  52 . HG#  1 1 
        612 1 1 1 1 49 ASN HA  .  49 . HA   1 1 
        612 1 2 1 1 53 LEU H   .  53 . HN   1 1 
        613 1 1 1 1 49 ASN HA  .  49 . HA   1 1 
        613 1 2 1 1 53 LEU QB  .  53 . HB#  1 1 
        614 1 1 1 1 49 ASN HA  .  49 . HA   1 1 
        614 1 2 2 1 53 LEU MD1 . 153 . HD1# 1 1 
        615 1 1 1 1 49 ASN HA  .  49 . HA   1 1 
        615 1 2 2 1 53 LEU QD  . 153 . HD#  1 1 
        616 1 1 1 1 49 ASN HA  .  49 . HA   1 1 
        616 1 2 2 1 53 LEU MD2 . 153 . HD2# 1 1 
        617 1 1 1 1 49 ASN QB  .  49 . HB#  1 1 
        617 1 2 1 1 50 ALA H   .  50 . HN   1 1 
        618 1 1 1 1 49 ASN QB  .  49 . HB#  1 1 
        618 1 2 1 1 50 ALA MB  .  50 . HB#  1 1 
        619 1 1 1 1 49 ASN QB  .  49 . HB#  1 1 
        619 1 2 1 1 51 VAL H   .  51 . HN   1 1 
        620 1 1 1 1 49 ASN QB  .  49 . HB#  1 1 
        620 1 2 1 1 52 VAL QG  .  52 . HG#  1 1 
        621 1 1 1 1 49 ASN QB  .  49 . HB#  1 1 
        621 1 2 1 1 53 LEU H   .  53 . HN   1 1 
        622 1 1 1 1 49 ASN QB  .  49 . HB#  1 1 
        622 1 2 1 1 53 LEU QD  .  53 . HD#  1 1 
        623 1 1 1 1 49 ASN QB  .  49 . HB#  1 1 
        623 1 2 2 1 53 LEU QD  . 153 . HD#  1 1 
        624 1 1 1 1 50 ALA H   .  50 . HN   1 1 
        624 1 2 1 1 50 ALA MB  .  50 . HB#  1 1 
        625 1 1 1 1 50 ALA H   .  50 . HN   1 1 
        625 1 2 1 1 51 VAL H   .  51 . HN   1 1 
        626 1 1 1 1 50 ALA H   .  50 . HN   1 1 
        626 1 2 1 1 51 VAL HA  .  51 . HA   1 1 
        627 1 1 1 1 50 ALA H   .  50 . HN   1 1 
        627 1 2 1 1 51 VAL QG  .  51 . HG#  1 1 
        628 1 1 1 1 50 ALA H   .  50 . HN   1 1 
        628 1 2 1 1 52 VAL H   .  52 . HN   1 1 
        629 1 1 1 1 50 ALA H   .  50 . HN   1 1 
        629 1 2 1 1 52 VAL QG  .  52 . HG#  1 1 
        630 1 1 1 1 50 ALA MB  .  50 . HB#  1 1 
        630 1 2 1 1 51 VAL H   .  51 . HN   1 1 
        631 1 1 1 1 50 ALA MB  .  50 . HB#  1 1 
        631 1 2 1 1 51 VAL HB  .  51 . HB   1 1 
        632 1 1 1 1 50 ALA MB  .  50 . HB#  1 1 
        632 1 2 1 1 51 VAL QG  .  51 . HG#  1 1 
        633 1 1 1 1 50 ALA MB  .  50 . HB#  1 1 
        633 1 2 1 1 53 LEU H   .  53 . HN   1 1 
        634 1 1 1 1 51 VAL H   .  51 . HN   1 1 
        634 1 2 1 1 51 VAL MG1 .  51 . HG1# 1 1 
        635 1 1 1 1 51 VAL H   .  51 . HN   1 1 
        635 1 2 1 1 51 VAL QG  .  51 . HG#  1 1 
        636 1 1 1 1 51 VAL H   .  51 . HN   1 1 
        636 1 2 1 1 51 VAL MG2 .  51 . HG2# 1 1 
        637 1 1 1 1 51 VAL H   .  51 . HN   1 1 
        637 1 2 1 1 52 VAL H   .  52 . HN   1 1 
        638 1 1 1 1 51 VAL H   .  51 . HN   1 1 
        638 1 2 1 1 52 VAL QG  .  52 . HG#  1 1 
        639 1 1 1 1 51 VAL H   .  51 . HN   1 1 
        639 1 2 1 1 53 LEU H   .  53 . HN   1 1 
        640 1 1 1 1 51 VAL H   .  51 . HN   1 1 
        640 1 2 1 1 54 LYS H   .  54 . HN   1 1 
        641 1 1 1 1 51 VAL HA  .  51 . HA   1 1 
        641 1 2 1 1 51 VAL MG1 .  51 . HG1# 1 1 
        642 1 1 1 1 51 VAL HA  .  51 . HA   1 1 
        642 1 2 1 1 51 VAL QG  .  51 . HG#  1 1 
        643 1 1 1 1 51 VAL HA  .  51 . HA   1 1 
        643 1 2 1 1 51 VAL MG2 .  51 . HG2# 1 1 
        644 1 1 1 1 51 VAL HA  .  51 . HA   1 1 
        644 1 2 1 1 54 LYS H   .  54 . HN   1 1 
        645 1 1 1 1 51 VAL HA  .  51 . HA   1 1 
        645 1 2 1 1 54 LYS QB  .  54 . HB#  1 1 
        646 1 1 1 1 51 VAL HB  .  51 . HB   1 1 
        646 1 2 1 1 52 VAL QG  .  52 . HG#  1 1 
        647 1 1 1 1 51 VAL QG  .  51 . HG#  1 1 
        647 1 2 1 1 52 VAL H   .  52 . HN   1 1 
        648 1 1 1 1 51 VAL QG  .  51 . HG#  1 1 
        648 1 2 1 1 52 VAL HA  .  52 . HA   1 1 
        649 1 1 1 1 51 VAL QG  .  51 . HG#  1 1 
        649 1 2 1 1 54 LYS H   .  54 . HN   1 1 
        650 1 1 1 1 51 VAL QG  .  51 . HG#  1 1 
        650 1 2 1 1 54 LYS QE  .  54 . HE#  1 1 
        651 1 1 1 1 51 VAL QG  .  51 . HG#  1 1 
        651 1 2 1 1 54 LYS QG  .  54 . HG#  1 1 
        652 1 1 1 1 52 VAL H   .  52 . HN   1 1 
        652 1 2 1 1 52 VAL HB  .  52 . HB   1 1 
        653 1 1 1 1 52 VAL H   .  52 . HN   1 1 
        653 1 2 1 1 52 VAL QG  .  52 . HG#  1 1 
        654 1 1 1 1 52 VAL H   .  52 . HN   1 1 
        654 1 2 1 1 53 LEU H   .  53 . HN   1 1 
        655 1 1 1 1 52 VAL H   .  52 . HN   1 1 
        655 1 2 1 1 53 LEU HA  .  53 . HA   1 1 
        656 1 1 1 1 52 VAL H   .  52 . HN   1 1 
        656 1 2 1 1 53 LEU QB  .  53 . HB#  1 1 
        657 1 1 1 1 52 VAL H   .  52 . HN   1 1 
        657 1 2 1 1 54 LYS H   .  54 . HN   1 1 
        658 1 1 1 1 52 VAL H   .  52 . HN   1 1 
        658 1 2 1 1 54 LYS QD  .  54 . HD#  1 1 
        659 1 1 1 1 52 VAL HA  .  52 . HA   1 1 
        659 1 2 1 1 52 VAL MG1 .  52 . HG1# 1 1 
        660 1 1 1 1 52 VAL HA  .  52 . HA   1 1 
        660 1 2 1 1 52 VAL QG  .  52 . HG#  1 1 
        661 1 1 1 1 52 VAL HA  .  52 . HA   1 1 
        661 1 2 1 1 52 VAL MG2 .  52 . HG2# 1 1 
        662 1 1 1 1 52 VAL HA  .  52 . HA   1 1 
        662 1 2 1 1 55 ARG H   .  55 . HN   1 1 
        663 1 1 1 1 52 VAL HA  .  52 . HA   1 1 
        663 1 2 1 1 56 ILE H   .  56 . HN   1 1 
        664 1 1 1 1 52 VAL HB  .  52 . HB   1 1 
        664 1 2 1 1 53 LEU H   .  53 . HN   1 1 
        665 1 1 1 1 52 VAL HB  .  52 . HB   1 1 
        665 1 2 2 1 53 LEU QD  . 153 . HD#  1 1 
        666 1 1 1 1 52 VAL QG  .  52 . HG#  1 1 
        666 1 2 1 1 53 LEU H   .  53 . HN   1 1 
        667 1 1 1 1 52 VAL QG  .  52 . HG#  1 1 
        667 1 2 1 1 53 LEU HA  .  53 . HA   1 1 
        668 1 1 1 1 52 VAL QG  .  52 . HG#  1 1 
        668 1 2 1 1 53 LEU QB  .  53 . HB#  1 1 
        669 1 1 1 1 52 VAL QG  .  52 . HG#  1 1 
        669 1 2 1 1 54 LYS H   .  54 . HN   1 1 
        670 1 1 1 1 52 VAL QG  .  52 . HG#  1 1 
        670 1 2 1 1 54 LYS QD  .  54 . HD#  1 1 
        671 1 1 1 1 52 VAL QG  .  52 . HG#  1 1 
        671 1 2 1 1 55 ARG H   .  55 . HN   1 1 
        672 1 1 1 1 52 VAL QG  .  52 . HG#  1 1 
        672 1 2 1 1 56 ILE HB  .  56 . HB   1 1 
        673 1 1 1 1 53 LEU H   .  53 . HN   1 1 
        673 1 2 1 1 53 LEU QB  .  53 . HB#  1 1 
        674 1 1 1 1 53 LEU H   .  53 . HN   1 1 
        674 1 2 1 1 53 LEU MD1 .  53 . HD1# 1 1 
        675 1 1 1 1 53 LEU H   .  53 . HN   1 1 
        675 1 2 1 1 53 LEU QD  .  53 . HD#  1 1 
        676 1 1 1 1 53 LEU H   .  53 . HN   1 1 
        676 1 2 1 1 53 LEU MD2 .  53 . HD2# 1 1 
        677 1 1 1 1 53 LEU H   .  53 . HN   1 1 
        677 1 2 1 1 54 LYS H   .  54 . HN   1 1 
        678 1 1 1 1 53 LEU H   .  53 . HN   1 1 
        678 1 2 1 1 54 LYS QD  .  54 . HD#  1 1 
        679 1 1 1 1 53 LEU H   .  53 . HN   1 1 
        679 1 2 1 1 56 ILE HB  .  56 . HB   1 1 
        680 1 1 1 1 53 LEU H   .  53 . HN   1 1 
        680 1 2 1 1 56 ILE QG  .  56 . HG1# 1 1 
        681 1 1 1 1 53 LEU HA  .  53 . HA   1 1 
        681 1 2 1 1 53 LEU MD1 .  53 . HD1# 1 1 
        682 1 1 1 1 53 LEU HA  .  53 . HA   1 1 
        682 1 2 1 1 53 LEU QD  .  53 . HD#  1 1 
        683 1 1 1 1 53 LEU HA  .  53 . HA   1 1 
        683 1 2 1 1 53 LEU MD2 .  53 . HD2# 1 1 
        684 1 1 1 1 53 LEU HA  .  53 . HA   1 1 
        684 1 2 1 1 56 ILE H   .  56 . HN   1 1 
        685 1 1 1 1 53 LEU HA  .  53 . HA   1 1 
        685 1 2 1 1 56 ILE MD  .  56 . HD1# 1 1 
        686 1 1 1 1 53 LEU HA  .  53 . HA   1 1 
        686 1 2 1 1 56 ILE MG  .  56 . HG2# 1 1 
        687 1 1 1 1 53 LEU QB  .  53 . HB#  1 1 
        687 1 2 1 1 53 LEU QD  .  53 . HD#  1 1 
        688 1 1 1 1 53 LEU QD  .  53 . HD#  1 1 
        688 1 2 1 1 54 LYS H   .  54 . HN   1 1 
        689 1 1 1 1 53 LEU QD  .  53 . HD#  1 1 
        689 1 2 1 1 56 ILE HA  .  56 . HA   1 1 
        690 1 1 1 1 53 LEU QD  .  53 . HD#  1 1 
        690 1 2 1 1 56 ILE HB  .  56 . HB   1 1 
        691 1 1 1 1 53 LEU QD  .  53 . HD#  1 1 
        691 1 2 1 1 56 ILE QG  .  56 . HG1# 1 1 
        692 1 1 1 1 53 LEU QD  .  53 . HD#  1 1 
        692 1 2 1 1 57 GLN HA  .  57 . HA   1 1 
        693 1 1 1 1 53 LEU QD  .  53 . HD#  1 1 
        693 1 2 1 1 57 GLN QG  .  57 . HG#  1 1 
        694 1 1 1 1 53 LEU QD  .  53 . HD#  1 1 
        694 1 2 2 1 49 ASN HA  . 149 . HA   1 1 
        695 1 1 1 1 53 LEU QD  .  53 . HD#  1 1 
        695 1 2 2 1 49 ASN QB  . 149 . HB#  1 1 
        696 1 1 1 1 53 LEU QD  .  53 . HD#  1 1 
        696 1 2 2 1 52 VAL HB  . 152 . HB   1 1 
        697 1 1 1 1 53 LEU MD1 .  53 . HD1# 1 1 
        697 1 2 1 1 56 ILE HB  .  56 . HB   1 1 
        698 1 1 1 1 53 LEU MD1 .  53 . HD1# 1 1 
        698 1 2 2 1 49 ASN HA  . 149 . HA   1 1 
        699 1 1 1 1 53 LEU MD2 .  53 . HD2# 1 1 
        699 1 2 1 1 56 ILE HB  .  56 . HB   1 1 
        700 1 1 1 1 53 LEU MD2 .  53 . HD2# 1 1 
        700 1 2 2 1 49 ASN HA  . 149 . HA   1 1 
        701 1 1 1 1 54 LYS H   .  54 . HN   1 1 
        701 1 2 1 1 54 LYS QG  .  54 . HG#  1 1 
        702 1 1 1 1 54 LYS H   .  54 . HN   1 1 
        702 1 2 1 1 55 ARG H   .  55 . HN   1 1 
        703 1 1 1 1 54 LYS H   .  54 . HN   1 1 
        703 1 2 1 1 56 ILE H   .  56 . HN   1 1 
        704 1 1 1 1 54 LYS H   .  54 . HN   1 1 
        704 1 2 1 1 56 ILE QG  .  56 . HG1# 1 1 
        705 1 1 1 1 54 LYS H   .  54 . HN   1 1 
        705 1 2 1 1 57 GLN H   .  57 . HN   1 1 
        706 1 1 1 1 54 LYS H   .  54 . HN   1 1 
        706 1 2 1 1 57 GLN QG  .  57 . HG#  1 1 
        707 1 1 1 1 54 LYS HA  .  54 . HA   1 1 
        707 1 2 1 1 54 LYS QG  .  54 . HG#  1 1 
        708 1 1 1 1 54 LYS HA  .  54 . HA   1 1 
        708 1 2 1 1 57 GLN H   .  57 . HN   1 1 
        709 1 1 1 1 54 LYS HA  .  54 . HA   1 1 
        709 1 2 1 1 57 GLN QG  .  57 . HG#  1 1 
        710 1 1 1 1 54 LYS QD  .  54 . HD#  1 1 
        710 1 2 1 1 54 LYS QE  .  54 . HE#  1 1 
        711 1 1 1 1 54 LYS HD2 .  54 . HD2  1 1 
        711 1 2 1 1 54 LYS QE  .  54 . HE#  1 1 
        712 1 1 1 1 54 LYS HD3 .  54 . HD1  1 1 
        712 1 2 1 1 54 LYS QE  .  54 . HE#  1 1 
        713 1 1 1 1 54 LYS QE  .  54 . HE#  1 1 
        713 1 2 1 1 54 LYS QG  .  54 . HG#  1 1 
        714 1 1 1 1 54 LYS QG  .  54 . HG#  1 1 
        714 1 2 1 1 55 ARG H   .  55 . HN   1 1 
        715 1 1 1 1 55 ARG H   .  55 . HN   1 1 
        715 1 2 1 1 56 ILE H   .  56 . HN   1 1 
        716 1 1 1 1 55 ARG H   .  55 . HN   1 1 
        716 1 2 1 1 57 GLN H   .  57 . HN   1 1 
        717 1 1 1 1 55 ARG H   .  55 . HN   1 1 
        717 1 2 1 1 57 GLN QG  .  57 . HG#  1 1 
        718 1 1 1 1 55 ARG H   .  55 . HN   1 1 
        718 1 2 1 1 58 HIS H   .  58 . HN   1 1 
        719 1 1 1 1 55 ARG HA  .  55 . HA   1 1 
        719 1 2 1 1 57 GLN H   .  57 . HN   1 1 
        720 1 1 1 1 56 ILE H   .  56 . HN   1 1 
        720 1 2 1 1 56 ILE MD  .  56 . HD1# 1 1 
        721 1 1 1 1 56 ILE H   .  56 . HN   1 1 
        721 1 2 1 1 57 GLN H   .  57 . HN   1 1 
        722 1 1 1 1 56 ILE HA  .  56 . HA   1 1 
        722 1 2 1 1 59 LEU QD  .  59 . HD#  1 1 
        723 1 1 1 1 56 ILE HB  .  56 . HB   1 1 
        723 1 2 1 1 56 ILE MD  .  56 . HD1# 1 1 
        724 1 1 1 1 56 ILE HB  .  56 . HB   1 1 
        724 1 2 1 1 59 LEU H   .  59 . HN   1 1 
        725 1 1 1 1 56 ILE MD  .  56 . HD1# 1 1 
        725 1 2 1 1 57 GLN H   .  57 . HN   1 1 
        726 1 1 1 1 56 ILE MD  .  56 . HD1# 1 1 
        726 1 2 1 1 58 HIS H   .  58 . HN   1 1 
        727 1 1 1 1 56 ILE MD  .  56 . HD1# 1 1 
        727 1 2 1 1 59 LEU H   .  59 . HN   1 1 
        728 1 1 1 1 56 ILE MD  .  56 . HD1# 1 1 
        728 1 2 2 1 42 VAL QG  . 142 . HG#  1 1 
        729 1 1 1 1 56 ILE QG  .  56 . HG1# 1 1 
        729 1 2 1 1 57 GLN H   .  57 . HN   1 1 
        730 1 1 1 1 56 ILE MG  .  56 . HG2# 1 1 
        730 1 2 1 1 57 GLN H   .  57 . HN   1 1 
        731 1 1 1 1 56 ILE MG  .  56 . HG2# 1 1 
        731 1 2 1 1 57 GLN HA  .  57 . HA   1 1 
        732 1 1 1 1 56 ILE MG  .  56 . HG2# 1 1 
        732 1 2 1 1 57 GLN QG  .  57 . HG#  1 1 
        733 1 1 1 1 56 ILE MG  .  56 . HG2# 1 1 
        733 1 2 1 1 59 LEU QD  .  59 . HD#  1 1 
        734 1 1 1 1 56 ILE MG  .  56 . HG2# 1 1 
        734 1 2 1 1 60 ASP H   .  60 . HN   1 1 
        735 1 1 1 1 57 GLN HA  .  57 . HA   1 1 
        735 1 2 2 1 42 VAL QG  . 142 . HG#  1 1 
        736 1 1 1 1 57 GLN QG  .  57 . HG#  1 1 
        736 1 2 2 1 42 VAL QG  . 142 . HG#  1 1 
        737 1 1 1 1 58 HIS H   .  58 . HN   1 1 
        737 1 2 1 1 59 LEU H   .  59 . HN   1 1 
        738 1 1 1 1 58 HIS H   .  58 . HN   1 1 
        738 1 2 1 1 59 LEU HB2 .  59 . HB2  1 1 
        739 1 1 1 1 58 HIS HA  .  58 . HA   1 1 
        739 1 2 1 1 61 GLU H   .  61 . HN   1 1 
        740 1 1 1 1 59 LEU H   .  59 . HN   1 1 
        740 1 2 1 1 59 LEU MD1 .  59 . HD1# 1 1 
        741 1 1 1 1 59 LEU H   .  59 . HN   1 1 
        741 1 2 1 1 59 LEU QD  .  59 . HD#  1 1 
        742 1 1 1 1 59 LEU H   .  59 . HN   1 1 
        742 1 2 1 1 59 LEU MD2 .  59 . HD2# 1 1 
        743 1 1 1 1 59 LEU H   .  59 . HN   1 1 
        743 1 2 1 1 60 ASP H   .  60 . HN   1 1 
        744 1 1 1 1 59 LEU H   .  59 . HN   1 1 
        744 1 2 1 1 61 GLU H   .  61 . HN   1 1 
        745 1 1 1 1 59 LEU HA  .  59 . HA   1 1 
        745 1 2 1 1 59 LEU QD  .  59 . HD#  1 1 
        746 1 1 1 1 59 LEU HA  .  59 . HA   1 1 
        746 1 2 1 1 62 ALA MB  .  62 . HB#  1 1 
        747 1 1 1 1 59 LEU HB2 .  59 . HB2  1 1 
        747 1 2 1 1 61 GLU QG  .  61 . HG#  1 1 
        748 1 1 1 1 59 LEU QD  .  59 . HD#  1 1 
        748 1 2 1 1 60 ASP H   .  60 . HN   1 1 
        749 1 1 1 1 59 LEU QD  .  59 . HD#  1 1 
        749 1 2 1 1 62 ALA MB  .  62 . HB#  1 1 
        750 1 1 1 1 59 LEU MD1 .  59 . HD1# 1 1 
        750 1 2 1 1 60 ASP H   .  60 . HN   1 1 
        751 1 1 1 1 59 LEU MD2 .  59 . HD2# 1 1 
        751 1 2 1 1 60 ASP H   .  60 . HN   1 1 
        752 1 1 1 1 59 LEU HG  .  59 . HG   1 1 
        752 1 2 1 1 60 ASP H   .  60 . HN   1 1 
        753 1 1 1 1 59 LEU HG  .  59 . HG   1 1 
        753 1 2 1 1 63 TYR H   .  63 . HN   1 1 
        754 1 1 1 1 60 ASP H   .  60 . HN   1 1 
        754 1 2 1 1 61 GLU HA  .  61 . HA   1 1 
        755 1 1 1 1 60 ASP H   .  60 . HN   1 1 
        755 1 2 1 1 61 GLU QB  .  61 . HB#  1 1 
        756 1 1 1 1 60 ASP H   .  60 . HN   1 1 
        756 1 2 1 1 61 GLU QG  .  61 . HG#  1 1 
        757 1 1 1 1 60 ASP QB  .  60 . HB#  1 1 
        757 1 2 1 1 61 GLU QG  .  61 . HG#  1 1 
        758 1 1 1 1 60 ASP QB  .  60 . HB#  1 1 
        758 1 2 1 1 62 ALA H   .  62 . HN   1 1 
        759 1 1 1 1 60 ASP QB  .  60 . HB#  1 1 
        759 1 2 1 1 63 TYR H   .  63 . HN   1 1 
        760 1 1 1 1 60 ASP QB  .  60 . HB#  1 1 
        760 1 2 1 1 63 TYR QD  .  63 . HD#  1 1 
        761 1 1 1 1 60 ASP QB  .  60 . HB#  1 1 
        761 1 2 1 1 63 TYR QE  .  63 . HE#  1 1 
        762 1 1 1 1 61 GLU H   .  61 . HN   1 1 
        762 1 2 1 1 61 GLU QB  .  61 . HB#  1 1 
        763 1 1 1 1 61 GLU H   .  61 . HN   1 1 
        763 1 2 1 1 61 GLU QG  .  61 . HG#  1 1 
        764 1 1 1 1 61 GLU H   .  61 . HN   1 1 
        764 1 2 1 1 62 ALA HA  .  62 . HA   1 1 
        765 1 1 1 1 61 GLU HA  .  61 . HA   1 1 
        765 1 2 1 1 61 GLU QG  .  61 . HG#  1 1 
        766 1 1 1 1 61 GLU HA  .  61 . HA   1 1 
        766 1 2 1 1 63 TYR H   .  63 . HN   1 1 
        767 1 1 1 1 61 GLU QB  .  61 . HB#  1 1 
        767 1 2 1 1 62 ALA H   .  62 . HN   1 1 
        768 1 1 1 1 61 GLU QG  .  61 . HG#  1 1 
        768 1 2 1 1 62 ALA H   .  62 . HN   1 1 
        769 1 1 1 1 61 GLU QG  .  61 . HG#  1 1 
        769 1 2 1 1 65 LYS QB  .  65 . HB#  1 1 
        770 1 1 1 1 62 ALA H   .  62 . HN   1 1 
        770 1 2 1 1 63 TYR H   .  63 . HN   1 1 
        771 1 1 1 1 62 ALA H   .  62 . HN   1 1 
        771 1 2 1 1 63 TYR QB  .  63 . HB#  1 1 
        772 1 1 1 1 62 ALA H   .  62 . HN   1 1 
        772 1 2 1 1 65 LYS QB  .  65 . HB#  1 1 
        773 1 1 1 1 62 ALA HA  .  62 . HA   1 1 
        773 1 2 1 1 65 LYS QB  .  65 . HB#  1 1 
        774 1 1 1 1 62 ALA MB  .  62 . HB#  1 1 
        774 1 2 1 1 63 TYR H   .  63 . HN   1 1 
        775 1 1 1 1 63 TYR H   .  63 . HN   1 1 
        775 1 2 1 1 63 TYR QD  .  63 . HD#  1 1 
        776 1 1 1 1 63 TYR H   .  63 . HN   1 1 
        776 1 2 1 1 63 TYR QE  .  63 . HE#  1 1 
        777 1 1 1 1 63 TYR H   .  63 . HN   1 1 
        777 1 2 1 1 64 ASN H   .  64 . HN   1 1 
        778 1 1 1 1 63 TYR H   .  63 . HN   1 1 
        778 1 2 1 1 64 ASN HA  .  64 . HA   1 1 
        779 1 1 1 1 63 TYR H   .  63 . HN   1 1 
        779 1 2 1 1 64 ASN QB  .  64 . HB#  1 1 
        780 1 1 1 1 63 TYR H   .  63 . HN   1 1 
        780 1 2 1 1 65 LYS QB  .  65 . HB#  1 1 
        781 1 1 1 1 63 TYR H   .  63 . HN   1 1 
        781 1 2 1 1 66 VAL HB  .  66 . HB   1 1 
        782 1 1 1 1 63 TYR QB  .  63 . HB#  1 1 
        782 1 2 1 1 64 ASN H   .  64 . HN   1 1 
        783 1 1 1 1 63 TYR QD  .  63 . HD#  1 1 
        783 1 2 1 1 64 ASN H   .  64 . HN   1 1 
        784 1 1 1 1 63 TYR QE  .  63 . HE#  1 1 
        784 1 2 1 1 64 ASN H   .  64 . HN   1 1 
        785 1 1 1 1 63 TYR QE  .  63 . HE#  1 1 
        785 1 2 1 1 67 LYS QD  .  67 . HD#  1 1 
        786 1 1 1 1 63 TYR QE  .  63 . HE#  1 1 
        786 1 2 1 1 67 LYS HG3 .  67 . HG1  1 1 
        787 1 1 1 1 64 ASN H   .  64 . HN   1 1 
        787 1 2 1 1 66 VAL HB  .  66 . HB   1 1 
        788 1 1 1 1 64 ASN H   .  64 . HN   1 1 
        788 1 2 1 1 68 ARG H   .  68 . HN   1 1 
        789 1 1 1 1 64 ASN HA  .  64 . HA   1 1 
        789 1 2 1 1 67 LYS H   .  67 . HN   1 1 
        790 1 1 1 1 64 ASN HA  .  64 . HA   1 1 
        790 1 2 1 1 68 ARG H   .  68 . HN   1 1 
        791 1 1 1 1 65 LYS H   .  65 . HN   1 1 
        791 1 2 1 1 66 VAL H   .  66 . HN   1 1 
        792 1 1 1 1 65 LYS H   .  65 . HN   1 1 
        792 1 2 1 1 66 VAL QG  .  66 . HG#  1 1 
        793 1 1 1 1 65 LYS H   .  65 . HN   1 1 
        793 1 2 1 1 67 LYS H   .  67 . HN   1 1 
        794 1 1 1 1 65 LYS HA  .  65 . HA   1 1 
        794 1 2 1 1 67 LYS H   .  67 . HN   1 1 
        795 1 1 1 1 66 VAL H   .  66 . HN   1 1 
        795 1 2 1 1 66 VAL HB  .  66 . HB   1 1 
        796 1 1 1 1 66 VAL H   .  66 . HN   1 1 
        796 1 2 1 1 66 VAL MG1 .  66 . HG1# 1 1 
        797 1 1 1 1 66 VAL H   .  66 . HN   1 1 
        797 1 2 1 1 66 VAL QG  .  66 . HG#  1 1 
        798 1 1 1 1 66 VAL H   .  66 . HN   1 1 
        798 1 2 1 1 66 VAL MG2 .  66 . HG2# 1 1 
        799 1 1 1 1 66 VAL H   .  66 . HN   1 1 
        799 1 2 1 1 67 LYS HG3 .  67 . HG1  1 1 
        800 1 1 1 1 66 VAL HA  .  66 . HA   1 1 
        800 1 2 1 1 66 VAL QG  .  66 . HG#  1 1 
        801 1 1 1 1 66 VAL HA  .  66 . HA   1 1 
        801 1 2 1 1 66 VAL MG2 .  66 . HG2# 1 1 
        802 1 1 1 1 66 VAL HA  .  66 . HA   1 1 
        802 1 2 1 1 68 ARG H   .  68 . HN   1 1 
        803 1 1 1 1 66 VAL HB  .  66 . HB   1 1 
        803 1 2 1 1 67 LYS HA  .  67 . HA   1 1 
        804 1 1 1 1 66 VAL QG  .  66 . HG#  1 1 
        804 1 2 1 1 67 LYS H   .  67 . HN   1 1 
        805 1 1 1 1 66 VAL QG  .  66 . HG#  1 1 
        805 1 2 1 1 67 LYS HA  .  67 . HA   1 1 
        806 1 1 1 1 66 VAL QG  .  66 . HG#  1 1 
        806 1 2 1 1 69 GLY H   .  69 . HN   1 1 
        807 1 1 1 1 66 VAL QG  .  66 . HG#  1 1 
        807 1 2 1 1 70 GLU QG  .  70 . HG#  1 1 
        808 1 1 1 1 67 LYS H   .  67 . HN   1 1 
        808 1 2 1 1 67 LYS HB2 .  67 . HB2  1 1 
        809 1 1 1 1 67 LYS H   .  67 . HN   1 1 
        809 1 2 1 1 68 ARG H   .  68 . HN   1 1 
        810 1 1 1 1 67 LYS H   .  67 . HN   1 1 
        810 1 2 1 1 68 ARG HB3 .  68 . HB1  1 1 
        811 1 1 1 1 67 LYS H   .  67 . HN   1 1 
        811 1 2 1 1 69 GLY H   .  69 . HN   1 1 
        812 1 1 1 1 67 LYS H   .  67 . HN   1 1 
        812 1 2 1 1 70 GLU QB  .  70 . HB#  1 1 
        813 1 1 1 1 67 LYS H   .  67 . HN   1 1 
        813 1 2 1 1 70 GLU QG  .  70 . HG#  1 1 
        814 1 1 1 1 67 LYS HA  .  67 . HA   1 1 
        814 1 2 1 1 67 LYS QD  .  67 . HD#  1 1 
        815 1 1 1 1 67 LYS HA  .  67 . HA   1 1 
        815 1 2 1 1 67 LYS HG3 .  67 . HG1  1 1 
        816 1 1 1 1 67 LYS HA  .  67 . HA   1 1 
        816 1 2 1 1 70 GLU H   .  70 . HN   1 1 
        817 1 1 1 1 67 LYS HB2 .  67 . HB2  1 1 
        817 1 2 1 1 68 ARG H   .  68 . HN   1 1 
        818 1 1 1 1 67 LYS HB2 .  67 . HB2  1 1 
        818 1 2 1 1 68 ARG QD  .  68 . HD#  1 1 
        819 1 1 1 1 67 LYS QD  .  67 . HD#  1 1 
        819 1 2 1 1 70 GLU H   .  70 . HN   1 1 
        820 1 1 1 1 67 LYS HG3 .  67 . HG1  1 1 
        820 1 2 1 1 68 ARG H   .  68 . HN   1 1 
        821 1 1 1 1 67 LYS HG3 .  67 . HG1  1 1 
        821 1 2 1 1 69 GLY H   .  69 . HN   1 1 
        822 1 1 1 1 68 ARG H   .  68 . HN   1 1 
        822 1 2 1 1 68 ARG QD  .  68 . HD#  1 1 
        823 1 1 1 1 68 ARG H   .  68 . HN   1 1 
        823 1 2 1 1 68 ARG QG  .  68 . HG#  1 1 
        824 1 1 1 1 68 ARG H   .  68 . HN   1 1 
        824 1 2 1 1 69 GLY H   .  69 . HN   1 1 
        825 1 1 1 1 68 ARG H   .  68 . HN   1 1 
        825 1 2 1 1 69 GLY QA  .  69 . HA#  1 1 
        826 1 1 1 1 68 ARG H   .  68 . HN   1 1 
        826 1 2 1 1 70 GLU H   .  70 . HN   1 1 
        827 1 1 1 1 68 ARG H   .  68 . HN   1 1 
        827 1 2 1 1 70 GLU QB  .  70 . HB#  1 1 
        828 1 1 1 1 68 ARG H   .  68 . HN   1 1 
        828 1 2 1 1 70 GLU HG2 .  70 . HG2  1 1 
        829 1 1 1 1 68 ARG H   .  68 . HN   1 1 
        829 1 2 1 1 70 GLU HG3 .  70 . HG1  1 1 
        830 1 1 1 1 68 ARG HA  .  68 . HA   1 1 
        830 1 2 1 1 68 ARG QG  .  68 . HG#  1 1 
        831 1 1 1 1 68 ARG HB3 .  68 . HB1  1 1 
        831 1 2 1 1 68 ARG QD  .  68 . HD#  1 1 
        832 1 1 1 1 68 ARG HB3 .  68 . HB1  1 1 
        832 1 2 1 1 69 GLY H   .  69 . HN   1 1 
        833 1 1 1 1 68 ARG HB3 .  68 . HB1  1 1 
        833 1 2 1 1 69 GLY QA  .  69 . HA#  1 1 
        834 1 1 1 1 68 ARG QG  .  68 . HG#  1 1 
        834 1 2 1 1 69 GLY H   .  69 . HN   1 1 
        835 1 1 1 1 69 GLY H   .  69 . HN   1 1 
        835 1 2 1 1 69 GLY QA  .  69 . HA#  1 1 
        836 1 1 1 1 69 GLY H   .  69 . HN   1 1 
        836 1 2 1 1 70 GLU H   .  70 . HN   1 1 
        837 1 1 1 1 69 GLY H   .  69 . HN   1 1 
        837 1 2 1 1 70 GLU HA  .  70 . HA   1 1 
        838 1 1 1 1 69 GLY H   .  69 . HN   1 1 
        838 1 2 1 1 70 GLU QB  .  70 . HB#  1 1 
        839 1 1 1 1 69 GLY H   .  69 . HN   1 1 
        839 1 2 1 1 70 GLU QG  .  70 . HG#  1 1 
        840 1 1 1 1 69 GLY QA  .  69 . HA#  1 1 
        840 1 2 1 1 70 GLU H   .  70 . HN   1 1 
        841 1 1 1 1 69 GLY QA  .  69 . HA#  1 1 
        841 1 2 1 1 70 GLU HA  .  70 . HA   1 1 
        842 1 1 1 1 70 GLU H   .  70 . HN   1 1 
        842 1 2 1 1 70 GLU QB  .  70 . HB#  1 1 
        843 1 1 1 1 70 GLU H   .  70 . HN   1 1 
        843 1 2 1 1 70 GLU QG  .  70 . HG#  1 1 
        844 1 1 1 1 70 GLU HA  .  70 . HA   1 1 
        844 1 2 1 1 70 GLU QB  .  70 . HB#  1 1 
        845 1 1 1 1 70 GLU HA  .  70 . HA   1 1 
        845 1 2 1 1 70 GLU QG  .  70 . HG#  1 1 
        846 1 1 1 1 70 GLU HB2 .  70 . HB2  1 1 
        846 1 2 1 1 71 SER H   .  71 . HN   1 1 
        847 1 1 1 1 70 GLU HB3 .  70 . HB1  1 1 
        847 1 2 1 1 71 SER H   .  71 . HN   1 1 
        848 1 1 1 1 71 SER H   .  71 . HN   1 1 
        848 1 2 1 1 71 SER QB  .  71 . HB#  1 1 
        849 1 1 1 1 71 SER H   .  71 . HN   1 1 
        849 1 2 1 1 72 LYS QG  .  72 . HG#  1 1 
        850 1 1 1 1 71 SER HA  .  71 . HA   1 1 
        850 1 2 1 1 72 LYS H   .  72 . HN   1 1 
        851 1 1 1 1 71 SER HA  .  71 . HA   1 1 
        851 1 2 1 1 72 LYS QB  .  72 . HB#  1 1 
        852 1 1 1 1 71 SER QB  .  71 . HB#  1 1 
        852 1 2 1 1 72 LYS H   .  72 . HN   1 1 
        853 1 1 1 1 71 SER QB  .  71 . HB#  1 1 
        853 1 2 1 1 73 LEU H   .  73 . HN   1 1 
        854 1 1 1 1 72 LYS H   .  72 . HN   1 1 
        854 1 2 1 1 72 LYS HB2 .  72 . HB2  1 1 
        855 1 1 1 1 72 LYS H   .  72 . HN   1 1 
        855 1 2 1 1 72 LYS QB  .  72 . HB#  1 1 
        856 1 1 1 1 72 LYS H   .  72 . HN   1 1 
        856 1 2 1 1 72 LYS HB3 .  72 . HB1  1 1 
        857 1 1 1 1 72 LYS H   .  72 . HN   1 1 
        857 1 2 1 1 72 LYS QG  .  72 . HG#  1 1 
        858 1 1 1 1 72 LYS H   .  72 . HN   1 1 
        858 1 2 1 1 74 GLU HG2 .  74 . HG2  1 1 
        859 1 1 1 1 72 LYS H   .  72 . HN   1 1 
        859 1 2 1 1 74 GLU HG3 .  74 . HG1  1 1 
        860 1 1 1 1 72 LYS HA  .  72 . HA   1 1 
        860 1 2 1 1 72 LYS QG  .  72 . HG#  1 1 
        861 1 1 1 1 72 LYS HA  .  72 . HA   1 1 
        861 1 2 1 1 73 LEU H   .  73 . HN   1 1 
        862 1 1 1 1 72 LYS QB  .  72 . HB#  1 1 
        862 1 2 1 1 73 LEU H   .  73 . HN   1 1 
        863 1 1 1 1 72 LYS QB  .  72 . HB#  1 1 
        863 1 2 1 1 73 LEU QD  .  73 . HD#  1 1 
        864 1 1 1 1 73 LEU H   .  73 . HN   1 1 
        864 1 2 1 1 73 LEU QB  .  73 . HB#  1 1 
        865 1 1 1 1 73 LEU H   .  73 . HN   1 1 
        865 1 2 1 1 73 LEU QD  .  73 . HD#  1 1 
        866 1 1 1 1 73 LEU H   .  73 . HN   1 1 
        866 1 2 1 1 73 LEU HG  .  73 . HG   1 1 
        867 1 1 1 1 73 LEU H   .  73 . HN   1 1 
        867 1 2 1 1 74 GLU QG  .  74 . HG#  1 1 
        868 1 1 1 1 73 LEU HA  .  73 . HA   1 1 
        868 1 2 1 1 73 LEU QD  .  73 . HD#  1 1 
        869 1 1 1 1 73 LEU HA  .  73 . HA   1 1 
        869 1 2 1 1 73 LEU HG  .  73 . HG   1 1 
        870 1 1 1 1 73 LEU HA  .  73 . HA   1 1 
        870 1 2 1 1 74 GLU H   .  74 . HN   1 1 
        871 1 1 1 1 73 LEU HA  .  73 . HA   1 1 
        871 1 2 1 1 74 GLU QB  .  74 . HB#  1 1 
        872 1 1 1 1 73 LEU QB  .  73 . HB#  1 1 
        872 1 2 1 1 73 LEU QD  .  73 . HD#  1 1 
        873 1 1 1 1 73 LEU QB  .  73 . HB#  1 1 
        873 1 2 1 1 74 GLU H   .  74 . HN   1 1 
        874 1 1 1 1 73 LEU QB  .  73 . HB#  1 1 
        874 1 2 1 1 74 GLU QG  .  74 . HG#  1 1 
        875 1 1 1 1 73 LEU QD  .  73 . HD#  1 1 
        875 1 2 1 1 74 GLU H   .  74 . HN   1 1 
        876 1 1 1 1 73 LEU QD  .  73 . HD#  1 1 
        876 1 2 1 1 75 HIS H   .  75 . HN   1 1 
        877 1 1 1 1 73 LEU QD  .  73 . HD#  1 1 
        877 1 2 1 1 75 HIS QB  .  75 . HB#  1 1 
        878 1 1 1 1 73 LEU HG  .  73 . HG   1 1 
        878 1 2 1 1 74 GLU H   .  74 . HN   1 1 
        879 1 1 1 1 74 GLU H   .  74 . HN   1 1 
        879 1 2 1 1 74 GLU QB  .  74 . HB#  1 1 
        880 1 1 1 1 74 GLU H   .  74 . HN   1 1 
        880 1 2 1 1 74 GLU QG  .  74 . HG#  1 1 
        881 1 1 1 1 74 GLU HA  .  74 . HA   1 1 
        881 1 2 1 1 74 GLU HG2 .  74 . HG2  1 1 
        882 1 1 1 1 74 GLU HA  .  74 . HA   1 1 
        882 1 2 1 1 74 GLU QG  .  74 . HG#  1 1 
        883 1 1 1 1 74 GLU HA  .  74 . HA   1 1 
        883 1 2 1 1 74 GLU HG3 .  74 . HG1  1 1 
        884 1 1 1 1 74 GLU HA  .  74 . HA   1 1 
        884 1 2 1 1 75 HIS H   .  75 . HN   1 1 
        885 1 1 1 1 74 GLU QB  .  74 . HB#  1 1 
        885 1 2 1 1 75 HIS HA  .  75 . HA   1 1 
        886 1 1 2 1  2 SER QB  . 102 . HB#  1 1 
        886 1 2 2 1  3 GLU H   . 103 . HN   1 1 
        887 1 1 2 1  2 SER HB2 . 102 . HB2  1 1 
        887 1 2 2 1  3 GLU H   . 103 . HN   1 1 
        888 1 1 2 1  2 SER HB3 . 102 . HB1  1 1 
        888 1 2 2 1  3 GLU H   . 103 . HN   1 1 
        889 1 1 2 1  3 GLU H   . 103 . HN   1 1 
        889 1 2 2 1  4 LEU H   . 104 . HN   1 1 
        890 1 1 2 1  3 GLU HA  . 103 . HA   1 1 
        890 1 2 2 1  4 LEU H   . 104 . HN   1 1 
        891 1 1 2 1  3 GLU HA  . 103 . HA   1 1 
        891 1 2 2 1  4 LEU HA  . 104 . HA   1 1 
        892 1 1 2 1  3 GLU HA  . 103 . HA   1 1 
        892 1 2 2 1  4 LEU QB  . 104 . HB#  1 1 
        893 1 1 2 1  3 GLU QG  . 103 . HG#  1 1 
        893 1 2 2 1  4 LEU H   . 104 . HN   1 1 
        894 1 1 2 1  3 GLU QG  . 103 . HG#  1 1 
        894 1 2 2 1  4 LEU QD  . 104 . HD#  1 1 
        895 1 1 2 1  4 LEU H   . 104 . HN   1 1 
        895 1 2 2 1  4 LEU QB  . 104 . HB#  1 1 
        896 1 1 2 1  4 LEU H   . 104 . HN   1 1 
        896 1 2 2 1  4 LEU QD  . 104 . HD#  1 1 
        897 1 1 2 1  4 LEU H   . 104 . HN   1 1 
        897 1 2 2 1  4 LEU HG  . 104 . HG   1 1 
        898 1 1 2 1  4 LEU H   . 104 . HN   1 1 
        898 1 2 2 1  6 SER H   . 106 . HN   1 1 
        899 1 1 2 1  4 LEU H   . 104 . HN   1 1 
        899 1 2 2 1  9 TYR QD  . 109 . HD#  1 1 
        900 1 1 2 1  4 LEU H   . 104 . HN   1 1 
        900 1 2 2 1  9 TYR QE  . 109 . HE#  1 1 
        901 1 1 2 1  4 LEU HA  . 104 . HA   1 1 
        901 1 2 2 1  4 LEU MD1 . 104 . HD1# 1 1 
        902 1 1 2 1  4 LEU HA  . 104 . HA   1 1 
        902 1 2 2 1  4 LEU QD  . 104 . HD#  1 1 
        903 1 1 2 1  4 LEU HA  . 104 . HA   1 1 
        903 1 2 2 1  4 LEU MD2 . 104 . HD2# 1 1 
        904 1 1 2 1  4 LEU HA  . 104 . HA   1 1 
        904 1 2 2 1  6 SER H   . 106 . HN   1 1 
        905 1 1 2 1  4 LEU HA  . 104 . HA   1 1 
        905 1 2 2 1  9 TYR QD  . 109 . HD#  1 1 
        906 1 1 2 1  4 LEU HA  . 104 . HA   1 1 
        906 1 2 2 1  9 TYR QE  . 109 . HE#  1 1 
        907 1 1 2 1  4 LEU QB  . 104 . HB#  1 1 
        907 1 2 2 1  4 LEU QD  . 104 . HD#  1 1 
        908 1 1 2 1  4 LEU QD  . 104 . HD#  1 1 
        908 1 2 2 1  9 TYR QD  . 109 . HD#  1 1 
        909 1 1 2 1  4 LEU QD  . 104 . HD#  1 1 
        909 1 2 2 1  9 TYR QE  . 109 . HE#  1 1 
        910 1 1 2 1  4 LEU QD  . 104 . HD#  1 1 
        910 1 2 2 1 10 PHE QE  . 110 . HE#  1 1 
        911 1 1 2 1  4 LEU MD1 . 104 . HD1# 1 1 
        911 1 2 2 1  9 TYR QD  . 109 . HD#  1 1 
        912 1 1 2 1  4 LEU MD1 . 104 . HD1# 1 1 
        912 1 2 2 1  9 TYR QE  . 109 . HE#  1 1 
        913 1 1 2 1  4 LEU MD1 . 104 . HD1# 1 1 
        913 1 2 2 1 10 PHE QD  . 110 . HD#  1 1 
        914 1 1 2 1  4 LEU MD1 . 104 . HD1# 1 1 
        914 1 2 2 1 10 PHE QE  . 110 . HE#  1 1 
        915 1 1 2 1  4 LEU MD2 . 104 . HD2# 1 1 
        915 1 2 2 1  9 TYR QD  . 109 . HD#  1 1 
        916 1 1 2 1  4 LEU MD2 . 104 . HD2# 1 1 
        916 1 2 2 1  9 TYR QE  . 109 . HE#  1 1 
        917 1 1 2 1  4 LEU MD2 . 104 . HD2# 1 1 
        917 1 2 2 1 10 PHE QD  . 110 . HD#  1 1 
        918 1 1 2 1  4 LEU MD2 . 104 . HD2# 1 1 
        918 1 2 2 1 10 PHE QE  . 110 . HE#  1 1 
        919 1 1 2 1  6 SER H   . 106 . HN   1 1 
        919 1 2 2 1  7 VAL H   . 107 . HN   1 1 
        920 1 1 2 1  7 VAL H   . 107 . HN   1 1 
        920 1 2 2 1  7 VAL HB  . 107 . HB   1 1 
        921 1 1 2 1  7 VAL H   . 107 . HN   1 1 
        921 1 2 2 1  7 VAL QG  . 107 . HG#  1 1 
        922 1 1 2 1  7 VAL H   . 107 . HN   1 1 
        922 1 2 2 1 10 PHE H   . 110 . HN   1 1 
        923 1 1 2 1  7 VAL HA  . 107 . HA   1 1 
        923 1 2 2 1  9 TYR H   . 109 . HN   1 1 
        924 1 1 2 1  7 VAL HB  . 107 . HB   1 1 
        924 1 2 2 1  8 PRO HA  . 108 . HA   1 1 
        925 1 1 2 1  7 VAL HB  . 107 . HB   1 1 
        925 1 2 2 1  9 TYR H   . 109 . HN   1 1 
        926 1 1 2 1  7 VAL QG  . 107 . HG#  1 1 
        926 1 2 2 1 10 PHE H   . 110 . HN   1 1 
        927 1 1 2 1  7 VAL QG  . 107 . HG#  1 1 
        927 1 2 2 1 61 GLU H   . 161 . HN   1 1 
        928 1 1 2 1  7 VAL QG  . 107 . HG#  1 1 
        928 1 2 2 1 61 GLU QG  . 161 . HG#  1 1 
        929 1 1 2 1  7 VAL QG  . 107 . HG#  1 1 
        929 1 2 2 1 62 ALA H   . 162 . HN   1 1 
        930 1 1 2 1  7 VAL MG1 . 107 . HG1# 1 1 
        930 1 2 2 1 61 GLU HG2 . 161 . HG2  1 1 
        931 1 1 2 1  7 VAL MG1 . 107 . HG1# 1 1 
        931 1 2 2 1 61 GLU HG3 . 161 . HG1  1 1 
        932 1 1 2 1  7 VAL MG2 . 107 . HG2# 1 1 
        932 1 2 2 1 61 GLU HG2 . 161 . HG2  1 1 
        933 1 1 2 1  7 VAL MG2 . 107 . HG2# 1 1 
        933 1 2 2 1 61 GLU HG3 . 161 . HG1  1 1 
        934 1 1 2 1  8 PRO HA  . 108 . HA   1 1 
        934 1 2 2 1 10 PHE H   . 110 . HN   1 1 
        935 1 1 2 1  8 PRO HA  . 108 . HA   1 1 
        935 1 2 2 1 11 ILE H   . 111 . HN   1 1 
        936 1 1 2 1  8 PRO HA  . 108 . HA   1 1 
        936 1 2 2 1 11 ILE HB  . 111 . HB   1 1 
        937 1 1 2 1  8 PRO HA  . 108 . HA   1 1 
        937 1 2 2 1 11 ILE MD  . 111 . HD1# 1 1 
        938 1 1 2 1  8 PRO HA  . 108 . HA   1 1 
        938 1 2 2 1 11 ILE MG  . 111 . HG2# 1 1 
        939 1 1 2 1  8 PRO HA  . 108 . HA   1 1 
        939 1 2 2 1 12 GLU H   . 112 . HN   1 1 
        940 1 1 2 1  8 PRO QB  . 108 . HB#  1 1 
        940 1 2 2 1  9 TYR H   . 109 . HN   1 1 
        941 1 1 2 1  8 PRO QB  . 108 . HB#  1 1 
        941 1 2 2 1 11 ILE H   . 111 . HN   1 1 
        942 1 1 2 1  8 PRO QB  . 108 . HB#  1 1 
        942 1 2 2 1 11 ILE MG  . 111 . HG2# 1 1 
        943 1 1 2 1  9 TYR H   . 109 . HN   1 1 
        943 1 2 2 1  9 TYR QD  . 109 . HD#  1 1 
        944 1 1 2 1  9 TYR H   . 109 . HN   1 1 
        944 1 2 2 1 10 PHE H   . 110 . HN   1 1 
        945 1 1 2 1  9 TYR QD  . 109 . HD#  1 1 
        945 1 2 2 1 10 PHE H   . 110 . HN   1 1 
        946 1 1 2 1  9 TYR QD  . 109 . HD#  1 1 
        946 1 2 2 1 10 PHE QE  . 110 . HE#  1 1 
        947 1 1 2 1  9 TYR QD  . 109 . HD#  1 1 
        947 1 2 2 1 10 PHE HZ  . 110 . HZ   1 1 
        948 1 1 2 1  9 TYR QE  . 109 . HE#  1 1 
        948 1 2 2 1 10 PHE QD  . 110 . HD#  1 1 
        949 1 1 2 1  9 TYR QE  . 109 . HE#  1 1 
        949 1 2 2 1 10 PHE QE  . 110 . HE#  1 1 
        950 1 1 2 1 10 PHE H   . 110 . HN   1 1 
        950 1 2 2 1 11 ILE H   . 111 . HN   1 1 
        951 1 1 2 1 10 PHE H   . 110 . HN   1 1 
        951 1 2 2 1 12 GLU H   . 112 . HN   1 1 
        952 1 1 2 1 10 PHE QB  . 110 . HB#  1 1 
        952 1 2 2 1 37 VAL QG  . 137 . HG#  1 1 
        953 1 1 2 1 10 PHE QB  . 110 . HB#  1 1 
        953 1 2 2 1 59 LEU QD  . 159 . HD#  1 1 
        954 1 1 2 1 10 PHE QB  . 110 . HB#  1 1 
        954 1 2 2 1 62 ALA H   . 162 . HN   1 1 
        955 1 1 2 1 10 PHE QB  . 110 . HB#  1 1 
        955 1 2 2 1 62 ALA MB  . 162 . HB#  1 1 
        956 1 1 2 1 10 PHE QD  . 110 . HD#  1 1 
        956 1 2 2 1 33 TYR QE  . 133 . HE#  1 1 
        957 1 1 2 1 10 PHE QD  . 110 . HD#  1 1 
        957 1 2 2 1 37 VAL HB  . 137 . HB   1 1 
        958 1 1 2 1 10 PHE QD  . 110 . HD#  1 1 
        958 1 2 2 1 37 VAL QG  . 137 . HG#  1 1 
        959 1 1 2 1 10 PHE QD  . 110 . HD#  1 1 
        959 1 2 2 1 59 LEU HB2 . 159 . HB2  1 1 
        960 1 1 2 1 10 PHE QE  . 110 . HE#  1 1 
        960 1 2 2 1 37 VAL MG1 . 137 . HG1# 1 1 
        961 1 1 2 1 10 PHE QE  . 110 . HE#  1 1 
        961 1 2 2 1 37 VAL QG  . 137 . HG#  1 1 
        962 1 1 2 1 10 PHE QE  . 110 . HE#  1 1 
        962 1 2 2 1 37 VAL MG2 . 137 . HG2# 1 1 
        963 1 1 2 1 10 PHE QE  . 110 . HE#  1 1 
        963 1 2 2 1 59 LEU QD  . 159 . HD#  1 1 
        964 1 1 2 1 10 PHE HZ  . 110 . HZ   1 1 
        964 1 2 2 1 37 VAL MG1 . 137 . HG1# 1 1 
        965 1 1 2 1 10 PHE HZ  . 110 . HZ   1 1 
        965 1 2 2 1 37 VAL QG  . 137 . HG#  1 1 
        966 1 1 2 1 10 PHE HZ  . 110 . HZ   1 1 
        966 1 2 2 1 37 VAL MG2 . 137 . HG2# 1 1 
        967 1 1 2 1 11 ILE H   . 111 . HN   1 1 
        967 1 2 2 1 11 ILE HB  . 111 . HB   1 1 
        968 1 1 2 1 11 ILE H   . 111 . HN   1 1 
        968 1 2 2 1 11 ILE MD  . 111 . HD1# 1 1 
        969 1 1 2 1 11 ILE H   . 111 . HN   1 1 
        969 1 2 2 1 11 ILE QG  . 111 . HG1# 1 1 
        970 1 1 2 1 11 ILE H   . 111 . HN   1 1 
        970 1 2 2 1 11 ILE MG  . 111 . HG2# 1 1 
        971 1 1 2 1 11 ILE H   . 111 . HN   1 1 
        971 1 2 2 1 12 GLU H   . 112 . HN   1 1 
        972 1 1 2 1 11 ILE H   . 111 . HN   1 1 
        972 1 2 2 1 13 ASN H   . 113 . HN   1 1 
        973 1 1 2 1 11 ILE H   . 111 . HN   1 1 
        973 1 2 2 1 61 GLU QG  . 161 . HG#  1 1 
        974 1 1 2 1 11 ILE H   . 111 . HN   1 1 
        974 1 2 2 1 62 ALA HA  . 162 . HA   1 1 
        975 1 1 2 1 11 ILE H   . 111 . HN   1 1 
        975 1 2 2 1 62 ALA MB  . 162 . HB#  1 1 
        976 1 1 2 1 11 ILE HA  . 111 . HA   1 1 
        976 1 2 2 1 14 LEU MD1 . 114 . HD1# 1 1 
        977 1 1 2 1 11 ILE HA  . 111 . HA   1 1 
        977 1 2 2 1 14 LEU MD2 . 114 . HD2# 1 1 
        978 1 1 2 1 11 ILE HA  . 111 . HA   1 1 
        978 1 2 2 1 15 LYS H   . 115 . HN   1 1 
        979 1 1 2 1 11 ILE HA  . 111 . HA   1 1 
        979 1 2 2 1 62 ALA MB  . 162 . HB#  1 1 
        980 1 1 2 1 11 ILE HB  . 111 . HB   1 1 
        980 1 2 2 1 11 ILE MD  . 111 . HD1# 1 1 
        981 1 1 2 1 11 ILE HB  . 111 . HB   1 1 
        981 1 2 2 1 12 GLU H   . 112 . HN   1 1 
        982 1 1 2 1 11 ILE HB  . 111 . HB   1 1 
        982 1 2 2 1 61 GLU QG  . 161 . HG#  1 1 
        983 1 1 2 1 11 ILE MD  . 111 . HD1# 1 1 
        983 1 2 2 1 14 LEU QD  . 114 . HD#  1 1 
        984 1 1 2 1 11 ILE MD  . 111 . HD1# 1 1 
        984 1 2 2 1 61 GLU H   . 161 . HN   1 1 
        985 1 1 2 1 11 ILE MD  . 111 . HD1# 1 1 
        985 1 2 2 1 61 GLU QB  . 161 . HB#  1 1 
        986 1 1 2 1 11 ILE MD  . 111 . HD1# 1 1 
        986 1 2 2 1 61 GLU QG  . 161 . HG#  1 1 
        987 1 1 2 1 11 ILE MD  . 111 . HD1# 1 1 
        987 1 2 2 1 62 ALA HA  . 162 . HA   1 1 
        988 1 1 2 1 11 ILE MD  . 111 . HD1# 1 1 
        988 1 2 2 1 62 ALA MB  . 162 . HB#  1 1 
        989 1 1 2 1 11 ILE MD  . 111 . HD1# 1 1 
        989 1 2 2 1 63 TYR H   . 163 . HN   1 1 
        990 1 1 2 1 11 ILE MD  . 111 . HD1# 1 1 
        990 1 2 2 1 64 ASN H   . 164 . HN   1 1 
        991 1 1 2 1 11 ILE QG  . 111 . HG1# 1 1 
        991 1 2 2 1 13 ASN H   . 113 . HN   1 1 
        992 1 1 2 1 11 ILE QG  . 111 . HG1# 1 1 
        992 1 2 2 1 61 GLU QG  . 161 . HG#  1 1 
        993 1 1 2 1 11 ILE QG  . 111 . HG1# 1 1 
        993 1 2 2 1 62 ALA H   . 162 . HN   1 1 
        994 1 1 2 1 11 ILE QG  . 111 . HG1# 1 1 
        994 1 2 2 1 62 ALA HA  . 162 . HA   1 1 
        995 1 1 2 1 11 ILE MG  . 111 . HG2# 1 1 
        995 1 2 2 1 12 GLU H   . 112 . HN   1 1 
        996 1 1 2 1 11 ILE MG  . 111 . HG2# 1 1 
        996 1 2 2 1 12 GLU QG  . 112 . HG#  1 1 
        997 1 1 2 1 11 ILE MG  . 111 . HG2# 1 1 
        997 1 2 2 1 13 ASN H   . 113 . HN   1 1 
        998 1 1 2 1 11 ILE MG  . 111 . HG2# 1 1 
        998 1 2 2 1 14 LEU H   . 114 . HN   1 1 
        999 1 1 2 1 11 ILE MG  . 111 . HG2# 1 1 
        999 1 2 2 1 14 LEU HA  . 114 . HA   1 1 
       1000 1 1 2 1 11 ILE MG  . 111 . HG2# 1 1 
       1000 1 2 2 1 14 LEU QD  . 114 . HD#  1 1 
       1001 1 1 2 1 11 ILE MG  . 111 . HG2# 1 1 
       1001 1 2 2 1 62 ALA HA  . 162 . HA   1 1 
       1002 1 1 2 1 11 ILE MG  . 111 . HG2# 1 1 
       1002 1 2 2 1 62 ALA MB  . 162 . HB#  1 1 
       1003 1 1 2 1 12 GLU H   . 112 . HN   1 1 
       1003 1 2 2 1 12 GLU QB  . 112 . HB#  1 1 
       1004 1 1 2 1 12 GLU H   . 112 . HN   1 1 
       1004 1 2 2 1 12 GLU QG  . 112 . HG#  1 1 
       1005 1 1 2 1 12 GLU H   . 112 . HN   1 1 
       1005 1 2 2 1 13 ASN H   . 113 . HN   1 1 
       1006 1 1 2 1 12 GLU H   . 112 . HN   1 1 
       1006 1 2 2 1 13 ASN QB  . 113 . HB#  1 1 
       1007 1 1 2 1 12 GLU H   . 112 . HN   1 1 
       1007 1 2 2 1 14 LEU H   . 114 . HN   1 1 
       1008 1 1 2 1 12 GLU H   . 112 . HN   1 1 
       1008 1 2 2 1 14 LEU QD  . 114 . HD#  1 1 
       1009 1 1 2 1 12 GLU HA  . 112 . HA   1 1 
       1009 1 2 2 1 12 GLU QG  . 112 . HG#  1 1 
       1010 1 1 2 1 12 GLU QG  . 112 . HG#  1 1 
       1010 1 2 2 1 13 ASN H   . 113 . HN   1 1 
       1011 1 1 2 1 13 ASN H   . 113 . HN   1 1 
       1011 1 2 2 1 14 LEU H   . 114 . HN   1 1 
       1012 1 1 2 1 13 ASN H   . 113 . HN   1 1 
       1012 1 2 2 1 14 LEU QD  . 114 . HD#  1 1 
       1013 1 1 2 1 13 ASN H   . 113 . HN   1 1 
       1013 1 2 2 1 15 LYS H   . 115 . HN   1 1 
       1014 1 1 2 1 13 ASN H   . 113 . HN   1 1 
       1014 1 2 2 1 33 TYR QE  . 133 . HE#  1 1 
       1015 1 1 2 1 13 ASN QB  . 113 . HB#  1 1 
       1015 1 2 2 1 15 LYS H   . 115 . HN   1 1 
       1016 1 1 2 1 13 ASN QB  . 113 . HB#  1 1 
       1016 1 2 2 1 33 TYR QE  . 133 . HE#  1 1 
       1017 1 1 2 1 14 LEU H   . 114 . HN   1 1 
       1017 1 2 2 1 14 LEU QB  . 114 . HB#  1 1 
       1018 1 1 2 1 14 LEU H   . 114 . HN   1 1 
       1018 1 2 2 1 14 LEU MD1 . 114 . HD1# 1 1 
       1019 1 1 2 1 14 LEU H   . 114 . HN   1 1 
       1019 1 2 2 1 14 LEU QD  . 114 . HD#  1 1 
       1020 1 1 2 1 14 LEU H   . 114 . HN   1 1 
       1020 1 2 2 1 14 LEU MD2 . 114 . HD2# 1 1 
       1021 1 1 2 1 14 LEU H   . 114 . HN   1 1 
       1021 1 2 2 1 14 LEU HG  . 114 . HG   1 1 
       1022 1 1 2 1 14 LEU H   . 114 . HN   1 1 
       1022 1 2 2 1 15 LYS H   . 115 . HN   1 1 
       1023 1 1 2 1 14 LEU H   . 114 . HN   1 1 
       1023 1 2 2 1 15 LYS HA  . 115 . HA   1 1 
       1024 1 1 2 1 14 LEU H   . 114 . HN   1 1 
       1024 1 2 2 1 16 GLN H   . 116 . HN   1 1 
       1025 1 1 2 1 14 LEU H   . 114 . HN   1 1 
       1025 1 2 2 1 33 TYR QB  . 133 . HB#  1 1 
       1026 1 1 2 1 14 LEU H   . 114 . HN   1 1 
       1026 1 2 2 1 33 TYR QE  . 133 . HE#  1 1 
       1027 1 1 2 1 14 LEU HA  . 114 . HA   1 1 
       1027 1 2 2 1 18 ILE MD  . 118 . HD1# 1 1 
       1028 1 1 2 1 14 LEU HA  . 114 . HA   1 1 
       1028 1 2 2 1 18 ILE QG  . 118 . HG1# 1 1 
       1029 1 1 2 1 14 LEU HA  . 114 . HA   1 1 
       1029 1 2 2 1 29 ALA MB  . 129 . HB#  1 1 
       1030 1 1 2 1 14 LEU HA  . 114 . HA   1 1 
       1030 1 2 2 1 33 TYR QB  . 133 . HB#  1 1 
       1031 1 1 2 1 14 LEU QB  . 114 . HB#  1 1 
       1031 1 2 2 1 18 ILE MD  . 118 . HD1# 1 1 
       1032 1 1 2 1 14 LEU QB  . 114 . HB#  1 1 
       1032 1 2 2 1 18 ILE MG  . 118 . HG2# 1 1 
       1033 1 1 2 1 14 LEU QD  . 114 . HD#  1 1 
       1033 1 2 2 1 15 LYS H   . 115 . HN   1 1 
       1034 1 1 2 1 14 LEU QD  . 114 . HD#  1 1 
       1034 1 2 2 1 17 HIS H   . 117 . HN   1 1 
       1035 1 1 2 1 14 LEU QD  . 114 . HD#  1 1 
       1035 1 2 2 1 29 ALA H   . 129 . HN   1 1 
       1036 1 1 2 1 14 LEU QD  . 114 . HD#  1 1 
       1036 1 2 2 1 29 ALA MB  . 129 . HB#  1 1 
       1037 1 1 2 1 14 LEU QD  . 114 . HD#  1 1 
       1037 1 2 2 1 30 MET H   . 130 . HN   1 1 
       1038 1 1 2 1 14 LEU QD  . 114 . HD#  1 1 
       1038 1 2 2 1 30 MET HA  . 130 . HA   1 1 
       1039 1 1 2 1 14 LEU QD  . 114 . HD#  1 1 
       1039 1 2 2 1 33 TYR H   . 133 . HN   1 1 
       1040 1 1 2 1 14 LEU QD  . 114 . HD#  1 1 
       1040 1 2 2 1 33 TYR QB  . 133 . HB#  1 1 
       1041 1 1 2 1 14 LEU QD  . 114 . HD#  1 1 
       1041 1 2 2 1 33 TYR QD  . 133 . HD#  1 1 
       1042 1 1 2 1 14 LEU QD  . 114 . HD#  1 1 
       1042 1 2 2 1 33 TYR QE  . 133 . HE#  1 1 
       1043 1 1 2 1 14 LEU QD  . 114 . HD#  1 1 
       1043 1 2 2 1 34 TYR H   . 134 . HN   1 1 
       1044 1 1 2 1 14 LEU QD  . 114 . HD#  1 1 
       1044 1 2 2 1 59 LEU QD  . 159 . HD#  1 1 
       1045 1 1 2 1 14 LEU QD  . 114 . HD#  1 1 
       1045 1 2 2 1 61 GLU QG  . 161 . HG#  1 1 
       1046 1 1 2 1 14 LEU QD  . 114 . HD#  1 1 
       1046 1 2 2 1 62 ALA HA  . 162 . HA   1 1 
       1047 1 1 2 1 14 LEU QD  . 114 . HD#  1 1 
       1047 1 2 2 1 62 ALA MB  . 162 . HB#  1 1 
       1048 1 1 2 1 14 LEU QD  . 114 . HD#  1 1 
       1048 1 2 2 1 63 TYR H   . 163 . HN   1 1 
       1049 1 1 2 1 14 LEU QD  . 114 . HD#  1 1 
       1049 1 2 2 1 63 TYR HA  . 163 . HA   1 1 
       1050 1 1 2 1 14 LEU QD  . 114 . HD#  1 1 
       1050 1 2 2 1 66 VAL H   . 166 . HN   1 1 
       1051 1 1 2 1 14 LEU QD  . 114 . HD#  1 1 
       1051 1 2 2 1 66 VAL HB  . 166 . HB   1 1 
       1052 1 1 2 1 14 LEU MD1 . 114 . HD1# 1 1 
       1052 1 2 2 1 62 ALA H   . 162 . HN   1 1 
       1053 1 1 2 1 14 LEU MD1 . 114 . HD1# 1 1 
       1053 1 2 2 1 62 ALA MB  . 162 . HB#  1 1 
       1054 1 1 2 1 14 LEU MD2 . 114 . HD2# 1 1 
       1054 1 2 2 1 62 ALA MB  . 162 . HB#  1 1 
       1055 1 1 2 1 14 LEU HG  . 114 . HG   1 1 
       1055 1 2 2 1 33 TYR QD  . 133 . HD#  1 1 
       1056 1 1 2 1 14 LEU HG  . 114 . HG   1 1 
       1056 1 2 2 1 33 TYR QE  . 133 . HE#  1 1 
       1057 1 1 2 1 15 LYS H   . 115 . HN   1 1 
       1057 1 2 2 1 15 LYS QB  . 115 . HB#  1 1 
       1058 1 1 2 1 15 LYS H   . 115 . HN   1 1 
       1058 1 2 2 1 16 GLN H   . 116 . HN   1 1 
       1059 1 1 2 1 15 LYS H   . 115 . HN   1 1 
       1059 1 2 2 1 18 ILE MD  . 118 . HD1# 1 1 
       1060 1 1 2 1 15 LYS H   . 115 . HN   1 1 
       1060 1 2 2 1 18 ILE MG  . 118 . HG2# 1 1 
       1061 1 1 2 1 15 LYS HA  . 115 . HA   1 1 
       1061 1 2 2 1 18 ILE H   . 118 . HN   1 1 
       1062 1 1 2 1 15 LYS HA  . 115 . HA   1 1 
       1062 1 2 2 1 18 ILE MD  . 118 . HD1# 1 1 
       1063 1 1 2 1 15 LYS HA  . 115 . HA   1 1 
       1063 1 2 2 1 18 ILE QG  . 118 . HG1# 1 1 
       1064 1 1 2 1 15 LYS HA  . 115 . HA   1 1 
       1064 1 2 2 1 18 ILE MG  . 118 . HG2# 1 1 
       1065 1 1 2 1 15 LYS QB  . 115 . HB#  1 1 
       1065 1 2 2 1 16 GLN H   . 116 . HN   1 1 
       1066 1 1 2 1 16 GLN H   . 116 . HN   1 1 
       1066 1 2 2 1 20 MET H   . 120 . HN   1 1 
       1067 1 1 2 1 16 GLN HA  . 116 . HA   1 1 
       1067 1 2 2 1 16 GLN QG  . 116 . HG#  1 1 
       1068 1 1 2 1 16 GLN HA  . 116 . HA   1 1 
       1068 1 2 2 1 20 MET ME  . 120 . HE#  1 1 
       1069 1 1 2 1 16 GLN HA  . 116 . HA   1 1 
       1069 1 2 2 1 22 GLN H   . 122 . HN   1 1 
       1070 1 1 2 1 16 GLN QG  . 116 . HG#  1 1 
       1070 1 2 2 1 17 HIS HA  . 117 . HA   1 1 
       1071 1 1 2 1 16 GLN QG  . 116 . HG#  1 1 
       1071 1 2 2 1 18 ILE H   . 118 . HN   1 1 
       1072 1 1 2 1 16 GLN QG  . 116 . HG#  1 1 
       1072 1 2 2 1 20 MET H   . 120 . HN   1 1 
       1073 1 1 2 1 16 GLN QG  . 116 . HG#  1 1 
       1073 1 2 2 1 21 ASN H   . 121 . HN   1 1 
       1074 1 1 2 1 16 GLN QG  . 116 . HG#  1 1 
       1074 1 2 2 1 22 GLN H   . 122 . HN   1 1 
       1075 1 1 2 1 16 GLN HG2 . 116 . HG2  1 1 
       1075 1 2 2 1 17 HIS H   . 117 . HN   1 1 
       1076 1 1 2 1 16 GLN HG2 . 116 . HG2  1 1 
       1076 1 2 2 1 21 ASN H   . 121 . HN   1 1 
       1077 1 1 2 1 16 GLN HG3 . 116 . HG1  1 1 
       1077 1 2 2 1 17 HIS H   . 117 . HN   1 1 
       1078 1 1 2 1 16 GLN HG3 . 116 . HG1  1 1 
       1078 1 2 2 1 21 ASN H   . 121 . HN   1 1 
       1079 1 1 2 1 17 HIS H   . 117 . HN   1 1 
       1079 1 2 2 1 19 GLU H   . 119 . HN   1 1 
       1080 1 1 2 1 17 HIS H   . 117 . HN   1 1 
       1080 1 2 2 1 20 MET ME  . 120 . HE#  1 1 
       1081 1 1 2 1 17 HIS H   . 117 . HN   1 1 
       1081 1 2 2 1 24 GLU HB3 . 124 . HB1  1 1 
       1082 1 1 2 1 17 HIS H   . 117 . HN   1 1 
       1082 1 2 2 1 24 GLU HG2 . 124 . HG2  1 1 
       1083 1 1 2 1 17 HIS HA  . 117 . HA   1 1 
       1083 1 2 2 1 19 GLU H   . 119 . HN   1 1 
       1084 1 1 2 1 17 HIS HA  . 117 . HA   1 1 
       1084 1 2 2 1 20 MET H   . 120 . HN   1 1 
       1085 1 1 2 1 17 HIS HA  . 117 . HA   1 1 
       1085 1 2 2 1 20 MET QG  . 120 . HG#  1 1 
       1086 1 1 2 1 17 HIS HA  . 117 . HA   1 1 
       1086 1 2 2 1 25 ASP H   . 125 . HN   1 1 
       1087 1 1 2 1 17 HIS QB  . 117 . HB#  1 1 
       1087 1 2 2 1 18 ILE MG  . 118 . HG2# 1 1 
       1088 1 1 2 1 17 HIS QB  . 117 . HB#  1 1 
       1088 1 2 2 1 19 GLU H   . 119 . HN   1 1 
       1089 1 1 2 1 18 ILE H   . 118 . HN   1 1 
       1089 1 2 2 1 18 ILE MD  . 118 . HD1# 1 1 
       1090 1 1 2 1 18 ILE H   . 118 . HN   1 1 
       1090 1 2 2 1 18 ILE QG  . 118 . HG1# 1 1 
       1091 1 1 2 1 18 ILE H   . 118 . HN   1 1 
       1091 1 2 2 1 18 ILE MG  . 118 . HG2# 1 1 
       1092 1 1 2 1 18 ILE H   . 118 . HN   1 1 
       1092 1 2 2 1 19 GLU H   . 119 . HN   1 1 
       1093 1 1 2 1 18 ILE H   . 118 . HN   1 1 
       1093 1 2 2 1 20 MET H   . 120 . HN   1 1 
       1094 1 1 2 1 18 ILE H   . 118 . HN   1 1 
       1094 1 2 2 1 25 ASP H   . 125 . HN   1 1 
       1095 1 1 2 1 18 ILE H   . 118 . HN   1 1 
       1095 1 2 2 1 29 ALA MB  . 129 . HB#  1 1 
       1096 1 1 2 1 18 ILE HA  . 118 . HA   1 1 
       1096 1 2 2 1 18 ILE MD  . 118 . HD1# 1 1 
       1097 1 1 2 1 18 ILE HA  . 118 . HA   1 1 
       1097 1 2 2 1 26 LYS QB  . 126 . HB#  1 1 
       1098 1 1 2 1 18 ILE HA  . 118 . HA   1 1 
       1098 1 2 2 1 26 LYS QG  . 126 . HG#  1 1 
       1099 1 1 2 1 18 ILE HB  . 118 . HB   1 1 
       1099 1 2 2 1 19 GLU HA  . 119 . HA   1 1 
       1100 1 1 2 1 18 ILE MD  . 118 . HD1# 1 1 
       1100 1 2 2 1 19 GLU HA  . 119 . HA   1 1 
       1101 1 1 2 1 18 ILE MD  . 118 . HD1# 1 1 
       1101 1 2 2 1 26 LYS HA  . 126 . HA   1 1 
       1102 1 1 2 1 18 ILE MD  . 118 . HD1# 1 1 
       1102 1 2 2 1 26 LYS QG  . 126 . HG#  1 1 
       1103 1 1 2 1 18 ILE MD  . 118 . HD1# 1 1 
       1103 1 2 2 1 29 ALA MB  . 129 . HB#  1 1 
       1104 1 1 2 1 18 ILE MD  . 118 . HD1# 1 1 
       1104 1 2 2 1 69 GLY H   . 169 . HN   1 1 
       1105 1 1 2 1 18 ILE MD  . 118 . HD1# 1 1 
       1105 1 2 2 1 70 GLU QG  . 170 . HG#  1 1 
       1106 1 1 2 1 18 ILE QG  . 118 . HG1# 1 1 
       1106 1 2 2 1 18 ILE MG  . 118 . HG2# 1 1 
       1107 1 1 2 1 18 ILE QG  . 118 . HG1# 1 1 
       1107 1 2 2 1 29 ALA MB  . 129 . HB#  1 1 
       1108 1 1 2 1 18 ILE MG  . 118 . HG2# 1 1 
       1108 1 2 2 1 19 GLU H   . 119 . HN   1 1 
       1109 1 1 2 1 18 ILE MG  . 118 . HG2# 1 1 
       1109 1 2 2 1 24 GLU QG  . 124 . HG#  1 1 
       1110 1 1 2 1 18 ILE MG  . 118 . HG2# 1 1 
       1110 1 2 2 1 26 LYS HA  . 126 . HA   1 1 
       1111 1 1 2 1 18 ILE MG  . 118 . HG2# 1 1 
       1111 1 2 2 1 26 LYS QG  . 126 . HG#  1 1 
       1112 1 1 2 1 18 ILE MG  . 118 . HG2# 1 1 
       1112 1 2 2 1 29 ALA MB  . 129 . HB#  1 1 
       1113 1 1 2 1 18 ILE MG  . 118 . HG2# 1 1 
       1113 1 2 2 1 30 MET H   . 130 . HN   1 1 
       1114 1 1 2 1 19 GLU H   . 119 . HN   1 1 
       1114 1 2 2 1 19 GLU QG  . 119 . HG#  1 1 
       1115 1 1 2 1 19 GLU H   . 119 . HN   1 1 
       1115 1 2 2 1 20 MET ME  . 120 . HE#  1 1 
       1116 1 1 2 1 19 GLU H   . 119 . HN   1 1 
       1116 1 2 2 1 26 LYS QG  . 126 . HG#  1 1 
       1117 1 1 2 1 19 GLU HA  . 119 . HA   1 1 
       1117 1 2 2 1 19 GLU QG  . 119 . HG#  1 1 
       1118 1 1 2 1 20 MET H   . 120 . HN   1 1 
       1118 1 2 2 1 21 ASN HA  . 121 . HA   1 1 
       1119 1 1 2 1 20 MET H   . 120 . HN   1 1 
       1119 1 2 2 1 21 ASN QB  . 121 . HB#  1 1 
       1120 1 1 2 1 20 MET HA  . 120 . HA   1 1 
       1120 1 2 2 1 20 MET QG  . 120 . HG#  1 1 
       1121 1 1 2 1 20 MET QB  . 120 . HB#  1 1 
       1121 1 2 2 1 21 ASN H   . 121 . HN   1 1 
       1122 1 1 2 1 20 MET QB  . 120 . HB#  1 1 
       1122 1 2 2 1 22 GLN H   . 122 . HN   1 1 
       1123 1 1 2 1 21 ASN H   . 121 . HN   1 1 
       1123 1 2 2 1 21 ASN QB  . 121 . HB#  1 1 
       1124 1 1 2 1 21 ASN H   . 121 . HN   1 1 
       1124 1 2 2 1 22 GLN H   . 122 . HN   1 1 
       1125 1 1 2 1 21 ASN H   . 121 . HN   1 1 
       1125 1 2 2 1 22 GLN HA  . 122 . HA   1 1 
       1126 1 1 2 1 21 ASN H   . 121 . HN   1 1 
       1126 1 2 2 1 22 GLN QB  . 122 . HB#  1 1 
       1127 1 1 2 1 21 ASN HA  . 121 . HA   1 1 
       1127 1 2 2 1 22 GLN H   . 122 . HN   1 1 
       1128 1 1 2 1 21 ASN HA  . 121 . HA   1 1 
       1128 1 2 2 1 22 GLN QB  . 122 . HB#  1 1 
       1129 1 1 2 1 21 ASN HA  . 121 . HA   1 1 
       1129 1 2 2 1 23 SER H   . 123 . HN   1 1 
       1130 1 1 2 1 21 ASN HA  . 121 . HA   1 1 
       1130 1 2 2 1 24 GLU H   . 124 . HN   1 1 
       1131 1 1 2 1 21 ASN HA  . 121 . HA   1 1 
       1131 1 2 2 1 24 GLU HB2 . 124 . HB2  1 1 
       1132 1 1 2 1 21 ASN QB  . 121 . HB#  1 1 
       1132 1 2 2 1 24 GLU H   . 124 . HN   1 1 
       1133 1 1 2 1 22 GLN H   . 122 . HN   1 1 
       1133 1 2 2 1 22 GLN QB  . 122 . HB#  1 1 
       1134 1 1 2 1 22 GLN H   . 122 . HN   1 1 
       1134 1 2 2 1 22 GLN QG  . 122 . HG#  1 1 
       1135 1 1 2 1 22 GLN H   . 122 . HN   1 1 
       1135 1 2 2 1 24 GLU H   . 124 . HN   1 1 
       1136 1 1 2 1 22 GLN HA  . 122 . HA   1 1 
       1136 1 2 2 1 22 GLN QG  . 122 . HG#  1 1 
       1137 1 1 2 1 22 GLN HA  . 122 . HA   1 1 
       1137 1 2 2 1 23 SER H   . 123 . HN   1 1 
       1138 1 1 2 1 22 GLN QB  . 122 . HB#  1 1 
       1138 1 2 2 1 23 SER H   . 123 . HN   1 1 
       1139 1 1 2 1 22 GLN HB2 . 122 . HB2  1 1 
       1139 1 2 2 1 23 SER H   . 123 . HN   1 1 
       1140 1 1 2 1 22 GLN HB3 . 122 . HB1  1 1 
       1140 1 2 2 1 23 SER H   . 123 . HN   1 1 
       1141 1 1 2 1 22 GLN QG  . 122 . HG#  1 1 
       1141 1 2 2 1 23 SER H   . 123 . HN   1 1 
       1142 1 1 2 1 23 SER H   . 123 . HN   1 1 
       1142 1 2 2 1 24 GLU H   . 124 . HN   1 1 
       1143 1 1 2 1 23 SER H   . 123 . HN   1 1 
       1143 1 2 2 1 24 GLU HA  . 124 . HA   1 1 
       1144 1 1 2 1 23 SER H   . 123 . HN   1 1 
       1144 1 2 2 1 24 GLU HB2 . 124 . HB2  1 1 
       1145 1 1 2 1 24 GLU H   . 124 . HN   1 1 
       1145 1 2 2 1 24 GLU HB2 . 124 . HB2  1 1 
       1146 1 1 2 1 24 GLU H   . 124 . HN   1 1 
       1146 1 2 2 1 24 GLU QG  . 124 . HG#  1 1 
       1147 1 1 2 1 24 GLU H   . 124 . HN   1 1 
       1147 1 2 2 1 25 ASP H   . 125 . HN   1 1 
       1148 1 1 2 1 24 GLU HA  . 124 . HA   1 1 
       1148 1 2 2 1 24 GLU QG  . 124 . HG#  1 1 
       1149 1 1 2 1 24 GLU HA  . 124 . HA   1 1 
       1149 1 2 2 1 25 ASP HB3 . 125 . HB1  1 1 
       1150 1 1 2 1 24 GLU HB2 . 124 . HB2  1 1 
       1150 1 2 2 1 25 ASP H   . 125 . HN   1 1 
       1151 1 1 2 1 24 GLU HB3 . 124 . HB1  1 1 
       1151 1 2 2 1 25 ASP H   . 125 . HN   1 1 
       1152 1 1 2 1 24 GLU HB3 . 124 . HB1  1 1 
       1152 1 2 2 1 29 ALA MB  . 129 . HB#  1 1 
       1153 1 1 2 1 24 GLU QG  . 124 . HG#  1 1 
       1153 1 2 2 1 29 ALA H   . 129 . HN   1 1 
       1154 1 1 2 1 24 GLU QG  . 124 . HG#  1 1 
       1154 1 2 2 1 29 ALA MB  . 129 . HB#  1 1 
       1155 1 1 2 1 24 GLU QG  . 124 . HG#  1 1 
       1155 1 2 2 1 32 SER H   . 132 . HN   1 1 
       1156 1 1 2 1 24 GLU QG  . 124 . HG#  1 1 
       1156 1 2 2 1 33 TYR H   . 133 . HN   1 1 
       1157 1 1 2 1 25 ASP H   . 125 . HN   1 1 
       1157 1 2 2 1 26 LYS HA  . 126 . HA   1 1 
       1158 1 1 2 1 25 ASP H   . 125 . HN   1 1 
       1158 1 2 2 1 28 HIS H   . 128 . HN   1 1 
       1159 1 1 2 1 25 ASP H   . 125 . HN   1 1 
       1159 1 2 2 1 29 ALA MB  . 129 . HB#  1 1 
       1160 1 1 2 1 25 ASP HA  . 125 . HA   1 1 
       1160 1 2 2 1 26 LYS QB  . 126 . HB#  1 1 
       1161 1 1 2 1 25 ASP HB2 . 125 . HB2  1 1 
       1161 1 2 2 1 28 HIS H   . 128 . HN   1 1 
       1162 1 1 2 1 25 ASP HB2 . 125 . HB2  1 1 
       1162 1 2 2 1 29 ALA H   . 129 . HN   1 1 
       1163 1 1 2 1 25 ASP HB2 . 125 . HB2  1 1 
       1163 1 2 2 1 30 MET H   . 130 . HN   1 1 
       1164 1 1 2 1 25 ASP HB3 . 125 . HB1  1 1 
       1164 1 2 2 1 26 LYS H   . 126 . HN   1 1 
       1165 1 1 2 1 26 LYS H   . 126 . HN   1 1 
       1165 1 2 2 1 26 LYS HB2 . 126 . HB2  1 1 
       1166 1 1 2 1 26 LYS H   . 126 . HN   1 1 
       1166 1 2 2 1 26 LYS QB  . 126 . HB#  1 1 
       1167 1 1 2 1 26 LYS H   . 126 . HN   1 1 
       1167 1 2 2 1 26 LYS HB3 . 126 . HB1  1 1 
       1168 1 1 2 1 26 LYS H   . 126 . HN   1 1 
       1168 1 2 2 1 26 LYS HG2 . 126 . HG2  1 1 
       1169 1 1 2 1 26 LYS H   . 126 . HN   1 1 
       1169 1 2 2 1 26 LYS QG  . 126 . HG#  1 1 
       1170 1 1 2 1 26 LYS H   . 126 . HN   1 1 
       1170 1 2 2 1 26 LYS HG3 . 126 . HG1  1 1 
       1171 1 1 2 1 26 LYS H   . 126 . HN   1 1 
       1171 1 2 2 1 27 ILE H   . 127 . HN   1 1 
       1172 1 1 2 1 26 LYS H   . 126 . HN   1 1 
       1172 1 2 2 1 27 ILE MG  . 127 . HG2# 1 1 
       1173 1 1 2 1 26 LYS HA  . 126 . HA   1 1 
       1173 1 2 2 1 26 LYS QG  . 126 . HG#  1 1 
       1174 1 1 2 1 26 LYS HA  . 126 . HA   1 1 
       1174 1 2 2 1 29 ALA H   . 129 . HN   1 1 
       1175 1 1 2 1 26 LYS HA  . 126 . HA   1 1 
       1175 1 2 2 1 29 ALA MB  . 129 . HB#  1 1 
       1176 1 1 2 1 26 LYS QB  . 126 . HB#  1 1 
       1176 1 2 2 1 27 ILE QG  . 127 . HG1# 1 1 
       1177 1 1 2 1 26 LYS QB  . 126 . HB#  1 1 
       1177 1 2 2 1 29 ALA H   . 129 . HN   1 1 
       1178 1 1 2 1 26 LYS QG  . 126 . HG#  1 1 
       1178 1 2 2 1 27 ILE H   . 127 . HN   1 1 
       1179 1 1 2 1 26 LYS QG  . 126 . HG#  1 1 
       1179 1 2 2 1 29 ALA H   . 129 . HN   1 1 
       1180 1 1 2 1 26 LYS HG2 . 126 . HG2  1 1 
       1180 1 2 2 1 27 ILE H   . 127 . HN   1 1 
       1181 1 1 2 1 26 LYS HG3 . 126 . HG1  1 1 
       1181 1 2 2 1 27 ILE H   . 127 . HN   1 1 
       1182 1 1 2 1 27 ILE H   . 127 . HN   1 1 
       1182 1 2 2 1 27 ILE MD  . 127 . HD1# 1 1 
       1183 1 1 2 1 27 ILE H   . 127 . HN   1 1 
       1183 1 2 2 1 27 ILE MG  . 127 . HG2# 1 1 
       1184 1 1 2 1 27 ILE H   . 127 . HN   1 1 
       1184 1 2 2 1 28 HIS H   . 128 . HN   1 1 
       1185 1 1 2 1 27 ILE H   . 127 . HN   1 1 
       1185 1 2 2 1 29 ALA H   . 129 . HN   1 1 
       1186 1 1 2 1 27 ILE HA  . 127 . HA   1 1 
       1186 1 2 2 1 27 ILE MD  . 127 . HD1# 1 1 
       1187 1 1 2 1 27 ILE HA  . 127 . HA   1 1 
       1187 1 2 2 1 66 VAL QG  . 166 . HG#  1 1 
       1188 1 1 2 1 27 ILE HA  . 127 . HA   1 1 
       1188 1 2 2 1 67 LYS QD  . 167 . HD#  1 1 
       1189 1 1 2 1 27 ILE HB  . 127 . HB   1 1 
       1189 1 2 2 1 27 ILE MD  . 127 . HD1# 1 1 
       1190 1 1 2 1 27 ILE HB  . 127 . HB   1 1 
       1190 1 2 2 1 29 ALA H   . 129 . HN   1 1 
       1191 1 1 2 1 27 ILE MD  . 127 . HD1# 1 1 
       1191 1 2 2 1 63 TYR QE  . 163 . HE#  1 1 
       1192 1 1 2 1 27 ILE MD  . 127 . HD1# 1 1 
       1192 1 2 2 1 67 LYS H   . 167 . HN   1 1 
       1193 1 1 2 1 27 ILE MD  . 127 . HD1# 1 1 
       1193 1 2 2 1 67 LYS HA  . 167 . HA   1 1 
       1194 1 1 2 1 27 ILE MD  . 127 . HD1# 1 1 
       1194 1 2 2 1 67 LYS HB3 . 167 . HB1  1 1 
       1195 1 1 2 1 27 ILE MD  . 127 . HD1# 1 1 
       1195 1 2 2 1 67 LYS QD  . 167 . HD#  1 1 
       1196 1 1 2 1 27 ILE MD  . 127 . HD1# 1 1 
       1196 1 2 2 1 67 LYS HG3 . 167 . HG1  1 1 
       1197 1 1 2 1 27 ILE MD  . 127 . HD1# 1 1 
       1197 1 2 2 1 68 ARG H   . 168 . HN   1 1 
       1198 1 1 2 1 27 ILE MD  . 127 . HD1# 1 1 
       1198 1 2 2 1 69 GLY H   . 169 . HN   1 1 
       1199 1 1 2 1 27 ILE MD  . 127 . HD1# 1 1 
       1199 1 2 2 1 70 GLU H   . 170 . HN   1 1 
       1200 1 1 2 1 27 ILE MD  . 127 . HD1# 1 1 
       1200 1 2 2 1 70 GLU QB  . 170 . HB#  1 1 
       1201 1 1 2 1 27 ILE MD  . 127 . HD1# 1 1 
       1201 1 2 2 1 70 GLU QG  . 170 . HG#  1 1 
       1202 1 1 2 1 27 ILE MD  . 127 . HD1# 1 1 
       1202 1 2 2 1 71 SER H   . 171 . HN   1 1 
       1203 1 1 2 1 27 ILE QG  . 127 . HG1# 1 1 
       1203 1 2 2 1 27 ILE MG  . 127 . HG2# 1 1 
       1204 1 1 2 1 27 ILE QG  . 127 . HG1# 1 1 
       1204 1 2 2 1 71 SER H   . 171 . HN   1 1 
       1205 1 1 2 1 27 ILE MG  . 127 . HG2# 1 1 
       1205 1 2 2 1 28 HIS H   . 128 . HN   1 1 
       1206 1 1 2 1 27 ILE MG  . 127 . HG2# 1 1 
       1206 1 2 2 1 29 ALA H   . 129 . HN   1 1 
       1207 1 1 2 1 27 ILE MG  . 127 . HG2# 1 1 
       1207 1 2 2 1 29 ALA MB  . 129 . HB#  1 1 
       1208 1 1 2 1 27 ILE MG  . 127 . HG2# 1 1 
       1208 1 2 2 1 30 MET H   . 130 . HN   1 1 
       1209 1 1 2 1 27 ILE MG  . 127 . HG2# 1 1 
       1209 1 2 2 1 31 ASN H   . 131 . HN   1 1 
       1210 1 1 2 1 27 ILE MG  . 127 . HG2# 1 1 
       1210 1 2 2 1 67 LYS QD  . 167 . HD#  1 1 
       1211 1 1 2 1 28 HIS H   . 128 . HN   1 1 
       1211 1 2 2 1 29 ALA H   . 129 . HN   1 1 
       1212 1 1 2 1 28 HIS H   . 128 . HN   1 1 
       1212 1 2 2 1 30 MET H   . 130 . HN   1 1 
       1213 1 1 2 1 29 ALA H   . 129 . HN   1 1 
       1213 1 2 2 1 30 MET H   . 130 . HN   1 1 
       1214 1 1 2 1 29 ALA H   . 129 . HN   1 1 
       1214 1 2 2 1 31 ASN H   . 131 . HN   1 1 
       1215 1 1 2 1 29 ALA H   . 129 . HN   1 1 
       1215 1 2 2 1 66 VAL QG  . 166 . HG#  1 1 
       1216 1 1 2 1 29 ALA MB  . 129 . HB#  1 1 
       1216 1 2 2 1 30 MET HA  . 130 . HA   1 1 
       1217 1 1 2 1 29 ALA MB  . 129 . HB#  1 1 
       1217 1 2 2 1 31 ASN H   . 131 . HN   1 1 
       1218 1 1 2 1 29 ALA MB  . 129 . HB#  1 1 
       1218 1 2 2 1 33 TYR H   . 133 . HN   1 1 
       1219 1 1 2 1 29 ALA MB  . 129 . HB#  1 1 
       1219 1 2 2 1 33 TYR QB  . 133 . HB#  1 1 
       1220 1 1 2 1 29 ALA MB  . 129 . HB#  1 1 
       1220 1 2 2 1 66 VAL HB  . 166 . HB   1 1 
       1221 1 1 2 1 30 MET H   . 130 . HN   1 1 
       1221 1 2 2 1 31 ASN H   . 131 . HN   1 1 
       1222 1 1 2 1 30 MET H   . 130 . HN   1 1 
       1222 1 2 2 1 32 SER H   . 132 . HN   1 1 
       1223 1 1 2 1 30 MET H   . 130 . HN   1 1 
       1223 1 2 2 1 33 TYR QB  . 133 . HB#  1 1 
       1224 1 1 2 1 30 MET H   . 130 . HN   1 1 
       1224 1 2 2 1 33 TYR QD  . 133 . HD#  1 1 
       1225 1 1 2 1 30 MET H   . 130 . HN   1 1 
       1225 1 2 2 1 66 VAL HB  . 166 . HB   1 1 
       1226 1 1 2 1 30 MET H   . 130 . HN   1 1 
       1226 1 2 2 1 66 VAL MG1 . 166 . HG1# 1 1 
       1227 1 1 2 1 30 MET H   . 130 . HN   1 1 
       1227 1 2 2 1 66 VAL MG2 . 166 . HG2# 1 1 
       1228 1 1 2 1 30 MET H   . 130 . HN   1 1 
       1228 1 2 2 1 67 LYS QD  . 167 . HD#  1 1 
       1229 1 1 2 1 30 MET HA  . 130 . HA   1 1 
       1229 1 2 2 1 33 TYR H   . 133 . HN   1 1 
       1230 1 1 2 1 30 MET HA  . 130 . HA   1 1 
       1230 1 2 2 1 33 TYR QB  . 133 . HB#  1 1 
       1231 1 1 2 1 30 MET HA  . 130 . HA   1 1 
       1231 1 2 2 1 34 TYR H   . 134 . HN   1 1 
       1232 1 1 2 1 30 MET HA  . 130 . HA   1 1 
       1232 1 2 2 1 66 VAL MG1 . 166 . HG1# 1 1 
       1233 1 1 2 1 30 MET HA  . 130 . HA   1 1 
       1233 1 2 2 1 66 VAL QG  . 166 . HG#  1 1 
       1234 1 1 2 1 30 MET HA  . 130 . HA   1 1 
       1234 1 2 2 1 66 VAL MG2 . 166 . HG2# 1 1 
       1235 1 1 2 1 30 MET ME  . 130 . HE#  1 1 
       1235 1 2 2 1 31 ASN H   . 131 . HN   1 1 
       1236 1 1 2 1 31 ASN H   . 131 . HN   1 1 
       1236 1 2 2 1 32 SER H   . 132 . HN   1 1 
       1237 1 1 2 1 31 ASN H   . 131 . HN   1 1 
       1237 1 2 2 1 33 TYR H   . 133 . HN   1 1 
       1238 1 1 2 1 31 ASN H   . 131 . HN   1 1 
       1238 1 2 2 1 33 TYR QB  . 133 . HB#  1 1 
       1239 1 1 2 1 32 SER H   . 132 . HN   1 1 
       1239 1 2 2 1 33 TYR H   . 133 . HN   1 1 
       1240 1 1 2 1 32 SER H   . 132 . HN   1 1 
       1240 1 2 2 1 33 TYR QB  . 133 . HB#  1 1 
       1241 1 1 2 1 32 SER H   . 132 . HN   1 1 
       1241 1 2 2 1 34 TYR H   . 134 . HN   1 1 
       1242 1 1 2 1 33 TYR H   . 133 . HN   1 1 
       1242 1 2 2 1 33 TYR HB2 . 133 . HB2  1 1 
       1243 1 1 2 1 33 TYR H   . 133 . HN   1 1 
       1243 1 2 2 1 33 TYR QB  . 133 . HB#  1 1 
       1244 1 1 2 1 33 TYR H   . 133 . HN   1 1 
       1244 1 2 2 1 33 TYR HB3 . 133 . HB1  1 1 
       1245 1 1 2 1 33 TYR H   . 133 . HN   1 1 
       1245 1 2 2 1 33 TYR QD  . 133 . HD#  1 1 
       1246 1 1 2 1 33 TYR H   . 133 . HN   1 1 
       1246 1 2 2 1 34 TYR H   . 134 . HN   1 1 
       1247 1 1 2 1 33 TYR H   . 133 . HN   1 1 
       1247 1 2 2 1 37 VAL H   . 137 . HN   1 1 
       1248 1 1 2 1 33 TYR QB  . 133 . HB#  1 1 
       1248 1 2 2 1 34 TYR H   . 134 . HN   1 1 
       1249 1 1 2 1 33 TYR QB  . 133 . HB#  1 1 
       1249 1 2 2 1 35 ARG H   . 135 . HN   1 1 
       1250 1 1 2 1 33 TYR QD  . 133 . HD#  1 1 
       1250 1 2 2 1 34 TYR H   . 134 . HN   1 1 
       1251 1 1 2 1 33 TYR QD  . 133 . HD#  1 1 
       1251 1 2 2 1 37 VAL H   . 137 . HN   1 1 
       1252 1 1 2 1 33 TYR QD  . 133 . HD#  1 1 
       1252 1 2 2 1 37 VAL QG  . 137 . HG#  1 1 
       1253 1 1 2 1 33 TYR QD  . 133 . HD#  1 1 
       1253 1 2 2 1 38 VAL H   . 138 . HN   1 1 
       1254 1 1 2 1 33 TYR QD  . 133 . HD#  1 1 
       1254 1 2 2 1 59 LEU QD  . 159 . HD#  1 1 
       1255 1 1 2 1 33 TYR QD  . 133 . HD#  1 1 
       1255 1 2 2 1 62 ALA MB  . 162 . HB#  1 1 
       1256 1 1 2 1 33 TYR QE  . 133 . HE#  1 1 
       1256 1 2 2 1 34 TYR H   . 134 . HN   1 1 
       1257 1 1 2 1 33 TYR QE  . 133 . HE#  1 1 
       1257 1 2 2 1 37 VAL H   . 137 . HN   1 1 
       1258 1 1 2 1 33 TYR QE  . 133 . HE#  1 1 
       1258 1 2 2 1 37 VAL QG  . 137 . HG#  1 1 
       1259 1 1 2 1 33 TYR QE  . 133 . HE#  1 1 
       1259 1 2 2 1 38 VAL H   . 138 . HN   1 1 
       1260 1 1 2 1 33 TYR QE  . 133 . HE#  1 1 
       1260 1 2 2 1 59 LEU QD  . 159 . HD#  1 1 
       1261 1 1 2 1 33 TYR QE  . 133 . HE#  1 1 
       1261 1 2 2 1 59 LEU HG  . 159 . HG   1 1 
       1262 1 1 2 1 34 TYR H   . 134 . HN   1 1 
       1262 1 2 2 1 34 TYR QD  . 134 . HD#  1 1 
       1263 1 1 2 1 34 TYR H   . 134 . HN   1 1 
       1263 1 2 2 1 35 ARG H   . 135 . HN   1 1 
       1264 1 1 2 1 34 TYR H   . 134 . HN   1 1 
       1264 1 2 2 1 36 SER H   . 136 . HN   1 1 
       1265 1 1 2 1 34 TYR H   . 134 . HN   1 1 
       1265 1 2 2 1 38 VAL QG  . 138 . HG#  1 1 
       1266 1 1 2 1 34 TYR HA  . 134 . HA   1 1 
       1266 1 2 2 1 34 TYR QD  . 134 . HD#  1 1 
       1267 1 1 2 1 34 TYR HA  . 134 . HA   1 1 
       1267 1 2 2 1 34 TYR QE  . 134 . HE#  1 1 
       1268 1 1 2 1 34 TYR QB  . 134 . HB#  1 1 
       1268 1 2 2 1 38 VAL QG  . 138 . HG#  1 1 
       1269 1 1 2 1 34 TYR QD  . 134 . HD#  1 1 
       1269 1 2 2 1 38 VAL QG  . 138 . HG#  1 1 
       1270 1 1 2 1 34 TYR QD  . 134 . HD#  1 1 
       1270 1 2 2 1 59 LEU MD1 . 159 . HD1# 1 1 
       1271 1 1 2 1 34 TYR QD  . 134 . HD#  1 1 
       1271 1 2 2 1 59 LEU QD  . 159 . HD#  1 1 
       1272 1 1 2 1 34 TYR QD  . 134 . HD#  1 1 
       1272 1 2 2 1 59 LEU MD2 . 159 . HD2# 1 1 
       1273 1 1 2 1 34 TYR QD  . 134 . HD#  1 1 
       1273 1 2 2 1 63 TYR H   . 163 . HN   1 1 
       1274 1 1 2 1 34 TYR QD  . 134 . HD#  1 1 
       1274 1 2 2 1 63 TYR HA  . 163 . HA   1 1 
       1275 1 1 2 1 34 TYR QD  . 134 . HD#  1 1 
       1275 1 2 2 1 63 TYR QB  . 163 . HB#  1 1 
       1276 1 1 2 1 34 TYR QE  . 134 . HE#  1 1 
       1276 1 2 2 1 37 VAL QG  . 137 . HG#  1 1 
       1277 1 1 2 1 34 TYR QE  . 134 . HE#  1 1 
       1277 1 2 2 1 38 VAL H   . 138 . HN   1 1 
       1278 1 1 2 1 34 TYR QE  . 134 . HE#  1 1 
       1278 1 2 2 1 38 VAL QG  . 138 . HG#  1 1 
       1279 1 1 2 1 34 TYR QE  . 134 . HE#  1 1 
       1279 1 2 2 1 60 ASP H   . 160 . HN   1 1 
       1280 1 1 2 1 34 TYR QE  . 134 . HE#  1 1 
       1280 1 2 2 1 60 ASP QB  . 160 . HB#  1 1 
       1281 1 1 2 1 34 TYR QE  . 134 . HE#  1 1 
       1281 1 2 2 1 63 TYR H   . 163 . HN   1 1 
       1282 1 1 2 1 34 TYR QE  . 134 . HE#  1 1 
       1282 1 2 2 1 63 TYR QB  . 163 . HB#  1 1 
       1283 1 1 2 1 35 ARG H   . 135 . HN   1 1 
       1283 1 2 2 1 35 ARG QB  . 135 . HB#  1 1 
       1284 1 1 2 1 35 ARG H   . 135 . HN   1 1 
       1284 1 2 2 1 36 SER H   . 136 . HN   1 1 
       1285 1 1 2 1 36 SER H   . 136 . HN   1 1 
       1285 1 2 2 1 37 VAL H   . 137 . HN   1 1 
       1286 1 1 2 1 36 SER H   . 136 . HN   1 1 
       1286 1 2 2 1 37 VAL QG  . 137 . HG#  1 1 
       1287 1 1 2 1 36 SER H   . 136 . HN   1 1 
       1287 1 2 2 1 38 VAL H   . 138 . HN   1 1 
       1288 1 1 2 1 37 VAL H   . 137 . HN   1 1 
       1288 1 2 2 1 37 VAL HB  . 137 . HB   1 1 
       1289 1 1 2 1 37 VAL H   . 137 . HN   1 1 
       1289 1 2 2 1 37 VAL QG  . 137 . HG#  1 1 
       1290 1 1 2 1 37 VAL H   . 137 . HN   1 1 
       1290 1 2 2 1 38 VAL H   . 138 . HN   1 1 
       1291 1 1 2 1 37 VAL H   . 137 . HN   1 1 
       1291 1 2 2 1 38 VAL QG  . 138 . HG#  1 1 
       1292 1 1 2 1 37 VAL H   . 137 . HN   1 1 
       1292 1 2 2 1 59 LEU MD1 . 159 . HD1# 1 1 
       1293 1 1 2 1 37 VAL H   . 137 . HN   1 1 
       1293 1 2 2 1 59 LEU QD  . 159 . HD#  1 1 
       1294 1 1 2 1 37 VAL H   . 137 . HN   1 1 
       1294 1 2 2 1 59 LEU MD2 . 159 . HD2# 1 1 
       1295 1 1 2 1 37 VAL HA  . 137 . HA   1 1 
       1295 1 2 2 1 37 VAL MG1 . 137 . HG1# 1 1 
       1296 1 1 2 1 37 VAL HA  . 137 . HA   1 1 
       1296 1 2 2 1 37 VAL QG  . 137 . HG#  1 1 
       1297 1 1 2 1 37 VAL HA  . 137 . HA   1 1 
       1297 1 2 2 1 37 VAL MG2 . 137 . HG2# 1 1 
       1298 1 1 2 1 37 VAL HA  . 137 . HA   1 1 
       1298 1 2 2 1 40 THR HB  . 140 . HB   1 1 
       1299 1 1 2 1 37 VAL HA  . 137 . HA   1 1 
       1299 1 2 2 1 40 THR MG  . 140 . HG2# 1 1 
       1300 1 1 2 1 37 VAL HA  . 137 . HA   1 1 
       1300 1 2 2 1 41 LEU HG  . 141 . HG   1 1 
       1301 1 1 2 1 37 VAL HB  . 137 . HB   1 1 
       1301 1 2 2 1 38 VAL H   . 138 . HN   1 1 
       1302 1 1 2 1 37 VAL HB  . 137 . HB   1 1 
       1302 1 2 2 1 38 VAL QG  . 138 . HG#  1 1 
       1303 1 1 2 1 37 VAL HB  . 137 . HB   1 1 
       1303 1 2 2 1 59 LEU QD  . 159 . HD#  1 1 
       1304 1 1 2 1 37 VAL QG  . 137 . HG#  1 1 
       1304 1 2 2 1 38 VAL H   . 138 . HN   1 1 
       1305 1 1 2 1 37 VAL QG  . 137 . HG#  1 1 
       1305 1 2 2 1 38 VAL HA  . 138 . HA   1 1 
       1306 1 1 2 1 37 VAL QG  . 137 . HG#  1 1 
       1306 1 2 2 1 40 THR HB  . 140 . HB   1 1 
       1307 1 1 2 1 37 VAL QG  . 137 . HG#  1 1 
       1307 1 2 2 1 40 THR MG  . 140 . HG2# 1 1 
       1308 1 1 2 1 37 VAL QG  . 137 . HG#  1 1 
       1308 1 2 2 1 41 LEU H   . 141 . HN   1 1 
       1309 1 1 2 1 37 VAL QG  . 137 . HG#  1 1 
       1309 1 2 2 1 41 LEU QB  . 141 . HB#  1 1 
       1310 1 1 2 1 37 VAL QG  . 137 . HG#  1 1 
       1310 1 2 2 1 41 LEU QD  . 141 . HD#  1 1 
       1311 1 1 2 1 37 VAL QG  . 137 . HG#  1 1 
       1311 1 2 2 1 42 VAL H   . 142 . HN   1 1 
       1312 1 1 2 1 37 VAL QG  . 137 . HG#  1 1 
       1312 1 2 2 1 56 ILE HA  . 156 . HA   1 1 
       1313 1 1 2 1 37 VAL QG  . 137 . HG#  1 1 
       1313 1 2 2 1 59 LEU H   . 159 . HN   1 1 
       1314 1 1 2 1 37 VAL QG  . 137 . HG#  1 1 
       1314 1 2 2 1 59 LEU QD  . 159 . HD#  1 1 
       1315 1 1 2 1 37 VAL MG1 . 137 . HG1# 1 1 
       1315 1 2 2 1 38 VAL H   . 138 . HN   1 1 
       1316 1 1 2 1 37 VAL MG1 . 137 . HG1# 1 1 
       1316 1 2 2 1 40 THR HB  . 140 . HB   1 1 
       1317 1 1 2 1 37 VAL MG2 . 137 . HG2# 1 1 
       1317 1 2 2 1 38 VAL H   . 138 . HN   1 1 
       1318 1 1 2 1 37 VAL MG2 . 137 . HG2# 1 1 
       1318 1 2 2 1 40 THR HB  . 140 . HB   1 1 
       1319 1 1 2 1 38 VAL H   . 138 . HN   1 1 
       1319 1 2 2 1 38 VAL QG  . 138 . HG#  1 1 
       1320 1 1 2 1 38 VAL H   . 138 . HN   1 1 
       1320 1 2 2 1 39 SER H   . 139 . HN   1 1 
       1321 1 1 2 1 38 VAL H   . 138 . HN   1 1 
       1321 1 2 2 1 39 SER QB  . 139 . HB#  1 1 
       1322 1 1 2 1 38 VAL H   . 138 . HN   1 1 
       1322 1 2 2 1 40 THR H   . 140 . HN   1 1 
       1323 1 1 2 1 38 VAL H   . 138 . HN   1 1 
       1323 1 2 2 1 40 THR HB  . 140 . HB   1 1 
       1324 1 1 2 1 38 VAL H   . 138 . HN   1 1 
       1324 1 2 2 1 41 LEU H   . 141 . HN   1 1 
       1325 1 1 2 1 38 VAL H   . 138 . HN   1 1 
       1325 1 2 2 1 41 LEU QD  . 141 . HD#  1 1 
       1326 1 1 2 1 38 VAL HA  . 138 . HA   1 1 
       1326 1 2 2 1 41 LEU H   . 141 . HN   1 1 
       1327 1 1 2 1 38 VAL HA  . 138 . HA   1 1 
       1327 1 2 2 1 41 LEU QD  . 141 . HD#  1 1 
       1328 1 1 2 1 38 VAL HA  . 138 . HA   1 1 
       1328 1 2 2 1 41 LEU HG  . 141 . HG   1 1 
       1329 1 1 2 1 38 VAL HA  . 138 . HA   1 1 
       1329 1 2 2 1 42 VAL QG  . 142 . HG#  1 1 
       1330 1 1 2 1 38 VAL HA  . 138 . HA   1 1 
       1330 1 2 2 1 56 ILE MG  . 156 . HG2# 1 1 
       1331 1 1 2 1 38 VAL QG  . 138 . HG#  1 1 
       1331 1 2 2 1 39 SER H   . 139 . HN   1 1 
       1332 1 1 2 1 38 VAL QG  . 138 . HG#  1 1 
       1332 1 2 2 1 59 LEU HB2 . 159 . HB2  1 1 
       1333 1 1 2 1 38 VAL QG  . 138 . HG#  1 1 
       1333 1 2 2 1 59 LEU QD  . 159 . HD#  1 1 
       1334 1 1 2 1 39 SER H   . 139 . HN   1 1 
       1334 1 2 2 1 39 SER QB  . 139 . HB#  1 1 
       1335 1 1 2 1 39 SER H   . 139 . HN   1 1 
       1335 1 2 2 1 40 THR H   . 140 . HN   1 1 
       1336 1 1 2 1 39 SER H   . 139 . HN   1 1 
       1336 1 2 2 1 40 THR HB  . 140 . HB   1 1 
       1337 1 1 2 1 39 SER H   . 139 . HN   1 1 
       1337 1 2 2 1 41 LEU H   . 141 . HN   1 1 
       1338 1 1 2 1 39 SER H   . 139 . HN   1 1 
       1338 1 2 2 1 42 VAL HB  . 142 . HB   1 1 
       1339 1 1 2 1 39 SER H   . 139 . HN   1 1 
       1339 1 2 2 1 42 VAL QG  . 142 . HG#  1 1 
       1340 1 1 2 1 39 SER HA  . 139 . HA   1 1 
       1340 1 2 2 1 42 VAL QG  . 142 . HG#  1 1 
       1341 1 1 2 1 39 SER QB  . 139 . HB#  1 1 
       1341 1 2 2 1 40 THR H   . 140 . HN   1 1 
       1342 1 1 2 1 39 SER QB  . 139 . HB#  1 1 
       1342 1 2 2 1 40 THR MG  . 140 . HG2# 1 1 
       1343 1 1 2 1 39 SER QB  . 139 . HB#  1 1 
       1343 1 2 2 1 41 LEU H   . 141 . HN   1 1 
       1344 1 1 2 1 39 SER QB  . 139 . HB#  1 1 
       1344 1 2 2 1 42 VAL H   . 142 . HN   1 1 
       1345 1 1 2 1 40 THR H   . 140 . HN   1 1 
       1345 1 2 2 1 40 THR MG  . 140 . HG2# 1 1 
       1346 1 1 2 1 40 THR H   . 140 . HN   1 1 
       1346 1 2 2 1 41 LEU H   . 141 . HN   1 1 
       1347 1 1 2 1 40 THR H   . 140 . HN   1 1 
       1347 1 2 2 1 41 LEU QB  . 141 . HB#  1 1 
       1348 1 1 2 1 40 THR H   . 140 . HN   1 1 
       1348 1 2 2 1 41 LEU QD  . 141 . HD#  1 1 
       1349 1 1 2 1 40 THR H   . 140 . HN   1 1 
       1349 1 2 2 1 42 VAL H   . 142 . HN   1 1 
       1350 1 1 2 1 40 THR H   . 140 . HN   1 1 
       1350 1 2 2 1 42 VAL QG  . 142 . HG#  1 1 
       1351 1 1 2 1 40 THR H   . 140 . HN   1 1 
       1351 1 2 2 1 43 GLN QB  . 143 . HB#  1 1 
       1352 1 1 2 1 40 THR HA  . 140 . HA   1 1 
       1352 1 2 2 1 40 THR MG  . 140 . HG2# 1 1 
       1353 1 1 2 1 40 THR HB  . 140 . HB   1 1 
       1353 1 2 2 1 41 LEU H   . 141 . HN   1 1 
       1354 1 1 2 1 40 THR HB  . 140 . HB   1 1 
       1354 1 2 2 1 41 LEU QD  . 141 . HD#  1 1 
       1355 1 1 2 1 40 THR MG  . 140 . HG2# 1 1 
       1355 1 2 2 1 41 LEU H   . 141 . HN   1 1 
       1356 1 1 2 1 40 THR MG  . 140 . HG2# 1 1 
       1356 1 2 2 1 41 LEU QB  . 141 . HB#  1 1 
       1357 1 1 2 1 40 THR MG  . 140 . HG2# 1 1 
       1357 1 2 2 1 41 LEU QD  . 141 . HD#  1 1 
       1358 1 1 2 1 40 THR MG  . 140 . HG2# 1 1 
       1358 1 2 2 1 42 VAL H   . 142 . HN   1 1 
       1359 1 1 2 1 40 THR MG  . 140 . HG2# 1 1 
       1359 1 2 2 1 43 GLN H   . 143 . HN   1 1 
       1360 1 1 2 1 40 THR MG  . 140 . HG2# 1 1 
       1360 1 2 2 1 43 GLN QB  . 143 . HB#  1 1 
       1361 1 1 2 1 40 THR MG  . 140 . HG2# 1 1 
       1361 1 2 2 1 43 GLN QG  . 143 . HG#  1 1 
       1362 1 1 2 1 40 THR MG  . 140 . HG2# 1 1 
       1362 1 2 2 1 44 ASP H   . 144 . HN   1 1 
       1363 1 1 2 1 41 LEU H   . 141 . HN   1 1 
       1363 1 2 2 1 41 LEU QB  . 141 . HB#  1 1 
       1364 1 1 2 1 41 LEU H   . 141 . HN   1 1 
       1364 1 2 2 1 41 LEU QD  . 141 . HD#  1 1 
       1365 1 1 2 1 41 LEU H   . 141 . HN   1 1 
       1365 1 2 2 1 42 VAL H   . 142 . HN   1 1 
       1366 1 1 2 1 41 LEU H   . 141 . HN   1 1 
       1366 1 2 2 1 43 GLN H   . 143 . HN   1 1 
       1367 1 1 2 1 41 LEU HA  . 141 . HA   1 1 
       1367 1 2 2 1 41 LEU QD  . 141 . HD#  1 1 
       1368 1 1 2 1 41 LEU HA  . 141 . HA   1 1 
       1368 1 2 2 1 43 GLN H   . 143 . HN   1 1 
       1369 1 1 2 1 41 LEU HA  . 141 . HA   1 1 
       1369 1 2 2 1 44 ASP H   . 144 . HN   1 1 
       1370 1 1 2 1 41 LEU QD  . 141 . HD#  1 1 
       1370 1 2 2 1 42 VAL H   . 142 . HN   1 1 
       1371 1 1 2 1 41 LEU QD  . 141 . HD#  1 1 
       1371 1 2 2 1 52 VAL HA  . 152 . HA   1 1 
       1372 1 1 2 1 41 LEU QD  . 141 . HD#  1 1 
       1372 1 2 2 1 55 ARG H   . 155 . HN   1 1 
       1373 1 1 2 1 41 LEU QD  . 141 . HD#  1 1 
       1373 1 2 2 1 55 ARG HA  . 155 . HA   1 1 
       1374 1 1 2 1 41 LEU QD  . 141 . HD#  1 1 
       1374 1 2 2 1 56 ILE H   . 156 . HN   1 1 
       1375 1 1 2 1 41 LEU HG  . 141 . HG   1 1 
       1375 1 2 2 1 59 LEU QD  . 159 . HD#  1 1 
       1376 1 1 2 1 42 VAL H   . 142 . HN   1 1 
       1376 1 2 2 1 42 VAL MG1 . 142 . HG1# 1 1 
       1377 1 1 2 1 42 VAL H   . 142 . HN   1 1 
       1377 1 2 2 1 42 VAL QG  . 142 . HG#  1 1 
       1378 1 1 2 1 42 VAL H   . 142 . HN   1 1 
       1378 1 2 2 1 42 VAL MG2 . 142 . HG2# 1 1 
       1379 1 1 2 1 42 VAL H   . 142 . HN   1 1 
       1379 1 2 2 1 43 GLN H   . 143 . HN   1 1 
       1380 1 1 2 1 42 VAL H   . 142 . HN   1 1 
       1380 1 2 2 1 44 ASP H   . 144 . HN   1 1 
       1381 1 1 2 1 42 VAL H   . 142 . HN   1 1 
       1381 1 2 2 1 44 ASP QB  . 144 . HB#  1 1 
       1382 1 1 2 1 42 VAL HA  . 142 . HA   1 1 
       1382 1 2 2 1 42 VAL QG  . 142 . HG#  1 1 
       1383 1 1 2 1 42 VAL HA  . 142 . HA   1 1 
       1383 1 2 2 1 52 VAL QG  . 152 . HG#  1 1 
       1384 1 1 2 1 42 VAL HB  . 142 . HB   1 1 
       1384 1 2 2 1 43 GLN H   . 143 . HN   1 1 
       1385 1 1 2 1 42 VAL HB  . 142 . HB   1 1 
       1385 1 2 2 1 44 ASP H   . 144 . HN   1 1 
       1386 1 1 2 1 42 VAL HB  . 142 . HB   1 1 
       1386 1 2 2 1 52 VAL QG  . 152 . HG#  1 1 
       1387 1 1 2 1 42 VAL HB  . 142 . HB   1 1 
       1387 1 2 2 1 56 ILE MD  . 156 . HD1# 1 1 
       1388 1 1 2 1 42 VAL QG  . 142 . HG#  1 1 
       1388 1 2 2 1 43 GLN H   . 143 . HN   1 1 
       1389 1 1 2 1 42 VAL QG  . 142 . HG#  1 1 
       1389 1 2 2 1 43 GLN QB  . 143 . HB#  1 1 
       1390 1 1 2 1 42 VAL QG  . 142 . HG#  1 1 
       1390 1 2 2 1 43 GLN QG  . 143 . HG#  1 1 
       1391 1 1 2 1 42 VAL QG  . 142 . HG#  1 1 
       1391 1 2 2 1 44 ASP H   . 144 . HN   1 1 
       1392 1 1 2 1 42 VAL QG  . 142 . HG#  1 1 
       1392 1 2 2 1 44 ASP QB  . 144 . HB#  1 1 
       1393 1 1 2 1 42 VAL QG  . 142 . HG#  1 1 
       1393 1 2 2 1 52 VAL H   . 152 . HN   1 1 
       1394 1 1 2 1 42 VAL QG  . 142 . HG#  1 1 
       1394 1 2 2 1 56 ILE QG  . 156 . HG1# 1 1 
       1395 1 1 2 1 42 VAL MG1 . 142 . HG1# 1 1 
       1395 1 2 2 1 43 GLN H   . 143 . HN   1 1 
       1396 1 1 2 1 42 VAL MG2 . 142 . HG2# 1 1 
       1396 1 2 2 1 43 GLN H   . 143 . HN   1 1 
       1397 1 1 2 1 43 GLN H   . 143 . HN   1 1 
       1397 1 2 2 1 44 ASP H   . 144 . HN   1 1 
       1398 1 1 2 1 43 GLN H   . 143 . HN   1 1 
       1398 1 2 2 1 44 ASP QB  . 144 . HB#  1 1 
       1399 1 1 2 1 43 GLN HA  . 143 . HA   1 1 
       1399 1 2 2 1 43 GLN QB  . 143 . HB#  1 1 
       1400 1 1 2 1 43 GLN HA  . 143 . HA   1 1 
       1400 1 2 2 1 43 GLN QG  . 143 . HG#  1 1 
       1401 1 1 2 1 44 ASP H   . 144 . HN   1 1 
       1401 1 2 2 1 44 ASP QB  . 144 . HB#  1 1 
       1402 1 1 2 1 44 ASP H   . 144 . HN   1 1 
       1402 1 2 2 1 45 GLN H   . 145 . HN   1 1 
       1403 1 1 2 1 44 ASP QB  . 144 . HB#  1 1 
       1403 1 2 2 1 46 LEU H   . 146 . HN   1 1 
       1404 1 1 2 1 45 GLN H   . 145 . HN   1 1 
       1404 1 2 2 1 45 GLN QG  . 145 . HG#  1 1 
       1405 1 1 2 1 45 GLN H   . 145 . HN   1 1 
       1405 1 2 2 1 46 LEU QB  . 146 . HB#  1 1 
       1406 1 1 2 1 45 GLN H   . 145 . HN   1 1 
       1406 1 2 2 1 46 LEU HG  . 146 . HG   1 1 
       1407 1 1 2 1 45 GLN HA  . 145 . HA   1 1 
       1407 1 2 2 1 45 GLN QG  . 145 . HG#  1 1 
       1408 1 1 2 1 45 GLN QG  . 145 . HG#  1 1 
       1408 1 2 2 1 46 LEU H   . 146 . HN   1 1 
       1409 1 1 2 1 45 GLN QG  . 145 . HG#  1 1 
       1409 1 2 2 1 46 LEU HA  . 146 . HA   1 1 
       1410 1 1 2 1 45 GLN QG  . 145 . HG#  1 1 
       1410 1 2 2 1 46 LEU QB  . 146 . HB#  1 1 
       1411 1 1 2 1 45 GLN QG  . 145 . HG#  1 1 
       1411 1 2 2 1 46 LEU HG  . 146 . HG   1 1 
       1412 1 1 2 1 45 GLN QG  . 145 . HG#  1 1 
       1412 1 2 2 1 47 THR H   . 147 . HN   1 1 
       1413 1 1 2 1 45 GLN QG  . 145 . HG#  1 1 
       1413 1 2 2 1 48 LYS H   . 148 . HN   1 1 
       1414 1 1 2 1 45 GLN QG  . 145 . HG#  1 1 
       1414 1 2 2 1 51 VAL QG  . 151 . HG#  1 1 
       1415 1 1 2 1 45 GLN QG  . 145 . HG#  1 1 
       1415 1 2 2 1 52 VAL H   . 152 . HN   1 1 
       1416 1 1 2 1 46 LEU H   . 146 . HN   1 1 
       1416 1 2 2 1 46 LEU HA  . 146 . HA   1 1 
       1417 1 1 2 1 46 LEU H   . 146 . HN   1 1 
       1417 1 2 2 1 46 LEU QB  . 146 . HB#  1 1 
       1418 1 1 2 1 46 LEU H   . 146 . HN   1 1 
       1418 1 2 2 1 46 LEU MD1 . 146 . HD1# 1 1 
       1419 1 1 2 1 46 LEU H   . 146 . HN   1 1 
       1419 1 2 2 1 46 LEU MD2 . 146 . HD2# 1 1 
       1420 1 1 2 1 46 LEU H   . 146 . HN   1 1 
       1420 1 2 2 1 46 LEU HG  . 146 . HG   1 1 
       1421 1 1 2 1 46 LEU H   . 146 . HN   1 1 
       1421 1 2 2 1 47 THR H   . 147 . HN   1 1 
       1422 1 1 2 1 46 LEU H   . 146 . HN   1 1 
       1422 1 2 2 1 47 THR HA  . 147 . HA   1 1 
       1423 1 1 2 1 46 LEU H   . 146 . HN   1 1 
       1423 1 2 2 1 47 THR HB  . 147 . HB   1 1 
       1424 1 1 2 1 46 LEU H   . 146 . HN   1 1 
       1424 1 2 2 1 47 THR MG  . 147 . HG2# 1 1 
       1425 1 1 2 1 46 LEU HA  . 146 . HA   1 1 
       1425 1 2 2 1 46 LEU QD  . 146 . HD#  1 1 
       1426 1 1 2 1 46 LEU HA  . 146 . HA   1 1 
       1426 1 2 2 1 47 THR H   . 147 . HN   1 1 
       1427 1 1 2 1 46 LEU HA  . 146 . HA   1 1 
       1427 1 2 2 1 48 LYS H   . 148 . HN   1 1 
       1428 1 1 2 1 46 LEU HA  . 146 . HA   1 1 
       1428 1 2 2 1 52 VAL H   . 152 . HN   1 1 
       1429 1 1 2 1 46 LEU QB  . 146 . HB#  1 1 
       1429 1 2 2 1 46 LEU QD  . 146 . HD#  1 1 
       1430 1 1 2 1 46 LEU QB  . 146 . HB#  1 1 
       1430 1 2 2 1 47 THR HA  . 147 . HA   1 1 
       1431 1 1 2 1 46 LEU HB2 . 146 . HB2  1 1 
       1431 1 2 2 1 46 LEU MD1 . 146 . HD1# 1 1 
       1432 1 1 2 1 46 LEU HB2 . 146 . HB2  1 1 
       1432 1 2 2 1 46 LEU MD2 . 146 . HD2# 1 1 
       1433 1 1 2 1 46 LEU HB3 . 146 . HB1  1 1 
       1433 1 2 2 1 46 LEU MD1 . 146 . HD1# 1 1 
       1434 1 1 2 1 46 LEU HB3 . 146 . HB1  1 1 
       1434 1 2 2 1 46 LEU MD2 . 146 . HD2# 1 1 
       1435 1 1 2 1 46 LEU QD  . 146 . HD#  1 1 
       1435 1 2 2 1 48 LYS H   . 148 . HN   1 1 
       1436 1 1 2 1 46 LEU HG  . 146 . HG   1 1 
       1436 1 2 2 1 48 LYS H   . 148 . HN   1 1 
       1437 1 1 2 1 47 THR H   . 147 . HN   1 1 
       1437 1 2 2 1 47 THR HB  . 147 . HB   1 1 
       1438 1 1 2 1 47 THR H   . 147 . HN   1 1 
       1438 1 2 2 1 47 THR MG  . 147 . HG2# 1 1 
       1439 1 1 2 1 47 THR H   . 147 . HN   1 1 
       1439 1 2 2 1 48 LYS H   . 148 . HN   1 1 
       1440 1 1 2 1 47 THR H   . 147 . HN   1 1 
       1440 1 2 2 1 51 VAL MG1 . 151 . HG1# 1 1 
       1441 1 1 2 1 47 THR H   . 147 . HN   1 1 
       1441 1 2 2 1 51 VAL QG  . 151 . HG#  1 1 
       1442 1 1 2 1 47 THR H   . 147 . HN   1 1 
       1442 1 2 2 1 51 VAL MG2 . 151 . HG2# 1 1 
       1443 1 1 2 1 47 THR HA  . 147 . HA   1 1 
       1443 1 2 2 1 47 THR MG  . 147 . HG2# 1 1 
       1444 1 1 2 1 47 THR HA  . 147 . HA   1 1 
       1444 1 2 2 1 48 LYS H   . 148 . HN   1 1 
       1445 1 1 2 1 47 THR HA  . 147 . HA   1 1 
       1445 1 2 2 1 48 LYS QB  . 148 . HB#  1 1 
       1446 1 1 2 1 47 THR HA  . 147 . HA   1 1 
       1446 1 2 2 1 51 VAL QG  . 151 . HG#  1 1 
       1447 1 1 2 1 47 THR HB  . 147 . HB   1 1 
       1447 1 2 2 1 48 LYS H   . 148 . HN   1 1 
       1448 1 1 2 1 47 THR HB  . 147 . HB   1 1 
       1448 1 2 2 1 51 VAL QG  . 151 . HG#  1 1 
       1449 1 1 2 1 47 THR HB  . 147 . HB   1 1 
       1449 1 2 2 1 52 VAL QG  . 152 . HG#  1 1 
       1450 1 1 2 1 47 THR MG  . 147 . HG2# 1 1 
       1450 1 2 2 1 48 LYS H   . 148 . HN   1 1 
       1451 1 1 2 1 47 THR MG  . 147 . HG2# 1 1 
       1451 1 2 2 1 48 LYS QB  . 148 . HB#  1 1 
       1452 1 1 2 1 47 THR MG  . 147 . HG2# 1 1 
       1452 1 2 2 1 50 ALA H   . 150 . HN   1 1 
       1453 1 1 2 1 47 THR MG  . 147 . HG2# 1 1 
       1453 1 2 2 1 51 VAL H   . 151 . HN   1 1 
       1454 1 1 2 1 47 THR MG  . 147 . HG2# 1 1 
       1454 1 2 2 1 51 VAL MG1 . 151 . HG1# 1 1 
       1455 1 1 2 1 47 THR MG  . 147 . HG2# 1 1 
       1455 1 2 2 1 51 VAL QG  . 151 . HG#  1 1 
       1456 1 1 2 1 47 THR MG  . 147 . HG2# 1 1 
       1456 1 2 2 1 51 VAL MG2 . 151 . HG2# 1 1 
       1457 1 1 2 1 47 THR MG  . 147 . HG2# 1 1 
       1457 1 2 2 1 52 VAL H   . 152 . HN   1 1 
       1458 1 1 2 1 48 LYS H   . 148 . HN   1 1 
       1458 1 2 2 1 48 LYS QB  . 148 . HB#  1 1 
       1459 1 1 2 1 48 LYS H   . 148 . HN   1 1 
       1459 1 2 2 1 48 LYS QG  . 148 . HG#  1 1 
       1460 1 1 2 1 48 LYS H   . 148 . HN   1 1 
       1460 1 2 2 1 49 ASN H   . 149 . HN   1 1 
       1461 1 1 2 1 48 LYS H   . 148 . HN   1 1 
       1461 1 2 2 1 51 VAL H   . 151 . HN   1 1 
       1462 1 1 2 1 48 LYS H   . 148 . HN   1 1 
       1462 1 2 2 1 51 VAL HB  . 151 . HB   1 1 
       1463 1 1 2 1 48 LYS H   . 148 . HN   1 1 
       1463 1 2 2 1 51 VAL MG1 . 151 . HG1# 1 1 
       1464 1 1 2 1 48 LYS H   . 148 . HN   1 1 
       1464 1 2 2 1 51 VAL QG  . 151 . HG#  1 1 
       1465 1 1 2 1 48 LYS H   . 148 . HN   1 1 
       1465 1 2 2 1 51 VAL MG2 . 151 . HG2# 1 1 
       1466 1 1 2 1 48 LYS H   . 148 . HN   1 1 
       1466 1 2 2 1 52 VAL QG  . 152 . HG#  1 1 
       1467 1 1 2 1 48 LYS HA  . 148 . HA   1 1 
       1467 1 2 2 1 49 ASN H   . 149 . HN   1 1 
       1468 1 1 2 1 48 LYS HA  . 148 . HA   1 1 
       1468 1 2 2 1 51 VAL H   . 151 . HN   1 1 
       1469 1 1 2 1 48 LYS QB  . 148 . HB#  1 1 
       1469 1 2 2 1 49 ASN H   . 149 . HN   1 1 
       1470 1 1 2 1 48 LYS QB  . 148 . HB#  1 1 
       1470 1 2 2 1 50 ALA H   . 150 . HN   1 1 
       1471 1 1 2 1 48 LYS QB  . 148 . HB#  1 1 
       1471 1 2 2 1 50 ALA MB  . 150 . HB#  1 1 
       1472 1 1 2 1 48 LYS QB  . 148 . HB#  1 1 
       1472 1 2 2 1 51 VAL QG  . 151 . HG#  1 1 
       1473 1 1 2 1 48 LYS QE  . 148 . HE#  1 1 
       1473 1 2 2 1 48 LYS QG  . 148 . HG#  1 1 
       1474 1 1 2 1 48 LYS QE  . 148 . HE#  1 1 
       1474 1 2 2 1 49 ASN H   . 149 . HN   1 1 
       1475 1 1 2 1 48 LYS QE  . 148 . HE#  1 1 
       1475 1 2 2 1 49 ASN HA  . 149 . HA   1 1 
       1476 1 1 2 1 48 LYS QE  . 148 . HE#  1 1 
       1476 1 2 2 1 50 ALA H   . 150 . HN   1 1 
       1477 1 1 2 1 48 LYS QE  . 148 . HE#  1 1 
       1477 1 2 2 1 50 ALA MB  . 150 . HB#  1 1 
       1478 1 1 2 1 48 LYS HE2 . 148 . HE2  1 1 
       1478 1 2 2 1 50 ALA MB  . 150 . HB#  1 1 
       1479 1 1 2 1 48 LYS HE3 . 148 . HE1  1 1 
       1479 1 2 2 1 50 ALA MB  . 150 . HB#  1 1 
       1480 1 1 2 1 48 LYS QG  . 148 . HG#  1 1 
       1480 1 2 2 1 49 ASN H   . 149 . HN   1 1 
       1481 1 1 2 1 48 LYS QG  . 148 . HG#  1 1 
       1481 1 2 2 1 50 ALA H   . 150 . HN   1 1 
       1482 1 1 2 1 48 LYS QG  . 148 . HG#  1 1 
       1482 1 2 2 1 50 ALA HA  . 150 . HA   1 1 
       1483 1 1 2 1 48 LYS QG  . 148 . HG#  1 1 
       1483 1 2 2 1 51 VAL H   . 151 . HN   1 1 
       1484 1 1 2 1 48 LYS QG  . 148 . HG#  1 1 
       1484 1 2 2 1 51 VAL QG  . 151 . HG#  1 1 
       1485 1 1 2 1 48 LYS QG  . 148 . HG#  1 1 
       1485 1 2 2 1 52 VAL H   . 152 . HN   1 1 
       1486 1 1 2 1 49 ASN H   . 149 . HN   1 1 
       1486 1 2 2 1 49 ASN HB2 . 149 . HB2  1 1 
       1487 1 1 2 1 49 ASN H   . 149 . HN   1 1 
       1487 1 2 2 1 49 ASN QB  . 149 . HB#  1 1 
       1488 1 1 2 1 49 ASN H   . 149 . HN   1 1 
       1488 1 2 2 1 49 ASN HB3 . 149 . HB1  1 1 
       1489 1 1 2 1 49 ASN H   . 149 . HN   1 1 
       1489 1 2 2 1 50 ALA H   . 150 . HN   1 1 
       1490 1 1 2 1 49 ASN H   . 149 . HN   1 1 
       1490 1 2 2 1 50 ALA HA  . 150 . HA   1 1 
       1491 1 1 2 1 49 ASN HA  . 149 . HA   1 1 
       1491 1 2 2 1 50 ALA MB  . 150 . HB#  1 1 
       1492 1 1 2 1 49 ASN HA  . 149 . HA   1 1 
       1492 1 2 2 1 52 VAL H   . 152 . HN   1 1 
       1493 1 1 2 1 49 ASN HA  . 149 . HA   1 1 
       1493 1 2 2 1 52 VAL QG  . 152 . HG#  1 1 
       1494 1 1 2 1 49 ASN HA  . 149 . HA   1 1 
       1494 1 2 2 1 53 LEU H   . 153 . HN   1 1 
       1495 1 1 2 1 49 ASN HA  . 149 . HA   1 1 
       1495 1 2 2 1 53 LEU QB  . 153 . HB#  1 1 
       1496 1 1 2 1 49 ASN QB  . 149 . HB#  1 1 
       1496 1 2 2 1 50 ALA H   . 150 . HN   1 1 
       1497 1 1 2 1 49 ASN QB  . 149 . HB#  1 1 
       1497 1 2 2 1 50 ALA MB  . 150 . HB#  1 1 
       1498 1 1 2 1 49 ASN QB  . 149 . HB#  1 1 
       1498 1 2 2 1 51 VAL H   . 151 . HN   1 1 
       1499 1 1 2 1 49 ASN QB  . 149 . HB#  1 1 
       1499 1 2 2 1 52 VAL QG  . 152 . HG#  1 1 
       1500 1 1 2 1 49 ASN QB  . 149 . HB#  1 1 
       1500 1 2 2 1 53 LEU H   . 153 . HN   1 1 
       1501 1 1 2 1 49 ASN QB  . 149 . HB#  1 1 
       1501 1 2 2 1 53 LEU QD  . 153 . HD#  1 1 
       1502 1 1 2 1 50 ALA H   . 150 . HN   1 1 
       1502 1 2 2 1 50 ALA MB  . 150 . HB#  1 1 
       1503 1 1 2 1 50 ALA H   . 150 . HN   1 1 
       1503 1 2 2 1 51 VAL H   . 151 . HN   1 1 
       1504 1 1 2 1 50 ALA H   . 150 . HN   1 1 
       1504 1 2 2 1 51 VAL HA  . 151 . HA   1 1 
       1505 1 1 2 1 50 ALA H   . 150 . HN   1 1 
       1505 1 2 2 1 51 VAL QG  . 151 . HG#  1 1 
       1506 1 1 2 1 50 ALA H   . 150 . HN   1 1 
       1506 1 2 2 1 52 VAL H   . 152 . HN   1 1 
       1507 1 1 2 1 50 ALA H   . 150 . HN   1 1 
       1507 1 2 2 1 52 VAL QG  . 152 . HG#  1 1 
       1508 1 1 2 1 50 ALA MB  . 150 . HB#  1 1 
       1508 1 2 2 1 51 VAL H   . 151 . HN   1 1 
       1509 1 1 2 1 50 ALA MB  . 150 . HB#  1 1 
       1509 1 2 2 1 51 VAL HB  . 151 . HB   1 1 
       1510 1 1 2 1 50 ALA MB  . 150 . HB#  1 1 
       1510 1 2 2 1 51 VAL QG  . 151 . HG#  1 1 
       1511 1 1 2 1 50 ALA MB  . 150 . HB#  1 1 
       1511 1 2 2 1 53 LEU H   . 153 . HN   1 1 
       1512 1 1 2 1 51 VAL H   . 151 . HN   1 1 
       1512 1 2 2 1 51 VAL MG1 . 151 . HG1# 1 1 
       1513 1 1 2 1 51 VAL H   . 151 . HN   1 1 
       1513 1 2 2 1 51 VAL QG  . 151 . HG#  1 1 
       1514 1 1 2 1 51 VAL H   . 151 . HN   1 1 
       1514 1 2 2 1 51 VAL MG2 . 151 . HG2# 1 1 
       1515 1 1 2 1 51 VAL H   . 151 . HN   1 1 
       1515 1 2 2 1 52 VAL H   . 152 . HN   1 1 
       1516 1 1 2 1 51 VAL H   . 151 . HN   1 1 
       1516 1 2 2 1 52 VAL QG  . 152 . HG#  1 1 
       1517 1 1 2 1 51 VAL H   . 151 . HN   1 1 
       1517 1 2 2 1 53 LEU H   . 153 . HN   1 1 
       1518 1 1 2 1 51 VAL H   . 151 . HN   1 1 
       1518 1 2 2 1 54 LYS H   . 154 . HN   1 1 
       1519 1 1 2 1 51 VAL HA  . 151 . HA   1 1 
       1519 1 2 2 1 51 VAL MG1 . 151 . HG1# 1 1 
       1520 1 1 2 1 51 VAL HA  . 151 . HA   1 1 
       1520 1 2 2 1 51 VAL QG  . 151 . HG#  1 1 
       1521 1 1 2 1 51 VAL HA  . 151 . HA   1 1 
       1521 1 2 2 1 51 VAL MG2 . 151 . HG2# 1 1 
       1522 1 1 2 1 51 VAL HA  . 151 . HA   1 1 
       1522 1 2 2 1 54 LYS H   . 154 . HN   1 1 
       1523 1 1 2 1 51 VAL HA  . 151 . HA   1 1 
       1523 1 2 2 1 54 LYS QB  . 154 . HB#  1 1 
       1524 1 1 2 1 51 VAL HB  . 151 . HB   1 1 
       1524 1 2 2 1 52 VAL QG  . 152 . HG#  1 1 
       1525 1 1 2 1 51 VAL QG  . 151 . HG#  1 1 
       1525 1 2 2 1 52 VAL H   . 152 . HN   1 1 
       1526 1 1 2 1 51 VAL QG  . 151 . HG#  1 1 
       1526 1 2 2 1 52 VAL HA  . 152 . HA   1 1 
       1527 1 1 2 1 51 VAL QG  . 151 . HG#  1 1 
       1527 1 2 2 1 54 LYS H   . 154 . HN   1 1 
       1528 1 1 2 1 51 VAL QG  . 151 . HG#  1 1 
       1528 1 2 2 1 54 LYS QE  . 154 . HE#  1 1 
       1529 1 1 2 1 51 VAL QG  . 151 . HG#  1 1 
       1529 1 2 2 1 54 LYS QG  . 154 . HG#  1 1 
       1530 1 1 2 1 52 VAL H   . 152 . HN   1 1 
       1530 1 2 2 1 52 VAL HB  . 152 . HB   1 1 
       1531 1 1 2 1 52 VAL H   . 152 . HN   1 1 
       1531 1 2 2 1 52 VAL QG  . 152 . HG#  1 1 
       1532 1 1 2 1 52 VAL H   . 152 . HN   1 1 
       1532 1 2 2 1 53 LEU H   . 153 . HN   1 1 
       1533 1 1 2 1 52 VAL H   . 152 . HN   1 1 
       1533 1 2 2 1 53 LEU HA  . 153 . HA   1 1 
       1534 1 1 2 1 52 VAL H   . 152 . HN   1 1 
       1534 1 2 2 1 53 LEU QB  . 153 . HB#  1 1 
       1535 1 1 2 1 52 VAL H   . 152 . HN   1 1 
       1535 1 2 2 1 54 LYS H   . 154 . HN   1 1 
       1536 1 1 2 1 52 VAL H   . 152 . HN   1 1 
       1536 1 2 2 1 54 LYS QD  . 154 . HD#  1 1 
       1537 1 1 2 1 52 VAL HA  . 152 . HA   1 1 
       1537 1 2 2 1 52 VAL MG1 . 152 . HG1# 1 1 
       1538 1 1 2 1 52 VAL HA  . 152 . HA   1 1 
       1538 1 2 2 1 52 VAL QG  . 152 . HG#  1 1 
       1539 1 1 2 1 52 VAL HA  . 152 . HA   1 1 
       1539 1 2 2 1 52 VAL MG2 . 152 . HG2# 1 1 
       1540 1 1 2 1 52 VAL HA  . 152 . HA   1 1 
       1540 1 2 2 1 55 ARG H   . 155 . HN   1 1 
       1541 1 1 2 1 52 VAL HA  . 152 . HA   1 1 
       1541 1 2 2 1 56 ILE H   . 156 . HN   1 1 
       1542 1 1 2 1 52 VAL HB  . 152 . HB   1 1 
       1542 1 2 2 1 53 LEU H   . 153 . HN   1 1 
       1543 1 1 2 1 52 VAL QG  . 152 . HG#  1 1 
       1543 1 2 2 1 53 LEU H   . 153 . HN   1 1 
       1544 1 1 2 1 52 VAL QG  . 152 . HG#  1 1 
       1544 1 2 2 1 53 LEU HA  . 153 . HA   1 1 
       1545 1 1 2 1 52 VAL QG  . 152 . HG#  1 1 
       1545 1 2 2 1 53 LEU QB  . 153 . HB#  1 1 
       1546 1 1 2 1 52 VAL QG  . 152 . HG#  1 1 
       1546 1 2 2 1 54 LYS H   . 154 . HN   1 1 
       1547 1 1 2 1 52 VAL QG  . 152 . HG#  1 1 
       1547 1 2 2 1 54 LYS QD  . 154 . HD#  1 1 
       1548 1 1 2 1 52 VAL QG  . 152 . HG#  1 1 
       1548 1 2 2 1 55 ARG H   . 155 . HN   1 1 
       1549 1 1 2 1 52 VAL QG  . 152 . HG#  1 1 
       1549 1 2 2 1 56 ILE HB  . 156 . HB   1 1 
       1550 1 1 2 1 53 LEU H   . 153 . HN   1 1 
       1550 1 2 2 1 53 LEU QB  . 153 . HB#  1 1 
       1551 1 1 2 1 53 LEU H   . 153 . HN   1 1 
       1551 1 2 2 1 53 LEU MD1 . 153 . HD1# 1 1 
       1552 1 1 2 1 53 LEU H   . 153 . HN   1 1 
       1552 1 2 2 1 53 LEU QD  . 153 . HD#  1 1 
       1553 1 1 2 1 53 LEU H   . 153 . HN   1 1 
       1553 1 2 2 1 53 LEU MD2 . 153 . HD2# 1 1 
       1554 1 1 2 1 53 LEU H   . 153 . HN   1 1 
       1554 1 2 2 1 54 LYS H   . 154 . HN   1 1 
       1555 1 1 2 1 53 LEU H   . 153 . HN   1 1 
       1555 1 2 2 1 54 LYS QD  . 154 . HD#  1 1 
       1556 1 1 2 1 53 LEU H   . 153 . HN   1 1 
       1556 1 2 2 1 56 ILE HB  . 156 . HB   1 1 
       1557 1 1 2 1 53 LEU H   . 153 . HN   1 1 
       1557 1 2 2 1 56 ILE QG  . 156 . HG1# 1 1 
       1558 1 1 2 1 53 LEU HA  . 153 . HA   1 1 
       1558 1 2 2 1 53 LEU MD1 . 153 . HD1# 1 1 
       1559 1 1 2 1 53 LEU HA  . 153 . HA   1 1 
       1559 1 2 2 1 53 LEU QD  . 153 . HD#  1 1 
       1560 1 1 2 1 53 LEU HA  . 153 . HA   1 1 
       1560 1 2 2 1 53 LEU MD2 . 153 . HD2# 1 1 
       1561 1 1 2 1 53 LEU HA  . 153 . HA   1 1 
       1561 1 2 2 1 56 ILE H   . 156 . HN   1 1 
       1562 1 1 2 1 53 LEU HA  . 153 . HA   1 1 
       1562 1 2 2 1 56 ILE MD  . 156 . HD1# 1 1 
       1563 1 1 2 1 53 LEU HA  . 153 . HA   1 1 
       1563 1 2 2 1 56 ILE MG  . 156 . HG2# 1 1 
       1564 1 1 2 1 53 LEU QB  . 153 . HB#  1 1 
       1564 1 2 2 1 53 LEU QD  . 153 . HD#  1 1 
       1565 1 1 2 1 53 LEU QD  . 153 . HD#  1 1 
       1565 1 2 2 1 54 LYS H   . 154 . HN   1 1 
       1566 1 1 2 1 53 LEU QD  . 153 . HD#  1 1 
       1566 1 2 2 1 56 ILE HA  . 156 . HA   1 1 
       1567 1 1 2 1 53 LEU QD  . 153 . HD#  1 1 
       1567 1 2 2 1 56 ILE HB  . 156 . HB   1 1 
       1568 1 1 2 1 53 LEU QD  . 153 . HD#  1 1 
       1568 1 2 2 1 56 ILE QG  . 156 . HG1# 1 1 
       1569 1 1 2 1 53 LEU QD  . 153 . HD#  1 1 
       1569 1 2 2 1 57 GLN HA  . 157 . HA   1 1 
       1570 1 1 2 1 53 LEU QD  . 153 . HD#  1 1 
       1570 1 2 2 1 57 GLN QG  . 157 . HG#  1 1 
       1571 1 1 2 1 53 LEU MD1 . 153 . HD1# 1 1 
       1571 1 2 2 1 56 ILE HB  . 156 . HB   1 1 
       1572 1 1 2 1 53 LEU MD2 . 153 . HD2# 1 1 
       1572 1 2 2 1 56 ILE HB  . 156 . HB   1 1 
       1573 1 1 2 1 54 LYS H   . 154 . HN   1 1 
       1573 1 2 2 1 54 LYS QG  . 154 . HG#  1 1 
       1574 1 1 2 1 54 LYS H   . 154 . HN   1 1 
       1574 1 2 2 1 55 ARG H   . 155 . HN   1 1 
       1575 1 1 2 1 54 LYS H   . 154 . HN   1 1 
       1575 1 2 2 1 56 ILE H   . 156 . HN   1 1 
       1576 1 1 2 1 54 LYS H   . 154 . HN   1 1 
       1576 1 2 2 1 56 ILE QG  . 156 . HG1# 1 1 
       1577 1 1 2 1 54 LYS H   . 154 . HN   1 1 
       1577 1 2 2 1 57 GLN H   . 157 . HN   1 1 
       1578 1 1 2 1 54 LYS H   . 154 . HN   1 1 
       1578 1 2 2 1 57 GLN QG  . 157 . HG#  1 1 
       1579 1 1 2 1 54 LYS HA  . 154 . HA   1 1 
       1579 1 2 2 1 54 LYS QG  . 154 . HG#  1 1 
       1580 1 1 2 1 54 LYS HA  . 154 . HA   1 1 
       1580 1 2 2 1 57 GLN H   . 157 . HN   1 1 
       1581 1 1 2 1 54 LYS HA  . 154 . HA   1 1 
       1581 1 2 2 1 57 GLN QG  . 157 . HG#  1 1 
       1582 1 1 2 1 54 LYS QD  . 154 . HD#  1 1 
       1582 1 2 2 1 54 LYS QE  . 154 . HE#  1 1 
       1583 1 1 2 1 54 LYS HD2 . 154 . HD2  1 1 
       1583 1 2 2 1 54 LYS QE  . 154 . HE#  1 1 
       1584 1 1 2 1 54 LYS HD3 . 154 . HD1  1 1 
       1584 1 2 2 1 54 LYS QE  . 154 . HE#  1 1 
       1585 1 1 2 1 54 LYS QE  . 154 . HE#  1 1 
       1585 1 2 2 1 54 LYS QG  . 154 . HG#  1 1 
       1586 1 1 2 1 54 LYS QG  . 154 . HG#  1 1 
       1586 1 2 2 1 55 ARG H   . 155 . HN   1 1 
       1587 1 1 2 1 55 ARG H   . 155 . HN   1 1 
       1587 1 2 2 1 56 ILE H   . 156 . HN   1 1 
       1588 1 1 2 1 55 ARG H   . 155 . HN   1 1 
       1588 1 2 2 1 57 GLN H   . 157 . HN   1 1 
       1589 1 1 2 1 55 ARG H   . 155 . HN   1 1 
       1589 1 2 2 1 57 GLN QG  . 157 . HG#  1 1 
       1590 1 1 2 1 55 ARG H   . 155 . HN   1 1 
       1590 1 2 2 1 58 HIS H   . 158 . HN   1 1 
       1591 1 1 2 1 55 ARG HA  . 155 . HA   1 1 
       1591 1 2 2 1 57 GLN H   . 157 . HN   1 1 
       1592 1 1 2 1 56 ILE H   . 156 . HN   1 1 
       1592 1 2 2 1 56 ILE MD  . 156 . HD1# 1 1 
       1593 1 1 2 1 56 ILE H   . 156 . HN   1 1 
       1593 1 2 2 1 57 GLN H   . 157 . HN   1 1 
       1594 1 1 2 1 56 ILE HA  . 156 . HA   1 1 
       1594 1 2 2 1 59 LEU QD  . 159 . HD#  1 1 
       1595 1 1 2 1 56 ILE HB  . 156 . HB   1 1 
       1595 1 2 2 1 56 ILE MD  . 156 . HD1# 1 1 
       1596 1 1 2 1 56 ILE HB  . 156 . HB   1 1 
       1596 1 2 2 1 59 LEU H   . 159 . HN   1 1 
       1597 1 1 2 1 56 ILE MD  . 156 . HD1# 1 1 
       1597 1 2 2 1 57 GLN H   . 157 . HN   1 1 
       1598 1 1 2 1 56 ILE MD  . 156 . HD1# 1 1 
       1598 1 2 2 1 58 HIS H   . 158 . HN   1 1 
       1599 1 1 2 1 56 ILE MD  . 156 . HD1# 1 1 
       1599 1 2 2 1 59 LEU H   . 159 . HN   1 1 
       1600 1 1 2 1 56 ILE QG  . 156 . HG1# 1 1 
       1600 1 2 2 1 57 GLN H   . 157 . HN   1 1 
       1601 1 1 2 1 56 ILE MG  . 156 . HG2# 1 1 
       1601 1 2 2 1 57 GLN H   . 157 . HN   1 1 
       1602 1 1 2 1 56 ILE MG  . 156 . HG2# 1 1 
       1602 1 2 2 1 57 GLN HA  . 157 . HA   1 1 
       1603 1 1 2 1 56 ILE MG  . 156 . HG2# 1 1 
       1603 1 2 2 1 57 GLN QG  . 157 . HG#  1 1 
       1604 1 1 2 1 56 ILE MG  . 156 . HG2# 1 1 
       1604 1 2 2 1 59 LEU QD  . 159 . HD#  1 1 
       1605 1 1 2 1 56 ILE MG  . 156 . HG2# 1 1 
       1605 1 2 2 1 60 ASP H   . 160 . HN   1 1 
       1606 1 1 2 1 58 HIS H   . 158 . HN   1 1 
       1606 1 2 2 1 59 LEU H   . 159 . HN   1 1 
       1607 1 1 2 1 58 HIS H   . 158 . HN   1 1 
       1607 1 2 2 1 59 LEU HB2 . 159 . HB2  1 1 
       1608 1 1 2 1 58 HIS HA  . 158 . HA   1 1 
       1608 1 2 2 1 61 GLU H   . 161 . HN   1 1 
       1609 1 1 2 1 59 LEU H   . 159 . HN   1 1 
       1609 1 2 2 1 59 LEU MD1 . 159 . HD1# 1 1 
       1610 1 1 2 1 59 LEU H   . 159 . HN   1 1 
       1610 1 2 2 1 59 LEU QD  . 159 . HD#  1 1 
       1611 1 1 2 1 59 LEU H   . 159 . HN   1 1 
       1611 1 2 2 1 59 LEU MD2 . 159 . HD2# 1 1 
       1612 1 1 2 1 59 LEU H   . 159 . HN   1 1 
       1612 1 2 2 1 60 ASP H   . 160 . HN   1 1 
       1613 1 1 2 1 59 LEU H   . 159 . HN   1 1 
       1613 1 2 2 1 61 GLU H   . 161 . HN   1 1 
       1614 1 1 2 1 59 LEU HA  . 159 . HA   1 1 
       1614 1 2 2 1 59 LEU QD  . 159 . HD#  1 1 
       1615 1 1 2 1 59 LEU HA  . 159 . HA   1 1 
       1615 1 2 2 1 62 ALA MB  . 162 . HB#  1 1 
       1616 1 1 2 1 59 LEU HB2 . 159 . HB2  1 1 
       1616 1 2 2 1 61 GLU QG  . 161 . HG#  1 1 
       1617 1 1 2 1 59 LEU QD  . 159 . HD#  1 1 
       1617 1 2 2 1 60 ASP H   . 160 . HN   1 1 
       1618 1 1 2 1 59 LEU QD  . 159 . HD#  1 1 
       1618 1 2 2 1 62 ALA MB  . 162 . HB#  1 1 
       1619 1 1 2 1 59 LEU MD1 . 159 . HD1# 1 1 
       1619 1 2 2 1 60 ASP H   . 160 . HN   1 1 
       1620 1 1 2 1 59 LEU MD2 . 159 . HD2# 1 1 
       1620 1 2 2 1 60 ASP H   . 160 . HN   1 1 
       1621 1 1 2 1 59 LEU HG  . 159 . HG   1 1 
       1621 1 2 2 1 60 ASP H   . 160 . HN   1 1 
       1622 1 1 2 1 59 LEU HG  . 159 . HG   1 1 
       1622 1 2 2 1 63 TYR H   . 163 . HN   1 1 
       1623 1 1 2 1 60 ASP H   . 160 . HN   1 1 
       1623 1 2 2 1 61 GLU HA  . 161 . HA   1 1 
       1624 1 1 2 1 60 ASP H   . 160 . HN   1 1 
       1624 1 2 2 1 61 GLU QB  . 161 . HB#  1 1 
       1625 1 1 2 1 60 ASP H   . 160 . HN   1 1 
       1625 1 2 2 1 61 GLU QG  . 161 . HG#  1 1 
       1626 1 1 2 1 60 ASP QB  . 160 . HB#  1 1 
       1626 1 2 2 1 61 GLU QG  . 161 . HG#  1 1 
       1627 1 1 2 1 60 ASP QB  . 160 . HB#  1 1 
       1627 1 2 2 1 62 ALA H   . 162 . HN   1 1 
       1628 1 1 2 1 60 ASP QB  . 160 . HB#  1 1 
       1628 1 2 2 1 63 TYR H   . 163 . HN   1 1 
       1629 1 1 2 1 60 ASP QB  . 160 . HB#  1 1 
       1629 1 2 2 1 63 TYR QD  . 163 . HD#  1 1 
       1630 1 1 2 1 60 ASP QB  . 160 . HB#  1 1 
       1630 1 2 2 1 63 TYR QE  . 163 . HE#  1 1 
       1631 1 1 2 1 61 GLU H   . 161 . HN   1 1 
       1631 1 2 2 1 61 GLU QB  . 161 . HB#  1 1 
       1632 1 1 2 1 61 GLU H   . 161 . HN   1 1 
       1632 1 2 2 1 61 GLU QG  . 161 . HG#  1 1 
       1633 1 1 2 1 61 GLU H   . 161 . HN   1 1 
       1633 1 2 2 1 62 ALA HA  . 162 . HA   1 1 
       1634 1 1 2 1 61 GLU HA  . 161 . HA   1 1 
       1634 1 2 2 1 61 GLU QG  . 161 . HG#  1 1 
       1635 1 1 2 1 61 GLU HA  . 161 . HA   1 1 
       1635 1 2 2 1 63 TYR H   . 163 . HN   1 1 
       1636 1 1 2 1 61 GLU QB  . 161 . HB#  1 1 
       1636 1 2 2 1 62 ALA H   . 162 . HN   1 1 
       1637 1 1 2 1 61 GLU QG  . 161 . HG#  1 1 
       1637 1 2 2 1 62 ALA H   . 162 . HN   1 1 
       1638 1 1 2 1 61 GLU QG  . 161 . HG#  1 1 
       1638 1 2 2 1 65 LYS QB  . 165 . HB#  1 1 
       1639 1 1 2 1 62 ALA H   . 162 . HN   1 1 
       1639 1 2 2 1 63 TYR H   . 163 . HN   1 1 
       1640 1 1 2 1 62 ALA H   . 162 . HN   1 1 
       1640 1 2 2 1 63 TYR QB  . 163 . HB#  1 1 
       1641 1 1 2 1 62 ALA H   . 162 . HN   1 1 
       1641 1 2 2 1 65 LYS QB  . 165 . HB#  1 1 
       1642 1 1 2 1 62 ALA HA  . 162 . HA   1 1 
       1642 1 2 2 1 65 LYS QB  . 165 . HB#  1 1 
       1643 1 1 2 1 62 ALA MB  . 162 . HB#  1 1 
       1643 1 2 2 1 63 TYR H   . 163 . HN   1 1 
       1644 1 1 2 1 63 TYR H   . 163 . HN   1 1 
       1644 1 2 2 1 63 TYR QD  . 163 . HD#  1 1 
       1645 1 1 2 1 63 TYR H   . 163 . HN   1 1 
       1645 1 2 2 1 63 TYR QE  . 163 . HE#  1 1 
       1646 1 1 2 1 63 TYR H   . 163 . HN   1 1 
       1646 1 2 2 1 64 ASN H   . 164 . HN   1 1 
       1647 1 1 2 1 63 TYR H   . 163 . HN   1 1 
       1647 1 2 2 1 64 ASN HA  . 164 . HA   1 1 
       1648 1 1 2 1 63 TYR H   . 163 . HN   1 1 
       1648 1 2 2 1 64 ASN QB  . 164 . HB#  1 1 
       1649 1 1 2 1 63 TYR H   . 163 . HN   1 1 
       1649 1 2 2 1 65 LYS QB  . 165 . HB#  1 1 
       1650 1 1 2 1 63 TYR H   . 163 . HN   1 1 
       1650 1 2 2 1 66 VAL HB  . 166 . HB   1 1 
       1651 1 1 2 1 63 TYR QB  . 163 . HB#  1 1 
       1651 1 2 2 1 64 ASN H   . 164 . HN   1 1 
       1652 1 1 2 1 63 TYR QD  . 163 . HD#  1 1 
       1652 1 2 2 1 64 ASN H   . 164 . HN   1 1 
       1653 1 1 2 1 63 TYR QE  . 163 . HE#  1 1 
       1653 1 2 2 1 64 ASN H   . 164 . HN   1 1 
       1654 1 1 2 1 63 TYR QE  . 163 . HE#  1 1 
       1654 1 2 2 1 67 LYS QD  . 167 . HD#  1 1 
       1655 1 1 2 1 63 TYR QE  . 163 . HE#  1 1 
       1655 1 2 2 1 67 LYS HG3 . 167 . HG1  1 1 
       1656 1 1 2 1 64 ASN H   . 164 . HN   1 1 
       1656 1 2 2 1 66 VAL HB  . 166 . HB   1 1 
       1657 1 1 2 1 64 ASN H   . 164 . HN   1 1 
       1657 1 2 2 1 68 ARG H   . 168 . HN   1 1 
       1658 1 1 2 1 64 ASN HA  . 164 . HA   1 1 
       1658 1 2 2 1 67 LYS H   . 167 . HN   1 1 
       1659 1 1 2 1 64 ASN HA  . 164 . HA   1 1 
       1659 1 2 2 1 68 ARG H   . 168 . HN   1 1 
       1660 1 1 2 1 65 LYS H   . 165 . HN   1 1 
       1660 1 2 2 1 66 VAL H   . 166 . HN   1 1 
       1661 1 1 2 1 65 LYS H   . 165 . HN   1 1 
       1661 1 2 2 1 66 VAL QG  . 166 . HG#  1 1 
       1662 1 1 2 1 65 LYS H   . 165 . HN   1 1 
       1662 1 2 2 1 67 LYS H   . 167 . HN   1 1 
       1663 1 1 2 1 65 LYS HA  . 165 . HA   1 1 
       1663 1 2 2 1 67 LYS H   . 167 . HN   1 1 
       1664 1 1 2 1 66 VAL H   . 166 . HN   1 1 
       1664 1 2 2 1 66 VAL HB  . 166 . HB   1 1 
       1665 1 1 2 1 66 VAL H   . 166 . HN   1 1 
       1665 1 2 2 1 66 VAL MG1 . 166 . HG1# 1 1 
       1666 1 1 2 1 66 VAL H   . 166 . HN   1 1 
       1666 1 2 2 1 66 VAL QG  . 166 . HG#  1 1 
       1667 1 1 2 1 66 VAL H   . 166 . HN   1 1 
       1667 1 2 2 1 66 VAL MG2 . 166 . HG2# 1 1 
       1668 1 1 2 1 66 VAL H   . 166 . HN   1 1 
       1668 1 2 2 1 67 LYS HG3 . 167 . HG1  1 1 
       1669 1 1 2 1 66 VAL HA  . 166 . HA   1 1 
       1669 1 2 2 1 66 VAL QG  . 166 . HG#  1 1 
       1670 1 1 2 1 66 VAL HA  . 166 . HA   1 1 
       1670 1 2 2 1 66 VAL MG2 . 166 . HG2# 1 1 
       1671 1 1 2 1 66 VAL HA  . 166 . HA   1 1 
       1671 1 2 2 1 68 ARG H   . 168 . HN   1 1 
       1672 1 1 2 1 66 VAL HB  . 166 . HB   1 1 
       1672 1 2 2 1 67 LYS HA  . 167 . HA   1 1 
       1673 1 1 2 1 66 VAL QG  . 166 . HG#  1 1 
       1673 1 2 2 1 67 LYS H   . 167 . HN   1 1 
       1674 1 1 2 1 66 VAL QG  . 166 . HG#  1 1 
       1674 1 2 2 1 67 LYS HA  . 167 . HA   1 1 
       1675 1 1 2 1 66 VAL QG  . 166 . HG#  1 1 
       1675 1 2 2 1 69 GLY H   . 169 . HN   1 1 
       1676 1 1 2 1 66 VAL QG  . 166 . HG#  1 1 
       1676 1 2 2 1 70 GLU QG  . 170 . HG#  1 1 
       1677 1 1 2 1 67 LYS H   . 167 . HN   1 1 
       1677 1 2 2 1 67 LYS HB2 . 167 . HB2  1 1 
       1678 1 1 2 1 67 LYS H   . 167 . HN   1 1 
       1678 1 2 2 1 68 ARG H   . 168 . HN   1 1 
       1679 1 1 2 1 67 LYS H   . 167 . HN   1 1 
       1679 1 2 2 1 68 ARG HB3 . 168 . HB1  1 1 
       1680 1 1 2 1 67 LYS H   . 167 . HN   1 1 
       1680 1 2 2 1 69 GLY H   . 169 . HN   1 1 
       1681 1 1 2 1 67 LYS H   . 167 . HN   1 1 
       1681 1 2 2 1 70 GLU QB  . 170 . HB#  1 1 
       1682 1 1 2 1 67 LYS H   . 167 . HN   1 1 
       1682 1 2 2 1 70 GLU QG  . 170 . HG#  1 1 
       1683 1 1 2 1 67 LYS HA  . 167 . HA   1 1 
       1683 1 2 2 1 67 LYS QD  . 167 . HD#  1 1 
       1684 1 1 2 1 67 LYS HA  . 167 . HA   1 1 
       1684 1 2 2 1 67 LYS HG3 . 167 . HG1  1 1 
       1685 1 1 2 1 67 LYS HA  . 167 . HA   1 1 
       1685 1 2 2 1 70 GLU H   . 170 . HN   1 1 
       1686 1 1 2 1 67 LYS HB2 . 167 . HB2  1 1 
       1686 1 2 2 1 68 ARG H   . 168 . HN   1 1 
       1687 1 1 2 1 67 LYS HB2 . 167 . HB2  1 1 
       1687 1 2 2 1 68 ARG QD  . 168 . HD#  1 1 
       1688 1 1 2 1 67 LYS QD  . 167 . HD#  1 1 
       1688 1 2 2 1 70 GLU H   . 170 . HN   1 1 
       1689 1 1 2 1 67 LYS HG3 . 167 . HG1  1 1 
       1689 1 2 2 1 68 ARG H   . 168 . HN   1 1 
       1690 1 1 2 1 67 LYS HG3 . 167 . HG1  1 1 
       1690 1 2 2 1 69 GLY H   . 169 . HN   1 1 
       1691 1 1 2 1 68 ARG H   . 168 . HN   1 1 
       1691 1 2 2 1 68 ARG QD  . 168 . HD#  1 1 
       1692 1 1 2 1 68 ARG H   . 168 . HN   1 1 
       1692 1 2 2 1 68 ARG QG  . 168 . HG#  1 1 
       1693 1 1 2 1 68 ARG H   . 168 . HN   1 1 
       1693 1 2 2 1 69 GLY H   . 169 . HN   1 1 
       1694 1 1 2 1 68 ARG H   . 168 . HN   1 1 
       1694 1 2 2 1 69 GLY QA  . 169 . HA#  1 1 
       1695 1 1 2 1 68 ARG H   . 168 . HN   1 1 
       1695 1 2 2 1 70 GLU H   . 170 . HN   1 1 
       1696 1 1 2 1 68 ARG H   . 168 . HN   1 1 
       1696 1 2 2 1 70 GLU QB  . 170 . HB#  1 1 
       1697 1 1 2 1 68 ARG H   . 168 . HN   1 1 
       1697 1 2 2 1 70 GLU HG2 . 170 . HG2  1 1 
       1698 1 1 2 1 68 ARG H   . 168 . HN   1 1 
       1698 1 2 2 1 70 GLU HG3 . 170 . HG1  1 1 
       1699 1 1 2 1 68 ARG HA  . 168 . HA   1 1 
       1699 1 2 2 1 68 ARG QG  . 168 . HG#  1 1 
       1700 1 1 2 1 68 ARG HB3 . 168 . HB1  1 1 
       1700 1 2 2 1 68 ARG QD  . 168 . HD#  1 1 
       1701 1 1 2 1 68 ARG HB3 . 168 . HB1  1 1 
       1701 1 2 2 1 69 GLY H   . 169 . HN   1 1 
       1702 1 1 2 1 68 ARG HB3 . 168 . HB1  1 1 
       1702 1 2 2 1 69 GLY QA  . 169 . HA#  1 1 
       1703 1 1 2 1 68 ARG QG  . 168 . HG#  1 1 
       1703 1 2 2 1 69 GLY H   . 169 . HN   1 1 
       1704 1 1 2 1 69 GLY H   . 169 . HN   1 1 
       1704 1 2 2 1 69 GLY QA  . 169 . HA#  1 1 
       1705 1 1 2 1 69 GLY H   . 169 . HN   1 1 
       1705 1 2 2 1 70 GLU H   . 170 . HN   1 1 
       1706 1 1 2 1 69 GLY H   . 169 . HN   1 1 
       1706 1 2 2 1 70 GLU HA  . 170 . HA   1 1 
       1707 1 1 2 1 69 GLY H   . 169 . HN   1 1 
       1707 1 2 2 1 70 GLU QB  . 170 . HB#  1 1 
       1708 1 1 2 1 69 GLY H   . 169 . HN   1 1 
       1708 1 2 2 1 70 GLU QG  . 170 . HG#  1 1 
       1709 1 1 2 1 69 GLY QA  . 169 . HA#  1 1 
       1709 1 2 2 1 70 GLU H   . 170 . HN   1 1 
       1710 1 1 2 1 69 GLY QA  . 169 . HA#  1 1 
       1710 1 2 2 1 70 GLU HA  . 170 . HA   1 1 
       1711 1 1 2 1 70 GLU H   . 170 . HN   1 1 
       1711 1 2 2 1 70 GLU QB  . 170 . HB#  1 1 
       1712 1 1 2 1 70 GLU H   . 170 . HN   1 1 
       1712 1 2 2 1 70 GLU QG  . 170 . HG#  1 1 
       1713 1 1 2 1 70 GLU HA  . 170 . HA   1 1 
       1713 1 2 2 1 70 GLU QB  . 170 . HB#  1 1 
       1714 1 1 2 1 70 GLU HA  . 170 . HA   1 1 
       1714 1 2 2 1 70 GLU QG  . 170 . HG#  1 1 
       1715 1 1 2 1 70 GLU HB2 . 170 . HB2  1 1 
       1715 1 2 2 1 71 SER H   . 171 . HN   1 1 
       1716 1 1 2 1 70 GLU HB3 . 170 . HB1  1 1 
       1716 1 2 2 1 71 SER H   . 171 . HN   1 1 
       1717 1 1 2 1 71 SER H   . 171 . HN   1 1 
       1717 1 2 2 1 71 SER QB  . 171 . HB#  1 1 
       1718 1 1 2 1 71 SER H   . 171 . HN   1 1 
       1718 1 2 2 1 72 LYS QG  . 172 . HG#  1 1 
       1719 1 1 2 1 71 SER HA  . 171 . HA   1 1 
       1719 1 2 2 1 72 LYS H   . 172 . HN   1 1 
       1720 1 1 2 1 71 SER HA  . 171 . HA   1 1 
       1720 1 2 2 1 72 LYS QB  . 172 . HB#  1 1 
       1721 1 1 2 1 71 SER QB  . 171 . HB#  1 1 
       1721 1 2 2 1 72 LYS H   . 172 . HN   1 1 
       1722 1 1 2 1 71 SER QB  . 171 . HB#  1 1 
       1722 1 2 2 1 73 LEU H   . 173 . HN   1 1 
       1723 1 1 2 1 72 LYS H   . 172 . HN   1 1 
       1723 1 2 2 1 72 LYS HB2 . 172 . HB2  1 1 
       1724 1 1 2 1 72 LYS H   . 172 . HN   1 1 
       1724 1 2 2 1 72 LYS QB  . 172 . HB#  1 1 
       1725 1 1 2 1 72 LYS H   . 172 . HN   1 1 
       1725 1 2 2 1 72 LYS HB3 . 172 . HB1  1 1 
       1726 1 1 2 1 72 LYS H   . 172 . HN   1 1 
       1726 1 2 2 1 72 LYS QG  . 172 . HG#  1 1 
       1727 1 1 2 1 72 LYS H   . 172 . HN   1 1 
       1727 1 2 2 1 74 GLU HG2 . 174 . HG2  1 1 
       1728 1 1 2 1 72 LYS H   . 172 . HN   1 1 
       1728 1 2 2 1 74 GLU HG3 . 174 . HG1  1 1 
       1729 1 1 2 1 72 LYS HA  . 172 . HA   1 1 
       1729 1 2 2 1 72 LYS QG  . 172 . HG#  1 1 
       1730 1 1 2 1 72 LYS HA  . 172 . HA   1 1 
       1730 1 2 2 1 73 LEU H   . 173 . HN   1 1 
       1731 1 1 2 1 72 LYS QB  . 172 . HB#  1 1 
       1731 1 2 2 1 73 LEU H   . 173 . HN   1 1 
       1732 1 1 2 1 72 LYS QB  . 172 . HB#  1 1 
       1732 1 2 2 1 73 LEU QD  . 173 . HD#  1 1 
       1733 1 1 2 1 73 LEU H   . 173 . HN   1 1 
       1733 1 2 2 1 73 LEU QB  . 173 . HB#  1 1 
       1734 1 1 2 1 73 LEU H   . 173 . HN   1 1 
       1734 1 2 2 1 73 LEU QD  . 173 . HD#  1 1 
       1735 1 1 2 1 73 LEU H   . 173 . HN   1 1 
       1735 1 2 2 1 73 LEU HG  . 173 . HG   1 1 
       1736 1 1 2 1 73 LEU H   . 173 . HN   1 1 
       1736 1 2 2 1 74 GLU QG  . 174 . HG#  1 1 
       1737 1 1 2 1 73 LEU HA  . 173 . HA   1 1 
       1737 1 2 2 1 73 LEU QD  . 173 . HD#  1 1 
       1738 1 1 2 1 73 LEU HA  . 173 . HA   1 1 
       1738 1 2 2 1 73 LEU HG  . 173 . HG   1 1 
       1739 1 1 2 1 73 LEU HA  . 173 . HA   1 1 
       1739 1 2 2 1 74 GLU H   . 174 . HN   1 1 
       1740 1 1 2 1 73 LEU HA  . 173 . HA   1 1 
       1740 1 2 2 1 74 GLU QB  . 174 . HB#  1 1 
       1741 1 1 2 1 73 LEU QB  . 173 . HB#  1 1 
       1741 1 2 2 1 73 LEU QD  . 173 . HD#  1 1 
       1742 1 1 2 1 73 LEU QB  . 173 . HB#  1 1 
       1742 1 2 2 1 74 GLU H   . 174 . HN   1 1 
       1743 1 1 2 1 73 LEU QB  . 173 . HB#  1 1 
       1743 1 2 2 1 74 GLU QG  . 174 . HG#  1 1 
       1744 1 1 2 1 73 LEU QD  . 173 . HD#  1 1 
       1744 1 2 2 1 74 GLU H   . 174 . HN   1 1 
       1745 1 1 2 1 73 LEU QD  . 173 . HD#  1 1 
       1745 1 2 2 1 75 HIS H   . 175 . HN   1 1 
       1746 1 1 2 1 73 LEU QD  . 173 . HD#  1 1 
       1746 1 2 2 1 75 HIS QB  . 175 . HB#  1 1 
       1747 1 1 2 1 73 LEU HG  . 173 . HG   1 1 
       1747 1 2 2 1 74 GLU H   . 174 . HN   1 1 
       1748 1 1 2 1 74 GLU H   . 174 . HN   1 1 
       1748 1 2 2 1 74 GLU QB  . 174 . HB#  1 1 
       1749 1 1 2 1 74 GLU H   . 174 . HN   1 1 
       1749 1 2 2 1 74 GLU QG  . 174 . HG#  1 1 
       1750 1 1 2 1 74 GLU HA  . 174 . HA   1 1 
       1750 1 2 2 1 74 GLU HG2 . 174 . HG2  1 1 
       1751 1 1 2 1 74 GLU HA  . 174 . HA   1 1 
       1751 1 2 2 1 74 GLU QG  . 174 . HG#  1 1 
       1752 1 1 2 1 74 GLU HA  . 174 . HA   1 1 
       1752 1 2 2 1 74 GLU HG3 . 174 . HG1  1 1 
       1753 1 1 2 1 74 GLU HA  . 174 . HA   1 1 
       1753 1 2 2 1 75 HIS H   . 175 . HN   1 1 
       1754 1 1 2 1 74 GLU QB  . 174 . HB#  1 1 
       1754 1 2 2 1 75 HIS HA  . 175 . HA   1 1 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

          1 1 . . . . . 4.45  1.8 4.45 1 1 
          2 1 . . . . . 5.08  1.8 5.08 1 1 
          3 1 . . . . . 5.08  1.8 5.08 1 1 
          4 1 . . . . .  6.0  1.8  6.0 1 1 
          5 1 . . . . . 3.44  1.8 3.44 1 1 
          6 1 . . . . . 4.61  1.8 4.61 1 1 
          7 1 . . . . . 4.47  1.8 4.47 1 1 
          8 1 . . . . . 5.84 1.86 5.84 1 1 
          9 1 . . . . . 5.79  1.8 5.79 1 1 
         10 1 . . . . . 3.57  1.8 3.57 1 1 
         11 1 . . . . .  4.5  1.8  4.5 1 1 
         12 1 . . . . . 4.88  1.8 4.88 1 1 
         13 1 . . . . .  6.0  1.8  6.0 1 1 
         14 1 . . . . .  5.0  1.8  5.0 1 1 
         15 1 . . . . . 5.26  1.8 5.26 1 1 
         16 1 . . . . . 4.34  1.8 4.34 1 1 
         17 1 . . . . . 3.68  1.8 3.68 1 1 
         18 1 . . . . . 4.34  1.8 4.34 1 1 
         19 1 . . . . .  6.0  1.8  6.0 1 1 
         20 1 . . . . . 5.06  1.8 5.06 1 1 
         21 1 . . . . . 4.82  1.8 4.82 1 1 
         22 1 . . . . .  2.8  1.8  2.8 1 1 
         23 1 . . . . . 4.37  1.8 4.37 1 1 
         24 1 . . . . . 4.06  1.8 4.06 1 1 
         25 1 . . . . . 4.15  1.8 4.15 1 1 
         26 1 . . . . . 5.59  1.8 5.59 1 1 
         27 1 . . . . . 4.75  1.8 4.75 1 1 
         28 1 . . . . .  6.0  1.8  6.0 1 1 
         29 1 . . . . . 4.98  1.8 4.98 1 1 
         30 1 . . . . . 5.59  1.8 5.59 1 1 
         31 1 . . . . . 4.75  1.8 4.75 1 1 
         32 1 . . . . .  6.0  1.8  6.0 1 1 
         33 1 . . . . . 4.98  1.8 4.98 1 1 
         34 1 . . . . .  6.0  1.8  6.0 1 1 
         35 1 . . . . . 4.07  1.8 4.07 1 1 
         36 1 . . . . .  4.2  1.8  4.2 1 1 
         37 1 . . . . .  6.0  1.8  6.0 1 1 
         38 1 . . . . . 3.73  1.8 3.73 1 1 
         39 1 . . . . . 4.84  1.8 4.84 1 1 
         40 1 . . . . . 4.79  1.8 4.79 1 1 
         41 1 . . . . . 5.69  1.8 5.69 1 1 
         42 1 . . . . . 5.92  1.8 5.92 1 1 
         43 1 . . . . . 3.63  1.8 3.63 1 1 
         44 1 . . . . . 5.92  1.8 5.92 1 1 
         45 1 . . . . .  6.0  1.8  6.0 1 1 
         46 1 . . . . .  6.0  1.8  6.0 1 1 
         47 1 . . . . .  6.0  1.8  6.0 1 1 
         48 1 . . . . .  6.0  1.8  6.0 1 1 
         49 1 . . . . . 4.85  1.8 4.85 1 1 
         50 1 . . . . . 4.27  1.8 4.27 1 1 
         51 1 . . . . . 3.59  1.8 3.59 1 1 
         52 1 . . . . . 4.62  1.8 4.62 1 1 
         53 1 . . . . . 4.48  1.8 4.48 1 1 
         54 1 . . . . . 4.13  1.8 4.13 1 1 
         55 1 . . . . . 4.11  1.8 4.11 1 1 
         56 1 . . . . .  5.5  1.8  5.5 1 1 
         57 1 . . . . . 5.14  1.8 5.14 1 1 
         58 1 . . . . .  5.3  1.8  5.3 1 1 
         59 1 . . . . . 4.24  1.8 4.24 1 1 
         60 1 . . . . . 4.68  1.8 4.68 1 1 
         61 1 . . . . . 4.69  1.8 4.69 1 1 
         62 1 . . . . .  6.0  1.8  6.0 1 1 
         63 1 . . . . . 5.15  1.8 5.15 1 1 
         64 1 . . . . .  4.7  1.8  4.7 1 1 
         65 1 . . . . . 4.31  1.8 4.31 1 1 
         66 1 . . . . . 5.63  1.8 5.63 1 1 
         67 1 . . . . . 5.18  1.8 5.18 1 1 
         68 1 . . . . .  4.4  1.8  4.4 1 1 
         69 1 . . . . . 5.81  1.8 5.81 1 1 
         70 1 . . . . . 4.94  1.8 4.94 1 1 
         71 1 . . . . . 5.32  1.8 5.32 1 1 
         72 1 . . . . .  6.0  1.8  6.0 1 1 
         73 1 . . . . . 3.82  1.8 3.82 1 1 
         74 1 . . . . .  6.0  1.8  6.0 1 1 
         75 1 . . . . . 4.11  1.8 4.11 1 1 
         76 1 . . . . . 3.51  1.8 3.51 1 1 
         77 1 . . . . . 4.11  1.8 4.11 1 1 
         78 1 . . . . . 3.82  1.8 3.82 1 1 
         79 1 . . . . . 4.31  1.8 4.31 1 1 
         80 1 . . . . . 3.15  1.8 3.15 1 1 
         81 1 . . . . . 4.31  1.8 4.31 1 1 
         82 1 . . . . . 3.37  1.8 3.37 1 1 
         83 1 . . . . . 4.03  1.8 4.03 1 1 
         84 1 . . . . . 4.15  1.8 4.15 1 1 
         85 1 . . . . . 4.12  1.8 4.12 1 1 
         86 1 . . . . .  4.1  1.8  4.1 1 1 
         87 1 . . . . .  6.0  1.8  6.0 1 1 
         88 1 . . . . . 5.81  1.8 5.81 1 1 
         89 1 . . . . . 5.83  1.8 5.83 1 1 
         90 1 . . . . . 4.38  1.8 4.38 1 1 
         91 1 . . . . .  4.2  1.8  4.2 1 1 
         92 1 . . . . .  4.2  1.8  4.2 1 1 
         93 1 . . . . . 5.52  1.8 5.52 1 1 
         94 1 . . . . .  6.0  1.8  6.0 1 1 
         95 1 . . . . . 2.98  1.8 2.98 1 1 
         96 1 . . . . . 3.02  1.8 3.02 1 1 
         97 1 . . . . . 5.81  1.8 5.81 1 1 
         98 1 . . . . .  4.1  1.8  4.1 1 1 
         99 1 . . . . . 5.89  1.8 5.89 1 1 
        100 1 . . . . .  4.4  1.8  4.4 1 1 
        101 1 . . . . . 4.07  1.8 4.07 1 1 
        102 1 . . . . . 4.49  1.8 4.49 1 1 
        103 1 . . . . . 3.56  1.8 3.56 1 1 
        104 1 . . . . . 5.65  1.8 5.65 1 1 
        105 1 . . . . .  6.0  1.8  6.0 1 1 
        106 1 . . . . . 5.81  1.8 5.81 1 1 
        107 1 . . . . . 4.17  1.8 4.17 1 1 
        108 1 . . . . . 3.89  1.8 3.89 1 1 
        109 1 . . . . . 3.48  1.8 3.48 1 1 
        110 1 . . . . . 3.79  1.8 3.79 1 1 
        111 1 . . . . . 4.76  1.8 4.76 1 1 
        112 1 . . . . .  6.0  1.8  6.0 1 1 
        113 1 . . . . .  6.0  1.8  6.0 1 1 
        114 1 . . . . .  6.0  1.8  6.0 1 1 
        115 1 . . . . . 3.52  1.8 3.52 1 1 
        116 1 . . . . .  4.5  1.8  4.5 1 1 
        117 1 . . . . . 3.41  1.8 3.41 1 1 
        118 1 . . . . . 3.32  1.8 3.32 1 1 
        119 1 . . . . .  3.7  1.8  3.7 1 1 
        120 1 . . . . . 3.37  1.8 3.37 1 1 
        121 1 . . . . . 5.03  1.8 5.03 1 1 
        122 1 . . . . . 5.65  1.8 5.65 1 1 
        123 1 . . . . . 4.62  1.8 4.62 1 1 
        124 1 . . . . . 3.35  1.8 3.35 1 1 
        125 1 . . . . . 5.81  1.8 5.81 1 1 
        126 1 . . . . . 4.08  1.8 4.08 1 1 
        127 1 . . . . . 5.38  1.8 5.38 1 1 
        128 1 . . . . . 5.01  1.8 5.01 1 1 
        129 1 . . . . . 5.63  1.8 5.63 1 1 
        130 1 . . . . . 5.81  1.8 5.81 1 1 
        131 1 . . . . . 4.45  1.8 4.45 1 1 
        132 1 . . . . . 3.54  1.8 3.54 1 1 
        133 1 . . . . . 3.96  1.8 3.96 1 1 
        134 1 . . . . . 3.38  1.8 3.38 1 1 
        135 1 . . . . . 3.96  1.8 3.96 1 1 
        136 1 . . . . . 3.83  1.8 3.83 1 1 
        137 1 . . . . . 4.24  1.8 4.24 1 1 
        138 1 . . . . . 5.96  1.8 5.96 1 1 
        139 1 . . . . . 5.85  1.8 5.85 1 1 
        140 1 . . . . . 5.81  1.8 5.81 1 1 
        141 1 . . . . .  6.0  1.8  6.0 1 1 
        142 1 . . . . .  6.0  1.8  6.0 1 1 
        143 1 . . . . .  6.0  1.8  6.0 1 1 
        144 1 . . . . . 4.23  1.8 4.23 1 1 
        145 1 . . . . . 5.69  1.8 5.69 1 1 
        146 1 . . . . . 4.85  1.8 4.85 1 1 
        147 1 . . . . . 3.94  1.8 3.94 1 1 
        148 1 . . . . .  3.8  1.8  3.8 1 1 
        149 1 . . . . . 5.92  1.8 5.92 1 1 
        150 1 . . . . . 5.92  1.8 5.92 1 1 
        151 1 . . . . . 5.92  1.8 5.92 1 1 
        152 1 . . . . . 5.92  1.8 5.92 1 1 
        153 1 . . . . . 4.69  1.8 4.69 1 1 
        154 1 . . . . . 5.92  1.8 5.92 1 1 
        155 1 . . . . . 5.07  1.8 5.07 1 1 
        156 1 . . . . . 3.78  1.8 3.78 1 1 
        157 1 . . . . . 3.89  1.8 3.89 1 1 
        158 1 . . . . . 5.87  1.8 5.87 1 1 
        159 1 . . . . . 4.52  1.8 4.52 1 1 
        160 1 . . . . . 5.73  1.8 5.73 1 1 
        161 1 . . . . . 3.88  1.8 3.88 1 1 
        162 1 . . . . . 2.93  1.8 2.93 1 1 
        163 1 . . . . . 5.44  1.8 5.44 1 1 
        164 1 . . . . . 4.16  1.8 4.16 1 1 
        165 1 . . . . . 5.92  1.8 5.92 1 1 
        166 1 . . . . . 3.94  1.8 3.94 1 1 
        167 1 . . . . .  6.0  1.8  6.0 1 1 
        168 1 . . . . . 3.91  1.8 3.91 1 1 
        169 1 . . . . . 3.91  1.8 3.91 1 1 
        170 1 . . . . .  6.0  1.8  6.0 1 1 
        171 1 . . . . . 4.77  1.8 4.77 1 1 
        172 1 . . . . . 3.39  1.8 3.39 1 1 
        173 1 . . . . . 3.39  1.8 3.39 1 1 
        174 1 . . . . .  4.4  1.8  4.4 1 1 
        175 1 . . . . . 5.06  1.8 5.06 1 1 
        176 1 . . . . . 4.44  1.8 4.44 1 1 
        177 1 . . . . . 3.94  1.8 3.94 1 1 
        178 1 . . . . . 3.48  1.8 3.48 1 1 
        179 1 . . . . . 5.28  1.8 5.28 1 1 
        180 1 . . . . . 3.15  1.8 3.15 1 1 
        181 1 . . . . .  6.0  1.8  6.0 1 1 
        182 1 . . . . . 3.17  1.8 3.17 1 1 
        183 1 . . . . . 4.71  1.8 4.71 1 1 
        184 1 . . . . .  6.0  1.8  6.0 1 1 
        185 1 . . . . . 4.44  1.8 4.44 1 1 
        186 1 . . . . . 5.81  1.8 5.81 1 1 
        187 1 . . . . .  4.5  1.8  4.5 1 1 
        188 1 . . . . . 4.45  1.8 4.45 1 1 
        189 1 . . . . . 4.06  1.8 4.06 1 1 
        190 1 . . . . .  6.0  1.8  6.0 1 1 
        191 1 . . . . . 5.17  1.8 5.17 1 1 
        192 1 . . . . .  6.0  1.8  6.0 1 1 
        193 1 . . . . . 5.17  1.8 5.17 1 1 
        194 1 . . . . . 4.01  1.8 4.01 1 1 
        195 1 . . . . .  6.0  1.8  6.0 1 1 
        196 1 . . . . .  6.0  1.8  6.0 1 1 
        197 1 . . . . .  6.0  1.8  6.0 1 1 
        198 1 . . . . .  6.0  1.8  6.0 1 1 
        199 1 . . . . .  6.0  1.8  6.0 1 1 
        200 1 . . . . . 5.81  1.8 5.81 1 1 
        201 1 . . . . .  6.0  1.8  6.0 1 1 
        202 1 . . . . . 4.06  1.8 4.06 1 1 
        203 1 . . . . . 4.75  1.8 4.75 1 1 
        204 1 . . . . . 4.99  1.8 4.99 1 1 
        205 1 . . . . . 3.55  1.8 3.55 1 1 
        206 1 . . . . . 4.43  1.8 4.43 1 1 
        207 1 . . . . . 3.54  1.8 3.54 1 1 
        208 1 . . . . . 5.93  1.8 5.93 1 1 
        209 1 . . . . .  6.0  1.8  6.0 1 1 
        210 1 . . . . . 4.93  1.8 4.93 1 1 
        211 1 . . . . . 4.49  1.8 4.49 1 1 
        212 1 . . . . . 4.18  1.8 4.18 1 1 
        213 1 . . . . . 4.77  1.8 4.77 1 1 
        214 1 . . . . . 4.76  1.8 4.76 1 1 
        215 1 . . . . .  6.0  1.8  6.0 1 1 
        216 1 . . . . . 4.87  1.8 4.87 1 1 
        217 1 . . . . . 4.13  1.8 4.13 1 1 
        218 1 . . . . . 4.55  1.8 4.55 1 1 
        219 1 . . . . .  6.0  1.8  6.0 1 1 
        220 1 . . . . . 4.94  1.8 4.94 1 1 
        221 1 . . . . .    .  1.8 3.19 1 1 
        222 1 . . . . . 5.35  1.8 5.35 1 1 
        223 1 . . . . . 4.72  1.8 4.72 1 1 
        224 1 . . . . . 5.29  1.8 5.29 1 1 
        225 1 . . . . . 3.55  1.8 3.55 1 1 
        226 1 . . . . . 3.37  1.8 3.37 1 1 
        227 1 . . . . . 3.62  1.8 3.62 1 1 
        228 1 . . . . . 5.68  1.8 5.68 1 1 
        229 1 . . . . . 4.65  1.8 4.65 1 1 
        230 1 . . . . . 5.85  1.8 5.85 1 1 
        231 1 . . . . . 5.81  1.8 5.81 1 1 
        232 1 . . . . . 3.55  1.8 3.55 1 1 
        233 1 . . . . .  6.0  1.8  6.0 1 1 
        234 1 . . . . . 5.81  1.8 5.81 1 1 
        235 1 . . . . . 3.33  1.8 3.33 1 1 
        236 1 . . . . . 3.28  1.8 3.28 1 1 
        237 1 . . . . . 4.31  1.8 4.31 1 1 
        238 1 . . . . . 3.28  1.8 3.28 1 1 
        239 1 . . . . .  3.9  1.8  3.9 1 1 
        240 1 . . . . . 4.48  1.8 4.48 1 1 
        241 1 . . . . . 4.16  1.8 4.16 1 1 
        242 1 . . . . . 3.42  1.8 3.42 1 1 
        243 1 . . . . . 5.81  1.8 5.81 1 1 
        244 1 . . . . . 4.54  1.8 4.54 1 1 
        245 1 . . . . .  6.0  1.8  6.0 1 1 
        246 1 . . . . .  6.0  1.8  6.0 1 1 
        247 1 . . . . . 5.81  1.8 5.81 1 1 
        248 1 . . . . . 3.34  1.8 3.34 1 1 
        249 1 . . . . . 4.88  1.8 4.88 1 1 
        250 1 . . . . . 4.71  1.8 4.71 1 1 
        251 1 . . . . . 3.32  1.8 3.32 1 1 
        252 1 . . . . . 3.55  1.8 3.55 1 1 
        253 1 . . . . . 3.59  1.8 3.59 1 1 
        254 1 . . . . . 4.16  1.8 4.16 1 1 
        255 1 . . . . . 4.16  1.8 4.16 1 1 
        256 1 . . . . . 4.37  1.8 4.37 1 1 
        257 1 . . . . . 3.39  1.8 3.39 1 1 
        258 1 . . . . .  5.6  1.8  5.6 1 1 
        259 1 . . . . . 4.22  1.8 4.22 1 1 
        260 1 . . . . . 3.59  1.8 3.59 1 1 
        261 1 . . . . . 4.41  1.8 4.41 1 1 
        262 1 . . . . . 4.41  1.8 4.41 1 1 
        263 1 . . . . . 3.57  1.8 3.57 1 1 
        264 1 . . . . .  6.0  1.8  6.0 1 1 
        265 1 . . . . . 3.75  1.8 3.75 1 1 
        266 1 . . . . .  6.0  1.8  6.0 1 1 
        267 1 . . . . .  5.1  1.8  5.1 1 1 
        268 1 . . . . . 4.36  1.8 4.36 1 1 
        269 1 . . . . . 3.65  1.8 3.65 1 1 
        270 1 . . . . . 5.05  1.8 5.05 1 1 
        271 1 . . . . . 4.31  1.8 4.31 1 1 
        272 1 . . . . .  6.0  1.8  6.0 1 1 
        273 1 . . . . .  6.0  1.8  6.0 1 1 
        274 1 . . . . .  3.8  1.8  3.8 1 1 
        275 1 . . . . .  5.3  1.8  5.3 1 1 
        276 1 . . . . . 3.71  1.8 3.71 1 1 
        277 1 . . . . . 4.46  1.8 4.46 1 1 
        278 1 . . . . . 5.83  1.8 5.83 1 1 
        279 1 . . . . . 4.39  1.8 4.39 1 1 
        280 1 . . . . . 4.06  1.8 4.06 1 1 
        281 1 . . . . . 3.56  1.8 3.56 1 1 
        282 1 . . . . . 4.06  1.8 4.06 1 1 
        283 1 . . . . . 5.14  1.8 5.14 1 1 
        284 1 . . . . . 4.42  1.8 4.42 1 1 
        285 1 . . . . . 5.14  1.8 5.14 1 1 
        286 1 . . . . . 3.81  1.8 3.81 1 1 
        287 1 . . . . .  6.0  1.8  6.0 1 1 
        288 1 . . . . . 3.65  1.8 3.65 1 1 
        289 1 . . . . . 4.98  1.8 4.98 1 1 
        290 1 . . . . . 3.65  1.8 3.65 1 1 
        291 1 . . . . . 5.61  1.8 5.61 1 1 
        292 1 . . . . . 5.81  1.8 5.81 1 1 
        293 1 . . . . . 4.41  1.8 4.41 1 1 
        294 1 . . . . . 5.81  1.8 5.81 1 1 
        295 1 . . . . . 5.13  1.8 5.13 1 1 
        296 1 . . . . . 5.13  1.8 5.13 1 1 
        297 1 . . . . .  5.0  1.8  5.0 1 1 
        298 1 . . . . . 3.91  1.8 3.91 1 1 
        299 1 . . . . . 3.96  1.8 3.96 1 1 
        300 1 . . . . . 5.65  1.8 5.65 1 1 
        301 1 . . . . . 3.32  1.8 3.32 1 1 
        302 1 . . . . . 5.34  1.8 5.34 1 1 
        303 1 . . . . . 4.95  1.8 4.95 1 1 
        304 1 . . . . . 3.28  1.8 3.28 1 1 
        305 1 . . . . .  6.0  1.8  6.0 1 1 
        306 1 . . . . .  6.0  1.8  6.0 1 1 
        307 1 . . . . .  6.0  1.8  6.0 1 1 
        308 1 . . . . .  4.1  1.8  4.1 1 1 
        309 1 . . . . .  6.0  1.8  6.0 1 1 
        310 1 . . . . . 2.68  1.8 2.68 1 1 
        311 1 . . . . . 4.93  1.8 4.93 1 1 
        312 1 . . . . .  6.0  1.8  6.0 1 1 
        313 1 . . . . .  6.0  1.8  6.0 1 1 
        314 1 . . . . . 5.25  1.8 5.25 1 1 
        315 1 . . . . .  5.4  1.8  5.4 1 1 
        316 1 . . . . . 5.81  1.8 5.81 1 1 
        317 1 . . . . . 4.98  1.8 4.98 1 1 
        318 1 . . . . . 3.17  1.8 3.17 1 1 
        319 1 . . . . . 5.81  1.8 5.81 1 1 
        320 1 . . . . .  6.0  1.8  6.0 1 1 
        321 1 . . . . .  6.0  1.8  6.0 1 1 
        322 1 . . . . .  5.4  1.8  5.4 1 1 
        323 1 . . . . .  6.0  1.8  6.0 1 1 
        324 1 . . . . . 5.86  1.8 5.86 1 1 
        325 1 . . . . . 5.75  1.8 5.75 1 1 
        326 1 . . . . . 4.15  1.8 4.15 1 1 
        327 1 . . . . . 5.61  1.8 5.61 1 1 
        328 1 . . . . . 3.64  1.8 3.64 1 1 
        329 1 . . . . .  6.0  1.8  6.0 1 1 
        330 1 . . . . . 4.13  1.8 4.13 1 1 
        331 1 . . . . .  6.0  1.8  6.0 1 1 
        332 1 . . . . .  6.0  1.8  6.0 1 1 
        333 1 . . . . .  6.0  1.8  6.0 1 1 
        334 1 . . . . . 4.28  1.8 4.28 1 1 
        335 1 . . . . . 5.61  1.8 5.61 1 1 
        336 1 . . . . . 4.01  1.8 4.01 1 1 
        337 1 . . . . . 4.48  1.8 4.48 1 1 
        338 1 . . . . . 4.41  1.8 4.41 1 1 
        339 1 . . . . .  6.0  1.8  6.0 1 1 
        340 1 . . . . . 4.48  1.8 4.48 1 1 
        341 1 . . . . . 3.88  1.8 3.88 1 1 
        342 1 . . . . . 3.96  1.8 3.96 1 1 
        343 1 . . . . . 5.77  1.8 5.77 1 1 
        344 1 . . . . . 4.44  1.8 4.44 1 1 
        345 1 . . . . . 5.81  1.8 5.81 1 1 
        346 1 . . . . . 3.89  1.8 3.89 1 1 
        347 1 . . . . .  5.2  1.8  5.2 1 1 
        348 1 . . . . . 4.12  1.8 4.12 1 1 
        349 1 . . . . .  5.2  1.8  5.2 1 1 
        350 1 . . . . . 5.73  1.8 5.73 1 1 
        351 1 . . . . . 4.39  1.8 4.39 1 1 
        352 1 . . . . .  6.0  1.8  6.0 1 1 
        353 1 . . . . . 5.03  1.8 5.03 1 1 
        354 1 . . . . . 3.91  1.8 3.91 1 1 
        355 1 . . . . . 5.81  1.8 5.81 1 1 
        356 1 . . . . .  6.0  1.8  6.0 1 1 
        357 1 . . . . . 3.88  1.8 3.88 1 1 
        358 1 . . . . .  3.3  1.8  3.3 1 1 
        359 1 . . . . . 3.88  1.8 3.88 1 1 
        360 1 . . . . . 4.91  1.8 4.91 1 1 
        361 1 . . . . . 3.85  1.8 3.85 1 1 
        362 1 . . . . .  6.0  1.8  6.0 1 1 
        363 1 . . . . . 4.05  1.8 4.05 1 1 
        364 1 . . . . . 5.72  1.8 5.72 1 1 
        365 1 . . . . . 4.36  1.8 4.36 1 1 
        366 1 . . . . .  6.0  1.8  6.0 1 1 
        367 1 . . . . . 4.43  1.8 4.43 1 1 
        368 1 . . . . .  6.0  1.8  6.0 1 1 
        369 1 . . . . . 4.17  1.8 4.17 1 1 
        370 1 . . . . .  6.0  1.8  6.0 1 1 
        371 1 . . . . . 5.84  1.8 5.84 1 1 
        372 1 . . . . .  6.0  1.8  6.0 1 1 
        373 1 . . . . . 3.92  1.8 3.92 1 1 
        374 1 . . . . .  6.0  1.8  6.0 1 1 
        375 1 . . . . . 3.35  1.8 3.35 1 1 
        376 1 . . . . . 4.78  1.8 4.78 1 1 
        377 1 . . . . . 4.87  1.8 4.87 1 1 
        378 1 . . . . . 4.15  1.8 4.15 1 1 
        379 1 . . . . .  6.0  1.8  6.0 1 1 
        380 1 . . . . . 5.63  1.8 5.63 1 1 
        381 1 . . . . . 4.44  1.8 4.44 1 1 
        382 1 . . . . . 5.41  1.8 5.41 1 1 
        383 1 . . . . . 5.38  1.8 5.38 1 1 
        384 1 . . . . .  5.6  1.8  5.6 1 1 
        385 1 . . . . .  6.0  1.8  6.0 1 1 
        386 1 . . . . . 5.13  1.8 5.13 1 1 
        387 1 . . . . .  6.0  1.8  6.0 1 1 
        388 1 . . . . . 5.78  1.8 5.78 1 1 
        389 1 . . . . . 4.43  1.8 4.43 1 1 
        390 1 . . . . . 4.17  1.8 4.17 1 1 
        391 1 . . . . . 5.11  1.8 5.11 1 1 
        392 1 . . . . .  6.0  1.8  6.0 1 1 
        393 1 . . . . . 4.34  1.8 4.34 1 1 
        394 1 . . . . .  5.4  1.8  5.4 1 1 
        395 1 . . . . . 5.34  1.8 5.34 1 1 
        396 1 . . . . .  6.0  1.8  6.0 1 1 
        397 1 . . . . . 4.23  1.8 4.23 1 1 
        398 1 . . . . . 3.14  1.8 3.14 1 1 
        399 1 . . . . . 4.08  1.8 4.08 1 1 
        400 1 . . . . .  3.7  1.8  3.7 1 1 
        401 1 . . . . . 4.85  1.8 4.85 1 1 
        402 1 . . . . . 5.92  1.8 5.92 1 1 
        403 1 . . . . . 3.77  1.8 3.77 1 1 
        404 1 . . . . .  3.4  1.8  3.4 1 1 
        405 1 . . . . . 3.55  1.8 3.55 1 1 
        406 1 . . . . . 4.65  1.8 4.65 1 1 
        407 1 . . . . . 5.39  1.8 5.39 1 1 
        408 1 . . . . . 4.49  1.8 4.49 1 1 
        409 1 . . . . . 5.39  1.8 5.39 1 1 
        410 1 . . . . . 3.53  1.8 3.53 1 1 
        411 1 . . . . . 2.77  1.8 2.77 1 1 
        412 1 . . . . . 3.53  1.8 3.53 1 1 
        413 1 . . . . .  6.0  1.8  6.0 1 1 
        414 1 . . . . . 5.52  1.8 5.52 1 1 
        415 1 . . . . .  6.0  1.8  6.0 1 1 
        416 1 . . . . . 4.58  1.8 4.58 1 1 
        417 1 . . . . . 4.93  1.8 4.93 1 1 
        418 1 . . . . . 4.41  1.8 4.41 1 1 
        419 1 . . . . . 3.19  1.8 3.19 1 1 
        420 1 . . . . . 3.47  1.8 3.47 1 1 
        421 1 . . . . . 5.24  1.8 5.24 1 1 
        422 1 . . . . . 4.87  1.8 4.87 1 1 
        423 1 . . . . . 3.85  1.8 3.85 1 1 
        424 1 . . . . . 3.95  1.8 3.95 1 1 
        425 1 . . . . . 2.99  1.8 2.99 1 1 
        426 1 . . . . . 5.25  1.8 5.25 1 1 
        427 1 . . . . . 5.51  1.8 5.51 1 1 
        428 1 . . . . . 5.52  1.8 5.52 1 1 
        429 1 . . . . . 3.18  1.8 3.18 1 1 
        430 1 . . . . . 4.63  1.8 4.63 1 1 
        431 1 . . . . .  6.0  1.8  6.0 1 1 
        432 1 . . . . . 4.63  1.8 4.63 1 1 
        433 1 . . . . .  6.0  1.8  6.0 1 1 
        434 1 . . . . . 3.11  1.8 3.11 1 1 
        435 1 . . . . . 3.87  1.8 3.87 1 1 
        436 1 . . . . . 5.04  1.8 5.04 1 1 
        437 1 . . . . . 5.93  1.8 5.93 1 1 
        438 1 . . . . .  6.0  1.8  6.0 1 1 
        439 1 . . . . .  6.0  1.8  6.0 1 1 
        440 1 . . . . . 5.18  1.8 5.18 1 1 
        441 1 . . . . .  6.0  1.8  6.0 1 1 
        442 1 . . . . . 4.41  1.8 4.41 1 1 
        443 1 . . . . . 4.15  1.8 4.15 1 1 
        444 1 . . . . . 5.92  1.8 5.92 1 1 
        445 1 . . . . .  6.0  1.8  6.0 1 1 
        446 1 . . . . . 5.92  1.8 5.92 1 1 
        447 1 . . . . . 5.57  1.8 5.57 1 1 
        448 1 . . . . . 3.42  1.8 3.42 1 1 
        449 1 . . . . . 3.32  1.8 3.32 1 1 
        450 1 . . . . . 3.98  1.8 3.98 1 1 
        451 1 . . . . .  6.0  1.8  6.0 1 1 
        452 1 . . . . .  6.0  1.8  6.0 1 1 
        453 1 . . . . .  5.6  1.8  5.6 1 1 
        454 1 . . . . . 5.92  1.8 5.92 1 1 
        455 1 . . . . . 5.92  1.8 5.92 1 1 
        456 1 . . . . .  3.3  1.8  3.3 1 1 
        457 1 . . . . . 5.81  1.8 5.81 1 1 
        458 1 . . . . . 5.78  1.8 5.78 1 1 
        459 1 . . . . . 5.81  1.8 5.81 1 1 
        460 1 . . . . . 3.99  1.8 3.99 1 1 
        461 1 . . . . . 3.76  1.8 3.76 1 1 
        462 1 . . . . . 5.33  1.8 5.33 1 1 
        463 1 . . . . . 5.35  1.8 5.35 1 1 
        464 1 . . . . . 5.53  1.8 5.53 1 1 
        465 1 . . . . . 5.56  1.8 5.56 1 1 
        466 1 . . . . . 5.84  1.8 5.84 1 1 
        467 1 . . . . . 3.55  1.8 3.55 1 1 
        468 1 . . . . .  6.0  1.8  6.0 1 1 
        469 1 . . . . . 5.92  1.8 5.92 1 1 
        470 1 . . . . . 4.55  1.8 4.55 1 1 
        471 1 . . . . .  4.6  1.8  4.6 1 1 
        472 1 . . . . .  5.1  1.8  5.1 1 1 
        473 1 . . . . .  6.0  1.8  6.0 1 1 
        474 1 . . . . .  6.0  1.8  6.0 1 1 
        475 1 . . . . . 5.81  1.8 5.81 1 1 
        476 1 . . . . . 5.81  1.8 5.81 1 1 
        477 1 . . . . .  6.0  1.8  6.0 1 1 
        478 1 . . . . . 3.06  1.8 3.06 1 1 
        479 1 . . . . . 3.85  1.8 3.85 1 1 
        480 1 . . . . . 3.55  1.8 3.55 1 1 
        481 1 . . . . . 5.54  1.8 5.54 1 1 
        482 1 . . . . . 3.95  1.8 3.95 1 1 
        483 1 . . . . . 4.56  1.8 4.56 1 1 
        484 1 . . . . . 5.42  1.8 5.42 1 1 
        485 1 . . . . . 4.31  1.8 4.31 1 1 
        486 1 . . . . . 5.92  1.8 5.92 1 1 
        487 1 . . . . .  5.1  1.8  5.1 1 1 
        488 1 . . . . . 4.81  1.8 4.81 1 1 
        489 1 . . . . . 5.92  1.8 5.92 1 1 
        490 1 . . . . . 5.92  1.8 5.92 1 1 
        491 1 . . . . . 4.09  1.8 4.09 1 1 
        492 1 . . . . . 3.52  1.8 3.52 1 1 
        493 1 . . . . . 4.09  1.8 4.09 1 1 
        494 1 . . . . . 3.93  1.8 3.93 1 1 
        495 1 . . . . . 5.16  1.8 5.16 1 1 
        496 1 . . . . . 5.81  1.8 5.81 1 1 
        497 1 . . . . . 3.12  1.8 3.12 1 1 
        498 1 . . . . .  4.5  1.8  4.5 1 1 
        499 1 . . . . . 4.21  1.8 4.21 1 1 
        500 1 . . . . . 5.64  1.8 5.64 1 1 
        501 1 . . . . . 5.92  1.8 5.92 1 1 
        502 1 . . . . . 5.86  1.8 5.86 1 1 
        503 1 . . . . . 3.96  1.8 3.96 1 1 
        504 1 . . . . . 5.73  1.8 5.73 1 1 
        505 1 . . . . . 5.73  1.8 5.73 1 1 
        506 1 . . . . . 4.47  1.8 4.47 1 1 
        507 1 . . . . . 5.73  1.8 5.73 1 1 
        508 1 . . . . . 5.92  1.8 5.92 1 1 
        509 1 . . . . . 5.66  1.8 5.66 1 1 
        510 1 . . . . . 5.77  1.8 5.77 1 1 
        511 1 . . . . . 4.87  1.8 4.87 1 1 
        512 1 . . . . . 3.67  1.8 3.67 1 1 
        513 1 . . . . . 5.19  1.8 5.19 1 1 
        514 1 . . . . . 5.19  1.8 5.19 1 1 
        515 1 . . . . . 3.37  1.8 3.37 1 1 
        516 1 . . . . . 5.33  1.8 5.33 1 1 
        517 1 . . . . . 2.44  1.8 2.44 1 1 
        518 1 . . . . . 3.55  1.8 3.55 1 1 
        519 1 . . . . . 3.23  1.8 3.23 1 1 
        520 1 . . . . . 4.68  1.8 4.68 1 1 
        521 1 . . . . . 5.87  1.8 5.87 1 1 
        522 1 . . . . . 4.73  1.8 4.73 1 1 
        523 1 . . . . . 5.81  1.8 5.81 1 1 
        524 1 . . . . .  6.0  1.8  6.0 1 1 
        525 1 . . . . . 3.71  1.8 3.71 1 1 
        526 1 . . . . . 4.21  1.8 4.21 1 1 
        527 1 . . . . .  4.4  1.8  4.4 1 1 
        528 1 . . . . . 5.61  1.8 5.61 1 1 
        529 1 . . . . . 5.81  1.8 5.81 1 1 
        530 1 . . . . . 3.73  1.8 3.73 1 1 
        531 1 . . . . . 5.81  1.8 5.81 1 1 
        532 1 . . . . . 4.15  1.8 4.15 1 1 
        533 1 . . . . . 5.84  1.8 5.84 1 1 
        534 1 . . . . . 2.93  1.8 2.93 1 1 
        535 1 . . . . . 3.08  1.8 3.08 1 1 
        536 1 . . . . . 4.91  1.8 4.91 1 1 
        537 1 . . . . . 4.91  1.8 4.91 1 1 
        538 1 . . . . . 5.36  1.8 5.36 1 1 
        539 1 . . . . . 3.23  1.8 3.23 1 1 
        540 1 . . . . . 5.53  1.8 5.53 1 1 
        541 1 . . . . . 5.29  1.8 5.29 1 1 
        542 1 . . . . .  6.0  1.8  6.0 1 1 
        543 1 . . . . . 3.78  1.8 3.78 1 1 
        544 1 . . . . . 3.55  1.8 3.55 1 1 
        545 1 . . . . . 3.66  1.8 3.66 1 1 
        546 1 . . . . . 5.69  1.8 5.69 1 1 
        547 1 . . . . . 2.44  1.8 2.44 1 1 
        548 1 . . . . . 5.81  1.8 5.81 1 1 
        549 1 . . . . . 3.28  1.8 3.28 1 1 
        550 1 . . . . . 3.28  1.8 3.28 1 1 
        551 1 . . . . . 3.28  1.8 3.28 1 1 
        552 1 . . . . . 3.28  1.8 3.28 1 1 
        553 1 . . . . . 5.47  1.8 5.47 1 1 
        554 1 . . . . .  6.0  1.8  6.0 1 1 
        555 1 . . . . . 3.74  1.8 3.74 1 1 
        556 1 . . . . . 4.21  1.8 4.21 1 1 
        557 1 . . . . . 5.37  1.8 5.37 1 1 
        558 1 . . . . . 4.92  1.8 4.92 1 1 
        559 1 . . . . . 3.72  1.8 3.72 1 1 
        560 1 . . . . . 4.92  1.8 4.92 1 1 
        561 1 . . . . . 3.59  1.8 3.59 1 1 
        562 1 . . . . . 3.28  1.8 3.28 1 1 
        563 1 . . . . . 5.81  1.8 5.81 1 1 
        564 1 . . . . . 4.87  1.8 4.87 1 1 
        565 1 . . . . .  6.0  1.8  6.0 1 1 
        566 1 . . . . . 4.45  1.8 4.45 1 1 
        567 1 . . . . . 5.52  1.8 5.52 1 1 
        568 1 . . . . . 3.95  1.8 3.95 1 1 
        569 1 . . . . . 3.72  1.8 3.72 1 1 
        570 1 . . . . .  6.0  1.8  6.0 1 1 
        571 1 . . . . .  6.0  1.8  6.0 1 1 
        572 1 . . . . . 2.79  1.8 2.79 1 1 
        573 1 . . . . . 2.41  1.8 2.41 1 1 
        574 1 . . . . . 2.79  1.8 2.79 1 1 
        575 1 . . . . . 4.99  1.8 4.99 1 1 
        576 1 . . . . . 3.41  1.8 3.41 1 1 
        577 1 . . . . . 4.08  1.8 4.08 1 1 
        578 1 . . . . . 4.56  1.8 4.56 1 1 
        579 1 . . . . .  6.0  1.8  6.0 1 1 
        580 1 . . . . .  6.0  1.8  6.0 1 1 
        581 1 . . . . . 5.55  1.8 5.55 1 1 
        582 1 . . . . . 4.66  1.8 4.66 1 1 
        583 1 . . . . . 5.55  1.8 5.55 1 1 
        584 1 . . . . . 4.73  1.8 4.73 1 1 
        585 1 . . . . . 3.11  1.8 3.11 1 1 
        586 1 . . . . . 5.24  1.8 5.24 1 1 
        587 1 . . . . . 3.64  1.8 3.64 1 1 
        588 1 . . . . . 3.96  1.8 3.96 1 1 
        589 1 . . . . . 4.57  1.8 4.57 1 1 
        590 1 . . . . . 3.02  1.8 3.02 1 1 
        591 1 . . . . . 2.38  1.8 2.38 1 1 
        592 1 . . . . . 5.81  1.8 5.81 1 1 
        593 1 . . . . . 5.81  1.8 5.81 1 1 
        594 1 . . . . . 4.16  1.8 4.16 1 1 
        595 1 . . . . . 4.62  1.8 4.62 1 1 
        596 1 . . . . . 5.27  1.8 5.27 1 1 
        597 1 . . . . . 5.27  1.8 5.27 1 1 
        598 1 . . . . . 3.83  1.8 3.83 1 1 
        599 1 . . . . . 4.76  1.8 4.76 1 1 
        600 1 . . . . . 4.54  1.8 4.54 1 1 
        601 1 . . . . . 4.24  1.8 4.24 1 1 
        602 1 . . . . . 3.37  1.8 3.37 1 1 
        603 1 . . . . . 4.79  1.8 4.79 1 1 
        604 1 . . . . . 4.14  1.8 4.14 1 1 
        605 1 . . . . . 3.53  1.8 3.53 1 1 
        606 1 . . . . . 4.14  1.8 4.14 1 1 
        607 1 . . . . . 4.18  1.8 4.18 1 1 
        608 1 . . . . .  5.7  1.8  5.7 1 1 
        609 1 . . . . .  6.0  1.8  6.0 1 1 
        610 1 . . . . . 4.98  1.8 4.98 1 1 
        611 1 . . . . . 5.15  1.8 5.15 1 1 
        612 1 . . . . . 5.24  1.8 5.24 1 1 
        613 1 . . . . . 4.67  1.8 4.67 1 1 
        614 1 . . . . . 5.27  1.8 5.27 1 1 
        615 1 . . . . . 4.19  1.8 4.19 1 1 
        616 1 . . . . . 5.27  1.8 5.27 1 1 
        617 1 . . . . . 3.56  1.8 3.56 1 1 
        618 1 . . . . . 5.09  1.8 5.09 1 1 
        619 1 . . . . . 5.81  1.8 5.81 1 1 
        620 1 . . . . . 4.89  1.8 4.89 1 1 
        621 1 . . . . . 5.81  1.8 5.81 1 1 
        622 1 . . . . . 4.19  1.8 4.19 1 1 
        623 1 . . . . . 4.12  1.8 4.12 1 1 
        624 1 . . . . . 3.44  1.8 3.44 1 1 
        625 1 . . . . . 3.87  1.8 3.87 1 1 
        626 1 . . . . .  6.0  1.8  6.0 1 1 
        627 1 . . . . . 4.91  1.8 4.91 1 1 
        628 1 . . . . . 4.98  1.8 4.98 1 1 
        629 1 . . . . . 4.38  1.8 4.38 1 1 
        630 1 . . . . . 4.61  1.8 4.61 1 1 
        631 1 . . . . .  6.0  1.8  6.0 1 1 
        632 1 . . . . . 3.62  1.8 3.62 1 1 
        633 1 . . . . . 5.44  1.8 5.44 1 1 
        634 1 . . . . . 3.87  1.8 3.87 1 1 
        635 1 . . . . . 3.21  1.8 3.21 1 1 
        636 1 . . . . . 3.87  1.8 3.87 1 1 
        637 1 . . . . . 4.13  1.8 4.13 1 1 
        638 1 . . . . . 4.77  1.8 4.77 1 1 
        639 1 . . . . . 5.25  1.8 5.25 1 1 
        640 1 . . . . .  6.0  1.8  6.0 1 1 
        641 1 . . . . . 3.27  1.8 3.27 1 1 
        642 1 . . . . . 2.78  1.8 2.78 1 1 
        643 1 . . . . . 3.27  1.8 3.27 1 1 
        644 1 . . . . . 4.33  1.8 4.33 1 1 
        645 1 . . . . . 4.85  1.8 4.85 1 1 
        646 1 . . . . . 4.56  1.8 4.56 1 1 
        647 1 . . . . . 3.46  1.8 3.46 1 1 
        648 1 . . . . . 5.92  1.8 5.92 1 1 
        649 1 . . . . . 5.92  1.8 5.92 1 1 
        650 1 . . . . . 5.92  1.8 5.92 1 1 
        651 1 . . . . . 5.06  1.8 5.06 1 1 
        652 1 . . . . .  3.7  1.8  3.7 1 1 
        653 1 . . . . . 3.63  1.8 3.63 1 1 
        654 1 . . . . . 4.08  1.8 4.08 1 1 
        655 1 . . . . .  6.0  1.8  6.0 1 1 
        656 1 . . . . . 5.14  1.8 5.14 1 1 
        657 1 . . . . . 4.42  1.8 4.42 1 1 
        658 1 . . . . .  5.6  1.8  5.6 1 1 
        659 1 . . . . . 3.45  1.8 3.45 1 1 
        660 1 . . . . . 3.02  1.8 3.02 1 1 
        661 1 . . . . . 3.45  1.8 3.45 1 1 
        662 1 . . . . . 4.36  1.8 4.36 1 1 
        663 1 . . . . . 5.38  1.8 5.38 1 1 
        664 1 . . . . . 4.56  1.8 4.56 1 1 
        665 1 . . . . . 5.27  1.8 5.27 1 1 
        666 1 . . . . . 3.44  1.8 3.44 1 1 
        667 1 . . . . . 3.63  1.8 3.63 1 1 
        668 1 . . . . . 3.96  1.8 3.96 1 1 
        669 1 . . . . . 4.78  1.8 4.78 1 1 
        670 1 . . . . . 5.34  1.8 5.34 1 1 
        671 1 . . . . . 4.81  1.8 4.81 1 1 
        672 1 . . . . . 5.92  1.8 5.92 1 1 
        673 1 . . . . . 3.19  1.8 3.19 1 1 
        674 1 . . . . . 4.53  1.8 4.53 1 1 
        675 1 . . . . . 3.88  1.8 3.88 1 1 
        676 1 . . . . . 4.53  1.8 4.53 1 1 
        677 1 . . . . . 3.79  1.8 3.79 1 1 
        678 1 . . . . . 5.39  1.8 5.39 1 1 
        679 1 . . . . .  6.0  1.8  6.0 1 1 
        680 1 . . . . . 4.64  1.8 4.64 1 1 
        681 1 . . . . . 4.21  1.8 4.21 1 1 
        682 1 . . . . . 3.45  1.8 3.45 1 1 
        683 1 . . . . . 4.21  1.8 4.21 1 1 
        684 1 . . . . . 4.51  1.8 4.51 1 1 
        685 1 . . . . . 4.44  1.8 4.44 1 1 
        686 1 . . . . .  6.0  1.8  6.0 1 1 
        687 1 . . . . . 2.67  1.8 2.67 1 1 
        688 1 . . . . . 5.27  1.8 5.27 1 1 
        689 1 . . . . . 5.92  1.8 5.92 1 1 
        690 1 . . . . . 4.14  1.8 4.14 1 1 
        691 1 . . . . . 3.97  1.8 3.97 1 1 
        692 1 . . . . .  4.8  1.8  4.8 1 1 
        693 1 . . . . .  3.7  1.8  3.7 1 1 
        694 1 . . . . . 4.19  1.8 4.19 1 1 
        695 1 . . . . . 4.12  1.8 4.12 1 1 
        696 1 . . . . . 5.27  1.8 5.27 1 1 
        697 1 . . . . . 5.17  1.8 5.17 1 1 
        698 1 . . . . . 5.27  1.8 5.27 1 1 
        699 1 . . . . . 5.17  1.8 5.17 1 1 
        700 1 . . . . . 5.27  1.8 5.27 1 1 
        701 1 . . . . . 3.73  1.8 3.73 1 1 
        702 1 . . . . . 4.11  1.8 4.11 1 1 
        703 1 . . . . . 5.09  1.8 5.09 1 1 
        704 1 . . . . . 5.81  1.8 5.81 1 1 
        705 1 . . . . . 5.82  1.8 5.82 1 1 
        706 1 . . . . .  4.9  1.8  4.9 1 1 
        707 1 . . . . . 3.63  1.8 3.63 1 1 
        708 1 . . . . . 4.49  1.8 4.49 1 1 
        709 1 . . . . . 5.81  1.8 5.81 1 1 
        710 1 . . . . . 2.05  1.8 2.05 1 1 
        711 1 . . . . . 2.36  1.8 2.36 1 1 
        712 1 . . . . . 2.36  1.8 2.36 1 1 
        713 1 . . . . . 2.95  1.8 2.95 1 1 
        714 1 . . . . . 5.81  1.8 5.81 1 1 
        715 1 . . . . . 3.65  1.8 3.65 1 1 
        716 1 . . . . .  6.0  1.8  6.0 1 1 
        717 1 . . . . . 5.31  1.8 5.31 1 1 
        718 1 . . . . . 5.64  1.8 5.64 1 1 
        719 1 . . . . . 4.84  1.8 4.84 1 1 
        720 1 . . . . . 5.19  1.8 5.19 1 1 
        721 1 . . . . . 4.26  1.8 4.26 1 1 
        722 1 . . . . . 5.92  1.8 5.92 1 1 
        723 1 . . . . . 3.48  1.8 3.48 1 1 
        724 1 . . . . .  6.0  1.8  6.0 1 1 
        725 1 . . . . . 4.52  1.8 4.52 1 1 
        726 1 . . . . .  6.0  1.8  6.0 1 1 
        727 1 . . . . .  6.0  1.8  6.0 1 1 
        728 1 . . . . . 5.77  1.8 5.77 1 1 
        729 1 . . . . . 4.04  1.8 4.04 1 1 
        730 1 . . . . .  6.0  1.8  6.0 1 1 
        731 1 . . . . .  6.0  1.8  6.0 1 1 
        732 1 . . . . . 5.81  1.8 5.81 1 1 
        733 1 . . . . . 4.29  1.8 4.29 1 1 
        734 1 . . . . .  6.0  1.8  6.0 1 1 
        735 1 . . . . . 4.87  1.8 4.87 1 1 
        736 1 . . . . . 3.67  1.8 3.67 1 1 
        737 1 . . . . . 3.73  1.8 3.73 1 1 
        738 1 . . . . .  4.8  1.8  4.8 1 1 
        739 1 . . . . . 4.14  1.8 4.14 1 1 
        740 1 . . . . . 4.98  1.8 4.98 1 1 
        741 1 . . . . . 4.16  1.8 4.16 1 1 
        742 1 . . . . . 4.98  1.8 4.98 1 1 
        743 1 . . . . . 3.82  1.8 3.82 1 1 
        744 1 . . . . .  6.0  1.8  6.0 1 1 
        745 1 . . . . . 3.81  1.8 3.81 1 1 
        746 1 . . . . .  6.0  1.8  6.0 1 1 
        747 1 . . . . . 5.81  1.8 5.81 1 1 
        748 1 . . . . . 4.82  1.8 4.82 1 1 
        749 1 . . . . . 4.09  1.8 4.09 1 1 
        750 1 . . . . .  6.0  1.8  6.0 1 1 
        751 1 . . . . .  6.0  1.8  6.0 1 1 
        752 1 . . . . .  6.0  1.8  6.0 1 1 
        753 1 . . . . .  6.0  1.8  6.0 1 1 
        754 1 . . . . .  5.5  1.8  5.5 1 1 
        755 1 . . . . . 5.78  1.8 5.78 1 1 
        756 1 . . . . . 5.81  1.8 5.81 1 1 
        757 1 . . . . . 5.61  1.8 5.61 1 1 
        758 1 . . . . . 5.81  1.8 5.81 1 1 
        759 1 . . . . . 5.81  1.8 5.81 1 1 
        760 1 . . . . . 5.18  1.8 5.18 1 1 
        761 1 . . . . . 5.06  1.8 5.06 1 1 
        762 1 . . . . . 3.41  1.8 3.41 1 1 
        763 1 . . . . . 3.49  1.8 3.49 1 1 
        764 1 . . . . .  6.0  1.8  6.0 1 1 
        765 1 . . . . . 3.56  1.8 3.56 1 1 
        766 1 . . . . .  6.0  1.8  6.0 1 1 
        767 1 . . . . . 4.03  1.8 4.03 1 1 
        768 1 . . . . .  4.1  1.8  4.1 1 1 
        769 1 . . . . . 5.61  1.8 5.61 1 1 
        770 1 . . . . . 3.73  1.8 3.73 1 1 
        771 1 . . . . . 5.81  1.8 5.81 1 1 
        772 1 . . . . . 5.32  1.8 5.32 1 1 
        773 1 . . . . . 5.41  1.8 5.41 1 1 
        774 1 . . . . . 4.21  1.8 4.21 1 1 
        775 1 . . . . . 4.56  1.8 4.56 1 1 
        776 1 . . . . .  6.0  1.8  6.0 1 1 
        777 1 . . . . . 4.25  1.8 4.25 1 1 
        778 1 . . . . .  6.0  1.8  6.0 1 1 
        779 1 . . . . . 5.81  1.8 5.81 1 1 
        780 1 . . . . . 5.81  1.8 5.81 1 1 
        781 1 . . . . .  6.0  1.8  6.0 1 1 
        782 1 . . . . . 3.57  1.8 3.57 1 1 
        783 1 . . . . . 4.23  1.8 4.23 1 1 
        784 1 . . . . . 4.38  1.8 4.38 1 1 
        785 1 . . . . . 4.83  1.8 4.83 1 1 
        786 1 . . . . . 3.95  1.8 3.95 1 1 
        787 1 . . . . .  6.0  1.8  6.0 1 1 
        788 1 . . . . .  6.0  1.8  6.0 1 1 
        789 1 . . . . . 3.84  1.8 3.84 1 1 
        790 1 . . . . . 4.04  1.8 4.04 1 1 
        791 1 . . . . . 3.41  1.8 3.41 1 1 
        792 1 . . . . . 5.61  1.8 5.61 1 1 
        793 1 . . . . . 4.71  1.8 4.71 1 1 
        794 1 . . . . .  6.0  1.8  6.0 1 1 
        795 1 . . . . . 4.17  1.8 4.17 1 1 
        796 1 . . . . .  3.7  1.8  3.7 1 1 
        797 1 . . . . .  3.1  1.8  3.1 1 1 
        798 1 . . . . .  3.7  1.8  3.7 1 1 
        799 1 . . . . . 4.66  1.8 4.66 1 1 
        800 1 . . . . . 2.95  1.8 2.95 1 1 
        801 1 . . . . . 3.43  1.8 3.43 1 1 
        802 1 . . . . .  6.0  1.8  6.0 1 1 
        803 1 . . . . .  6.0  1.8  6.0 1 1 
        804 1 . . . . . 3.71  1.8 3.71 1 1 
        805 1 . . . . . 4.23  1.8 4.23 1 1 
        806 1 . . . . . 5.92  1.8 5.92 1 1 
        807 1 . . . . . 3.12  1.8 3.12 1 1 
        808 1 . . . . . 3.66  1.8 3.66 1 1 
        809 1 . . . . . 3.61  1.8 3.61 1 1 
        810 1 . . . . .  6.0  1.8  6.0 1 1 
        811 1 . . . . . 5.15  1.8 5.15 1 1 
        812 1 . . . . . 5.49  1.8 5.49 1 1 
        813 1 . . . . . 5.81  1.8 5.81 1 1 
        814 1 . . . . . 4.81  1.8 4.81 1 1 
        815 1 . . . . . 3.44  1.8 3.44 1 1 
        816 1 . . . . . 4.29  1.8 4.29 1 1 
        817 1 . . . . . 4.15  1.8 4.15 1 1 
        818 1 . . . . . 5.81  1.8 5.81 1 1 
        819 1 . . . . . 5.81  1.8 5.81 1 1 
        820 1 . . . . . 4.52  1.8 4.52 1 1 
        821 1 . . . . .  6.0  1.8  6.0 1 1 
        822 1 . . . . . 4.99  1.8 4.99 1 1 
        823 1 . . . . . 3.64  1.8 3.64 1 1 
        824 1 . . . . . 2.93  1.8 2.93 1 1 
        825 1 . . . . . 4.33  1.8 4.33 1 1 
        826 1 . . . . . 4.88  1.8 4.88 1 1 
        827 1 . . . . . 5.81  1.8 5.81 1 1 
        828 1 . . . . .  6.0  1.8  6.0 1 1 
        829 1 . . . . .  6.0  1.8  6.0 1 1 
        830 1 . . . . . 3.03  1.8 3.03 1 1 
        831 1 . . . . . 3.39  1.8 3.39 1 1 
        832 1 . . . . . 3.52  1.8 3.52 1 1 
        833 1 . . . . . 4.46  1.8 4.46 1 1 
        834 1 . . . . . 4.68  1.8 4.68 1 1 
        835 1 . . . . . 2.58  1.8 2.58 1 1 
        836 1 . . . . . 3.33  1.8 3.33 1 1 
        837 1 . . . . . 5.04  1.8 5.04 1 1 
        838 1 . . . . . 5.81  1.8 5.81 1 1 
        839 1 . . . . . 4.75  1.8 4.75 1 1 
        840 1 . . . . .  3.1  1.8  3.1 1 1 
        841 1 . . . . . 5.24  1.8 5.24 1 1 
        842 1 . . . . . 3.05  1.8 3.05 1 1 
        843 1 . . . . . 3.81  1.8 3.81 1 1 
        844 1 . . . . .  2.6  1.8  2.6 1 1 
        845 1 . . . . . 3.08  1.8 3.08 1 1 
        846 1 . . . . . 4.13  1.8 4.13 1 1 
        847 1 . . . . . 4.13  1.8 4.13 1 1 
        848 1 . . . . . 3.06  1.8 3.06 1 1 
        849 1 . . . . . 5.81  1.8 5.81 1 1 
        850 1 . . . . . 3.07  1.8 3.07 1 1 
        851 1 . . . . . 4.87  1.8 4.87 1 1 
        852 1 . . . . . 3.89  1.8 3.89 1 1 
        853 1 . . . . . 5.61  1.8 5.61 1 1 
        854 1 . . . . . 4.02  1.8 4.02 1 1 
        855 1 . . . . . 3.48  1.8 3.48 1 1 
        856 1 . . . . . 4.02  1.8 4.02 1 1 
        857 1 . . . . . 4.16  1.8 4.16 1 1 
        858 1 . . . . .  6.0  1.8  6.0 1 1 
        859 1 . . . . .  6.0  1.8  6.0 1 1 
        860 1 . . . . . 3.61  1.8 3.61 1 1 
        861 1 . . . . . 3.57  1.8 3.57 1 1 
        862 1 . . . . .  3.9  1.8  3.9 1 1 
        863 1 . . . . . 5.73  1.8 5.73 1 1 
        864 1 . . . . .  3.0  1.8  3.0 1 1 
        865 1 . . . . . 4.53  1.8 4.53 1 1 
        866 1 . . . . . 4.49  1.8 4.49 1 1 
        867 1 . . . . . 5.81  1.8 5.81 1 1 
        868 1 . . . . . 3.48  1.8 3.48 1 1 
        869 1 . . . . . 3.51  1.8 3.51 1 1 
        870 1 . . . . . 3.22  1.8 3.22 1 1 
        871 1 . . . . . 5.34  1.8 5.34 1 1 
        872 1 . . . . .  2.7  1.8  2.7 1 1 
        873 1 . . . . . 4.12  1.8 4.12 1 1 
        874 1 . . . . .  5.1  1.8  5.1 1 1 
        875 1 . . . . . 4.67  1.8 4.67 1 1 
        876 1 . . . . .  5.8  1.8  5.8 1 1 
        877 1 . . . . . 5.73  1.8 5.73 1 1 
        878 1 . . . . . 4.46  1.8 4.46 1 1 
        879 1 . . . . . 3.19  1.8 3.19 1 1 
        880 1 . . . . . 3.71  1.8 3.71 1 1 
        881 1 . . . . . 4.11  1.8 4.11 1 1 
        882 1 . . . . . 3.53  1.8 3.53 1 1 
        883 1 . . . . . 4.11  1.8 4.11 1 1 
        884 1 . . . . . 3.37  1.8 3.37 1 1 
        885 1 . . . . . 5.81  1.8 5.81 1 1 
        886 1 . . . . . 4.45  1.8 4.45 1 1 
        887 1 . . . . . 5.08  1.8 5.08 1 1 
        888 1 . . . . . 5.08  1.8 5.08 1 1 
        889 1 . . . . .  6.0  1.8  6.0 1 1 
        890 1 . . . . . 3.44  1.8 3.44 1 1 
        891 1 . . . . . 4.61  1.8 4.61 1 1 
        892 1 . . . . . 4.47  1.8 4.47 1 1 
        893 1 . . . . . 5.84 1.86 5.84 1 1 
        894 1 . . . . . 5.79  1.8 5.79 1 1 
        895 1 . . . . . 3.57  1.8 3.57 1 1 
        896 1 . . . . .  4.5  1.8  4.5 1 1 
        897 1 . . . . . 4.88  1.8 4.88 1 1 
        898 1 . . . . .  6.0  1.8  6.0 1 1 
        899 1 . . . . .  5.0  1.8  5.0 1 1 
        900 1 . . . . . 5.26  1.8 5.26 1 1 
        901 1 . . . . . 4.34  1.8 4.34 1 1 
        902 1 . . . . . 3.68  1.8 3.68 1 1 
        903 1 . . . . . 4.34  1.8 4.34 1 1 
        904 1 . . . . .  6.0  1.8  6.0 1 1 
        905 1 . . . . . 5.06  1.8 5.06 1 1 
        906 1 . . . . . 4.82  1.8 4.82 1 1 
        907 1 . . . . .  2.8  1.8  2.8 1 1 
        908 1 . . . . . 4.37  1.8 4.37 1 1 
        909 1 . . . . . 4.06  1.8 4.06 1 1 
        910 1 . . . . . 4.15  1.8 4.15 1 1 
        911 1 . . . . . 5.59  1.8 5.59 1 1 
        912 1 . . . . . 4.75  1.8 4.75 1 1 
        913 1 . . . . .  6.0  1.8  6.0 1 1 
        914 1 . . . . . 4.98  1.8 4.98 1 1 
        915 1 . . . . . 5.59  1.8 5.59 1 1 
        916 1 . . . . . 4.75  1.8 4.75 1 1 
        917 1 . . . . .  6.0  1.8  6.0 1 1 
        918 1 . . . . . 4.98  1.8 4.98 1 1 
        919 1 . . . . .  6.0  1.8  6.0 1 1 
        920 1 . . . . . 4.07  1.8 4.07 1 1 
        921 1 . . . . .  4.2  1.8  4.2 1 1 
        922 1 . . . . .  6.0  1.8  6.0 1 1 
        923 1 . . . . . 3.73  1.8 3.73 1 1 
        924 1 . . . . . 4.84  1.8 4.84 1 1 
        925 1 . . . . . 4.79  1.8 4.79 1 1 
        926 1 . . . . . 5.69  1.8 5.69 1 1 
        927 1 . . . . . 5.92  1.8 5.92 1 1 
        928 1 . . . . . 3.63  1.8 3.63 1 1 
        929 1 . . . . . 5.92  1.8 5.92 1 1 
        930 1 . . . . .  6.0  1.8  6.0 1 1 
        931 1 . . . . .  6.0  1.8  6.0 1 1 
        932 1 . . . . .  6.0  1.8  6.0 1 1 
        933 1 . . . . .  6.0  1.8  6.0 1 1 
        934 1 . . . . . 4.85  1.8 4.85 1 1 
        935 1 . . . . . 4.27  1.8 4.27 1 1 
        936 1 . . . . . 3.59  1.8 3.59 1 1 
        937 1 . . . . . 4.62  1.8 4.62 1 1 
        938 1 . . . . . 4.48  1.8 4.48 1 1 
        939 1 . . . . . 4.13  1.8 4.13 1 1 
        940 1 . . . . . 4.11  1.8 4.11 1 1 
        941 1 . . . . .  5.5  1.8  5.5 1 1 
        942 1 . . . . . 5.14  1.8 5.14 1 1 
        943 1 . . . . .  5.3  1.8  5.3 1 1 
        944 1 . . . . . 4.24  1.8 4.24 1 1 
        945 1 . . . . . 4.68  1.8 4.68 1 1 
        946 1 . . . . . 4.69  1.8 4.69 1 1 
        947 1 . . . . .  6.0  1.8  6.0 1 1 
        948 1 . . . . . 5.15  1.8 5.15 1 1 
        949 1 . . . . .  4.7  1.8  4.7 1 1 
        950 1 . . . . . 4.31  1.8 4.31 1 1 
        951 1 . . . . . 5.63  1.8 5.63 1 1 
        952 1 . . . . . 5.18  1.8 5.18 1 1 
        953 1 . . . . .  4.4  1.8  4.4 1 1 
        954 1 . . . . . 5.81  1.8 5.81 1 1 
        955 1 . . . . . 4.94  1.8 4.94 1 1 
        956 1 . . . . . 5.32  1.8 5.32 1 1 
        957 1 . . . . .  6.0  1.8  6.0 1 1 
        958 1 . . . . . 3.82  1.8 3.82 1 1 
        959 1 . . . . .  6.0  1.8  6.0 1 1 
        960 1 . . . . . 4.11  1.8 4.11 1 1 
        961 1 . . . . . 3.51  1.8 3.51 1 1 
        962 1 . . . . . 4.11  1.8 4.11 1 1 
        963 1 . . . . . 3.82  1.8 3.82 1 1 
        964 1 . . . . . 4.31  1.8 4.31 1 1 
        965 1 . . . . . 3.15  1.8 3.15 1 1 
        966 1 . . . . . 4.31  1.8 4.31 1 1 
        967 1 . . . . . 3.37  1.8 3.37 1 1 
        968 1 . . . . . 4.03  1.8 4.03 1 1 
        969 1 . . . . . 4.15  1.8 4.15 1 1 
        970 1 . . . . . 4.12  1.8 4.12 1 1 
        971 1 . . . . .  4.1  1.8  4.1 1 1 
        972 1 . . . . .  6.0  1.8  6.0 1 1 
        973 1 . . . . . 5.81  1.8 5.81 1 1 
        974 1 . . . . . 5.83  1.8 5.83 1 1 
        975 1 . . . . . 4.38  1.8 4.38 1 1 
        976 1 . . . . .  4.2  1.8  4.2 1 1 
        977 1 . . . . .  4.2  1.8  4.2 1 1 
        978 1 . . . . . 5.52  1.8 5.52 1 1 
        979 1 . . . . .  6.0  1.8  6.0 1 1 
        980 1 . . . . . 2.98  1.8 2.98 1 1 
        981 1 . . . . . 3.02  1.8 3.02 1 1 
        982 1 . . . . . 5.81  1.8 5.81 1 1 
        983 1 . . . . .  4.1  1.8  4.1 1 1 
        984 1 . . . . . 5.89  1.8 5.89 1 1 
        985 1 . . . . .  4.4  1.8  4.4 1 1 
        986 1 . . . . . 4.07  1.8 4.07 1 1 
        987 1 . . . . . 4.49  1.8 4.49 1 1 
        988 1 . . . . . 3.56  1.8 3.56 1 1 
        989 1 . . . . . 5.65  1.8 5.65 1 1 
        990 1 . . . . .  6.0  1.8  6.0 1 1 
        991 1 . . . . . 5.81  1.8 5.81 1 1 
        992 1 . . . . . 4.17  1.8 4.17 1 1 
        993 1 . . . . . 3.89  1.8 3.89 1 1 
        994 1 . . . . . 3.48  1.8 3.48 1 1 
        995 1 . . . . . 3.79  1.8 3.79 1 1 
        996 1 . . . . . 4.76  1.8 4.76 1 1 
        997 1 . . . . .  6.0  1.8  6.0 1 1 
        998 1 . . . . .  6.0  1.8  6.0 1 1 
        999 1 . . . . .  6.0  1.8  6.0 1 1 
       1000 1 . . . . . 3.52  1.8 3.52 1 1 
       1001 1 . . . . .  4.5  1.8  4.5 1 1 
       1002 1 . . . . . 3.41  1.8 3.41 1 1 
       1003 1 . . . . . 3.32  1.8 3.32 1 1 
       1004 1 . . . . .  3.7  1.8  3.7 1 1 
       1005 1 . . . . . 3.37  1.8 3.37 1 1 
       1006 1 . . . . . 5.03  1.8 5.03 1 1 
       1007 1 . . . . . 5.65  1.8 5.65 1 1 
       1008 1 . . . . . 4.62  1.8 4.62 1 1 
       1009 1 . . . . . 3.35  1.8 3.35 1 1 
       1010 1 . . . . . 5.81  1.8 5.81 1 1 
       1011 1 . . . . . 4.08  1.8 4.08 1 1 
       1012 1 . . . . . 5.38  1.8 5.38 1 1 
       1013 1 . . . . . 5.01  1.8 5.01 1 1 
       1014 1 . . . . . 5.63  1.8 5.63 1 1 
       1015 1 . . . . . 5.81  1.8 5.81 1 1 
       1016 1 . . . . . 4.45  1.8 4.45 1 1 
       1017 1 . . . . . 3.54  1.8 3.54 1 1 
       1018 1 . . . . . 3.96  1.8 3.96 1 1 
       1019 1 . . . . . 3.38  1.8 3.38 1 1 
       1020 1 . . . . . 3.96  1.8 3.96 1 1 
       1021 1 . . . . . 3.83  1.8 3.83 1 1 
       1022 1 . . . . . 4.24  1.8 4.24 1 1 
       1023 1 . . . . . 5.96  1.8 5.96 1 1 
       1024 1 . . . . . 5.85  1.8 5.85 1 1 
       1025 1 . . . . . 5.81  1.8 5.81 1 1 
       1026 1 . . . . .  6.0  1.8  6.0 1 1 
       1027 1 . . . . .  6.0  1.8  6.0 1 1 
       1028 1 . . . . .  6.0  1.8  6.0 1 1 
       1029 1 . . . . . 4.23  1.8 4.23 1 1 
       1030 1 . . . . . 5.69  1.8 5.69 1 1 
       1031 1 . . . . . 4.85  1.8 4.85 1 1 
       1032 1 . . . . . 3.94  1.8 3.94 1 1 
       1033 1 . . . . .  3.8  1.8  3.8 1 1 
       1034 1 . . . . . 5.92  1.8 5.92 1 1 
       1035 1 . . . . . 5.92  1.8 5.92 1 1 
       1036 1 . . . . . 5.92  1.8 5.92 1 1 
       1037 1 . . . . . 5.92  1.8 5.92 1 1 
       1038 1 . . . . . 4.69  1.8 4.69 1 1 
       1039 1 . . . . . 5.92  1.8 5.92 1 1 
       1040 1 . . . . . 5.07  1.8 5.07 1 1 
       1041 1 . . . . . 3.78  1.8 3.78 1 1 
       1042 1 . . . . . 3.89  1.8 3.89 1 1 
       1043 1 . . . . . 5.87  1.8 5.87 1 1 
       1044 1 . . . . . 4.52  1.8 4.52 1 1 
       1045 1 . . . . . 5.73  1.8 5.73 1 1 
       1046 1 . . . . . 3.88  1.8 3.88 1 1 
       1047 1 . . . . . 2.93  1.8 2.93 1 1 
       1048 1 . . . . . 5.44  1.8 5.44 1 1 
       1049 1 . . . . . 4.16  1.8 4.16 1 1 
       1050 1 . . . . . 5.92  1.8 5.92 1 1 
       1051 1 . . . . . 3.94  1.8 3.94 1 1 
       1052 1 . . . . .  6.0  1.8  6.0 1 1 
       1053 1 . . . . . 3.91  1.8 3.91 1 1 
       1054 1 . . . . . 3.91  1.8 3.91 1 1 
       1055 1 . . . . .  6.0  1.8  6.0 1 1 
       1056 1 . . . . . 4.77  1.8 4.77 1 1 
       1057 1 . . . . . 3.39  1.8 3.39 1 1 
       1058 1 . . . . . 3.39  1.8 3.39 1 1 
       1059 1 . . . . .  4.4  1.8  4.4 1 1 
       1060 1 . . . . . 5.06  1.8 5.06 1 1 
       1061 1 . . . . . 4.44  1.8 4.44 1 1 
       1062 1 . . . . . 3.94  1.8 3.94 1 1 
       1063 1 . . . . . 3.48  1.8 3.48 1 1 
       1064 1 . . . . . 5.28  1.8 5.28 1 1 
       1065 1 . . . . . 3.15  1.8 3.15 1 1 
       1066 1 . . . . .  6.0  1.8  6.0 1 1 
       1067 1 . . . . . 3.17  1.8 3.17 1 1 
       1068 1 . . . . . 4.71  1.8 4.71 1 1 
       1069 1 . . . . .  6.0  1.8  6.0 1 1 
       1070 1 . . . . . 4.44  1.8 4.44 1 1 
       1071 1 . . . . . 5.81  1.8 5.81 1 1 
       1072 1 . . . . .  4.5  1.8  4.5 1 1 
       1073 1 . . . . . 4.45  1.8 4.45 1 1 
       1074 1 . . . . . 4.06  1.8 4.06 1 1 
       1075 1 . . . . .  6.0  1.8  6.0 1 1 
       1076 1 . . . . . 5.17  1.8 5.17 1 1 
       1077 1 . . . . .  6.0  1.8  6.0 1 1 
       1078 1 . . . . . 5.17  1.8 5.17 1 1 
       1079 1 . . . . . 4.01  1.8 4.01 1 1 
       1080 1 . . . . .  6.0  1.8  6.0 1 1 
       1081 1 . . . . .  6.0  1.8  6.0 1 1 
       1082 1 . . . . .  6.0  1.8  6.0 1 1 
       1083 1 . . . . .  6.0  1.8  6.0 1 1 
       1084 1 . . . . .  6.0  1.8  6.0 1 1 
       1085 1 . . . . . 5.81  1.8 5.81 1 1 
       1086 1 . . . . .  6.0  1.8  6.0 1 1 
       1087 1 . . . . . 4.06  1.8 4.06 1 1 
       1088 1 . . . . . 4.75  1.8 4.75 1 1 
       1089 1 . . . . . 4.99  1.8 4.99 1 1 
       1090 1 . . . . . 3.55  1.8 3.55 1 1 
       1091 1 . . . . . 4.43  1.8 4.43 1 1 
       1092 1 . . . . . 3.54  1.8 3.54 1 1 
       1093 1 . . . . . 5.93  1.8 5.93 1 1 
       1094 1 . . . . .  6.0  1.8  6.0 1 1 
       1095 1 . . . . . 4.93  1.8 4.93 1 1 
       1096 1 . . . . . 4.49  1.8 4.49 1 1 
       1097 1 . . . . . 4.18  1.8 4.18 1 1 
       1098 1 . . . . . 4.77  1.8 4.77 1 1 
       1099 1 . . . . . 4.76  1.8 4.76 1 1 
       1100 1 . . . . .  6.0  1.8  6.0 1 1 
       1101 1 . . . . . 4.87  1.8 4.87 1 1 
       1102 1 . . . . . 4.13  1.8 4.13 1 1 
       1103 1 . . . . . 4.55  1.8 4.55 1 1 
       1104 1 . . . . .  6.0  1.8  6.0 1 1 
       1105 1 . . . . . 4.94  1.8 4.94 1 1 
       1106 1 . . . . .    .  1.8 3.19 1 1 
       1107 1 . . . . . 5.35  1.8 5.35 1 1 
       1108 1 . . . . . 4.72  1.8 4.72 1 1 
       1109 1 . . . . . 5.29  1.8 5.29 1 1 
       1110 1 . . . . . 3.55  1.8 3.55 1 1 
       1111 1 . . . . . 3.37  1.8 3.37 1 1 
       1112 1 . . . . . 3.62  1.8 3.62 1 1 
       1113 1 . . . . . 5.68  1.8 5.68 1 1 
       1114 1 . . . . . 4.65  1.8 4.65 1 1 
       1115 1 . . . . . 5.85  1.8 5.85 1 1 
       1116 1 . . . . . 5.81  1.8 5.81 1 1 
       1117 1 . . . . . 3.55  1.8 3.55 1 1 
       1118 1 . . . . .  6.0  1.8  6.0 1 1 
       1119 1 . . . . . 5.81  1.8 5.81 1 1 
       1120 1 . . . . . 3.33  1.8 3.33 1 1 
       1121 1 . . . . . 3.28  1.8 3.28 1 1 
       1122 1 . . . . . 4.31  1.8 4.31 1 1 
       1123 1 . . . . . 3.28  1.8 3.28 1 1 
       1124 1 . . . . .  3.9  1.8  3.9 1 1 
       1125 1 . . . . . 4.48  1.8 4.48 1 1 
       1126 1 . . . . . 4.16  1.8 4.16 1 1 
       1127 1 . . . . . 3.42  1.8 3.42 1 1 
       1128 1 . . . . . 5.81  1.8 5.81 1 1 
       1129 1 . . . . . 4.54  1.8 4.54 1 1 
       1130 1 . . . . .  6.0  1.8  6.0 1 1 
       1131 1 . . . . .  6.0  1.8  6.0 1 1 
       1132 1 . . . . . 5.81  1.8 5.81 1 1 
       1133 1 . . . . . 3.34  1.8 3.34 1 1 
       1134 1 . . . . . 4.88  1.8 4.88 1 1 
       1135 1 . . . . . 4.71  1.8 4.71 1 1 
       1136 1 . . . . . 3.32  1.8 3.32 1 1 
       1137 1 . . . . . 3.55  1.8 3.55 1 1 
       1138 1 . . . . . 3.59  1.8 3.59 1 1 
       1139 1 . . . . . 4.16  1.8 4.16 1 1 
       1140 1 . . . . . 4.16  1.8 4.16 1 1 
       1141 1 . . . . . 4.37  1.8 4.37 1 1 
       1142 1 . . . . . 3.39  1.8 3.39 1 1 
       1143 1 . . . . .  5.6  1.8  5.6 1 1 
       1144 1 . . . . . 4.22  1.8 4.22 1 1 
       1145 1 . . . . . 3.59  1.8 3.59 1 1 
       1146 1 . . . . . 4.41  1.8 4.41 1 1 
       1147 1 . . . . . 4.41  1.8 4.41 1 1 
       1148 1 . . . . . 3.57  1.8 3.57 1 1 
       1149 1 . . . . .  6.0  1.8  6.0 1 1 
       1150 1 . . . . . 3.75  1.8 3.75 1 1 
       1151 1 . . . . .  6.0  1.8  6.0 1 1 
       1152 1 . . . . .  5.1  1.8  5.1 1 1 
       1153 1 . . . . . 4.36  1.8 4.36 1 1 
       1154 1 . . . . . 3.65  1.8 3.65 1 1 
       1155 1 . . . . . 5.05  1.8 5.05 1 1 
       1156 1 . . . . . 4.31  1.8 4.31 1 1 
       1157 1 . . . . .  6.0  1.8  6.0 1 1 
       1158 1 . . . . .  6.0  1.8  6.0 1 1 
       1159 1 . . . . .  3.8  1.8  3.8 1 1 
       1160 1 . . . . .  5.3  1.8  5.3 1 1 
       1161 1 . . . . . 3.71  1.8 3.71 1 1 
       1162 1 . . . . . 4.46  1.8 4.46 1 1 
       1163 1 . . . . . 5.83  1.8 5.83 1 1 
       1164 1 . . . . . 4.39  1.8 4.39 1 1 
       1165 1 . . . . . 4.06  1.8 4.06 1 1 
       1166 1 . . . . . 3.56  1.8 3.56 1 1 
       1167 1 . . . . . 4.06  1.8 4.06 1 1 
       1168 1 . . . . . 5.14  1.8 5.14 1 1 
       1169 1 . . . . . 4.42  1.8 4.42 1 1 
       1170 1 . . . . . 5.14  1.8 5.14 1 1 
       1171 1 . . . . . 3.81  1.8 3.81 1 1 
       1172 1 . . . . .  6.0  1.8  6.0 1 1 
       1173 1 . . . . . 3.65  1.8 3.65 1 1 
       1174 1 . . . . . 4.98  1.8 4.98 1 1 
       1175 1 . . . . . 3.65  1.8 3.65 1 1 
       1176 1 . . . . . 5.61  1.8 5.61 1 1 
       1177 1 . . . . . 5.81  1.8 5.81 1 1 
       1178 1 . . . . . 4.41  1.8 4.41 1 1 
       1179 1 . . . . . 5.81  1.8 5.81 1 1 
       1180 1 . . . . . 5.13  1.8 5.13 1 1 
       1181 1 . . . . . 5.13  1.8 5.13 1 1 
       1182 1 . . . . .  5.0  1.8  5.0 1 1 
       1183 1 . . . . . 3.91  1.8 3.91 1 1 
       1184 1 . . . . . 3.96  1.8 3.96 1 1 
       1185 1 . . . . . 5.65  1.8 5.65 1 1 
       1186 1 . . . . . 3.32  1.8 3.32 1 1 
       1187 1 . . . . . 5.34  1.8 5.34 1 1 
       1188 1 . . . . . 4.95  1.8 4.95 1 1 
       1189 1 . . . . . 3.28  1.8 3.28 1 1 
       1190 1 . . . . .  6.0  1.8  6.0 1 1 
       1191 1 . . . . .  6.0  1.8  6.0 1 1 
       1192 1 . . . . .  6.0  1.8  6.0 1 1 
       1193 1 . . . . .  4.1  1.8  4.1 1 1 
       1194 1 . . . . .  6.0  1.8  6.0 1 1 
       1195 1 . . . . . 2.68  1.8 2.68 1 1 
       1196 1 . . . . . 4.93  1.8 4.93 1 1 
       1197 1 . . . . .  6.0  1.8  6.0 1 1 
       1198 1 . . . . .  6.0  1.8  6.0 1 1 
       1199 1 . . . . . 5.25  1.8 5.25 1 1 
       1200 1 . . . . .  5.4  1.8  5.4 1 1 
       1201 1 . . . . . 5.81  1.8 5.81 1 1 
       1202 1 . . . . . 4.98  1.8 4.98 1 1 
       1203 1 . . . . . 3.17  1.8 3.17 1 1 
       1204 1 . . . . . 5.81  1.8 5.81 1 1 
       1205 1 . . . . .  6.0  1.8  6.0 1 1 
       1206 1 . . . . .  6.0  1.8  6.0 1 1 
       1207 1 . . . . .  5.4  1.8  5.4 1 1 
       1208 1 . . . . .  6.0  1.8  6.0 1 1 
       1209 1 . . . . . 5.86  1.8 5.86 1 1 
       1210 1 . . . . . 5.75  1.8 5.75 1 1 
       1211 1 . . . . . 4.15  1.8 4.15 1 1 
       1212 1 . . . . . 5.61  1.8 5.61 1 1 
       1213 1 . . . . . 3.64  1.8 3.64 1 1 
       1214 1 . . . . .  6.0  1.8  6.0 1 1 
       1215 1 . . . . . 4.13  1.8 4.13 1 1 
       1216 1 . . . . .  6.0  1.8  6.0 1 1 
       1217 1 . . . . .  6.0  1.8  6.0 1 1 
       1218 1 . . . . .  6.0  1.8  6.0 1 1 
       1219 1 . . . . . 4.28  1.8 4.28 1 1 
       1220 1 . . . . . 5.61  1.8 5.61 1 1 
       1221 1 . . . . . 4.01  1.8 4.01 1 1 
       1222 1 . . . . . 4.48  1.8 4.48 1 1 
       1223 1 . . . . . 4.41  1.8 4.41 1 1 
       1224 1 . . . . .  6.0  1.8  6.0 1 1 
       1225 1 . . . . . 4.48  1.8 4.48 1 1 
       1226 1 . . . . . 3.88  1.8 3.88 1 1 
       1227 1 . . . . . 3.96  1.8 3.96 1 1 
       1228 1 . . . . . 5.77  1.8 5.77 1 1 
       1229 1 . . . . . 4.44  1.8 4.44 1 1 
       1230 1 . . . . . 5.81  1.8 5.81 1 1 
       1231 1 . . . . . 3.89  1.8 3.89 1 1 
       1232 1 . . . . .  5.2  1.8  5.2 1 1 
       1233 1 . . . . . 4.12  1.8 4.12 1 1 
       1234 1 . . . . .  5.2  1.8  5.2 1 1 
       1235 1 . . . . . 5.73  1.8 5.73 1 1 
       1236 1 . . . . . 4.39  1.8 4.39 1 1 
       1237 1 . . . . .  6.0  1.8  6.0 1 1 
       1238 1 . . . . . 5.03  1.8 5.03 1 1 
       1239 1 . . . . . 3.91  1.8 3.91 1 1 
       1240 1 . . . . . 5.81  1.8 5.81 1 1 
       1241 1 . . . . .  6.0  1.8  6.0 1 1 
       1242 1 . . . . . 3.88  1.8 3.88 1 1 
       1243 1 . . . . .  3.3  1.8  3.3 1 1 
       1244 1 . . . . . 3.88  1.8 3.88 1 1 
       1245 1 . . . . . 4.91  1.8 4.91 1 1 
       1246 1 . . . . . 3.85  1.8 3.85 1 1 
       1247 1 . . . . .  6.0  1.8  6.0 1 1 
       1248 1 . . . . . 4.05  1.8 4.05 1 1 
       1249 1 . . . . . 5.72  1.8 5.72 1 1 
       1250 1 . . . . . 4.36  1.8 4.36 1 1 
       1251 1 . . . . .  6.0  1.8  6.0 1 1 
       1252 1 . . . . . 4.43  1.8 4.43 1 1 
       1253 1 . . . . .  6.0  1.8  6.0 1 1 
       1254 1 . . . . . 4.17  1.8 4.17 1 1 
       1255 1 . . . . .  6.0  1.8  6.0 1 1 
       1256 1 . . . . . 5.84  1.8 5.84 1 1 
       1257 1 . . . . .  6.0  1.8  6.0 1 1 
       1258 1 . . . . . 3.92  1.8 3.92 1 1 
       1259 1 . . . . .  6.0  1.8  6.0 1 1 
       1260 1 . . . . . 3.35  1.8 3.35 1 1 
       1261 1 . . . . . 4.78  1.8 4.78 1 1 
       1262 1 . . . . . 4.87  1.8 4.87 1 1 
       1263 1 . . . . . 4.15  1.8 4.15 1 1 
       1264 1 . . . . .  6.0  1.8  6.0 1 1 
       1265 1 . . . . . 5.63  1.8 5.63 1 1 
       1266 1 . . . . . 4.44  1.8 4.44 1 1 
       1267 1 . . . . . 5.41  1.8 5.41 1 1 
       1268 1 . . . . . 5.38  1.8 5.38 1 1 
       1269 1 . . . . .  5.6  1.8  5.6 1 1 
       1270 1 . . . . .  6.0  1.8  6.0 1 1 
       1271 1 . . . . . 5.13  1.8 5.13 1 1 
       1272 1 . . . . .  6.0  1.8  6.0 1 1 
       1273 1 . . . . . 5.78  1.8 5.78 1 1 
       1274 1 . . . . . 4.43  1.8 4.43 1 1 
       1275 1 . . . . . 4.17  1.8 4.17 1 1 
       1276 1 . . . . . 5.11  1.8 5.11 1 1 
       1277 1 . . . . .  6.0  1.8  6.0 1 1 
       1278 1 . . . . . 4.34  1.8 4.34 1 1 
       1279 1 . . . . .  5.4  1.8  5.4 1 1 
       1280 1 . . . . . 5.34  1.8 5.34 1 1 
       1281 1 . . . . .  6.0  1.8  6.0 1 1 
       1282 1 . . . . . 4.23  1.8 4.23 1 1 
       1283 1 . . . . . 3.14  1.8 3.14 1 1 
       1284 1 . . . . . 4.08  1.8 4.08 1 1 
       1285 1 . . . . .  3.7  1.8  3.7 1 1 
       1286 1 . . . . . 4.85  1.8 4.85 1 1 
       1287 1 . . . . . 5.92  1.8 5.92 1 1 
       1288 1 . . . . . 3.77  1.8 3.77 1 1 
       1289 1 . . . . .  3.4  1.8  3.4 1 1 
       1290 1 . . . . . 3.55  1.8 3.55 1 1 
       1291 1 . . . . . 4.65  1.8 4.65 1 1 
       1292 1 . . . . . 5.39  1.8 5.39 1 1 
       1293 1 . . . . . 4.49  1.8 4.49 1 1 
       1294 1 . . . . . 5.39  1.8 5.39 1 1 
       1295 1 . . . . . 3.53  1.8 3.53 1 1 
       1296 1 . . . . . 2.77  1.8 2.77 1 1 
       1297 1 . . . . . 3.53  1.8 3.53 1 1 
       1298 1 . . . . .  6.0  1.8  6.0 1 1 
       1299 1 . . . . . 5.52  1.8 5.52 1 1 
       1300 1 . . . . .  6.0  1.8  6.0 1 1 
       1301 1 . . . . . 4.58  1.8 4.58 1 1 
       1302 1 . . . . . 4.93  1.8 4.93 1 1 
       1303 1 . . . . . 4.41  1.8 4.41 1 1 
       1304 1 . . . . . 3.19  1.8 3.19 1 1 
       1305 1 . . . . . 3.47  1.8 3.47 1 1 
       1306 1 . . . . . 5.24  1.8 5.24 1 1 
       1307 1 . . . . . 4.87  1.8 4.87 1 1 
       1308 1 . . . . . 3.85  1.8 3.85 1 1 
       1309 1 . . . . . 3.95  1.8 3.95 1 1 
       1310 1 . . . . . 2.99  1.8 2.99 1 1 
       1311 1 . . . . . 5.25  1.8 5.25 1 1 
       1312 1 . . . . . 5.51  1.8 5.51 1 1 
       1313 1 . . . . . 5.52  1.8 5.52 1 1 
       1314 1 . . . . . 3.18  1.8 3.18 1 1 
       1315 1 . . . . . 4.63  1.8 4.63 1 1 
       1316 1 . . . . .  6.0  1.8  6.0 1 1 
       1317 1 . . . . . 4.63  1.8 4.63 1 1 
       1318 1 . . . . .  6.0  1.8  6.0 1 1 
       1319 1 . . . . . 3.11  1.8 3.11 1 1 
       1320 1 . . . . . 3.87  1.8 3.87 1 1 
       1321 1 . . . . . 5.04  1.8 5.04 1 1 
       1322 1 . . . . . 5.93  1.8 5.93 1 1 
       1323 1 . . . . .  6.0  1.8  6.0 1 1 
       1324 1 . . . . .  6.0  1.8  6.0 1 1 
       1325 1 . . . . . 5.18  1.8 5.18 1 1 
       1326 1 . . . . .  6.0  1.8  6.0 1 1 
       1327 1 . . . . . 4.41  1.8 4.41 1 1 
       1328 1 . . . . . 4.15  1.8 4.15 1 1 
       1329 1 . . . . . 5.92  1.8 5.92 1 1 
       1330 1 . . . . .  6.0  1.8  6.0 1 1 
       1331 1 . . . . . 5.92  1.8 5.92 1 1 
       1332 1 . . . . . 5.57  1.8 5.57 1 1 
       1333 1 . . . . . 3.42  1.8 3.42 1 1 
       1334 1 . . . . . 3.32  1.8 3.32 1 1 
       1335 1 . . . . . 3.98  1.8 3.98 1 1 
       1336 1 . . . . .  6.0  1.8  6.0 1 1 
       1337 1 . . . . .  6.0  1.8  6.0 1 1 
       1338 1 . . . . .  5.6  1.8  5.6 1 1 
       1339 1 . . . . . 5.92  1.8 5.92 1 1 
       1340 1 . . . . . 5.92  1.8 5.92 1 1 
       1341 1 . . . . .  3.3  1.8  3.3 1 1 
       1342 1 . . . . . 5.81  1.8 5.81 1 1 
       1343 1 . . . . . 5.78  1.8 5.78 1 1 
       1344 1 . . . . . 5.81  1.8 5.81 1 1 
       1345 1 . . . . . 3.99  1.8 3.99 1 1 
       1346 1 . . . . . 3.76  1.8 3.76 1 1 
       1347 1 . . . . . 5.33  1.8 5.33 1 1 
       1348 1 . . . . . 5.35  1.8 5.35 1 1 
       1349 1 . . . . . 5.53  1.8 5.53 1 1 
       1350 1 . . . . . 5.56  1.8 5.56 1 1 
       1351 1 . . . . . 5.84  1.8 5.84 1 1 
       1352 1 . . . . . 3.55  1.8 3.55 1 1 
       1353 1 . . . . .  6.0  1.8  6.0 1 1 
       1354 1 . . . . . 5.92  1.8 5.92 1 1 
       1355 1 . . . . . 4.55  1.8 4.55 1 1 
       1356 1 . . . . .  4.6  1.8  4.6 1 1 
       1357 1 . . . . .  5.1  1.8  5.1 1 1 
       1358 1 . . . . .  6.0  1.8  6.0 1 1 
       1359 1 . . . . .  6.0  1.8  6.0 1 1 
       1360 1 . . . . . 5.81  1.8 5.81 1 1 
       1361 1 . . . . . 5.81  1.8 5.81 1 1 
       1362 1 . . . . .  6.0  1.8  6.0 1 1 
       1363 1 . . . . . 3.06  1.8 3.06 1 1 
       1364 1 . . . . . 3.85  1.8 3.85 1 1 
       1365 1 . . . . . 3.55  1.8 3.55 1 1 
       1366 1 . . . . . 5.54  1.8 5.54 1 1 
       1367 1 . . . . . 3.95  1.8 3.95 1 1 
       1368 1 . . . . . 4.56  1.8 4.56 1 1 
       1369 1 . . . . . 5.42  1.8 5.42 1 1 
       1370 1 . . . . . 4.31  1.8 4.31 1 1 
       1371 1 . . . . . 5.92  1.8 5.92 1 1 
       1372 1 . . . . .  5.1  1.8  5.1 1 1 
       1373 1 . . . . . 4.81  1.8 4.81 1 1 
       1374 1 . . . . . 5.92  1.8 5.92 1 1 
       1375 1 . . . . . 5.92  1.8 5.92 1 1 
       1376 1 . . . . . 4.09  1.8 4.09 1 1 
       1377 1 . . . . . 3.52  1.8 3.52 1 1 
       1378 1 . . . . . 4.09  1.8 4.09 1 1 
       1379 1 . . . . . 3.93  1.8 3.93 1 1 
       1380 1 . . . . . 5.16  1.8 5.16 1 1 
       1381 1 . . . . . 5.81  1.8 5.81 1 1 
       1382 1 . . . . . 3.12  1.8 3.12 1 1 
       1383 1 . . . . .  4.5  1.8  4.5 1 1 
       1384 1 . . . . . 4.21  1.8 4.21 1 1 
       1385 1 . . . . . 5.64  1.8 5.64 1 1 
       1386 1 . . . . . 5.92  1.8 5.92 1 1 
       1387 1 . . . . . 5.86  1.8 5.86 1 1 
       1388 1 . . . . . 3.96  1.8 3.96 1 1 
       1389 1 . . . . . 5.73  1.8 5.73 1 1 
       1390 1 . . . . . 5.73  1.8 5.73 1 1 
       1391 1 . . . . . 4.47  1.8 4.47 1 1 
       1392 1 . . . . . 5.73  1.8 5.73 1 1 
       1393 1 . . . . . 5.92  1.8 5.92 1 1 
       1394 1 . . . . . 5.66  1.8 5.66 1 1 
       1395 1 . . . . . 5.19  1.8 5.19 1 1 
       1396 1 . . . . . 5.19  1.8 5.19 1 1 
       1397 1 . . . . . 3.37  1.8 3.37 1 1 
       1398 1 . . . . . 5.33  1.8 5.33 1 1 
       1399 1 . . . . . 2.44  1.8 2.44 1 1 
       1400 1 . . . . . 3.55  1.8 3.55 1 1 
       1401 1 . . . . . 3.23  1.8 3.23 1 1 
       1402 1 . . . . . 4.68  1.8 4.68 1 1 
       1403 1 . . . . . 5.87  1.8 5.87 1 1 
       1404 1 . . . . . 4.73  1.8 4.73 1 1 
       1405 1 . . . . . 5.81  1.8 5.81 1 1 
       1406 1 . . . . .  6.0  1.8  6.0 1 1 
       1407 1 . . . . . 3.71  1.8 3.71 1 1 
       1408 1 . . . . . 4.21  1.8 4.21 1 1 
       1409 1 . . . . .  4.4  1.8  4.4 1 1 
       1410 1 . . . . . 5.61  1.8 5.61 1 1 
       1411 1 . . . . . 5.81  1.8 5.81 1 1 
       1412 1 . . . . . 3.73  1.8 3.73 1 1 
       1413 1 . . . . . 5.81  1.8 5.81 1 1 
       1414 1 . . . . . 4.15  1.8 4.15 1 1 
       1415 1 . . . . . 5.84  1.8 5.84 1 1 
       1416 1 . . . . . 2.93  1.8 2.93 1 1 
       1417 1 . . . . . 3.08  1.8 3.08 1 1 
       1418 1 . . . . . 4.91  1.8 4.91 1 1 
       1419 1 . . . . . 4.91  1.8 4.91 1 1 
       1420 1 . . . . . 5.36  1.8 5.36 1 1 
       1421 1 . . . . . 3.23  1.8 3.23 1 1 
       1422 1 . . . . . 5.53  1.8 5.53 1 1 
       1423 1 . . . . . 5.29  1.8 5.29 1 1 
       1424 1 . . . . .  6.0  1.8  6.0 1 1 
       1425 1 . . . . . 3.78  1.8 3.78 1 1 
       1426 1 . . . . . 3.55  1.8 3.55 1 1 
       1427 1 . . . . . 3.66  1.8 3.66 1 1 
       1428 1 . . . . . 5.69  1.8 5.69 1 1 
       1429 1 . . . . . 2.44  1.8 2.44 1 1 
       1430 1 . . . . . 5.81  1.8 5.81 1 1 
       1431 1 . . . . . 3.28  1.8 3.28 1 1 
       1432 1 . . . . . 3.28  1.8 3.28 1 1 
       1433 1 . . . . . 3.28  1.8 3.28 1 1 
       1434 1 . . . . . 3.28  1.8 3.28 1 1 
       1435 1 . . . . . 5.47  1.8 5.47 1 1 
       1436 1 . . . . .  6.0  1.8  6.0 1 1 
       1437 1 . . . . . 3.74  1.8 3.74 1 1 
       1438 1 . . . . . 4.21  1.8 4.21 1 1 
       1439 1 . . . . . 5.37  1.8 5.37 1 1 
       1440 1 . . . . . 4.92  1.8 4.92 1 1 
       1441 1 . . . . . 3.72  1.8 3.72 1 1 
       1442 1 . . . . . 4.92  1.8 4.92 1 1 
       1443 1 . . . . . 3.59  1.8 3.59 1 1 
       1444 1 . . . . . 3.28  1.8 3.28 1 1 
       1445 1 . . . . . 5.81  1.8 5.81 1 1 
       1446 1 . . . . . 4.87  1.8 4.87 1 1 
       1447 1 . . . . .  6.0  1.8  6.0 1 1 
       1448 1 . . . . . 4.45  1.8 4.45 1 1 
       1449 1 . . . . . 5.52  1.8 5.52 1 1 
       1450 1 . . . . . 3.95  1.8 3.95 1 1 
       1451 1 . . . . . 3.72  1.8 3.72 1 1 
       1452 1 . . . . .  6.0  1.8  6.0 1 1 
       1453 1 . . . . .  6.0  1.8  6.0 1 1 
       1454 1 . . . . . 2.79  1.8 2.79 1 1 
       1455 1 . . . . . 2.41  1.8 2.41 1 1 
       1456 1 . . . . . 2.79  1.8 2.79 1 1 
       1457 1 . . . . . 4.99  1.8 4.99 1 1 
       1458 1 . . . . . 3.41  1.8 3.41 1 1 
       1459 1 . . . . . 4.08  1.8 4.08 1 1 
       1460 1 . . . . . 4.56  1.8 4.56 1 1 
       1461 1 . . . . .  6.0  1.8  6.0 1 1 
       1462 1 . . . . .  6.0  1.8  6.0 1 1 
       1463 1 . . . . . 5.55  1.8 5.55 1 1 
       1464 1 . . . . . 4.66  1.8 4.66 1 1 
       1465 1 . . . . . 5.55  1.8 5.55 1 1 
       1466 1 . . . . . 4.73  1.8 4.73 1 1 
       1467 1 . . . . . 3.11  1.8 3.11 1 1 
       1468 1 . . . . . 5.24  1.8 5.24 1 1 
       1469 1 . . . . . 3.64  1.8 3.64 1 1 
       1470 1 . . . . . 3.96  1.8 3.96 1 1 
       1471 1 . . . . . 4.57  1.8 4.57 1 1 
       1472 1 . . . . . 3.02  1.8 3.02 1 1 
       1473 1 . . . . . 2.38  1.8 2.38 1 1 
       1474 1 . . . . . 5.81  1.8 5.81 1 1 
       1475 1 . . . . . 5.81  1.8 5.81 1 1 
       1476 1 . . . . . 4.16  1.8 4.16 1 1 
       1477 1 . . . . . 4.62  1.8 4.62 1 1 
       1478 1 . . . . . 5.27  1.8 5.27 1 1 
       1479 1 . . . . . 5.27  1.8 5.27 1 1 
       1480 1 . . . . . 3.83  1.8 3.83 1 1 
       1481 1 . . . . . 4.76  1.8 4.76 1 1 
       1482 1 . . . . . 4.54  1.8 4.54 1 1 
       1483 1 . . . . . 4.24  1.8 4.24 1 1 
       1484 1 . . . . . 3.37  1.8 3.37 1 1 
       1485 1 . . . . . 4.79  1.8 4.79 1 1 
       1486 1 . . . . . 4.14  1.8 4.14 1 1 
       1487 1 . . . . . 3.53  1.8 3.53 1 1 
       1488 1 . . . . . 4.14  1.8 4.14 1 1 
       1489 1 . . . . . 4.18  1.8 4.18 1 1 
       1490 1 . . . . .  5.7  1.8  5.7 1 1 
       1491 1 . . . . .  6.0  1.8  6.0 1 1 
       1492 1 . . . . . 4.98  1.8 4.98 1 1 
       1493 1 . . . . . 5.15  1.8 5.15 1 1 
       1494 1 . . . . . 5.24  1.8 5.24 1 1 
       1495 1 . . . . . 4.67  1.8 4.67 1 1 
       1496 1 . . . . . 3.56  1.8 3.56 1 1 
       1497 1 . . . . . 5.09  1.8 5.09 1 1 
       1498 1 . . . . . 5.81  1.8 5.81 1 1 
       1499 1 . . . . . 4.89  1.8 4.89 1 1 
       1500 1 . . . . . 5.81  1.8 5.81 1 1 
       1501 1 . . . . . 4.19  1.8 4.19 1 1 
       1502 1 . . . . . 3.44  1.8 3.44 1 1 
       1503 1 . . . . . 3.87  1.8 3.87 1 1 
       1504 1 . . . . .  6.0  1.8  6.0 1 1 
       1505 1 . . . . . 4.91  1.8 4.91 1 1 
       1506 1 . . . . . 4.98  1.8 4.98 1 1 
       1507 1 . . . . . 4.38  1.8 4.38 1 1 
       1508 1 . . . . . 4.61  1.8 4.61 1 1 
       1509 1 . . . . .  6.0  1.8  6.0 1 1 
       1510 1 . . . . . 3.62  1.8 3.62 1 1 
       1511 1 . . . . . 5.44  1.8 5.44 1 1 
       1512 1 . . . . . 3.87  1.8 3.87 1 1 
       1513 1 . . . . . 3.21  1.8 3.21 1 1 
       1514 1 . . . . . 3.87  1.8 3.87 1 1 
       1515 1 . . . . . 4.13  1.8 4.13 1 1 
       1516 1 . . . . . 4.77  1.8 4.77 1 1 
       1517 1 . . . . . 5.25  1.8 5.25 1 1 
       1518 1 . . . . .  6.0  1.8  6.0 1 1 
       1519 1 . . . . . 3.27  1.8 3.27 1 1 
       1520 1 . . . . . 2.78  1.8 2.78 1 1 
       1521 1 . . . . . 3.27  1.8 3.27 1 1 
       1522 1 . . . . . 4.33  1.8 4.33 1 1 
       1523 1 . . . . . 4.85  1.8 4.85 1 1 
       1524 1 . . . . . 4.56  1.8 4.56 1 1 
       1525 1 . . . . . 3.46  1.8 3.46 1 1 
       1526 1 . . . . . 5.92  1.8 5.92 1 1 
       1527 1 . . . . . 5.92  1.8 5.92 1 1 
       1528 1 . . . . . 5.92  1.8 5.92 1 1 
       1529 1 . . . . . 5.06  1.8 5.06 1 1 
       1530 1 . . . . .  3.7  1.8  3.7 1 1 
       1531 1 . . . . . 3.63  1.8 3.63 1 1 
       1532 1 . . . . . 4.08  1.8 4.08 1 1 
       1533 1 . . . . .  6.0  1.8  6.0 1 1 
       1534 1 . . . . . 5.14  1.8 5.14 1 1 
       1535 1 . . . . . 4.42  1.8 4.42 1 1 
       1536 1 . . . . .  5.6  1.8  5.6 1 1 
       1537 1 . . . . . 3.45  1.8 3.45 1 1 
       1538 1 . . . . . 3.02  1.8 3.02 1 1 
       1539 1 . . . . . 3.45  1.8 3.45 1 1 
       1540 1 . . . . . 4.36  1.8 4.36 1 1 
       1541 1 . . . . . 5.38  1.8 5.38 1 1 
       1542 1 . . . . . 4.56  1.8 4.56 1 1 
       1543 1 . . . . . 3.44  1.8 3.44 1 1 
       1544 1 . . . . . 3.63  1.8 3.63 1 1 
       1545 1 . . . . . 3.96  1.8 3.96 1 1 
       1546 1 . . . . . 4.78  1.8 4.78 1 1 
       1547 1 . . . . . 5.34  1.8 5.34 1 1 
       1548 1 . . . . . 4.81  1.8 4.81 1 1 
       1549 1 . . . . . 5.92  1.8 5.92 1 1 
       1550 1 . . . . . 3.19  1.8 3.19 1 1 
       1551 1 . . . . . 4.53  1.8 4.53 1 1 
       1552 1 . . . . . 3.88  1.8 3.88 1 1 
       1553 1 . . . . . 4.53  1.8 4.53 1 1 
       1554 1 . . . . . 3.79  1.8 3.79 1 1 
       1555 1 . . . . . 5.39  1.8 5.39 1 1 
       1556 1 . . . . .  6.0  1.8  6.0 1 1 
       1557 1 . . . . . 4.64  1.8 4.64 1 1 
       1558 1 . . . . . 4.21  1.8 4.21 1 1 
       1559 1 . . . . . 3.45  1.8 3.45 1 1 
       1560 1 . . . . . 4.21  1.8 4.21 1 1 
       1561 1 . . . . . 4.51  1.8 4.51 1 1 
       1562 1 . . . . . 4.44  1.8 4.44 1 1 
       1563 1 . . . . .  6.0  1.8  6.0 1 1 
       1564 1 . . . . . 2.67  1.8 2.67 1 1 
       1565 1 . . . . . 5.27  1.8 5.27 1 1 
       1566 1 . . . . . 5.92  1.8 5.92 1 1 
       1567 1 . . . . . 4.14  1.8 4.14 1 1 
       1568 1 . . . . . 3.97  1.8 3.97 1 1 
       1569 1 . . . . .  4.8  1.8  4.8 1 1 
       1570 1 . . . . .  3.7  1.8  3.7 1 1 
       1571 1 . . . . . 5.17  1.8 5.17 1 1 
       1572 1 . . . . . 5.17  1.8 5.17 1 1 
       1573 1 . . . . . 3.73  1.8 3.73 1 1 
       1574 1 . . . . . 4.11  1.8 4.11 1 1 
       1575 1 . . . . . 5.09  1.8 5.09 1 1 
       1576 1 . . . . . 5.81  1.8 5.81 1 1 
       1577 1 . . . . . 5.82  1.8 5.82 1 1 
       1578 1 . . . . .  4.9  1.8  4.9 1 1 
       1579 1 . . . . . 3.63  1.8 3.63 1 1 
       1580 1 . . . . . 4.49  1.8 4.49 1 1 
       1581 1 . . . . . 5.81  1.8 5.81 1 1 
       1582 1 . . . . . 2.05  1.8 2.05 1 1 
       1583 1 . . . . . 2.36  1.8 2.36 1 1 
       1584 1 . . . . . 2.36  1.8 2.36 1 1 
       1585 1 . . . . . 2.95  1.8 2.95 1 1 
       1586 1 . . . . . 5.81  1.8 5.81 1 1 
       1587 1 . . . . . 3.65  1.8 3.65 1 1 
       1588 1 . . . . .  6.0  1.8  6.0 1 1 
       1589 1 . . . . . 5.31  1.8 5.31 1 1 
       1590 1 . . . . . 5.64  1.8 5.64 1 1 
       1591 1 . . . . . 4.84  1.8 4.84 1 1 
       1592 1 . . . . . 5.19  1.8 5.19 1 1 
       1593 1 . . . . . 4.26  1.8 4.26 1 1 
       1594 1 . . . . . 5.92  1.8 5.92 1 1 
       1595 1 . . . . . 3.48  1.8 3.48 1 1 
       1596 1 . . . . .  6.0  1.8  6.0 1 1 
       1597 1 . . . . . 4.52  1.8 4.52 1 1 
       1598 1 . . . . .  6.0  1.8  6.0 1 1 
       1599 1 . . . . .  6.0  1.8  6.0 1 1 
       1600 1 . . . . . 4.04  1.8 4.04 1 1 
       1601 1 . . . . .  6.0  1.8  6.0 1 1 
       1602 1 . . . . .  6.0  1.8  6.0 1 1 
       1603 1 . . . . . 5.81  1.8 5.81 1 1 
       1604 1 . . . . . 4.29  1.8 4.29 1 1 
       1605 1 . . . . .  6.0  1.8  6.0 1 1 
       1606 1 . . . . . 3.73  1.8 3.73 1 1 
       1607 1 . . . . .  4.8  1.8  4.8 1 1 
       1608 1 . . . . . 4.14  1.8 4.14 1 1 
       1609 1 . . . . . 4.98  1.8 4.98 1 1 
       1610 1 . . . . . 4.16  1.8 4.16 1 1 
       1611 1 . . . . . 4.98  1.8 4.98 1 1 
       1612 1 . . . . . 3.82  1.8 3.82 1 1 
       1613 1 . . . . .  6.0  1.8  6.0 1 1 
       1614 1 . . . . . 3.81  1.8 3.81 1 1 
       1615 1 . . . . .  6.0  1.8  6.0 1 1 
       1616 1 . . . . . 5.81  1.8 5.81 1 1 
       1617 1 . . . . . 4.82  1.8 4.82 1 1 
       1618 1 . . . . . 4.09  1.8 4.09 1 1 
       1619 1 . . . . .  6.0  1.8  6.0 1 1 
       1620 1 . . . . .  6.0  1.8  6.0 1 1 
       1621 1 . . . . .  6.0  1.8  6.0 1 1 
       1622 1 . . . . .  6.0  1.8  6.0 1 1 
       1623 1 . . . . .  5.5  1.8  5.5 1 1 
       1624 1 . . . . . 5.78  1.8 5.78 1 1 
       1625 1 . . . . . 5.81  1.8 5.81 1 1 
       1626 1 . . . . . 5.61  1.8 5.61 1 1 
       1627 1 . . . . . 5.81  1.8 5.81 1 1 
       1628 1 . . . . . 5.81  1.8 5.81 1 1 
       1629 1 . . . . . 5.18  1.8 5.18 1 1 
       1630 1 . . . . . 5.06  1.8 5.06 1 1 
       1631 1 . . . . . 3.41  1.8 3.41 1 1 
       1632 1 . . . . . 3.49  1.8 3.49 1 1 
       1633 1 . . . . .  6.0  1.8  6.0 1 1 
       1634 1 . . . . . 3.56  1.8 3.56 1 1 
       1635 1 . . . . .  6.0  1.8  6.0 1 1 
       1636 1 . . . . . 4.03  1.8 4.03 1 1 
       1637 1 . . . . .  4.1  1.8  4.1 1 1 
       1638 1 . . . . . 5.61  1.8 5.61 1 1 
       1639 1 . . . . . 3.73  1.8 3.73 1 1 
       1640 1 . . . . . 5.81  1.8 5.81 1 1 
       1641 1 . . . . . 5.32  1.8 5.32 1 1 
       1642 1 . . . . . 5.41  1.8 5.41 1 1 
       1643 1 . . . . . 4.21  1.8 4.21 1 1 
       1644 1 . . . . . 4.56  1.8 4.56 1 1 
       1645 1 . . . . .  6.0  1.8  6.0 1 1 
       1646 1 . . . . . 4.25  1.8 4.25 1 1 
       1647 1 . . . . .  6.0  1.8  6.0 1 1 
       1648 1 . . . . . 5.81  1.8 5.81 1 1 
       1649 1 . . . . . 5.81  1.8 5.81 1 1 
       1650 1 . . . . .  6.0  1.8  6.0 1 1 
       1651 1 . . . . . 3.57  1.8 3.57 1 1 
       1652 1 . . . . . 4.23  1.8 4.23 1 1 
       1653 1 . . . . . 4.38  1.8 4.38 1 1 
       1654 1 . . . . . 4.83  1.8 4.83 1 1 
       1655 1 . . . . . 3.95  1.8 3.95 1 1 
       1656 1 . . . . .  6.0  1.8  6.0 1 1 
       1657 1 . . . . .  6.0  1.8  6.0 1 1 
       1658 1 . . . . . 3.84  1.8 3.84 1 1 
       1659 1 . . . . . 4.04  1.8 4.04 1 1 
       1660 1 . . . . . 3.41  1.8 3.41 1 1 
       1661 1 . . . . . 5.61  1.8 5.61 1 1 
       1662 1 . . . . . 4.71  1.8 4.71 1 1 
       1663 1 . . . . .  6.0  1.8  6.0 1 1 
       1664 1 . . . . . 4.17  1.8 4.17 1 1 
       1665 1 . . . . .  3.7  1.8  3.7 1 1 
       1666 1 . . . . .  3.1  1.8  3.1 1 1 
       1667 1 . . . . .  3.7  1.8  3.7 1 1 
       1668 1 . . . . . 4.66  1.8 4.66 1 1 
       1669 1 . . . . . 2.95  1.8 2.95 1 1 
       1670 1 . . . . . 3.43  1.8 3.43 1 1 
       1671 1 . . . . .  6.0  1.8  6.0 1 1 
       1672 1 . . . . .  6.0  1.8  6.0 1 1 
       1673 1 . . . . . 3.71  1.8 3.71 1 1 
       1674 1 . . . . . 4.23  1.8 4.23 1 1 
       1675 1 . . . . . 5.92  1.8 5.92 1 1 
       1676 1 . . . . . 3.12  1.8 3.12 1 1 
       1677 1 . . . . . 3.66  1.8 3.66 1 1 
       1678 1 . . . . . 3.61  1.8 3.61 1 1 
       1679 1 . . . . .  6.0  1.8  6.0 1 1 
       1680 1 . . . . . 5.15  1.8 5.15 1 1 
       1681 1 . . . . . 5.49  1.8 5.49 1 1 
       1682 1 . . . . . 5.81  1.8 5.81 1 1 
       1683 1 . . . . . 4.81  1.8 4.81 1 1 
       1684 1 . . . . . 3.44  1.8 3.44 1 1 
       1685 1 . . . . . 4.29  1.8 4.29 1 1 
       1686 1 . . . . . 4.15  1.8 4.15 1 1 
       1687 1 . . . . . 5.81  1.8 5.81 1 1 
       1688 1 . . . . . 5.81  1.8 5.81 1 1 
       1689 1 . . . . . 4.52  1.8 4.52 1 1 
       1690 1 . . . . .  6.0  1.8  6.0 1 1 
       1691 1 . . . . . 4.99  1.8 4.99 1 1 
       1692 1 . . . . . 3.64  1.8 3.64 1 1 
       1693 1 . . . . . 2.93  1.8 2.93 1 1 
       1694 1 . . . . . 4.33  1.8 4.33 1 1 
       1695 1 . . . . . 4.88  1.8 4.88 1 1 
       1696 1 . . . . . 5.81  1.8 5.81 1 1 
       1697 1 . . . . .  6.0  1.8  6.0 1 1 
       1698 1 . . . . .  6.0  1.8  6.0 1 1 
       1699 1 . . . . . 3.03  1.8 3.03 1 1 
       1700 1 . . . . . 3.39  1.8 3.39 1 1 
       1701 1 . . . . . 3.52  1.8 3.52 1 1 
       1702 1 . . . . . 4.46  1.8 4.46 1 1 
       1703 1 . . . . . 4.68  1.8 4.68 1 1 
       1704 1 . . . . . 2.58  1.8 2.58 1 1 
       1705 1 . . . . . 3.33  1.8 3.33 1 1 
       1706 1 . . . . . 5.04  1.8 5.04 1 1 
       1707 1 . . . . . 5.81  1.8 5.81 1 1 
       1708 1 . . . . . 4.75  1.8 4.75 1 1 
       1709 1 . . . . .  3.1  1.8  3.1 1 1 
       1710 1 . . . . . 5.24  1.8 5.24 1 1 
       1711 1 . . . . . 3.05  1.8 3.05 1 1 
       1712 1 . . . . . 3.81  1.8 3.81 1 1 
       1713 1 . . . . .  2.6  1.8  2.6 1 1 
       1714 1 . . . . . 3.08  1.8 3.08 1 1 
       1715 1 . . . . . 4.13  1.8 4.13 1 1 
       1716 1 . . . . . 4.13  1.8 4.13 1 1 
       1717 1 . . . . . 3.06  1.8 3.06 1 1 
       1718 1 . . . . . 5.81  1.8 5.81 1 1 
       1719 1 . . . . . 3.07  1.8 3.07 1 1 
       1720 1 . . . . . 4.87  1.8 4.87 1 1 
       1721 1 . . . . . 3.89  1.8 3.89 1 1 
       1722 1 . . . . . 5.61  1.8 5.61 1 1 
       1723 1 . . . . . 4.02  1.8 4.02 1 1 
       1724 1 . . . . . 3.48  1.8 3.48 1 1 
       1725 1 . . . . . 4.02  1.8 4.02 1 1 
       1726 1 . . . . . 4.16  1.8 4.16 1 1 
       1727 1 . . . . .  6.0  1.8  6.0 1 1 
       1728 1 . . . . .  6.0  1.8  6.0 1 1 
       1729 1 . . . . . 3.61  1.8 3.61 1 1 
       1730 1 . . . . . 3.57  1.8 3.57 1 1 
       1731 1 . . . . .  3.9  1.8  3.9 1 1 
       1732 1 . . . . . 5.73  1.8 5.73 1 1 
       1733 1 . . . . .  3.0  1.8  3.0 1 1 
       1734 1 . . . . . 4.53  1.8 4.53 1 1 
       1735 1 . . . . . 4.49  1.8 4.49 1 1 
       1736 1 . . . . . 5.81  1.8 5.81 1 1 
       1737 1 . . . . . 3.48  1.8 3.48 1 1 
       1738 1 . . . . . 3.51  1.8 3.51 1 1 
       1739 1 . . . . . 3.22  1.8 3.22 1 1 
       1740 1 . . . . . 5.34  1.8 5.34 1 1 
       1741 1 . . . . .  2.7  1.8  2.7 1 1 
       1742 1 . . . . . 4.12  1.8 4.12 1 1 
       1743 1 . . . . .  5.1  1.8  5.1 1 1 
       1744 1 . . . . . 4.67  1.8 4.67 1 1 
       1745 1 . . . . .  5.8  1.8  5.8 1 1 
       1746 1 . . . . . 5.73  1.8 5.73 1 1 
       1747 1 . . . . . 4.46  1.8 4.46 1 1 
       1748 1 . . . . . 3.19  1.8 3.19 1 1 
       1749 1 . . . . . 3.71  1.8 3.71 1 1 
       1750 1 . . . . . 4.11  1.8 4.11 1 1 
       1751 1 . . . . . 3.53  1.8 3.53 1 1 
       1752 1 . . . . . 4.11  1.8 4.11 1 1 
       1753 1 . . . . . 3.37  1.8 3.37 1 1 
       1754 1 . . . . . 5.81  1.8 5.81 1 1 
    stop_

save_


save_CNS/XPLOR_dihedral_4
    _Torsion_angle_constraint_list.Sf_category         torsion_angle_constraints
    _Torsion_angle_constraint_list.Entry_ID            1
    _Torsion_angle_constraint_list.ID                  1
    _Torsion_angle_constraint_list.Constraint_file_ID  .
    _Torsion_angle_constraint_list.Block_ID            .

    loop_
       _Torsion_angle_constraint.ID
       _Torsion_angle_constraint.Torsion_angle_name
       _Torsion_angle_constraint.Entity_assembly_ID_1
       _Torsion_angle_constraint.Entity_ID_1
       _Torsion_angle_constraint.Comp_index_ID_1
       _Torsion_angle_constraint.Comp_ID_1
       _Torsion_angle_constraint.Atom_ID_1
       _Torsion_angle_constraint.Entity_assembly_ID_2
       _Torsion_angle_constraint.Entity_ID_2
       _Torsion_angle_constraint.Comp_index_ID_2
       _Torsion_angle_constraint.Comp_ID_2
       _Torsion_angle_constraint.Atom_ID_2
       _Torsion_angle_constraint.Entity_assembly_ID_3
       _Torsion_angle_constraint.Entity_ID_3
       _Torsion_angle_constraint.Comp_index_ID_3
       _Torsion_angle_constraint.Comp_ID_3
       _Torsion_angle_constraint.Atom_ID_3
       _Torsion_angle_constraint.Entity_assembly_ID_4
       _Torsion_angle_constraint.Entity_ID_4
       _Torsion_angle_constraint.Comp_index_ID_4
       _Torsion_angle_constraint.Comp_ID_4
       _Torsion_angle_constraint.Atom_ID_4
       _Torsion_angle_constraint.Angle_lower_bound_val
       _Torsion_angle_constraint.Angle_upper_bound_val
       _Torsion_angle_constraint.Auth_asym_ID_1
       _Torsion_angle_constraint.Auth_seq_ID_1
       _Torsion_angle_constraint.Auth_comp_ID_1
       _Torsion_angle_constraint.Auth_atom_ID_1
       _Torsion_angle_constraint.Auth_asym_ID_2
       _Torsion_angle_constraint.Auth_seq_ID_2
       _Torsion_angle_constraint.Auth_comp_ID_2
       _Torsion_angle_constraint.Auth_atom_ID_2
       _Torsion_angle_constraint.Auth_asym_ID_3
       _Torsion_angle_constraint.Auth_seq_ID_3
       _Torsion_angle_constraint.Auth_comp_ID_3
       _Torsion_angle_constraint.Auth_atom_ID_3
       _Torsion_angle_constraint.Auth_asym_ID_4
       _Torsion_angle_constraint.Auth_seq_ID_4
       _Torsion_angle_constraint.Auth_comp_ID_4
       _Torsion_angle_constraint.Auth_atom_ID_4
       _Torsion_angle_constraint.Entry_ID
       _Torsion_angle_constraint.Torsion_angle_constraint_list_ID

         1 . 1 1  6 SER C 1 1  7 VAL N  1 1  7 VAL CA 1 1  7 VAL C      -72.0      -36.0 .   6 . C .   7 . N  .   7 . CA .   7 . C 1 1 
         2 . 1 1  7 VAL N 1 1  7 VAL CA 1 1  7 VAL C  1 1  8 PRO N      -59.0 -30.999998 .   7 . N .   7 . CA .   7 . C  .   8 . N 1 1 
         3 . 1 1  8 PRO C 1 1  9 TYR N  1 1  9 TYR CA 1 1  9 TYR C      -77.0      -57.0 .   8 . C .   9 . N  .   9 . CA .   9 . C 1 1 
         4 . 1 1  9 TYR N 1 1  9 TYR CA 1 1  9 TYR C  1 1 10 PHE N      -58.0      -22.0 .   9 . N .   9 . CA .   9 . C  .  10 . N 1 1 
         5 . 1 1  9 TYR C 1 1 10 PHE N  1 1 10 PHE CA 1 1 10 PHE C      -81.0      -49.0 .   9 . C .  10 . N  .  10 . CA .  10 . C 1 1 
         6 . 1 1 10 PHE N 1 1 10 PHE CA 1 1 10 PHE C  1 1 11 ILE N -50.999996 -30.999998 .  10 . N .  10 . CA .  10 . C  .  11 . N 1 1 
         7 . 1 1 10 PHE C 1 1 11 ILE N  1 1 11 ILE CA 1 1 11 ILE C      -75.0      -55.0 .  10 . C .  11 . N  .  11 . CA .  11 . C 1 1 
         8 . 1 1 11 ILE N 1 1 11 ILE CA 1 1 11 ILE C  1 1 12 GLU N -53.999996      -34.0 .  11 . N .  11 . CA .  11 . C  .  12 . N 1 1 
         9 . 1 1 11 ILE C 1 1 12 GLU N  1 1 12 GLU CA 1 1 12 GLU C      -75.0      -55.0 .  11 . C .  12 . N  .  12 . CA .  12 . C 1 1 
        10 . 1 1 12 GLU N 1 1 12 GLU CA 1 1 12 GLU C  1 1 13 ASN N -50.999996 -26.999998 .  12 . N .  12 . CA .  12 . C  .  13 . N 1 1 
        11 . 1 1 12 GLU C 1 1 13 ASN N  1 1 13 ASN CA 1 1 13 ASN C      -73.0      -53.0 .  12 . C .  13 . N  .  13 . CA .  13 . C 1 1 
        12 . 1 1 13 ASN N 1 1 13 ASN CA 1 1 13 ASN C  1 1 14 LEU N      -52.0      -32.0 .  13 . N .  13 . CA .  13 . C  .  14 . N 1 1 
        13 . 1 1 13 ASN C 1 1 14 LEU N  1 1 14 LEU CA 1 1 14 LEU C      -73.0      -49.0 .  13 . C .  14 . N  .  14 . CA .  14 . C 1 1 
        14 . 1 1 14 LEU N 1 1 14 LEU CA 1 1 14 LEU C  1 1 15 LYS N      -57.0      -37.0 .  14 . N .  14 . CA .  14 . C  .  15 . N 1 1 
        15 . 1 1 14 LEU C 1 1 15 LYS N  1 1 15 LYS CA 1 1 15 LYS C      -72.0      -52.0 .  14 . C .  15 . N  .  15 . CA .  15 . C 1 1 
        16 . 1 1 15 LYS N 1 1 15 LYS CA 1 1 15 LYS C  1 1 16 GLN N      -52.0      -32.0 .  15 . N .  15 . CA .  15 . C  .  16 . N 1 1 
        17 . 1 1 15 LYS C 1 1 16 GLN N  1 1 16 GLN CA 1 1 16 GLN C      -80.0      -56.0 .  15 . C .  16 . N  .  16 . CA .  16 . C 1 1 
        18 . 1 1 16 GLN N 1 1 16 GLN CA 1 1 16 GLN C  1 1 17 HIS N -53.999996      -30.0 .  16 . N .  16 . CA .  16 . C  .  17 . N 1 1 
        19 . 1 1 16 GLN C 1 1 17 HIS N  1 1 17 HIS CA 1 1 17 HIS C      -80.0      -52.0 .  16 . C .  17 . N  .  17 . CA .  17 . C 1 1 
        20 . 1 1 17 HIS N 1 1 17 HIS CA 1 1 17 HIS C  1 1 18 ILE N      -52.0      -26.0 .  17 . N .  17 . CA .  17 . C  .  18 . N 1 1 
        21 . 1 1 17 HIS C 1 1 18 ILE N  1 1 18 ILE CA 1 1 18 ILE C      -74.0 -53.999996 .  17 . C .  18 . N  .  18 . CA .  18 . C 1 1 
        22 . 1 1 18 ILE N 1 1 18 ILE CA 1 1 18 ILE C  1 1 19 GLU N -53.999996      -34.0 .  18 . N .  18 . CA .  18 . C  .  19 . N 1 1 
        23 . 1 1 18 ILE C 1 1 19 GLU N  1 1 19 GLU CA 1 1 19 GLU C      -76.0 -47.999996 .  18 . C .  19 . N  .  19 . CA .  19 . C 1 1 
        24 . 1 1 19 GLU N 1 1 19 GLU CA 1 1 19 GLU C  1 1 20 MET N -50.999996      -25.0 .  19 . N .  19 . CA .  19 . C  .  20 . N 1 1 
        25 . 1 1 26 LYS C 1 1 27 ILE N  1 1 27 ILE CA 1 1 27 ILE C      -83.0 -50.999996 .  26 . C .  27 . N  .  27 . CA .  27 . C 1 1 
        26 . 1 1 27 ILE N 1 1 27 ILE CA 1 1 27 ILE C  1 1 28 HIS N      -55.0      -15.0 .  27 . N .  27 . CA .  27 . C  .  28 . N 1 1 
        27 . 1 1 27 ILE C 1 1 28 HIS N  1 1 28 HIS CA 1 1 28 HIS C      -92.0      -52.0 .  27 . C .  28 . N  .  28 . CA .  28 . C 1 1 
        28 . 1 1 28 HIS N 1 1 28 HIS CA 1 1 28 HIS C  1 1 29 ALA N      -79.0       17.0 .  28 . N .  28 . CA .  28 . C  .  29 . N 1 1 
        29 . 1 1 28 HIS C 1 1 29 ALA N  1 1 29 ALA CA 1 1 29 ALA C      -74.0      -50.0 .  28 . C .  29 . N  .  29 . CA .  29 . C 1 1 
        30 . 1 1 29 ALA N 1 1 29 ALA CA 1 1 29 ALA C  1 1 30 MET N      -57.0      -29.0 .  29 . N .  29 . CA .  29 . C  .  30 . N 1 1 
        31 . 1 1 29 ALA C 1 1 30 MET N  1 1 30 MET CA 1 1 30 MET C      -72.0      -52.0 .  29 . C .  30 . N  .  30 . CA .  30 . C 1 1 
        32 . 1 1 30 MET N 1 1 30 MET CA 1 1 30 MET C  1 1 31 ASN N      -53.0      -33.0 .  30 . N .  30 . CA .  30 . C  .  31 . N 1 1 
        33 . 1 1 30 MET C 1 1 31 ASN N  1 1 31 ASN CA 1 1 31 ASN C      -78.0      -56.0 .  30 . C .  31 . N  .  31 . CA .  31 . C 1 1 
        34 . 1 1 31 ASN N 1 1 31 ASN CA 1 1 31 ASN C  1 1 32 SER N      -56.0      -20.0 .  31 . N .  31 . CA .  31 . C  .  32 . N 1 1 
        35 . 1 1 31 ASN C 1 1 32 SER N  1 1 32 SER CA 1 1 32 SER C      -84.0      -52.0 .  31 . C .  32 . N  .  32 . CA .  32 . C 1 1 
        36 . 1 1 32 SER N 1 1 32 SER CA 1 1 32 SER C  1 1 33 TYR N -50.999996      -23.0 .  32 . N .  32 . CA .  32 . C  .  33 . N 1 1 
        37 . 1 1 32 SER C 1 1 33 TYR N  1 1 33 TYR CA 1 1 33 TYR C      -80.0      -52.0 .  32 . C .  33 . N  .  33 . CA .  33 . C 1 1 
        38 . 1 1 33 TYR N 1 1 33 TYR CA 1 1 33 TYR C  1 1 34 TYR N -60.999996      -21.0 .  33 . N .  33 . CA .  33 . C  .  34 . N 1 1 
        39 . 1 1 33 TYR C 1 1 34 TYR N  1 1 34 TYR CA 1 1 34 TYR C      -73.0      -49.0 .  33 . C .  34 . N  .  34 . CA .  34 . C 1 1 
        40 . 1 1 34 TYR N 1 1 34 TYR CA 1 1 34 TYR C  1 1 35 ARG N      -55.0 -30.999998 .  34 . N .  34 . CA .  34 . C  .  35 . N 1 1 
        41 . 1 1 34 TYR C 1 1 35 ARG N  1 1 35 ARG CA 1 1 35 ARG C      -72.0 -47.999996 .  34 . C .  35 . N  .  35 . CA .  35 . C 1 1 
        42 . 1 1 35 ARG N 1 1 35 ARG CA 1 1 35 ARG C  1 1 36 SER N      -63.0 -26.999998 .  35 . N .  35 . CA .  35 . C  .  36 . N 1 1 
        43 . 1 1 35 ARG C 1 1 36 SER N  1 1 36 SER CA 1 1 36 SER C      -74.0 -53.999996 .  35 . C .  36 . N  .  36 . CA .  36 . C 1 1 
        44 . 1 1 36 SER N 1 1 36 SER CA 1 1 36 SER C  1 1 37 VAL N      -53.0      -29.0 .  36 . N .  36 . CA .  36 . C  .  37 . N 1 1 
        45 . 1 1 36 SER C 1 1 37 VAL N  1 1 37 VAL CA 1 1 37 VAL C      -76.0      -52.0 .  36 . C .  37 . N  .  37 . CA .  37 . C 1 1 
        46 . 1 1 37 VAL N 1 1 37 VAL CA 1 1 37 VAL C  1 1 38 VAL N      -57.0      -33.0 .  37 . N .  37 . CA .  37 . C  .  38 . N 1 1 
        47 . 1 1 37 VAL C 1 1 38 VAL N  1 1 38 VAL CA 1 1 38 VAL C      -75.0 -50.999996 .  37 . C .  38 . N  .  38 . CA .  38 . C 1 1 
        48 . 1 1 38 VAL N 1 1 38 VAL CA 1 1 38 VAL C  1 1 39 SER N      -57.0      -33.0 .  38 . N .  38 . CA .  38 . C  .  39 . N 1 1 
        49 . 1 1 38 VAL C 1 1 39 SER N  1 1 39 SER CA 1 1 39 SER C      -69.0      -49.0 .  38 . C .  39 . N  .  39 . CA .  39 . C 1 1 
        50 . 1 1 39 SER N 1 1 39 SER CA 1 1 39 SER C  1 1 40 THR N      -59.0      -19.0 .  39 . N .  39 . CA .  39 . C  .  40 . N 1 1 
        51 . 1 1 39 SER C 1 1 40 THR N  1 1 40 THR CA 1 1 40 THR C      -83.0 -50.999996 .  39 . C .  40 . N  .  40 . CA .  40 . C 1 1 
        52 . 1 1 40 THR N 1 1 40 THR CA 1 1 40 THR C  1 1 41 LEU N      -55.0 -26.999998 .  40 . N .  40 . CA .  40 . C  .  41 . N 1 1 
        53 . 1 1 40 THR C 1 1 41 LEU N  1 1 41 LEU CA 1 1 41 LEU C      -84.0 -47.999996 .  40 . C .  41 . N  .  41 . CA .  41 . C 1 1 
        54 . 1 1 41 LEU N 1 1 41 LEU CA 1 1 41 LEU C  1 1 42 VAL N      -49.0      -29.0 .  41 . N .  41 . CA .  41 . C  .  42 . N 1 1 
        55 . 1 1 41 LEU C 1 1 42 VAL N  1 1 42 VAL CA 1 1 42 VAL C     -105.0      -49.0 .  41 . C .  42 . N  .  42 . CA .  42 . C 1 1 
        56 . 1 1 42 VAL N 1 1 42 VAL CA 1 1 42 VAL C  1 1 43 GLN N      -50.0       22.0 .  42 . N .  42 . CA .  42 . C  .  43 . N 1 1 
        57 . 1 1 48 LYS C 1 1 49 ASN N  1 1 49 ASN CA 1 1 49 ASN C      -70.0      -50.0 .  48 . C .  49 . N  .  49 . CA .  49 . C 1 1 
        58 . 1 1 49 ASN N 1 1 49 ASN CA 1 1 49 ASN C  1 1 50 ALA N      -64.0 -11.999999 .  49 . N .  49 . CA .  49 . C  .  50 . N 1 1 
        59 . 1 1 49 ASN C 1 1 50 ALA N  1 1 50 ALA CA 1 1 50 ALA C      -74.0 -53.999996 .  49 . C .  50 . N  .  50 . CA .  50 . C 1 1 
        60 . 1 1 50 ALA N 1 1 50 ALA CA 1 1 50 ALA C  1 1 51 VAL N      -50.0 -23.999998 .  50 . N .  50 . CA .  50 . C  .  51 . N 1 1 
        61 . 1 1 50 ALA C 1 1 51 VAL N  1 1 51 VAL CA 1 1 51 VAL C      -80.0      -52.0 .  50 . C .  51 . N  .  51 . CA .  51 . C 1 1 
        62 . 1 1 51 VAL N 1 1 51 VAL CA 1 1 51 VAL C  1 1 52 VAL N      -56.0      -34.0 .  51 . N .  51 . CA .  51 . C  .  52 . N 1 1 
        63 . 1 1 51 VAL C 1 1 52 VAL N  1 1 52 VAL CA 1 1 52 VAL C      -75.0      -55.0 .  51 . C .  52 . N  .  52 . CA .  52 . C 1 1 
        64 . 1 1 52 VAL N 1 1 52 VAL CA 1 1 52 VAL C  1 1 53 LEU N      -55.0      -35.0 .  52 . N .  52 . CA .  52 . C  .  53 . N 1 1 
        65 . 1 1 52 VAL C 1 1 53 LEU N  1 1 53 LEU CA 1 1 53 LEU C      -70.0      -50.0 .  52 . C .  53 . N  .  53 . CA .  53 . C 1 1 
        66 . 1 1 53 LEU N 1 1 53 LEU CA 1 1 53 LEU C  1 1 54 LYS N      -58.0      -18.0 .  53 . N .  53 . CA .  53 . C  .  54 . N 1 1 
        67 . 1 1 53 LEU C 1 1 54 LYS N  1 1 54 LYS CA 1 1 54 LYS C      -74.0 -53.999996 .  53 . C .  54 . N  .  54 . CA .  54 . C 1 1 
        68 . 1 1 54 LYS N 1 1 54 LYS CA 1 1 54 LYS C  1 1 55 ARG N      -50.0      -30.0 .  54 . N .  54 . CA .  54 . C  .  55 . N 1 1 
        69 . 1 1 54 LYS C 1 1 55 ARG N  1 1 55 ARG CA 1 1 55 ARG C      -74.0 -53.999996 .  54 . C .  55 . N  .  55 . CA .  55 . C 1 1 
        70 . 1 1 55 ARG N 1 1 55 ARG CA 1 1 55 ARG C  1 1 56 ILE N      -53.0      -33.0 .  55 . N .  55 . CA .  55 . C  .  56 . N 1 1 
        71 . 1 1 55 ARG C 1 1 56 ILE N  1 1 56 ILE CA 1 1 56 ILE C      -76.0      -56.0 .  55 . C .  56 . N  .  56 . CA .  56 . C 1 1 
        72 . 1 1 56 ILE N 1 1 56 ILE CA 1 1 56 ILE C  1 1 57 GLN N -50.999996 -30.999998 .  56 . N .  56 . CA .  56 . C  .  57 . N 1 1 
        73 . 1 1 56 ILE C 1 1 57 GLN N  1 1 57 GLN CA 1 1 57 GLN C      -70.0      -50.0 .  56 . C .  57 . N  .  57 . CA .  57 . C 1 1 
        74 . 1 1 57 GLN N 1 1 57 GLN CA 1 1 57 GLN C  1 1 58 HIS N      -58.0      -26.0 .  57 . N .  57 . CA .  57 . C  .  58 . N 1 1 
        75 . 1 1 57 GLN C 1 1 58 HIS N  1 1 58 HIS CA 1 1 58 HIS C      -77.0      -57.0 .  57 . C .  58 . N  .  58 . CA .  58 . C 1 1 
        76 . 1 1 58 HIS N 1 1 58 HIS CA 1 1 58 HIS C  1 1 59 LEU N      -55.0      -23.0 .  58 . N .  58 . CA .  58 . C  .  59 . N 1 1 
        77 . 1 1 58 HIS C 1 1 59 LEU N  1 1 59 LEU CA 1 1 59 LEU C      -74.0 -53.999996 .  58 . C .  59 . N  .  59 . CA .  59 . C 1 1 
        78 . 1 1 59 LEU N 1 1 59 LEU CA 1 1 59 LEU C  1 1 60 ASP N      -52.0 -23.999998 .  59 . N .  59 . CA .  59 . C  .  60 . N 1 1 
        79 . 1 1 59 LEU C 1 1 60 ASP N  1 1 60 ASP CA 1 1 60 ASP C      -73.0      -53.0 .  59 . C .  60 . N  .  60 . CA .  60 . C 1 1 
        80 . 1 1 60 ASP N 1 1 60 ASP CA 1 1 60 ASP C  1 1 61 GLU N -53.999996      -30.0 .  60 . N .  60 . CA .  60 . C  .  61 . N 1 1 
        81 . 1 1 60 ASP C 1 1 61 GLU N  1 1 61 GLU CA 1 1 61 GLU C      -73.0      -53.0 .  60 . C .  61 . N  .  61 . CA .  61 . C 1 1 
        82 . 1 1 61 GLU N 1 1 61 GLU CA 1 1 61 GLU C  1 1 62 ALA N      -58.0      -14.0 .  61 . N .  61 . CA .  61 . C  .  62 . N 1 1 
        83 . 1 1 61 GLU C 1 1 62 ALA N  1 1 62 ALA CA 1 1 62 ALA C      -71.0 -50.999996 .  61 . C .  62 . N  .  62 . CA .  62 . C 1 1 
        84 . 1 1 62 ALA N 1 1 62 ALA CA 1 1 62 ALA C  1 1 63 TYR N      -58.0      -34.0 .  62 . N .  62 . CA .  62 . C  .  63 . N 1 1 
        85 . 1 1 62 ALA C 1 1 63 TYR N  1 1 63 TYR CA 1 1 63 TYR C      -74.0      -50.0 .  62 . C .  63 . N  .  63 . CA .  63 . C 1 1 
        86 . 1 1 63 TYR N 1 1 63 TYR CA 1 1 63 TYR C  1 1 64 ASN N      -56.0      -32.0 .  63 . N .  63 . CA .  63 . C  .  64 . N 1 1 
        87 . 1 1 63 TYR C 1 1 64 ASN N  1 1 64 ASN CA 1 1 64 ASN C      -71.0 -50.999996 .  63 . C .  64 . N  .  64 . CA .  64 . C 1 1 
        88 . 1 1 64 ASN N 1 1 64 ASN CA 1 1 64 ASN C  1 1 65 LYS N -53.999996      -22.0 .  64 . N .  64 . CA .  64 . C  .  65 . N 1 1 
        89 . 1 1 64 ASN C 1 1 65 LYS N  1 1 65 LYS CA 1 1 65 LYS C      -75.0      -55.0 .  64 . C .  65 . N  .  65 . CA .  65 . C 1 1 
        90 . 1 1 65 LYS N 1 1 65 LYS CA 1 1 65 LYS C  1 1 66 VAL N -50.999996 -26.999998 .  65 . N .  65 . CA .  65 . C  .  66 . N 1 1 
        91 . 1 1 65 LYS C 1 1 66 VAL N  1 1 66 VAL CA 1 1 66 VAL C      -74.0 -53.999996 .  65 . C .  66 . N  .  66 . CA .  66 . C 1 1 
        92 . 1 1 66 VAL N 1 1 66 VAL CA 1 1 66 VAL C  1 1 67 LYS N      -60.0      -28.0 .  66 . N .  66 . CA .  66 . C  .  67 . N 1 1 
        93 . 1 1 66 VAL C 1 1 67 LYS N  1 1 67 LYS CA 1 1 67 LYS C      -71.0 -50.999996 .  66 . C .  67 . N  .  67 . CA .  67 . C 1 1 
        94 . 1 1 67 LYS N 1 1 67 LYS CA 1 1 67 LYS C  1 1 68 ARG N      -56.0      -28.0 .  67 . N .  67 . CA .  67 . C  .  68 . N 1 1 
        95 . 1 1 67 LYS C 1 1 68 ARG N  1 1 68 ARG CA 1 1 68 ARG C -121.99999      -42.0 .  67 . C .  68 . N  .  68 . CA .  68 . C 1 1 
        96 . 1 1 68 ARG N 1 1 68 ARG CA 1 1 68 ARG C  1 1 69 GLY N      -64.0  23.999998 .  68 . N .  68 . CA .  68 . C  .  69 . N 1 1 
        97 . 2 1  6 SER C 2 1  7 VAL N  2 1  7 VAL CA 2 1  7 VAL C      -72.0      -36.0 . 106 . C . 107 . N  . 107 . CA . 107 . C 1 1 
        98 . 2 1  7 VAL N 2 1  7 VAL CA 2 1  7 VAL C  2 1  8 PRO N      -59.0 -30.999998 . 107 . N . 107 . CA . 107 . C  . 108 . N 1 1 
        99 . 2 1  8 PRO C 2 1  9 TYR N  2 1  9 TYR CA 2 1  9 TYR C      -77.0      -57.0 . 108 . C . 109 . N  . 109 . CA . 109 . C 1 1 
       100 . 2 1  9 TYR N 2 1  9 TYR CA 2 1  9 TYR C  2 1 10 PHE N      -58.0      -22.0 . 109 . N . 109 . CA . 109 . C  . 110 . N 1 1 
       101 . 2 1  9 TYR C 2 1 10 PHE N  2 1 10 PHE CA 2 1 10 PHE C      -81.0      -49.0 . 109 . C . 110 . N  . 110 . CA . 110 . C 1 1 
       102 . 2 1 10 PHE N 2 1 10 PHE CA 2 1 10 PHE C  2 1 11 ILE N -50.999996 -30.999998 . 110 . N . 110 . CA . 110 . C  . 111 . N 1 1 
       103 . 2 1 10 PHE C 2 1 11 ILE N  2 1 11 ILE CA 2 1 11 ILE C      -75.0      -55.0 . 110 . C . 111 . N  . 111 . CA . 111 . C 1 1 
       104 . 2 1 11 ILE N 2 1 11 ILE CA 2 1 11 ILE C  2 1 12 GLU N -53.999996      -34.0 . 111 . N . 111 . CA . 111 . C  . 112 . N 1 1 
       105 . 2 1 11 ILE C 2 1 12 GLU N  2 1 12 GLU CA 2 1 12 GLU C      -75.0      -55.0 . 111 . C . 112 . N  . 112 . CA . 112 . C 1 1 
       106 . 2 1 12 GLU N 2 1 12 GLU CA 2 1 12 GLU C  2 1 13 ASN N -50.999996 -26.999998 . 112 . N . 112 . CA . 112 . C  . 113 . N 1 1 
       107 . 2 1 12 GLU C 2 1 13 ASN N  2 1 13 ASN CA 2 1 13 ASN C      -73.0      -53.0 . 112 . C . 113 . N  . 113 . CA . 113 . C 1 1 
       108 . 2 1 13 ASN N 2 1 13 ASN CA 2 1 13 ASN C  2 1 14 LEU N      -52.0      -32.0 . 113 . N . 113 . CA . 113 . C  . 114 . N 1 1 
       109 . 2 1 13 ASN C 2 1 14 LEU N  2 1 14 LEU CA 2 1 14 LEU C      -73.0      -49.0 . 113 . C . 114 . N  . 114 . CA . 114 . C 1 1 
       110 . 2 1 14 LEU N 2 1 14 LEU CA 2 1 14 LEU C  2 1 15 LYS N      -57.0      -37.0 . 114 . N . 114 . CA . 114 . C  . 115 . N 1 1 
       111 . 2 1 14 LEU C 2 1 15 LYS N  2 1 15 LYS CA 2 1 15 LYS C      -72.0      -52.0 . 114 . C . 115 . N  . 115 . CA . 115 . C 1 1 
       112 . 2 1 15 LYS N 2 1 15 LYS CA 2 1 15 LYS C  2 1 16 GLN N      -52.0      -32.0 . 115 . N . 115 . CA . 115 . C  . 116 . N 1 1 
       113 . 2 1 15 LYS C 2 1 16 GLN N  2 1 16 GLN CA 2 1 16 GLN C      -80.0      -56.0 . 115 . C . 116 . N  . 116 . CA . 116 . C 1 1 
       114 . 2 1 16 GLN N 2 1 16 GLN CA 2 1 16 GLN C  2 1 17 HIS N -53.999996      -30.0 . 116 . N . 116 . CA . 116 . C  . 117 . N 1 1 
       115 . 2 1 16 GLN C 2 1 17 HIS N  2 1 17 HIS CA 2 1 17 HIS C      -80.0      -52.0 . 116 . C . 117 . N  . 117 . CA . 117 . C 1 1 
       116 . 2 1 17 HIS N 2 1 17 HIS CA 2 1 17 HIS C  2 1 18 ILE N      -52.0      -26.0 . 117 . N . 117 . CA . 117 . C  . 118 . N 1 1 
       117 . 2 1 17 HIS C 2 1 18 ILE N  2 1 18 ILE CA 2 1 18 ILE C      -74.0 -53.999996 . 117 . C . 118 . N  . 118 . CA . 118 . C 1 1 
       118 . 2 1 18 ILE N 2 1 18 ILE CA 2 1 18 ILE C  2 1 19 GLU N -53.999996      -34.0 . 118 . N . 118 . CA . 118 . C  . 119 . N 1 1 
       119 . 2 1 18 ILE C 2 1 19 GLU N  2 1 19 GLU CA 2 1 19 GLU C      -76.0 -47.999996 . 118 . C . 119 . N  . 119 . CA . 119 . C 1 1 
       120 . 2 1 19 GLU N 2 1 19 GLU CA 2 1 19 GLU C  2 1 20 MET N -50.999996      -25.0 . 119 . N . 119 . CA . 119 . C  . 120 . N 1 1 
       121 . 2 1 26 LYS C 2 1 27 ILE N  2 1 27 ILE CA 2 1 27 ILE C      -83.0 -50.999996 . 126 . C . 127 . N  . 127 . CA . 127 . C 1 1 
       122 . 2 1 27 ILE N 2 1 27 ILE CA 2 1 27 ILE C  2 1 28 HIS N      -55.0      -15.0 . 127 . N . 127 . CA . 127 . C  . 128 . N 1 1 
       123 . 2 1 27 ILE C 2 1 28 HIS N  2 1 28 HIS CA 2 1 28 HIS C      -92.0      -52.0 . 127 . C . 128 . N  . 128 . CA . 128 . C 1 1 
       124 . 2 1 28 HIS N 2 1 28 HIS CA 2 1 28 HIS C  2 1 29 ALA N      -79.0       17.0 . 128 . N . 128 . CA . 128 . C  . 129 . N 1 1 
       125 . 2 1 28 HIS C 2 1 29 ALA N  2 1 29 ALA CA 2 1 29 ALA C      -74.0      -50.0 . 128 . C . 129 . N  . 129 . CA . 129 . C 1 1 
       126 . 2 1 29 ALA N 2 1 29 ALA CA 2 1 29 ALA C  2 1 30 MET N      -57.0      -29.0 . 129 . N . 129 . CA . 129 . C  . 130 . N 1 1 
       127 . 2 1 29 ALA C 2 1 30 MET N  2 1 30 MET CA 2 1 30 MET C      -72.0      -52.0 . 129 . C . 130 . N  . 130 . CA . 130 . C 1 1 
       128 . 2 1 30 MET N 2 1 30 MET CA 2 1 30 MET C  2 1 31 ASN N      -53.0      -33.0 . 130 . N . 130 . CA . 130 . C  . 131 . N 1 1 
       129 . 2 1 30 MET C 2 1 31 ASN N  2 1 31 ASN CA 2 1 31 ASN C      -78.0      -56.0 . 130 . C . 131 . N  . 131 . CA . 131 . C 1 1 
       130 . 2 1 31 ASN N 2 1 31 ASN CA 2 1 31 ASN C  2 1 32 SER N      -56.0      -20.0 . 131 . N . 131 . CA . 131 . C  . 132 . N 1 1 
       131 . 2 1 31 ASN C 2 1 32 SER N  2 1 32 SER CA 2 1 32 SER C      -84.0      -52.0 . 131 . C . 132 . N  . 132 . CA . 132 . C 1 1 
       132 . 2 1 32 SER N 2 1 32 SER CA 2 1 32 SER C  2 1 33 TYR N -50.999996      -23.0 . 132 . N . 132 . CA . 132 . C  . 133 . N 1 1 
       133 . 2 1 32 SER C 2 1 33 TYR N  2 1 33 TYR CA 2 1 33 TYR C      -80.0      -52.0 . 132 . C . 133 . N  . 133 . CA . 133 . C 1 1 
       134 . 2 1 33 TYR N 2 1 33 TYR CA 2 1 33 TYR C  2 1 34 TYR N -60.999996      -21.0 . 133 . N . 133 . CA . 133 . C  . 134 . N 1 1 
       135 . 2 1 33 TYR C 2 1 34 TYR N  2 1 34 TYR CA 2 1 34 TYR C      -73.0      -49.0 . 133 . C . 134 . N  . 134 . CA . 134 . C 1 1 
       136 . 2 1 34 TYR N 2 1 34 TYR CA 2 1 34 TYR C  2 1 35 ARG N      -55.0 -30.999998 . 134 . N . 134 . CA . 134 . C  . 135 . N 1 1 
       137 . 2 1 34 TYR C 2 1 35 ARG N  2 1 35 ARG CA 2 1 35 ARG C      -72.0 -47.999996 . 134 . C . 135 . N  . 135 . CA . 135 . C 1 1 
       138 . 2 1 35 ARG N 2 1 35 ARG CA 2 1 35 ARG C  2 1 36 SER N      -63.0 -26.999998 . 135 . N . 135 . CA . 135 . C  . 136 . N 1 1 
       139 . 2 1 35 ARG C 2 1 36 SER N  2 1 36 SER CA 2 1 36 SER C      -74.0 -53.999996 . 135 . C . 136 . N  . 136 . CA . 136 . C 1 1 
       140 . 2 1 36 SER N 2 1 36 SER CA 2 1 36 SER C  2 1 37 VAL N      -53.0      -29.0 . 136 . N . 136 . CA . 136 . C  . 137 . N 1 1 
       141 . 2 1 36 SER C 2 1 37 VAL N  2 1 37 VAL CA 2 1 37 VAL C      -76.0      -52.0 . 136 . C . 137 . N  . 137 . CA . 137 . C 1 1 
       142 . 2 1 37 VAL N 2 1 37 VAL CA 2 1 37 VAL C  2 1 38 VAL N      -57.0      -33.0 . 137 . N . 137 . CA . 137 . C  . 138 . N 1 1 
       143 . 2 1 37 VAL C 2 1 38 VAL N  2 1 38 VAL CA 2 1 38 VAL C      -75.0 -50.999996 . 137 . C . 138 . N  . 138 . CA . 138 . C 1 1 
       144 . 2 1 38 VAL N 2 1 38 VAL CA 2 1 38 VAL C  2 1 39 SER N      -57.0      -33.0 . 138 . N . 138 . CA . 138 . C  . 139 . N 1 1 
       145 . 2 1 38 VAL C 2 1 39 SER N  2 1 39 SER CA 2 1 39 SER C      -69.0      -49.0 . 138 . C . 139 . N  . 139 . CA . 139 . C 1 1 
       146 . 2 1 39 SER N 2 1 39 SER CA 2 1 39 SER C  2 1 40 THR N      -59.0      -19.0 . 139 . N . 139 . CA . 139 . C  . 140 . N 1 1 
       147 . 2 1 39 SER C 2 1 40 THR N  2 1 40 THR CA 2 1 40 THR C      -83.0 -50.999996 . 139 . C . 140 . N  . 140 . CA . 140 . C 1 1 
       148 . 2 1 40 THR N 2 1 40 THR CA 2 1 40 THR C  2 1 41 LEU N      -55.0 -26.999998 . 140 . N . 140 . CA . 140 . C  . 141 . N 1 1 
       149 . 2 1 40 THR C 2 1 41 LEU N  2 1 41 LEU CA 2 1 41 LEU C      -84.0 -47.999996 . 140 . C . 141 . N  . 141 . CA . 141 . C 1 1 
       150 . 2 1 41 LEU N 2 1 41 LEU CA 2 1 41 LEU C  2 1 42 VAL N      -49.0      -29.0 . 141 . N . 141 . CA . 141 . C  . 142 . N 1 1 
       151 . 2 1 41 LEU C 2 1 42 VAL N  2 1 42 VAL CA 2 1 42 VAL C     -105.0      -49.0 . 141 . C . 142 . N  . 142 . CA . 142 . C 1 1 
       152 . 2 1 42 VAL N 2 1 42 VAL CA 2 1 42 VAL C  2 1 43 GLN N      -50.0       22.0 . 142 . N . 142 . CA . 142 . C  . 143 . N 1 1 
       153 . 2 1 48 LYS C 2 1 49 ASN N  2 1 49 ASN CA 2 1 49 ASN C      -70.0      -50.0 . 148 . C . 149 . N  . 149 . CA . 149 . C 1 1 
       154 . 2 1 49 ASN N 2 1 49 ASN CA 2 1 49 ASN C  2 1 50 ALA N      -64.0 -11.999999 . 149 . N . 149 . CA . 149 . C  . 150 . N 1 1 
       155 . 2 1 49 ASN C 2 1 50 ALA N  2 1 50 ALA CA 2 1 50 ALA C      -74.0 -53.999996 . 149 . C . 150 . N  . 150 . CA . 150 . C 1 1 
       156 . 2 1 50 ALA N 2 1 50 ALA CA 2 1 50 ALA C  2 1 51 VAL N      -50.0 -23.999998 . 150 . N . 150 . CA . 150 . C  . 151 . N 1 1 
       157 . 2 1 50 ALA C 2 1 51 VAL N  2 1 51 VAL CA 2 1 51 VAL C      -80.0      -52.0 . 150 . C . 151 . N  . 151 . CA . 151 . C 1 1 
       158 . 2 1 51 VAL N 2 1 51 VAL CA 2 1 51 VAL C  2 1 52 VAL N      -56.0      -34.0 . 151 . N . 151 . CA . 151 . C  . 152 . N 1 1 
       159 . 2 1 51 VAL C 2 1 52 VAL N  2 1 52 VAL CA 2 1 52 VAL C      -75.0      -55.0 . 151 . C . 152 . N  . 152 . CA . 152 . C 1 1 
       160 . 2 1 52 VAL N 2 1 52 VAL CA 2 1 52 VAL C  2 1 53 LEU N      -55.0      -35.0 . 152 . N . 152 . CA . 152 . C  . 153 . N 1 1 
       161 . 2 1 52 VAL C 2 1 53 LEU N  2 1 53 LEU CA 2 1 53 LEU C      -70.0      -50.0 . 152 . C . 153 . N  . 153 . CA . 153 . C 1 1 
       162 . 2 1 53 LEU N 2 1 53 LEU CA 2 1 53 LEU C  2 1 54 LYS N      -58.0      -18.0 . 153 . N . 153 . CA . 153 . C  . 154 . N 1 1 
       163 . 2 1 53 LEU C 2 1 54 LYS N  2 1 54 LYS CA 2 1 54 LYS C      -74.0 -53.999996 . 153 . C . 154 . N  . 154 . CA . 154 . C 1 1 
       164 . 2 1 54 LYS N 2 1 54 LYS CA 2 1 54 LYS C  2 1 55 ARG N      -50.0      -30.0 . 154 . N . 154 . CA . 154 . C  . 155 . N 1 1 
       165 . 2 1 54 LYS C 2 1 55 ARG N  2 1 55 ARG CA 2 1 55 ARG C      -74.0 -53.999996 . 154 . C . 155 . N  . 155 . CA . 155 . C 1 1 
       166 . 2 1 55 ARG N 2 1 55 ARG CA 2 1 55 ARG C  2 1 56 ILE N      -53.0      -33.0 . 155 . N . 155 . CA . 155 . C  . 156 . N 1 1 
       167 . 2 1 55 ARG C 2 1 56 ILE N  2 1 56 ILE CA 2 1 56 ILE C      -76.0      -56.0 . 155 . C . 156 . N  . 156 . CA . 156 . C 1 1 
       168 . 2 1 56 ILE N 2 1 56 ILE CA 2 1 56 ILE C  2 1 57 GLN N -50.999996 -30.999998 . 156 . N . 156 . CA . 156 . C  . 157 . N 1 1 
       169 . 2 1 56 ILE C 2 1 57 GLN N  2 1 57 GLN CA 2 1 57 GLN C      -70.0      -50.0 . 156 . C . 157 . N  . 157 . CA . 157 . C 1 1 
       170 . 2 1 57 GLN N 2 1 57 GLN CA 2 1 57 GLN C  2 1 58 HIS N      -58.0      -26.0 . 157 . N . 157 . CA . 157 . C  . 158 . N 1 1 
       171 . 2 1 57 GLN C 2 1 58 HIS N  2 1 58 HIS CA 2 1 58 HIS C      -77.0      -57.0 . 157 . C . 158 . N  . 158 . CA . 158 . C 1 1 
       172 . 2 1 58 HIS N 2 1 58 HIS CA 2 1 58 HIS C  2 1 59 LEU N      -55.0      -23.0 . 158 . N . 158 . CA . 158 . C  . 159 . N 1 1 
       173 . 2 1 58 HIS C 2 1 59 LEU N  2 1 59 LEU CA 2 1 59 LEU C      -74.0 -53.999996 . 158 . C . 159 . N  . 159 . CA . 159 . C 1 1 
       174 . 2 1 59 LEU N 2 1 59 LEU CA 2 1 59 LEU C  2 1 60 ASP N      -52.0 -23.999998 . 159 . N . 159 . CA . 159 . C  . 160 . N 1 1 
       175 . 2 1 59 LEU C 2 1 60 ASP N  2 1 60 ASP CA 2 1 60 ASP C      -73.0      -53.0 . 159 . C . 160 . N  . 160 . CA . 160 . C 1 1 
       176 . 2 1 60 ASP N 2 1 60 ASP CA 2 1 60 ASP C  2 1 61 GLU N -53.999996      -30.0 . 160 . N . 160 . CA . 160 . C  . 161 . N 1 1 
       177 . 2 1 60 ASP C 2 1 61 GLU N  2 1 61 GLU CA 2 1 61 GLU C      -73.0      -53.0 . 160 . C . 161 . N  . 161 . CA . 161 . C 1 1 
       178 . 2 1 61 GLU N 2 1 61 GLU CA 2 1 61 GLU C  2 1 62 ALA N      -58.0      -14.0 . 161 . N . 161 . CA . 161 . C  . 162 . N 1 1 
       179 . 2 1 61 GLU C 2 1 62 ALA N  2 1 62 ALA CA 2 1 62 ALA C      -71.0 -50.999996 . 161 . C . 162 . N  . 162 . CA . 162 . C 1 1 
       180 . 2 1 62 ALA N 2 1 62 ALA CA 2 1 62 ALA C  2 1 63 TYR N      -58.0      -34.0 . 162 . N . 162 . CA . 162 . C  . 163 . N 1 1 
       181 . 2 1 62 ALA C 2 1 63 TYR N  2 1 63 TYR CA 2 1 63 TYR C      -74.0      -50.0 . 162 . C . 163 . N  . 163 . CA . 163 . C 1 1 
       182 . 2 1 63 TYR N 2 1 63 TYR CA 2 1 63 TYR C  2 1 64 ASN N      -56.0      -32.0 . 163 . N . 163 . CA . 163 . C  . 164 . N 1 1 
       183 . 2 1 63 TYR C 2 1 64 ASN N  2 1 64 ASN CA 2 1 64 ASN C      -71.0 -50.999996 . 163 . C . 164 . N  . 164 . CA . 164 . C 1 1 
       184 . 2 1 64 ASN N 2 1 64 ASN CA 2 1 64 ASN C  2 1 65 LYS N -53.999996      -22.0 . 164 . N . 164 . CA . 164 . C  . 165 . N 1 1 
       185 . 2 1 64 ASN C 2 1 65 LYS N  2 1 65 LYS CA 2 1 65 LYS C      -75.0      -55.0 . 164 . C . 165 . N  . 165 . CA . 165 . C 1 1 
       186 . 2 1 65 LYS N 2 1 65 LYS CA 2 1 65 LYS C  2 1 66 VAL N -50.999996 -26.999998 . 165 . N . 165 . CA . 165 . C  . 166 . N 1 1 
       187 . 2 1 65 LYS C 2 1 66 VAL N  2 1 66 VAL CA 2 1 66 VAL C      -74.0 -53.999996 . 165 . C . 166 . N  . 166 . CA . 166 . C 1 1 
       188 . 2 1 66 VAL N 2 1 66 VAL CA 2 1 66 VAL C  2 1 67 LYS N      -60.0      -28.0 . 166 . N . 166 . CA . 166 . C  . 167 . N 1 1 
       189 . 2 1 66 VAL C 2 1 67 LYS N  2 1 67 LYS CA 2 1 67 LYS C      -71.0 -50.999996 . 166 . C . 167 . N  . 167 . CA . 167 . C 1 1 
       190 . 2 1 67 LYS N 2 1 67 LYS CA 2 1 67 LYS C  2 1 68 ARG N      -56.0      -28.0 . 167 . N . 167 . CA . 167 . C  . 168 . N 1 1 
       191 . 2 1 67 LYS C 2 1 68 ARG N  2 1 68 ARG CA 2 1 68 ARG C -121.99999      -42.0 . 167 . C . 168 . N  . 168 . CA . 168 . C 1 1 
       192 . 2 1 68 ARG N 2 1 68 ARG CA 2 1 68 ARG C  2 1 69 GLY N      -64.0  23.999998 . 168 . N . 168 . CA . 168 . C  . 169 . N 1 1 
    stop_

save_


save_CNS/XPLOR_dipolar_coupling_5
    _RDC_constraint_list.Sf_category         RDC_constraints
    _RDC_constraint_list.Entry_ID            1
    _RDC_constraint_list.ID                  1
    _RDC_constraint_list.Constraint_file_ID  .
    _RDC_constraint_list.Block_ID            .

    loop_
       _RDC_constraint.ID
       _RDC_constraint.Entity_assembly_ID_1
       _RDC_constraint.Entity_ID_1
       _RDC_constraint.Comp_index_ID_1
       _RDC_constraint.Comp_ID_1
       _RDC_constraint.Atom_ID_1
       _RDC_constraint.Entity_assembly_ID_2
       _RDC_constraint.Entity_ID_2
       _RDC_constraint.Comp_index_ID_2
       _RDC_constraint.Comp_ID_2
       _RDC_constraint.Atom_ID_2
       _RDC_constraint.RDC_val
       _RDC_constraint.RDC_lower_bound
       _RDC_constraint.RDC_upper_bound
       _RDC_constraint.RDC_val_err
       _RDC_constraint.Auth_asym_ID_1
       _RDC_constraint.Auth_seq_ID_1
       _RDC_constraint.Auth_comp_ID_1
       _RDC_constraint.Auth_atom_ID_1
       _RDC_constraint.Auth_asym_ID_2
       _RDC_constraint.Auth_seq_ID_2
       _RDC_constraint.Auth_comp_ID_2
       _RDC_constraint.Auth_atom_ID_2
       _RDC_constraint.Entry_ID
       _RDC_constraint.RDC_constraint_list_ID

         1 1 1  6 SER N 1 1  6 SER H 13.56 . . . .   6 . N .   6 . HN 1 1 
         2 1 1  7 VAL N 1 1  7 VAL H -3.96 . . . .   7 . N .   7 . HN 1 1 
         3 1 1  9 TYR N 1 1  9 TYR H -1.99 . . . .   9 . N .   9 . HN 1 1 
         4 1 1 10 PHE N 1 1 10 PHE H -2.23 . . . .  10 . N .  10 . HN 1 1 
         5 1 1 11 ILE N 1 1 11 ILE H -6.28 . . . .  11 . N .  11 . HN 1 1 
         6 1 1 12 GLU N 1 1 12 GLU H -3.86 . . . .  12 . N .  12 . HN 1 1 
         7 1 1 13 ASN N 1 1 13 ASN H -0.54 . . . .  13 . N .  13 . HN 1 1 
         8 1 1 14 LEU N 1 1 14 LEU H -3.58 . . . .  14 . N .  14 . HN 1 1 
         9 1 1 20 MET N 1 1 20 MET H -2.06 . . . .  20 . N .  20 . HN 1 1 
        10 1 1 25 ASP N 1 1 25 ASP H -4.65 . . . .  25 . N .  25 . HN 1 1 
        11 1 1 26 LYS N 1 1 26 LYS H -3.83 . . . .  26 . N .  26 . HN 1 1 
        12 1 1 27 ILE N 1 1 27 ILE H  2.79 . . . .  27 . N .  27 . HN 1 1 
        13 1 1 28 HIS N 1 1 28 HIS H -4.11 . . . .  28 . N .  28 . HN 1 1 
        14 1 1 29 ALA N 1 1 29 ALA H -4.45 . . . .  29 . N .  29 . HN 1 1 
        15 1 1 30 MET N 1 1 30 MET H  1.55 . . . .  30 . N .  30 . HN 1 1 
        16 1 1 31 ASN N 1 1 31 ASN H -0.71 . . . .  31 . N .  31 . HN 1 1 
        17 1 1 33 TYR N 1 1 33 TYR H -4.26 . . . .  33 . N .  33 . HN 1 1 
        18 1 1 34 TYR N 1 1 34 TYR H  0.45 . . . .  34 . N .  34 . HN 1 1 
        19 1 1 36 SER N 1 1 36 SER H -6.37 . . . .  36 . N .  36 . HN 1 1 
        20 1 1 37 VAL N 1 1 37 VAL H  0.19 . . . .  37 . N .  37 . HN 1 1 
        21 1 1 38 VAL N 1 1 38 VAL H  -1.3 . . . .  38 . N .  38 . HN 1 1 
        22 1 1 39 SER N 1 1 39 SER H -3.56 . . . .  39 . N .  39 . HN 1 1 
        23 1 1 40 THR N 1 1 40 THR H  -6.6 . . . .  40 . N .  40 . HN 1 1 
        24 1 1 41 LEU N 1 1 41 LEU H -0.67 . . . .  41 . N .  41 . HN 1 1 
        25 1 1 42 VAL N 1 1 42 VAL H -2.25 . . . .  42 . N .  42 . HN 1 1 
        26 1 1 43 GLN N 1 1 43 GLN H  -6.4 . . . .  43 . N .  43 . HN 1 1 
        27 1 1 44 ASP N 1 1 44 ASP H  0.98 . . . .  44 . N .  44 . HN 1 1 
        28 1 1 45 GLN N 1 1 45 GLN H  7.92 . . . .  45 . N .  45 . HN 1 1 
        29 1 1 46 LEU N 1 1 46 LEU H -2.62 . . . .  46 . N .  46 . HN 1 1 
        30 1 1 48 LYS N 1 1 48 LYS H -0.54 . . . .  48 . N .  48 . HN 1 1 
        31 1 1 49 ASN N 1 1 49 ASN H  -6.5 . . . .  49 . N .  49 . HN 1 1 
        32 1 1 50 ALA N 1 1 50 ALA H -3.91 . . . .  50 . N .  50 . HN 1 1 
        33 1 1 51 VAL N 1 1 51 VAL H -5.92 . . . .  51 . N .  51 . HN 1 1 
        34 1 1 52 VAL N 1 1 52 VAL H -6.87 . . . .  52 . N .  52 . HN 1 1 
        35 1 1 53 LEU N 1 1 53 LEU H -4.01 . . . .  53 . N .  53 . HN 1 1 
        36 1 1 54 LYS N 1 1 54 LYS H -1.98 . . . .  54 . N .  54 . HN 1 1 
        37 1 1 55 ARG N 1 1 55 ARG H -7.32 . . . .  55 . N .  55 . HN 1 1 
        38 1 1 56 ILE N 1 1 56 ILE H -5.52 . . . .  56 . N .  56 . HN 1 1 
        39 1 1 57 GLN N 1 1 57 GLN H -3.81 . . . .  57 . N .  57 . HN 1 1 
        40 1 1 58 HIS N 1 1 58 HIS H -1.39 . . . .  58 . N .  58 . HN 1 1 
        41 1 1 59 LEU N 1 1 59 LEU H -7.68 . . . .  59 . N .  59 . HN 1 1 
        42 1 1 61 GLU N 1 1 61 GLU H -0.38 . . . .  61 . N .  61 . HN 1 1 
        43 1 1 62 ALA N 1 1 62 ALA H -6.81 . . . .  62 . N .  62 . HN 1 1 
        44 1 1 63 TYR N 1 1 63 TYR H -6.75 . . . .  63 . N .  63 . HN 1 1 
        45 1 1 65 LYS N 1 1 65 LYS H -0.87 . . . .  65 . N .  65 . HN 1 1 
        46 1 1 70 GLU N 1 1 70 GLU H -4.29 . . . .  70 . N .  70 . HN 1 1 
        47 1 1 72 LYS N 1 1 72 LYS H  1.46 . . . .  72 . N .  72 . HN 1 1 
        48 1 1 73 LEU N 1 1 73 LEU H   0.1 . . . .  73 . N .  73 . HN 1 1 
        49 1 1 74 GLU N 1 1 74 GLU H  0.06 . . . .  74 . N .  74 . HN 1 1 
        50 1 1 75 HIS N 1 1 75 HIS H  1.88 . . . .  75 . N .  75 . HN 1 1 
        51 1 1 76 HIS N 1 1 76 HIS H  1.07 . . . .  76 . N .  76 . HN 1 1 
        52 2 1  6 SER N 2 1  6 SER H 13.56 . . . . 106 . N . 106 . HN 1 1 
        53 2 1  7 VAL N 2 1  7 VAL H -3.96 . . . . 107 . N . 107 . HN 1 1 
        54 2 1  9 TYR N 2 1  9 TYR H -1.99 . . . . 109 . N . 109 . HN 1 1 
        55 2 1 10 PHE N 2 1 10 PHE H -2.23 . . . . 110 . N . 110 . HN 1 1 
        56 2 1 11 ILE N 2 1 11 ILE H -6.28 . . . . 111 . N . 111 . HN 1 1 
        57 2 1 12 GLU N 2 1 12 GLU H -3.86 . . . . 112 . N . 112 . HN 1 1 
        58 2 1 13 ASN N 2 1 13 ASN H -0.54 . . . . 113 . N . 113 . HN 1 1 
        59 2 1 14 LEU N 2 1 14 LEU H -3.58 . . . . 114 . N . 114 . HN 1 1 
        60 2 1 20 MET N 2 1 20 MET H -2.06 . . . . 120 . N . 120 . HN 1 1 
        61 2 1 25 ASP N 2 1 25 ASP H -4.65 . . . . 125 . N . 125 . HN 1 1 
        62 2 1 26 LYS N 2 1 26 LYS H -3.83 . . . . 126 . N . 126 . HN 1 1 
        63 2 1 27 ILE N 2 1 27 ILE H  2.79 . . . . 127 . N . 127 . HN 1 1 
        64 2 1 28 HIS N 2 1 28 HIS H -4.11 . . . . 128 . N . 128 . HN 1 1 
        65 2 1 29 ALA N 2 1 29 ALA H -4.45 . . . . 129 . N . 129 . HN 1 1 
        66 2 1 30 MET N 2 1 30 MET H  1.55 . . . . 130 . N . 130 . HN 1 1 
        67 2 1 31 ASN N 2 1 31 ASN H -0.71 . . . . 131 . N . 131 . HN 1 1 
        68 2 1 33 TYR N 2 1 33 TYR H -4.26 . . . . 133 . N . 133 . HN 1 1 
        69 2 1 34 TYR N 2 1 34 TYR H  0.45 . . . . 134 . N . 134 . HN 1 1 
        70 2 1 36 SER N 2 1 36 SER H -6.37 . . . . 136 . N . 136 . HN 1 1 
        71 2 1 37 VAL N 2 1 37 VAL H  0.19 . . . . 137 . N . 137 . HN 1 1 
        72 2 1 38 VAL N 2 1 38 VAL H  -1.3 . . . . 138 . N . 138 . HN 1 1 
        73 2 1 39 SER N 2 1 39 SER H -3.56 . . . . 139 . N . 139 . HN 1 1 
        74 2 1 40 THR N 2 1 40 THR H  -6.6 . . . . 140 . N . 140 . HN 1 1 
        75 2 1 41 LEU N 2 1 41 LEU H -0.67 . . . . 141 . N . 141 . HN 1 1 
        76 2 1 42 VAL N 2 1 42 VAL H -2.25 . . . . 142 . N . 142 . HN 1 1 
        77 2 1 43 GLN N 2 1 43 GLN H  -6.4 . . . . 143 . N . 143 . HN 1 1 
        78 2 1 44 ASP N 2 1 44 ASP H  0.98 . . . . 144 . N . 144 . HN 1 1 
        79 2 1 45 GLN N 2 1 45 GLN H  7.92 . . . . 145 . N . 145 . HN 1 1 
        80 2 1 46 LEU N 2 1 46 LEU H -2.62 . . . . 146 . N . 146 . HN 1 1 
        81 2 1 48 LYS N 2 1 48 LYS H -0.54 . . . . 148 . N . 148 . HN 1 1 
        82 2 1 49 ASN N 2 1 49 ASN H  -6.5 . . . . 149 . N . 149 . HN 1 1 
        83 2 1 50 ALA N 2 1 50 ALA H -3.91 . . . . 150 . N . 150 . HN 1 1 
        84 2 1 51 VAL N 2 1 51 VAL H -5.92 . . . . 151 . N . 151 . HN 1 1 
        85 2 1 52 VAL N 2 1 52 VAL H -6.87 . . . . 152 . N . 152 . HN 1 1 
        86 2 1 53 LEU N 2 1 53 LEU H -4.01 . . . . 153 . N . 153 . HN 1 1 
        87 2 1 54 LYS N 2 1 54 LYS H -1.98 . . . . 154 . N . 154 . HN 1 1 
        88 2 1 55 ARG N 2 1 55 ARG H -7.32 . . . . 155 . N . 155 . HN 1 1 
        89 2 1 56 ILE N 2 1 56 ILE H -5.52 . . . . 156 . N . 156 . HN 1 1 
        90 2 1 57 GLN N 2 1 57 GLN H -3.81 . . . . 157 . N . 157 . HN 1 1 
        91 2 1 58 HIS N 2 1 58 HIS H -1.39 . . . . 158 . N . 158 . HN 1 1 
        92 2 1 59 LEU N 2 1 59 LEU H -7.68 . . . . 159 . N . 159 . HN 1 1 
        93 2 1 61 GLU N 2 1 61 GLU H -0.38 . . . . 161 . N . 161 . HN 1 1 
        94 2 1 62 ALA N 2 1 62 ALA H -6.81 . . . . 162 . N . 162 . HN 1 1 
        95 2 1 63 TYR N 2 1 63 TYR H -6.75 . . . . 163 . N . 163 . HN 1 1 
        96 2 1 65 LYS N 2 1 65 LYS H -0.87 . . . . 165 . N . 165 . HN 1 1 
        97 2 1 70 GLU N 2 1 70 GLU H -4.29 . . . . 170 . N . 170 . HN 1 1 
        98 2 1 72 LYS N 2 1 72 LYS H  1.46 . . . . 172 . N . 172 . HN 1 1 
        99 2 1 73 LEU N 2 1 73 LEU H   0.1 . . . . 173 . N . 173 . HN 1 1 
       100 2 1 74 GLU N 2 1 74 GLU H  0.06 . . . . 174 . N . 174 . HN 1 1 
       101 2 1 75 HIS N 2 1 75 HIS H  1.88 . . . . 175 . N . 175 . HN 1 1 
       102 2 1 76 HIS N 2 1 76 HIS H  1.07 . . . . 176 . N . 176 . HN 1 1 
    stop_

save_


save_conformer_family_coord_set_1
    _Conformer_family_coord_set.Sf_category  conformer_family_coord_set
    _Conformer_family_coord_set.Entry_ID     1
    _Conformer_family_coord_set.ID           1

    loop_
       _Atom_site.Model_ID
       _Atom_site.ID
       _Atom_site.Label_entity_assembly_ID
       _Atom_site.Label_entity_ID
       _Atom_site.Label_comp_index_ID
       _Atom_site.Label_comp_ID
       _Atom_site.Label_atom_ID
       _Atom_site.Type_symbol
       _Atom_site.Cartn_x
       _Atom_site.Cartn_y
       _Atom_site.Cartn_z
       _Atom_site.Occupancy
       _Atom_site.Uncertainty
       _Atom_site.PDBX_label_asym_ID
       _Atom_site.PDB_strand_ID
       _Atom_site.PDB_ins_code
       _Atom_site.PDB_residue_no
       _Atom_site.PDB_residue_name
       _Atom_site.PDB_atom_name
       _Atom_site.Entry_ID
       _Atom_site.Conformer_family_coord_set_ID

        1     1 1 1  1 MET C    C   0.625  2.606  -8.670 1.00 . A A .  1 MET C    1 1 
        1     2 1 1  1 MET CA   C   0.943  1.307  -9.409 1.00 . A A .  1 MET CA   1 1 
        1     3 1 1  1 MET CB   C   0.516  1.417 -10.879 1.00 . A A .  1 MET CB   1 1 
        1     4 1 1  1 MET CE   C   3.610  2.714 -13.204 1.00 . A A .  1 MET CE   1 1 
        1     5 1 1  1 MET CG   C   1.423  2.406 -11.622 1.00 . A A .  1 MET CG   1 1 
        1     6 1 1  1 MET H1   H  -0.816  0.318  -8.882 1.00 . A A .  1 MET H1   1 1 
        1     7 1 1  1 MET H2   H   0.440  0.148  -7.751 1.00 . A A .  1 MET H2   1 1 
        1     8 1 1  1 MET H3   H   0.486 -0.718  -9.212 1.00 . A A .  1 MET H3   1 1 
        1     9 1 1  1 MET HA   H   2.005  1.116  -9.354 1.00 . A A .  1 MET HA   1 1 
        1    10 1 1  1 MET HB2  H   0.589  0.446 -11.346 1.00 . A A .  1 MET HB2  1 1 
        1    11 1 1  1 MET HB3  H  -0.508  1.762 -10.933 1.00 . A A .  1 MET HB3  1 1 
        1    12 1 1  1 MET HE1  H   3.538  3.756 -12.923 1.00 . A A .  1 MET HE1  1 1 
        1    13 1 1  1 MET HE2  H   2.980  2.522 -14.061 1.00 . A A .  1 MET HE2  1 1 
        1    14 1 1  1 MET HE3  H   4.632  2.480 -13.452 1.00 . A A .  1 MET HE3  1 1 
        1    15 1 1  1 MET HG2  H   1.004  2.613 -12.595 1.00 . A A .  1 MET HG2  1 1 
        1    16 1 1  1 MET HG3  H   1.498  3.326 -11.063 1.00 . A A .  1 MET HG3  1 1 
        1    17 1 1  1 MET N    N   0.207  0.179  -8.764 1.00 . A A .  1 MET N    1 1 
        1    18 1 1  1 MET O    O   1.502  3.209  -8.052 1.00 . A A .  1 MET O    1 1 
        1    19 1 1  1 MET SD   S   3.070  1.682 -11.820 1.00 . A A .  1 MET SD   1 1 
        1    20 1 1  2 SER C    C  -1.153  4.045  -6.574 1.00 . A A .  2 SER C    1 1 
        1    21 1 1  2 SER CA   C  -1.056  4.258  -8.078 1.00 . A A .  2 SER CA   1 1 
        1    22 1 1  2 SER CB   C  -2.414  4.700  -8.622 1.00 . A A .  2 SER CB   1 1 
        1    23 1 1  2 SER H    H  -1.288  2.506  -9.250 1.00 . A A .  2 SER H    1 1 
        1    24 1 1  2 SER HA   H  -0.332  5.037  -8.275 1.00 . A A .  2 SER HA   1 1 
        1    25 1 1  2 SER HB2  H  -2.698  5.637  -8.173 1.00 . A A .  2 SER HB2  1 1 
        1    26 1 1  2 SER HB3  H  -2.346  4.824  -9.696 1.00 . A A .  2 SER HB3  1 1 
        1    27 1 1  2 SER HG   H  -3.033  3.151  -7.619 1.00 . A A .  2 SER HG   1 1 
        1    28 1 1  2 SER N    N  -0.632  3.028  -8.741 1.00 . A A .  2 SER N    1 1 
        1    29 1 1  2 SER O    O  -2.158  3.541  -6.072 1.00 . A A .  2 SER O    1 1 
        1    30 1 1  2 SER OG   O  -3.392  3.715  -8.309 1.00 . A A .  2 SER OG   1 1 
        1    31 1 1  3 GLU C    C   1.112  5.023  -3.814 1.00 . A A .  3 GLU C    1 1 
        1    32 1 1  3 GLU CA   C  -0.073  4.277  -4.409 1.00 . A A .  3 GLU CA   1 1 
        1    33 1 1  3 GLU CB   C   0.013  2.792  -4.046 1.00 . A A .  3 GLU CB   1 1 
        1    34 1 1  3 GLU CD   C   1.291  0.669  -4.424 1.00 . A A .  3 GLU CD   1 1 
        1    35 1 1  3 GLU CG   C   1.247  2.167  -4.707 1.00 . A A .  3 GLU CG   1 1 
        1    36 1 1  3 GLU H    H   0.671  4.826  -6.312 1.00 . A A .  3 GLU H    1 1 
        1    37 1 1  3 GLU HA   H  -0.979  4.684  -3.993 1.00 . A A .  3 GLU HA   1 1 
        1    38 1 1  3 GLU HB2  H   0.088  2.688  -2.973 1.00 . A A .  3 GLU HB2  1 1 
        1    39 1 1  3 GLU HB3  H  -0.874  2.285  -4.395 1.00 . A A .  3 GLU HB3  1 1 
        1    40 1 1  3 GLU HG2  H   1.203  2.329  -5.774 1.00 . A A .  3 GLU HG2  1 1 
        1    41 1 1  3 GLU HG3  H   2.140  2.628  -4.313 1.00 . A A .  3 GLU HG3  1 1 
        1    42 1 1  3 GLU N    N  -0.102  4.431  -5.858 1.00 . A A .  3 GLU N    1 1 
        1    43 1 1  3 GLU O    O   2.197  5.054  -4.395 1.00 . A A .  3 GLU O    1 1 
        1    44 1 1  3 GLU OE1  O   0.882  0.275  -3.344 1.00 . A A .  3 GLU OE1  1 1 
        1    45 1 1  3 GLU OE2  O   1.736 -0.062  -5.294 1.00 . A A .  3 GLU OE2  1 1 
        1    46 1 1  4 LEU C    C   2.491  7.468  -2.870 1.00 . A A .  4 LEU C    1 1 
        1    47 1 1  4 LEU CA   C   1.962  6.357  -1.973 1.00 . A A .  4 LEU CA   1 1 
        1    48 1 1  4 LEU CB   C   3.101  5.399  -1.610 1.00 . A A .  4 LEU CB   1 1 
        1    49 1 1  4 LEU CD1  C   3.698  3.207  -0.574 1.00 . A A .  4 LEU CD1  1 1 
        1    50 1 1  4 LEU CD2  C   1.775  4.538   0.367 1.00 . A A .  4 LEU CD2  1 1 
        1    51 1 1  4 LEU CG   C   2.539  4.150  -0.916 1.00 . A A .  4 LEU CG   1 1 
        1    52 1 1  4 LEU H    H   0.014  5.564  -2.230 1.00 . A A .  4 LEU H    1 1 
        1    53 1 1  4 LEU HA   H   1.570  6.800  -1.071 1.00 . A A .  4 LEU HA   1 1 
        1    54 1 1  4 LEU HB2  H   3.623  5.101  -2.507 1.00 . A A .  4 LEU HB2  1 1 
        1    55 1 1  4 LEU HB3  H   3.789  5.897  -0.945 1.00 . A A .  4 LEU HB3  1 1 
        1    56 1 1  4 LEU HD11 H   4.182  2.891  -1.486 1.00 . A A .  4 LEU HD11 1 1 
        1    57 1 1  4 LEU HD12 H   3.317  2.344  -0.049 1.00 . A A .  4 LEU HD12 1 1 
        1    58 1 1  4 LEU HD13 H   4.411  3.724   0.051 1.00 . A A .  4 LEU HD13 1 1 
        1    59 1 1  4 LEU HD21 H   1.649  3.667   0.996 1.00 . A A .  4 LEU HD21 1 1 
        1    60 1 1  4 LEU HD22 H   0.801  4.924   0.103 1.00 . A A .  4 LEU HD22 1 1 
        1    61 1 1  4 LEU HD23 H   2.325  5.291   0.911 1.00 . A A .  4 LEU HD23 1 1 
        1    62 1 1  4 LEU HG   H   1.866  3.642  -1.593 1.00 . A A .  4 LEU HG   1 1 
        1    63 1 1  4 LEU N    N   0.899  5.622  -2.647 1.00 . A A .  4 LEU N    1 1 
        1    64 1 1  4 LEU O    O   3.486  8.120  -2.551 1.00 . A A .  4 LEU O    1 1 
        1    65 1 1  5 PHE C    C   1.986 10.098  -4.337 1.00 . A A .  5 PHE C    1 1 
        1    66 1 1  5 PHE CA   C   2.222  8.717  -4.936 1.00 . A A .  5 PHE CA   1 1 
        1    67 1 1  5 PHE CB   C   1.435  8.575  -6.247 1.00 . A A .  5 PHE CB   1 1 
        1    68 1 1  5 PHE CD1  C  -0.896  7.841  -5.593 1.00 . A A .  5 PHE CD1  1 1 
        1    69 1 1  5 PHE CD2  C  -0.532 10.164  -6.186 1.00 . A A .  5 PHE CD2  1 1 
        1    70 1 1  5 PHE CE1  C  -2.251  8.112  -5.363 1.00 . A A .  5 PHE CE1  1 1 
        1    71 1 1  5 PHE CE2  C  -1.886 10.435  -5.956 1.00 . A A .  5 PHE CE2  1 1 
        1    72 1 1  5 PHE CG   C  -0.037  8.867  -6.005 1.00 . A A .  5 PHE CG   1 1 
        1    73 1 1  5 PHE CZ   C  -2.745  9.409  -5.544 1.00 . A A .  5 PHE CZ   1 1 
        1    74 1 1  5 PHE H    H   1.033  7.131  -4.199 1.00 . A A .  5 PHE H    1 1 
        1    75 1 1  5 PHE HA   H   3.276  8.604  -5.148 1.00 . A A .  5 PHE HA   1 1 
        1    76 1 1  5 PHE HB2  H   1.828  9.270  -6.975 1.00 . A A .  5 PHE HB2  1 1 
        1    77 1 1  5 PHE HB3  H   1.543  7.568  -6.621 1.00 . A A .  5 PHE HB3  1 1 
        1    78 1 1  5 PHE HD1  H  -0.516  6.841  -5.454 1.00 . A A .  5 PHE HD1  1 1 
        1    79 1 1  5 PHE HD2  H   0.131 10.956  -6.504 1.00 . A A .  5 PHE HD2  1 1 
        1    80 1 1  5 PHE HE1  H  -2.914  7.321  -5.046 1.00 . A A .  5 PHE HE1  1 1 
        1    81 1 1  5 PHE HE2  H  -2.268 11.437  -6.096 1.00 . A A .  5 PHE HE2  1 1 
        1    82 1 1  5 PHE HZ   H  -3.790  9.619  -5.366 1.00 . A A .  5 PHE HZ   1 1 
        1    83 1 1  5 PHE N    N   1.817  7.681  -3.996 1.00 . A A .  5 PHE N    1 1 
        1    84 1 1  5 PHE O    O   2.742 11.036  -4.592 1.00 . A A .  5 PHE O    1 1 
        1    85 1 1  6 SER C    C   1.527 11.783  -1.764 1.00 . A A .  6 SER C    1 1 
        1    86 1 1  6 SER CA   C   0.583 11.492  -2.929 1.00 . A A .  6 SER CA   1 1 
        1    87 1 1  6 SER CB   C  -0.884 11.439  -2.439 1.00 . A A .  6 SER CB   1 1 
        1    88 1 1  6 SER H    H   0.358  9.437  -3.380 1.00 . A A .  6 SER H    1 1 
        1    89 1 1  6 SER HA   H   0.685 12.280  -3.659 1.00 . A A .  6 SER HA   1 1 
        1    90 1 1  6 SER HB2  H  -0.940 11.037  -1.438 1.00 . A A .  6 SER HB2  1 1 
        1    91 1 1  6 SER HB3  H  -1.311 12.433  -2.445 1.00 . A A .  6 SER HB3  1 1 
        1    92 1 1  6 SER HG   H  -2.018  9.902  -2.789 1.00 . A A .  6 SER HG   1 1 
        1    93 1 1  6 SER N    N   0.924 10.218  -3.547 1.00 . A A .  6 SER N    1 1 
        1    94 1 1  6 SER O    O   1.760 10.924  -0.915 1.00 . A A .  6 SER O    1 1 
        1    95 1 1  6 SER OG   O  -1.632 10.608  -3.313 1.00 . A A .  6 SER OG   1 1 
        1    96 1 1  7 VAL C    C   2.185 13.491   0.675 1.00 . A A .  7 VAL C    1 1 
        1    97 1 1  7 VAL CA   C   2.960 13.406  -0.653 1.00 . A A .  7 VAL CA   1 1 
        1    98 1 1  7 VAL CB   C   3.629 14.774  -0.976 1.00 . A A .  7 VAL CB   1 1 
        1    99 1 1  7 VAL CG1  C   4.974 14.902  -0.247 1.00 . A A .  7 VAL CG1  1 1 
        1   100 1 1  7 VAL CG2  C   3.843 14.909  -2.495 1.00 . A A .  7 VAL CG2  1 1 
        1   101 1 1  7 VAL H    H   1.838 13.644  -2.433 1.00 . A A .  7 VAL H    1 1 
        1   102 1 1  7 VAL HA   H   3.732 12.649  -0.552 1.00 . A A .  7 VAL HA   1 1 
        1   103 1 1  7 VAL HB   H   2.997 15.578  -0.642 1.00 . A A .  7 VAL HB   1 1 
        1   104 1 1  7 VAL HG11 H   5.670 14.173  -0.633 1.00 . A A .  7 VAL HG11 1 1 
        1   105 1 1  7 VAL HG12 H   4.826 14.735   0.810 1.00 . A A .  7 VAL HG12 1 1 
        1   106 1 1  7 VAL HG13 H   5.372 15.895  -0.401 1.00 . A A .  7 VAL HG13 1 1 
        1   107 1 1  7 VAL HG21 H   4.327 14.023  -2.876 1.00 . A A .  7 VAL HG21 1 1 
        1   108 1 1  7 VAL HG22 H   4.460 15.771  -2.700 1.00 . A A .  7 VAL HG22 1 1 
        1   109 1 1  7 VAL HG23 H   2.887 15.034  -2.986 1.00 . A A .  7 VAL HG23 1 1 
        1   110 1 1  7 VAL N    N   2.061 13.000  -1.729 1.00 . A A .  7 VAL N    1 1 
        1   111 1 1  7 VAL O    O   2.706 13.064   1.705 1.00 . A A .  7 VAL O    1 1 
        1   112 1 1  8 PRO C    C   0.122 12.822   2.690 1.00 . A A .  8 PRO C    1 1 
        1   113 1 1  8 PRO CA   C   0.182 14.140   1.919 1.00 . A A .  8 PRO CA   1 1 
        1   114 1 1  8 PRO CB   C  -1.222 14.554   1.419 1.00 . A A .  8 PRO CB   1 1 
        1   115 1 1  8 PRO CD   C   0.248 14.557  -0.503 1.00 . A A .  8 PRO CD   1 1 
        1   116 1 1  8 PRO CG   C  -0.985 15.242   0.109 1.00 . A A .  8 PRO CG   1 1 
        1   117 1 1  8 PRO HA   H   0.587 14.913   2.552 1.00 . A A .  8 PRO HA   1 1 
        1   118 1 1  8 PRO HB2  H  -1.850 13.677   1.275 1.00 . A A .  8 PRO HB2  1 1 
        1   119 1 1  8 PRO HB3  H  -1.694 15.233   2.120 1.00 . A A .  8 PRO HB3  1 1 
        1   120 1 1  8 PRO HD2  H  -0.066 13.762  -1.142 1.00 . A A .  8 PRO HD2  1 1 
        1   121 1 1  8 PRO HD3  H   0.846 15.257  -1.052 1.00 . A A .  8 PRO HD3  1 1 
        1   122 1 1  8 PRO HG2  H  -1.854 15.125  -0.539 1.00 . A A .  8 PRO HG2  1 1 
        1   123 1 1  8 PRO HG3  H  -0.783 16.294   0.261 1.00 . A A .  8 PRO HG3  1 1 
        1   124 1 1  8 PRO N    N   0.993 14.019   0.670 1.00 . A A .  8 PRO N    1 1 
        1   125 1 1  8 PRO O    O  -0.093 12.823   3.903 1.00 . A A .  8 PRO O    1 1 
        1   126 1 1  9 TYR C    C   1.326 10.294   3.711 1.00 . A A .  9 TYR C    1 1 
        1   127 1 1  9 TYR CA   C   0.256 10.396   2.624 1.00 . A A .  9 TYR CA   1 1 
        1   128 1 1  9 TYR CB   C   0.474  9.300   1.574 1.00 . A A .  9 TYR CB   1 1 
        1   129 1 1  9 TYR CD1  C  -0.955  7.392   2.392 1.00 . A A .  9 TYR CD1  1 1 
        1   130 1 1  9 TYR CD2  C   1.449  7.240   2.676 1.00 . A A .  9 TYR CD2  1 1 
        1   131 1 1  9 TYR CE1  C  -1.106  6.140   2.999 1.00 . A A .  9 TYR CE1  1 1 
        1   132 1 1  9 TYR CE2  C   1.298  5.988   3.283 1.00 . A A .  9 TYR CE2  1 1 
        1   133 1 1  9 TYR CG   C   0.322  7.943   2.231 1.00 . A A .  9 TYR CG   1 1 
        1   134 1 1  9 TYR CZ   C   0.020  5.437   3.443 1.00 . A A .  9 TYR CZ   1 1 
        1   135 1 1  9 TYR H    H   0.473 11.768   1.026 1.00 . A A .  9 TYR H    1 1 
        1   136 1 1  9 TYR HA   H  -0.717 10.259   3.076 1.00 . A A .  9 TYR HA   1 1 
        1   137 1 1  9 TYR HB2  H  -0.259  9.406   0.783 1.00 . A A .  9 TYR HB2  1 1 
        1   138 1 1  9 TYR HB3  H   1.465  9.396   1.155 1.00 . A A .  9 TYR HB3  1 1 
        1   139 1 1  9 TYR HD1  H  -1.824  7.934   2.049 1.00 . A A .  9 TYR HD1  1 1 
        1   140 1 1  9 TYR HD2  H   2.434  7.665   2.552 1.00 . A A .  9 TYR HD2  1 1 
        1   141 1 1  9 TYR HE1  H  -2.091  5.715   3.122 1.00 . A A .  9 TYR HE1  1 1 
        1   142 1 1  9 TYR HE2  H   2.167  5.446   3.625 1.00 . A A .  9 TYR HE2  1 1 
        1   143 1 1  9 TYR HH   H  -0.375  4.349   4.962 1.00 . A A .  9 TYR HH   1 1 
        1   144 1 1  9 TYR N    N   0.302 11.708   1.988 1.00 . A A .  9 TYR N    1 1 
        1   145 1 1  9 TYR O    O   1.087  9.746   4.787 1.00 . A A .  9 TYR O    1 1 
        1   146 1 1  9 TYR OH   O  -0.129  4.204   4.045 1.00 . A A .  9 TYR OH   1 1 
        1   147 1 1 10 PHE C    C   3.215 11.514   5.663 1.00 . A A . 10 PHE C    1 1 
        1   148 1 1 10 PHE CA   C   3.613 10.795   4.373 1.00 . A A . 10 PHE CA   1 1 
        1   149 1 1 10 PHE CB   C   4.868 11.465   3.749 1.00 . A A . 10 PHE CB   1 1 
        1   150 1 1 10 PHE CD1  C   5.153  9.428   2.273 1.00 . A A . 10 PHE CD1  1 1 
        1   151 1 1 10 PHE CD2  C   7.135 10.473   3.200 1.00 . A A . 10 PHE CD2  1 1 
        1   152 1 1 10 PHE CE1  C   5.953  8.468   1.644 1.00 . A A . 10 PHE CE1  1 1 
        1   153 1 1 10 PHE CE2  C   7.935  9.512   2.570 1.00 . A A . 10 PHE CE2  1 1 
        1   154 1 1 10 PHE CG   C   5.744 10.430   3.052 1.00 . A A . 10 PHE CG   1 1 
        1   155 1 1 10 PHE CZ   C   7.343  8.509   1.791 1.00 . A A . 10 PHE CZ   1 1 
        1   156 1 1 10 PHE H    H   2.639 11.250   2.542 1.00 . A A . 10 PHE H    1 1 
        1   157 1 1 10 PHE HA   H   3.835  9.764   4.615 1.00 . A A . 10 PHE HA   1 1 
        1   158 1 1 10 PHE HB2  H   4.547 12.202   3.026 1.00 . A A . 10 PHE HB2  1 1 
        1   159 1 1 10 PHE HB3  H   5.443 11.963   4.523 1.00 . A A . 10 PHE HB3  1 1 
        1   160 1 1 10 PHE HD1  H   4.080  9.394   2.157 1.00 . A A . 10 PHE HD1  1 1 
        1   161 1 1 10 PHE HD2  H   7.593 11.245   3.800 1.00 . A A . 10 PHE HD2  1 1 
        1   162 1 1 10 PHE HE1  H   5.496  7.695   1.044 1.00 . A A . 10 PHE HE1  1 1 
        1   163 1 1 10 PHE HE2  H   9.006  9.542   2.685 1.00 . A A . 10 PHE HE2  1 1 
        1   164 1 1 10 PHE HZ   H   7.965  7.772   1.312 1.00 . A A . 10 PHE HZ   1 1 
        1   165 1 1 10 PHE N    N   2.508 10.826   3.415 1.00 . A A . 10 PHE N    1 1 
        1   166 1 1 10 PHE O    O   3.516 11.040   6.758 1.00 . A A . 10 PHE O    1 1 
        1   167 1 1 11 ILE C    C   1.090 12.657   7.492 1.00 . A A . 11 ILE C    1 1 
        1   168 1 1 11 ILE CA   C   2.129 13.428   6.685 1.00 . A A . 11 ILE CA   1 1 
        1   169 1 1 11 ILE CB   C   1.541 14.768   6.229 1.00 . A A . 11 ILE CB   1 1 
        1   170 1 1 11 ILE CD1  C   1.945 16.772   4.768 1.00 . A A . 11 ILE CD1  1 1 
        1   171 1 1 11 ILE CG1  C   2.540 15.463   5.293 1.00 . A A . 11 ILE CG1  1 1 
        1   172 1 1 11 ILE CG2  C   1.283 15.656   7.456 1.00 . A A . 11 ILE CG2  1 1 
        1   173 1 1 11 ILE H    H   2.338 12.983   4.626 1.00 . A A . 11 ILE H    1 1 
        1   174 1 1 11 ILE HA   H   2.989 13.617   7.307 1.00 . A A . 11 ILE HA   1 1 
        1   175 1 1 11 ILE HB   H   0.612 14.598   5.705 1.00 . A A . 11 ILE HB   1 1 
        1   176 1 1 11 ILE HD11 H   0.960 16.586   4.367 1.00 . A A . 11 ILE HD11 1 1 
        1   177 1 1 11 ILE HD12 H   2.581 17.169   3.991 1.00 . A A . 11 ILE HD12 1 1 
        1   178 1 1 11 ILE HD13 H   1.878 17.484   5.576 1.00 . A A . 11 ILE HD13 1 1 
        1   179 1 1 11 ILE HG12 H   3.445 15.668   5.828 1.00 . A A . 11 ILE HG12 1 1 
        1   180 1 1 11 ILE HG13 H   2.762 14.821   4.456 1.00 . A A . 11 ILE HG13 1 1 
        1   181 1 1 11 ILE HG21 H   0.622 15.151   8.143 1.00 . A A . 11 ILE HG21 1 1 
        1   182 1 1 11 ILE HG22 H   0.827 16.578   7.144 1.00 . A A . 11 ILE HG22 1 1 
        1   183 1 1 11 ILE HG23 H   2.220 15.865   7.951 1.00 . A A . 11 ILE HG23 1 1 
        1   184 1 1 11 ILE N    N   2.548 12.654   5.525 1.00 . A A . 11 ILE N    1 1 
        1   185 1 1 11 ILE O    O   1.146 12.613   8.721 1.00 . A A . 11 ILE O    1 1 
        1   186 1 1 12 GLU C    C  -0.332 10.289   8.440 1.00 . A A . 12 GLU C    1 1 
        1   187 1 1 12 GLU CA   C  -0.929 11.295   7.453 1.00 . A A . 12 GLU CA   1 1 
        1   188 1 1 12 GLU CB   C  -1.767 10.549   6.398 1.00 . A A . 12 GLU CB   1 1 
        1   189 1 1 12 GLU CD   C  -3.739 12.113   6.451 1.00 . A A . 12 GLU CD   1 1 
        1   190 1 1 12 GLU CG   C  -2.614 11.543   5.587 1.00 . A A . 12 GLU CG   1 1 
        1   191 1 1 12 GLU H    H   0.139 12.129   5.812 1.00 . A A . 12 GLU H    1 1 
        1   192 1 1 12 GLU HA   H  -1.567 11.977   7.992 1.00 . A A . 12 GLU HA   1 1 
        1   193 1 1 12 GLU HB2  H  -1.105 10.016   5.730 1.00 . A A . 12 GLU HB2  1 1 
        1   194 1 1 12 GLU HB3  H  -2.421  9.841   6.888 1.00 . A A . 12 GLU HB3  1 1 
        1   195 1 1 12 GLU HG2  H  -1.989 12.351   5.245 1.00 . A A . 12 GLU HG2  1 1 
        1   196 1 1 12 GLU HG3  H  -3.041 11.036   4.736 1.00 . A A . 12 GLU HG3  1 1 
        1   197 1 1 12 GLU N    N   0.134 12.058   6.789 1.00 . A A . 12 GLU N    1 1 
        1   198 1 1 12 GLU O    O  -0.955  9.966   9.453 1.00 . A A . 12 GLU O    1 1 
        1   199 1 1 12 GLU OE1  O  -3.931 11.604   7.544 1.00 . A A . 12 GLU OE1  1 1 
        1   200 1 1 12 GLU OE2  O  -4.389 13.045   6.009 1.00 . A A . 12 GLU OE2  1 1 
        1   201 1 1 13 ASN C    C   1.973  9.537  10.330 1.00 . A A . 13 ASN C    1 1 
        1   202 1 1 13 ASN CA   C   1.545  8.857   9.030 1.00 . A A . 13 ASN CA   1 1 
        1   203 1 1 13 ASN CB   C   2.764  8.262   8.326 1.00 . A A . 13 ASN CB   1 1 
        1   204 1 1 13 ASN CG   C   2.328  7.563   7.043 1.00 . A A . 13 ASN CG   1 1 
        1   205 1 1 13 ASN H    H   1.322 10.101   7.329 1.00 . A A . 13 ASN H    1 1 
        1   206 1 1 13 ASN HA   H   0.858  8.055   9.268 1.00 . A A . 13 ASN HA   1 1 
        1   207 1 1 13 ASN HB2  H   3.462  9.050   8.089 1.00 . A A . 13 ASN HB2  1 1 
        1   208 1 1 13 ASN HB3  H   3.240  7.546   8.978 1.00 . A A . 13 ASN HB3  1 1 
        1   209 1 1 13 ASN HD21 H   4.086  7.791   6.146 1.00 . A A . 13 ASN HD21 1 1 
        1   210 1 1 13 ASN HD22 H   2.901  6.991   5.230 1.00 . A A . 13 ASN HD22 1 1 
        1   211 1 1 13 ASN N    N   0.874  9.809   8.150 1.00 . A A . 13 ASN N    1 1 
        1   212 1 1 13 ASN ND2  N   3.175  7.438   6.058 1.00 . A A . 13 ASN ND2  1 1 
        1   213 1 1 13 ASN O    O   1.951  8.932  11.402 1.00 . A A . 13 ASN O    1 1 
        1   214 1 1 13 ASN OD1  O   1.187  7.114   6.937 1.00 . A A . 13 ASN OD1  1 1 
        1   215 1 1 14 LEU C    C   1.667 11.831  12.330 1.00 . A A . 14 LEU C    1 1 
        1   216 1 1 14 LEU CA   C   2.823 11.571  11.378 1.00 . A A . 14 LEU CA   1 1 
        1   217 1 1 14 LEU CB   C   3.412 12.906  10.918 1.00 . A A . 14 LEU CB   1 1 
        1   218 1 1 14 LEU CD1  C   4.997 13.998   9.318 1.00 . A A . 14 LEU CD1  1 1 
        1   219 1 1 14 LEU CD2  C   5.582 11.766  10.315 1.00 . A A . 14 LEU CD2  1 1 
        1   220 1 1 14 LEU CG   C   4.436 12.660   9.804 1.00 . A A . 14 LEU CG   1 1 
        1   221 1 1 14 LEU H    H   2.371 11.230   9.340 1.00 . A A . 14 LEU H    1 1 
        1   222 1 1 14 LEU HA   H   3.581 11.011  11.902 1.00 . A A . 14 LEU HA   1 1 
        1   223 1 1 14 LEU HB2  H   2.623 13.543  10.543 1.00 . A A . 14 LEU HB2  1 1 
        1   224 1 1 14 LEU HB3  H   3.899 13.391  11.752 1.00 . A A . 14 LEU HB3  1 1 
        1   225 1 1 14 LEU HD11 H   5.595 13.824   8.439 1.00 . A A . 14 LEU HD11 1 1 
        1   226 1 1 14 LEU HD12 H   5.613 14.434  10.088 1.00 . A A . 14 LEU HD12 1 1 
        1   227 1 1 14 LEU HD13 H   4.184 14.667   9.076 1.00 . A A . 14 LEU HD13 1 1 
        1   228 1 1 14 LEU HD21 H   6.443 11.888   9.685 1.00 . A A . 14 LEU HD21 1 1 
        1   229 1 1 14 LEU HD22 H   5.266 10.732  10.286 1.00 . A A . 14 LEU HD22 1 1 
        1   230 1 1 14 LEU HD23 H   5.844 12.035  11.328 1.00 . A A . 14 LEU HD23 1 1 
        1   231 1 1 14 LEU HG   H   3.947 12.171   8.976 1.00 . A A . 14 LEU HG   1 1 
        1   232 1 1 14 LEU N    N   2.375 10.800  10.220 1.00 . A A . 14 LEU N    1 1 
        1   233 1 1 14 LEU O    O   1.829 11.793  13.549 1.00 . A A . 14 LEU O    1 1 
        1   234 1 1 15 LYS C    C  -0.945 11.213  13.529 1.00 . A A . 15 LYS C    1 1 
        1   235 1 1 15 LYS CA   C  -0.686 12.367  12.566 1.00 . A A . 15 LYS CA   1 1 
        1   236 1 1 15 LYS CB   C  -1.900 12.567  11.661 1.00 . A A . 15 LYS CB   1 1 
        1   237 1 1 15 LYS CD   C  -4.273 13.392  11.592 1.00 . A A . 15 LYS CD   1 1 
        1   238 1 1 15 LYS CE   C  -4.737 12.206  10.731 1.00 . A A . 15 LYS CE   1 1 
        1   239 1 1 15 LYS CG   C  -3.111 12.980  12.506 1.00 . A A . 15 LYS CG   1 1 
        1   240 1 1 15 LYS H    H   0.424 12.112  10.787 1.00 . A A . 15 LYS H    1 1 
        1   241 1 1 15 LYS HA   H  -0.521 13.271  13.126 1.00 . A A . 15 LYS HA   1 1 
        1   242 1 1 15 LYS HB2  H  -1.685 13.338  10.936 1.00 . A A . 15 LYS HB2  1 1 
        1   243 1 1 15 LYS HB3  H  -2.116 11.641  11.152 1.00 . A A . 15 LYS HB3  1 1 
        1   244 1 1 15 LYS HD2  H  -5.097 13.733  12.199 1.00 . A A . 15 LYS HD2  1 1 
        1   245 1 1 15 LYS HD3  H  -3.949 14.198  10.948 1.00 . A A . 15 LYS HD3  1 1 
        1   246 1 1 15 LYS HE2  H  -4.059 12.070   9.901 1.00 . A A . 15 LYS HE2  1 1 
        1   247 1 1 15 LYS HE3  H  -4.763 11.303  11.326 1.00 . A A . 15 LYS HE3  1 1 
        1   248 1 1 15 LYS HG2  H  -3.417 12.148  13.126 1.00 . A A . 15 LYS HG2  1 1 
        1   249 1 1 15 LYS HG3  H  -2.845 13.815  13.136 1.00 . A A . 15 LYS HG3  1 1 
        1   250 1 1 15 LYS HZ1  H  -6.329 11.814   9.446 1.00 . A A . 15 LYS HZ1  1 1 
        1   251 1 1 15 LYS HZ2  H  -6.134 13.456   9.824 1.00 . A A . 15 LYS HZ2  1 1 
        1   252 1 1 15 LYS HZ3  H  -6.797 12.394  10.973 1.00 . A A . 15 LYS HZ3  1 1 
        1   253 1 1 15 LYS N    N   0.495 12.096  11.764 1.00 . A A . 15 LYS N    1 1 
        1   254 1 1 15 LYS NZ   N  -6.102 12.489  10.203 1.00 . A A . 15 LYS NZ   1 1 
        1   255 1 1 15 LYS O    O  -1.380 11.424  14.660 1.00 . A A . 15 LYS O    1 1 
        1   256 1 1 16 GLN C    C   0.141  8.779  15.040 1.00 . A A . 16 GLN C    1 1 
        1   257 1 1 16 GLN CA   C  -0.875  8.812  13.905 1.00 . A A . 16 GLN CA   1 1 
        1   258 1 1 16 GLN CB   C  -0.750  7.543  13.055 1.00 . A A . 16 GLN CB   1 1 
        1   259 1 1 16 GLN CD   C  -1.098  5.060  13.050 1.00 . A A . 16 GLN CD   1 1 
        1   260 1 1 16 GLN CG   C  -1.023  6.308  13.923 1.00 . A A . 16 GLN CG   1 1 
        1   261 1 1 16 GLN H    H  -0.328  9.887  12.162 1.00 . A A . 16 GLN H    1 1 
        1   262 1 1 16 GLN HA   H  -1.864  8.845  14.332 1.00 . A A . 16 GLN HA   1 1 
        1   263 1 1 16 GLN HB2  H  -1.466  7.581  12.246 1.00 . A A . 16 GLN HB2  1 1 
        1   264 1 1 16 GLN HB3  H   0.249  7.480  12.647 1.00 . A A . 16 GLN HB3  1 1 
        1   265 1 1 16 GLN HE21 H  -1.948  3.948  14.459 1.00 . A A . 16 GLN HE21 1 1 
        1   266 1 1 16 GLN HE22 H  -1.662  3.157  12.984 1.00 . A A . 16 GLN HE22 1 1 
        1   267 1 1 16 GLN HG2  H  -0.227  6.190  14.643 1.00 . A A . 16 GLN HG2  1 1 
        1   268 1 1 16 GLN HG3  H  -1.959  6.437  14.442 1.00 . A A . 16 GLN HG3  1 1 
        1   269 1 1 16 GLN N    N  -0.674  9.995  13.073 1.00 . A A . 16 GLN N    1 1 
        1   270 1 1 16 GLN NE2  N  -1.612  3.964  13.538 1.00 . A A . 16 GLN NE2  1 1 
        1   271 1 1 16 GLN O    O  -0.175  8.360  16.154 1.00 . A A . 16 GLN O    1 1 
        1   272 1 1 16 GLN OE1  O  -0.672  5.081  11.895 1.00 . A A . 16 GLN OE1  1 1 
        1   273 1 1 17 HIS C    C   2.017 10.107  16.946 1.00 . A A . 17 HIS C    1 1 
        1   274 1 1 17 HIS CA   C   2.410  9.219  15.764 1.00 . A A . 17 HIS CA   1 1 
        1   275 1 1 17 HIS CB   C   3.712  9.733  15.152 1.00 . A A . 17 HIS CB   1 1 
        1   276 1 1 17 HIS CD2  C   3.611  7.663  13.535 1.00 . A A . 17 HIS CD2  1 1 
        1   277 1 1 17 HIS CE1  C   5.157  8.273  12.144 1.00 . A A . 17 HIS CE1  1 1 
        1   278 1 1 17 HIS CG   C   4.084  8.876  13.972 1.00 . A A . 17 HIS CG   1 1 
        1   279 1 1 17 HIS H    H   1.556  9.540  13.847 1.00 . A A . 17 HIS H    1 1 
        1   280 1 1 17 HIS HA   H   2.564  8.210  16.116 1.00 . A A . 17 HIS HA   1 1 
        1   281 1 1 17 HIS HB2  H   3.579 10.755  14.830 1.00 . A A . 17 HIS HB2  1 1 
        1   282 1 1 17 HIS HB3  H   4.497  9.687  15.890 1.00 . A A . 17 HIS HB3  1 1 
        1   283 1 1 17 HIS HD1  H   5.602 10.067  13.099 1.00 . A A . 17 HIS HD1  1 1 
        1   284 1 1 17 HIS HD2  H   2.828  7.092  14.010 1.00 . A A . 17 HIS HD2  1 1 
        1   285 1 1 17 HIS HE1  H   5.843  8.292  11.310 1.00 . A A . 17 HIS HE1  1 1 
        1   286 1 1 17 HIS HE2  H   4.159  6.470  11.853 1.00 . A A . 17 HIS HE2  1 1 
        1   287 1 1 17 HIS N    N   1.361  9.218  14.751 1.00 . A A . 17 HIS N    1 1 
        1   288 1 1 17 HIS ND1  N   5.069  9.246  13.070 1.00 . A A . 17 HIS ND1  1 1 
        1   289 1 1 17 HIS NE2  N   4.290  7.285  12.380 1.00 . A A . 17 HIS NE2  1 1 
        1   290 1 1 17 HIS O    O   2.077  9.685  18.102 1.00 . A A . 17 HIS O    1 1 
        1   291 1 1 18 ILE C    C  -0.151 11.881  18.283 1.00 . A A . 18 ILE C    1 1 
        1   292 1 1 18 ILE CA   C   1.203 12.279  17.687 1.00 . A A . 18 ILE CA   1 1 
        1   293 1 1 18 ILE CB   C   1.131 13.704  17.105 1.00 . A A . 18 ILE CB   1 1 
        1   294 1 1 18 ILE CD1  C   0.123 15.116  15.264 1.00 . A A . 18 ILE CD1  1 1 
        1   295 1 1 18 ILE CG1  C   0.098 13.750  15.965 1.00 . A A . 18 ILE CG1  1 1 
        1   296 1 1 18 ILE CG2  C   2.511 14.109  16.562 1.00 . A A . 18 ILE CG2  1 1 
        1   297 1 1 18 ILE H    H   1.585 11.618  15.707 1.00 . A A . 18 ILE H    1 1 
        1   298 1 1 18 ILE HA   H   1.943 12.267  18.479 1.00 . A A . 18 ILE HA   1 1 
        1   299 1 1 18 ILE HB   H   0.839 14.392  17.885 1.00 . A A . 18 ILE HB   1 1 
        1   300 1 1 18 ILE HD11 H   0.168 15.902  16.004 1.00 . A A . 18 ILE HD11 1 1 
        1   301 1 1 18 ILE HD12 H  -0.772 15.230  14.669 1.00 . A A . 18 ILE HD12 1 1 
        1   302 1 1 18 ILE HD13 H   0.990 15.173  14.625 1.00 . A A . 18 ILE HD13 1 1 
        1   303 1 1 18 ILE HG12 H   0.332 12.976  15.257 1.00 . A A . 18 ILE HG12 1 1 
        1   304 1 1 18 ILE HG13 H  -0.889 13.587  16.362 1.00 . A A . 18 ILE HG13 1 1 
        1   305 1 1 18 ILE HG21 H   2.716 13.572  15.645 1.00 . A A . 18 ILE HG21 1 1 
        1   306 1 1 18 ILE HG22 H   3.262 13.873  17.288 1.00 . A A . 18 ILE HG22 1 1 
        1   307 1 1 18 ILE HG23 H   2.527 15.170  16.366 1.00 . A A . 18 ILE HG23 1 1 
        1   308 1 1 18 ILE N    N   1.613 11.337  16.645 1.00 . A A . 18 ILE N    1 1 
        1   309 1 1 18 ILE O    O  -0.346 11.913  19.497 1.00 . A A . 18 ILE O    1 1 
        1   310 1 1 19 GLU C    C  -2.351  9.827  18.666 1.00 . A A . 19 GLU C    1 1 
        1   311 1 1 19 GLU CA   C  -2.418 11.117  17.858 1.00 . A A . 19 GLU CA   1 1 
        1   312 1 1 19 GLU CB   C  -3.339 10.916  16.643 1.00 . A A . 19 GLU CB   1 1 
        1   313 1 1 19 GLU CD   C  -5.365 12.001  17.669 1.00 . A A . 19 GLU CD   1 1 
        1   314 1 1 19 GLU CG   C  -4.794 10.701  17.100 1.00 . A A . 19 GLU CG   1 1 
        1   315 1 1 19 GLU H    H  -0.869 11.502  16.453 1.00 . A A . 19 GLU H    1 1 
        1   316 1 1 19 GLU HA   H  -2.824 11.901  18.480 1.00 . A A . 19 GLU HA   1 1 
        1   317 1 1 19 GLU HB2  H  -3.291 11.789  16.011 1.00 . A A . 19 GLU HB2  1 1 
        1   318 1 1 19 GLU HB3  H  -3.009 10.052  16.084 1.00 . A A . 19 GLU HB3  1 1 
        1   319 1 1 19 GLU HG2  H  -5.387 10.394  16.250 1.00 . A A . 19 GLU HG2  1 1 
        1   320 1 1 19 GLU HG3  H  -4.834  9.931  17.853 1.00 . A A . 19 GLU HG3  1 1 
        1   321 1 1 19 GLU N    N  -1.081 11.508  17.410 1.00 . A A . 19 GLU N    1 1 
        1   322 1 1 19 GLU O    O  -2.865  9.753  19.782 1.00 . A A . 19 GLU O    1 1 
        1   323 1 1 19 GLU OE1  O  -4.730 13.027  17.490 1.00 . A A . 19 GLU OE1  1 1 
        1   324 1 1 19 GLU OE2  O  -6.428 11.951  18.266 1.00 . A A . 19 GLU OE2  1 1 
        1   325 1 1 20 MET C    C  -0.149  7.357  19.291 1.00 . A A . 20 MET C    1 1 
        1   326 1 1 20 MET CA   C  -1.570  7.516  18.760 1.00 . A A . 20 MET CA   1 1 
        1   327 1 1 20 MET CB   C  -1.884  6.383  17.771 1.00 . A A . 20 MET CB   1 1 
        1   328 1 1 20 MET CE   C  -4.906  6.034  15.080 1.00 . A A . 20 MET CE   1 1 
        1   329 1 1 20 MET CG   C  -3.284  6.589  17.193 1.00 . A A . 20 MET CG   1 1 
        1   330 1 1 20 MET H    H  -1.320  8.931  17.203 1.00 . A A . 20 MET H    1 1 
        1   331 1 1 20 MET HA   H  -2.259  7.446  19.591 1.00 . A A . 20 MET HA   1 1 
        1   332 1 1 20 MET HB2  H  -1.159  6.380  16.974 1.00 . A A . 20 MET HB2  1 1 
        1   333 1 1 20 MET HB3  H  -1.852  5.435  18.285 1.00 . A A . 20 MET HB3  1 1 
        1   334 1 1 20 MET HE1  H  -4.374  6.664  14.378 1.00 . A A . 20 MET HE1  1 1 
        1   335 1 1 20 MET HE2  H  -5.560  6.639  15.691 1.00 . A A . 20 MET HE2  1 1 
        1   336 1 1 20 MET HE3  H  -5.492  5.310  14.538 1.00 . A A . 20 MET HE3  1 1 
        1   337 1 1 20 MET HG2  H  -3.998  6.669  17.998 1.00 . A A . 20 MET HG2  1 1 
        1   338 1 1 20 MET HG3  H  -3.299  7.497  16.607 1.00 . A A . 20 MET HG3  1 1 
        1   339 1 1 20 MET N    N  -1.710  8.813  18.094 1.00 . A A . 20 MET N    1 1 
        1   340 1 1 20 MET O    O   0.558  8.335  19.526 1.00 . A A . 20 MET O    1 1 
        1   341 1 1 20 MET SD   S  -3.714  5.180  16.140 1.00 . A A . 20 MET SD   1 1 
        1   342 1 1 21 ASN C    C   2.166  4.569  19.339 1.00 . A A . 21 ASN C    1 1 
        1   343 1 1 21 ASN CA   C   1.598  5.818  20.003 1.00 . A A . 21 ASN CA   1 1 
        1   344 1 1 21 ASN CB   C   1.535  5.613  21.520 1.00 . A A . 21 ASN CB   1 1 
        1   345 1 1 21 ASN CG   C   2.946  5.539  22.096 1.00 . A A . 21 ASN CG   1 1 
        1   346 1 1 21 ASN H    H  -0.353  5.366  19.286 1.00 . A A . 21 ASN H    1 1 
        1   347 1 1 21 ASN HA   H   2.260  6.650  19.790 1.00 . A A . 21 ASN HA   1 1 
        1   348 1 1 21 ASN HB2  H   1.008  6.442  21.969 1.00 . A A . 21 ASN HB2  1 1 
        1   349 1 1 21 ASN HB3  H   1.010  4.695  21.738 1.00 . A A . 21 ASN HB3  1 1 
        1   350 1 1 21 ASN HD21 H   2.567  3.949  23.223 1.00 . A A . 21 ASN HD21 1 1 
        1   351 1 1 21 ASN HD22 H   4.151  4.549  23.325 1.00 . A A . 21 ASN HD22 1 1 
        1   352 1 1 21 ASN N    N   0.255  6.106  19.489 1.00 . A A . 21 ASN N    1 1 
        1   353 1 1 21 ASN ND2  N   3.247  4.601  22.953 1.00 . A A . 21 ASN ND2  1 1 
        1   354 1 1 21 ASN O    O   2.437  3.571  20.008 1.00 . A A . 21 ASN O    1 1 
        1   355 1 1 21 ASN OD1  O   3.797  6.359  21.754 1.00 . A A . 21 ASN OD1  1 1 
        1   356 1 1 22 GLN C    C   4.373  3.320  17.555 1.00 . A A . 22 GLN C    1 1 
        1   357 1 1 22 GLN CA   C   2.886  3.490  17.282 1.00 . A A . 22 GLN CA   1 1 
        1   358 1 1 22 GLN CB   C   2.659  3.697  15.786 1.00 . A A . 22 GLN CB   1 1 
        1   359 1 1 22 GLN CD   C   1.469  1.529  15.323 1.00 . A A . 22 GLN CD   1 1 
        1   360 1 1 22 GLN CG   C   2.727  2.348  15.037 1.00 . A A . 22 GLN CG   1 1 
        1   361 1 1 22 GLN H    H   2.113  5.451  17.543 1.00 . A A . 22 GLN H    1 1 
        1   362 1 1 22 GLN HA   H   2.369  2.592  17.599 1.00 . A A . 22 GLN HA   1 1 
        1   363 1 1 22 GLN HB2  H   1.691  4.143  15.653 1.00 . A A . 22 GLN HB2  1 1 
        1   364 1 1 22 GLN HB3  H   3.411  4.365  15.391 1.00 . A A . 22 GLN HB3  1 1 
        1   365 1 1 22 GLN HE21 H   0.258  2.831  14.444 1.00 . A A . 22 GLN HE21 1 1 
        1   366 1 1 22 GLN HE22 H  -0.502  1.465  15.103 1.00 . A A . 22 GLN HE22 1 1 
        1   367 1 1 22 GLN HG2  H   2.802  2.529  13.977 1.00 . A A . 22 GLN HG2  1 1 
        1   368 1 1 22 GLN HG3  H   3.593  1.793  15.366 1.00 . A A . 22 GLN HG3  1 1 
        1   369 1 1 22 GLN N    N   2.347  4.629  18.024 1.00 . A A . 22 GLN N    1 1 
        1   370 1 1 22 GLN NE2  N   0.312  1.978  14.922 1.00 . A A . 22 GLN NE2  1 1 
        1   371 1 1 22 GLN O    O   5.161  3.013  16.660 1.00 . A A . 22 GLN O    1 1 
        1   372 1 1 22 GLN OE1  O   1.541  0.459  15.929 1.00 . A A . 22 GLN OE1  1 1 
        1   373 1 1 23 SER C    C   6.958  4.586  18.772 1.00 . A A . 23 SER C    1 1 
        1   374 1 1 23 SER CA   C   6.146  3.384  19.230 1.00 . A A . 23 SER CA   1 1 
        1   375 1 1 23 SER CB   C   6.752  2.080  18.660 1.00 . A A . 23 SER CB   1 1 
        1   376 1 1 23 SER H    H   4.079  3.766  19.484 1.00 . A A . 23 SER H    1 1 
        1   377 1 1 23 SER HA   H   6.176  3.340  20.308 1.00 . A A . 23 SER HA   1 1 
        1   378 1 1 23 SER HB2  H   7.540  1.725  19.305 1.00 . A A . 23 SER HB2  1 1 
        1   379 1 1 23 SER HB3  H   5.976  1.326  18.599 1.00 . A A . 23 SER HB3  1 1 
        1   380 1 1 23 SER HG   H   8.246  2.331  17.435 1.00 . A A . 23 SER HG   1 1 
        1   381 1 1 23 SER N    N   4.750  3.523  18.814 1.00 . A A . 23 SER N    1 1 
        1   382 1 1 23 SER O    O   8.007  4.432  18.146 1.00 . A A . 23 SER O    1 1 
        1   383 1 1 23 SER OG   O   7.292  2.319  17.364 1.00 . A A . 23 SER OG   1 1 
        1   384 1 1 24 GLU C    C   7.000  8.086  19.767 1.00 . A A . 24 GLU C    1 1 
        1   385 1 1 24 GLU CA   C   7.148  7.014  18.682 1.00 . A A . 24 GLU CA   1 1 
        1   386 1 1 24 GLU CB   C   6.570  7.507  17.336 1.00 . A A . 24 GLU CB   1 1 
        1   387 1 1 24 GLU CD   C   8.708  7.406  16.017 1.00 . A A . 24 GLU CD   1 1 
        1   388 1 1 24 GLU CG   C   7.627  8.335  16.573 1.00 . A A . 24 GLU CG   1 1 
        1   389 1 1 24 GLU H    H   5.623  5.843  19.575 1.00 . A A . 24 GLU H    1 1 
        1   390 1 1 24 GLU HA   H   8.205  6.809  18.563 1.00 . A A . 24 GLU HA   1 1 
        1   391 1 1 24 GLU HB2  H   6.278  6.644  16.751 1.00 . A A . 24 GLU HB2  1 1 
        1   392 1 1 24 GLU HB3  H   5.692  8.118  17.507 1.00 . A A . 24 GLU HB3  1 1 
        1   393 1 1 24 GLU HG2  H   7.154  8.863  15.759 1.00 . A A . 24 GLU HG2  1 1 
        1   394 1 1 24 GLU HG3  H   8.082  9.050  17.245 1.00 . A A . 24 GLU HG3  1 1 
        1   395 1 1 24 GLU N    N   6.464  5.782  19.075 1.00 . A A . 24 GLU N    1 1 
        1   396 1 1 24 GLU O    O   7.122  7.800  20.959 1.00 . A A . 24 GLU O    1 1 
        1   397 1 1 24 GLU OE1  O   8.356  6.317  15.593 1.00 . A A . 24 GLU OE1  1 1 
        1   398 1 1 24 GLU OE2  O   9.863  7.797  16.015 1.00 . A A . 24 GLU OE2  1 1 
        1   399 1 1 25 ASP C    C   5.675 11.493  19.700 1.00 . A A . 25 ASP C    1 1 
        1   400 1 1 25 ASP CA   C   6.595 10.432  20.280 1.00 . A A . 25 ASP CA   1 1 
        1   401 1 1 25 ASP CB   C   7.967 11.040  20.554 1.00 . A A . 25 ASP CB   1 1 
        1   402 1 1 25 ASP CG   C   8.874 10.002  21.208 1.00 . A A . 25 ASP CG   1 1 
        1   403 1 1 25 ASP H    H   6.657  9.489  18.380 1.00 . A A . 25 ASP H    1 1 
        1   404 1 1 25 ASP HA   H   6.174 10.079  21.214 1.00 . A A . 25 ASP HA   1 1 
        1   405 1 1 25 ASP HB2  H   8.400 11.363  19.618 1.00 . A A . 25 ASP HB2  1 1 
        1   406 1 1 25 ASP HB3  H   7.864 11.889  21.215 1.00 . A A . 25 ASP HB3  1 1 
        1   407 1 1 25 ASP N    N   6.744  9.319  19.342 1.00 . A A . 25 ASP N    1 1 
        1   408 1 1 25 ASP O    O   4.945 11.244  18.741 1.00 . A A . 25 ASP O    1 1 
        1   409 1 1 25 ASP OD1  O   8.470  9.444  22.215 1.00 . A A . 25 ASP OD1  1 1 
        1   410 1 1 25 ASP OD2  O   9.958  9.783  20.695 1.00 . A A . 25 ASP OD2  1 1 
        1   411 1 1 26 LYS C    C   5.540 14.506  18.662 1.00 . A A . 26 LYS C    1 1 
        1   412 1 1 26 LYS CA   C   4.868 13.773  19.828 1.00 . A A . 26 LYS CA   1 1 
        1   413 1 1 26 LYS CB   C   4.583 14.733  20.989 1.00 . A A . 26 LYS CB   1 1 
        1   414 1 1 26 LYS CD   C   3.178 16.642  21.764 1.00 . A A . 26 LYS CD   1 1 
        1   415 1 1 26 LYS CE   C   2.092 17.634  21.356 1.00 . A A . 26 LYS CE   1 1 
        1   416 1 1 26 LYS CG   C   3.517 15.749  20.571 1.00 . A A . 26 LYS CG   1 1 
        1   417 1 1 26 LYS H    H   6.312 12.820  21.056 1.00 . A A . 26 LYS H    1 1 
        1   418 1 1 26 LYS HA   H   3.923 13.369  19.482 1.00 . A A . 26 LYS HA   1 1 
        1   419 1 1 26 LYS HB2  H   4.221 14.163  21.831 1.00 . A A . 26 LYS HB2  1 1 
        1   420 1 1 26 LYS HB3  H   5.487 15.246  21.273 1.00 . A A . 26 LYS HB3  1 1 
        1   421 1 1 26 LYS HD2  H   2.828 16.034  22.585 1.00 . A A . 26 LYS HD2  1 1 
        1   422 1 1 26 LYS HD3  H   4.062 17.185  22.069 1.00 . A A . 26 LYS HD3  1 1 
        1   423 1 1 26 LYS HE2  H   1.789 18.210  22.216 1.00 . A A . 26 LYS HE2  1 1 
        1   424 1 1 26 LYS HE3  H   2.476 18.295  20.596 1.00 . A A . 26 LYS HE3  1 1 
        1   425 1 1 26 LYS HG2  H   3.889 16.355  19.759 1.00 . A A . 26 LYS HG2  1 1 
        1   426 1 1 26 LYS HG3  H   2.627 15.224  20.247 1.00 . A A . 26 LYS HG3  1 1 
        1   427 1 1 26 LYS HZ1  H   0.956 16.882  19.784 1.00 . A A . 26 LYS HZ1  1 1 
        1   428 1 1 26 LYS HZ2  H   0.043 17.340  21.138 1.00 . A A . 26 LYS HZ2  1 1 
        1   429 1 1 26 LYS HZ3  H   0.952 15.905  21.174 1.00 . A A . 26 LYS HZ3  1 1 
        1   430 1 1 26 LYS N    N   5.710 12.681  20.296 1.00 . A A . 26 LYS N    1 1 
        1   431 1 1 26 LYS NZ   N   0.921 16.884  20.823 1.00 . A A . 26 LYS NZ   1 1 
        1   432 1 1 26 LYS O    O   5.569 13.996  17.542 1.00 . A A . 26 LYS O    1 1 
        1   433 1 1 27 ILE C    C   7.917 15.708  17.359 1.00 . A A . 27 ILE C    1 1 
        1   434 1 1 27 ILE CA   C   6.713 16.472  17.885 1.00 . A A . 27 ILE CA   1 1 
        1   435 1 1 27 ILE CB   C   7.152 17.842  18.426 1.00 . A A . 27 ILE CB   1 1 
        1   436 1 1 27 ILE CD1  C   6.223 20.109  19.062 1.00 . A A . 27 ILE CD1  1 1 
        1   437 1 1 27 ILE CG1  C   5.883 18.643  18.809 1.00 . A A . 27 ILE CG1  1 1 
        1   438 1 1 27 ILE CG2  C   7.969 18.615  17.351 1.00 . A A . 27 ILE CG2  1 1 
        1   439 1 1 27 ILE H    H   6.013 16.055  19.839 1.00 . A A . 27 ILE H    1 1 
        1   440 1 1 27 ILE HA   H   6.017 16.625  17.074 1.00 . A A . 27 ILE HA   1 1 
        1   441 1 1 27 ILE HB   H   7.767 17.696  19.305 1.00 . A A . 27 ILE HB   1 1 
        1   442 1 1 27 ILE HD11 H   5.442 20.567  19.643 1.00 . A A . 27 ILE HD11 1 1 
        1   443 1 1 27 ILE HD12 H   6.309 20.611  18.106 1.00 . A A . 27 ILE HD12 1 1 
        1   444 1 1 27 ILE HD13 H   7.160 20.181  19.593 1.00 . A A . 27 ILE HD13 1 1 
        1   445 1 1 27 ILE HG12 H   5.157 18.587  18.012 1.00 . A A . 27 ILE HG12 1 1 
        1   446 1 1 27 ILE HG13 H   5.456 18.220  19.706 1.00 . A A . 27 ILE HG13 1 1 
        1   447 1 1 27 ILE HG21 H   8.380 19.515  17.785 1.00 . A A . 27 ILE HG21 1 1 
        1   448 1 1 27 ILE HG22 H   7.326 18.878  16.529 1.00 . A A . 27 ILE HG22 1 1 
        1   449 1 1 27 ILE HG23 H   8.780 18.007  16.984 1.00 . A A . 27 ILE HG23 1 1 
        1   450 1 1 27 ILE N    N   6.065 15.698  18.928 1.00 . A A . 27 ILE N    1 1 
        1   451 1 1 27 ILE O    O   8.165 15.696  16.153 1.00 . A A . 27 ILE O    1 1 
        1   452 1 1 28 HIS C    C   9.501 13.272  16.859 1.00 . A A . 28 HIS C    1 1 
        1   453 1 1 28 HIS CA   C   9.864 14.363  17.858 1.00 . A A . 28 HIS CA   1 1 
        1   454 1 1 28 HIS CB   C  10.546 13.755  19.090 1.00 . A A . 28 HIS CB   1 1 
        1   455 1 1 28 HIS CD2  C  12.384 15.419  19.966 1.00 . A A . 28 HIS CD2  1 1 
        1   456 1 1 28 HIS CE1  C  11.215 16.397  21.508 1.00 . A A . 28 HIS CE1  1 1 
        1   457 1 1 28 HIS CG   C  11.135 14.850  19.940 1.00 . A A . 28 HIS CG   1 1 
        1   458 1 1 28 HIS H    H   8.431 15.140  19.208 1.00 . A A . 28 HIS H    1 1 
        1   459 1 1 28 HIS HA   H  10.548 15.048  17.381 1.00 . A A . 28 HIS HA   1 1 
        1   460 1 1 28 HIS HB2  H   9.822 13.212  19.669 1.00 . A A . 28 HIS HB2  1 1 
        1   461 1 1 28 HIS HB3  H  11.332 13.085  18.776 1.00 . A A . 28 HIS HB3  1 1 
        1   462 1 1 28 HIS HD1  H   9.472 15.313  21.170 1.00 . A A . 28 HIS HD1  1 1 
        1   463 1 1 28 HIS HD2  H  13.203 15.152  19.316 1.00 . A A . 28 HIS HD2  1 1 
        1   464 1 1 28 HIS HE1  H  10.917 17.048  22.317 1.00 . A A . 28 HIS HE1  1 1 
        1   465 1 1 28 HIS HE2  H  13.195 16.962  21.197 1.00 . A A . 28 HIS HE2  1 1 
        1   466 1 1 28 HIS N    N   8.678 15.097  18.261 1.00 . A A . 28 HIS N    1 1 
        1   467 1 1 28 HIS ND1  N  10.406 15.488  20.932 1.00 . A A . 28 HIS ND1  1 1 
        1   468 1 1 28 HIS NE2  N  12.433 16.396  20.957 1.00 . A A . 28 HIS NE2  1 1 
        1   469 1 1 28 HIS O    O  10.382 12.610  16.311 1.00 . A A . 28 HIS O    1 1 
        1   470 1 1 29 ALA C    C   8.280 12.382  14.298 1.00 . A A . 29 ALA C    1 1 
        1   471 1 1 29 ALA CA   C   7.748 12.082  15.683 1.00 . A A . 29 ALA CA   1 1 
        1   472 1 1 29 ALA CB   C   6.224 12.055  15.629 1.00 . A A . 29 ALA CB   1 1 
        1   473 1 1 29 ALA H    H   7.549 13.647  17.092 1.00 . A A . 29 ALA H    1 1 
        1   474 1 1 29 ALA HA   H   8.107 11.112  15.994 1.00 . A A . 29 ALA HA   1 1 
        1   475 1 1 29 ALA HB1  H   5.836 11.782  16.594 1.00 . A A . 29 ALA HB1  1 1 
        1   476 1 1 29 ALA HB2  H   5.905 11.333  14.894 1.00 . A A . 29 ALA HB2  1 1 
        1   477 1 1 29 ALA HB3  H   5.859 13.033  15.354 1.00 . A A . 29 ALA HB3  1 1 
        1   478 1 1 29 ALA N    N   8.206 13.089  16.625 1.00 . A A . 29 ALA N    1 1 
        1   479 1 1 29 ALA O    O   8.757 11.479  13.611 1.00 . A A . 29 ALA O    1 1 
        1   480 1 1 30 MET C    C  10.176 13.787  12.483 1.00 . A A . 30 MET C    1 1 
        1   481 1 1 30 MET CA   C   8.679 14.017  12.576 1.00 . A A . 30 MET CA   1 1 
        1   482 1 1 30 MET CB   C   8.368 15.494  12.293 1.00 . A A . 30 MET CB   1 1 
        1   483 1 1 30 MET CE   C  11.443 17.788  13.879 1.00 . A A . 30 MET CE   1 1 
        1   484 1 1 30 MET CG   C   9.180 16.423  13.229 1.00 . A A . 30 MET CG   1 1 
        1   485 1 1 30 MET H    H   7.806 14.319  14.476 1.00 . A A . 30 MET H    1 1 
        1   486 1 1 30 MET HA   H   8.183 13.410  11.832 1.00 . A A . 30 MET HA   1 1 
        1   487 1 1 30 MET HB2  H   8.619 15.711  11.266 1.00 . A A . 30 MET HB2  1 1 
        1   488 1 1 30 MET HB3  H   7.312 15.663  12.444 1.00 . A A . 30 MET HB3  1 1 
        1   489 1 1 30 MET HE1  H  12.522 17.829  13.825 1.00 . A A . 30 MET HE1  1 1 
        1   490 1 1 30 MET HE2  H  11.142 17.349  14.820 1.00 . A A . 30 MET HE2  1 1 
        1   491 1 1 30 MET HE3  H  11.045 18.788  13.810 1.00 . A A . 30 MET HE3  1 1 
        1   492 1 1 30 MET HG2  H   8.644 17.350  13.369 1.00 . A A . 30 MET HG2  1 1 
        1   493 1 1 30 MET HG3  H   9.311 15.955  14.182 1.00 . A A . 30 MET HG3  1 1 
        1   494 1 1 30 MET N    N   8.197 13.642  13.884 1.00 . A A . 30 MET N    1 1 
        1   495 1 1 30 MET O    O  10.660 13.246  11.489 1.00 . A A . 30 MET O    1 1 
        1   496 1 1 30 MET SD   S  10.810 16.779  12.511 1.00 . A A . 30 MET SD   1 1 
        1   497 1 1 31 ASN C    C  12.745 12.606  13.193 1.00 . A A . 31 ASN C    1 1 
        1   498 1 1 31 ASN CA   C  12.360 14.056  13.479 1.00 . A A . 31 ASN CA   1 1 
        1   499 1 1 31 ASN CB   C  12.946 14.479  14.826 1.00 . A A . 31 ASN CB   1 1 
        1   500 1 1 31 ASN CG   C  14.469 14.432  14.780 1.00 . A A . 31 ASN CG   1 1 
        1   501 1 1 31 ASN H    H  10.470 14.631  14.273 1.00 . A A . 31 ASN H    1 1 
        1   502 1 1 31 ASN HA   H  12.765 14.689  12.709 1.00 . A A . 31 ASN HA   1 1 
        1   503 1 1 31 ASN HB2  H  12.624 15.483  15.055 1.00 . A A . 31 ASN HB2  1 1 
        1   504 1 1 31 ASN HB3  H  12.593 13.807  15.595 1.00 . A A . 31 ASN HB3  1 1 
        1   505 1 1 31 ASN HD21 H  14.648 13.856  16.670 1.00 . A A . 31 ASN HD21 1 1 
        1   506 1 1 31 ASN HD22 H  16.109 14.058  15.831 1.00 . A A . 31 ASN HD22 1 1 
        1   507 1 1 31 ASN N    N  10.909 14.207  13.508 1.00 . A A . 31 ASN N    1 1 
        1   508 1 1 31 ASN ND2  N  15.130 14.086  15.850 1.00 . A A . 31 ASN ND2  1 1 
        1   509 1 1 31 ASN O    O  13.561 12.336  12.313 1.00 . A A . 31 ASN O    1 1 
        1   510 1 1 31 ASN OD1  O  15.073 14.728  13.749 1.00 . A A . 31 ASN OD1  1 1 
        1   511 1 1 32 SER C    C  12.011  9.810  12.331 1.00 . A A . 32 SER C    1 1 
        1   512 1 1 32 SER CA   C  12.440 10.263  13.731 1.00 . A A . 32 SER CA   1 1 
        1   513 1 1 32 SER CB   C  11.701  9.442  14.775 1.00 . A A . 32 SER CB   1 1 
        1   514 1 1 32 SER H    H  11.505 11.954  14.624 1.00 . A A . 32 SER H    1 1 
        1   515 1 1 32 SER HA   H  13.501 10.100  13.843 1.00 . A A . 32 SER HA   1 1 
        1   516 1 1 32 SER HB2  H  11.885  8.393  14.611 1.00 . A A . 32 SER HB2  1 1 
        1   517 1 1 32 SER HB3  H  12.049  9.720  15.762 1.00 . A A . 32 SER HB3  1 1 
        1   518 1 1 32 SER HG   H   9.850  8.863  14.657 1.00 . A A . 32 SER HG   1 1 
        1   519 1 1 32 SER N    N  12.148 11.679  13.936 1.00 . A A . 32 SER N    1 1 
        1   520 1 1 32 SER O    O  12.787  9.195  11.600 1.00 . A A . 32 SER O    1 1 
        1   521 1 1 32 SER OG   O  10.311  9.704  14.655 1.00 . A A . 32 SER OG   1 1 
        1   522 1 1 33 TYR C    C  10.941 10.568   9.552 1.00 . A A . 33 TYR C    1 1 
        1   523 1 1 33 TYR CA   C  10.251  9.755  10.658 1.00 . A A . 33 TYR CA   1 1 
        1   524 1 1 33 TYR CB   C   8.740 10.011  10.619 1.00 . A A . 33 TYR CB   1 1 
        1   525 1 1 33 TYR CD1  C   8.255 10.720   8.251 1.00 . A A . 33 TYR CD1  1 1 
        1   526 1 1 33 TYR CD2  C   7.701  8.453   8.913 1.00 . A A . 33 TYR CD2  1 1 
        1   527 1 1 33 TYR CE1  C   7.781 10.458   6.959 1.00 . A A . 33 TYR CE1  1 1 
        1   528 1 1 33 TYR CE2  C   7.227  8.193   7.622 1.00 . A A . 33 TYR CE2  1 1 
        1   529 1 1 33 TYR CG   C   8.217  9.717   9.227 1.00 . A A . 33 TYR CG   1 1 
        1   530 1 1 33 TYR CZ   C   7.265  9.195   6.645 1.00 . A A . 33 TYR CZ   1 1 
        1   531 1 1 33 TYR H    H  10.197 10.614  12.596 1.00 . A A . 33 TYR H    1 1 
        1   532 1 1 33 TYR HA   H  10.430  8.702  10.488 1.00 . A A . 33 TYR HA   1 1 
        1   533 1 1 33 TYR HB2  H   8.249  9.369  11.339 1.00 . A A . 33 TYR HB2  1 1 
        1   534 1 1 33 TYR HB3  H   8.543 11.047  10.873 1.00 . A A . 33 TYR HB3  1 1 
        1   535 1 1 33 TYR HD1  H   8.656 11.696   8.498 1.00 . A A . 33 TYR HD1  1 1 
        1   536 1 1 33 TYR HD2  H   7.672  7.681   9.666 1.00 . A A . 33 TYR HD2  1 1 
        1   537 1 1 33 TYR HE1  H   7.813 11.233   6.208 1.00 . A A . 33 TYR HE1  1 1 
        1   538 1 1 33 TYR HE2  H   6.827  7.218   7.378 1.00 . A A . 33 TYR HE2  1 1 
        1   539 1 1 33 TYR HH   H   5.934  8.526   5.450 1.00 . A A . 33 TYR HH   1 1 
        1   540 1 1 33 TYR N    N  10.771 10.123  11.971 1.00 . A A . 33 TYR N    1 1 
        1   541 1 1 33 TYR O    O  10.956 10.167   8.388 1.00 . A A . 33 TYR O    1 1 
        1   542 1 1 33 TYR OH   O   6.798  8.937   5.373 1.00 . A A . 33 TYR OH   1 1 
        1   543 1 1 34 TYR C    C  13.524 11.999   8.585 1.00 . A A . 34 TYR C    1 1 
        1   544 1 1 34 TYR CA   C  12.174 12.583   8.965 1.00 . A A . 34 TYR CA   1 1 
        1   545 1 1 34 TYR CB   C  12.361 13.994   9.553 1.00 . A A . 34 TYR CB   1 1 
        1   546 1 1 34 TYR CD1  C  14.489 14.844   8.499 1.00 . A A . 34 TYR CD1  1 1 
        1   547 1 1 34 TYR CD2  C  12.372 15.730   7.715 1.00 . A A . 34 TYR CD2  1 1 
        1   548 1 1 34 TYR CE1  C  15.168 15.655   7.581 1.00 . A A . 34 TYR CE1  1 1 
        1   549 1 1 34 TYR CE2  C  13.050 16.541   6.797 1.00 . A A . 34 TYR CE2  1 1 
        1   550 1 1 34 TYR CG   C  13.091 14.882   8.566 1.00 . A A . 34 TYR CG   1 1 
        1   551 1 1 34 TYR CZ   C  14.449 16.503   6.730 1.00 . A A . 34 TYR CZ   1 1 
        1   552 1 1 34 TYR H    H  11.456 11.984  10.871 1.00 . A A . 34 TYR H    1 1 
        1   553 1 1 34 TYR HA   H  11.567 12.659   8.074 1.00 . A A . 34 TYR HA   1 1 
        1   554 1 1 34 TYR HB2  H  11.395 14.428   9.760 1.00 . A A . 34 TYR HB2  1 1 
        1   555 1 1 34 TYR HB3  H  12.931 13.926  10.466 1.00 . A A . 34 TYR HB3  1 1 
        1   556 1 1 34 TYR HD1  H  15.044 14.192   9.157 1.00 . A A . 34 TYR HD1  1 1 
        1   557 1 1 34 TYR HD2  H  11.286 15.763   7.772 1.00 . A A . 34 TYR HD2  1 1 
        1   558 1 1 34 TYR HE1  H  16.245 15.626   7.530 1.00 . A A . 34 TYR HE1  1 1 
        1   559 1 1 34 TYR HE2  H  12.496 17.193   6.141 1.00 . A A . 34 TYR HE2  1 1 
        1   560 1 1 34 TYR HH   H  15.973 17.526   6.208 1.00 . A A . 34 TYR HH   1 1 
        1   561 1 1 34 TYR N    N  11.498 11.714   9.929 1.00 . A A . 34 TYR N    1 1 
        1   562 1 1 34 TYR O    O  13.794 11.768   7.407 1.00 . A A . 34 TYR O    1 1 
        1   563 1 1 34 TYR OH   O  15.120 17.303   5.829 1.00 . A A . 34 TYR OH   1 1 
        1   564 1 1 35 ARG C    C  15.571  9.837   8.686 1.00 . A A . 35 ARG C    1 1 
        1   565 1 1 35 ARG CA   C  15.686 11.204   9.348 1.00 . A A . 35 ARG CA   1 1 
        1   566 1 1 35 ARG CB   C  16.456 11.081  10.662 1.00 . A A . 35 ARG CB   1 1 
        1   567 1 1 35 ARG CD   C  16.407 10.128  12.976 1.00 . A A . 35 ARG CD   1 1 
        1   568 1 1 35 ARG CG   C  15.746 10.102  11.601 1.00 . A A . 35 ARG CG   1 1 
        1   569 1 1 35 ARG CZ   C  18.823 10.427  12.668 1.00 . A A . 35 ARG CZ   1 1 
        1   570 1 1 35 ARG H    H  14.099 11.966  10.502 1.00 . A A . 35 ARG H    1 1 
        1   571 1 1 35 ARG HA   H  16.227 11.869   8.707 1.00 . A A . 35 ARG HA   1 1 
        1   572 1 1 35 ARG HB2  H  17.448 10.718  10.447 1.00 . A A . 35 ARG HB2  1 1 
        1   573 1 1 35 ARG HB3  H  16.521 12.052  11.133 1.00 . A A . 35 ARG HB3  1 1 
        1   574 1 1 35 ARG HD2  H  16.399 11.135  13.361 1.00 . A A . 35 ARG HD2  1 1 
        1   575 1 1 35 ARG HD3  H  15.845  9.494  13.644 1.00 . A A . 35 ARG HD3  1 1 
        1   576 1 1 35 ARG HE   H  17.938  8.664  12.977 1.00 . A A . 35 ARG HE   1 1 
        1   577 1 1 35 ARG HG2  H  14.722 10.392  11.697 1.00 . A A . 35 ARG HG2  1 1 
        1   578 1 1 35 ARG HG3  H  15.801  9.102  11.198 1.00 . A A . 35 ARG HG3  1 1 
        1   579 1 1 35 ARG HH11 H  17.714 12.095  12.582 1.00 . A A . 35 ARG HH11 1 1 
        1   580 1 1 35 ARG HH12 H  19.418 12.314  12.368 1.00 . A A . 35 ARG HH12 1 1 
        1   581 1 1 35 ARG HH21 H  20.165  8.946  12.706 1.00 . A A . 35 ARG HH21 1 1 
        1   582 1 1 35 ARG HH22 H  20.804 10.532  12.436 1.00 . A A . 35 ARG HH22 1 1 
        1   583 1 1 35 ARG N    N  14.369 11.762   9.583 1.00 . A A . 35 ARG N    1 1 
        1   584 1 1 35 ARG NE   N  17.783  9.626  12.881 1.00 . A A . 35 ARG NE   1 1 
        1   585 1 1 35 ARG NH1  N  18.639 11.711  12.530 1.00 . A A . 35 ARG NH1  1 1 
        1   586 1 1 35 ARG NH2  N  20.027  9.929  12.600 1.00 . A A . 35 ARG NH2  1 1 
        1   587 1 1 35 ARG O    O  16.489  9.385   8.002 1.00 . A A . 35 ARG O    1 1 
        1   588 1 1 36 SER C    C  13.970  7.948   6.831 1.00 . A A . 36 SER C    1 1 
        1   589 1 1 36 SER CA   C  14.210  7.855   8.332 1.00 . A A . 36 SER CA   1 1 
        1   590 1 1 36 SER CB   C  13.000  7.194   8.994 1.00 . A A . 36 SER CB   1 1 
        1   591 1 1 36 SER H    H  13.741  9.588   9.458 1.00 . A A . 36 SER H    1 1 
        1   592 1 1 36 SER HA   H  15.082  7.241   8.508 1.00 . A A . 36 SER HA   1 1 
        1   593 1 1 36 SER HB2  H  13.259  6.862   9.987 1.00 . A A . 36 SER HB2  1 1 
        1   594 1 1 36 SER HB3  H  12.192  7.913   9.058 1.00 . A A . 36 SER HB3  1 1 
        1   595 1 1 36 SER HG   H  13.385  5.629   7.905 1.00 . A A . 36 SER HG   1 1 
        1   596 1 1 36 SER N    N  14.438  9.178   8.905 1.00 . A A . 36 SER N    1 1 
        1   597 1 1 36 SER O    O  14.537  7.184   6.051 1.00 . A A . 36 SER O    1 1 
        1   598 1 1 36 SER OG   O  12.594  6.078   8.214 1.00 . A A . 36 SER OG   1 1 
        1   599 1 1 37 VAL C    C  14.061  9.517   4.253 1.00 . A A . 37 VAL C    1 1 
        1   600 1 1 37 VAL CA   C  12.825  9.046   5.010 1.00 . A A . 37 VAL CA   1 1 
        1   601 1 1 37 VAL CB   C  11.688 10.085   4.831 1.00 . A A . 37 VAL CB   1 1 
        1   602 1 1 37 VAL CG1  C  11.615 10.595   3.372 1.00 . A A . 37 VAL CG1  1 1 
        1   603 1 1 37 VAL CG2  C  10.340  9.457   5.210 1.00 . A A . 37 VAL CG2  1 1 
        1   604 1 1 37 VAL H    H  12.701  9.473   7.099 1.00 . A A . 37 VAL H    1 1 
        1   605 1 1 37 VAL HA   H  12.508  8.096   4.606 1.00 . A A . 37 VAL HA   1 1 
        1   606 1 1 37 VAL HB   H  11.880 10.926   5.483 1.00 . A A . 37 VAL HB   1 1 
        1   607 1 1 37 VAL HG11 H  12.440 11.267   3.185 1.00 . A A . 37 VAL HG11 1 1 
        1   608 1 1 37 VAL HG12 H  10.687 11.124   3.213 1.00 . A A . 37 VAL HG12 1 1 
        1   609 1 1 37 VAL HG13 H  11.677  9.757   2.691 1.00 . A A . 37 VAL HG13 1 1 
        1   610 1 1 37 VAL HG21 H  10.341  9.212   6.260 1.00 . A A . 37 VAL HG21 1 1 
        1   611 1 1 37 VAL HG22 H  10.176  8.560   4.628 1.00 . A A . 37 VAL HG22 1 1 
        1   612 1 1 37 VAL HG23 H   9.553 10.162   5.003 1.00 . A A . 37 VAL HG23 1 1 
        1   613 1 1 37 VAL N    N  13.124  8.892   6.433 1.00 . A A . 37 VAL N    1 1 
        1   614 1 1 37 VAL O    O  14.568  8.809   3.383 1.00 . A A . 37 VAL O    1 1 
        1   615 1 1 38 VAL C    C  16.820 10.204   3.805 1.00 . A A . 38 VAL C    1 1 
        1   616 1 1 38 VAL CA   C  15.719 11.260   3.909 1.00 . A A . 38 VAL CA   1 1 
        1   617 1 1 38 VAL CB   C  16.250 12.475   4.686 1.00 . A A . 38 VAL CB   1 1 
        1   618 1 1 38 VAL CG1  C  15.137 13.521   4.845 1.00 . A A . 38 VAL CG1  1 1 
        1   619 1 1 38 VAL CG2  C  16.737 12.025   6.073 1.00 . A A . 38 VAL CG2  1 1 
        1   620 1 1 38 VAL H    H  14.097 11.230   5.289 1.00 . A A . 38 VAL H    1 1 
        1   621 1 1 38 VAL HA   H  15.441 11.575   2.919 1.00 . A A . 38 VAL HA   1 1 
        1   622 1 1 38 VAL HB   H  17.075 12.914   4.142 1.00 . A A . 38 VAL HB   1 1 
        1   623 1 1 38 VAL HG11 H  14.382 13.147   5.519 1.00 . A A . 38 VAL HG11 1 1 
        1   624 1 1 38 VAL HG12 H  14.693 13.725   3.884 1.00 . A A . 38 VAL HG12 1 1 
        1   625 1 1 38 VAL HG13 H  15.557 14.430   5.247 1.00 . A A . 38 VAL HG13 1 1 
        1   626 1 1 38 VAL HG21 H  16.874 12.891   6.708 1.00 . A A . 38 VAL HG21 1 1 
        1   627 1 1 38 VAL HG22 H  17.678 11.501   5.975 1.00 . A A . 38 VAL HG22 1 1 
        1   628 1 1 38 VAL HG23 H  16.005 11.363   6.510 1.00 . A A . 38 VAL HG23 1 1 
        1   629 1 1 38 VAL N    N  14.542 10.710   4.587 1.00 . A A . 38 VAL N    1 1 
        1   630 1 1 38 VAL O    O  17.479 10.092   2.770 1.00 . A A . 38 VAL O    1 1 
        1   631 1 1 39 SER C    C  17.739  7.389   3.740 1.00 . A A . 39 SER C    1 1 
        1   632 1 1 39 SER CA   C  18.012  8.380   4.866 1.00 . A A . 39 SER CA   1 1 
        1   633 1 1 39 SER CB   C  18.010  7.654   6.213 1.00 . A A . 39 SER CB   1 1 
        1   634 1 1 39 SER H    H  16.449  9.561   5.663 1.00 . A A . 39 SER H    1 1 
        1   635 1 1 39 SER HA   H  18.982  8.829   4.712 1.00 . A A . 39 SER HA   1 1 
        1   636 1 1 39 SER HB2  H  16.998  7.408   6.488 1.00 . A A . 39 SER HB2  1 1 
        1   637 1 1 39 SER HB3  H  18.593  6.744   6.142 1.00 . A A . 39 SER HB3  1 1 
        1   638 1 1 39 SER HG   H  18.939  9.274   6.756 1.00 . A A . 39 SER HG   1 1 
        1   639 1 1 39 SER N    N  17.003  9.426   4.866 1.00 . A A . 39 SER N    1 1 
        1   640 1 1 39 SER O    O  18.668  6.915   3.084 1.00 . A A . 39 SER O    1 1 
        1   641 1 1 39 SER OG   O  18.567  8.509   7.203 1.00 . A A . 39 SER OG   1 1 
        1   642 1 1 40 THR C    C  16.200  6.799   1.100 1.00 . A A . 40 THR C    1 1 
        1   643 1 1 40 THR CA   C  16.081  6.140   2.471 1.00 . A A . 40 THR CA   1 1 
        1   644 1 1 40 THR CB   C  14.639  5.662   2.690 1.00 . A A . 40 THR CB   1 1 
        1   645 1 1 40 THR CG2  C  14.249  4.664   1.593 1.00 . A A . 40 THR CG2  1 1 
        1   646 1 1 40 THR H    H  15.768  7.482   4.076 1.00 . A A . 40 THR H    1 1 
        1   647 1 1 40 THR HA   H  16.738  5.282   2.501 1.00 . A A . 40 THR HA   1 1 
        1   648 1 1 40 THR HB   H  13.969  6.506   2.661 1.00 . A A . 40 THR HB   1 1 
        1   649 1 1 40 THR HG1  H  14.099  5.618   4.558 1.00 . A A . 40 THR HG1  1 1 
        1   650 1 1 40 THR HG21 H  14.145  5.184   0.651 1.00 . A A . 40 THR HG21 1 1 
        1   651 1 1 40 THR HG22 H  13.310  4.198   1.851 1.00 . A A . 40 THR HG22 1 1 
        1   652 1 1 40 THR HG23 H  15.014  3.906   1.505 1.00 . A A . 40 THR HG23 1 1 
        1   653 1 1 40 THR N    N  16.466  7.073   3.523 1.00 . A A . 40 THR N    1 1 
        1   654 1 1 40 THR O    O  16.710  6.196   0.156 1.00 . A A . 40 THR O    1 1 
        1   655 1 1 40 THR OG1  O  14.548  5.021   3.954 1.00 . A A . 40 THR OG1  1 1 
        1   656 1 1 41 LEU C    C  17.205  8.864  -0.770 1.00 . A A . 41 LEU C    1 1 
        1   657 1 1 41 LEU CA   C  15.771  8.768  -0.264 1.00 . A A . 41 LEU CA   1 1 
        1   658 1 1 41 LEU CB   C  15.180 10.163  -0.086 1.00 . A A . 41 LEU CB   1 1 
        1   659 1 1 41 LEU CD1  C  13.161 11.484   0.547 1.00 . A A . 41 LEU CD1  1 1 
        1   660 1 1 41 LEU CD2  C  12.861  9.314  -0.711 1.00 . A A . 41 LEU CD2  1 1 
        1   661 1 1 41 LEU CG   C  13.706 10.066   0.351 1.00 . A A . 41 LEU CG   1 1 
        1   662 1 1 41 LEU H    H  15.323  8.465   1.780 1.00 . A A . 41 LEU H    1 1 
        1   663 1 1 41 LEU HA   H  15.197  8.231  -1.001 1.00 . A A . 41 LEU HA   1 1 
        1   664 1 1 41 LEU HB2  H  15.740 10.692   0.669 1.00 . A A . 41 LEU HB2  1 1 
        1   665 1 1 41 LEU HB3  H  15.240 10.699  -1.020 1.00 . A A . 41 LEU HB3  1 1 
        1   666 1 1 41 LEU HD11 H  13.253 12.034  -0.374 1.00 . A A . 41 LEU HD11 1 1 
        1   667 1 1 41 LEU HD12 H  13.727 11.981   1.317 1.00 . A A . 41 LEU HD12 1 1 
        1   668 1 1 41 LEU HD13 H  12.122 11.434   0.834 1.00 . A A . 41 LEU HD13 1 1 
        1   669 1 1 41 LEU HD21 H  13.270  9.488  -1.694 1.00 . A A . 41 LEU HD21 1 1 
        1   670 1 1 41 LEU HD22 H  11.833  9.652  -0.683 1.00 . A A . 41 LEU HD22 1 1 
        1   671 1 1 41 LEU HD23 H  12.883  8.254  -0.501 1.00 . A A . 41 LEU HD23 1 1 
        1   672 1 1 41 LEU HG   H  13.653  9.536   1.289 1.00 . A A . 41 LEU HG   1 1 
        1   673 1 1 41 LEU N    N  15.719  8.033   0.995 1.00 . A A . 41 LEU N    1 1 
        1   674 1 1 41 LEU O    O  17.442  9.052  -1.963 1.00 . A A . 41 LEU O    1 1 
        1   675 1 1 42 VAL C    C  20.125  7.393  -0.515 1.00 . A A . 42 VAL C    1 1 
        1   676 1 1 42 VAL CA   C  19.581  8.796  -0.224 1.00 . A A . 42 VAL CA   1 1 
        1   677 1 1 42 VAL CB   C  20.383  9.451   0.911 1.00 . A A . 42 VAL CB   1 1 
        1   678 1 1 42 VAL CG1  C  21.891  9.385   0.599 1.00 . A A . 42 VAL CG1  1 1 
        1   679 1 1 42 VAL CG2  C  19.949 10.921   1.052 1.00 . A A . 42 VAL CG2  1 1 
        1   680 1 1 42 VAL H    H  17.911  8.584   1.082 1.00 . A A . 42 VAL H    1 1 
        1   681 1 1 42 VAL HA   H  19.695  9.400  -1.119 1.00 . A A . 42 VAL HA   1 1 
        1   682 1 1 42 VAL HB   H  20.186  8.926   1.835 1.00 . A A . 42 VAL HB   1 1 
        1   683 1 1 42 VAL HG11 H  22.431 10.037   1.271 1.00 . A A . 42 VAL HG11 1 1 
        1   684 1 1 42 VAL HG12 H  22.066  9.694  -0.421 1.00 . A A . 42 VAL HG12 1 1 
        1   685 1 1 42 VAL HG13 H  22.240  8.368   0.728 1.00 . A A . 42 VAL HG13 1 1 
        1   686 1 1 42 VAL HG21 H  20.310 11.488   0.207 1.00 . A A . 42 VAL HG21 1 1 
        1   687 1 1 42 VAL HG22 H  20.360 11.332   1.962 1.00 . A A . 42 VAL HG22 1 1 
        1   688 1 1 42 VAL HG23 H  18.872 10.979   1.085 1.00 . A A . 42 VAL HG23 1 1 
        1   689 1 1 42 VAL N    N  18.159  8.733   0.146 1.00 . A A . 42 VAL N    1 1 
        1   690 1 1 42 VAL O    O  21.064  7.238  -1.296 1.00 . A A . 42 VAL O    1 1 
        1   691 1 1 43 GLN C    C  19.230  4.342  -1.225 1.00 . A A . 43 GLN C    1 1 
        1   692 1 1 43 GLN CA   C  19.991  4.999  -0.080 1.00 . A A . 43 GLN CA   1 1 
        1   693 1 1 43 GLN CB   C  19.780  4.199   1.207 1.00 . A A . 43 GLN CB   1 1 
        1   694 1 1 43 GLN CD   C  20.313  2.045   2.367 1.00 . A A . 43 GLN CD   1 1 
        1   695 1 1 43 GLN CG   C  20.358  2.791   1.039 1.00 . A A . 43 GLN CG   1 1 
        1   696 1 1 43 GLN H    H  18.795  6.568   0.731 1.00 . A A . 43 GLN H    1 1 
        1   697 1 1 43 GLN HA   H  21.048  4.993  -0.320 1.00 . A A . 43 GLN HA   1 1 
        1   698 1 1 43 GLN HB2  H  20.278  4.700   2.025 1.00 . A A . 43 GLN HB2  1 1 
        1   699 1 1 43 GLN HB3  H  18.723  4.130   1.419 1.00 . A A . 43 GLN HB3  1 1 
        1   700 1 1 43 GLN HE21 H  22.283  1.836   2.476 1.00 . A A . 43 GLN HE21 1 1 
        1   701 1 1 43 GLN HE22 H  21.410  1.171   3.771 1.00 . A A . 43 GLN HE22 1 1 
        1   702 1 1 43 GLN HG2  H  19.779  2.247   0.306 1.00 . A A . 43 GLN HG2  1 1 
        1   703 1 1 43 GLN HG3  H  21.383  2.859   0.707 1.00 . A A . 43 GLN HG3  1 1 
        1   704 1 1 43 GLN N    N  19.539  6.385   0.121 1.00 . A A . 43 GLN N    1 1 
        1   705 1 1 43 GLN NE2  N  21.428  1.651   2.917 1.00 . A A . 43 GLN NE2  1 1 
        1   706 1 1 43 GLN O    O  19.788  3.573  -2.008 1.00 . A A . 43 GLN O    1 1 
        1   707 1 1 43 GLN OE1  O  19.236  1.810   2.915 1.00 . A A . 43 GLN OE1  1 1 
        1   708 1 1 44 ASP C    C  17.803  4.091  -3.706 1.00 . A A . 44 ASP C    1 1 
        1   709 1 1 44 ASP CA   C  17.086  4.087  -2.360 1.00 . A A . 44 ASP CA   1 1 
        1   710 1 1 44 ASP CB   C  15.798  4.898  -2.479 1.00 . A A . 44 ASP CB   1 1 
        1   711 1 1 44 ASP CG   C  16.118  6.370  -2.687 1.00 . A A . 44 ASP CG   1 1 
        1   712 1 1 44 ASP H    H  17.549  5.269  -0.656 1.00 . A A . 44 ASP H    1 1 
        1   713 1 1 44 ASP HA   H  16.835  3.071  -2.100 1.00 . A A . 44 ASP HA   1 1 
        1   714 1 1 44 ASP HB2  H  15.231  4.539  -3.324 1.00 . A A . 44 ASP HB2  1 1 
        1   715 1 1 44 ASP HB3  H  15.218  4.784  -1.579 1.00 . A A . 44 ASP HB3  1 1 
        1   716 1 1 44 ASP N    N  17.940  4.650  -1.308 1.00 . A A . 44 ASP N    1 1 
        1   717 1 1 44 ASP O    O  18.008  3.039  -4.311 1.00 . A A . 44 ASP O    1 1 
        1   718 1 1 44 ASP OD1  O  17.243  6.756  -2.415 1.00 . A A . 44 ASP OD1  1 1 
        1   719 1 1 44 ASP OD2  O  15.240  7.091  -3.132 1.00 . A A . 44 ASP OD2  1 1 
        1   720 1 1 45 GLN C    C  19.476  6.818  -5.558 1.00 . A A . 45 GLN C    1 1 
        1   721 1 1 45 GLN CA   C  18.887  5.417  -5.427 1.00 . A A . 45 GLN CA   1 1 
        1   722 1 1 45 GLN CB   C  17.913  5.149  -6.578 1.00 . A A . 45 GLN CB   1 1 
        1   723 1 1 45 GLN CD   C  15.647  5.781  -7.484 1.00 . A A . 45 GLN CD   1 1 
        1   724 1 1 45 GLN CG   C  16.819  6.240  -6.621 1.00 . A A . 45 GLN CG   1 1 
        1   725 1 1 45 GLN H    H  18.002  6.082  -3.638 1.00 . A A . 45 GLN H    1 1 
        1   726 1 1 45 GLN HA   H  19.689  4.694  -5.472 1.00 . A A . 45 GLN HA   1 1 
        1   727 1 1 45 GLN HB2  H  18.458  5.149  -7.512 1.00 . A A . 45 GLN HB2  1 1 
        1   728 1 1 45 GLN HB3  H  17.454  4.182  -6.432 1.00 . A A . 45 GLN HB3  1 1 
        1   729 1 1 45 GLN HE21 H  15.468  7.526  -8.413 1.00 . A A . 45 GLN HE21 1 1 
        1   730 1 1 45 GLN HE22 H  14.361  6.332  -8.893 1.00 . A A . 45 GLN HE22 1 1 
        1   731 1 1 45 GLN HG2  H  16.468  6.447  -5.621 1.00 . A A . 45 GLN HG2  1 1 
        1   732 1 1 45 GLN HG3  H  17.228  7.148  -7.047 1.00 . A A . 45 GLN HG3  1 1 
        1   733 1 1 45 GLN N    N  18.194  5.277  -4.163 1.00 . A A . 45 GLN N    1 1 
        1   734 1 1 45 GLN NE2  N  15.114  6.616  -8.334 1.00 . A A . 45 GLN NE2  1 1 
        1   735 1 1 45 GLN O    O  18.773  7.824  -5.462 1.00 . A A . 45 GLN O    1 1 
        1   736 1 1 45 GLN OE1  O  15.204  4.637  -7.381 1.00 . A A . 45 GLN OE1  1 1 
        1   737 1 1 46 LEU C    C  21.591  8.509  -7.421 1.00 . A A . 46 LEU C    1 1 
        1   738 1 1 46 LEU CA   C  21.482  8.146  -5.948 1.00 . A A . 46 LEU CA   1 1 
        1   739 1 1 46 LEU CB   C  22.889  8.056  -5.342 1.00 . A A . 46 LEU CB   1 1 
        1   740 1 1 46 LEU CD1  C  22.997  6.097  -3.708 1.00 . A A . 46 LEU CD1  1 1 
        1   741 1 1 46 LEU CD2  C  23.895  8.327  -3.022 1.00 . A A . 46 LEU CD2  1 1 
        1   742 1 1 46 LEU CG   C  22.808  7.619  -3.847 1.00 . A A . 46 LEU CG   1 1 
        1   743 1 1 46 LEU H    H  21.295  6.035  -5.854 1.00 . A A . 46 LEU H    1 1 
        1   744 1 1 46 LEU HA   H  20.935  8.930  -5.436 1.00 . A A . 46 LEU HA   1 1 
        1   745 1 1 46 LEU HB2  H  23.475  7.345  -5.913 1.00 . A A . 46 LEU HB2  1 1 
        1   746 1 1 46 LEU HB3  H  23.353  9.031  -5.417 1.00 . A A . 46 LEU HB3  1 1 
        1   747 1 1 46 LEU HD11 H  22.282  5.581  -4.331 1.00 . A A . 46 LEU HD11 1 1 
        1   748 1 1 46 LEU HD12 H  22.846  5.812  -2.679 1.00 . A A . 46 LEU HD12 1 1 
        1   749 1 1 46 LEU HD13 H  24.000  5.828  -4.011 1.00 . A A . 46 LEU HD13 1 1 
        1   750 1 1 46 LEU HD21 H  23.886  7.945  -2.011 1.00 . A A . 46 LEU HD21 1 1 
        1   751 1 1 46 LEU HD22 H  23.699  9.390  -3.006 1.00 . A A . 46 LEU HD22 1 1 
        1   752 1 1 46 LEU HD23 H  24.863  8.148  -3.467 1.00 . A A . 46 LEU HD23 1 1 
        1   753 1 1 46 LEU HG   H  21.840  7.885  -3.443 1.00 . A A . 46 LEU HG   1 1 
        1   754 1 1 46 LEU N    N  20.784  6.870  -5.788 1.00 . A A . 46 LEU N    1 1 
        1   755 1 1 46 LEU O    O  22.677  8.813  -7.916 1.00 . A A . 46 LEU O    1 1 
        1   756 1 1 47 THR C    C  20.940 10.220  -9.759 1.00 . A A . 47 THR C    1 1 
        1   757 1 1 47 THR CA   C  20.447  8.802  -9.534 1.00 . A A . 47 THR CA   1 1 
        1   758 1 1 47 THR CB   C  19.031  8.646 -10.089 1.00 . A A . 47 THR CB   1 1 
        1   759 1 1 47 THR CG2  C  18.048  9.430  -9.221 1.00 . A A . 47 THR CG2  1 1 
        1   760 1 1 47 THR H    H  19.624  8.231  -7.671 1.00 . A A . 47 THR H    1 1 
        1   761 1 1 47 THR HA   H  21.100  8.124 -10.050 1.00 . A A . 47 THR HA   1 1 
        1   762 1 1 47 THR HB   H  18.754  7.603 -10.084 1.00 . A A . 47 THR HB   1 1 
        1   763 1 1 47 THR HG1  H  19.226  8.424 -12.010 1.00 . A A . 47 THR HG1  1 1 
        1   764 1 1 47 THR HG21 H  18.066  9.047  -8.214 1.00 . A A . 47 THR HG21 1 1 
        1   765 1 1 47 THR HG22 H  17.055  9.322  -9.628 1.00 . A A . 47 THR HG22 1 1 
        1   766 1 1 47 THR HG23 H  18.325 10.471  -9.214 1.00 . A A . 47 THR HG23 1 1 
        1   767 1 1 47 THR N    N  20.460  8.481  -8.118 1.00 . A A . 47 THR N    1 1 
        1   768 1 1 47 THR O    O  21.533 10.533 -10.791 1.00 . A A . 47 THR O    1 1 
        1   769 1 1 47 THR OG1  O  18.989  9.143 -11.419 1.00 . A A . 47 THR OG1  1 1 
        1   770 1 1 48 LYS C    C  20.913 13.186  -7.552 1.00 . A A . 48 LYS C    1 1 
        1   771 1 1 48 LYS CA   C  21.102 12.473  -8.882 1.00 . A A . 48 LYS CA   1 1 
        1   772 1 1 48 LYS CB   C  20.282 13.189  -9.963 1.00 . A A . 48 LYS CB   1 1 
        1   773 1 1 48 LYS CD   C  21.968 14.435 -11.385 1.00 . A A . 48 LYS CD   1 1 
        1   774 1 1 48 LYS CE   C  22.699 15.764 -11.557 1.00 . A A . 48 LYS CE   1 1 
        1   775 1 1 48 LYS CG   C  20.896 14.572 -10.290 1.00 . A A . 48 LYS CG   1 1 
        1   776 1 1 48 LYS H    H  20.202 10.782  -7.985 1.00 . A A . 48 LYS H    1 1 
        1   777 1 1 48 LYS HA   H  22.145 12.508  -9.148 1.00 . A A . 48 LYS HA   1 1 
        1   778 1 1 48 LYS HB2  H  20.251 12.576 -10.849 1.00 . A A . 48 LYS HB2  1 1 
        1   779 1 1 48 LYS HB3  H  19.278 13.326  -9.603 1.00 . A A . 48 LYS HB3  1 1 
        1   780 1 1 48 LYS HD2  H  22.674 13.667 -11.114 1.00 . A A . 48 LYS HD2  1 1 
        1   781 1 1 48 LYS HD3  H  21.490 14.168 -12.315 1.00 . A A . 48 LYS HD3  1 1 
        1   782 1 1 48 LYS HE2  H  23.125 16.066 -10.609 1.00 . A A . 48 LYS HE2  1 1 
        1   783 1 1 48 LYS HE3  H  23.485 15.649 -12.287 1.00 . A A . 48 LYS HE3  1 1 
        1   784 1 1 48 LYS HG2  H  20.116 15.233 -10.640 1.00 . A A . 48 LYS HG2  1 1 
        1   785 1 1 48 LYS HG3  H  21.342 14.998  -9.402 1.00 . A A . 48 LYS HG3  1 1 
        1   786 1 1 48 LYS HZ1  H  20.901 16.798 -11.400 1.00 . A A . 48 LYS HZ1  1 1 
        1   787 1 1 48 LYS HZ2  H  21.435 16.578 -12.993 1.00 . A A . 48 LYS HZ2  1 1 
        1   788 1 1 48 LYS HZ3  H  22.187 17.733 -11.999 1.00 . A A . 48 LYS HZ3  1 1 
        1   789 1 1 48 LYS N    N  20.679 11.086  -8.786 1.00 . A A . 48 LYS N    1 1 
        1   790 1 1 48 LYS NZ   N  21.733 16.796 -12.022 1.00 . A A . 48 LYS NZ   1 1 
        1   791 1 1 48 LYS O    O  19.828 13.153  -6.970 1.00 . A A . 48 LYS O    1 1 
        1   792 1 1 49 ASN C    C  20.680 15.475  -5.803 1.00 . A A . 49 ASN C    1 1 
        1   793 1 1 49 ASN CA   C  21.904 14.567  -5.819 1.00 . A A . 49 ASN CA   1 1 
        1   794 1 1 49 ASN CB   C  23.174 15.411  -5.632 1.00 . A A . 49 ASN CB   1 1 
        1   795 1 1 49 ASN CG   C  23.530 16.109  -6.939 1.00 . A A . 49 ASN CG   1 1 
        1   796 1 1 49 ASN H    H  22.808 13.827  -7.583 1.00 . A A . 49 ASN H    1 1 
        1   797 1 1 49 ASN HA   H  21.829 13.865  -5.004 1.00 . A A . 49 ASN HA   1 1 
        1   798 1 1 49 ASN HB2  H  23.014 16.155  -4.860 1.00 . A A . 49 ASN HB2  1 1 
        1   799 1 1 49 ASN HB3  H  23.992 14.769  -5.340 1.00 . A A . 49 ASN HB3  1 1 
        1   800 1 1 49 ASN HD21 H  25.462 16.230  -6.505 1.00 . A A . 49 ASN HD21 1 1 
        1   801 1 1 49 ASN HD22 H  25.013 16.880  -8.007 1.00 . A A . 49 ASN HD22 1 1 
        1   802 1 1 49 ASN N    N  21.970 13.835  -7.076 1.00 . A A . 49 ASN N    1 1 
        1   803 1 1 49 ASN ND2  N  24.771 16.435  -7.170 1.00 . A A . 49 ASN ND2  1 1 
        1   804 1 1 49 ASN O    O  20.084 15.691  -4.748 1.00 . A A . 49 ASN O    1 1 
        1   805 1 1 49 ASN OD1  O  22.660 16.355  -7.776 1.00 . A A . 49 ASN OD1  1 1 
        1   806 1 1 50 ALA C    C  17.840 16.084  -6.863 1.00 . A A . 50 ALA C    1 1 
        1   807 1 1 50 ALA CA   C  19.139 16.882  -7.043 1.00 . A A . 50 ALA CA   1 1 
        1   808 1 1 50 ALA CB   C  19.109 17.598  -8.399 1.00 . A A . 50 ALA CB   1 1 
        1   809 1 1 50 ALA H    H  20.819 15.791  -7.775 1.00 . A A . 50 ALA H    1 1 
        1   810 1 1 50 ALA HA   H  19.206 17.630  -6.264 1.00 . A A . 50 ALA HA   1 1 
        1   811 1 1 50 ALA HB1  H  18.268 18.274  -8.429 1.00 . A A . 50 ALA HB1  1 1 
        1   812 1 1 50 ALA HB2  H  19.012 16.867  -9.187 1.00 . A A . 50 ALA HB2  1 1 
        1   813 1 1 50 ALA HB3  H  20.023 18.155  -8.535 1.00 . A A . 50 ALA HB3  1 1 
        1   814 1 1 50 ALA N    N  20.307 15.999  -6.966 1.00 . A A . 50 ALA N    1 1 
        1   815 1 1 50 ALA O    O  16.977 16.450  -6.066 1.00 . A A . 50 ALA O    1 1 
        1   816 1 1 51 VAL C    C  16.141 13.881  -6.071 1.00 . A A . 51 VAL C    1 1 
        1   817 1 1 51 VAL CA   C  16.503 14.149  -7.529 1.00 . A A . 51 VAL CA   1 1 
        1   818 1 1 51 VAL CB   C  16.746 12.804  -8.260 1.00 . A A . 51 VAL CB   1 1 
        1   819 1 1 51 VAL CG1  C  15.755 11.712  -7.772 1.00 . A A . 51 VAL CG1  1 1 
        1   820 1 1 51 VAL CG2  C  16.595 13.003  -9.786 1.00 . A A . 51 VAL CG2  1 1 
        1   821 1 1 51 VAL H    H  18.438 14.749  -8.230 1.00 . A A . 51 VAL H    1 1 
        1   822 1 1 51 VAL HA   H  15.680 14.670  -7.998 1.00 . A A . 51 VAL HA   1 1 
        1   823 1 1 51 VAL HB   H  17.753 12.476  -8.041 1.00 . A A . 51 VAL HB   1 1 
        1   824 1 1 51 VAL HG11 H  14.764 12.135  -7.682 1.00 . A A . 51 VAL HG11 1 1 
        1   825 1 1 51 VAL HG12 H  16.074 11.339  -6.807 1.00 . A A . 51 VAL HG12 1 1 
        1   826 1 1 51 VAL HG13 H  15.736 10.894  -8.472 1.00 . A A . 51 VAL HG13 1 1 
        1   827 1 1 51 VAL HG21 H  15.546 13.038 -10.045 1.00 . A A . 51 VAL HG21 1 1 
        1   828 1 1 51 VAL HG22 H  17.063 12.179 -10.303 1.00 . A A . 51 VAL HG22 1 1 
        1   829 1 1 51 VAL HG23 H  17.063 13.930 -10.084 1.00 . A A . 51 VAL HG23 1 1 
        1   830 1 1 51 VAL N    N  17.718 14.993  -7.612 1.00 . A A . 51 VAL N    1 1 
        1   831 1 1 51 VAL O    O  14.961 13.878  -5.716 1.00 . A A . 51 VAL O    1 1 
        1   832 1 1 52 VAL C    C  16.751 14.759  -3.053 1.00 . A A . 52 VAL C    1 1 
        1   833 1 1 52 VAL CA   C  16.915 13.436  -3.809 1.00 . A A . 52 VAL CA   1 1 
        1   834 1 1 52 VAL CB   C  18.061 12.612  -3.216 1.00 . A A . 52 VAL CB   1 1 
        1   835 1 1 52 VAL CG1  C  18.073 11.229  -3.866 1.00 . A A . 52 VAL CG1  1 1 
        1   836 1 1 52 VAL CG2  C  19.397 13.297  -3.485 1.00 . A A . 52 VAL CG2  1 1 
        1   837 1 1 52 VAL H    H  18.069 13.683  -5.571 1.00 . A A . 52 VAL H    1 1 
        1   838 1 1 52 VAL HA   H  15.998 12.869  -3.695 1.00 . A A . 52 VAL HA   1 1 
        1   839 1 1 52 VAL HB   H  17.912 12.508  -2.151 1.00 . A A . 52 VAL HB   1 1 
        1   840 1 1 52 VAL HG11 H  18.897 10.653  -3.473 1.00 . A A . 52 VAL HG11 1 1 
        1   841 1 1 52 VAL HG12 H  18.185 11.338  -4.935 1.00 . A A . 52 VAL HG12 1 1 
        1   842 1 1 52 VAL HG13 H  17.143 10.725  -3.652 1.00 . A A . 52 VAL HG13 1 1 
        1   843 1 1 52 VAL HG21 H  20.198 12.694  -3.085 1.00 . A A . 52 VAL HG21 1 1 
        1   844 1 1 52 VAL HG22 H  19.405 14.266  -3.012 1.00 . A A . 52 VAL HG22 1 1 
        1   845 1 1 52 VAL HG23 H  19.535 13.406  -4.548 1.00 . A A . 52 VAL HG23 1 1 
        1   846 1 1 52 VAL N    N  17.149 13.669  -5.232 1.00 . A A . 52 VAL N    1 1 
        1   847 1 1 52 VAL O    O  16.003 14.850  -2.078 1.00 . A A . 52 VAL O    1 1 
        1   848 1 1 53 LEU C    C  16.047 17.691  -2.899 1.00 . A A . 53 LEU C    1 1 
        1   849 1 1 53 LEU CA   C  17.446 17.078  -2.823 1.00 . A A . 53 LEU CA   1 1 
        1   850 1 1 53 LEU CB   C  18.479 18.045  -3.463 1.00 . A A . 53 LEU CB   1 1 
        1   851 1 1 53 LEU CD1  C  17.943 19.752  -1.692 1.00 . A A . 53 LEU CD1  1 1 
        1   852 1 1 53 LEU CD2  C  19.949 18.204  -1.384 1.00 . A A . 53 LEU CD2  1 1 
        1   853 1 1 53 LEU CG   C  19.076 19.000  -2.412 1.00 . A A . 53 LEU CG   1 1 
        1   854 1 1 53 LEU H    H  18.065 15.642  -4.278 1.00 . A A . 53 LEU H    1 1 
        1   855 1 1 53 LEU HA   H  17.694 16.921  -1.788 1.00 . A A . 53 LEU HA   1 1 
        1   856 1 1 53 LEU HB2  H  19.268 17.481  -3.897 1.00 . A A . 53 LEU HB2  1 1 
        1   857 1 1 53 LEU HB3  H  18.009 18.630  -4.241 1.00 . A A . 53 LEU HB3  1 1 
        1   858 1 1 53 LEU HD11 H  17.503 19.105  -0.949 1.00 . A A . 53 LEU HD11 1 1 
        1   859 1 1 53 LEU HD12 H  17.190 20.056  -2.404 1.00 . A A . 53 LEU HD12 1 1 
        1   860 1 1 53 LEU HD13 H  18.346 20.628  -1.209 1.00 . A A . 53 LEU HD13 1 1 
        1   861 1 1 53 LEU HD21 H  20.830 18.782  -1.151 1.00 . A A . 53 LEU HD21 1 1 
        1   862 1 1 53 LEU HD22 H  20.252 17.251  -1.795 1.00 . A A . 53 LEU HD22 1 1 
        1   863 1 1 53 LEU HD23 H  19.393 18.026  -0.472 1.00 . A A . 53 LEU HD23 1 1 
        1   864 1 1 53 LEU HG   H  19.701 19.722  -2.917 1.00 . A A . 53 LEU HG   1 1 
        1   865 1 1 53 LEU N    N  17.487 15.772  -3.497 1.00 . A A . 53 LEU N    1 1 
        1   866 1 1 53 LEU O    O  15.506 18.175  -1.905 1.00 . A A . 53 LEU O    1 1 
        1   867 1 1 54 LYS C    C  13.128 17.465  -3.429 1.00 . A A . 54 LYS C    1 1 
        1   868 1 1 54 LYS CA   C  14.139 18.208  -4.295 1.00 . A A . 54 LYS CA   1 1 
        1   869 1 1 54 LYS CB   C  13.749 18.101  -5.784 1.00 . A A . 54 LYS CB   1 1 
        1   870 1 1 54 LYS CD   C  12.879 15.993  -6.984 1.00 . A A . 54 LYS CD   1 1 
        1   871 1 1 54 LYS CE   C  12.580 16.651  -8.327 1.00 . A A . 54 LYS CE   1 1 
        1   872 1 1 54 LYS CG   C  14.101 16.680  -6.337 1.00 . A A . 54 LYS CG   1 1 
        1   873 1 1 54 LYS H    H  15.946 17.257  -4.850 1.00 . A A . 54 LYS H    1 1 
        1   874 1 1 54 LYS HA   H  14.145 19.248  -4.007 1.00 . A A . 54 LYS HA   1 1 
        1   875 1 1 54 LYS HB2  H  12.691 18.306  -5.889 1.00 . A A . 54 LYS HB2  1 1 
        1   876 1 1 54 LYS HB3  H  14.303 18.847  -6.342 1.00 . A A . 54 LYS HB3  1 1 
        1   877 1 1 54 LYS HD2  H  13.104 14.946  -7.145 1.00 . A A . 54 LYS HD2  1 1 
        1   878 1 1 54 LYS HD3  H  12.019 16.076  -6.337 1.00 . A A . 54 LYS HD3  1 1 
        1   879 1 1 54 LYS HE2  H  11.686 16.221  -8.751 1.00 . A A . 54 LYS HE2  1 1 
        1   880 1 1 54 LYS HE3  H  12.440 17.711  -8.185 1.00 . A A . 54 LYS HE3  1 1 
        1   881 1 1 54 LYS HG2  H  14.884 16.763  -7.079 1.00 . A A . 54 LYS HG2  1 1 
        1   882 1 1 54 LYS HG3  H  14.458 16.059  -5.540 1.00 . A A . 54 LYS HG3  1 1 
        1   883 1 1 54 LYS HZ1  H  14.118 15.466  -9.078 1.00 . A A . 54 LYS HZ1  1 1 
        1   884 1 1 54 LYS HZ2  H  14.477 17.123  -9.038 1.00 . A A . 54 LYS HZ2  1 1 
        1   885 1 1 54 LYS HZ3  H  13.426 16.512 -10.225 1.00 . A A . 54 LYS HZ3  1 1 
        1   886 1 1 54 LYS N    N  15.467 17.655  -4.094 1.00 . A A . 54 LYS N    1 1 
        1   887 1 1 54 LYS NZ   N  13.737 16.421  -9.237 1.00 . A A . 54 LYS NZ   1 1 
        1   888 1 1 54 LYS O    O  12.234 18.079  -2.846 1.00 . A A . 54 LYS O    1 1 
        1   889 1 1 55 ARG C    C  12.528 15.669  -1.063 1.00 . A A . 55 ARG C    1 1 
        1   890 1 1 55 ARG CA   C  12.371 15.333  -2.544 1.00 . A A . 55 ARG CA   1 1 
        1   891 1 1 55 ARG CB   C  12.657 13.841  -2.775 1.00 . A A . 55 ARG CB   1 1 
        1   892 1 1 55 ARG CD   C  12.534 11.960  -4.437 1.00 . A A . 55 ARG CD   1 1 
        1   893 1 1 55 ARG CG   C  12.225 13.441  -4.190 1.00 . A A . 55 ARG CG   1 1 
        1   894 1 1 55 ARG CZ   C  11.672  9.800  -3.730 1.00 . A A . 55 ARG CZ   1 1 
        1   895 1 1 55 ARG H    H  14.006 15.711  -3.831 1.00 . A A . 55 ARG H    1 1 
        1   896 1 1 55 ARG HA   H  11.355 15.543  -2.842 1.00 . A A . 55 ARG HA   1 1 
        1   897 1 1 55 ARG HB2  H  13.717 13.659  -2.656 1.00 . A A . 55 ARG HB2  1 1 
        1   898 1 1 55 ARG HB3  H  12.108 13.252  -2.057 1.00 . A A . 55 ARG HB3  1 1 
        1   899 1 1 55 ARG HD2  H  12.377 11.728  -5.478 1.00 . A A . 55 ARG HD2  1 1 
        1   900 1 1 55 ARG HD3  H  13.566 11.761  -4.179 1.00 . A A . 55 ARG HD3  1 1 
        1   901 1 1 55 ARG HE   H  11.054 11.549  -2.978 1.00 . A A . 55 ARG HE   1 1 
        1   902 1 1 55 ARG HG2  H  11.162 13.605  -4.295 1.00 . A A . 55 ARG HG2  1 1 
        1   903 1 1 55 ARG HG3  H  12.748 14.043  -4.911 1.00 . A A . 55 ARG HG3  1 1 
        1   904 1 1 55 ARG HH11 H  13.086  9.775  -5.146 1.00 . A A . 55 ARG HH11 1 1 
        1   905 1 1 55 ARG HH12 H  12.489  8.224  -4.656 1.00 . A A . 55 ARG HH12 1 1 
        1   906 1 1 55 ARG HH21 H  10.258  9.521  -2.339 1.00 . A A . 55 ARG HH21 1 1 
        1   907 1 1 55 ARG HH22 H  10.888  8.080  -3.067 1.00 . A A . 55 ARG HH22 1 1 
        1   908 1 1 55 ARG N    N  13.275 16.147  -3.345 1.00 . A A . 55 ARG N    1 1 
        1   909 1 1 55 ARG NE   N  11.661 11.124  -3.621 1.00 . A A . 55 ARG NE   1 1 
        1   910 1 1 55 ARG NH1  N  12.477  9.222  -4.578 1.00 . A A . 55 ARG NH1  1 1 
        1   911 1 1 55 ARG NH2  N  10.876  9.078  -2.989 1.00 . A A . 55 ARG NH2  1 1 
        1   912 1 1 55 ARG O    O  11.543 15.734  -0.327 1.00 . A A . 55 ARG O    1 1 
        1   913 1 1 56 ILE C    C  13.445 17.582   1.098 1.00 . A A . 56 ILE C    1 1 
        1   914 1 1 56 ILE CA   C  14.033 16.218   0.758 1.00 . A A . 56 ILE CA   1 1 
        1   915 1 1 56 ILE CB   C  15.553 16.221   1.012 1.00 . A A . 56 ILE CB   1 1 
        1   916 1 1 56 ILE CD1  C  17.612 14.815   0.853 1.00 . A A . 56 ILE CD1  1 1 
        1   917 1 1 56 ILE CG1  C  16.091 14.780   0.927 1.00 . A A . 56 ILE CG1  1 1 
        1   918 1 1 56 ILE CG2  C  15.876 16.815   2.401 1.00 . A A . 56 ILE CG2  1 1 
        1   919 1 1 56 ILE H    H  14.513 15.818  -1.267 1.00 . A A . 56 ILE H    1 1 
        1   920 1 1 56 ILE HA   H  13.573 15.473   1.391 1.00 . A A . 56 ILE HA   1 1 
        1   921 1 1 56 ILE HB   H  16.026 16.827   0.251 1.00 . A A . 56 ILE HB   1 1 
        1   922 1 1 56 ILE HD11 H  17.995 13.811   0.804 1.00 . A A . 56 ILE HD11 1 1 
        1   923 1 1 56 ILE HD12 H  17.995 15.310   1.730 1.00 . A A . 56 ILE HD12 1 1 
        1   924 1 1 56 ILE HD13 H  17.909 15.362  -0.027 1.00 . A A . 56 ILE HD13 1 1 
        1   925 1 1 56 ILE HG12 H  15.786 14.227   1.802 1.00 . A A . 56 ILE HG12 1 1 
        1   926 1 1 56 ILE HG13 H  15.704 14.296   0.051 1.00 . A A . 56 ILE HG13 1 1 
        1   927 1 1 56 ILE HG21 H  15.204 16.399   3.139 1.00 . A A . 56 ILE HG21 1 1 
        1   928 1 1 56 ILE HG22 H  15.753 17.888   2.370 1.00 . A A . 56 ILE HG22 1 1 
        1   929 1 1 56 ILE HG23 H  16.895 16.586   2.672 1.00 . A A . 56 ILE HG23 1 1 
        1   930 1 1 56 ILE N    N  13.767 15.883  -0.636 1.00 . A A . 56 ILE N    1 1 
        1   931 1 1 56 ILE O    O  12.795 17.742   2.131 1.00 . A A . 56 ILE O    1 1 
        1   932 1 1 57 GLN C    C  11.662 19.875   0.582 1.00 . A A . 57 GLN C    1 1 
        1   933 1 1 57 GLN CA   C  13.167 19.907   0.449 1.00 . A A . 57 GLN CA   1 1 
        1   934 1 1 57 GLN CB   C  13.567 20.824  -0.722 1.00 . A A . 57 GLN CB   1 1 
        1   935 1 1 57 GLN CD   C  15.329 22.126   0.507 1.00 . A A . 57 GLN CD   1 1 
        1   936 1 1 57 GLN CG   C  15.063 21.150  -0.638 1.00 . A A . 57 GLN CG   1 1 
        1   937 1 1 57 GLN H    H  14.198 18.376  -0.579 1.00 . A A . 57 GLN H    1 1 
        1   938 1 1 57 GLN HA   H  13.587 20.296   1.364 1.00 . A A . 57 GLN HA   1 1 
        1   939 1 1 57 GLN HB2  H  13.363 20.319  -1.657 1.00 . A A . 57 GLN HB2  1 1 
        1   940 1 1 57 GLN HB3  H  12.998 21.743  -0.682 1.00 . A A . 57 GLN HB3  1 1 
        1   941 1 1 57 GLN HE21 H  14.913 23.735  -0.580 1.00 . A A . 57 GLN HE21 1 1 
        1   942 1 1 57 GLN HE22 H  15.359 24.041   1.029 1.00 . A A . 57 GLN HE22 1 1 
        1   943 1 1 57 GLN HG2  H  15.609 20.244  -0.462 1.00 . A A . 57 GLN HG2  1 1 
        1   944 1 1 57 GLN HG3  H  15.390 21.592  -1.567 1.00 . A A . 57 GLN HG3  1 1 
        1   945 1 1 57 GLN N    N  13.675 18.561   0.229 1.00 . A A . 57 GLN N    1 1 
        1   946 1 1 57 GLN NE2  N  15.189 23.407   0.302 1.00 . A A . 57 GLN NE2  1 1 
        1   947 1 1 57 GLN O    O  11.088 20.646   1.352 1.00 . A A . 57 GLN O    1 1 
        1   948 1 1 57 GLN OE1  O  15.667 21.711   1.616 1.00 . A A . 57 GLN OE1  1 1 
        1   949 1 1 58 HIS C    C   9.146 18.284   1.220 1.00 . A A . 58 HIS C    1 1 
        1   950 1 1 58 HIS CA   C   9.576 18.865  -0.116 1.00 . A A . 58 HIS CA   1 1 
        1   951 1 1 58 HIS CB   C   9.086 17.961  -1.248 1.00 . A A . 58 HIS CB   1 1 
        1   952 1 1 58 HIS CD2  C  10.043 19.770  -2.895 1.00 . A A . 58 HIS CD2  1 1 
        1   953 1 1 58 HIS CE1  C   9.807 18.668  -4.746 1.00 . A A . 58 HIS CE1  1 1 
        1   954 1 1 58 HIS CG   C   9.488 18.557  -2.568 1.00 . A A . 58 HIS CG   1 1 
        1   955 1 1 58 HIS H    H  11.530 18.396  -0.758 1.00 . A A . 58 HIS H    1 1 
        1   956 1 1 58 HIS HA   H   9.134 19.843  -0.233 1.00 . A A . 58 HIS HA   1 1 
        1   957 1 1 58 HIS HB2  H   9.525 16.980  -1.143 1.00 . A A . 58 HIS HB2  1 1 
        1   958 1 1 58 HIS HB3  H   8.011 17.883  -1.202 1.00 . A A . 58 HIS HB3  1 1 
        1   959 1 1 58 HIS HD1  H   8.980 16.969  -3.875 1.00 . A A . 58 HIS HD1  1 1 
        1   960 1 1 58 HIS HD2  H  10.292 20.552  -2.193 1.00 . A A . 58 HIS HD2  1 1 
        1   961 1 1 58 HIS HE1  H   9.823 18.395  -5.790 1.00 . A A . 58 HIS HE1  1 1 
        1   962 1 1 58 HIS HE2  H  10.624 20.583  -4.781 1.00 . A A . 58 HIS HE2  1 1 
        1   963 1 1 58 HIS N    N  11.020 18.983  -0.164 1.00 . A A . 58 HIS N    1 1 
        1   964 1 1 58 HIS ND1  N   9.347 17.871  -3.765 1.00 . A A . 58 HIS ND1  1 1 
        1   965 1 1 58 HIS NE2  N  10.244 19.838  -4.271 1.00 . A A . 58 HIS NE2  1 1 
        1   966 1 1 58 HIS O    O   8.170 18.739   1.814 1.00 . A A . 58 HIS O    1 1 
        1   967 1 1 59 LEU C    C   9.452 17.678   4.075 1.00 . A A . 59 LEU C    1 1 
        1   968 1 1 59 LEU CA   C   9.537 16.636   2.958 1.00 . A A . 59 LEU CA   1 1 
        1   969 1 1 59 LEU CB   C  10.593 15.585   3.323 1.00 . A A . 59 LEU CB   1 1 
        1   970 1 1 59 LEU CD1  C   8.885 13.921   4.257 1.00 . A A . 59 LEU CD1  1 1 
        1   971 1 1 59 LEU CD2  C  11.306 13.870   5.004 1.00 . A A . 59 LEU CD2  1 1 
        1   972 1 1 59 LEU CG   C  10.147 14.773   4.563 1.00 . A A . 59 LEU CG   1 1 
        1   973 1 1 59 LEU H    H  10.642 16.954   1.170 1.00 . A A . 59 LEU H    1 1 
        1   974 1 1 59 LEU HA   H   8.579 16.155   2.854 1.00 . A A . 59 LEU HA   1 1 
        1   975 1 1 59 LEU HB2  H  10.739 14.918   2.485 1.00 . A A . 59 LEU HB2  1 1 
        1   976 1 1 59 LEU HB3  H  11.525 16.084   3.544 1.00 . A A . 59 LEU HB3  1 1 
        1   977 1 1 59 LEU HD11 H   8.000 14.515   4.431 1.00 . A A . 59 LEU HD11 1 1 
        1   978 1 1 59 LEU HD12 H   8.856 13.058   4.906 1.00 . A A . 59 LEU HD12 1 1 
        1   979 1 1 59 LEU HD13 H   8.897 13.592   3.228 1.00 . A A . 59 LEU HD13 1 1 
        1   980 1 1 59 LEU HD21 H  10.976 13.225   5.806 1.00 . A A . 59 LEU HD21 1 1 
        1   981 1 1 59 LEU HD22 H  12.124 14.485   5.351 1.00 . A A . 59 LEU HD22 1 1 
        1   982 1 1 59 LEU HD23 H  11.634 13.272   4.171 1.00 . A A . 59 LEU HD23 1 1 
        1   983 1 1 59 LEU HG   H   9.913 15.453   5.367 1.00 . A A . 59 LEU HG   1 1 
        1   984 1 1 59 LEU N    N   9.873 17.273   1.687 1.00 . A A . 59 LEU N    1 1 
        1   985 1 1 59 LEU O    O   8.706 17.509   5.039 1.00 . A A . 59 LEU O    1 1 
        1   986 1 1 60 ASP C    C   8.797 20.285   5.224 1.00 . A A . 60 ASP C    1 1 
        1   987 1 1 60 ASP CA   C  10.224 19.808   4.946 1.00 . A A . 60 ASP CA   1 1 
        1   988 1 1 60 ASP CB   C  11.084 20.984   4.468 1.00 . A A . 60 ASP CB   1 1 
        1   989 1 1 60 ASP CG   C  11.288 21.985   5.602 1.00 . A A . 60 ASP CG   1 1 
        1   990 1 1 60 ASP H    H  10.798 18.833   3.147 1.00 . A A . 60 ASP H    1 1 
        1   991 1 1 60 ASP HA   H  10.646 19.415   5.859 1.00 . A A . 60 ASP HA   1 1 
        1   992 1 1 60 ASP HB2  H  12.045 20.613   4.142 1.00 . A A . 60 ASP HB2  1 1 
        1   993 1 1 60 ASP HB3  H  10.594 21.476   3.642 1.00 . A A . 60 ASP HB3  1 1 
        1   994 1 1 60 ASP N    N  10.224 18.751   3.936 1.00 . A A . 60 ASP N    1 1 
        1   995 1 1 60 ASP O    O   8.482 20.725   6.330 1.00 . A A . 60 ASP O    1 1 
        1   996 1 1 60 ASP OD1  O  11.870 21.607   6.605 1.00 . A A . 60 ASP OD1  1 1 
        1   997 1 1 60 ASP OD2  O  10.854 23.114   5.450 1.00 . A A . 60 ASP OD2  1 1 
        1   998 1 1 61 GLU C    C   5.828 19.754   5.380 1.00 . A A . 61 GLU C    1 1 
        1   999 1 1 61 GLU CA   C   6.551 20.620   4.350 1.00 . A A . 61 GLU CA   1 1 
        1  1000 1 1 61 GLU CB   C   5.835 20.525   2.984 1.00 . A A . 61 GLU CB   1 1 
        1  1001 1 1 61 GLU CD   C   5.120 18.892   1.189 1.00 . A A . 61 GLU CD   1 1 
        1  1002 1 1 61 GLU CG   C   5.398 19.068   2.681 1.00 . A A . 61 GLU CG   1 1 
        1  1003 1 1 61 GLU H    H   8.250 19.838   3.350 1.00 . A A . 61 GLU H    1 1 
        1  1004 1 1 61 GLU HA   H   6.532 21.647   4.686 1.00 . A A . 61 GLU HA   1 1 
        1  1005 1 1 61 GLU HB2  H   4.959 21.162   2.994 1.00 . A A . 61 GLU HB2  1 1 
        1  1006 1 1 61 GLU HB3  H   6.512 20.867   2.215 1.00 . A A . 61 GLU HB3  1 1 
        1  1007 1 1 61 GLU HG2  H   6.174 18.384   2.984 1.00 . A A . 61 GLU HG2  1 1 
        1  1008 1 1 61 GLU HG3  H   4.496 18.841   3.237 1.00 . A A . 61 GLU HG3  1 1 
        1  1009 1 1 61 GLU N    N   7.943 20.199   4.209 1.00 . A A . 61 GLU N    1 1 
        1  1010 1 1 61 GLU O    O   4.930 20.216   6.081 1.00 . A A . 61 GLU O    1 1 
        1  1011 1 1 61 GLU OE1  O   4.131 19.431   0.720 1.00 . A A . 61 GLU OE1  1 1 
        1  1012 1 1 61 GLU OE2  O   5.898 18.211   0.542 1.00 . A A . 61 GLU OE2  1 1 
        1  1013 1 1 62 ALA C    C   5.992 17.896   7.812 1.00 . A A . 62 ALA C    1 1 
        1  1014 1 1 62 ALA CA   C   5.607 17.559   6.384 1.00 . A A . 62 ALA CA   1 1 
        1  1015 1 1 62 ALA CB   C   6.047 16.133   6.058 1.00 . A A . 62 ALA CB   1 1 
        1  1016 1 1 62 ALA H    H   6.946 18.174   4.867 1.00 . A A . 62 ALA H    1 1 
        1  1017 1 1 62 ALA HA   H   4.539 17.629   6.289 1.00 . A A . 62 ALA HA   1 1 
        1  1018 1 1 62 ALA HB1  H   5.717 15.871   5.063 1.00 . A A . 62 ALA HB1  1 1 
        1  1019 1 1 62 ALA HB2  H   5.615 15.454   6.769 1.00 . A A . 62 ALA HB2  1 1 
        1  1020 1 1 62 ALA HB3  H   7.122 16.067   6.110 1.00 . A A . 62 ALA HB3  1 1 
        1  1021 1 1 62 ALA N    N   6.224 18.486   5.452 1.00 . A A . 62 ALA N    1 1 
        1  1022 1 1 62 ALA O    O   5.130 18.154   8.652 1.00 . A A . 62 ALA O    1 1 
        1  1023 1 1 63 TYR C    C   7.187 19.536   9.904 1.00 . A A . 63 TYR C    1 1 
        1  1024 1 1 63 TYR CA   C   7.787 18.211   9.416 1.00 . A A . 63 TYR CA   1 1 
        1  1025 1 1 63 TYR CB   C   9.345 18.293   9.394 1.00 . A A . 63 TYR CB   1 1 
        1  1026 1 1 63 TYR CD1  C   9.832 19.838  11.335 1.00 . A A . 63 TYR CD1  1 1 
        1  1027 1 1 63 TYR CD2  C  10.210 20.662   9.085 1.00 . A A . 63 TYR CD2  1 1 
        1  1028 1 1 63 TYR CE1  C  10.235 21.073  11.856 1.00 . A A . 63 TYR CE1  1 1 
        1  1029 1 1 63 TYR CE2  C  10.613 21.898   9.607 1.00 . A A . 63 TYR CE2  1 1 
        1  1030 1 1 63 TYR CG   C   9.820 19.632   9.950 1.00 . A A . 63 TYR CG   1 1 
        1  1031 1 1 63 TYR CZ   C  10.626 22.103  10.991 1.00 . A A . 63 TYR CZ   1 1 
        1  1032 1 1 63 TYR H    H   7.934 17.687   7.373 1.00 . A A . 63 TYR H    1 1 
        1  1033 1 1 63 TYR HA   H   7.485 17.418  10.080 1.00 . A A . 63 TYR HA   1 1 
        1  1034 1 1 63 TYR HB2  H   9.761 17.496   9.999 1.00 . A A . 63 TYR HB2  1 1 
        1  1035 1 1 63 TYR HB3  H   9.694 18.179   8.377 1.00 . A A . 63 TYR HB3  1 1 
        1  1036 1 1 63 TYR HD1  H   9.520 19.058  11.996 1.00 . A A . 63 TYR HD1  1 1 
        1  1037 1 1 63 TYR HD2  H  10.200 20.504   8.019 1.00 . A A . 63 TYR HD2  1 1 
        1  1038 1 1 63 TYR HE1  H  10.246 21.228  12.921 1.00 . A A . 63 TYR HE1  1 1 
        1  1039 1 1 63 TYR HE2  H  10.914 22.691   8.941 1.00 . A A . 63 TYR HE2  1 1 
        1  1040 1 1 63 TYR HH   H  10.740 23.342  12.434 1.00 . A A . 63 TYR HH   1 1 
        1  1041 1 1 63 TYR N    N   7.293 17.900   8.083 1.00 . A A . 63 TYR N    1 1 
        1  1042 1 1 63 TYR O    O   6.777 19.662  11.058 1.00 . A A . 63 TYR O    1 1 
        1  1043 1 1 63 TYR OH   O  11.004 23.319  11.510 1.00 . A A . 63 TYR OH   1 1 
        1  1044 1 1 64 ASN C    C   5.154 21.744   9.676 1.00 . A A . 64 ASN C    1 1 
        1  1045 1 1 64 ASN CA   C   6.630 21.834   9.350 1.00 . A A . 64 ASN CA   1 1 
        1  1046 1 1 64 ASN CB   C   6.854 22.803   8.186 1.00 . A A . 64 ASN CB   1 1 
        1  1047 1 1 64 ASN CG   C   6.381 24.199   8.573 1.00 . A A . 64 ASN CG   1 1 
        1  1048 1 1 64 ASN H    H   7.496 20.362   8.107 1.00 . A A . 64 ASN H    1 1 
        1  1049 1 1 64 ASN HA   H   7.155 22.205  10.217 1.00 . A A . 64 ASN HA   1 1 
        1  1050 1 1 64 ASN HB2  H   7.907 22.836   7.944 1.00 . A A . 64 ASN HB2  1 1 
        1  1051 1 1 64 ASN HB3  H   6.299 22.462   7.325 1.00 . A A . 64 ASN HB3  1 1 
        1  1052 1 1 64 ASN HD21 H   5.759 24.662   6.746 1.00 . A A . 64 ASN HD21 1 1 
        1  1053 1 1 64 ASN HD22 H   5.545 25.875   7.914 1.00 . A A . 64 ASN HD22 1 1 
        1  1054 1 1 64 ASN N    N   7.155 20.521   9.012 1.00 . A A . 64 ASN N    1 1 
        1  1055 1 1 64 ASN ND2  N   5.852 24.977   7.669 1.00 . A A . 64 ASN ND2  1 1 
        1  1056 1 1 64 ASN O    O   4.642 22.478  10.519 1.00 . A A . 64 ASN O    1 1 
        1  1057 1 1 64 ASN OD1  O   6.493 24.589   9.736 1.00 . A A . 64 ASN OD1  1 1 
        1  1058 1 1 65 LYS C    C   2.780 20.162  10.638 1.00 . A A . 65 LYS C    1 1 
        1  1059 1 1 65 LYS CA   C   3.043 20.653   9.216 1.00 . A A . 65 LYS CA   1 1 
        1  1060 1 1 65 LYS CB   C   2.470 19.639   8.209 1.00 . A A . 65 LYS CB   1 1 
        1  1061 1 1 65 LYS CD   C   0.497 20.825   7.147 1.00 . A A . 65 LYS CD   1 1 
        1  1062 1 1 65 LYS CE   C  -1.024 20.933   7.136 1.00 . A A . 65 LYS CE   1 1 
        1  1063 1 1 65 LYS CG   C   0.924 19.749   8.154 1.00 . A A . 65 LYS CG   1 1 
        1  1064 1 1 65 LYS H    H   4.926 20.276   8.333 1.00 . A A . 65 LYS H    1 1 
        1  1065 1 1 65 LYS HA   H   2.554 21.602   9.079 1.00 . A A . 65 LYS HA   1 1 
        1  1066 1 1 65 LYS HB2  H   2.886 19.835   7.232 1.00 . A A . 65 LYS HB2  1 1 
        1  1067 1 1 65 LYS HB3  H   2.749 18.637   8.510 1.00 . A A . 65 LYS HB3  1 1 
        1  1068 1 1 65 LYS HD2  H   0.921 21.776   7.424 1.00 . A A . 65 LYS HD2  1 1 
        1  1069 1 1 65 LYS HD3  H   0.843 20.551   6.163 1.00 . A A . 65 LYS HD3  1 1 
        1  1070 1 1 65 LYS HE2  H  -1.453 19.982   6.854 1.00 . A A . 65 LYS HE2  1 1 
        1  1071 1 1 65 LYS HE3  H  -1.374 21.209   8.121 1.00 . A A . 65 LYS HE3  1 1 
        1  1072 1 1 65 LYS HG2  H   0.509 18.803   7.847 1.00 . A A . 65 LYS HG2  1 1 
        1  1073 1 1 65 LYS HG3  H   0.535 20.000   9.131 1.00 . A A . 65 LYS HG3  1 1 
        1  1074 1 1 65 LYS HZ1  H  -1.516 22.889   6.640 1.00 . A A . 65 LYS HZ1  1 1 
        1  1075 1 1 65 LYS HZ2  H  -2.339 21.718   5.729 1.00 . A A . 65 LYS HZ2  1 1 
        1  1076 1 1 65 LYS HZ3  H  -0.701 22.044   5.413 1.00 . A A . 65 LYS HZ3  1 1 
        1  1077 1 1 65 LYS N    N   4.465 20.834   8.994 1.00 . A A . 65 LYS N    1 1 
        1  1078 1 1 65 LYS NZ   N  -1.426 21.974   6.155 1.00 . A A . 65 LYS NZ   1 1 
        1  1079 1 1 65 LYS O    O   1.818 20.581  11.282 1.00 . A A . 65 LYS O    1 1 
        1  1080 1 1 66 VAL C    C   3.587 19.832  13.498 1.00 . A A . 66 VAL C    1 1 
        1  1081 1 1 66 VAL CA   C   3.467 18.728  12.456 1.00 . A A . 66 VAL CA   1 1 
        1  1082 1 1 66 VAL CB   C   4.525 17.637  12.721 1.00 . A A . 66 VAL CB   1 1 
        1  1083 1 1 66 VAL CG1  C   4.390 17.104  14.156 1.00 . A A . 66 VAL CG1  1 1 
        1  1084 1 1 66 VAL CG2  C   4.324 16.492  11.720 1.00 . A A . 66 VAL CG2  1 1 
        1  1085 1 1 66 VAL H    H   4.390 18.976  10.562 1.00 . A A . 66 VAL H    1 1 
        1  1086 1 1 66 VAL HA   H   2.487 18.285  12.527 1.00 . A A . 66 VAL HA   1 1 
        1  1087 1 1 66 VAL HB   H   5.519 18.046  12.594 1.00 . A A . 66 VAL HB   1 1 
        1  1088 1 1 66 VAL HG11 H   3.361 16.841  14.345 1.00 . A A . 66 VAL HG11 1 1 
        1  1089 1 1 66 VAL HG12 H   4.702 17.866  14.858 1.00 . A A . 66 VAL HG12 1 1 
        1  1090 1 1 66 VAL HG13 H   5.014 16.230  14.277 1.00 . A A . 66 VAL HG13 1 1 
        1  1091 1 1 66 VAL HG21 H   3.292 16.173  11.734 1.00 . A A . 66 VAL HG21 1 1 
        1  1092 1 1 66 VAL HG22 H   4.959 15.664  11.992 1.00 . A A . 66 VAL HG22 1 1 
        1  1093 1 1 66 VAL HG23 H   4.581 16.833  10.729 1.00 . A A . 66 VAL HG23 1 1 
        1  1094 1 1 66 VAL N    N   3.641 19.271  11.119 1.00 . A A . 66 VAL N    1 1 
        1  1095 1 1 66 VAL O    O   2.728 19.991  14.366 1.00 . A A . 66 VAL O    1 1 
        1  1096 1 1 67 LYS C    C   3.854 22.765  14.210 1.00 . A A . 67 LYS C    1 1 
        1  1097 1 1 67 LYS CA   C   4.905 21.678  14.346 1.00 . A A . 67 LYS CA   1 1 
        1  1098 1 1 67 LYS CB   C   6.277 22.269  14.084 1.00 . A A . 67 LYS CB   1 1 
        1  1099 1 1 67 LYS CD   C   8.494 21.490  15.081 1.00 . A A . 67 LYS CD   1 1 
        1  1100 1 1 67 LYS CE   C   9.148 22.845  14.701 1.00 . A A . 67 LYS CE   1 1 
        1  1101 1 1 67 LYS CG   C   7.347 21.139  14.119 1.00 . A A . 67 LYS CG   1 1 
        1  1102 1 1 67 LYS H    H   5.321 20.424  12.691 1.00 . A A . 67 LYS H    1 1 
        1  1103 1 1 67 LYS HA   H   4.886 21.281  15.347 1.00 . A A . 67 LYS HA   1 1 
        1  1104 1 1 67 LYS HB2  H   6.274 22.746  13.109 1.00 . A A . 67 LYS HB2  1 1 
        1  1105 1 1 67 LYS HB3  H   6.479 23.010  14.832 1.00 . A A . 67 LYS HB3  1 1 
        1  1106 1 1 67 LYS HD2  H   8.091 21.543  16.087 1.00 . A A . 67 LYS HD2  1 1 
        1  1107 1 1 67 LYS HD3  H   9.235 20.703  15.038 1.00 . A A . 67 LYS HD3  1 1 
        1  1108 1 1 67 LYS HE2  H   8.923 23.099  13.673 1.00 . A A . 67 LYS HE2  1 1 
        1  1109 1 1 67 LYS HE3  H   8.775 23.630  15.348 1.00 . A A . 67 LYS HE3  1 1 
        1  1110 1 1 67 LYS HG2  H   6.903 20.206  14.442 1.00 . A A . 67 LYS HG2  1 1 
        1  1111 1 1 67 LYS HG3  H   7.746 20.999  13.126 1.00 . A A . 67 LYS HG3  1 1 
        1  1112 1 1 67 LYS HZ1  H  10.865 21.854  15.354 1.00 . A A . 67 LYS HZ1  1 1 
        1  1113 1 1 67 LYS HZ2  H  10.977 23.546  15.419 1.00 . A A . 67 LYS HZ2  1 1 
        1  1114 1 1 67 LYS HZ3  H  11.078 22.746  13.923 1.00 . A A . 67 LYS HZ3  1 1 
        1  1115 1 1 67 LYS N    N   4.671 20.595  13.404 1.00 . A A . 67 LYS N    1 1 
        1  1116 1 1 67 LYS NZ   N  10.628 22.739  14.862 1.00 . A A . 67 LYS NZ   1 1 
        1  1117 1 1 67 LYS O    O   3.293 23.252  15.191 1.00 . A A . 67 LYS O    1 1 
        1  1118 1 1 68 ARG C    C   1.270 23.818  13.318 1.00 . A A . 68 ARG C    1 1 
        1  1119 1 1 68 ARG CA   C   2.601 24.169  12.673 1.00 . A A . 68 ARG CA   1 1 
        1  1120 1 1 68 ARG CB   C   2.432 24.285  11.149 1.00 . A A . 68 ARG CB   1 1 
        1  1121 1 1 68 ARG CD   C   3.382 26.566  10.558 1.00 . A A . 68 ARG CD   1 1 
        1  1122 1 1 68 ARG CG   C   3.621 25.050  10.513 1.00 . A A . 68 ARG CG   1 1 
        1  1123 1 1 68 ARG CZ   C   4.618 28.607  10.127 1.00 . A A . 68 ARG CZ   1 1 
        1  1124 1 1 68 ARG H    H   4.064 22.716  12.220 1.00 . A A . 68 ARG H    1 1 
        1  1125 1 1 68 ARG HA   H   2.948 25.107  13.072 1.00 . A A . 68 ARG HA   1 1 
        1  1126 1 1 68 ARG HB2  H   2.386 23.290  10.737 1.00 . A A . 68 ARG HB2  1 1 
        1  1127 1 1 68 ARG HB3  H   1.508 24.794  10.925 1.00 . A A . 68 ARG HB3  1 1 
        1  1128 1 1 68 ARG HD2  H   2.563 26.815   9.903 1.00 . A A . 68 ARG HD2  1 1 
        1  1129 1 1 68 ARG HD3  H   3.136 26.869  11.562 1.00 . A A . 68 ARG HD3  1 1 
        1  1130 1 1 68 ARG HE   H   5.358 26.771   9.812 1.00 . A A . 68 ARG HE   1 1 
        1  1131 1 1 68 ARG HG2  H   4.529 24.821  11.053 1.00 . A A . 68 ARG HG2  1 1 
        1  1132 1 1 68 ARG HG3  H   3.735 24.743   9.484 1.00 . A A . 68 ARG HG3  1 1 
        1  1133 1 1 68 ARG HH11 H   2.760 28.812  10.842 1.00 . A A . 68 ARG HH11 1 1 
        1  1134 1 1 68 ARG HH12 H   3.615 30.288  10.543 1.00 . A A . 68 ARG HH12 1 1 
        1  1135 1 1 68 ARG HH21 H   6.488 28.705   9.416 1.00 . A A . 68 ARG HH21 1 1 
        1  1136 1 1 68 ARG HH22 H   5.726 30.228   9.736 1.00 . A A . 68 ARG HH22 1 1 
        1  1137 1 1 68 ARG N    N   3.585 23.138  12.963 1.00 . A A . 68 ARG N    1 1 
        1  1138 1 1 68 ARG NE   N   4.577 27.279  10.119 1.00 . A A . 68 ARG NE   1 1 
        1  1139 1 1 68 ARG NH1  N   3.584 29.290  10.537 1.00 . A A . 68 ARG NH1  1 1 
        1  1140 1 1 68 ARG NH2  N   5.694 29.229   9.728 1.00 . A A . 68 ARG NH2  1 1 
        1  1141 1 1 68 ARG O    O   0.463 24.699  13.614 1.00 . A A . 68 ARG O    1 1 
        1  1142 1 1 69 GLY C    C  -0.137 22.232  15.662 1.00 . A A . 69 GLY C    1 1 
        1  1143 1 1 69 GLY CA   C  -0.187 22.057  14.151 1.00 . A A . 69 GLY CA   1 1 
        1  1144 1 1 69 GLY H    H   1.727 21.870  13.282 1.00 . A A . 69 GLY H    1 1 
        1  1145 1 1 69 GLY HA2  H  -1.026 22.609  13.748 1.00 . A A . 69 GLY HA2  1 1 
        1  1146 1 1 69 GLY HA3  H  -0.309 21.011  13.922 1.00 . A A . 69 GLY HA3  1 1 
        1  1147 1 1 69 GLY N    N   1.047 22.527  13.540 1.00 . A A . 69 GLY N    1 1 
        1  1148 1 1 69 GLY O    O  -1.156 22.115  16.345 1.00 . A A . 69 GLY O    1 1 
        1  1149 1 1 70 GLU C    C   0.973 24.158  17.998 1.00 . A A . 70 GLU C    1 1 
        1  1150 1 1 70 GLU CA   C   1.231 22.704  17.621 1.00 . A A . 70 GLU CA   1 1 
        1  1151 1 1 70 GLU CB   C   2.657 22.311  18.022 1.00 . A A . 70 GLU CB   1 1 
        1  1152 1 1 70 GLU CD   C   2.045 19.935  18.550 1.00 . A A . 70 GLU CD   1 1 
        1  1153 1 1 70 GLU CG   C   2.900 20.839  17.667 1.00 . A A . 70 GLU CG   1 1 
        1  1154 1 1 70 GLU H    H   1.829 22.593  15.589 1.00 . A A . 70 GLU H    1 1 
        1  1155 1 1 70 GLU HA   H   0.533 22.077  18.161 1.00 . A A . 70 GLU HA   1 1 
        1  1156 1 1 70 GLU HB2  H   3.366 22.932  17.501 1.00 . A A . 70 GLU HB2  1 1 
        1  1157 1 1 70 GLU HB3  H   2.781 22.446  19.085 1.00 . A A . 70 GLU HB3  1 1 
        1  1158 1 1 70 GLU HG2  H   2.646 20.670  16.633 1.00 . A A . 70 GLU HG2  1 1 
        1  1159 1 1 70 GLU HG3  H   3.935 20.605  17.814 1.00 . A A . 70 GLU HG3  1 1 
        1  1160 1 1 70 GLU N    N   1.054 22.511  16.181 1.00 . A A . 70 GLU N    1 1 
        1  1161 1 1 70 GLU O    O   0.400 24.923  17.220 1.00 . A A . 70 GLU O    1 1 
        1  1162 1 1 70 GLU OE1  O   1.611 20.401  19.590 1.00 . A A . 70 GLU OE1  1 1 
        1  1163 1 1 70 GLU OE2  O   1.832 18.794  18.173 1.00 . A A . 70 GLU OE2  1 1 
        1  1164 1 1 71 SER C    C   2.335 26.317  20.608 1.00 . A A . 71 SER C    1 1 
        1  1165 1 1 71 SER CA   C   1.202 25.905  19.683 1.00 . A A . 71 SER CA   1 1 
        1  1166 1 1 71 SER CB   C  -0.125 26.007  20.426 1.00 . A A . 71 SER CB   1 1 
        1  1167 1 1 71 SER H    H   1.845 23.881  19.777 1.00 . A A . 71 SER H    1 1 
        1  1168 1 1 71 SER HA   H   1.181 26.588  18.842 1.00 . A A . 71 SER HA   1 1 
        1  1169 1 1 71 SER HB2  H  -0.323 27.036  20.670 1.00 . A A . 71 SER HB2  1 1 
        1  1170 1 1 71 SER HB3  H  -0.914 25.629  19.792 1.00 . A A . 71 SER HB3  1 1 
        1  1171 1 1 71 SER HG   H   0.005 24.317  21.380 1.00 . A A . 71 SER HG   1 1 
        1  1172 1 1 71 SER N    N   1.396 24.533  19.200 1.00 . A A . 71 SER N    1 1 
        1  1173 1 1 71 SER O    O   2.106 26.746  21.739 1.00 . A A . 71 SER O    1 1 
        1  1174 1 1 71 SER OG   O  -0.054 25.244  21.623 1.00 . A A . 71 SER OG   1 1 
        1  1175 1 1 72 LYS C    C   4.773 25.757  22.198 1.00 . A A . 72 LYS C    1 1 
        1  1176 1 1 72 LYS CA   C   4.740 26.545  20.896 1.00 . A A . 72 LYS CA   1 1 
        1  1177 1 1 72 LYS CB   C   4.736 28.047  21.203 1.00 . A A . 72 LYS CB   1 1 
        1  1178 1 1 72 LYS CD   C   4.759 30.332  20.205 1.00 . A A . 72 LYS CD   1 1 
        1  1179 1 1 72 LYS CE   C   4.701 31.120  18.897 1.00 . A A . 72 LYS CE   1 1 
        1  1180 1 1 72 LYS CG   C   4.795 28.835  19.896 1.00 . A A . 72 LYS CG   1 1 
        1  1181 1 1 72 LYS H    H   3.686 25.837  19.211 1.00 . A A . 72 LYS H    1 1 
        1  1182 1 1 72 LYS HA   H   5.622 26.310  20.320 1.00 . A A . 72 LYS HA   1 1 
        1  1183 1 1 72 LYS HB2  H   3.841 28.310  21.741 1.00 . A A . 72 LYS HB2  1 1 
        1  1184 1 1 72 LYS HB3  H   5.597 28.290  21.804 1.00 . A A . 72 LYS HB3  1 1 
        1  1185 1 1 72 LYS HD2  H   3.884 30.556  20.801 1.00 . A A . 72 LYS HD2  1 1 
        1  1186 1 1 72 LYS HD3  H   5.648 30.609  20.752 1.00 . A A . 72 LYS HD3  1 1 
        1  1187 1 1 72 LYS HE2  H   3.812 30.844  18.349 1.00 . A A . 72 LYS HE2  1 1 
        1  1188 1 1 72 LYS HE3  H   4.675 32.178  19.115 1.00 . A A . 72 LYS HE3  1 1 
        1  1189 1 1 72 LYS HG2  H   5.709 28.596  19.372 1.00 . A A . 72 LYS HG2  1 1 
        1  1190 1 1 72 LYS HG3  H   3.947 28.576  19.280 1.00 . A A . 72 LYS HG3  1 1 
        1  1191 1 1 72 LYS HZ1  H   6.761 30.944  18.654 1.00 . A A . 72 LYS HZ1  1 1 
        1  1192 1 1 72 LYS HZ2  H   5.941 31.447  17.257 1.00 . A A . 72 LYS HZ2  1 1 
        1  1193 1 1 72 LYS HZ3  H   5.858 29.823  17.752 1.00 . A A . 72 LYS HZ3  1 1 
        1  1194 1 1 72 LYS N    N   3.564 26.184  20.119 1.00 . A A . 72 LYS N    1 1 
        1  1195 1 1 72 LYS NZ   N   5.906 30.811  18.078 1.00 . A A . 72 LYS NZ   1 1 
        1  1196 1 1 72 LYS O    O   5.412 26.166  23.167 1.00 . A A . 72 LYS O    1 1 
        1  1197 1 1 73 LEU C    C   5.441 23.338  23.790 1.00 . A A . 73 LEU C    1 1 
        1  1198 1 1 73 LEU CA   C   4.035 23.792  23.410 1.00 . A A . 73 LEU CA   1 1 
        1  1199 1 1 73 LEU CB   C   3.153 22.559  23.165 1.00 . A A . 73 LEU CB   1 1 
        1  1200 1 1 73 LEU CD1  C   2.100 22.571  25.496 1.00 . A A . 73 LEU CD1  1 1 
        1  1201 1 1 73 LEU CD2  C   2.258 20.434  24.149 1.00 . A A . 73 LEU CD2  1 1 
        1  1202 1 1 73 LEU CG   C   2.947 21.767  24.478 1.00 . A A . 73 LEU CG   1 1 
        1  1203 1 1 73 LEU H    H   3.587 24.348  21.413 1.00 . A A . 73 LEU H    1 1 
        1  1204 1 1 73 LEU HA   H   3.618 24.371  24.216 1.00 . A A . 73 LEU HA   1 1 
        1  1205 1 1 73 LEU HB2  H   2.195 22.875  22.777 1.00 . A A . 73 LEU HB2  1 1 
        1  1206 1 1 73 LEU HB3  H   3.635 21.922  22.438 1.00 . A A . 73 LEU HB3  1 1 
        1  1207 1 1 73 LEU HD11 H   1.329 23.127  24.981 1.00 . A A . 73 LEU HD11 1 1 
        1  1208 1 1 73 LEU HD12 H   2.735 23.254  26.038 1.00 . A A . 73 LEU HD12 1 1 
        1  1209 1 1 73 LEU HD13 H   1.638 21.896  26.204 1.00 . A A . 73 LEU HD13 1 1 
        1  1210 1 1 73 LEU HD21 H   2.030 19.911  25.066 1.00 . A A . 73 LEU HD21 1 1 
        1  1211 1 1 73 LEU HD22 H   2.921 19.832  23.548 1.00 . A A . 73 LEU HD22 1 1 
        1  1212 1 1 73 LEU HD23 H   1.345 20.620  23.604 1.00 . A A . 73 LEU HD23 1 1 
        1  1213 1 1 73 LEU HG   H   3.907 21.558  24.922 1.00 . A A . 73 LEU HG   1 1 
        1  1214 1 1 73 LEU N    N   4.077 24.625  22.215 1.00 . A A . 73 LEU N    1 1 
        1  1215 1 1 73 LEU O    O   5.967 22.373  23.235 1.00 . A A . 73 LEU O    1 1 
        1  1216 1 1 74 GLU C    C   7.823 24.640  26.321 1.00 . A A . 74 GLU C    1 1 
        1  1217 1 1 74 GLU CA   C   7.382 23.695  25.204 1.00 . A A . 74 GLU CA   1 1 
        1  1218 1 1 74 GLU CB   C   8.374 23.770  24.025 1.00 . A A . 74 GLU CB   1 1 
        1  1219 1 1 74 GLU CD   C   9.308 25.391  22.327 1.00 . A A . 74 GLU CD   1 1 
        1  1220 1 1 74 GLU CG   C   8.084 25.019  23.163 1.00 . A A . 74 GLU CG   1 1 
        1  1221 1 1 74 GLU H    H   5.572 24.797  25.154 1.00 . A A . 74 GLU H    1 1 
        1  1222 1 1 74 GLU HA   H   7.369 22.685  25.590 1.00 . A A . 74 GLU HA   1 1 
        1  1223 1 1 74 GLU HB2  H   9.387 23.811  24.403 1.00 . A A . 74 GLU HB2  1 1 
        1  1224 1 1 74 GLU HB3  H   8.270 22.887  23.413 1.00 . A A . 74 GLU HB3  1 1 
        1  1225 1 1 74 GLU HG2  H   7.258 24.809  22.497 1.00 . A A . 74 GLU HG2  1 1 
        1  1226 1 1 74 GLU HG3  H   7.820 25.854  23.795 1.00 . A A . 74 GLU HG3  1 1 
        1  1227 1 1 74 GLU N    N   6.041 24.037  24.748 1.00 . A A . 74 GLU N    1 1 
        1  1228 1 1 74 GLU O    O   8.961 25.106  26.333 1.00 . A A . 74 GLU O    1 1 
        1  1229 1 1 74 GLU OE1  O   9.940 24.491  21.800 1.00 . A A . 74 GLU OE1  1 1 
        1  1230 1 1 74 GLU OE2  O   9.590 26.573  22.225 1.00 . A A . 74 GLU OE2  1 1 
        1  1231 1 1 75 HIS C    C   7.509 27.213  27.868 1.00 . A A . 75 HIS C    1 1 
        1  1232 1 1 75 HIS CA   C   7.221 25.805  28.374 1.00 . A A . 75 HIS CA   1 1 
        1  1233 1 1 75 HIS CB   C   8.431 25.272  29.164 1.00 . A A . 75 HIS CB   1 1 
        1  1234 1 1 75 HIS CD2  C   8.003 25.725  31.716 1.00 . A A . 75 HIS CD2  1 1 
        1  1235 1 1 75 HIS CE1  C   9.182 27.530  31.923 1.00 . A A . 75 HIS CE1  1 1 
        1  1236 1 1 75 HIS CG   C   8.543 25.990  30.482 1.00 . A A . 75 HIS CG   1 1 
        1  1237 1 1 75 HIS H    H   6.024 24.518  27.191 1.00 . A A . 75 HIS H    1 1 
        1  1238 1 1 75 HIS HA   H   6.359 25.838  29.027 1.00 . A A . 75 HIS HA   1 1 
        1  1239 1 1 75 HIS HB2  H   8.306 24.216  29.343 1.00 . A A . 75 HIS HB2  1 1 
        1  1240 1 1 75 HIS HB3  H   9.338 25.432  28.603 1.00 . A A . 75 HIS HB3  1 1 
        1  1241 1 1 75 HIS HD1  H   9.809 27.600  29.939 1.00 . A A . 75 HIS HD1  1 1 
        1  1242 1 1 75 HIS HD2  H   7.363 24.886  31.946 1.00 . A A . 75 HIS HD2  1 1 
        1  1243 1 1 75 HIS HE1  H   9.663 28.404  32.337 1.00 . A A . 75 HIS HE1  1 1 
        1  1244 1 1 75 HIS HE2  H   8.176 26.759  33.574 1.00 . A A . 75 HIS HE2  1 1 
        1  1245 1 1 75 HIS N    N   6.917 24.919  27.252 1.00 . A A . 75 HIS N    1 1 
        1  1246 1 1 75 HIS ND1  N   9.292 27.147  30.638 1.00 . A A . 75 HIS ND1  1 1 
        1  1247 1 1 75 HIS NE2  N   8.408 26.698  32.624 1.00 . A A . 75 HIS NE2  1 1 
        1  1248 1 1 75 HIS O    O   8.668 27.606  27.728 1.00 . A A . 75 HIS O    1 1 
        1  1249 1 1 76 HIS C    C   7.486 30.144  28.049 1.00 . A A . 76 HIS C    1 1 
        1  1250 1 1 76 HIS CA   C   6.608 29.332  27.101 1.00 . A A . 76 HIS CA   1 1 
        1  1251 1 1 76 HIS CB   C   5.236 29.998  26.976 1.00 . A A . 76 HIS CB   1 1 
        1  1252 1 1 76 HIS CD2  C   4.015 29.455  24.711 1.00 . A A . 76 HIS CD2  1 1 
        1  1253 1 1 76 HIS CE1  C   3.107 27.575  25.291 1.00 . A A . 76 HIS CE1  1 1 
        1  1254 1 1 76 HIS CG   C   4.386 29.217  26.011 1.00 . A A . 76 HIS CG   1 1 
        1  1255 1 1 76 HIS H    H   5.551 27.604  27.726 1.00 . A A . 76 HIS H    1 1 
        1  1256 1 1 76 HIS HA   H   7.072 29.300  26.126 1.00 . A A . 76 HIS HA   1 1 
        1  1257 1 1 76 HIS HB2  H   4.756 30.022  27.942 1.00 . A A . 76 HIS HB2  1 1 
        1  1258 1 1 76 HIS HB3  H   5.360 31.008  26.609 1.00 . A A . 76 HIS HB3  1 1 
        1  1259 1 1 76 HIS HD1  H   3.868 27.563  27.227 1.00 . A A . 76 HIS HD1  1 1 
        1  1260 1 1 76 HIS HD2  H   4.304 30.317  24.128 1.00 . A A . 76 HIS HD2  1 1 
        1  1261 1 1 76 HIS HE1  H   2.542 26.655  25.269 1.00 . A A . 76 HIS HE1  1 1 
        1  1262 1 1 76 HIS HE2  H   2.798 28.322  23.372 1.00 . A A . 76 HIS HE2  1 1 
        1  1263 1 1 76 HIS N    N   6.451 27.969  27.595 1.00 . A A . 76 HIS N    1 1 
        1  1264 1 1 76 HIS ND1  N   3.796 28.013  26.360 1.00 . A A . 76 HIS ND1  1 1 
        1  1265 1 1 76 HIS NE2  N   3.207 28.416  24.258 1.00 . A A . 76 HIS NE2  1 1 
        1  1266 1 1 76 HIS O    O   7.194 30.262  29.239 1.00 . A A . 76 HIS O    1 1 
        1  1267 1 1 77 HIS C    C   9.000 32.944  28.411 1.00 . A A . 77 HIS C    1 1 
        1  1268 1 1 77 HIS CA   C   9.491 31.503  28.312 1.00 . A A . 77 HIS CA   1 1 
        1  1269 1 1 77 HIS CB   C  10.886 31.479  27.680 1.00 . A A . 77 HIS CB   1 1 
        1  1270 1 1 77 HIS CD2  C  12.485 31.774  29.746 1.00 . A A . 77 HIS CD2  1 1 
        1  1271 1 1 77 HIS CE1  C  13.160 33.793  29.337 1.00 . A A . 77 HIS CE1  1 1 
        1  1272 1 1 77 HIS CG   C  11.865 32.175  28.589 1.00 . A A . 77 HIS CG   1 1 
        1  1273 1 1 77 HIS H    H   8.747 30.574  26.554 1.00 . A A . 77 HIS H    1 1 
        1  1274 1 1 77 HIS HA   H   9.554 31.086  29.309 1.00 . A A . 77 HIS HA   1 1 
        1  1275 1 1 77 HIS HB2  H  11.197 30.454  27.535 1.00 . A A . 77 HIS HB2  1 1 
        1  1276 1 1 77 HIS HB3  H  10.858 31.985  26.727 1.00 . A A . 77 HIS HB3  1 1 
        1  1277 1 1 77 HIS HD1  H  12.051 34.036  27.594 1.00 . A A . 77 HIS HD1  1 1 
        1  1278 1 1 77 HIS HD2  H  12.357 30.812  30.221 1.00 . A A . 77 HIS HD2  1 1 
        1  1279 1 1 77 HIS HE1  H  13.664 34.744  29.413 1.00 . A A . 77 HIS HE1  1 1 
        1  1280 1 1 77 HIS HE2  H  13.862 32.789  31.022 1.00 . A A . 77 HIS HE2  1 1 
        1  1281 1 1 77 HIS N    N   8.565 30.701  27.509 1.00 . A A . 77 HIS N    1 1 
        1  1282 1 1 77 HIS ND1  N  12.310 33.465  28.347 1.00 . A A . 77 HIS ND1  1 1 
        1  1283 1 1 77 HIS NE2  N  13.303 32.797  30.217 1.00 . A A . 77 HIS NE2  1 1 
        1  1284 1 1 77 HIS O    O   9.785 33.862  28.646 1.00 . A A . 77 HIS O    1 1 
        1  1285 1 1 78 HIS C    C   7.822 35.418  27.343 1.00 . A A . 78 HIS C    1 1 
        1  1286 1 1 78 HIS CA   C   7.110 34.467  28.298 1.00 . A A . 78 HIS CA   1 1 
        1  1287 1 1 78 HIS CB   C   7.208 35.008  29.727 1.00 . A A . 78 HIS CB   1 1 
        1  1288 1 1 78 HIS CD2  C   5.149 36.604  30.062 1.00 . A A . 78 HIS CD2  1 1 
        1  1289 1 1 78 HIS CE1  C   6.171 38.497  29.805 1.00 . A A . 78 HIS CE1  1 1 
        1  1290 1 1 78 HIS CG   C   6.469 36.314  29.823 1.00 . A A . 78 HIS CG   1 1 
        1  1291 1 1 78 HIS H    H   7.120 32.363  28.045 1.00 . A A . 78 HIS H    1 1 
        1  1292 1 1 78 HIS HA   H   6.068 34.403  28.019 1.00 . A A . 78 HIS HA   1 1 
        1  1293 1 1 78 HIS HB2  H   6.771 34.295  30.411 1.00 . A A . 78 HIS HB2  1 1 
        1  1294 1 1 78 HIS HB3  H   8.246 35.162  29.982 1.00 . A A . 78 HIS HB3  1 1 
        1  1295 1 1 78 HIS HD1  H   8.054 37.676  29.476 1.00 . A A . 78 HIS HD1  1 1 
        1  1296 1 1 78 HIS HD2  H   4.372 35.873  30.232 1.00 . A A . 78 HIS HD2  1 1 
        1  1297 1 1 78 HIS HE1  H   6.375 39.555  29.730 1.00 . A A . 78 HIS HE1  1 1 
        1  1298 1 1 78 HIS HE2  H   4.125 38.473  30.192 1.00 . A A . 78 HIS HE2  1 1 
        1  1299 1 1 78 HIS N    N   7.698 33.134  28.229 1.00 . A A . 78 HIS N    1 1 
        1  1300 1 1 78 HIS ND1  N   7.102 37.537  29.662 1.00 . A A . 78 HIS ND1  1 1 
        1  1301 1 1 78 HIS NE2  N   4.963 37.984  30.052 1.00 . A A . 78 HIS NE2  1 1 
        1  1302 1 1 78 HIS O    O   8.647 36.232  27.759 1.00 . A A . 78 HIS O    1 1 
        1  1303 1 1 79 HIS C    C   7.143 36.398  23.882 1.00 . A A . 79 HIS C    1 1 
        1  1304 1 1 79 HIS CA   C   8.109 36.164  25.038 1.00 . A A . 79 HIS CA   1 1 
        1  1305 1 1 79 HIS CB   C   9.391 35.512  24.512 1.00 . A A . 79 HIS CB   1 1 
        1  1306 1 1 79 HIS CD2  C  11.061 37.417  23.807 1.00 . A A . 79 HIS CD2  1 1 
        1  1307 1 1 79 HIS CE1  C  10.618 37.452  21.686 1.00 . A A . 79 HIS CE1  1 1 
        1  1308 1 1 79 HIS CG   C  10.099 36.462  23.585 1.00 . A A . 79 HIS CG   1 1 
        1  1309 1 1 79 HIS H    H   6.832 34.643  25.785 1.00 . A A . 79 HIS H    1 1 
        1  1310 1 1 79 HIS HA   H   8.360 37.125  25.475 1.00 . A A . 79 HIS HA   1 1 
        1  1311 1 1 79 HIS HB2  H  10.037 35.271  25.343 1.00 . A A . 79 HIS HB2  1 1 
        1  1312 1 1 79 HIS HB3  H   9.140 34.607  23.978 1.00 . A A . 79 HIS HB3  1 1 
        1  1313 1 1 79 HIS HD1  H   9.189 35.940  21.744 1.00 . A A . 79 HIS HD1  1 1 
        1  1314 1 1 79 HIS HD2  H  11.497 37.649  24.767 1.00 . A A . 79 HIS HD2  1 1 
        1  1315 1 1 79 HIS HE1  H  10.627 37.707  20.636 1.00 . A A . 79 HIS HE1  1 1 
        1  1316 1 1 79 HIS HE2  H  12.040 38.757  22.466 1.00 . A A . 79 HIS HE2  1 1 
        1  1317 1 1 79 HIS N    N   7.497 35.309  26.059 1.00 . A A . 79 HIS N    1 1 
        1  1318 1 1 79 HIS ND1  N   9.833 36.502  22.225 1.00 . A A . 79 HIS ND1  1 1 
        1  1319 1 1 79 HIS NE2  N  11.387 38.040  22.606 1.00 . A A . 79 HIS NE2  1 1 
        1  1320 1 1 79 HIS O    O   6.432 35.489  23.456 1.00 . A A . 79 HIS O    1 1 
        1  1321 1 1 80 HIS C    C   6.504 37.066  21.074 1.00 . A A . 80 HIS C    1 1 
        1  1322 1 1 80 HIS CA   C   6.246 37.977  22.269 1.00 . A A . 80 HIS CA   1 1 
        1  1323 1 1 80 HIS CB   C   6.474 39.434  21.862 1.00 . A A . 80 HIS CB   1 1 
        1  1324 1 1 80 HIS CD2  C   6.968 41.018  23.900 1.00 . A A . 80 HIS CD2  1 1 
        1  1325 1 1 80 HIS CE1  C   4.922 41.451  24.466 1.00 . A A . 80 HIS CE1  1 1 
        1  1326 1 1 80 HIS CG   C   6.160 40.336  23.024 1.00 . A A . 80 HIS CG   1 1 
        1  1327 1 1 80 HIS H    H   7.715 38.312  23.758 1.00 . A A . 80 HIS H    1 1 
        1  1328 1 1 80 HIS HA   H   5.221 37.860  22.585 1.00 . A A . 80 HIS HA   1 1 
        1  1329 1 1 80 HIS HB2  H   7.506 39.568  21.570 1.00 . A A . 80 HIS HB2  1 1 
        1  1330 1 1 80 HIS HB3  H   5.830 39.681  21.031 1.00 . A A . 80 HIS HB3  1 1 
        1  1331 1 1 80 HIS HD1  H   4.043 40.291  22.978 1.00 . A A . 80 HIS HD1  1 1 
        1  1332 1 1 80 HIS HD2  H   8.048 41.010  23.885 1.00 . A A . 80 HIS HD2  1 1 
        1  1333 1 1 80 HIS HE1  H   4.057 41.845  24.978 1.00 . A A . 80 HIS HE1  1 1 
        1  1334 1 1 80 HIS HE2  H   6.492 42.294  25.543 1.00 . A A . 80 HIS HE2  1 1 
        1  1335 1 1 80 HIS N    N   7.127 37.628  23.378 1.00 . A A . 80 HIS N    1 1 
        1  1336 1 1 80 HIS ND1  N   4.860 40.626  23.405 1.00 . A A . 80 HIS ND1  1 1 
        1  1337 1 1 80 HIS NE2  N   6.185 41.722  24.809 1.00 . A A . 80 HIS NE2  1 1 
        1  1338 1 1 80 HIS O    O   7.389 37.380  20.294 1.00 . A A . 80 HIS O    1 1 
        1  1339 2 1  1 MET C    C  42.172 32.838  15.181 1.00 . B B .  1 MET C    1 1 
        1  1340 2 1  1 MET CA   C  43.536 33.198  15.759 1.00 . B B .  1 MET CA   1 1 
        1  1341 2 1  1 MET CB   C  43.584 34.693  16.093 1.00 . B B .  1 MET CB   1 1 
        1  1342 2 1  1 MET CE   C  47.424 36.016  16.527 1.00 . B B .  1 MET CE   1 1 
        1  1343 2 1  1 MET CG   C  44.907 35.036  16.792 1.00 . B B .  1 MET CG   1 1 
        1  1344 2 1  1 MET H1   H  44.268 32.110  14.141 1.00 . B B .  1 MET H1   1 1 
        1  1345 2 1  1 MET H2   H  45.460 32.580  15.258 1.00 . B B .  1 MET H2   1 1 
        1  1346 2 1  1 MET H3   H  44.798 33.721  14.188 1.00 . B B .  1 MET H3   1 1 
        1  1347 2 1  1 MET HA   H  43.705 32.623  16.656 1.00 . B B .  1 MET HA   1 1 
        1  1348 2 1  1 MET HB2  H  43.501 35.266  15.181 1.00 . B B .  1 MET HB2  1 1 
        1  1349 2 1  1 MET HB3  H  42.760 34.939  16.748 1.00 . B B .  1 MET HB3  1 1 
        1  1350 2 1  1 MET HE1  H  48.423 35.851  16.147 1.00 . B B .  1 MET HE1  1 1 
        1  1351 2 1  1 MET HE2  H  47.377 35.729  17.569 1.00 . B B .  1 MET HE2  1 1 
        1  1352 2 1  1 MET HE3  H  47.172 37.060  16.432 1.00 . B B .  1 MET HE3  1 1 
        1  1353 2 1  1 MET HG2  H  44.837 36.020  17.231 1.00 . B B .  1 MET HG2  1 1 
        1  1354 2 1  1 MET HG3  H  45.114 34.313  17.568 1.00 . B B .  1 MET HG3  1 1 
        1  1355 2 1  1 MET N    N  44.595 32.878  14.761 1.00 . B B .  1 MET N    1 1 
        1  1356 2 1  1 MET O    O  41.149 32.953  15.857 1.00 . B B .  1 MET O    1 1 
        1  1357 2 1  1 MET SD   S  46.249 35.019  15.577 1.00 . B B .  1 MET SD   1 1 
        1  1358 2 1  2 SER C    C  40.484 30.625  13.714 1.00 . B B .  2 SER C    1 1 
        1  1359 2 1  2 SER CA   C  40.918 32.015  13.265 1.00 . B B .  2 SER CA   1 1 
        1  1360 2 1  2 SER CB   C  41.109 32.028  11.748 1.00 . B B .  2 SER CB   1 1 
        1  1361 2 1  2 SER H    H  43.011 32.326  13.437 1.00 . B B .  2 SER H    1 1 
        1  1362 2 1  2 SER HA   H  40.141 32.724  13.523 1.00 . B B .  2 SER HA   1 1 
        1  1363 2 1  2 SER HB2  H  40.195 31.726  11.262 1.00 . B B .  2 SER HB2  1 1 
        1  1364 2 1  2 SER HB3  H  41.369 33.029  11.428 1.00 . B B .  2 SER HB3  1 1 
        1  1365 2 1  2 SER HG   H  42.476 31.369  10.531 1.00 . B B .  2 SER HG   1 1 
        1  1366 2 1  2 SER N    N  42.165 32.396  13.927 1.00 . B B .  2 SER N    1 1 
        1  1367 2 1  2 SER O    O  39.359 30.436  14.173 1.00 . B B .  2 SER O    1 1 
        1  1368 2 1  2 SER OG   O  42.146 31.121  11.397 1.00 . B B .  2 SER OG   1 1 
        1  1369 2 1  3 GLU C    C  39.771 27.826  13.361 1.00 . B B .  3 GLU C    1 1 
        1  1370 2 1  3 GLU CA   C  41.079 28.278  13.968 1.00 . B B .  3 GLU CA   1 1 
        1  1371 2 1  3 GLU CB   C  40.996 28.169  15.495 1.00 . B B .  3 GLU CB   1 1 
        1  1372 2 1  3 GLU CD   C  42.732 29.912  15.974 1.00 . B B .  3 GLU CD   1 1 
        1  1373 2 1  3 GLU CG   C  42.372 28.438  16.116 1.00 . B B .  3 GLU CG   1 1 
        1  1374 2 1  3 GLU H    H  42.264 29.864  13.201 1.00 . B B .  3 GLU H    1 1 
        1  1375 2 1  3 GLU HA   H  41.855 27.627  13.607 1.00 . B B .  3 GLU HA   1 1 
        1  1376 2 1  3 GLU HB2  H  40.282 28.892  15.866 1.00 . B B .  3 GLU HB2  1 1 
        1  1377 2 1  3 GLU HB3  H  40.671 27.174  15.767 1.00 . B B .  3 GLU HB3  1 1 
        1  1378 2 1  3 GLU HG2  H  42.345 28.177  17.164 1.00 . B B .  3 GLU HG2  1 1 
        1  1379 2 1  3 GLU HG3  H  43.120 27.836  15.619 1.00 . B B .  3 GLU HG3  1 1 
        1  1380 2 1  3 GLU N    N  41.381 29.654  13.574 1.00 . B B .  3 GLU N    1 1 
        1  1381 2 1  3 GLU O    O  38.701 28.019  13.939 1.00 . B B .  3 GLU O    1 1 
        1  1382 2 1  3 GLU OE1  O  42.276 30.694  16.792 1.00 . B B .  3 GLU OE1  1 1 
        1  1383 2 1  3 GLU OE2  O  43.458 30.238  15.049 1.00 . B B .  3 GLU OE2  1 1 
        1  1384 2 1  4 LEU C    C  39.070 25.861  10.315 1.00 . B B .  4 LEU C    1 1 
        1  1385 2 1  4 LEU CA   C  38.674 26.743  11.494 1.00 . B B .  4 LEU CA   1 1 
        1  1386 2 1  4 LEU CB   C  37.828 27.944  10.990 1.00 . B B .  4 LEU CB   1 1 
        1  1387 2 1  4 LEU CD1  C  35.743 27.916  12.423 1.00 . B B .  4 LEU CD1  1 1 
        1  1388 2 1  4 LEU CD2  C  35.547 28.412   9.977 1.00 . B B .  4 LEU CD2  1 1 
        1  1389 2 1  4 LEU CG   C  36.313 27.601  11.034 1.00 . B B .  4 LEU CG   1 1 
        1  1390 2 1  4 LEU H    H  40.736 27.096  11.766 1.00 . B B .  4 LEU H    1 1 
        1  1391 2 1  4 LEU HA   H  38.091 26.151  12.189 1.00 . B B .  4 LEU HA   1 1 
        1  1392 2 1  4 LEU HB2  H  38.030 28.805  11.613 1.00 . B B .  4 LEU HB2  1 1 
        1  1393 2 1  4 LEU HB3  H  38.116 28.188   9.972 1.00 . B B .  4 LEU HB3  1 1 
        1  1394 2 1  4 LEU HD11 H  35.783 28.981  12.595 1.00 . B B .  4 LEU HD11 1 1 
        1  1395 2 1  4 LEU HD12 H  36.329 27.410  13.176 1.00 . B B .  4 LEU HD12 1 1 
        1  1396 2 1  4 LEU HD13 H  34.720 27.580  12.475 1.00 . B B .  4 LEU HD13 1 1 
        1  1397 2 1  4 LEU HD21 H  35.738 29.465  10.121 1.00 . B B .  4 LEU HD21 1 1 
        1  1398 2 1  4 LEU HD22 H  34.489 28.220  10.076 1.00 . B B .  4 LEU HD22 1 1 
        1  1399 2 1  4 LEU HD23 H  35.875 28.118   8.990 1.00 . B B .  4 LEU HD23 1 1 
        1  1400 2 1  4 LEU HG   H  36.182 26.548  10.839 1.00 . B B .  4 LEU HG   1 1 
        1  1401 2 1  4 LEU N    N  39.856 27.222  12.180 1.00 . B B .  4 LEU N    1 1 
        1  1402 2 1  4 LEU O    O  40.171 25.313  10.268 1.00 . B B .  4 LEU O    1 1 
        1  1403 2 1  5 PHE C    C  38.443 23.441   8.521 1.00 . B B .  5 PHE C    1 1 
        1  1404 2 1  5 PHE CA   C  38.386 24.919   8.162 1.00 . B B .  5 PHE CA   1 1 
        1  1405 2 1  5 PHE CB   C  39.695 25.342   7.471 1.00 . B B .  5 PHE CB   1 1 
        1  1406 2 1  5 PHE CD1  C  39.117 25.302   5.018 1.00 . B B .  5 PHE CD1  1 1 
        1  1407 2 1  5 PHE CD2  C  40.548 23.552   5.895 1.00 . B B .  5 PHE CD2  1 1 
        1  1408 2 1  5 PHE CE1  C  39.206 24.735   3.740 1.00 . B B .  5 PHE CE1  1 1 
        1  1409 2 1  5 PHE CE2  C  40.637 22.984   4.618 1.00 . B B .  5 PHE CE2  1 1 
        1  1410 2 1  5 PHE CG   C  39.788 24.711   6.094 1.00 . B B .  5 PHE CG   1 1 
        1  1411 2 1  5 PHE CZ   C  39.966 23.576   3.541 1.00 . B B .  5 PHE CZ   1 1 
        1  1412 2 1  5 PHE H    H  37.296 26.190   9.450 1.00 . B B .  5 PHE H    1 1 
        1  1413 2 1  5 PHE HA   H  37.562 25.076   7.483 1.00 . B B .  5 PHE HA   1 1 
        1  1414 2 1  5 PHE HB2  H  39.712 26.418   7.372 1.00 . B B .  5 PHE HB2  1 1 
        1  1415 2 1  5 PHE HB3  H  40.542 25.030   8.061 1.00 . B B .  5 PHE HB3  1 1 
        1  1416 2 1  5 PHE HD1  H  38.532 26.197   5.172 1.00 . B B .  5 PHE HD1  1 1 
        1  1417 2 1  5 PHE HD2  H  41.065 23.095   6.726 1.00 . B B .  5 PHE HD2  1 1 
        1  1418 2 1  5 PHE HE1  H  38.690 25.192   2.910 1.00 . B B .  5 PHE HE1  1 1 
        1  1419 2 1  5 PHE HE2  H  41.222 22.091   4.465 1.00 . B B .  5 PHE HE2  1 1 
        1  1420 2 1  5 PHE HZ   H  40.036 23.138   2.556 1.00 . B B .  5 PHE HZ   1 1 
        1  1421 2 1  5 PHE N    N  38.155 25.729   9.360 1.00 . B B .  5 PHE N    1 1 
        1  1422 2 1  5 PHE O    O  37.865 22.589   7.845 1.00 . B B .  5 PHE O    1 1 
        1  1423 2 1  6 SER C    C  37.930 21.213  10.472 1.00 . B B .  6 SER C    1 1 
        1  1424 2 1  6 SER CA   C  39.287 21.769  10.043 1.00 . B B .  6 SER CA   1 1 
        1  1425 2 1  6 SER CB   C  40.275 21.706  11.216 1.00 . B B .  6 SER CB   1 1 
        1  1426 2 1  6 SER H    H  39.593 23.864  10.104 1.00 . B B .  6 SER H    1 1 
        1  1427 2 1  6 SER HA   H  39.667 21.176   9.225 1.00 . B B .  6 SER HA   1 1 
        1  1428 2 1  6 SER HB2  H  39.778 21.955  12.143 1.00 . B B .  6 SER HB2  1 1 
        1  1429 2 1  6 SER HB3  H  40.686 20.706  11.289 1.00 . B B .  6 SER HB3  1 1 
        1  1430 2 1  6 SER HG   H  41.063 23.477  11.376 1.00 . B B .  6 SER HG   1 1 
        1  1431 2 1  6 SER N    N  39.154 23.144   9.603 1.00 . B B .  6 SER N    1 1 
        1  1432 2 1  6 SER O    O  37.208 21.836  11.251 1.00 . B B .  6 SER O    1 1 
        1  1433 2 1  6 SER OG   O  41.323 22.637  10.987 1.00 . B B .  6 SER OG   1 1 
        1  1434 2 1  7 VAL C    C  36.264 19.197  11.845 1.00 . B B .  7 VAL C    1 1 
        1  1435 2 1  7 VAL CA   C  36.339 19.389  10.321 1.00 . B B .  7 VAL CA   1 1 
        1  1436 2 1  7 VAL CB   C  36.210 18.029   9.609 1.00 . B B .  7 VAL CB   1 1 
        1  1437 2 1  7 VAL CG1  C  34.986 17.252  10.128 1.00 . B B .  7 VAL CG1  1 1 
        1  1438 2 1  7 VAL CG2  C  36.083 18.242   8.092 1.00 . B B .  7 VAL CG2  1 1 
        1  1439 2 1  7 VAL H    H  38.210 19.582   9.346 1.00 . B B .  7 VAL H    1 1 
        1  1440 2 1  7 VAL HA   H  35.517 20.024  10.010 1.00 . B B .  7 VAL HA   1 1 
        1  1441 2 1  7 VAL HB   H  37.091 17.450   9.799 1.00 . B B .  7 VAL HB   1 1 
        1  1442 2 1  7 VAL HG11 H  34.791 16.421   9.475 1.00 . B B .  7 VAL HG11 1 1 
        1  1443 2 1  7 VAL HG12 H  34.122 17.900  10.153 1.00 . B B .  7 VAL HG12 1 1 
        1  1444 2 1  7 VAL HG13 H  35.183 16.881  11.128 1.00 . B B .  7 VAL HG13 1 1 
        1  1445 2 1  7 VAL HG21 H  36.935 18.799   7.733 1.00 . B B .  7 VAL HG21 1 1 
        1  1446 2 1  7 VAL HG22 H  35.176 18.787   7.876 1.00 . B B .  7 VAL HG22 1 1 
        1  1447 2 1  7 VAL HG23 H  36.050 17.281   7.600 1.00 . B B .  7 VAL HG23 1 1 
        1  1448 2 1  7 VAL N    N  37.595 20.032   9.962 1.00 . B B .  7 VAL N    1 1 
        1  1449 2 1  7 VAL O    O  35.250 19.557  12.444 1.00 . B B .  7 VAL O    1 1 
        1  1450 2 1  8 PRO C    C  36.795 19.668  14.708 1.00 . B B .  8 PRO C    1 1 
        1  1451 2 1  8 PRO CA   C  37.258 18.428  13.941 1.00 . B B .  8 PRO CA   1 1 
        1  1452 2 1  8 PRO CB   C  38.732 18.061  14.286 1.00 . B B .  8 PRO CB   1 1 
        1  1453 2 1  8 PRO CD   C  38.543 18.145  11.890 1.00 . B B .  8 PRO CD   1 1 
        1  1454 2 1  8 PRO CG   C  39.520 18.358  13.041 1.00 . B B .  8 PRO CG   1 1 
        1  1455 2 1  8 PRO HA   H  36.611 17.598  14.175 1.00 . B B .  8 PRO HA   1 1 
        1  1456 2 1  8 PRO HB2  H  39.099 18.652  15.124 1.00 . B B .  8 PRO HB2  1 1 
        1  1457 2 1  8 PRO HB3  H  38.809 17.008  14.524 1.00 . B B .  8 PRO HB3  1 1 
        1  1458 2 1  8 PRO HD2  H  38.860 18.691  11.026 1.00 . B B .  8 PRO HD2  1 1 
        1  1459 2 1  8 PRO HD3  H  38.450 17.095  11.662 1.00 . B B .  8 PRO HD3  1 1 
        1  1460 2 1  8 PRO HG2  H  39.870 19.387  13.058 1.00 . B B .  8 PRO HG2  1 1 
        1  1461 2 1  8 PRO HG3  H  40.360 17.685  12.944 1.00 . B B .  8 PRO HG3  1 1 
        1  1462 2 1  8 PRO N    N  37.276 18.650  12.462 1.00 . B B .  8 PRO N    1 1 
        1  1463 2 1  8 PRO O    O  36.317 19.555  15.837 1.00 . B B .  8 PRO O    1 1 
        1  1464 2 1  9 TYR C    C  35.031 22.092  14.998 1.00 . B B .  9 TYR C    1 1 
        1  1465 2 1  9 TYR CA   C  36.542 22.078  14.756 1.00 . B B .  9 TYR CA   1 1 
        1  1466 2 1  9 TYR CB   C  36.936 23.270  13.888 1.00 . B B .  9 TYR CB   1 1 
        1  1467 2 1  9 TYR CD1  C  35.403 25.146  14.590 1.00 . B B .  9 TYR CD1  1 1 
        1  1468 2 1  9 TYR CD2  C  37.690 25.148  15.396 1.00 . B B .  9 TYR CD2  1 1 
        1  1469 2 1  9 TYR CE1  C  35.155 26.333  15.289 1.00 . B B .  9 TYR CE1  1 1 
        1  1470 2 1  9 TYR CE2  C  37.443 26.335  16.096 1.00 . B B .  9 TYR CE2  1 1 
        1  1471 2 1  9 TYR CG   C  36.670 24.553  14.642 1.00 . B B .  9 TYR CG   1 1 
        1  1472 2 1  9 TYR CZ   C  36.175 26.927  16.043 1.00 . B B .  9 TYR CZ   1 1 
        1  1473 2 1  9 TYR H    H  37.333 20.871  13.200 1.00 . B B .  9 TYR H    1 1 
        1  1474 2 1  9 TYR HA   H  37.052 22.151  15.706 1.00 . B B .  9 TYR HA   1 1 
        1  1475 2 1  9 TYR HB2  H  37.987 23.200  13.638 1.00 . B B .  9 TYR HB2  1 1 
        1  1476 2 1  9 TYR HB3  H  36.352 23.259  12.982 1.00 . B B .  9 TYR HB3  1 1 
        1  1477 2 1  9 TYR HD1  H  34.617 24.686  14.009 1.00 . B B .  9 TYR HD1  1 1 
        1  1478 2 1  9 TYR HD2  H  38.669 24.691  15.436 1.00 . B B .  9 TYR HD2  1 1 
        1  1479 2 1  9 TYR HE1  H  34.178 26.788  15.246 1.00 . B B .  9 TYR HE1  1 1 
        1  1480 2 1  9 TYR HE2  H  38.231 26.793  16.672 1.00 . B B .  9 TYR HE2  1 1 
        1  1481 2 1  9 TYR HH   H  35.433 28.681  16.161 1.00 . B B .  9 TYR HH   1 1 
        1  1482 2 1  9 TYR N    N  36.946 20.841  14.101 1.00 . B B .  9 TYR N    1 1 
        1  1483 2 1  9 TYR O    O  34.561 22.499  16.061 1.00 . B B .  9 TYR O    1 1 
        1  1484 2 1  9 TYR OH   O  35.933 28.095  16.734 1.00 . B B .  9 TYR OH   1 1 
        1  1485 2 1 10 PHE C    C  32.391 20.703  15.259 1.00 . B B . 10 PHE C    1 1 
        1  1486 2 1 10 PHE CA   C  32.819 21.611  14.103 1.00 . B B . 10 PHE CA   1 1 
        1  1487 2 1 10 PHE CB   C  32.209 21.107  12.767 1.00 . B B . 10 PHE CB   1 1 
        1  1488 2 1 10 PHE CD1  C  32.667 23.358  11.713 1.00 . B B . 10 PHE CD1  1 1 
        1  1489 2 1 10 PHE CD2  C  30.537 22.289  11.268 1.00 . B B . 10 PHE CD2  1 1 
        1  1490 2 1 10 PHE CE1  C  32.287 24.447  10.919 1.00 . B B . 10 PHE CE1  1 1 
        1  1491 2 1 10 PHE CE2  C  30.157 23.378  10.474 1.00 . B B . 10 PHE CE2  1 1 
        1  1492 2 1 10 PHE CG   C  31.792 22.279  11.887 1.00 . B B . 10 PHE CG   1 1 
        1  1493 2 1 10 PHE CZ   C  31.032 24.457  10.300 1.00 . B B . 10 PHE CZ   1 1 
        1  1494 2 1 10 PHE H    H  34.708 21.335  13.174 1.00 . B B . 10 PHE H    1 1 
        1  1495 2 1 10 PHE HA   H  32.462 22.610  14.312 1.00 . B B . 10 PHE HA   1 1 
        1  1496 2 1 10 PHE HB2  H  32.952 20.522  12.244 1.00 . B B . 10 PHE HB2  1 1 
        1  1497 2 1 10 PHE HB3  H  31.346 20.478  12.964 1.00 . B B . 10 PHE HB3  1 1 
        1  1498 2 1 10 PHE HD1  H  33.635 23.351  12.191 1.00 . B B . 10 PHE HD1  1 1 
        1  1499 2 1 10 PHE HD2  H  29.859 21.458  11.400 1.00 . B B . 10 PHE HD2  1 1 
        1  1500 2 1 10 PHE HE1  H  32.962 25.280  10.789 1.00 . B B . 10 PHE HE1  1 1 
        1  1501 2 1 10 PHE HE2  H  29.192 23.389   9.999 1.00 . B B . 10 PHE HE2  1 1 
        1  1502 2 1 10 PHE HZ   H  30.729 25.294   9.689 1.00 . B B . 10 PHE HZ   1 1 
        1  1503 2 1 10 PHE N    N  34.278 21.647  13.997 1.00 . B B . 10 PHE N    1 1 
        1  1504 2 1 10 PHE O    O  31.500 21.054  16.033 1.00 . B B . 10 PHE O    1 1 
        1  1505 2 1 11 ILE C    C  33.128 19.141  17.788 1.00 . B B . 11 ILE C    1 1 
        1  1506 2 1 11 ILE CA   C  32.693 18.596  16.427 1.00 . B B . 11 ILE CA   1 1 
        1  1507 2 1 11 ILE CB   C  33.377 17.249  16.156 1.00 . B B . 11 ILE CB   1 1 
        1  1508 2 1 11 ILE CD1  C  33.810 15.513  14.388 1.00 . B B . 11 ILE CD1  1 1 
        1  1509 2 1 11 ILE CG1  C  32.977 16.744  14.754 1.00 . B B . 11 ILE CG1  1 1 
        1  1510 2 1 11 ILE CG2  C  32.937 16.234  17.221 1.00 . B B . 11 ILE CG2  1 1 
        1  1511 2 1 11 ILE H    H  33.728 19.313  14.722 1.00 . B B . 11 ILE H    1 1 
        1  1512 2 1 11 ILE HA   H  31.626 18.444  16.437 1.00 . B B . 11 ILE HA   1 1 
        1  1513 2 1 11 ILE HB   H  34.447 17.375  16.202 1.00 . B B . 11 ILE HB   1 1 
        1  1514 2 1 11 ILE HD11 H  33.681 14.755  15.144 1.00 . B B . 11 ILE HD11 1 1 
        1  1515 2 1 11 ILE HD12 H  34.853 15.787  14.327 1.00 . B B . 11 ILE HD12 1 1 
        1  1516 2 1 11 ILE HD13 H  33.481 15.127  13.434 1.00 . B B . 11 ILE HD13 1 1 
        1  1517 2 1 11 ILE HG12 H  31.931 16.486  14.745 1.00 . B B . 11 ILE HG12 1 1 
        1  1518 2 1 11 ILE HG13 H  33.157 17.518  14.023 1.00 . B B . 11 ILE HG13 1 1 
        1  1519 2 1 11 ILE HG21 H  31.859 16.173  17.239 1.00 . B B . 11 ILE HG21 1 1 
        1  1520 2 1 11 ILE HG22 H  33.295 16.547  18.190 1.00 . B B . 11 ILE HG22 1 1 
        1  1521 2 1 11 ILE HG23 H  33.347 15.264  16.989 1.00 . B B . 11 ILE HG23 1 1 
        1  1522 2 1 11 ILE N    N  33.026 19.540  15.367 1.00 . B B . 11 ILE N    1 1 
        1  1523 2 1 11 ILE O    O  32.394 19.058  18.772 1.00 . B B . 11 ILE O    1 1 
        1  1524 2 1 12 GLU C    C  33.864 21.204  19.717 1.00 . B B . 12 GLU C    1 1 
        1  1525 2 1 12 GLU CA   C  34.876 20.247  19.077 1.00 . B B . 12 GLU CA   1 1 
        1  1526 2 1 12 GLU CB   C  36.194 20.998  18.775 1.00 . B B . 12 GLU CB   1 1 
        1  1527 2 1 12 GLU CD   C  37.748 19.490  20.053 1.00 . B B . 12 GLU CD   1 1 
        1  1528 2 1 12 GLU CG   C  37.371 20.012  18.667 1.00 . B B . 12 GLU CG   1 1 
        1  1529 2 1 12 GLU H    H  34.878 19.730  17.013 1.00 . B B . 12 GLU H    1 1 
        1  1530 2 1 12 GLU HA   H  35.073 19.440  19.767 1.00 . B B . 12 GLU HA   1 1 
        1  1531 2 1 12 GLU HB2  H  36.088 21.527  17.838 1.00 . B B . 12 GLU HB2  1 1 
        1  1532 2 1 12 GLU HB3  H  36.401 21.714  19.562 1.00 . B B . 12 GLU HB3  1 1 
        1  1533 2 1 12 GLU HG2  H  37.091 19.179  18.041 1.00 . B B . 12 GLU HG2  1 1 
        1  1534 2 1 12 GLU HG3  H  38.222 20.517  18.235 1.00 . B B . 12 GLU HG3  1 1 
        1  1535 2 1 12 GLU N    N  34.336 19.693  17.830 1.00 . B B . 12 GLU N    1 1 
        1  1536 2 1 12 GLU O    O  33.859 21.378  20.935 1.00 . B B . 12 GLU O    1 1 
        1  1537 2 1 12 GLU OE1  O  38.048 20.311  20.905 1.00 . B B . 12 GLU OE1  1 1 
        1  1538 2 1 12 GLU OE2  O  37.724 18.286  20.245 1.00 . B B . 12 GLU OE2  1 1 
        1  1539 2 1 13 ASN C    C  30.887 21.947  20.120 1.00 . B B . 13 ASN C    1 1 
        1  1540 2 1 13 ASN CA   C  31.987 22.721  19.395 1.00 . B B . 13 ASN CA   1 1 
        1  1541 2 1 13 ASN CB   C  31.386 23.515  18.235 1.00 . B B . 13 ASN CB   1 1 
        1  1542 2 1 13 ASN CG   C  30.354 24.504  18.764 1.00 . B B . 13 ASN CG   1 1 
        1  1543 2 1 13 ASN H    H  33.057 21.627  17.934 1.00 . B B . 13 ASN H    1 1 
        1  1544 2 1 13 ASN HA   H  32.443 23.414  20.090 1.00 . B B . 13 ASN HA   1 1 
        1  1545 2 1 13 ASN HB2  H  32.172 24.054  17.724 1.00 . B B . 13 ASN HB2  1 1 
        1  1546 2 1 13 ASN HB3  H  30.910 22.836  17.545 1.00 . B B . 13 ASN HB3  1 1 
        1  1547 2 1 13 ASN HD21 H  29.105 24.246  17.242 1.00 . B B . 13 ASN HD21 1 1 
        1  1548 2 1 13 ASN HD22 H  28.592 25.353  18.422 1.00 . B B . 13 ASN HD22 1 1 
        1  1549 2 1 13 ASN N    N  33.007 21.803  18.896 1.00 . B B . 13 ASN N    1 1 
        1  1550 2 1 13 ASN ND2  N  29.260 24.719  18.087 1.00 . B B . 13 ASN ND2  1 1 
        1  1551 2 1 13 ASN O    O  30.275 22.451  21.061 1.00 . B B . 13 ASN O    1 1 
        1  1552 2 1 13 ASN OD1  O  30.550 25.094  19.827 1.00 . B B . 13 ASN OD1  1 1 
        1  1553 2 1 14 LEU C    C  30.056 19.367  21.617 1.00 . B B . 14 LEU C    1 1 
        1  1554 2 1 14 LEU CA   C  29.611 19.869  20.255 1.00 . B B . 14 LEU CA   1 1 
        1  1555 2 1 14 LEU CB   C  29.329 18.676  19.335 1.00 . B B . 14 LEU CB   1 1 
        1  1556 2 1 14 LEU CD1  C  28.912 17.976  16.959 1.00 . B B . 14 LEU CD1  1 1 
        1  1557 2 1 14 LEU CD2  C  27.865 20.087  17.834 1.00 . B B . 14 LEU CD2  1 1 
        1  1558 2 1 14 LEU CG   C  29.100 19.171  17.898 1.00 . B B . 14 LEU CG   1 1 
        1  1559 2 1 14 LEU H    H  31.158 20.375  18.911 1.00 . B B . 14 LEU H    1 1 
        1  1560 2 1 14 LEU HA   H  28.703 20.439  20.380 1.00 . B B . 14 LEU HA   1 1 
        1  1561 2 1 14 LEU HB2  H  30.172 17.999  19.350 1.00 . B B . 14 LEU HB2  1 1 
        1  1562 2 1 14 LEU HB3  H  28.446 18.157  19.680 1.00 . B B . 14 LEU HB3  1 1 
        1  1563 2 1 14 LEU HD11 H  27.952 17.522  17.134 1.00 . B B . 14 LEU HD11 1 1 
        1  1564 2 1 14 LEU HD12 H  29.695 17.251  17.127 1.00 . B B . 14 LEU HD12 1 1 
        1  1565 2 1 14 LEU HD13 H  28.960 18.327  15.941 1.00 . B B . 14 LEU HD13 1 1 
        1  1566 2 1 14 LEU HD21 H  27.530 20.164  16.814 1.00 . B B . 14 LEU HD21 1 1 
        1  1567 2 1 14 LEU HD22 H  28.127 21.070  18.194 1.00 . B B . 14 LEU HD22 1 1 
        1  1568 2 1 14 LEU HD23 H  27.068 19.680  18.439 1.00 . B B . 14 LEU HD23 1 1 
        1  1569 2 1 14 LEU HG   H  29.966 19.728  17.576 1.00 . B B . 14 LEU HG   1 1 
        1  1570 2 1 14 LEU N    N  30.637 20.724  19.664 1.00 . B B . 14 LEU N    1 1 
        1  1571 2 1 14 LEU O    O  29.248 19.227  22.535 1.00 . B B . 14 LEU O    1 1 
        1  1572 2 1 15 LYS C    C  31.562 19.557  24.134 1.00 . B B . 15 LYS C    1 1 
        1  1573 2 1 15 LYS CA   C  31.899 18.595  22.996 1.00 . B B . 15 LYS CA   1 1 
        1  1574 2 1 15 LYS CB   C  33.420 18.442  22.883 1.00 . B B . 15 LYS CB   1 1 
        1  1575 2 1 15 LYS CD   C  35.465 17.544  24.004 1.00 . B B . 15 LYS CD   1 1 
        1  1576 2 1 15 LYS CE   C  36.000 16.863  25.264 1.00 . B B . 15 LYS CE   1 1 
        1  1577 2 1 15 LYS CG   C  33.963 17.773  24.151 1.00 . B B . 15 LYS CG   1 1 
        1  1578 2 1 15 LYS H    H  31.949 19.224  20.980 1.00 . B B . 15 LYS H    1 1 
        1  1579 2 1 15 LYS HA   H  31.476 17.628  23.200 1.00 . B B . 15 LYS HA   1 1 
        1  1580 2 1 15 LYS HB2  H  33.656 17.830  22.024 1.00 . B B . 15 LYS HB2  1 1 
        1  1581 2 1 15 LYS HB3  H  33.873 19.414  22.768 1.00 . B B . 15 LYS HB3  1 1 
        1  1582 2 1 15 LYS HD2  H  35.650 16.913  23.146 1.00 . B B . 15 LYS HD2  1 1 
        1  1583 2 1 15 LYS HD3  H  35.964 18.491  23.869 1.00 . B B . 15 LYS HD3  1 1 
        1  1584 2 1 15 LYS HE2  H  35.829 17.501  26.118 1.00 . B B . 15 LYS HE2  1 1 
        1  1585 2 1 15 LYS HE3  H  35.490 15.922  25.409 1.00 . B B . 15 LYS HE3  1 1 
        1  1586 2 1 15 LYS HG2  H  33.781 18.410  25.004 1.00 . B B . 15 LYS HG2  1 1 
        1  1587 2 1 15 LYS HG3  H  33.469 16.825  24.297 1.00 . B B . 15 LYS HG3  1 1 
        1  1588 2 1 15 LYS HZ1  H  37.626 15.608  24.928 1.00 . B B . 15 LYS HZ1  1 1 
        1  1589 2 1 15 LYS HZ2  H  37.952 16.895  25.983 1.00 . B B . 15 LYS HZ2  1 1 
        1  1590 2 1 15 LYS HZ3  H  37.823 17.180  24.313 1.00 . B B . 15 LYS HZ3  1 1 
        1  1591 2 1 15 LYS N    N  31.351 19.093  21.746 1.00 . B B . 15 LYS N    1 1 
        1  1592 2 1 15 LYS NZ   N  37.461 16.617  25.111 1.00 . B B . 15 LYS NZ   1 1 
        1  1593 2 1 15 LYS O    O  31.254 19.131  25.247 1.00 . B B . 15 LYS O    1 1 
        1  1594 2 1 16 GLN C    C  29.858 21.805  25.253 1.00 . B B . 16 GLN C    1 1 
        1  1595 2 1 16 GLN CA   C  31.326 21.869  24.852 1.00 . B B . 16 GLN CA   1 1 
        1  1596 2 1 16 GLN CB   C  31.656 23.262  24.307 1.00 . B B . 16 GLN CB   1 1 
        1  1597 2 1 16 GLN CD   C  31.955 25.668  24.932 1.00 . B B . 16 GLN CD   1 1 
        1  1598 2 1 16 GLN CG   C  31.468 24.306  25.412 1.00 . B B . 16 GLN CG   1 1 
        1  1599 2 1 16 GLN H    H  31.881 21.133  22.942 1.00 . B B . 16 GLN H    1 1 
        1  1600 2 1 16 GLN HA   H  31.924 21.690  25.729 1.00 . B B . 16 GLN HA   1 1 
        1  1601 2 1 16 GLN HB2  H  32.681 23.280  23.965 1.00 . B B . 16 GLN HB2  1 1 
        1  1602 2 1 16 GLN HB3  H  30.998 23.492  23.483 1.00 . B B . 16 GLN HB3  1 1 
        1  1603 2 1 16 GLN HE21 H  32.640 26.213  26.715 1.00 . B B . 16 GLN HE21 1 1 
        1  1604 2 1 16 GLN HE22 H  32.844 27.358  25.478 1.00 . B B . 16 GLN HE22 1 1 
        1  1605 2 1 16 GLN HG2  H  30.421 24.372  25.672 1.00 . B B . 16 GLN HG2  1 1 
        1  1606 2 1 16 GLN HG3  H  32.034 24.013  26.282 1.00 . B B . 16 GLN HG3  1 1 
        1  1607 2 1 16 GLN N    N  31.630 20.853  23.847 1.00 . B B . 16 GLN N    1 1 
        1  1608 2 1 16 GLN NE2  N  32.527 26.481  25.778 1.00 . B B . 16 GLN NE2  1 1 
        1  1609 2 1 16 GLN O    O  29.517 22.019  26.416 1.00 . B B . 16 GLN O    1 1 
        1  1610 2 1 16 GLN OE1  O  31.809 26.002  23.757 1.00 . B B . 16 GLN OE1  1 1 
        1  1611 2 1 17 HIS C    C  27.276 20.312  25.568 1.00 . B B . 17 HIS C    1 1 
        1  1612 2 1 17 HIS CA   C  27.566 21.433  24.571 1.00 . B B . 17 HIS CA   1 1 
        1  1613 2 1 17 HIS CB   C  26.793 21.175  23.275 1.00 . B B . 17 HIS CB   1 1 
        1  1614 2 1 17 HIS CD2  C  26.880 22.403  20.953 1.00 . B B . 17 HIS CD2  1 1 
        1  1615 2 1 17 HIS CE1  C  27.653 24.308  21.635 1.00 . B B . 17 HIS CE1  1 1 
        1  1616 2 1 17 HIS CG   C  27.052 22.298  22.311 1.00 . B B . 17 HIS CG   1 1 
        1  1617 2 1 17 HIS H    H  29.323 21.351  23.378 1.00 . B B . 17 HIS H    1 1 
        1  1618 2 1 17 HIS HA   H  27.240 22.370  24.990 1.00 . B B . 17 HIS HA   1 1 
        1  1619 2 1 17 HIS HB2  H  27.115 20.243  22.840 1.00 . B B . 17 HIS HB2  1 1 
        1  1620 2 1 17 HIS HB3  H  25.737 21.124  23.491 1.00 . B B . 17 HIS HB3  1 1 
        1  1621 2 1 17 HIS HD1  H  27.779 23.776  23.643 1.00 . B B . 17 HIS HD1  1 1 
        1  1622 2 1 17 HIS HD2  H  26.508 21.617  20.310 1.00 . B B . 17 HIS HD2  1 1 
        1  1623 2 1 17 HIS HE1  H  28.017 25.325  21.653 1.00 . B B . 17 HIS HE1  1 1 
        1  1624 2 1 17 HIS HE2  H  27.246 24.023  19.614 1.00 . B B . 17 HIS HE2  1 1 
        1  1625 2 1 17 HIS N    N  28.993 21.512  24.288 1.00 . B B . 17 HIS N    1 1 
        1  1626 2 1 17 HIS ND1  N  27.547 23.525  22.725 1.00 . B B . 17 HIS ND1  1 1 
        1  1627 2 1 17 HIS NE2  N  27.259 23.673  20.528 1.00 . B B . 17 HIS NE2  1 1 
        1  1628 2 1 17 HIS O    O  26.606 20.524  26.580 1.00 . B B . 17 HIS O    1 1 
        1  1629 2 1 18 ILE C    C  28.424 18.097  27.420 1.00 . B B . 18 ILE C    1 1 
        1  1630 2 1 18 ILE CA   C  27.580 17.968  26.154 1.00 . B B . 18 ILE CA   1 1 
        1  1631 2 1 18 ILE CB   C  27.929 16.667  25.406 1.00 . B B . 18 ILE CB   1 1 
        1  1632 2 1 18 ILE CD1  C  29.743 15.496  24.088 1.00 . B B . 18 ILE CD1  1 1 
        1  1633 2 1 18 ILE CG1  C  29.405 16.699  24.979 1.00 . B B . 18 ILE CG1  1 1 
        1  1634 2 1 18 ILE CG2  C  27.036 16.537  24.164 1.00 . B B . 18 ILE CG2  1 1 
        1  1635 2 1 18 ILE H    H  28.310 19.010  24.453 1.00 . B B . 18 ILE H    1 1 
        1  1636 2 1 18 ILE HA   H  26.538 17.932  26.440 1.00 . B B . 18 ILE HA   1 1 
        1  1637 2 1 18 ILE HB   H  27.760 15.824  26.060 1.00 . B B . 18 ILE HB   1 1 
        1  1638 2 1 18 ILE HD11 H  29.320 14.598  24.515 1.00 . B B . 18 ILE HD11 1 1 
        1  1639 2 1 18 ILE HD12 H  30.817 15.392  24.020 1.00 . B B . 18 ILE HD12 1 1 
        1  1640 2 1 18 ILE HD13 H  29.333 15.655  23.103 1.00 . B B . 18 ILE HD13 1 1 
        1  1641 2 1 18 ILE HG12 H  29.584 17.610  24.440 1.00 . B B . 18 ILE HG12 1 1 
        1  1642 2 1 18 ILE HG13 H  30.037 16.667  25.850 1.00 . B B . 18 ILE HG13 1 1 
        1  1643 2 1 18 ILE HG21 H  27.342 17.257  23.417 1.00 . B B . 18 ILE HG21 1 1 
        1  1644 2 1 18 ILE HG22 H  26.015 16.720  24.437 1.00 . B B . 18 ILE HG22 1 1 
        1  1645 2 1 18 ILE HG23 H  27.121 15.541  23.758 1.00 . B B . 18 ILE HG23 1 1 
        1  1646 2 1 18 ILE N    N  27.783 19.120  25.274 1.00 . B B . 18 ILE N    1 1 
        1  1647 2 1 18 ILE O    O  27.958 17.820  28.526 1.00 . B B . 18 ILE O    1 1 
        1  1648 2 1 19 GLU C    C  30.074 19.746  29.328 1.00 . B B . 19 GLU C    1 1 
        1  1649 2 1 19 GLU CA   C  30.570 18.658  28.385 1.00 . B B . 19 GLU CA   1 1 
        1  1650 2 1 19 GLU CB   C  31.978 19.014  27.886 1.00 . B B . 19 GLU CB   1 1 
        1  1651 2 1 19 GLU CD   C  34.379 19.317  28.554 1.00 . B B . 19 GLU CD   1 1 
        1  1652 2 1 19 GLU CG   C  32.958 19.089  29.062 1.00 . B B . 19 GLU CG   1 1 
        1  1653 2 1 19 GLU H    H  29.989 18.722  26.342 1.00 . B B . 19 GLU H    1 1 
        1  1654 2 1 19 GLU HA   H  30.617 17.722  28.919 1.00 . B B . 19 GLU HA   1 1 
        1  1655 2 1 19 GLU HB2  H  32.314 18.258  27.193 1.00 . B B . 19 GLU HB2  1 1 
        1  1656 2 1 19 GLU HB3  H  31.948 19.972  27.389 1.00 . B B . 19 GLU HB3  1 1 
        1  1657 2 1 19 GLU HG2  H  32.683 19.906  29.712 1.00 . B B . 19 GLU HG2  1 1 
        1  1658 2 1 19 GLU HG3  H  32.925 18.163  29.616 1.00 . B B . 19 GLU HG3  1 1 
        1  1659 2 1 19 GLU N    N  29.673 18.516  27.246 1.00 . B B . 19 GLU N    1 1 
        1  1660 2 1 19 GLU O    O  29.871 19.497  30.516 1.00 . B B . 19 GLU O    1 1 
        1  1661 2 1 19 GLU OE1  O  34.531 19.666  27.395 1.00 . B B . 19 GLU OE1  1 1 
        1  1662 2 1 19 GLU OE2  O  35.297 19.138  29.338 1.00 . B B . 19 GLU OE2  1 1 
        1  1663 2 1 20 MET C    C  27.874 22.230  29.427 1.00 . B B . 20 MET C    1 1 
        1  1664 2 1 20 MET CA   C  29.388 22.071  29.602 1.00 . B B . 20 MET CA   1 1 
        1  1665 2 1 20 MET CB   C  30.104 23.360  29.175 1.00 . B B . 20 MET CB   1 1 
        1  1666 2 1 20 MET CE   C  34.059 24.037  28.505 1.00 . B B . 20 MET CE   1 1 
        1  1667 2 1 20 MET CG   C  31.615 23.171  29.296 1.00 . B B . 20 MET CG   1 1 
        1  1668 2 1 20 MET H    H  30.049 21.088  27.842 1.00 . B B . 20 MET H    1 1 
        1  1669 2 1 20 MET HA   H  29.596 21.890  30.648 1.00 . B B . 20 MET HA   1 1 
        1  1670 2 1 20 MET HB2  H  29.850 23.600  28.156 1.00 . B B . 20 MET HB2  1 1 
        1  1671 2 1 20 MET HB3  H  29.802 24.171  29.819 1.00 . B B . 20 MET HB3  1 1 
        1  1672 2 1 20 MET HE1  H  34.782 24.835  28.427 1.00 . B B . 20 MET HE1  1 1 
        1  1673 2 1 20 MET HE2  H  34.000 23.501  27.565 1.00 . B B . 20 MET HE2  1 1 
        1  1674 2 1 20 MET HE3  H  34.359 23.357  29.285 1.00 . B B . 20 MET HE3  1 1 
        1  1675 2 1 20 MET HG2  H  31.863 22.877  30.305 1.00 . B B . 20 MET HG2  1 1 
        1  1676 2 1 20 MET HG3  H  31.939 22.405  28.607 1.00 . B B . 20 MET HG3  1 1 
        1  1677 2 1 20 MET N    N  29.870 20.947  28.796 1.00 . B B . 20 MET N    1 1 
        1  1678 2 1 20 MET O    O  27.147 21.247  29.287 1.00 . B B . 20 MET O    1 1 
        1  1679 2 1 20 MET SD   S  32.438 24.732  28.899 1.00 . B B . 20 MET SD   1 1 
        1  1680 2 1 21 ASN C    C  25.756 25.235  29.125 1.00 . B B . 21 ASN C    1 1 
        1  1681 2 1 21 ASN CA   C  25.990 23.746  29.298 1.00 . B B . 21 ASN CA   1 1 
        1  1682 2 1 21 ASN CB   C  25.234 23.245  30.529 1.00 . B B . 21 ASN CB   1 1 
        1  1683 2 1 21 ASN CG   C  25.738 23.963  31.777 1.00 . B B . 21 ASN CG   1 1 
        1  1684 2 1 21 ASN H    H  28.039 24.220  29.561 1.00 . B B . 21 ASN H    1 1 
        1  1685 2 1 21 ASN HA   H  25.618 23.227  28.424 1.00 . B B . 21 ASN HA   1 1 
        1  1686 2 1 21 ASN HB2  H  24.179 23.438  30.406 1.00 . B B . 21 ASN HB2  1 1 
        1  1687 2 1 21 ASN HB3  H  25.393 22.183  30.641 1.00 . B B . 21 ASN HB3  1 1 
        1  1688 2 1 21 ASN HD21 H  24.640 22.877  33.024 1.00 . B B . 21 ASN HD21 1 1 
        1  1689 2 1 21 ASN HD22 H  25.612 24.060  33.756 1.00 . B B . 21 ASN HD22 1 1 
        1  1690 2 1 21 ASN N    N  27.412 23.476  29.447 1.00 . B B . 21 ASN N    1 1 
        1  1691 2 1 21 ASN ND2  N  25.292 23.603  32.951 1.00 . B B . 21 ASN ND2  1 1 
        1  1692 2 1 21 ASN O    O  24.874 25.811  29.761 1.00 . B B . 21 ASN O    1 1 
        1  1693 2 1 21 ASN OD1  O  26.555 24.878  31.681 1.00 . B B . 21 ASN OD1  1 1 
        1  1694 2 1 22 GLN C    C  24.987 27.636  27.614 1.00 . B B . 22 GLN C    1 1 
        1  1695 2 1 22 GLN CA   C  26.418 27.288  28.016 1.00 . B B . 22 GLN CA   1 1 
        1  1696 2 1 22 GLN CB   C  27.380 27.707  26.902 1.00 . B B . 22 GLN CB   1 1 
        1  1697 2 1 22 GLN CD   C  29.785 27.922  26.255 1.00 . B B . 22 GLN CD   1 1 
        1  1698 2 1 22 GLN CG   C  28.825 27.549  27.378 1.00 . B B . 22 GLN CG   1 1 
        1  1699 2 1 22 GLN H    H  27.233 25.347  27.778 1.00 . B B . 22 GLN H    1 1 
        1  1700 2 1 22 GLN HA   H  26.671 27.821  28.920 1.00 . B B . 22 GLN HA   1 1 
        1  1701 2 1 22 GLN HB2  H  27.219 27.076  26.041 1.00 . B B . 22 GLN HB2  1 1 
        1  1702 2 1 22 GLN HB3  H  27.201 28.737  26.638 1.00 . B B . 22 GLN HB3  1 1 
        1  1703 2 1 22 GLN HE21 H  30.560 29.465  27.235 1.00 . B B . 22 GLN HE21 1 1 
        1  1704 2 1 22 GLN HE22 H  31.204 29.191  25.689 1.00 . B B . 22 GLN HE22 1 1 
        1  1705 2 1 22 GLN HG2  H  28.995 28.197  28.227 1.00 . B B . 22 GLN HG2  1 1 
        1  1706 2 1 22 GLN HG3  H  28.996 26.524  27.670 1.00 . B B . 22 GLN HG3  1 1 
        1  1707 2 1 22 GLN N    N  26.548 25.857  28.257 1.00 . B B . 22 GLN N    1 1 
        1  1708 2 1 22 GLN NE2  N  30.583 28.944  26.406 1.00 . B B . 22 GLN NE2  1 1 
        1  1709 2 1 22 GLN O    O  24.408 28.606  28.105 1.00 . B B . 22 GLN O    1 1 
        1  1710 2 1 22 GLN OE1  O  29.815 27.264  25.215 1.00 . B B . 22 GLN OE1  1 1 
        1  1711 2 1 23 SER C    C  22.658 25.999  25.238 1.00 . B B . 23 SER C    1 1 
        1  1712 2 1 23 SER CA   C  23.054 27.063  26.258 1.00 . B B . 23 SER CA   1 1 
        1  1713 2 1 23 SER CB   C  22.932 28.466  25.631 1.00 . B B . 23 SER CB   1 1 
        1  1714 2 1 23 SER H    H  24.930 26.076  26.360 1.00 . B B . 23 SER H    1 1 
        1  1715 2 1 23 SER HA   H  22.388 27.001  27.104 1.00 . B B . 23 SER HA   1 1 
        1  1716 2 1 23 SER HB2  H  23.838 28.710  25.106 1.00 . B B . 23 SER HB2  1 1 
        1  1717 2 1 23 SER HB3  H  22.100 28.491  24.933 1.00 . B B . 23 SER HB3  1 1 
        1  1718 2 1 23 SER HG   H  22.470 28.953  27.457 1.00 . B B . 23 SER HG   1 1 
        1  1719 2 1 23 SER N    N  24.421 26.834  26.719 1.00 . B B . 23 SER N    1 1 
        1  1720 2 1 23 SER O    O  22.502 26.301  24.056 1.00 . B B . 23 SER O    1 1 
        1  1721 2 1 23 SER OG   O  22.717 29.425  26.658 1.00 . B B . 23 SER OG   1 1 
        1  1722 2 1 24 GLU C    C  21.630 22.465  25.602 1.00 . B B . 24 GLU C    1 1 
        1  1723 2 1 24 GLU CA   C  22.108 23.677  24.798 1.00 . B B . 24 GLU CA   1 1 
        1  1724 2 1 24 GLU CB   C  23.306 23.296  23.890 1.00 . B B . 24 GLU CB   1 1 
        1  1725 2 1 24 GLU CD   C  22.190 23.678  21.669 1.00 . B B . 24 GLU CD   1 1 
        1  1726 2 1 24 GLU CG   C  22.799 22.623  22.595 1.00 . B B . 24 GLU CG   1 1 
        1  1727 2 1 24 GLU H    H  22.631 24.579  26.649 1.00 . B B . 24 GLU H    1 1 
        1  1728 2 1 24 GLU HA   H  21.287 24.014  24.179 1.00 . B B . 24 GLU HA   1 1 
        1  1729 2 1 24 GLU HB2  H  23.857 24.192  23.644 1.00 . B B . 24 GLU HB2  1 1 
        1  1730 2 1 24 GLU HB3  H  23.966 22.616  24.412 1.00 . B B . 24 GLU HB3  1 1 
        1  1731 2 1 24 GLU HG2  H  23.626 22.143  22.091 1.00 . B B . 24 GLU HG2  1 1 
        1  1732 2 1 24 GLU HG3  H  22.050 21.883  22.836 1.00 . B B . 24 GLU HG3  1 1 
        1  1733 2 1 24 GLU N    N  22.494 24.762  25.697 1.00 . B B . 24 GLU N    1 1 
        1  1734 2 1 24 GLU O    O  20.845 22.601  26.542 1.00 . B B . 24 GLU O    1 1 
        1  1735 2 1 24 GLU OE1  O  22.735 24.767  21.617 1.00 . B B . 24 GLU OE1  1 1 
        1  1736 2 1 24 GLU OE2  O  21.194 23.383  21.028 1.00 . B B . 24 GLU OE2  1 1 
        1  1737 2 1 25 ASP C    C  22.787 18.990  25.698 1.00 . B B . 25 ASP C    1 1 
        1  1738 2 1 25 ASP CA   C  21.727 20.057  25.911 1.00 . B B . 25 ASP CA   1 1 
        1  1739 2 1 25 ASP CB   C  20.384 19.565  25.366 1.00 . B B . 25 ASP CB   1 1 
        1  1740 2 1 25 ASP CG   C  19.287 20.568  25.713 1.00 . B B . 25 ASP CG   1 1 
        1  1741 2 1 25 ASP H    H  22.734 21.236  24.472 1.00 . B B . 25 ASP H    1 1 
        1  1742 2 1 25 ASP HA   H  21.628 20.241  26.976 1.00 . B B . 25 ASP HA   1 1 
        1  1743 2 1 25 ASP HB2  H  20.457 19.461  24.291 1.00 . B B . 25 ASP HB2  1 1 
        1  1744 2 1 25 ASP HB3  H  20.141 18.609  25.805 1.00 . B B . 25 ASP HB3  1 1 
        1  1745 2 1 25 ASP N    N  22.111 21.285  25.227 1.00 . B B . 25 ASP N    1 1 
        1  1746 2 1 25 ASP O    O  23.892 19.269  25.233 1.00 . B B . 25 ASP O    1 1 
        1  1747 2 1 25 ASP OD1  O  19.156 20.887  26.883 1.00 . B B . 25 ASP OD1  1 1 
        1  1748 2 1 25 ASP OD2  O  18.598 21.003  24.806 1.00 . B B . 25 ASP OD2  1 1 
        1  1749 2 1 26 LYS C    C  23.326 16.106  24.451 1.00 . B B . 26 LYS C    1 1 
        1  1750 2 1 26 LYS CA   C  23.366 16.644  25.890 1.00 . B B . 26 LYS CA   1 1 
        1  1751 2 1 26 LYS CB   C  23.008 15.550  26.899 1.00 . B B . 26 LYS CB   1 1 
        1  1752 2 1 26 LYS CD   C  23.833 13.433  28.027 1.00 . B B . 26 LYS CD   1 1 
        1  1753 2 1 26 LYS CE   C  22.714 12.457  27.621 1.00 . B B . 26 LYS CE   1 1 
        1  1754 2 1 26 LYS CG   C  24.103 14.469  26.912 1.00 . B B . 26 LYS CG   1 1 
        1  1755 2 1 26 LYS H    H  21.543 17.594  26.412 1.00 . B B . 26 LYS H    1 1 
        1  1756 2 1 26 LYS HA   H  24.371 16.989  26.100 1.00 . B B . 26 LYS HA   1 1 
        1  1757 2 1 26 LYS HB2  H  22.927 15.994  27.879 1.00 . B B . 26 LYS HB2  1 1 
        1  1758 2 1 26 LYS HB3  H  22.063 15.114  26.630 1.00 . B B . 26 LYS HB3  1 1 
        1  1759 2 1 26 LYS HD2  H  24.737 12.868  28.206 1.00 . B B . 26 LYS HD2  1 1 
        1  1760 2 1 26 LYS HD3  H  23.550 13.942  28.936 1.00 . B B . 26 LYS HD3  1 1 
        1  1761 2 1 26 LYS HE2  H  22.611 11.700  28.384 1.00 . B B . 26 LYS HE2  1 1 
        1  1762 2 1 26 LYS HE3  H  21.780 12.986  27.521 1.00 . B B . 26 LYS HE3  1 1 
        1  1763 2 1 26 LYS HG2  H  24.135 13.978  25.955 1.00 . B B . 26 LYS HG2  1 1 
        1  1764 2 1 26 LYS HG3  H  25.061 14.943  27.094 1.00 . B B . 26 LYS HG3  1 1 
        1  1765 2 1 26 LYS HZ1  H  22.430 11.001  26.163 1.00 . B B . 26 LYS HZ1  1 1 
        1  1766 2 1 26 LYS HZ2  H  24.045 11.472  26.366 1.00 . B B . 26 LYS HZ2  1 1 
        1  1767 2 1 26 LYS HZ3  H  22.960 12.497  25.558 1.00 . B B . 26 LYS HZ3  1 1 
        1  1768 2 1 26 LYS N    N  22.438 17.757  26.047 1.00 . B B . 26 LYS N    1 1 
        1  1769 2 1 26 LYS NZ   N  23.063 11.807  26.329 1.00 . B B . 26 LYS NZ   1 1 
        1  1770 2 1 26 LYS O    O  23.854 16.741  23.538 1.00 . B B . 26 LYS O    1 1 
        1  1771 2 1 27 ILE C    C  21.820 15.231  22.009 1.00 . B B . 27 ILE C    1 1 
        1  1772 2 1 27 ILE CA   C  22.622 14.340  22.943 1.00 . B B . 27 ILE CA   1 1 
        1  1773 2 1 27 ILE CB   C  21.970 12.962  23.053 1.00 . B B . 27 ILE CB   1 1 
        1  1774 2 1 27 ILE CD1  C  21.665 10.769  21.842 1.00 . B B . 27 ILE CD1  1 1 
        1  1775 2 1 27 ILE CG1  C  22.032 12.247  21.688 1.00 . B B . 27 ILE CG1  1 1 
        1  1776 2 1 27 ILE CG2  C  20.510 13.104  23.512 1.00 . B B . 27 ILE CG2  1 1 
        1  1777 2 1 27 ILE H    H  22.310 14.482  25.029 1.00 . B B . 27 ILE H    1 1 
        1  1778 2 1 27 ILE HA   H  23.613 14.215  22.536 1.00 . B B . 27 ILE HA   1 1 
        1  1779 2 1 27 ILE HB   H  22.511 12.380  23.784 1.00 . B B . 27 ILE HB   1 1 
        1  1780 2 1 27 ILE HD11 H  20.946 10.637  22.634 1.00 . B B . 27 ILE HD11 1 1 
        1  1781 2 1 27 ILE HD12 H  22.560 10.208  22.069 1.00 . B B . 27 ILE HD12 1 1 
        1  1782 2 1 27 ILE HD13 H  21.241 10.411  20.921 1.00 . B B . 27 ILE HD13 1 1 
        1  1783 2 1 27 ILE HG12 H  21.346 12.717  21.000 1.00 . B B . 27 ILE HG12 1 1 
        1  1784 2 1 27 ILE HG13 H  23.038 12.310  21.288 1.00 . B B . 27 ILE HG13 1 1 
        1  1785 2 1 27 ILE HG21 H  20.120 12.132  23.775 1.00 . B B . 27 ILE HG21 1 1 
        1  1786 2 1 27 ILE HG22 H  19.915 13.525  22.715 1.00 . B B . 27 ILE HG22 1 1 
        1  1787 2 1 27 ILE HG23 H  20.465 13.753  24.375 1.00 . B B . 27 ILE HG23 1 1 
        1  1788 2 1 27 ILE N    N  22.712 14.942  24.264 1.00 . B B . 27 ILE N    1 1 
        1  1789 2 1 27 ILE O    O  22.103 15.300  20.812 1.00 . B B . 27 ILE O    1 1 
        1  1790 2 1 28 HIS C    C  20.782 18.006  21.269 1.00 . B B . 28 HIS C    1 1 
        1  1791 2 1 28 HIS CA   C  19.980 16.791  21.750 1.00 . B B . 28 HIS CA   1 1 
        1  1792 2 1 28 HIS CB   C  18.775 17.249  22.578 1.00 . B B . 28 HIS CB   1 1 
        1  1793 2 1 28 HIS CD2  C  17.605 15.403  24.044 1.00 . B B . 28 HIS CD2  1 1 
        1  1794 2 1 28 HIS CE1  C  16.451 14.446  22.481 1.00 . B B . 28 HIS CE1  1 1 
        1  1795 2 1 28 HIS CG   C  17.885 16.071  22.879 1.00 . B B . 28 HIS CG   1 1 
        1  1796 2 1 28 HIS H    H  20.635 15.812  23.512 1.00 . B B . 28 HIS H    1 1 
        1  1797 2 1 28 HIS HA   H  19.624 16.250  20.887 1.00 . B B . 28 HIS HA   1 1 
        1  1798 2 1 28 HIS HB2  H  19.119 17.677  23.504 1.00 . B B . 28 HIS HB2  1 1 
        1  1799 2 1 28 HIS HB3  H  18.217 17.988  22.023 1.00 . B B . 28 HIS HB3  1 1 
        1  1800 2 1 28 HIS HD1  H  17.114 15.681  20.944 1.00 . B B . 28 HIS HD1  1 1 
        1  1801 2 1 28 HIS HD2  H  18.025 15.638  25.012 1.00 . B B . 28 HIS HD2  1 1 
        1  1802 2 1 28 HIS HE1  H  15.781 13.781  21.957 1.00 . B B . 28 HIS HE1  1 1 
        1  1803 2 1 28 HIS HE2  H  16.325 13.741  24.436 1.00 . B B . 28 HIS HE2  1 1 
        1  1804 2 1 28 HIS N    N  20.814 15.906  22.553 1.00 . B B . 28 HIS N    1 1 
        1  1805 2 1 28 HIS ND1  N  17.138 15.442  21.894 1.00 . B B . 28 HIS ND1  1 1 
        1  1806 2 1 28 HIS NE2  N  16.700 14.378  23.791 1.00 . B B . 28 HIS NE2  1 1 
        1  1807 2 1 28 HIS O    O  20.221 18.941  20.697 1.00 . B B . 28 HIS O    1 1 
        1  1808 2 1 29 ALA C    C  23.210 19.024  19.573 1.00 . B B . 29 ALA C    1 1 
        1  1809 2 1 29 ALA CA   C  22.968 19.076  21.078 1.00 . B B . 29 ALA CA   1 1 
        1  1810 2 1 29 ALA CB   C  24.305 18.986  21.814 1.00 . B B . 29 ALA CB   1 1 
        1  1811 2 1 29 ALA H    H  22.483 17.209  21.959 1.00 . B B . 29 ALA H    1 1 
        1  1812 2 1 29 ALA HA   H  22.501 20.020  21.324 1.00 . B B . 29 ALA HA   1 1 
        1  1813 2 1 29 ALA HB1  H  24.741 18.012  21.650 1.00 . B B . 29 ALA HB1  1 1 
        1  1814 2 1 29 ALA HB2  H  24.141 19.134  22.869 1.00 . B B . 29 ALA HB2  1 1 
        1  1815 2 1 29 ALA HB3  H  24.975 19.748  21.445 1.00 . B B . 29 ALA HB3  1 1 
        1  1816 2 1 29 ALA N    N  22.091 17.981  21.499 1.00 . B B . 29 ALA N    1 1 
        1  1817 2 1 29 ALA O    O  23.144 20.042  18.884 1.00 . B B . 29 ALA O    1 1 
        1  1818 2 1 30 MET C    C  22.506 18.052  16.853 1.00 . B B . 30 MET C    1 1 
        1  1819 2 1 30 MET CA   C  23.740 17.645  17.650 1.00 . B B . 30 MET CA   1 1 
        1  1820 2 1 30 MET CB   C  24.082 16.161  17.358 1.00 . B B . 30 MET CB   1 1 
        1  1821 2 1 30 MET CE   C  21.316 13.853  17.077 1.00 . B B . 30 MET CE   1 1 
        1  1822 2 1 30 MET CG   C  23.312 15.249  18.338 1.00 . B B . 30 MET CG   1 1 
        1  1823 2 1 30 MET H    H  23.531 17.051  19.668 1.00 . B B . 30 MET H    1 1 
        1  1824 2 1 30 MET HA   H  24.572 18.269  17.350 1.00 . B B . 30 MET HA   1 1 
        1  1825 2 1 30 MET HB2  H  23.809 15.909  16.339 1.00 . B B . 30 MET HB2  1 1 
        1  1826 2 1 30 MET HB3  H  25.145 16.001  17.485 1.00 . B B . 30 MET HB3  1 1 
        1  1827 2 1 30 MET HE1  H  20.977 12.972  16.552 1.00 . B B . 30 MET HE1  1 1 
        1  1828 2 1 30 MET HE2  H  21.253 14.715  16.426 1.00 . B B . 30 MET HE2  1 1 
        1  1829 2 1 30 MET HE3  H  20.693 14.015  17.943 1.00 . B B . 30 MET HE3  1 1 
        1  1830 2 1 30 MET HG2  H  23.882 15.134  19.247 1.00 . B B . 30 MET HG2  1 1 
        1  1831 2 1 30 MET HG3  H  22.359 15.696  18.573 1.00 . B B . 30 MET HG3  1 1 
        1  1832 2 1 30 MET N    N  23.492 17.828  19.071 1.00 . B B . 30 MET N    1 1 
        1  1833 2 1 30 MET O    O  22.631 18.773  15.864 1.00 . B B . 30 MET O    1 1 
        1  1834 2 1 30 MET SD   S  23.040 13.621  17.598 1.00 . B B . 30 MET SD   1 1 
        1  1835 2 1 31 ASN C    C  19.990 19.441  16.357 1.00 . B B . 31 ASN C    1 1 
        1  1836 2 1 31 ASN CA   C  20.106 17.928  16.550 1.00 . B B . 31 ASN CA   1 1 
        1  1837 2 1 31 ASN CB   C  18.894 17.424  17.343 1.00 . B B . 31 ASN CB   1 1 
        1  1838 2 1 31 ASN CG   C  17.603 17.751  16.597 1.00 . B B . 31 ASN CG   1 1 
        1  1839 2 1 31 ASN H    H  21.290 17.027  18.070 1.00 . B B . 31 ASN H    1 1 
        1  1840 2 1 31 ASN HA   H  20.121 17.447  15.586 1.00 . B B . 31 ASN HA   1 1 
        1  1841 2 1 31 ASN HB2  H  18.972 16.355  17.471 1.00 . B B . 31 ASN HB2  1 1 
        1  1842 2 1 31 ASN HB3  H  18.876 17.902  18.311 1.00 . B B . 31 ASN HB3  1 1 
        1  1843 2 1 31 ASN HD21 H  16.958 15.874  16.595 1.00 . B B . 31 ASN HD21 1 1 
        1  1844 2 1 31 ASN HD22 H  15.927 16.997  15.847 1.00 . B B . 31 ASN HD22 1 1 
        1  1845 2 1 31 ASN N    N  21.329 17.597  17.275 1.00 . B B . 31 ASN N    1 1 
        1  1846 2 1 31 ASN ND2  N  16.760 16.794  16.323 1.00 . B B . 31 ASN ND2  1 1 
        1  1847 2 1 31 ASN O    O  19.694 19.909  15.259 1.00 . B B . 31 ASN O    1 1 
        1  1848 2 1 31 ASN OD1  O  17.359 18.908  16.255 1.00 . B B . 31 ASN OD1  1 1 
        1  1849 2 1 32 SER C    C  21.275 22.202  16.441 1.00 . B B . 32 SER C    1 1 
        1  1850 2 1 32 SER CA   C  20.157 21.651  17.332 1.00 . B B . 32 SER CA   1 1 
        1  1851 2 1 32 SER CB   C  20.287 22.248  18.730 1.00 . B B . 32 SER CB   1 1 
        1  1852 2 1 32 SER H    H  20.466 19.770  18.275 1.00 . B B . 32 SER H    1 1 
        1  1853 2 1 32 SER HA   H  19.201 21.933  16.918 1.00 . B B . 32 SER HA   1 1 
        1  1854 2 1 32 SER HB2  H  21.191 21.883  19.187 1.00 . B B . 32 SER HB2  1 1 
        1  1855 2 1 32 SER HB3  H  20.328 23.328  18.662 1.00 . B B . 32 SER HB3  1 1 
        1  1856 2 1 32 SER HG   H  18.411 22.360  19.232 1.00 . B B . 32 SER HG   1 1 
        1  1857 2 1 32 SER N    N  20.235 20.197  17.423 1.00 . B B . 32 SER N    1 1 
        1  1858 2 1 32 SER O    O  21.019 22.933  15.484 1.00 . B B . 32 SER O    1 1 
        1  1859 2 1 32 SER OG   O  19.172 21.850  19.516 1.00 . B B . 32 SER OG   1 1 
        1  1860 2 1 33 TYR C    C  23.586 21.801  14.549 1.00 . B B . 33 TYR C    1 1 
        1  1861 2 1 33 TYR CA   C  23.668 22.299  15.997 1.00 . B B . 33 TYR CA   1 1 
        1  1862 2 1 33 TYR CB   C  24.954 21.778  16.650 1.00 . B B . 33 TYR CB   1 1 
        1  1863 2 1 33 TYR CD1  C  26.526 21.396  14.719 1.00 . B B . 33 TYR CD1  1 1 
        1  1864 2 1 33 TYR CD2  C  26.846 23.363  16.100 1.00 . B B . 33 TYR CD2  1 1 
        1  1865 2 1 33 TYR CE1  C  27.617 21.774  13.927 1.00 . B B . 33 TYR CE1  1 1 
        1  1866 2 1 33 TYR CE2  C  27.936 23.743  15.308 1.00 . B B . 33 TYR CE2  1 1 
        1  1867 2 1 33 TYR CG   C  26.141 22.190  15.805 1.00 . B B . 33 TYR CG   1 1 
        1  1868 2 1 33 TYR CZ   C  28.322 22.948  14.222 1.00 . B B . 33 TYR CZ   1 1 
        1  1869 2 1 33 TYR H    H  22.656 21.258  17.539 1.00 . B B . 33 TYR H    1 1 
        1  1870 2 1 33 TYR HA   H  23.688 23.378  15.997 1.00 . B B . 33 TYR HA   1 1 
        1  1871 2 1 33 TYR HB2  H  25.047 22.194  17.644 1.00 . B B . 33 TYR HB2  1 1 
        1  1872 2 1 33 TYR HB3  H  24.912 20.697  16.718 1.00 . B B . 33 TYR HB3  1 1 
        1  1873 2 1 33 TYR HD1  H  25.980 20.486  14.498 1.00 . B B . 33 TYR HD1  1 1 
        1  1874 2 1 33 TYR HD2  H  26.548 23.974  16.939 1.00 . B B . 33 TYR HD2  1 1 
        1  1875 2 1 33 TYR HE1  H  27.908 21.162  13.086 1.00 . B B . 33 TYR HE1  1 1 
        1  1876 2 1 33 TYR HE2  H  28.481 24.647  15.535 1.00 . B B . 33 TYR HE2  1 1 
        1  1877 2 1 33 TYR HH   H  29.413 24.284  13.404 1.00 . B B . 33 TYR HH   1 1 
        1  1878 2 1 33 TYR N    N  22.512 21.842  16.766 1.00 . B B . 33 TYR N    1 1 
        1  1879 2 1 33 TYR O    O  23.805 22.555  13.601 1.00 . B B . 33 TYR O    1 1 
        1  1880 2 1 33 TYR OH   O  29.397 23.325  13.444 1.00 . B B . 33 TYR OH   1 1 
        1  1881 2 1 34 TYR C    C  22.167 20.685  12.233 1.00 . B B . 34 TYR C    1 1 
        1  1882 2 1 34 TYR CA   C  23.163 19.910  13.079 1.00 . B B . 34 TYR CA   1 1 
        1  1883 2 1 34 TYR CB   C  22.709 18.443  13.208 1.00 . B B . 34 TYR CB   1 1 
        1  1884 2 1 34 TYR CD1  C  23.793 17.177  11.316 1.00 . B B . 34 TYR CD1  1 1 
        1  1885 2 1 34 TYR CD2  C  21.467 17.822  11.091 1.00 . B B . 34 TYR CD2  1 1 
        1  1886 2 1 34 TYR CE1  C  23.754 16.592  10.044 1.00 . B B . 34 TYR CE1  1 1 
        1  1887 2 1 34 TYR CE2  C  21.427 17.237   9.819 1.00 . B B . 34 TYR CE2  1 1 
        1  1888 2 1 34 TYR CG   C  22.649 17.793  11.838 1.00 . B B . 34 TYR CG   1 1 
        1  1889 2 1 34 TYR CZ   C  22.571 16.622   9.297 1.00 . B B . 34 TYR CZ   1 1 
        1  1890 2 1 34 TYR H    H  23.104 19.967  15.190 1.00 . B B . 34 TYR H    1 1 
        1  1891 2 1 34 TYR HA   H  24.129 19.938  12.600 1.00 . B B . 34 TYR HA   1 1 
        1  1892 2 1 34 TYR HB2  H  23.415 17.905  13.826 1.00 . B B . 34 TYR HB2  1 1 
        1  1893 2 1 34 TYR HB3  H  21.732 18.410  13.667 1.00 . B B . 34 TYR HB3  1 1 
        1  1894 2 1 34 TYR HD1  H  24.702 17.152  11.896 1.00 . B B . 34 TYR HD1  1 1 
        1  1895 2 1 34 TYR HD2  H  20.583 18.297  11.494 1.00 . B B . 34 TYR HD2  1 1 
        1  1896 2 1 34 TYR HE1  H  24.636 16.119   9.641 1.00 . B B . 34 TYR HE1  1 1 
        1  1897 2 1 34 TYR HE2  H  20.514 17.260   9.242 1.00 . B B . 34 TYR HE2  1 1 
        1  1898 2 1 34 TYR HH   H  21.621 15.802   7.855 1.00 . B B . 34 TYR HH   1 1 
        1  1899 2 1 34 TYR N    N  23.268 20.520  14.398 1.00 . B B . 34 TYR N    1 1 
        1  1900 2 1 34 TYR O    O  22.449 21.009  11.079 1.00 . B B . 34 TYR O    1 1 
        1  1901 2 1 34 TYR OH   O  22.531 16.043   8.042 1.00 . B B . 34 TYR OH   1 1 
        1  1902 2 1 35 ARG C    C  20.458 23.151  11.810 1.00 . B B . 35 ARG C    1 1 
        1  1903 2 1 35 ARG CA   C  19.979 21.730  12.091 1.00 . B B . 35 ARG CA   1 1 
        1  1904 2 1 35 ARG CB   C  18.685 21.768  12.907 1.00 . B B . 35 ARG CB   1 1 
        1  1905 2 1 35 ARG CD   C  16.292 22.471  12.913 1.00 . B B . 35 ARG CD   1 1 
        1  1906 2 1 35 ARG CG   C  17.580 22.455  12.097 1.00 . B B . 35 ARG CG   1 1 
        1  1907 2 1 35 ARG CZ   C  14.124 23.558  12.770 1.00 . B B . 35 ARG CZ   1 1 
        1  1908 2 1 35 ARG H    H  20.836 20.701  13.728 1.00 . B B . 35 ARG H    1 1 
        1  1909 2 1 35 ARG HA   H  19.783 21.237  11.151 1.00 . B B . 35 ARG HA   1 1 
        1  1910 2 1 35 ARG HB2  H  18.382 20.759  13.147 1.00 . B B . 35 ARG HB2  1 1 
        1  1911 2 1 35 ARG HB3  H  18.853 22.319  13.821 1.00 . B B . 35 ARG HB3  1 1 
        1  1912 2 1 35 ARG HD2  H  15.986 21.457  13.118 1.00 . B B . 35 ARG HD2  1 1 
        1  1913 2 1 35 ARG HD3  H  16.471 22.987  13.848 1.00 . B B . 35 ARG HD3  1 1 
        1  1914 2 1 35 ARG HE   H  15.354 23.316  11.209 1.00 . B B . 35 ARG HE   1 1 
        1  1915 2 1 35 ARG HG2  H  17.866 23.470  11.868 1.00 . B B . 35 ARG HG2  1 1 
        1  1916 2 1 35 ARG HG3  H  17.414 21.911  11.180 1.00 . B B . 35 ARG HG3  1 1 
        1  1917 2 1 35 ARG HH11 H  14.671 22.883  14.574 1.00 . B B . 35 ARG HH11 1 1 
        1  1918 2 1 35 ARG HH12 H  13.120 23.651  14.499 1.00 . B B . 35 ARG HH12 1 1 
        1  1919 2 1 35 ARG HH21 H  13.323 24.326  11.105 1.00 . B B . 35 ARG HH21 1 1 
        1  1920 2 1 35 ARG HH22 H  12.357 24.468  12.535 1.00 . B B . 35 ARG HH22 1 1 
        1  1921 2 1 35 ARG N    N  21.006 20.985  12.804 1.00 . B B . 35 ARG N    1 1 
        1  1922 2 1 35 ARG NE   N  15.238 23.154  12.169 1.00 . B B . 35 ARG NE   1 1 
        1  1923 2 1 35 ARG NH1  N  13.959 23.348  14.047 1.00 . B B . 35 ARG NH1  1 1 
        1  1924 2 1 35 ARG NH2  N  13.195 24.165  12.084 1.00 . B B . 35 ARG NH2  1 1 
        1  1925 2 1 35 ARG O    O  20.117 23.734  10.780 1.00 . B B . 35 ARG O    1 1 
        1  1926 2 1 36 SER C    C  22.631 25.165  11.335 1.00 . B B . 36 SER C    1 1 
        1  1927 2 1 36 SER CA   C  21.743 25.065  12.568 1.00 . B B . 36 SER CA   1 1 
        1  1928 2 1 36 SER CB   C  22.537 25.486  13.803 1.00 . B B . 36 SER CB   1 1 
        1  1929 2 1 36 SER H    H  21.479 23.194  13.531 1.00 . B B . 36 SER H    1 1 
        1  1930 2 1 36 SER HA   H  20.905 25.735  12.448 1.00 . B B . 36 SER HA   1 1 
        1  1931 2 1 36 SER HB2  H  23.421 24.881  13.892 1.00 . B B . 36 SER HB2  1 1 
        1  1932 2 1 36 SER HB3  H  22.825 26.523  13.705 1.00 . B B . 36 SER HB3  1 1 
        1  1933 2 1 36 SER HG   H  21.920 26.034  15.563 1.00 . B B . 36 SER HG   1 1 
        1  1934 2 1 36 SER N    N  21.239 23.706  12.730 1.00 . B B . 36 SER N    1 1 
        1  1935 2 1 36 SER O    O  22.512 26.102  10.545 1.00 . B B . 36 SER O    1 1 
        1  1936 2 1 36 SER OG   O  21.731 25.313  14.959 1.00 . B B . 36 SER OG   1 1 
        1  1937 2 1 37 VAL C    C  23.643 23.904   8.738 1.00 . B B . 37 VAL C    1 1 
        1  1938 2 1 37 VAL CA   C  24.420 24.181  10.023 1.00 . B B . 37 VAL CA   1 1 
        1  1939 2 1 37 VAL CB   C  25.505 23.110  10.215 1.00 . B B . 37 VAL CB   1 1 
        1  1940 2 1 37 VAL CG1  C  26.421 23.046   8.980 1.00 . B B . 37 VAL CG1  1 1 
        1  1941 2 1 37 VAL CG2  C  26.343 23.451  11.452 1.00 . B B . 37 VAL CG2  1 1 
        1  1942 2 1 37 VAL H    H  23.569 23.470  11.836 1.00 . B B . 37 VAL H    1 1 
        1  1943 2 1 37 VAL HA   H  24.897 25.147   9.943 1.00 . B B . 37 VAL HA   1 1 
        1  1944 2 1 37 VAL HB   H  25.033 22.148  10.356 1.00 . B B . 37 VAL HB   1 1 
        1  1945 2 1 37 VAL HG11 H  25.865 22.683   8.133 1.00 . B B . 37 VAL HG11 1 1 
        1  1946 2 1 37 VAL HG12 H  27.239 22.372   9.177 1.00 . B B . 37 VAL HG12 1 1 
        1  1947 2 1 37 VAL HG13 H  26.808 24.032   8.764 1.00 . B B . 37 VAL HG13 1 1 
        1  1948 2 1 37 VAL HG21 H  25.740 23.322  12.339 1.00 . B B . 37 VAL HG21 1 1 
        1  1949 2 1 37 VAL HG22 H  26.682 24.475  11.392 1.00 . B B . 37 VAL HG22 1 1 
        1  1950 2 1 37 VAL HG23 H  27.199 22.795  11.499 1.00 . B B . 37 VAL HG23 1 1 
        1  1951 2 1 37 VAL N    N  23.519 24.191  11.174 1.00 . B B . 37 VAL N    1 1 
        1  1952 2 1 37 VAL O    O  23.852 24.563   7.719 1.00 . B B . 37 VAL O    1 1 
        1  1953 2 1 38 VAL C    C  21.291 23.795   7.023 1.00 . B B . 38 VAL C    1 1 
        1  1954 2 1 38 VAL CA   C  21.955 22.559   7.616 1.00 . B B . 38 VAL CA   1 1 
        1  1955 2 1 38 VAL CB   C  20.872 21.532   8.009 1.00 . B B . 38 VAL CB   1 1 
        1  1956 2 1 38 VAL CG1  C  19.886 21.297   6.837 1.00 . B B . 38 VAL CG1  1 1 
        1  1957 2 1 38 VAL CG2  C  21.532 20.190   8.405 1.00 . B B . 38 VAL CG2  1 1 
        1  1958 2 1 38 VAL H    H  22.628 22.431   9.635 1.00 . B B . 38 VAL H    1 1 
        1  1959 2 1 38 VAL HA   H  22.600 22.119   6.876 1.00 . B B . 38 VAL HA   1 1 
        1  1960 2 1 38 VAL HB   H  20.319 21.922   8.855 1.00 . B B . 38 VAL HB   1 1 
        1  1961 2 1 38 VAL HG11 H  19.281 20.425   7.042 1.00 . B B . 38 VAL HG11 1 1 
        1  1962 2 1 38 VAL HG12 H  20.441 21.142   5.924 1.00 . B B . 38 VAL HG12 1 1 
        1  1963 2 1 38 VAL HG13 H  19.244 22.159   6.725 1.00 . B B . 38 VAL HG13 1 1 
        1  1964 2 1 38 VAL HG21 H  21.685 19.581   7.532 1.00 . B B . 38 VAL HG21 1 1 
        1  1965 2 1 38 VAL HG22 H  20.885 19.669   9.088 1.00 . B B . 38 VAL HG22 1 1 
        1  1966 2 1 38 VAL HG23 H  22.486 20.366   8.874 1.00 . B B . 38 VAL HG23 1 1 
        1  1967 2 1 38 VAL N    N  22.752 22.921   8.795 1.00 . B B . 38 VAL N    1 1 
        1  1968 2 1 38 VAL O    O  21.360 24.016   5.814 1.00 . B B . 38 VAL O    1 1 
        1  1969 2 1 39 SER C    C  20.966 26.692   6.661 1.00 . B B . 39 SER C    1 1 
        1  1970 2 1 39 SER CA   C  19.989 25.796   7.405 1.00 . B B . 39 SER CA   1 1 
        1  1971 2 1 39 SER CB   C  19.407 26.558   8.593 1.00 . B B . 39 SER CB   1 1 
        1  1972 2 1 39 SER H    H  20.633 24.368   8.824 1.00 . B B . 39 SER H    1 1 
        1  1973 2 1 39 SER HA   H  19.185 25.519   6.739 1.00 . B B . 39 SER HA   1 1 
        1  1974 2 1 39 SER HB2  H  18.930 27.458   8.248 1.00 . B B . 39 SER HB2  1 1 
        1  1975 2 1 39 SER HB3  H  18.679 25.934   9.095 1.00 . B B . 39 SER HB3  1 1 
        1  1976 2 1 39 SER HG   H  20.073 27.043  10.355 1.00 . B B . 39 SER HG   1 1 
        1  1977 2 1 39 SER N    N  20.655 24.596   7.870 1.00 . B B . 39 SER N    1 1 
        1  1978 2 1 39 SER O    O  20.637 27.240   5.609 1.00 . B B . 39 SER O    1 1 
        1  1979 2 1 39 SER OG   O  20.457 26.897   9.489 1.00 . B B . 39 SER OG   1 1 
        1  1980 2 1 40 THR C    C  23.592 27.077   5.226 1.00 . B B . 40 THR C    1 1 
        1  1981 2 1 40 THR CA   C  23.186 27.662   6.575 1.00 . B B . 40 THR CA   1 1 
        1  1982 2 1 40 THR CB   C  24.417 27.771   7.480 1.00 . B B . 40 THR CB   1 1 
        1  1983 2 1 40 THR CG2  C  25.489 28.634   6.804 1.00 . B B . 40 THR CG2  1 1 
        1  1984 2 1 40 THR H    H  22.376 26.375   8.048 1.00 . B B . 40 THR H    1 1 
        1  1985 2 1 40 THR HA   H  22.782 28.652   6.420 1.00 . B B . 40 THR HA   1 1 
        1  1986 2 1 40 THR HB   H  24.816 26.784   7.663 1.00 . B B . 40 THR HB   1 1 
        1  1987 2 1 40 THR HG1  H  24.608 29.127   8.859 1.00 . B B . 40 THR HG1  1 1 
        1  1988 2 1 40 THR HG21 H  25.922 28.091   5.977 1.00 . B B . 40 THR HG21 1 1 
        1  1989 2 1 40 THR HG22 H  26.260 28.875   7.520 1.00 . B B . 40 THR HG22 1 1 
        1  1990 2 1 40 THR HG23 H  25.040 29.549   6.437 1.00 . B B . 40 THR HG23 1 1 
        1  1991 2 1 40 THR N    N  22.168 26.836   7.208 1.00 . B B . 40 THR N    1 1 
        1  1992 2 1 40 THR O    O  23.723 27.799   4.239 1.00 . B B . 40 THR O    1 1 
        1  1993 2 1 40 THR OG1  O  24.041 28.367   8.714 1.00 . B B . 40 THR OG1  1 1 
        1  1994 2 1 41 LEU C    C  23.145 25.295   2.876 1.00 . B B . 41 LEU C    1 1 
        1  1995 2 1 41 LEU CA   C  24.205 25.104   3.960 1.00 . B B . 41 LEU CA   1 1 
        1  1996 2 1 41 LEU CB   C  24.407 23.606   4.222 1.00 . B B . 41 LEU CB   1 1 
        1  1997 2 1 41 LEU CD1  C  25.657 21.901   5.573 1.00 . B B . 41 LEU CD1  1 1 
        1  1998 2 1 41 LEU CD2  C  26.952 23.748   4.420 1.00 . B B . 41 LEU CD2  1 1 
        1  1999 2 1 41 LEU CG   C  25.625 23.377   5.141 1.00 . B B . 41 LEU CG   1 1 
        1  2000 2 1 41 LEU H    H  23.678 25.239   6.016 1.00 . B B . 41 LEU H    1 1 
        1  2001 2 1 41 LEU HA   H  25.129 25.533   3.618 1.00 . B B . 41 LEU HA   1 1 
        1  2002 2 1 41 LEU HB2  H  23.522 23.216   4.704 1.00 . B B . 41 LEU HB2  1 1 
        1  2003 2 1 41 LEU HB3  H  24.559 23.090   3.286 1.00 . B B . 41 LEU HB3  1 1 
        1  2004 2 1 41 LEU HD11 H  26.583 21.693   6.086 1.00 . B B . 41 LEU HD11 1 1 
        1  2005 2 1 41 LEU HD12 H  25.575 21.263   4.705 1.00 . B B . 41 LEU HD12 1 1 
        1  2006 2 1 41 LEU HD13 H  24.831 21.704   6.234 1.00 . B B . 41 LEU HD13 1 1 
        1  2007 2 1 41 LEU HD21 H  26.895 23.484   3.373 1.00 . B B . 41 LEU HD21 1 1 
        1  2008 2 1 41 LEU HD22 H  27.777 23.220   4.875 1.00 . B B . 41 LEU HD22 1 1 
        1  2009 2 1 41 LEU HD23 H  27.130 24.807   4.514 1.00 . B B . 41 LEU HD23 1 1 
        1  2010 2 1 41 LEU HG   H  25.515 23.995   6.021 1.00 . B B . 41 LEU HG   1 1 
        1  2011 2 1 41 LEU N    N  23.797 25.764   5.196 1.00 . B B . 41 LEU N    1 1 
        1  2012 2 1 41 LEU O    O  23.467 25.653   1.743 1.00 . B B . 41 LEU O    1 1 
        1  2013 2 1 42 VAL C    C  20.623 26.699   1.902 1.00 . B B . 42 VAL C    1 1 
        1  2014 2 1 42 VAL CA   C  20.788 25.225   2.279 1.00 . B B . 42 VAL CA   1 1 
        1  2015 2 1 42 VAL CB   C  19.486 24.677   2.879 1.00 . B B . 42 VAL CB   1 1 
        1  2016 2 1 42 VAL CG1  C  18.314 24.923   1.913 1.00 . B B . 42 VAL CG1  1 1 
        1  2017 2 1 42 VAL CG2  C  19.648 23.172   3.120 1.00 . B B . 42 VAL CG2  1 1 
        1  2018 2 1 42 VAL H    H  21.689 24.781   4.149 1.00 . B B . 42 VAL H    1 1 
        1  2019 2 1 42 VAL HA   H  21.020 24.666   1.384 1.00 . B B . 42 VAL HA   1 1 
        1  2020 2 1 42 VAL HB   H  19.288 25.175   3.817 1.00 . B B . 42 VAL HB   1 1 
        1  2021 2 1 42 VAL HG11 H  18.080 25.977   1.891 1.00 . B B . 42 VAL HG11 1 1 
        1  2022 2 1 42 VAL HG12 H  17.448 24.373   2.248 1.00 . B B . 42 VAL HG12 1 1 
        1  2023 2 1 42 VAL HG13 H  18.588 24.595   0.920 1.00 . B B . 42 VAL HG13 1 1 
        1  2024 2 1 42 VAL HG21 H  18.713 22.762   3.474 1.00 . B B . 42 VAL HG21 1 1 
        1  2025 2 1 42 VAL HG22 H  20.417 23.007   3.857 1.00 . B B . 42 VAL HG22 1 1 
        1  2026 2 1 42 VAL HG23 H  19.931 22.685   2.194 1.00 . B B . 42 VAL HG23 1 1 
        1  2027 2 1 42 VAL N    N  21.886 25.063   3.232 1.00 . B B . 42 VAL N    1 1 
        1  2028 2 1 42 VAL O    O  20.385 27.030   0.741 1.00 . B B . 42 VAL O    1 1 
        1  2029 2 1 43 GLN C    C  21.817 29.559   1.927 1.00 . B B . 43 GLN C    1 1 
        1  2030 2 1 43 GLN CA   C  20.606 29.014   2.662 1.00 . B B . 43 GLN CA   1 1 
        1  2031 2 1 43 GLN CB   C  20.430 29.744   4.001 1.00 . B B . 43 GLN CB   1 1 
        1  2032 2 1 43 GLN CD   C  18.908 30.041   5.966 1.00 . B B . 43 GLN CD   1 1 
        1  2033 2 1 43 GLN CG   C  19.031 29.466   4.561 1.00 . B B . 43 GLN CG   1 1 
        1  2034 2 1 43 GLN H    H  20.937 27.252   3.800 1.00 . B B . 43 GLN H    1 1 
        1  2035 2 1 43 GLN HA   H  19.732 29.187   2.053 1.00 . B B . 43 GLN HA   1 1 
        1  2036 2 1 43 GLN HB2  H  21.175 29.395   4.700 1.00 . B B . 43 GLN HB2  1 1 
        1  2037 2 1 43 GLN HB3  H  20.547 30.809   3.855 1.00 . B B . 43 GLN HB3  1 1 
        1  2038 2 1 43 GLN HE21 H  17.014 30.588   5.732 1.00 . B B . 43 GLN HE21 1 1 
        1  2039 2 1 43 GLN HE22 H  17.688 30.943   7.249 1.00 . B B . 43 GLN HE22 1 1 
        1  2040 2 1 43 GLN HG2  H  18.295 29.931   3.921 1.00 . B B . 43 GLN HG2  1 1 
        1  2041 2 1 43 GLN HG3  H  18.854 28.403   4.590 1.00 . B B . 43 GLN HG3  1 1 
        1  2042 2 1 43 GLN N    N  20.747 27.574   2.894 1.00 . B B . 43 GLN N    1 1 
        1  2043 2 1 43 GLN NE2  N  17.776 30.567   6.348 1.00 . B B . 43 GLN NE2  1 1 
        1  2044 2 1 43 GLN O    O  21.714 30.500   1.140 1.00 . B B . 43 GLN O    1 1 
        1  2045 2 1 43 GLN OE1  O  19.867 30.013   6.737 1.00 . B B . 43 GLN OE1  1 1 
        1  2046 2 1 44 ASP C    C  23.974 30.004   0.166 1.00 . B B . 44 ASP C    1 1 
        1  2047 2 1 44 ASP CA   C  24.236 29.391   1.553 1.00 . B B . 44 ASP CA   1 1 
        1  2048 2 1 44 ASP CB   C  25.197 28.194   1.426 1.00 . B B . 44 ASP CB   1 1 
        1  2049 2 1 44 ASP CG   C  26.546 28.665   0.881 1.00 . B B . 44 ASP CG   1 1 
        1  2050 2 1 44 ASP H    H  22.995 28.216   2.830 1.00 . B B . 44 ASP H    1 1 
        1  2051 2 1 44 ASP HA   H  24.700 30.139   2.175 1.00 . B B . 44 ASP HA   1 1 
        1  2052 2 1 44 ASP HB2  H  25.339 27.746   2.397 1.00 . B B . 44 ASP HB2  1 1 
        1  2053 2 1 44 ASP HB3  H  24.778 27.460   0.754 1.00 . B B . 44 ASP HB3  1 1 
        1  2054 2 1 44 ASP N    N  22.973 28.961   2.194 1.00 . B B . 44 ASP N    1 1 
        1  2055 2 1 44 ASP O    O  23.853 31.222   0.031 1.00 . B B . 44 ASP O    1 1 
        1  2056 2 1 44 ASP OD1  O  26.636 29.825   0.512 1.00 . B B . 44 ASP OD1  1 1 
        1  2057 2 1 44 ASP OD2  O  27.463 27.862   0.840 1.00 . B B . 44 ASP OD2  1 1 
        1  2058 2 1 45 GLN C    C  23.105 28.499  -3.077 1.00 . B B . 45 GLN C    1 1 
        1  2059 2 1 45 GLN CA   C  23.590 29.633  -2.200 1.00 . B B . 45 GLN CA   1 1 
        1  2060 2 1 45 GLN CB   C  24.861 30.226  -2.796 1.00 . B B . 45 GLN CB   1 1 
        1  2061 2 1 45 GLN CD   C  27.220 29.753  -3.432 1.00 . B B . 45 GLN CD   1 1 
        1  2062 2 1 45 GLN CG   C  25.977 29.175  -2.771 1.00 . B B . 45 GLN CG   1 1 
        1  2063 2 1 45 GLN H    H  23.975 28.189  -0.679 1.00 . B B . 45 GLN H    1 1 
        1  2064 2 1 45 GLN HA   H  22.827 30.398  -2.165 1.00 . B B . 45 GLN HA   1 1 
        1  2065 2 1 45 GLN HB2  H  24.675 30.534  -3.815 1.00 . B B . 45 GLN HB2  1 1 
        1  2066 2 1 45 GLN HB3  H  25.164 31.081  -2.211 1.00 . B B . 45 GLN HB3  1 1 
        1  2067 2 1 45 GLN HE21 H  28.489 28.731  -2.298 1.00 . B B . 45 GLN HE21 1 1 
        1  2068 2 1 45 GLN HE22 H  29.205 29.758  -3.444 1.00 . B B . 45 GLN HE22 1 1 
        1  2069 2 1 45 GLN HG2  H  26.198 28.909  -1.749 1.00 . B B . 45 GLN HG2  1 1 
        1  2070 2 1 45 GLN HG3  H  25.667 28.284  -3.305 1.00 . B B . 45 GLN HG3  1 1 
        1  2071 2 1 45 GLN N    N  23.869 29.150  -0.846 1.00 . B B . 45 GLN N    1 1 
        1  2072 2 1 45 GLN NE2  N  28.403 29.381  -3.025 1.00 . B B . 45 GLN NE2  1 1 
        1  2073 2 1 45 GLN O    O  22.996 28.639  -4.295 1.00 . B B . 45 GLN O    1 1 
        1  2074 2 1 45 GLN OE1  O  27.108 30.567  -4.347 1.00 . B B . 45 GLN OE1  1 1 
        1  2075 2 1 46 LEU C    C  22.870 26.153  -4.627 1.00 . B B . 46 LEU C    1 1 
        1  2076 2 1 46 LEU CA   C  22.372 26.149  -3.171 1.00 . B B . 46 LEU CA   1 1 
        1  2077 2 1 46 LEU CB   C  20.823 26.062  -3.117 1.00 . B B . 46 LEU CB   1 1 
        1  2078 2 1 46 LEU CD1  C  18.837 24.571  -2.797 1.00 . B B . 46 LEU CD1  1 1 
        1  2079 2 1 46 LEU CD2  C  20.733 23.807  -4.234 1.00 . B B . 46 LEU CD2  1 1 
        1  2080 2 1 46 LEU CG   C  20.357 24.603  -2.980 1.00 . B B . 46 LEU CG   1 1 
        1  2081 2 1 46 LEU H    H  22.933 27.309  -1.477 1.00 . B B . 46 LEU H    1 1 
        1  2082 2 1 46 LEU HA   H  22.803 25.294  -2.676 1.00 . B B . 46 LEU HA   1 1 
        1  2083 2 1 46 LEU HB2  H  20.474 26.621  -2.262 1.00 . B B . 46 LEU HB2  1 1 
        1  2084 2 1 46 LEU HB3  H  20.393 26.491  -4.012 1.00 . B B . 46 LEU HB3  1 1 
        1  2085 2 1 46 LEU HD11 H  18.360 24.974  -3.680 1.00 . B B . 46 LEU HD11 1 1 
        1  2086 2 1 46 LEU HD12 H  18.564 25.168  -1.938 1.00 . B B . 46 LEU HD12 1 1 
        1  2087 2 1 46 LEU HD13 H  18.511 23.553  -2.646 1.00 . B B . 46 LEU HD13 1 1 
        1  2088 2 1 46 LEU HD21 H  20.312 22.815  -4.169 1.00 . B B . 46 LEU HD21 1 1 
        1  2089 2 1 46 LEU HD22 H  21.808 23.735  -4.308 1.00 . B B . 46 LEU HD22 1 1 
        1  2090 2 1 46 LEU HD23 H  20.341 24.304  -5.108 1.00 . B B . 46 LEU HD23 1 1 
        1  2091 2 1 46 LEU HG   H  20.829 24.157  -2.115 1.00 . B B . 46 LEU HG   1 1 
        1  2092 2 1 46 LEU N    N  22.827 27.361  -2.450 1.00 . B B . 46 LEU N    1 1 
        1  2093 2 1 46 LEU O    O  22.130 25.834  -5.557 1.00 . B B . 46 LEU O    1 1 
        1  2094 2 1 47 THR C    C  24.697 25.291  -6.801 1.00 . B B . 47 THR C    1 1 
        1  2095 2 1 47 THR CA   C  24.711 26.641  -6.125 1.00 . B B . 47 THR CA   1 1 
        1  2096 2 1 47 THR CB   C  26.145 27.170  -6.030 1.00 . B B . 47 THR CB   1 1 
        1  2097 2 1 47 THR CG2  C  26.967 26.281  -5.095 1.00 . B B . 47 THR CG2  1 1 
        1  2098 2 1 47 THR H    H  24.668 26.794  -4.024 1.00 . B B . 47 THR H    1 1 
        1  2099 2 1 47 THR HA   H  24.132 27.321  -6.715 1.00 . B B . 47 THR HA   1 1 
        1  2100 2 1 47 THR HB   H  26.132 28.178  -5.641 1.00 . B B . 47 THR HB   1 1 
        1  2101 2 1 47 THR HG1  H  26.060 27.448  -7.950 1.00 . B B . 47 THR HG1  1 1 
        1  2102 2 1 47 THR HG21 H  26.479 26.214  -4.134 1.00 . B B . 47 THR HG21 1 1 
        1  2103 2 1 47 THR HG22 H  27.952 26.707  -4.967 1.00 . B B . 47 THR HG22 1 1 
        1  2104 2 1 47 THR HG23 H  27.050 25.297  -5.522 1.00 . B B . 47 THR HG23 1 1 
        1  2105 2 1 47 THR N    N  24.126 26.551  -4.803 1.00 . B B . 47 THR N    1 1 
        1  2106 2 1 47 THR O    O  24.569 25.187  -8.020 1.00 . B B . 47 THR O    1 1 
        1  2107 2 1 47 THR OG1  O  26.729 27.171  -7.323 1.00 . B B . 47 THR OG1  1 1 
        1  2108 2 1 48 LYS C    C  24.398 21.903  -5.454 1.00 . B B . 48 LYS C    1 1 
        1  2109 2 1 48 LYS CA   C  24.844 22.886  -6.520 1.00 . B B . 48 LYS CA   1 1 
        1  2110 2 1 48 LYS CB   C  26.251 22.523  -6.990 1.00 . B B . 48 LYS CB   1 1 
        1  2111 2 1 48 LYS CD   C  25.923 21.419  -9.251 1.00 . B B . 48 LYS CD   1 1 
        1  2112 2 1 48 LYS CE   C  25.792 20.075  -9.963 1.00 . B B . 48 LYS CE   1 1 
        1  2113 2 1 48 LYS CG   C  26.247 21.183  -7.765 1.00 . B B . 48 LYS CG   1 1 
        1  2114 2 1 48 LYS H    H  24.942 24.385  -5.033 1.00 . B B . 48 LYS H    1 1 
        1  2115 2 1 48 LYS HA   H  24.162 22.819  -7.353 1.00 . B B . 48 LYS HA   1 1 
        1  2116 2 1 48 LYS HB2  H  26.626 23.314  -7.620 1.00 . B B . 48 LYS HB2  1 1 
        1  2117 2 1 48 LYS HB3  H  26.891 22.434  -6.125 1.00 . B B . 48 LYS HB3  1 1 
        1  2118 2 1 48 LYS HD2  H  24.998 21.966  -9.344 1.00 . B B . 48 LYS HD2  1 1 
        1  2119 2 1 48 LYS HD3  H  26.720 21.986  -9.703 1.00 . B B . 48 LYS HD3  1 1 
        1  2120 2 1 48 LYS HE2  H  25.056 19.467  -9.456 1.00 . B B . 48 LYS HE2  1 1 
        1  2121 2 1 48 LYS HE3  H  25.484 20.238 -10.984 1.00 . B B . 48 LYS HE3  1 1 
        1  2122 2 1 48 LYS HG2  H  27.222 20.727  -7.685 1.00 . B B . 48 LYS HG2  1 1 
        1  2123 2 1 48 LYS HG3  H  25.516 20.511  -7.343 1.00 . B B . 48 LYS HG3  1 1 
        1  2124 2 1 48 LYS HZ1  H  27.694 19.770  -9.178 1.00 . B B . 48 LYS HZ1  1 1 
        1  2125 2 1 48 LYS HZ2  H  27.592 19.533 -10.853 1.00 . B B . 48 LYS HZ2  1 1 
        1  2126 2 1 48 LYS HZ3  H  26.965 18.364  -9.792 1.00 . B B . 48 LYS HZ3  1 1 
        1  2127 2 1 48 LYS N    N  24.843 24.243  -5.997 1.00 . B B . 48 LYS N    1 1 
        1  2128 2 1 48 LYS NZ   N  27.110 19.383  -9.945 1.00 . B B . 48 LYS NZ   1 1 
        1  2129 2 1 48 LYS O    O  24.945 21.877  -4.351 1.00 . B B . 48 LYS O    1 1 
        1  2130 2 1 49 ASN C    C  24.063 19.328  -4.219 1.00 . B B . 49 ASN C    1 1 
        1  2131 2 1 49 ASN CA   C  22.900 20.090  -4.857 1.00 . B B . 49 ASN CA   1 1 
        1  2132 2 1 49 ASN CB   C  22.001 19.097  -5.589 1.00 . B B . 49 ASN CB   1 1 
        1  2133 2 1 49 ASN CG   C  20.917 19.846  -6.349 1.00 . B B . 49 ASN CG   1 1 
        1  2134 2 1 49 ASN H    H  23.011 21.150  -6.684 1.00 . B B . 49 ASN H    1 1 
        1  2135 2 1 49 ASN HA   H  22.322 20.579  -4.095 1.00 . B B . 49 ASN HA   1 1 
        1  2136 2 1 49 ASN HB2  H  22.594 18.523  -6.285 1.00 . B B . 49 ASN HB2  1 1 
        1  2137 2 1 49 ASN HB3  H  21.543 18.430  -4.872 1.00 . B B . 49 ASN HB3  1 1 
        1  2138 2 1 49 ASN HD21 H  19.633 19.854  -4.833 1.00 . B B . 49 ASN HD21 1 1 
        1  2139 2 1 49 ASN HD22 H  19.086 20.606  -6.252 1.00 . B B . 49 ASN HD22 1 1 
        1  2140 2 1 49 ASN N    N  23.407 21.084  -5.791 1.00 . B B . 49 ASN N    1 1 
        1  2141 2 1 49 ASN ND2  N  19.785 20.126  -5.764 1.00 . B B . 49 ASN ND2  1 1 
        1  2142 2 1 49 ASN O    O  23.981 18.936  -3.055 1.00 . B B . 49 ASN O    1 1 
        1  2143 2 1 49 ASN OD1  O  21.113 20.192  -7.515 1.00 . B B . 49 ASN OD1  1 1 
        1  2144 2 1 50 ALA C    C  27.001 19.242  -3.374 1.00 . B B . 50 ALA C    1 1 
        1  2145 2 1 50 ALA CA   C  26.302 18.418  -4.461 1.00 . B B . 50 ALA CA   1 1 
        1  2146 2 1 50 ALA CB   C  27.296 18.134  -5.594 1.00 . B B . 50 ALA CB   1 1 
        1  2147 2 1 50 ALA H    H  25.145 19.463  -5.897 1.00 . B B . 50 ALA H    1 1 
        1  2148 2 1 50 ALA HA   H  25.986 17.479  -4.051 1.00 . B B . 50 ALA HA   1 1 
        1  2149 2 1 50 ALA HB1  H  28.089 17.499  -5.222 1.00 . B B . 50 ALA HB1  1 1 
        1  2150 2 1 50 ALA HB2  H  27.716 19.063  -5.946 1.00 . B B . 50 ALA HB2  1 1 
        1  2151 2 1 50 ALA HB3  H  26.789 17.635  -6.406 1.00 . B B . 50 ALA HB3  1 1 
        1  2152 2 1 50 ALA N    N  25.135 19.127  -4.977 1.00 . B B . 50 ALA N    1 1 
        1  2153 2 1 50 ALA O    O  27.282 18.737  -2.287 1.00 . B B . 50 ALA O    1 1 
        1  2154 2 1 51 VAL C    C  27.233 21.314  -1.350 1.00 . B B . 51 VAL C    1 1 
        1  2155 2 1 51 VAL CA   C  27.948 21.377  -2.700 1.00 . B B . 51 VAL CA   1 1 
        1  2156 2 1 51 VAL CB   C  27.957 22.830  -3.225 1.00 . B B . 51 VAL CB   1 1 
        1  2157 2 1 51 VAL CG1  C  28.274 23.837  -2.089 1.00 . B B . 51 VAL CG1  1 1 
        1  2158 2 1 51 VAL CG2  C  29.007 22.966  -4.345 1.00 . B B . 51 VAL CG2  1 1 
        1  2159 2 1 51 VAL H    H  27.026 20.855  -4.559 1.00 . B B . 51 VAL H    1 1 
        1  2160 2 1 51 VAL HA   H  28.965 21.044  -2.567 1.00 . B B . 51 VAL HA   1 1 
        1  2161 2 1 51 VAL HB   H  26.979 23.056  -3.627 1.00 . B B . 51 VAL HB   1 1 
        1  2162 2 1 51 VAL HG11 H  28.532 24.797  -2.512 1.00 . B B . 51 VAL HG11 1 1 
        1  2163 2 1 51 VAL HG12 H  29.100 23.469  -1.497 1.00 . B B . 51 VAL HG12 1 1 
        1  2164 2 1 51 VAL HG13 H  27.403 23.950  -1.454 1.00 . B B . 51 VAL HG13 1 1 
        1  2165 2 1 51 VAL HG21 H  28.834 23.880  -4.890 1.00 . B B . 51 VAL HG21 1 1 
        1  2166 2 1 51 VAL HG22 H  28.934 22.126  -5.018 1.00 . B B . 51 VAL HG22 1 1 
        1  2167 2 1 51 VAL HG23 H  29.998 22.988  -3.913 1.00 . B B . 51 VAL HG23 1 1 
        1  2168 2 1 51 VAL N    N  27.273 20.507  -3.677 1.00 . B B . 51 VAL N    1 1 
        1  2169 2 1 51 VAL O    O  27.877 21.178  -0.308 1.00 . B B . 51 VAL O    1 1 
        1  2170 2 1 52 VAL C    C  25.013 19.922   0.387 1.00 . B B . 52 VAL C    1 1 
        1  2171 2 1 52 VAL CA   C  25.130 21.360  -0.134 1.00 . B B . 52 VAL CA   1 1 
        1  2172 2 1 52 VAL CB   C  23.729 21.949  -0.360 1.00 . B B . 52 VAL CB   1 1 
        1  2173 2 1 52 VAL CG1  C  23.851 23.434  -0.715 1.00 . B B . 52 VAL CG1  1 1 
        1  2174 2 1 52 VAL CG2  C  23.037 21.217  -1.517 1.00 . B B . 52 VAL CG2  1 1 
        1  2175 2 1 52 VAL H    H  25.449 21.525  -2.231 1.00 . B B . 52 VAL H    1 1 
        1  2176 2 1 52 VAL HA   H  25.641 21.948   0.609 1.00 . B B . 52 VAL HA   1 1 
        1  2177 2 1 52 VAL HB   H  23.139 21.841   0.542 1.00 . B B . 52 VAL HB   1 1 
        1  2178 2 1 52 VAL HG11 H  22.865 23.871  -0.757 1.00 . B B . 52 VAL HG11 1 1 
        1  2179 2 1 52 VAL HG12 H  24.333 23.538  -1.676 1.00 . B B . 52 VAL HG12 1 1 
        1  2180 2 1 52 VAL HG13 H  24.438 23.938   0.037 1.00 . B B . 52 VAL HG13 1 1 
        1  2181 2 1 52 VAL HG21 H  22.826 20.198  -1.233 1.00 . B B . 52 VAL HG21 1 1 
        1  2182 2 1 52 VAL HG22 H  23.684 21.223  -2.375 1.00 . B B . 52 VAL HG22 1 1 
        1  2183 2 1 52 VAL HG23 H  22.111 21.717  -1.762 1.00 . B B . 52 VAL HG23 1 1 
        1  2184 2 1 52 VAL N    N  25.909 21.418  -1.372 1.00 . B B . 52 VAL N    1 1 
        1  2185 2 1 52 VAL O    O  25.086 19.668   1.589 1.00 . B B . 52 VAL O    1 1 
        1  2186 2 1 53 LEU C    C  25.989 17.042   0.421 1.00 . B B . 53 LEU C    1 1 
        1  2187 2 1 53 LEU CA   C  24.684 17.580  -0.159 1.00 . B B . 53 LEU CA   1 1 
        1  2188 2 1 53 LEU CB   C  24.275 16.743  -1.376 1.00 . B B . 53 LEU CB   1 1 
        1  2189 2 1 53 LEU CD1  C  23.082 15.047   0.077 1.00 . B B . 53 LEU CD1  1 1 
        1  2190 2 1 53 LEU CD2  C  23.764 14.475  -2.291 1.00 . B B . 53 LEU CD2  1 1 
        1  2191 2 1 53 LEU CG   C  24.148 15.250  -1.020 1.00 . B B . 53 LEU CG   1 1 
        1  2192 2 1 53 LEU H    H  24.773 19.251  -1.484 1.00 . B B . 53 LEU H    1 1 
        1  2193 2 1 53 LEU HA   H  23.910 17.509   0.589 1.00 . B B . 53 LEU HA   1 1 
        1  2194 2 1 53 LEU HB2  H  23.326 17.095  -1.747 1.00 . B B . 53 LEU HB2  1 1 
        1  2195 2 1 53 LEU HB3  H  25.017 16.856  -2.135 1.00 . B B . 53 LEU HB3  1 1 
        1  2196 2 1 53 LEU HD11 H  22.253 15.725  -0.082 1.00 . B B . 53 LEU HD11 1 1 
        1  2197 2 1 53 LEU HD12 H  23.521 15.241   1.046 1.00 . B B . 53 LEU HD12 1 1 
        1  2198 2 1 53 LEU HD13 H  22.721 14.030   0.058 1.00 . B B . 53 LEU HD13 1 1 
        1  2199 2 1 53 LEU HD21 H  24.574 14.535  -3.004 1.00 . B B . 53 LEU HD21 1 1 
        1  2200 2 1 53 LEU HD22 H  22.872 14.903  -2.723 1.00 . B B . 53 LEU HD22 1 1 
        1  2201 2 1 53 LEU HD23 H  23.582 13.439  -2.043 1.00 . B B . 53 LEU HD23 1 1 
        1  2202 2 1 53 LEU HG   H  25.095 14.881  -0.659 1.00 . B B . 53 LEU HG   1 1 
        1  2203 2 1 53 LEU N    N  24.823 18.989  -0.541 1.00 . B B . 53 LEU N    1 1 
        1  2204 2 1 53 LEU O    O  25.992 16.289   1.394 1.00 . B B . 53 LEU O    1 1 
        1  2205 2 1 54 LYS C    C  28.632 17.342   1.700 1.00 . B B . 54 LYS C    1 1 
        1  2206 2 1 54 LYS CA   C  28.407 16.970   0.247 1.00 . B B . 54 LYS CA   1 1 
        1  2207 2 1 54 LYS CB   C  29.492 17.616  -0.630 1.00 . B B . 54 LYS CB   1 1 
        1  2208 2 1 54 LYS CD   C  30.173 17.917  -3.038 1.00 . B B . 54 LYS CD   1 1 
        1  2209 2 1 54 LYS CE   C  31.616 18.211  -2.607 1.00 . B B . 54 LYS CE   1 1 
        1  2210 2 1 54 LYS CG   C  29.502 16.969  -2.035 1.00 . B B . 54 LYS CG   1 1 
        1  2211 2 1 54 LYS H    H  27.037 18.037  -0.964 1.00 . B B . 54 LYS H    1 1 
        1  2212 2 1 54 LYS HA   H  28.456 15.900   0.146 1.00 . B B . 54 LYS HA   1 1 
        1  2213 2 1 54 LYS HB2  H  29.283 18.675  -0.713 1.00 . B B . 54 LYS HB2  1 1 
        1  2214 2 1 54 LYS HB3  H  30.462 17.481  -0.168 1.00 . B B . 54 LYS HB3  1 1 
        1  2215 2 1 54 LYS HD2  H  30.172 17.464  -4.017 1.00 . B B . 54 LYS HD2  1 1 
        1  2216 2 1 54 LYS HD3  H  29.613 18.846  -3.071 1.00 . B B . 54 LYS HD3  1 1 
        1  2217 2 1 54 LYS HE2  H  32.143 18.691  -3.417 1.00 . B B . 54 LYS HE2  1 1 
        1  2218 2 1 54 LYS HE3  H  31.610 18.867  -1.748 1.00 . B B . 54 LYS HE3  1 1 
        1  2219 2 1 54 LYS HG2  H  30.049 16.038  -1.996 1.00 . B B . 54 LYS HG2  1 1 
        1  2220 2 1 54 LYS HG3  H  28.494 16.765  -2.358 1.00 . B B . 54 LYS HG3  1 1 
        1  2221 2 1 54 LYS HZ1  H  32.030 16.649  -1.293 1.00 . B B . 54 LYS HZ1  1 1 
        1  2222 2 1 54 LYS HZ2  H  33.334 17.078  -2.289 1.00 . B B . 54 LYS HZ2  1 1 
        1  2223 2 1 54 LYS HZ3  H  32.031 16.196  -2.932 1.00 . B B . 54 LYS HZ3  1 1 
        1  2224 2 1 54 LYS N    N  27.100 17.436  -0.194 1.00 . B B . 54 LYS N    1 1 
        1  2225 2 1 54 LYS NZ   N  32.305 16.938  -2.254 1.00 . B B . 54 LYS NZ   1 1 
        1  2226 2 1 54 LYS O    O  29.092 16.524   2.497 1.00 . B B . 54 LYS O    1 1 
        1  2227 2 1 55 ARG C    C  27.529 18.302   4.333 1.00 . B B . 55 ARG C    1 1 
        1  2228 2 1 55 ARG CA   C  28.459 19.059   3.402 1.00 . B B . 55 ARG CA   1 1 
        1  2229 2 1 55 ARG CB   C  28.153 20.561   3.456 1.00 . B B . 55 ARG CB   1 1 
        1  2230 2 1 55 ARG CD   C  30.496 21.558   3.477 1.00 . B B . 55 ARG CD   1 1 
        1  2231 2 1 55 ARG CG   C  29.205 21.370   2.662 1.00 . B B . 55 ARG CG   1 1 
        1  2232 2 1 55 ARG CZ   C  32.254 21.791   1.805 1.00 . B B . 55 ARG CZ   1 1 
        1  2233 2 1 55 ARG H    H  27.935 19.189   1.367 1.00 . B B . 55 ARG H    1 1 
        1  2234 2 1 55 ARG HA   H  29.469 18.888   3.716 1.00 . B B . 55 ARG HA   1 1 
        1  2235 2 1 55 ARG HB2  H  27.177 20.730   3.023 1.00 . B B . 55 ARG HB2  1 1 
        1  2236 2 1 55 ARG HB3  H  28.148 20.889   4.484 1.00 . B B . 55 ARG HB3  1 1 
        1  2237 2 1 55 ARG HD2  H  30.261 22.079   4.392 1.00 . B B . 55 ARG HD2  1 1 
        1  2238 2 1 55 ARG HD3  H  30.929 20.600   3.719 1.00 . B B . 55 ARG HD3  1 1 
        1  2239 2 1 55 ARG HE   H  31.514 23.314   2.863 1.00 . B B . 55 ARG HE   1 1 
        1  2240 2 1 55 ARG HG2  H  29.439 20.854   1.741 1.00 . B B . 55 ARG HG2  1 1 
        1  2241 2 1 55 ARG HG3  H  28.798 22.342   2.425 1.00 . B B . 55 ARG HG3  1 1 
        1  2242 2 1 55 ARG HH11 H  31.520 19.946   2.074 1.00 . B B . 55 ARG HH11 1 1 
        1  2243 2 1 55 ARG HH12 H  32.782 20.085   0.895 1.00 . B B . 55 ARG HH12 1 1 
        1  2244 2 1 55 ARG HH21 H  33.171 23.503   1.327 1.00 . B B . 55 ARG HH21 1 1 
        1  2245 2 1 55 ARG HH22 H  33.716 22.099   0.472 1.00 . B B . 55 ARG HH22 1 1 
        1  2246 2 1 55 ARG N    N  28.298 18.580   2.045 1.00 . B B . 55 ARG N    1 1 
        1  2247 2 1 55 ARG NE   N  31.454 22.351   2.706 1.00 . B B . 55 ARG NE   1 1 
        1  2248 2 1 55 ARG NH1  N  32.180 20.508   1.573 1.00 . B B . 55 ARG NH1  1 1 
        1  2249 2 1 55 ARG NH2  N  33.114 22.523   1.151 1.00 . B B . 55 ARG NH2  1 1 
        1  2250 2 1 55 ARG O    O  27.874 18.040   5.485 1.00 . B B . 55 ARG O    1 1 
        1  2251 2 1 56 ILE C    C  25.869 15.812   4.918 1.00 . B B . 56 ILE C    1 1 
        1  2252 2 1 56 ILE CA   C  25.379 17.225   4.647 1.00 . B B . 56 ILE CA   1 1 
        1  2253 2 1 56 ILE CB   C  24.015 17.185   3.924 1.00 . B B . 56 ILE CB   1 1 
        1  2254 2 1 56 ILE CD1  C  22.643 18.951   5.156 1.00 . B B . 56 ILE CD1  1 1 
        1  2255 2 1 56 ILE CG1  C  23.401 18.614   3.869 1.00 . B B . 56 ILE CG1  1 1 
        1  2256 2 1 56 ILE CG2  C  23.053 16.204   4.640 1.00 . B B . 56 ILE CG2  1 1 
        1  2257 2 1 56 ILE H    H  26.127 18.188   2.908 1.00 . B B . 56 ILE H    1 1 
        1  2258 2 1 56 ILE HA   H  25.265 17.734   5.590 1.00 . B B . 56 ILE HA   1 1 
        1  2259 2 1 56 ILE HB   H  24.176 16.832   2.912 1.00 . B B . 56 ILE HB   1 1 
        1  2260 2 1 56 ILE HD11 H  22.543 20.023   5.240 1.00 . B B . 56 ILE HD11 1 1 
        1  2261 2 1 56 ILE HD12 H  23.180 18.571   6.009 1.00 . B B . 56 ILE HD12 1 1 
        1  2262 2 1 56 ILE HD13 H  21.666 18.501   5.121 1.00 . B B . 56 ILE HD13 1 1 
        1  2263 2 1 56 ILE HG12 H  24.187 19.343   3.737 1.00 . B B . 56 ILE HG12 1 1 
        1  2264 2 1 56 ILE HG13 H  22.718 18.682   3.035 1.00 . B B . 56 ILE HG13 1 1 
        1  2265 2 1 56 ILE HG21 H  23.334 15.187   4.402 1.00 . B B . 56 ILE HG21 1 1 
        1  2266 2 1 56 ILE HG22 H  22.041 16.380   4.310 1.00 . B B . 56 ILE HG22 1 1 
        1  2267 2 1 56 ILE HG23 H  23.115 16.351   5.710 1.00 . B B . 56 ILE HG23 1 1 
        1  2268 2 1 56 ILE N    N  26.347 17.952   3.834 1.00 . B B . 56 ILE N    1 1 
        1  2269 2 1 56 ILE O    O  25.846 15.348   6.058 1.00 . B B . 56 ILE O    1 1 
        1  2270 2 1 57 GLN C    C  27.977 13.727   4.961 1.00 . B B . 57 GLN C    1 1 
        1  2271 2 1 57 GLN CA   C  26.797 13.768   4.002 1.00 . B B . 57 GLN CA   1 1 
        1  2272 2 1 57 GLN CB   C  27.226 13.231   2.634 1.00 . B B . 57 GLN CB   1 1 
        1  2273 2 1 57 GLN CD   C  26.419 12.624   0.348 1.00 . B B . 57 GLN CD   1 1 
        1  2274 2 1 57 GLN CG   C  25.998 13.086   1.736 1.00 . B B . 57 GLN CG   1 1 
        1  2275 2 1 57 GLN H    H  26.305 15.551   2.982 1.00 . B B . 57 GLN H    1 1 
        1  2276 2 1 57 GLN HA   H  26.006 13.146   4.393 1.00 . B B . 57 GLN HA   1 1 
        1  2277 2 1 57 GLN HB2  H  27.927 13.918   2.180 1.00 . B B . 57 GLN HB2  1 1 
        1  2278 2 1 57 GLN HB3  H  27.696 12.266   2.754 1.00 . B B . 57 GLN HB3  1 1 
        1  2279 2 1 57 GLN HE21 H  25.535 10.854   0.512 1.00 . B B . 57 GLN HE21 1 1 
        1  2280 2 1 57 GLN HE22 H  26.335 11.131  -0.959 1.00 . B B . 57 GLN HE22 1 1 
        1  2281 2 1 57 GLN HG2  H  25.323 12.363   2.167 1.00 . B B . 57 GLN HG2  1 1 
        1  2282 2 1 57 GLN HG3  H  25.500 14.037   1.660 1.00 . B B . 57 GLN HG3  1 1 
        1  2283 2 1 57 GLN N    N  26.310 15.129   3.867 1.00 . B B . 57 GLN N    1 1 
        1  2284 2 1 57 GLN NE2  N  26.067 11.438  -0.069 1.00 . B B . 57 GLN NE2  1 1 
        1  2285 2 1 57 GLN O    O  28.059 12.842   5.813 1.00 . B B . 57 GLN O    1 1 
        1  2286 2 1 57 GLN OE1  O  27.091 13.358  -0.377 1.00 . B B . 57 GLN OE1  1 1 
        1  2287 2 1 58 HIS C    C  29.651 15.133   7.102 1.00 . B B . 58 HIS C    1 1 
        1  2288 2 1 58 HIS CA   C  30.055 14.745   5.685 1.00 . B B . 58 HIS CA   1 1 
        1  2289 2 1 58 HIS CB   C  31.062 15.767   5.141 1.00 . B B . 58 HIS CB   1 1 
        1  2290 2 1 58 HIS CD2  C  31.752 15.883   2.605 1.00 . B B . 58 HIS CD2  1 1 
        1  2291 2 1 58 HIS CE1  C  32.520 13.867   2.401 1.00 . B B . 58 HIS CE1  1 1 
        1  2292 2 1 58 HIS CG   C  31.613 15.279   3.830 1.00 . B B . 58 HIS CG   1 1 
        1  2293 2 1 58 HIS H    H  28.767 15.365   4.125 1.00 . B B . 58 HIS H    1 1 
        1  2294 2 1 58 HIS HA   H  30.525 13.771   5.710 1.00 . B B . 58 HIS HA   1 1 
        1  2295 2 1 58 HIS HB2  H  30.566 16.715   4.993 1.00 . B B . 58 HIS HB2  1 1 
        1  2296 2 1 58 HIS HB3  H  31.871 15.888   5.847 1.00 . B B . 58 HIS HB3  1 1 
        1  2297 2 1 58 HIS HD1  H  32.152 13.303   4.370 1.00 . B B . 58 HIS HD1  1 1 
        1  2298 2 1 58 HIS HD2  H  31.468 16.900   2.377 1.00 . B B . 58 HIS HD2  1 1 
        1  2299 2 1 58 HIS HE1  H  32.954 12.967   1.991 1.00 . B B . 58 HIS HE1  1 1 
        1  2300 2 1 58 HIS HE2  H  32.538 15.150   0.761 1.00 . B B . 58 HIS HE2  1 1 
        1  2301 2 1 58 HIS N    N  28.886 14.685   4.822 1.00 . B B . 58 HIS N    1 1 
        1  2302 2 1 58 HIS ND1  N  32.110 13.993   3.676 1.00 . B B . 58 HIS ND1  1 1 
        1  2303 2 1 58 HIS NE2  N  32.325 14.990   1.704 1.00 . B B . 58 HIS NE2  1 1 
        1  2304 2 1 58 HIS O    O  30.108 14.533   8.074 1.00 . B B . 58 HIS O    1 1 
        1  2305 2 1 59 LEU C    C  27.835 15.438   9.361 1.00 . B B . 59 LEU C    1 1 
        1  2306 2 1 59 LEU CA   C  28.353 16.609   8.528 1.00 . B B . 59 LEU CA   1 1 
        1  2307 2 1 59 LEU CB   C  27.240 17.656   8.375 1.00 . B B . 59 LEU CB   1 1 
        1  2308 2 1 59 LEU CD1  C  28.023 18.963  10.421 1.00 . B B . 59 LEU CD1  1 1 
        1  2309 2 1 59 LEU CD2  C  25.654 19.206   9.558 1.00 . B B . 59 LEU CD2  1 1 
        1  2310 2 1 59 LEU CG   C  26.832 18.233   9.749 1.00 . B B . 59 LEU CG   1 1 
        1  2311 2 1 59 LEU H    H  28.468 16.588   6.402 1.00 . B B . 59 LEU H    1 1 
        1  2312 2 1 59 LEU HA   H  29.193 17.055   9.032 1.00 . B B . 59 LEU HA   1 1 
        1  2313 2 1 59 LEU HB2  H  27.588 18.457   7.747 1.00 . B B . 59 LEU HB2  1 1 
        1  2314 2 1 59 LEU HB3  H  26.379 17.190   7.915 1.00 . B B . 59 LEU HB3  1 1 
        1  2315 2 1 59 LEU HD11 H  28.649 19.424   9.668 1.00 . B B . 59 LEU HD11 1 1 
        1  2316 2 1 59 LEU HD12 H  28.607 18.249  10.983 1.00 . B B . 59 LEU HD12 1 1 
        1  2317 2 1 59 LEU HD13 H  27.660 19.723  11.098 1.00 . B B . 59 LEU HD13 1 1 
        1  2318 2 1 59 LEU HD21 H  25.239 19.456  10.524 1.00 . B B . 59 LEU HD21 1 1 
        1  2319 2 1 59 LEU HD22 H  24.891 18.741   8.952 1.00 . B B . 59 LEU HD22 1 1 
        1  2320 2 1 59 LEU HD23 H  26.000 20.104   9.071 1.00 . B B . 59 LEU HD23 1 1 
        1  2321 2 1 59 LEU HG   H  26.516 17.429  10.391 1.00 . B B . 59 LEU HG   1 1 
        1  2322 2 1 59 LEU N    N  28.798 16.146   7.211 1.00 . B B . 59 LEU N    1 1 
        1  2323 2 1 59 LEU O    O  27.910 15.462  10.590 1.00 . B B . 59 LEU O    1 1 
        1  2324 2 1 60 ASP C    C  27.861 12.662  10.311 1.00 . B B . 60 ASP C    1 1 
        1  2325 2 1 60 ASP CA   C  26.794 13.249   9.390 1.00 . B B . 60 ASP CA   1 1 
        1  2326 2 1 60 ASP CB   C  26.336 12.187   8.387 1.00 . B B . 60 ASP CB   1 1 
        1  2327 2 1 60 ASP CG   C  25.731 10.994   9.120 1.00 . B B . 60 ASP CG   1 1 
        1  2328 2 1 60 ASP H    H  27.281 14.453   7.709 1.00 . B B . 60 ASP H    1 1 
        1  2329 2 1 60 ASP HA   H  25.946 13.550   9.986 1.00 . B B . 60 ASP HA   1 1 
        1  2330 2 1 60 ASP HB2  H  25.598 12.610   7.726 1.00 . B B . 60 ASP HB2  1 1 
        1  2331 2 1 60 ASP HB3  H  27.183 11.851   7.810 1.00 . B B . 60 ASP HB3  1 1 
        1  2332 2 1 60 ASP N    N  27.315 14.417   8.688 1.00 . B B . 60 ASP N    1 1 
        1  2333 2 1 60 ASP O    O  27.543 12.062  11.339 1.00 . B B . 60 ASP O    1 1 
        1  2334 2 1 60 ASP OD1  O  24.821 11.201   9.905 1.00 . B B . 60 ASP OD1  1 1 
        1  2335 2 1 60 ASP OD2  O  26.182  9.888   8.874 1.00 . B B . 60 ASP OD2  1 1 
        1  2336 2 1 61 GLU C    C  30.194 12.906  12.141 1.00 . B B . 61 GLU C    1 1 
        1  2337 2 1 61 GLU CA   C  30.224 12.309  10.734 1.00 . B B . 61 GLU CA   1 1 
        1  2338 2 1 61 GLU CB   C  31.561 12.640  10.047 1.00 . B B . 61 GLU CB   1 1 
        1  2339 2 1 61 GLU CD   C  32.978 14.561   9.245 1.00 . B B . 61 GLU CD   1 1 
        1  2340 2 1 61 GLU CG   C  31.947 14.120  10.275 1.00 . B B . 61 GLU CG   1 1 
        1  2341 2 1 61 GLU H    H  29.317 13.316   9.103 1.00 . B B . 61 GLU H    1 1 
        1  2342 2 1 61 GLU HA   H  30.125 11.237  10.806 1.00 . B B . 61 GLU HA   1 1 
        1  2343 2 1 61 GLU HB2  H  32.339 12.003  10.451 1.00 . B B . 61 GLU HB2  1 1 
        1  2344 2 1 61 GLU HB3  H  31.462 12.452   8.987 1.00 . B B . 61 GLU HB3  1 1 
        1  2345 2 1 61 GLU HG2  H  31.071 14.745  10.197 1.00 . B B . 61 GLU HG2  1 1 
        1  2346 2 1 61 GLU HG3  H  32.368 14.233  11.267 1.00 . B B . 61 GLU HG3  1 1 
        1  2347 2 1 61 GLU N    N  29.124 12.830   9.932 1.00 . B B . 61 GLU N    1 1 
        1  2348 2 1 61 GLU O    O  30.532 12.235  13.117 1.00 . B B . 61 GLU O    1 1 
        1  2349 2 1 61 GLU OE1  O  34.008 13.915   9.149 1.00 . B B . 61 GLU OE1  1 1 
        1  2350 2 1 61 GLU OE2  O  32.731 15.554   8.580 1.00 . B B . 61 GLU OE2  1 1 
        1  2351 2 1 62 ALA C    C  28.562 14.321  14.344 1.00 . B B . 62 ALA C    1 1 
        1  2352 2 1 62 ALA CA   C  29.725 14.848  13.519 1.00 . B B . 62 ALA CA   1 1 
        1  2353 2 1 62 ALA CB   C  29.565 16.350  13.300 1.00 . B B . 62 ALA CB   1 1 
        1  2354 2 1 62 ALA H    H  29.537 14.655  11.422 1.00 . B B . 62 ALA H    1 1 
        1  2355 2 1 62 ALA HA   H  30.639 14.668  14.059 1.00 . B B . 62 ALA HA   1 1 
        1  2356 2 1 62 ALA HB1  H  29.622 16.857  14.246 1.00 . B B . 62 ALA HB1  1 1 
        1  2357 2 1 62 ALA HB2  H  28.607 16.546  12.842 1.00 . B B . 62 ALA HB2  1 1 
        1  2358 2 1 62 ALA HB3  H  30.354 16.705  12.652 1.00 . B B . 62 ALA HB3  1 1 
        1  2359 2 1 62 ALA N    N  29.795 14.170  12.234 1.00 . B B . 62 ALA N    1 1 
        1  2360 2 1 62 ALA O    O  28.726 13.976  15.514 1.00 . B B . 62 ALA O    1 1 
        1  2361 2 1 63 TYR C    C  26.468 12.363  14.976 1.00 . B B . 63 TYR C    1 1 
        1  2362 2 1 63 TYR CA   C  26.200 13.768  14.413 1.00 . B B . 63 TYR CA   1 1 
        1  2363 2 1 63 TYR CB   C  24.995 13.747  13.418 1.00 . B B . 63 TYR CB   1 1 
        1  2364 2 1 63 TYR CD1  C  24.638 11.311  12.844 1.00 . B B . 63 TYR CD1  1 1 
        1  2365 2 1 63 TYR CD2  C  23.085 12.370  14.376 1.00 . B B . 63 TYR CD2  1 1 
        1  2366 2 1 63 TYR CE1  C  23.949 10.100  12.983 1.00 . B B . 63 TYR CE1  1 1 
        1  2367 2 1 63 TYR CE2  C  22.396 11.160  14.515 1.00 . B B . 63 TYR CE2  1 1 
        1  2368 2 1 63 TYR CG   C  24.207 12.446  13.541 1.00 . B B . 63 TYR CG   1 1 
        1  2369 2 1 63 TYR CZ   C  22.828 10.024  13.818 1.00 . B B . 63 TYR CZ   1 1 
        1  2370 2 1 63 TYR H    H  27.315 14.547  12.795 1.00 . B B . 63 TYR H    1 1 
        1  2371 2 1 63 TYR HA   H  25.976 14.441  15.230 1.00 . B B . 63 TYR HA   1 1 
        1  2372 2 1 63 TYR HB2  H  24.338 14.584  13.624 1.00 . B B . 63 TYR HB2  1 1 
        1  2373 2 1 63 TYR HB3  H  25.369 13.839  12.410 1.00 . B B . 63 TYR HB3  1 1 
        1  2374 2 1 63 TYR HD1  H  25.497 11.366  12.206 1.00 . B B . 63 TYR HD1  1 1 
        1  2375 2 1 63 TYR HD2  H  22.753 13.244  14.909 1.00 . B B . 63 TYR HD2  1 1 
        1  2376 2 1 63 TYR HE1  H  24.285  9.227  12.443 1.00 . B B . 63 TYR HE1  1 1 
        1  2377 2 1 63 TYR HE2  H  21.533 11.102  15.158 1.00 . B B . 63 TYR HE2  1 1 
        1  2378 2 1 63 TYR HH   H  21.251  9.016  14.208 1.00 . B B . 63 TYR HH   1 1 
        1  2379 2 1 63 TYR N    N  27.386 14.257  13.729 1.00 . B B . 63 TYR N    1 1 
        1  2380 2 1 63 TYR O    O  26.058 12.044  16.093 1.00 . B B . 63 TYR O    1 1 
        1  2381 2 1 63 TYR OH   O  22.156  8.825  13.958 1.00 . B B . 63 TYR OH   1 1 
        1  2382 2 1 64 ASN C    C  28.440 10.140  15.731 1.00 . B B . 64 ASN C    1 1 
        1  2383 2 1 64 ASN CA   C  27.428 10.158  14.595 1.00 . B B . 64 ASN CA   1 1 
        1  2384 2 1 64 ASN CB   C  27.959  9.357  13.403 1.00 . B B . 64 ASN CB   1 1 
        1  2385 2 1 64 ASN CG   C  28.223  7.915  13.819 1.00 . B B . 64 ASN CG   1 1 
        1  2386 2 1 64 ASN H    H  27.434 11.840  13.304 1.00 . B B . 64 ASN H    1 1 
        1  2387 2 1 64 ASN HA   H  26.516  9.696  14.940 1.00 . B B . 64 ASN HA   1 1 
        1  2388 2 1 64 ASN HB2  H  27.224  9.372  12.610 1.00 . B B . 64 ASN HB2  1 1 
        1  2389 2 1 64 ASN HB3  H  28.876  9.803  13.050 1.00 . B B . 64 ASN HB3  1 1 
        1  2390 2 1 64 ASN HD21 H  29.659  7.631  12.478 1.00 . B B . 64 ASN HD21 1 1 
        1  2391 2 1 64 ASN HD22 H  29.314  6.293  13.462 1.00 . B B . 64 ASN HD22 1 1 
        1  2392 2 1 64 ASN N    N  27.132 11.530  14.183 1.00 . B B . 64 ASN N    1 1 
        1  2393 2 1 64 ASN ND2  N  29.142  7.223  13.203 1.00 . B B . 64 ASN ND2  1 1 
        1  2394 2 1 64 ASN O    O  28.366  9.313  16.640 1.00 . B B . 64 ASN O    1 1 
        1  2395 2 1 64 ASN OD1  O  27.578  7.406  14.736 1.00 . B B . 64 ASN OD1  1 1 
        1  2396 2 1 65 LYS C    C  29.786 11.411  18.056 1.00 . B B . 65 LYS C    1 1 
        1  2397 2 1 65 LYS CA   C  30.418 11.146  16.693 1.00 . B B . 65 LYS CA   1 1 
        1  2398 2 1 65 LYS CB   C  31.412 12.273  16.338 1.00 . B B . 65 LYS CB   1 1 
        1  2399 2 1 65 LYS CD   C  33.637 11.160  15.910 1.00 . B B . 65 LYS CD   1 1 
        1  2400 2 1 65 LYS CE   C  34.556 10.592  14.833 1.00 . B B . 65 LYS CE   1 1 
        1  2401 2 1 65 LYS CG   C  32.409 11.798  15.249 1.00 . B B . 65 LYS CG   1 1 
        1  2402 2 1 65 LYS H    H  29.402 11.696  14.919 1.00 . B B . 65 LYS H    1 1 
        1  2403 2 1 65 LYS HA   H  30.947 10.207  16.734 1.00 . B B . 65 LYS HA   1 1 
        1  2404 2 1 65 LYS HB2  H  30.856 13.118  15.966 1.00 . B B . 65 LYS HB2  1 1 
        1  2405 2 1 65 LYS HB3  H  31.955 12.577  17.224 1.00 . B B . 65 LYS HB3  1 1 
        1  2406 2 1 65 LYS HD2  H  34.165 11.912  16.477 1.00 . B B . 65 LYS HD2  1 1 
        1  2407 2 1 65 LYS HD3  H  33.322 10.368  16.571 1.00 . B B . 65 LYS HD3  1 1 
        1  2408 2 1 65 LYS HE2  H  35.380 10.075  15.301 1.00 . B B . 65 LYS HE2  1 1 
        1  2409 2 1 65 LYS HE3  H  34.002  9.903  14.212 1.00 . B B . 65 LYS HE3  1 1 
        1  2410 2 1 65 LYS HG2  H  31.936 11.068  14.605 1.00 . B B . 65 LYS HG2  1 1 
        1  2411 2 1 65 LYS HG3  H  32.726 12.641  14.654 1.00 . B B . 65 LYS HG3  1 1 
        1  2412 2 1 65 LYS HZ1  H  35.018 12.597  14.533 1.00 . B B . 65 LYS HZ1  1 1 
        1  2413 2 1 65 LYS HZ2  H  34.505 11.790  13.133 1.00 . B B . 65 LYS HZ2  1 1 
        1  2414 2 1 65 LYS HZ3  H  36.067 11.518  13.745 1.00 . B B . 65 LYS HZ3  1 1 
        1  2415 2 1 65 LYS N    N  29.393 11.063  15.666 1.00 . B B . 65 LYS N    1 1 
        1  2416 2 1 65 LYS NZ   N  35.076 11.709  13.997 1.00 . B B . 65 LYS NZ   1 1 
        1  2417 2 1 65 LYS O    O  30.199 10.824  19.055 1.00 . B B . 65 LYS O    1 1 
        1  2418 2 1 66 VAL C    C  27.345 11.412  19.863 1.00 . B B . 66 VAL C    1 1 
        1  2419 2 1 66 VAL CA   C  28.127 12.613  19.346 1.00 . B B . 66 VAL CA   1 1 
        1  2420 2 1 66 VAL CB   C  27.188 13.822  19.148 1.00 . B B . 66 VAL CB   1 1 
        1  2421 2 1 66 VAL CG1  C  26.449 14.130  20.457 1.00 . B B . 66 VAL CG1  1 1 
        1  2422 2 1 66 VAL CG2  C  28.019 15.041  18.723 1.00 . B B . 66 VAL CG2  1 1 
        1  2423 2 1 66 VAL H    H  28.502 12.728  17.264 1.00 . B B . 66 VAL H    1 1 
        1  2424 2 1 66 VAL HA   H  28.872 12.875  20.074 1.00 . B B . 66 VAL HA   1 1 
        1  2425 2 1 66 VAL HB   H  26.461 13.600  18.376 1.00 . B B . 66 VAL HB   1 1 
        1  2426 2 1 66 VAL HG11 H  27.151 14.130  21.279 1.00 . B B . 66 VAL HG11 1 1 
        1  2427 2 1 66 VAL HG12 H  25.695 13.375  20.627 1.00 . B B . 66 VAL HG12 1 1 
        1  2428 2 1 66 VAL HG13 H  25.975 15.098  20.390 1.00 . B B . 66 VAL HG13 1 1 
        1  2429 2 1 66 VAL HG21 H  28.377 14.897  17.715 1.00 . B B . 66 VAL HG21 1 1 
        1  2430 2 1 66 VAL HG22 H  28.860 15.162  19.391 1.00 . B B . 66 VAL HG22 1 1 
        1  2431 2 1 66 VAL HG23 H  27.401 15.926  18.764 1.00 . B B . 66 VAL HG23 1 1 
        1  2432 2 1 66 VAL N    N  28.790 12.291  18.093 1.00 . B B . 66 VAL N    1 1 
        1  2433 2 1 66 VAL O    O  27.422 11.047  21.036 1.00 . B B . 66 VAL O    1 1 
        1  2434 2 1 67 LYS C    C  26.619  8.489  19.768 1.00 . B B . 67 LYS C    1 1 
        1  2435 2 1 67 LYS CA   C  25.759  9.657  19.334 1.00 . B B . 67 LYS CA   1 1 
        1  2436 2 1 67 LYS CB   C  24.949  9.246  18.122 1.00 . B B . 67 LYS CB   1 1 
        1  2437 2 1 67 LYS CD   C  22.577 10.205  17.901 1.00 . B B . 67 LYS CD   1 1 
        1  2438 2 1 67 LYS CE   C  22.051  8.999  17.080 1.00 . B B . 67 LYS CE   1 1 
        1  2439 2 1 67 LYS CG   C  24.081 10.454  17.656 1.00 . B B . 67 LYS CG   1 1 
        1  2440 2 1 67 LYS H    H  26.550 11.141  18.045 1.00 . B B . 67 LYS H    1 1 
        1  2441 2 1 67 LYS HA   H  25.087  9.935  20.123 1.00 . B B . 67 LYS HA   1 1 
        1  2442 2 1 67 LYS HB2  H  25.642  8.942  17.333 1.00 . B B . 67 LYS HB2  1 1 
        1  2443 2 1 67 LYS HB3  H  24.328  8.410  18.385 1.00 . B B . 67 LYS HB3  1 1 
        1  2444 2 1 67 LYS HD2  H  22.429 10.011  18.951 1.00 . B B . 67 LYS HD2  1 1 
        1  2445 2 1 67 LYS HD3  H  22.031 11.099  17.632 1.00 . B B . 67 LYS HD3  1 1 
        1  2446 2 1 67 LYS HE2  H  21.111  9.257  16.611 1.00 . B B . 67 LYS HE2  1 1 
        1  2447 2 1 67 LYS HE3  H  22.761  8.713  16.316 1.00 . B B . 67 LYS HE3  1 1 
        1  2448 2 1 67 LYS HG2  H  24.364 11.347  18.194 1.00 . B B . 67 LYS HG2  1 1 
        1  2449 2 1 67 LYS HG3  H  24.254 10.623  16.616 1.00 . B B . 67 LYS HG3  1 1 
        1  2450 2 1 67 LYS HZ1  H  22.396  7.036  17.689 1.00 . B B . 67 LYS HZ1  1 1 
        1  2451 2 1 67 LYS HZ2  H  20.817  7.583  17.982 1.00 . B B . 67 LYS HZ2  1 1 
        1  2452 2 1 67 LYS HZ3  H  22.095  8.115  18.966 1.00 . B B . 67 LYS HZ3  1 1 
        1  2453 2 1 67 LYS N    N  26.572 10.807  18.967 1.00 . B B . 67 LYS N    1 1 
        1  2454 2 1 67 LYS NZ   N  21.822  7.846  17.999 1.00 . B B . 67 LYS NZ   1 1 
        1  2455 2 1 67 LYS O    O  26.352  7.819  20.767 1.00 . B B . 67 LYS O    1 1 
        1  2456 2 1 68 ARG C    C  29.272  7.372  20.597 1.00 . B B . 68 ARG C    1 1 
        1  2457 2 1 68 ARG CA   C  28.579  7.153  19.266 1.00 . B B . 68 ARG CA   1 1 
        1  2458 2 1 68 ARG CB   C  29.609  7.051  18.139 1.00 . B B . 68 ARG CB   1 1 
        1  2459 2 1 68 ARG CD   C  31.372  5.581  17.129 1.00 . B B . 68 ARG CD   1 1 
        1  2460 2 1 68 ARG CG   C  30.484  5.815  18.355 1.00 . B B . 68 ARG CG   1 1 
        1  2461 2 1 68 ARG CZ   C  31.094  4.968  14.793 1.00 . B B . 68 ARG CZ   1 1 
        1  2462 2 1 68 ARG H    H  27.834  8.814  18.211 1.00 . B B . 68 ARG H    1 1 
        1  2463 2 1 68 ARG HA   H  28.013  6.235  19.308 1.00 . B B . 68 ARG HA   1 1 
        1  2464 2 1 68 ARG HB2  H  29.100  6.978  17.189 1.00 . B B . 68 ARG HB2  1 1 
        1  2465 2 1 68 ARG HB3  H  30.232  7.933  18.146 1.00 . B B . 68 ARG HB3  1 1 
        1  2466 2 1 68 ARG HD2  H  31.845  6.510  16.850 1.00 . B B . 68 ARG HD2  1 1 
        1  2467 2 1 68 ARG HD3  H  32.126  4.850  17.370 1.00 . B B . 68 ARG HD3  1 1 
        1  2468 2 1 68 ARG HE   H  29.630  4.876  16.152 1.00 . B B . 68 ARG HE   1 1 
        1  2469 2 1 68 ARG HG2  H  31.100  5.965  19.226 1.00 . B B . 68 ARG HG2  1 1 
        1  2470 2 1 68 ARG HG3  H  29.853  4.953  18.505 1.00 . B B . 68 ARG HG3  1 1 
        1  2471 2 1 68 ARG HH11 H  32.919  5.580  15.342 1.00 . B B . 68 ARG HH11 1 1 
        1  2472 2 1 68 ARG HH12 H  32.743  5.154  13.672 1.00 . B B . 68 ARG HH12 1 1 
        1  2473 2 1 68 ARG HH21 H  29.389  4.324  13.964 1.00 . B B . 68 ARG HH21 1 1 
        1  2474 2 1 68 ARG HH22 H  30.745  4.443  12.893 1.00 . B B . 68 ARG HH22 1 1 
        1  2475 2 1 68 ARG N    N  27.672  8.248  18.995 1.00 . B B . 68 ARG N    1 1 
        1  2476 2 1 68 ARG NE   N  30.573  5.100  16.007 1.00 . B B . 68 ARG NE   1 1 
        1  2477 2 1 68 ARG NH1  N  32.350  5.257  14.586 1.00 . B B . 68 ARG NH1  1 1 
        1  2478 2 1 68 ARG NH2  N  30.351  4.546  13.806 1.00 . B B . 68 ARG NH2  1 1 
        1  2479 2 1 68 ARG O    O  29.767  6.432  21.219 1.00 . B B . 68 ARG O    1 1 
        1  2480 2 1 69 GLY C    C  28.886  9.176  23.406 1.00 . B B . 69 GLY C    1 1 
        1  2481 2 1 69 GLY CA   C  29.931  8.983  22.310 1.00 . B B . 69 GLY CA   1 1 
        1  2482 2 1 69 GLY H    H  28.886  9.334  20.501 1.00 . B B . 69 GLY H    1 1 
        1  2483 2 1 69 GLY HA2  H  30.632  8.212  22.609 1.00 . B B . 69 GLY HA2  1 1 
        1  2484 2 1 69 GLY HA3  H  30.467  9.908  22.174 1.00 . B B . 69 GLY HA3  1 1 
        1  2485 2 1 69 GLY N    N  29.296  8.625  21.040 1.00 . B B . 69 GLY N    1 1 
        1  2486 2 1 69 GLY O    O  29.196  9.119  24.596 1.00 . B B . 69 GLY O    1 1 
        1  2487 2 1 70 GLU C    C  25.708  8.358  24.076 1.00 . B B . 70 GLU C    1 1 
        1  2488 2 1 70 GLU CA   C  26.539  9.622  23.934 1.00 . B B . 70 GLU CA   1 1 
        1  2489 2 1 70 GLU CB   C  25.667 10.770  23.420 1.00 . B B . 70 GLU CB   1 1 
        1  2490 2 1 70 GLU CD   C  26.519 12.569  24.971 1.00 . B B . 70 GLU CD   1 1 
        1  2491 2 1 70 GLU CG   C  26.447 12.093  23.519 1.00 . B B . 70 GLU CG   1 1 
        1  2492 2 1 70 GLU H    H  27.457  9.445  22.031 1.00 . B B . 70 GLU H    1 1 
        1  2493 2 1 70 GLU HA   H  26.931  9.893  24.909 1.00 . B B . 70 GLU HA   1 1 
        1  2494 2 1 70 GLU HB2  H  25.408 10.582  22.389 1.00 . B B . 70 GLU HB2  1 1 
        1  2495 2 1 70 GLU HB3  H  24.763 10.835  24.007 1.00 . B B . 70 GLU HB3  1 1 
        1  2496 2 1 70 GLU HG2  H  27.454 11.951  23.155 1.00 . B B . 70 GLU HG2  1 1 
        1  2497 2 1 70 GLU HG3  H  25.957 12.837  22.918 1.00 . B B . 70 GLU HG3  1 1 
        1  2498 2 1 70 GLU N    N  27.646  9.410  22.992 1.00 . B B . 70 GLU N    1 1 
        1  2499 2 1 70 GLU O    O  24.798  8.294  24.904 1.00 . B B . 70 GLU O    1 1 
        1  2500 2 1 70 GLU OE1  O  25.674 12.167  25.752 1.00 . B B . 70 GLU OE1  1 1 
        1  2501 2 1 70 GLU OE2  O  27.420 13.335  25.274 1.00 . B B . 70 GLU OE2  1 1 
        1  2502 2 1 71 SER C    C  25.071  5.651  24.765 1.00 . B B . 71 SER C    1 1 
        1  2503 2 1 71 SER CA   C  25.308  6.076  23.319 1.00 . B B . 71 SER CA   1 1 
        1  2504 2 1 71 SER CB   C  26.117  4.994  22.598 1.00 . B B . 71 SER CB   1 1 
        1  2505 2 1 71 SER H    H  26.760  7.457  22.632 1.00 . B B . 71 SER H    1 1 
        1  2506 2 1 71 SER HA   H  24.355  6.191  22.824 1.00 . B B . 71 SER HA   1 1 
        1  2507 2 1 71 SER HB2  H  25.542  4.085  22.549 1.00 . B B . 71 SER HB2  1 1 
        1  2508 2 1 71 SER HB3  H  26.346  5.327  21.594 1.00 . B B . 71 SER HB3  1 1 
        1  2509 2 1 71 SER HG   H  27.565  3.831  23.177 1.00 . B B . 71 SER HG   1 1 
        1  2510 2 1 71 SER N    N  26.026  7.349  23.272 1.00 . B B . 71 SER N    1 1 
        1  2511 2 1 71 SER O    O  25.767  6.098  25.677 1.00 . B B . 71 SER O    1 1 
        1  2512 2 1 71 SER OG   O  27.318  4.748  23.317 1.00 . B B . 71 SER OG   1 1 
        1  2513 2 1 72 LYS C    C  24.964  3.673  26.948 1.00 . B B . 72 LYS C    1 1 
        1  2514 2 1 72 LYS CA   C  23.756  4.347  26.309 1.00 . B B . 72 LYS CA   1 1 
        1  2515 2 1 72 LYS CB   C  22.590  3.359  26.247 1.00 . B B . 72 LYS CB   1 1 
        1  2516 2 1 72 LYS CD   C  20.180  3.090  25.630 1.00 . B B . 72 LYS CD   1 1 
        1  2517 2 1 72 LYS CE   C  18.936  3.806  25.095 1.00 . B B . 72 LYS CE   1 1 
        1  2518 2 1 72 LYS CG   C  21.348  4.077  25.714 1.00 . B B . 72 LYS CG   1 1 
        1  2519 2 1 72 LYS H    H  23.555  4.471  24.204 1.00 . B B . 72 LYS H    1 1 
        1  2520 2 1 72 LYS HA   H  23.465  5.198  26.907 1.00 . B B . 72 LYS HA   1 1 
        1  2521 2 1 72 LYS HB2  H  22.846  2.541  25.589 1.00 . B B . 72 LYS HB2  1 1 
        1  2522 2 1 72 LYS HB3  H  22.387  2.978  27.236 1.00 . B B . 72 LYS HB3  1 1 
        1  2523 2 1 72 LYS HD2  H  20.441  2.278  24.965 1.00 . B B . 72 LYS HD2  1 1 
        1  2524 2 1 72 LYS HD3  H  19.970  2.695  26.613 1.00 . B B . 72 LYS HD3  1 1 
        1  2525 2 1 72 LYS HE2  H  18.658  4.598  25.774 1.00 . B B . 72 LYS HE2  1 1 
        1  2526 2 1 72 LYS HE3  H  19.151  4.223  24.123 1.00 . B B . 72 LYS HE3  1 1 
        1  2527 2 1 72 LYS HG2  H  21.090  4.889  26.378 1.00 . B B . 72 LYS HG2  1 1 
        1  2528 2 1 72 LYS HG3  H  21.559  4.471  24.729 1.00 . B B . 72 LYS HG3  1 1 
        1  2529 2 1 72 LYS HZ1  H  16.917  3.348  24.857 1.00 . B B . 72 LYS HZ1  1 1 
        1  2530 2 1 72 LYS HZ2  H  17.761  2.257  25.844 1.00 . B B . 72 LYS HZ2  1 1 
        1  2531 2 1 72 LYS HZ3  H  17.971  2.214  24.159 1.00 . B B . 72 LYS HZ3  1 1 
        1  2532 2 1 72 LYS N    N  24.076  4.794  24.968 1.00 . B B . 72 LYS N    1 1 
        1  2533 2 1 72 LYS NZ   N  17.811  2.832  24.981 1.00 . B B . 72 LYS NZ   1 1 
        1  2534 2 1 72 LYS O    O  25.385  4.038  28.046 1.00 . B B . 72 LYS O    1 1 
        1  2535 2 1 73 LEU C    C  27.948  2.793  26.573 1.00 . B B . 73 LEU C    1 1 
        1  2536 2 1 73 LEU CA   C  26.683  1.958  26.760 1.00 . B B . 73 LEU CA   1 1 
        1  2537 2 1 73 LEU CB   C  26.818  0.614  26.014 1.00 . B B . 73 LEU CB   1 1 
        1  2538 2 1 73 LEU CD1  C  25.498 -1.492  25.546 1.00 . B B . 73 LEU CD1  1 1 
        1  2539 2 1 73 LEU CD2  C  26.512 -1.159  27.807 1.00 . B B . 73 LEU CD2  1 1 
        1  2540 2 1 73 LEU CG   C  25.848 -0.445  26.612 1.00 . B B . 73 LEU CG   1 1 
        1  2541 2 1 73 LEU H    H  25.136  2.433  25.385 1.00 . B B . 73 LEU H    1 1 
        1  2542 2 1 73 LEU HA   H  26.551  1.769  27.816 1.00 . B B . 73 LEU HA   1 1 
        1  2543 2 1 73 LEU HB2  H  26.581  0.782  24.972 1.00 . B B . 73 LEU HB2  1 1 
        1  2544 2 1 73 LEU HB3  H  27.838  0.253  26.086 1.00 . B B . 73 LEU HB3  1 1 
        1  2545 2 1 73 LEU HD11 H  24.899 -2.271  25.991 1.00 . B B . 73 LEU HD11 1 1 
        1  2546 2 1 73 LEU HD12 H  26.406 -1.916  25.147 1.00 . B B . 73 LEU HD12 1 1 
        1  2547 2 1 73 LEU HD13 H  24.941 -1.019  24.749 1.00 . B B . 73 LEU HD13 1 1 
        1  2548 2 1 73 LEU HD21 H  26.862 -0.432  28.524 1.00 . B B . 73 LEU HD21 1 1 
        1  2549 2 1 73 LEU HD22 H  27.349 -1.744  27.455 1.00 . B B . 73 LEU HD22 1 1 
        1  2550 2 1 73 LEU HD23 H  25.792 -1.808  28.280 1.00 . B B . 73 LEU HD23 1 1 
        1  2551 2 1 73 LEU HG   H  24.939  0.040  26.945 1.00 . B B . 73 LEU HG   1 1 
        1  2552 2 1 73 LEU N    N  25.514  2.681  26.255 1.00 . B B . 73 LEU N    1 1 
        1  2553 2 1 73 LEU O    O  28.189  3.371  25.515 1.00 . B B . 73 LEU O    1 1 
        1  2554 2 1 74 GLU C    C  31.051  2.856  28.414 1.00 . B B . 74 GLU C    1 1 
        1  2555 2 1 74 GLU CA   C  29.992  3.596  27.613 1.00 . B B . 74 GLU CA   1 1 
        1  2556 2 1 74 GLU CB   C  29.767  4.986  28.216 1.00 . B B . 74 GLU CB   1 1 
        1  2557 2 1 74 GLU CD   C  28.628  7.203  27.882 1.00 . B B . 74 GLU CD   1 1 
        1  2558 2 1 74 GLU CG   C  28.774  5.778  27.350 1.00 . B B . 74 GLU CG   1 1 
        1  2559 2 1 74 GLU H    H  28.512  2.362  28.446 1.00 . B B . 74 GLU H    1 1 
        1  2560 2 1 74 GLU HA   H  30.347  3.709  26.593 1.00 . B B . 74 GLU HA   1 1 
        1  2561 2 1 74 GLU HB2  H  29.368  4.881  29.214 1.00 . B B . 74 GLU HB2  1 1 
        1  2562 2 1 74 GLU HB3  H  30.706  5.517  28.258 1.00 . B B . 74 GLU HB3  1 1 
        1  2563 2 1 74 GLU HG2  H  29.122  5.807  26.329 1.00 . B B . 74 GLU HG2  1 1 
        1  2564 2 1 74 GLU HG3  H  27.809  5.296  27.382 1.00 . B B . 74 GLU HG3  1 1 
        1  2565 2 1 74 GLU N    N  28.756  2.845  27.628 1.00 . B B . 74 GLU N    1 1 
        1  2566 2 1 74 GLU O    O  30.768  2.082  29.329 1.00 . B B . 74 GLU O    1 1 
        1  2567 2 1 74 GLU OE1  O  29.249  7.511  28.886 1.00 . B B . 74 GLU OE1  1 1 
        1  2568 2 1 74 GLU OE2  O  27.893  7.964  27.274 1.00 . B B . 74 GLU OE2  1 1 
        1  2569 2 1 75 HIS C    C  34.640  3.436  28.757 1.00 . B B . 75 HIS C    1 1 
        1  2570 2 1 75 HIS CA   C  33.447  2.485  28.716 1.00 . B B . 75 HIS CA   1 1 
        1  2571 2 1 75 HIS CB   C  33.847  1.207  27.975 1.00 . B B . 75 HIS CB   1 1 
        1  2572 2 1 75 HIS CD2  C  31.878 -0.267  27.044 1.00 . B B . 75 HIS CD2  1 1 
        1  2573 2 1 75 HIS CE1  C  31.268 -1.186  28.908 1.00 . B B . 75 HIS CE1  1 1 
        1  2574 2 1 75 HIS CG   C  32.709  0.225  28.021 1.00 . B B . 75 HIS CG   1 1 
        1  2575 2 1 75 HIS H    H  32.466  3.740  27.309 1.00 . B B . 75 HIS H    1 1 
        1  2576 2 1 75 HIS HA   H  33.178  2.225  29.733 1.00 . B B . 75 HIS HA   1 1 
        1  2577 2 1 75 HIS HB2  H  34.077  1.445  26.947 1.00 . B B . 75 HIS HB2  1 1 
        1  2578 2 1 75 HIS HB3  H  34.716  0.772  28.447 1.00 . B B . 75 HIS HB3  1 1 
        1  2579 2 1 75 HIS HD1  H  32.693 -0.235  30.088 1.00 . B B . 75 HIS HD1  1 1 
        1  2580 2 1 75 HIS HD2  H  31.924 -0.001  25.998 1.00 . B B . 75 HIS HD2  1 1 
        1  2581 2 1 75 HIS HE1  H  30.744 -1.786  29.637 1.00 . B B . 75 HIS HE1  1 1 
        1  2582 2 1 75 HIS HE2  H  30.262 -1.655  27.146 1.00 . B B . 75 HIS HE2  1 1 
        1  2583 2 1 75 HIS N    N  32.301  3.116  28.046 1.00 . B B . 75 HIS N    1 1 
        1  2584 2 1 75 HIS ND1  N  32.301 -0.375  29.202 1.00 . B B . 75 HIS ND1  1 1 
        1  2585 2 1 75 HIS NE2  N  30.969 -1.157  27.607 1.00 . B B . 75 HIS NE2  1 1 
        1  2586 2 1 75 HIS O    O  35.053  3.980  27.733 1.00 . B B . 75 HIS O    1 1 
        1  2587 2 1 76 HIS C    C  36.931  4.373  31.521 1.00 . B B . 76 HIS C    1 1 
        1  2588 2 1 76 HIS CA   C  36.338  4.516  30.117 1.00 . B B . 76 HIS CA   1 1 
        1  2589 2 1 76 HIS CB   C  35.917  5.974  29.865 1.00 . B B . 76 HIS CB   1 1 
        1  2590 2 1 76 HIS CD2  C  37.509  7.847  30.809 1.00 . B B . 76 HIS CD2  1 1 
        1  2591 2 1 76 HIS CE1  C  39.065  7.716  29.307 1.00 . B B . 76 HIS CE1  1 1 
        1  2592 2 1 76 HIS CG   C  37.129  6.865  29.927 1.00 . B B . 76 HIS CG   1 1 
        1  2593 2 1 76 HIS H    H  34.817  3.171  30.733 1.00 . B B . 76 HIS H    1 1 
        1  2594 2 1 76 HIS HA   H  37.093  4.245  29.394 1.00 . B B . 76 HIS HA   1 1 
        1  2595 2 1 76 HIS HB2  H  35.462  6.054  28.889 1.00 . B B . 76 HIS HB2  1 1 
        1  2596 2 1 76 HIS HB3  H  35.206  6.281  30.619 1.00 . B B . 76 HIS HB3  1 1 
        1  2597 2 1 76 HIS HD1  H  38.168  6.194  28.208 1.00 . B B . 76 HIS HD1  1 1 
        1  2598 2 1 76 HIS HD2  H  36.945  8.155  31.677 1.00 . B B . 76 HIS HD2  1 1 
        1  2599 2 1 76 HIS HE1  H  39.971  7.891  28.745 1.00 . B B . 76 HIS HE1  1 1 
        1  2600 2 1 76 HIS HE2  H  39.239  9.095  30.857 1.00 . B B . 76 HIS HE2  1 1 
        1  2601 2 1 76 HIS N    N  35.189  3.631  29.951 1.00 . B B . 76 HIS N    1 1 
        1  2602 2 1 76 HIS ND1  N  38.137  6.799  28.977 1.00 . B B . 76 HIS ND1  1 1 
        1  2603 2 1 76 HIS NE2  N  38.731  8.383  30.415 1.00 . B B . 76 HIS NE2  1 1 
        1  2604 2 1 76 HIS O    O  37.410  3.303  31.896 1.00 . B B . 76 HIS O    1 1 
        1  2605 2 1 77 HIS C    C  36.834  6.581  34.465 1.00 . B B . 77 HIS C    1 1 
        1  2606 2 1 77 HIS CA   C  37.425  5.440  33.649 1.00 . B B . 77 HIS CA   1 1 
        1  2607 2 1 77 HIS CB   C  38.949  5.573  33.612 1.00 . B B . 77 HIS CB   1 1 
        1  2608 2 1 77 HIS CD2  C  39.944  6.389  35.904 1.00 . B B . 77 HIS CD2  1 1 
        1  2609 2 1 77 HIS CE1  C  40.149  4.457  36.863 1.00 . B B . 77 HIS CE1  1 1 
        1  2610 2 1 77 HIS CG   C  39.501  5.450  35.006 1.00 . B B . 77 HIS CG   1 1 
        1  2611 2 1 77 HIS H    H  36.494  6.281  31.936 1.00 . B B . 77 HIS H    1 1 
        1  2612 2 1 77 HIS HA   H  37.167  4.503  34.125 1.00 . B B . 77 HIS HA   1 1 
        1  2613 2 1 77 HIS HB2  H  39.362  4.793  32.990 1.00 . B B . 77 HIS HB2  1 1 
        1  2614 2 1 77 HIS HB3  H  39.215  6.537  33.204 1.00 . B B . 77 HIS HB3  1 1 
        1  2615 2 1 77 HIS HD1  H  39.412  3.349  35.263 1.00 . B B . 77 HIS HD1  1 1 
        1  2616 2 1 77 HIS HD2  H  39.969  7.454  35.728 1.00 . B B . 77 HIS HD2  1 1 
        1  2617 2 1 77 HIS HE1  H  40.366  3.684  37.585 1.00 . B B . 77 HIS HE1  1 1 
        1  2618 2 1 77 HIS HE2  H  40.711  6.182  37.884 1.00 . B B . 77 HIS HE2  1 1 
        1  2619 2 1 77 HIS N    N  36.889  5.457  32.289 1.00 . B B . 77 HIS N    1 1 
        1  2620 2 1 77 HIS ND1  N  39.642  4.224  35.639 1.00 . B B . 77 HIS ND1  1 1 
        1  2621 2 1 77 HIS NE2  N  40.353  5.759  37.076 1.00 . B B . 77 HIS NE2  1 1 
        1  2622 2 1 77 HIS O    O  37.236  6.809  35.606 1.00 . B B . 77 HIS O    1 1 
        1  2623 2 1 78 HIS C    C  36.288  9.376  35.110 1.00 . B B . 78 HIS C    1 1 
        1  2624 2 1 78 HIS CA   C  35.240  8.413  34.560 1.00 . B B . 78 HIS CA   1 1 
        1  2625 2 1 78 HIS CB   C  34.369  7.895  35.704 1.00 . B B . 78 HIS CB   1 1 
        1  2626 2 1 78 HIS CD2  C  33.076  5.662  35.199 1.00 . B B . 78 HIS CD2  1 1 
        1  2627 2 1 78 HIS CE1  C  31.422  6.503  34.079 1.00 . B B . 78 HIS CE1  1 1 
        1  2628 2 1 78 HIS CG   C  33.277  7.019  35.149 1.00 . B B . 78 HIS CG   1 1 
        1  2629 2 1 78 HIS H    H  35.601  7.065  32.966 1.00 . B B . 78 HIS H    1 1 
        1  2630 2 1 78 HIS HA   H  34.614  8.940  33.856 1.00 . B B . 78 HIS HA   1 1 
        1  2631 2 1 78 HIS HB2  H  34.977  7.322  36.388 1.00 . B B . 78 HIS HB2  1 1 
        1  2632 2 1 78 HIS HB3  H  33.927  8.730  36.228 1.00 . B B . 78 HIS HB3  1 1 
        1  2633 2 1 78 HIS HD1  H  32.058  8.479  34.215 1.00 . B B . 78 HIS HD1  1 1 
        1  2634 2 1 78 HIS HD2  H  33.728  4.954  35.688 1.00 . B B . 78 HIS HD2  1 1 
        1  2635 2 1 78 HIS HE1  H  30.511  6.604  33.507 1.00 . B B . 78 HIS HE1  1 1 
        1  2636 2 1 78 HIS HE2  H  31.515  4.448  34.398 1.00 . B B . 78 HIS HE2  1 1 
        1  2637 2 1 78 HIS N    N  35.879  7.294  33.877 1.00 . B B . 78 HIS N    1 1 
        1  2638 2 1 78 HIS ND1  N  32.210  7.535  34.430 1.00 . B B . 78 HIS ND1  1 1 
        1  2639 2 1 78 HIS NE2  N  31.903  5.338  34.523 1.00 . B B . 78 HIS NE2  1 1 
        1  2640 2 1 78 HIS O    O  37.480  9.229  34.843 1.00 . B B . 78 HIS O    1 1 
        1  2641 2 1 79 HIS C    C  36.108 12.003  37.685 1.00 . B B . 79 HIS C    1 1 
        1  2642 2 1 79 HIS CA   C  36.744 11.346  36.466 1.00 . B B . 79 HIS CA   1 1 
        1  2643 2 1 79 HIS CB   C  37.093 12.415  35.428 1.00 . B B . 79 HIS CB   1 1 
        1  2644 2 1 79 HIS CD2  C  38.051 14.695  36.316 1.00 . B B . 79 HIS CD2  1 1 
        1  2645 2 1 79 HIS CE1  C  40.051 14.024  36.812 1.00 . B B . 79 HIS CE1  1 1 
        1  2646 2 1 79 HIS CG   C  38.113 13.360  36.001 1.00 . B B . 79 HIS CG   1 1 
        1  2647 2 1 79 HIS H    H  34.874 10.428  36.058 1.00 . B B . 79 HIS H    1 1 
        1  2648 2 1 79 HIS HA   H  37.655 10.851  36.776 1.00 . B B . 79 HIS HA   1 1 
        1  2649 2 1 79 HIS HB2  H  37.497 11.941  34.545 1.00 . B B . 79 HIS HB2  1 1 
        1  2650 2 1 79 HIS HB3  H  36.201 12.966  35.163 1.00 . B B . 79 HIS HB3  1 1 
        1  2651 2 1 79 HIS HD1  H  39.763 12.050  36.219 1.00 . B B . 79 HIS HD1  1 1 
        1  2652 2 1 79 HIS HD2  H  37.185 15.326  36.187 1.00 . B B . 79 HIS HD2  1 1 
        1  2653 2 1 79 HIS HE1  H  41.077 14.006  37.148 1.00 . B B . 79 HIS HE1  1 1 
        1  2654 2 1 79 HIS HE2  H  39.519 16.011  37.135 1.00 . B B . 79 HIS HE2  1 1 
        1  2655 2 1 79 HIS N    N  35.835 10.361  35.880 1.00 . B B . 79 HIS N    1 1 
        1  2656 2 1 79 HIS ND1  N  39.398 12.953  36.325 1.00 . B B . 79 HIS ND1  1 1 
        1  2657 2 1 79 HIS NE2  N  39.276 15.113  36.828 1.00 . B B . 79 HIS NE2  1 1 
        1  2658 2 1 79 HIS O    O  34.918 12.319  37.685 1.00 . B B . 79 HIS O    1 1 
        1  2659 2 1 80 HIS C    C  37.576 13.132  40.894 1.00 . B B . 80 HIS C    1 1 
        1  2660 2 1 80 HIS CA   C  36.419 12.825  39.950 1.00 . B B . 80 HIS CA   1 1 
        1  2661 2 1 80 HIS CB   C  35.426 11.891  40.643 1.00 . B B . 80 HIS CB   1 1 
        1  2662 2 1 80 HIS CD2  C  36.366  9.497  40.096 1.00 . B B . 80 HIS CD2  1 1 
        1  2663 2 1 80 HIS CE1  C  37.078  8.980  42.076 1.00 . B B . 80 HIS CE1  1 1 
        1  2664 2 1 80 HIS CG   C  36.085 10.566  40.912 1.00 . B B . 80 HIS CG   1 1 
        1  2665 2 1 80 HIS H    H  37.851 11.933  38.668 1.00 . B B . 80 HIS H    1 1 
        1  2666 2 1 80 HIS HA   H  35.916 13.747  39.701 1.00 . B B . 80 HIS HA   1 1 
        1  2667 2 1 80 HIS HB2  H  35.109 12.331  41.577 1.00 . B B . 80 HIS HB2  1 1 
        1  2668 2 1 80 HIS HB3  H  34.567 11.742  40.006 1.00 . B B . 80 HIS HB3  1 1 
        1  2669 2 1 80 HIS HD1  H  36.499 10.762  42.980 1.00 . B B . 80 HIS HD1  1 1 
        1  2670 2 1 80 HIS HD2  H  36.135  9.441  39.043 1.00 . B B . 80 HIS HD2  1 1 
        1  2671 2 1 80 HIS HE1  H  37.518  8.445  42.905 1.00 . B B . 80 HIS HE1  1 1 
        1  2672 2 1 80 HIS HE2  H  37.304  7.626  40.510 1.00 . B B . 80 HIS HE2  1 1 
        1  2673 2 1 80 HIS N    N  36.911 12.206  38.724 1.00 . B B . 80 HIS N    1 1 
        1  2674 2 1 80 HIS ND1  N  36.548 10.213  42.169 1.00 . B B . 80 HIS ND1  1 1 
        1  2675 2 1 80 HIS NE2  N  36.992  8.497  40.833 1.00 . B B . 80 HIS NE2  1 1 
        1  2676 2 1 80 HIS O    O  38.528 12.368  40.901 1.00 . B B . 80 HIS O    1 1 
        2  2677 1 1  1 MET C    C  -4.662  4.783  -3.402 1.00 . A A .  1 MET C    1 1 
        2  2678 1 1  1 MET CA   C  -5.633  3.805  -2.744 1.00 . A A .  1 MET CA   1 1 
        2  2679 1 1  1 MET CB   C  -6.674  4.576  -1.929 1.00 . A A .  1 MET CB   1 1 
        2  2680 1 1  1 MET CE   C  -8.254  4.703   1.063 1.00 . A A .  1 MET CE   1 1 
        2  2681 1 1  1 MET CG   C  -7.728  3.603  -1.390 1.00 . A A .  1 MET CG   1 1 
        2  2682 1 1  1 MET H1   H  -4.178  2.355  -2.393 1.00 . A A .  1 MET H1   1 1 
        2  2683 1 1  1 MET H2   H  -5.545  2.221  -1.394 1.00 . A A .  1 MET H2   1 1 
        2  2684 1 1  1 MET H3   H  -4.396  3.440  -1.108 1.00 . A A .  1 MET H3   1 1 
        2  2685 1 1  1 MET HA   H  -6.131  3.227  -3.509 1.00 . A A .  1 MET HA   1 1 
        2  2686 1 1  1 MET HB2  H  -6.185  5.075  -1.106 1.00 . A A .  1 MET HB2  1 1 
        2  2687 1 1  1 MET HB3  H  -7.154  5.308  -2.560 1.00 . A A .  1 MET HB3  1 1 
        2  2688 1 1  1 MET HE1  H  -7.347  5.279   0.961 1.00 . A A .  1 MET HE1  1 1 
        2  2689 1 1  1 MET HE2  H  -8.024  3.725   1.462 1.00 . A A .  1 MET HE2  1 1 
        2  2690 1 1  1 MET HE3  H  -8.925  5.214   1.737 1.00 . A A .  1 MET HE3  1 1 
        2  2691 1 1  1 MET HG2  H  -8.146  3.038  -2.209 1.00 . A A .  1 MET HG2  1 1 
        2  2692 1 1  1 MET HG3  H  -7.264  2.925  -0.687 1.00 . A A .  1 MET HG3  1 1 
        2  2693 1 1  1 MET N    N  -4.881  2.886  -1.842 1.00 . A A .  1 MET N    1 1 
        2  2694 1 1  1 MET O    O  -4.282  4.611  -4.561 1.00 . A A .  1 MET O    1 1 
        2  2695 1 1  1 MET SD   S  -9.049  4.524  -0.557 1.00 . A A .  1 MET SD   1 1 
        2  2696 1 1  2 SER C    C  -1.997  6.153  -3.541 1.00 . A A .  2 SER C    1 1 
        2  2697 1 1  2 SER CA   C  -3.330  6.804  -3.170 1.00 . A A .  2 SER CA   1 1 
        2  2698 1 1  2 SER CB   C  -3.097  7.891  -2.120 1.00 . A A .  2 SER CB   1 1 
        2  2699 1 1  2 SER H    H  -4.594  5.890  -1.736 1.00 . A A .  2 SER H    1 1 
        2  2700 1 1  2 SER HA   H  -3.759  7.258  -4.052 1.00 . A A .  2 SER HA   1 1 
        2  2701 1 1  2 SER HB2  H  -2.713  7.447  -1.218 1.00 . A A .  2 SER HB2  1 1 
        2  2702 1 1  2 SER HB3  H  -2.382  8.609  -2.498 1.00 . A A .  2 SER HB3  1 1 
        2  2703 1 1  2 SER HG   H  -4.273  8.910  -0.950 1.00 . A A .  2 SER HG   1 1 
        2  2704 1 1  2 SER N    N  -4.260  5.804  -2.653 1.00 . A A .  2 SER N    1 1 
        2  2705 1 1  2 SER O    O  -1.387  6.490  -4.555 1.00 . A A .  2 SER O    1 1 
        2  2706 1 1  2 SER OG   O  -4.331  8.539  -1.833 1.00 . A A .  2 SER OG   1 1 
        2  2707 1 1  3 GLU C    C   0.853  5.523  -3.054 1.00 . A A .  3 GLU C    1 1 
        2  2708 1 1  3 GLU CA   C  -0.292  4.524  -2.939 1.00 . A A .  3 GLU CA   1 1 
        2  2709 1 1  3 GLU CB   C  -0.383  3.684  -4.224 1.00 . A A .  3 GLU CB   1 1 
        2  2710 1 1  3 GLU CD   C   0.759  1.652  -3.277 1.00 . A A .  3 GLU CD   1 1 
        2  2711 1 1  3 GLU CG   C   0.837  2.753  -4.333 1.00 . A A .  3 GLU CG   1 1 
        2  2712 1 1  3 GLU H    H  -2.083  4.994  -1.911 1.00 . A A .  3 GLU H    1 1 
        2  2713 1 1  3 GLU HA   H  -0.098  3.867  -2.105 1.00 . A A .  3 GLU HA   1 1 
        2  2714 1 1  3 GLU HB2  H  -1.287  3.091  -4.197 1.00 . A A .  3 GLU HB2  1 1 
        2  2715 1 1  3 GLU HB3  H  -0.411  4.339  -5.083 1.00 . A A .  3 GLU HB3  1 1 
        2  2716 1 1  3 GLU HG2  H   0.854  2.303  -5.316 1.00 . A A .  3 GLU HG2  1 1 
        2  2717 1 1  3 GLU HG3  H   1.743  3.321  -4.189 1.00 . A A .  3 GLU HG3  1 1 
        2  2718 1 1  3 GLU N    N  -1.554  5.221  -2.704 1.00 . A A .  3 GLU N    1 1 
        2  2719 1 1  3 GLU O    O   1.385  5.746  -4.141 1.00 . A A .  3 GLU O    1 1 
        2  2720 1 1  3 GLU OE1  O  -0.287  1.522  -2.663 1.00 . A A .  3 GLU OE1  1 1 
        2  2721 1 1  3 GLU OE2  O   1.745  0.955  -3.099 1.00 . A A .  3 GLU OE2  1 1 
        2  2722 1 1  4 LEU C    C   2.095  8.154  -2.989 1.00 . A A .  4 LEU C    1 1 
        2  2723 1 1  4 LEU CA   C   2.311  7.095  -1.903 1.00 . A A .  4 LEU CA   1 1 
        2  2724 1 1  4 LEU CB   C   3.659  6.387  -2.108 1.00 . A A .  4 LEU CB   1 1 
        2  2725 1 1  4 LEU CD1  C   2.968  4.422  -0.654 1.00 . A A .  4 LEU CD1  1 1 
        2  2726 1 1  4 LEU CD2  C   5.407  4.912  -1.127 1.00 . A A .  4 LEU CD2  1 1 
        2  2727 1 1  4 LEU CG   C   4.019  5.530  -0.885 1.00 . A A .  4 LEU CG   1 1 
        2  2728 1 1  4 LEU H    H   0.767  5.904  -1.090 1.00 . A A .  4 LEU H    1 1 
        2  2729 1 1  4 LEU HA   H   2.319  7.583  -0.941 1.00 . A A .  4 LEU HA   1 1 
        2  2730 1 1  4 LEU HB2  H   3.606  5.760  -2.985 1.00 . A A .  4 LEU HB2  1 1 
        2  2731 1 1  4 LEU HB3  H   4.433  7.127  -2.243 1.00 . A A .  4 LEU HB3  1 1 
        2  2732 1 1  4 LEU HD11 H   2.621  4.036  -1.604 1.00 . A A .  4 LEU HD11 1 1 
        2  2733 1 1  4 LEU HD12 H   2.130  4.827  -0.104 1.00 . A A .  4 LEU HD12 1 1 
        2  2734 1 1  4 LEU HD13 H   3.404  3.616  -0.079 1.00 . A A .  4 LEU HD13 1 1 
        2  2735 1 1  4 LEU HD21 H   6.128  5.703  -1.270 1.00 . A A .  4 LEU HD21 1 1 
        2  2736 1 1  4 LEU HD22 H   5.378  4.288  -2.010 1.00 . A A .  4 LEU HD22 1 1 
        2  2737 1 1  4 LEU HD23 H   5.693  4.316  -0.275 1.00 . A A .  4 LEU HD23 1 1 
        2  2738 1 1  4 LEU HG   H   4.058  6.163  -0.012 1.00 . A A .  4 LEU HG   1 1 
        2  2739 1 1  4 LEU N    N   1.227  6.122  -1.928 1.00 . A A .  4 LEU N    1 1 
        2  2740 1 1  4 LEU O    O   1.040  8.785  -3.046 1.00 . A A .  4 LEU O    1 1 
        2  2741 1 1  5 PHE C    C   2.773 10.726  -4.346 1.00 . A A .  5 PHE C    1 1 
        2  2742 1 1  5 PHE CA   C   3.008  9.329  -4.917 1.00 . A A .  5 PHE CA   1 1 
        2  2743 1 1  5 PHE CB   C   1.864  8.961  -5.877 1.00 . A A .  5 PHE CB   1 1 
        2  2744 1 1  5 PHE CD1  C   2.778  9.505  -8.162 1.00 . A A .  5 PHE CD1  1 1 
        2  2745 1 1  5 PHE CD2  C   1.118 10.990  -7.201 1.00 . A A .  5 PHE CD2  1 1 
        2  2746 1 1  5 PHE CE1  C   2.839 10.312  -9.304 1.00 . A A .  5 PHE CE1  1 1 
        2  2747 1 1  5 PHE CE2  C   1.180 11.797  -8.343 1.00 . A A .  5 PHE CE2  1 1 
        2  2748 1 1  5 PHE CG   C   1.918  9.844  -7.110 1.00 . A A .  5 PHE CG   1 1 
        2  2749 1 1  5 PHE CZ   C   2.040 11.458  -9.395 1.00 . A A .  5 PHE CZ   1 1 
        2  2750 1 1  5 PHE H    H   3.916  7.811  -3.747 1.00 . A A .  5 PHE H    1 1 
        2  2751 1 1  5 PHE HA   H   3.938  9.333  -5.465 1.00 . A A .  5 PHE HA   1 1 
        2  2752 1 1  5 PHE HB2  H   1.967  7.926  -6.173 1.00 . A A .  5 PHE HB2  1 1 
        2  2753 1 1  5 PHE HB3  H   0.915  9.095  -5.382 1.00 . A A .  5 PHE HB3  1 1 
        2  2754 1 1  5 PHE HD1  H   3.393  8.621  -8.092 1.00 . A A .  5 PHE HD1  1 1 
        2  2755 1 1  5 PHE HD2  H   0.454 11.250  -6.390 1.00 . A A .  5 PHE HD2  1 1 
        2  2756 1 1  5 PHE HE1  H   3.502 10.051 -10.116 1.00 . A A .  5 PHE HE1  1 1 
        2  2757 1 1  5 PHE HE2  H   0.563 12.681  -8.413 1.00 . A A .  5 PHE HE2  1 1 
        2  2758 1 1  5 PHE HZ   H   2.085 12.081 -10.275 1.00 . A A .  5 PHE HZ   1 1 
        2  2759 1 1  5 PHE N    N   3.099  8.342  -3.841 1.00 . A A .  5 PHE N    1 1 
        2  2760 1 1  5 PHE O    O   3.651 11.586  -4.393 1.00 . A A .  5 PHE O    1 1 
        2  2761 1 1  6 SER C    C   2.136 12.529  -2.038 1.00 . A A .  6 SER C    1 1 
        2  2762 1 1  6 SER CA   C   1.229 12.225  -3.230 1.00 . A A .  6 SER CA   1 1 
        2  2763 1 1  6 SER CB   C  -0.257 12.207  -2.810 1.00 . A A .  6 SER CB   1 1 
        2  2764 1 1  6 SER H    H   0.917 10.218  -3.795 1.00 . A A .  6 SER H    1 1 
        2  2765 1 1  6 SER HA   H   1.372 12.991  -3.972 1.00 . A A .  6 SER HA   1 1 
        2  2766 1 1  6 SER HB2  H  -0.774 11.434  -3.352 1.00 . A A .  6 SER HB2  1 1 
        2  2767 1 1  6 SER HB3  H  -0.350 12.011  -1.745 1.00 . A A .  6 SER HB3  1 1 
        2  2768 1 1  6 SER HG   H  -0.138 14.095  -3.261 1.00 . A A .  6 SER HG   1 1 
        2  2769 1 1  6 SER N    N   1.577 10.941  -3.804 1.00 . A A .  6 SER N    1 1 
        2  2770 1 1  6 SER O    O   2.313 11.697  -1.149 1.00 . A A .  6 SER O    1 1 
        2  2771 1 1  6 SER OG   O  -0.849 13.459  -3.127 1.00 . A A .  6 SER OG   1 1 
        2  2772 1 1  7 VAL C    C   2.750 14.295   0.364 1.00 . A A .  7 VAL C    1 1 
        2  2773 1 1  7 VAL CA   C   3.569 14.148  -0.930 1.00 . A A .  7 VAL CA   1 1 
        2  2774 1 1  7 VAL CB   C   4.286 15.487  -1.273 1.00 . A A .  7 VAL CB   1 1 
        2  2775 1 1  7 VAL CG1  C   5.622 15.600  -0.516 1.00 . A A .  7 VAL CG1  1 1 
        2  2776 1 1  7 VAL CG2  C   4.547 15.576  -2.790 1.00 . A A .  7 VAL CG2  1 1 
        2  2777 1 1  7 VAL H    H   2.523 14.356  -2.762 1.00 . A A .  7 VAL H    1 1 
        2  2778 1 1  7 VAL HA   H   4.317 13.376  -0.775 1.00 . A A .  7 VAL HA   1 1 
        2  2779 1 1  7 VAL HB   H   3.662 16.314  -0.978 1.00 . A A .  7 VAL HB   1 1 
        2  2780 1 1  7 VAL HG11 H   5.447 15.484   0.542 1.00 . A A .  7 VAL HG11 1 1 
        2  2781 1 1  7 VAL HG12 H   6.056 16.570  -0.705 1.00 . A A .  7 VAL HG12 1 1 
        2  2782 1 1  7 VAL HG13 H   6.305 14.833  -0.856 1.00 . A A .  7 VAL HG13 1 1 
        2  2783 1 1  7 VAL HG21 H   5.010 14.664  -3.137 1.00 . A A .  7 VAL HG21 1 1 
        2  2784 1 1  7 VAL HG22 H   5.201 16.413  -2.997 1.00 . A A .  7 VAL HG22 1 1 
        2  2785 1 1  7 VAL HG23 H   3.611 15.723  -3.310 1.00 . A A .  7 VAL HG23 1 1 
        2  2786 1 1  7 VAL N    N   2.701 13.732  -2.027 1.00 . A A .  7 VAL N    1 1 
        2  2787 1 1  7 VAL O    O   3.234 13.928   1.435 1.00 . A A .  7 VAL O    1 1 
        2  2788 1 1  8 PRO C    C   0.539 13.696   2.282 1.00 . A A .  8 PRO C    1 1 
        2  2789 1 1  8 PRO CA   C   0.692 14.992   1.494 1.00 . A A .  8 PRO CA   1 1 
        2  2790 1 1  8 PRO CB   C  -0.662 15.462   0.918 1.00 . A A .  8 PRO CB   1 1 
        2  2791 1 1  8 PRO CD   C   0.849 15.275  -0.936 1.00 . A A .  8 PRO CD   1 1 
        2  2792 1 1  8 PRO CG   C  -0.311 16.112  -0.382 1.00 . A A .  8 PRO CG   1 1 
        2  2793 1 1  8 PRO HA   H   1.102 15.759   2.131 1.00 . A A .  8 PRO HA   1 1 
        2  2794 1 1  8 PRO HB2  H  -1.319 14.611   0.749 1.00 . A A .  8 PRO HB2  1 1 
        2  2795 1 1  8 PRO HB3  H  -1.137 16.173   1.580 1.00 . A A .  8 PRO HB3  1 1 
        2  2796 1 1  8 PRO HD2  H   0.462 14.436  -1.486 1.00 . A A .  8 PRO HD2  1 1 
        2  2797 1 1  8 PRO HD3  H   1.503 15.863  -1.557 1.00 . A A .  8 PRO HD3  1 1 
        2  2798 1 1  8 PRO HG2  H  -1.167 16.091  -1.055 1.00 . A A .  8 PRO HG2  1 1 
        2  2799 1 1  8 PRO HG3  H   0.011 17.130  -0.222 1.00 . A A .  8 PRO HG3  1 1 
        2  2800 1 1  8 PRO N    N   1.554 14.813   0.286 1.00 . A A .  8 PRO N    1 1 
        2  2801 1 1  8 PRO O    O   0.288 13.732   3.487 1.00 . A A .  8 PRO O    1 1 
        2  2802 1 1  9 TYR C    C   1.578 11.118   3.376 1.00 . A A .  9 TYR C    1 1 
        2  2803 1 1  9 TYR CA   C   0.540 11.266   2.261 1.00 . A A .  9 TYR CA   1 1 
        2  2804 1 1  9 TYR CB   C   0.717 10.139   1.235 1.00 . A A .  9 TYR CB   1 1 
        2  2805 1 1  9 TYR CD1  C  -0.770  8.313   2.132 1.00 . A A .  9 TYR CD1  1 1 
        2  2806 1 1  9 TYR CD2  C   1.631  8.052   2.339 1.00 . A A .  9 TYR CD2  1 1 
        2  2807 1 1  9 TYR CE1  C  -0.959  7.078   2.764 1.00 . A A .  9 TYR CE1  1 1 
        2  2808 1 1  9 TYR CE2  C   1.442  6.817   2.971 1.00 . A A .  9 TYR CE2  1 1 
        2  2809 1 1  9 TYR CG   C   0.525  8.800   1.919 1.00 . A A .  9 TYR CG   1 1 
        2  2810 1 1  9 TYR CZ   C   0.147  6.330   3.183 1.00 . A A .  9 TYR CZ   1 1 
        2  2811 1 1  9 TYR H    H   0.878 12.594   0.646 1.00 . A A .  9 TYR H    1 1 
        2  2812 1 1  9 TYR HA   H  -0.449 11.194   2.689 1.00 . A A .  9 TYR HA   1 1 
        2  2813 1 1  9 TYR HB2  H  -0.018 10.249   0.445 1.00 . A A .  9 TYR HB2  1 1 
        2  2814 1 1  9 TYR HB3  H   1.707 10.192   0.806 1.00 . A A .  9 TYR HB3  1 1 
        2  2815 1 1  9 TYR HD1  H  -1.624  8.891   1.809 1.00 . A A .  9 TYR HD1  1 1 
        2  2816 1 1  9 TYR HD2  H   2.630  8.427   2.176 1.00 . A A .  9 TYR HD2  1 1 
        2  2817 1 1  9 TYR HE1  H  -1.960  6.703   2.928 1.00 . A A .  9 TYR HE1  1 1 
        2  2818 1 1  9 TYR HE2  H   2.296  6.240   3.295 1.00 . A A .  9 TYR HE2  1 1 
        2  2819 1 1  9 TYR HH   H  -0.399  5.285   4.686 1.00 . A A .  9 TYR HH   1 1 
        2  2820 1 1  9 TYR N    N   0.679 12.561   1.605 1.00 . A A .  9 TYR N    1 1 
        2  2821 1 1  9 TYR O    O   1.267 10.643   4.468 1.00 . A A .  9 TYR O    1 1 
        2  2822 1 1  9 TYR OH   O  -0.040  5.115   3.810 1.00 . A A .  9 TYR OH   1 1 
        2  2823 1 1 10 PHE C    C   3.505 12.200   5.346 1.00 . A A . 10 PHE C    1 1 
        2  2824 1 1 10 PHE CA   C   3.886 11.439   4.075 1.00 . A A . 10 PHE CA   1 1 
        2  2825 1 1 10 PHE CB   C   5.204 12.014   3.474 1.00 . A A . 10 PHE CB   1 1 
        2  2826 1 1 10 PHE CD1  C   5.664  9.821   2.306 1.00 . A A . 10 PHE CD1  1 1 
        2  2827 1 1 10 PHE CD2  C   7.494 10.917   3.459 1.00 . A A . 10 PHE CD2  1 1 
        2  2828 1 1 10 PHE CE1  C   6.521  8.777   1.937 1.00 . A A . 10 PHE CE1  1 1 
        2  2829 1 1 10 PHE CE2  C   8.351  9.873   3.090 1.00 . A A . 10 PHE CE2  1 1 
        2  2830 1 1 10 PHE CG   C   6.150 10.890   3.066 1.00 . A A . 10 PHE CG   1 1 
        2  2831 1 1 10 PHE CZ   C   7.865  8.803   2.329 1.00 . A A . 10 PHE CZ   1 1 
        2  2832 1 1 10 PHE H    H   2.998 11.899   2.202 1.00 . A A . 10 PHE H    1 1 
        2  2833 1 1 10 PHE HA   H   4.031 10.398   4.335 1.00 . A A . 10 PHE HA   1 1 
        2  2834 1 1 10 PHE HB2  H   4.962 12.601   2.601 1.00 . A A . 10 PHE HB2  1 1 
        2  2835 1 1 10 PHE HB3  H   5.695 12.655   4.199 1.00 . A A . 10 PHE HB3  1 1 
        2  2836 1 1 10 PHE HD1  H   4.628  9.800   2.004 1.00 . A A . 10 PHE HD1  1 1 
        2  2837 1 1 10 PHE HD2  H   7.873 11.740   4.047 1.00 . A A . 10 PHE HD2  1 1 
        2  2838 1 1 10 PHE HE1  H   6.146  7.951   1.351 1.00 . A A . 10 PHE HE1  1 1 
        2  2839 1 1 10 PHE HE2  H   9.384  9.890   3.391 1.00 . A A . 10 PHE HE2  1 1 
        2  2840 1 1 10 PHE HZ   H   8.529  7.998   2.054 1.00 . A A . 10 PHE HZ   1 1 
        2  2841 1 1 10 PHE N    N   2.809 11.528   3.088 1.00 . A A . 10 PHE N    1 1 
        2  2842 1 1 10 PHE O    O   3.778 11.737   6.454 1.00 . A A . 10 PHE O    1 1 
        2  2843 1 1 11 ILE C    C   1.366 13.474   7.105 1.00 . A A . 11 ILE C    1 1 
        2  2844 1 1 11 ILE CA   C   2.481 14.171   6.325 1.00 . A A . 11 ILE CA   1 1 
        2  2845 1 1 11 ILE CB   C   2.007 15.549   5.852 1.00 . A A . 11 ILE CB   1 1 
        2  2846 1 1 11 ILE CD1  C   2.575 17.498   4.385 1.00 . A A . 11 ILE CD1  1 1 
        2  2847 1 1 11 ILE CG1  C   3.099 16.195   4.985 1.00 . A A . 11 ILE CG1  1 1 
        2  2848 1 1 11 ILE CG2  C   1.743 16.445   7.069 1.00 . A A . 11 ILE CG2  1 1 
        2  2849 1 1 11 ILE H    H   2.691 13.681   4.273 1.00 . A A . 11 ILE H    1 1 
        2  2850 1 1 11 ILE HA   H   3.331 14.303   6.972 1.00 . A A . 11 ILE HA   1 1 
        2  2851 1 1 11 ILE HB   H   1.098 15.442   5.277 1.00 . A A . 11 ILE HB   1 1 
        2  2852 1 1 11 ILE HD11 H   1.639 17.315   3.881 1.00 . A A . 11 ILE HD11 1 1 
        2  2853 1 1 11 ILE HD12 H   3.294 17.881   3.680 1.00 . A A . 11 ILE HD12 1 1 
        2  2854 1 1 11 ILE HD13 H   2.425 18.220   5.174 1.00 . A A . 11 ILE HD13 1 1 
        2  2855 1 1 11 ILE HG12 H   3.969 16.406   5.592 1.00 . A A . 11 ILE HG12 1 1 
        2  2856 1 1 11 ILE HG13 H   3.375 15.525   4.186 1.00 . A A . 11 ILE HG13 1 1 
        2  2857 1 1 11 ILE HG21 H   2.667 16.604   7.602 1.00 . A A . 11 ILE HG21 1 1 
        2  2858 1 1 11 ILE HG22 H   1.029 15.975   7.724 1.00 . A A . 11 ILE HG22 1 1 
        2  2859 1 1 11 ILE HG23 H   1.353 17.390   6.738 1.00 . A A . 11 ILE HG23 1 1 
        2  2860 1 1 11 ILE N    N   2.882 13.361   5.180 1.00 . A A . 11 ILE N    1 1 
        2  2861 1 1 11 ILE O    O   1.383 13.429   8.335 1.00 . A A . 11 ILE O    1 1 
        2  2862 1 1 12 GLU C    C  -0.238 11.204   8.016 1.00 . A A . 12 GLU C    1 1 
        2  2863 1 1 12 GLU CA   C  -0.739 12.255   7.012 1.00 . A A . 12 GLU CA   1 1 
        2  2864 1 1 12 GLU CB   C  -1.602 11.571   5.936 1.00 . A A . 12 GLU CB   1 1 
        2  2865 1 1 12 GLU CD   C  -3.452 13.272   5.948 1.00 . A A . 12 GLU CD   1 1 
        2  2866 1 1 12 GLU CG   C  -2.358 12.621   5.106 1.00 . A A . 12 GLU CG   1 1 
        2  2867 1 1 12 GLU H    H   0.432 13.007   5.397 1.00 . A A . 12 GLU H    1 1 
        2  2868 1 1 12 GLU HA   H  -1.341 12.980   7.536 1.00 . A A . 12 GLU HA   1 1 
        2  2869 1 1 12 GLU HB2  H  -0.966 10.992   5.285 1.00 . A A . 12 GLU HB2  1 1 
        2  2870 1 1 12 GLU HB3  H  -2.317 10.914   6.413 1.00 . A A . 12 GLU HB3  1 1 
        2  2871 1 1 12 GLU HG2  H  -1.668 13.380   4.774 1.00 . A A . 12 GLU HG2  1 1 
        2  2872 1 1 12 GLU HG3  H  -2.805 12.143   4.248 1.00 . A A . 12 GLU HG3  1 1 
        2  2873 1 1 12 GLU N    N   0.392 12.941   6.374 1.00 . A A . 12 GLU N    1 1 
        2  2874 1 1 12 GLU O    O  -0.898 10.942   9.021 1.00 . A A . 12 GLU O    1 1 
        2  2875 1 1 12 GLU OE1  O  -4.264 12.539   6.490 1.00 . A A . 12 GLU OE1  1 1 
        2  2876 1 1 12 GLU OE2  O  -3.462 14.488   6.041 1.00 . A A . 12 GLU OE2  1 1 
        2  2877 1 1 13 ASN C    C   1.953 10.267   9.948 1.00 . A A . 13 ASN C    1 1 
        2  2878 1 1 13 ASN CA   C   1.505  9.621   8.637 1.00 . A A . 13 ASN CA   1 1 
        2  2879 1 1 13 ASN CB   C   2.695  8.940   7.956 1.00 . A A . 13 ASN CB   1 1 
        2  2880 1 1 13 ASN CG   C   2.211  8.138   6.750 1.00 . A A . 13 ASN CG   1 1 
        2  2881 1 1 13 ASN H    H   1.408 10.873   6.927 1.00 . A A . 13 ASN H    1 1 
        2  2882 1 1 13 ASN HA   H   0.754  8.871   8.858 1.00 . A A . 13 ASN HA   1 1 
        2  2883 1 1 13 ASN HB2  H   3.399  9.690   7.633 1.00 . A A . 13 ASN HB2  1 1 
        2  2884 1 1 13 ASN HB3  H   3.178  8.273   8.655 1.00 . A A . 13 ASN HB3  1 1 
        2  2885 1 1 13 ASN HD21 H   3.529  8.938   5.499 1.00 . A A . 13 ASN HD21 1 1 
        2  2886 1 1 13 ASN HD22 H   2.478  7.797   4.812 1.00 . A A . 13 ASN HD22 1 1 
        2  2887 1 1 13 ASN N    N   0.927 10.624   7.743 1.00 . A A . 13 ASN N    1 1 
        2  2888 1 1 13 ASN ND2  N   2.788  8.304   5.591 1.00 . A A . 13 ASN ND2  1 1 
        2  2889 1 1 13 ASN O    O   1.922  9.643  11.008 1.00 . A A . 13 ASN O    1 1 
        2  2890 1 1 13 ASN OD1  O   1.285  7.337   6.870 1.00 . A A . 13 ASN OD1  1 1 
        2  2891 1 1 14 LEU C    C   1.664 12.665  11.908 1.00 . A A . 14 LEU C    1 1 
        2  2892 1 1 14 LEU CA   C   2.844 12.271  11.025 1.00 . A A . 14 LEU CA   1 1 
        2  2893 1 1 14 LEU CB   C   3.588 13.532  10.569 1.00 . A A . 14 LEU CB   1 1 
        2  2894 1 1 14 LEU CD1  C   5.258 14.450   8.931 1.00 . A A . 14 LEU CD1  1 1 
        2  2895 1 1 14 LEU CD2  C   5.613 12.172   9.918 1.00 . A A . 14 LEU CD2  1 1 
        2  2896 1 1 14 LEU CG   C   4.562 13.180   9.433 1.00 . A A . 14 LEU CG   1 1 
        2  2897 1 1 14 LEU H    H   2.383 11.971   8.987 1.00 . A A . 14 LEU H    1 1 
        2  2898 1 1 14 LEU HA   H   3.512 11.652  11.605 1.00 . A A . 14 LEU HA   1 1 
        2  2899 1 1 14 LEU HB2  H   2.877 14.265  10.214 1.00 . A A . 14 LEU HB2  1 1 
        2  2900 1 1 14 LEU HB3  H   4.144 13.945  11.400 1.00 . A A . 14 LEU HB3  1 1 
        2  2901 1 1 14 LEU HD11 H   4.532 15.238   8.790 1.00 . A A . 14 LEU HD11 1 1 
        2  2902 1 1 14 LEU HD12 H   5.745 14.240   7.991 1.00 . A A . 14 LEU HD12 1 1 
        2  2903 1 1 14 LEU HD13 H   5.992 14.761   9.650 1.00 . A A . 14 LEU HD13 1 1 
        2  2904 1 1 14 LEU HD21 H   6.017 12.494  10.866 1.00 . A A . 14 LEU HD21 1 1 
        2  2905 1 1 14 LEU HD22 H   6.405 12.110   9.193 1.00 . A A . 14 LEU HD22 1 1 
        2  2906 1 1 14 LEU HD23 H   5.159 11.199  10.027 1.00 . A A . 14 LEU HD23 1 1 
        2  2907 1 1 14 LEU HG   H   4.011 12.747   8.617 1.00 . A A . 14 LEU HG   1 1 
        2  2908 1 1 14 LEU N    N   2.380 11.522   9.859 1.00 . A A . 14 LEU N    1 1 
        2  2909 1 1 14 LEU O    O   1.758 12.642  13.134 1.00 . A A . 14 LEU O    1 1 
        2  2910 1 1 15 LYS C    C  -1.065 12.337  12.964 1.00 . A A . 15 LYS C    1 1 
        2  2911 1 1 15 LYS CA   C  -0.638 13.439  12.002 1.00 . A A . 15 LYS CA   1 1 
        2  2912 1 1 15 LYS CB   C  -1.782 13.761  11.027 1.00 . A A . 15 LYS CB   1 1 
        2  2913 1 1 15 LYS CD   C  -2.656 15.412   9.364 1.00 . A A . 15 LYS CD   1 1 
        2  2914 1 1 15 LYS CE   C  -2.458 16.808   8.769 1.00 . A A . 15 LYS CE   1 1 
        2  2915 1 1 15 LYS CG   C  -1.492 15.081  10.299 1.00 . A A . 15 LYS CG   1 1 
        2  2916 1 1 15 LYS H    H   0.536 13.033  10.294 1.00 . A A . 15 LYS H    1 1 
        2  2917 1 1 15 LYS HA   H  -0.407 14.325  12.567 1.00 . A A . 15 LYS HA   1 1 
        2  2918 1 1 15 LYS HB2  H  -1.871 12.964  10.301 1.00 . A A . 15 LYS HB2  1 1 
        2  2919 1 1 15 LYS HB3  H  -2.710 13.855  11.572 1.00 . A A . 15 LYS HB3  1 1 
        2  2920 1 1 15 LYS HD2  H  -2.692 14.684   8.566 1.00 . A A . 15 LYS HD2  1 1 
        2  2921 1 1 15 LYS HD3  H  -3.583 15.386   9.916 1.00 . A A . 15 LYS HD3  1 1 
        2  2922 1 1 15 LYS HE2  H  -3.324 17.074   8.181 1.00 . A A . 15 LYS HE2  1 1 
        2  2923 1 1 15 LYS HE3  H  -2.334 17.523   9.568 1.00 . A A . 15 LYS HE3  1 1 
        2  2924 1 1 15 LYS HG2  H  -1.373 15.873  11.026 1.00 . A A . 15 LYS HG2  1 1 
        2  2925 1 1 15 LYS HG3  H  -0.583 14.981   9.724 1.00 . A A . 15 LYS HG3  1 1 
        2  2926 1 1 15 LYS HZ1  H  -1.493 17.198   6.969 1.00 . A A . 15 LYS HZ1  1 1 
        2  2927 1 1 15 LYS HZ2  H  -0.893 15.845   7.798 1.00 . A A . 15 LYS HZ2  1 1 
        2  2928 1 1 15 LYS HZ3  H  -0.514 17.409   8.342 1.00 . A A . 15 LYS HZ3  1 1 
        2  2929 1 1 15 LYS N    N   0.554 13.033  11.274 1.00 . A A . 15 LYS N    1 1 
        2  2930 1 1 15 LYS NZ   N  -1.249 16.815   7.904 1.00 . A A . 15 LYS NZ   1 1 
        2  2931 1 1 15 LYS O    O  -1.582 12.613  14.047 1.00 . A A . 15 LYS O    1 1 
        2  2932 1 1 16 GLN C    C  -0.326  9.905  14.641 1.00 . A A . 16 GLN C    1 1 
        2  2933 1 1 16 GLN CA   C  -1.213  9.954  13.400 1.00 . A A . 16 GLN CA   1 1 
        2  2934 1 1 16 GLN CB   C  -1.075  8.652  12.606 1.00 . A A . 16 GLN CB   1 1 
        2  2935 1 1 16 GLN CD   C  -1.606  6.204  12.621 1.00 . A A . 16 GLN CD   1 1 
        2  2936 1 1 16 GLN CG   C  -1.551  7.475  13.462 1.00 . A A . 16 GLN CG   1 1 
        2  2937 1 1 16 GLN H    H  -0.436 10.927  11.690 1.00 . A A . 16 GLN H    1 1 
        2  2938 1 1 16 GLN HA   H  -2.238 10.060  13.716 1.00 . A A . 16 GLN HA   1 1 
        2  2939 1 1 16 GLN HB2  H  -1.675  8.714  11.710 1.00 . A A . 16 GLN HB2  1 1 
        2  2940 1 1 16 GLN HB3  H  -0.039  8.501  12.336 1.00 . A A . 16 GLN HB3  1 1 
        2  2941 1 1 16 GLN HE21 H  -1.503  4.990  14.188 1.00 . A A . 16 GLN HE21 1 1 
        2  2942 1 1 16 GLN HE22 H  -1.605  4.220  12.680 1.00 . A A . 16 GLN HE22 1 1 
        2  2943 1 1 16 GLN HG2  H  -0.870  7.329  14.287 1.00 . A A . 16 GLN HG2  1 1 
        2  2944 1 1 16 GLN HG3  H  -2.537  7.688  13.846 1.00 . A A . 16 GLN HG3  1 1 
        2  2945 1 1 16 GLN N    N  -0.852 11.088  12.563 1.00 . A A . 16 GLN N    1 1 
        2  2946 1 1 16 GLN NE2  N  -1.568  5.041  13.212 1.00 . A A . 16 GLN NE2  1 1 
        2  2947 1 1 16 GLN O    O  -0.771  9.486  15.710 1.00 . A A . 16 GLN O    1 1 
        2  2948 1 1 16 GLN OE1  O  -1.684  6.272  11.395 1.00 . A A . 16 GLN OE1  1 1 
        2  2949 1 1 17 HIS C    C   1.405 11.287  16.708 1.00 . A A . 17 HIS C    1 1 
        2  2950 1 1 17 HIS CA   C   1.855 10.309  15.618 1.00 . A A . 17 HIS CA   1 1 
        2  2951 1 1 17 HIS CB   C   3.261 10.685  15.140 1.00 . A A . 17 HIS CB   1 1 
        2  2952 1 1 17 HIS CD2  C   3.224  8.468  13.722 1.00 . A A . 17 HIS CD2  1 1 
        2  2953 1 1 17 HIS CE1  C   5.031  8.802  12.572 1.00 . A A . 17 HIS CE1  1 1 
        2  2954 1 1 17 HIS CG   C   3.732  9.679  14.122 1.00 . A A . 17 HIS CG   1 1 
        2  2955 1 1 17 HIS H    H   1.224 10.648  13.617 1.00 . A A . 17 HIS H    1 1 
        2  2956 1 1 17 HIS HA   H   1.884  9.317  16.033 1.00 . A A . 17 HIS HA   1 1 
        2  2957 1 1 17 HIS HB2  H   3.247 11.667  14.698 1.00 . A A . 17 HIS HB2  1 1 
        2  2958 1 1 17 HIS HB3  H   3.937 10.682  15.979 1.00 . A A . 17 HIS HB3  1 1 
        2  2959 1 1 17 HIS HD1  H   5.483 10.647  13.423 1.00 . A A . 17 HIS HD1  1 1 
        2  2960 1 1 17 HIS HD2  H   2.319  8.016  14.098 1.00 . A A . 17 HIS HD2  1 1 
        2  2961 1 1 17 HIS HE1  H   5.844  8.675  11.877 1.00 . A A . 17 HIS HE1  1 1 
        2  2962 1 1 17 HIS HE2  H   3.926  7.062  12.278 1.00 . A A . 17 HIS HE2  1 1 
        2  2963 1 1 17 HIS N    N   0.926 10.325  14.492 1.00 . A A . 17 HIS N    1 1 
        2  2964 1 1 17 HIS ND1  N   4.885  9.872  13.377 1.00 . A A . 17 HIS ND1  1 1 
        2  2965 1 1 17 HIS NE2  N   4.046  7.916  12.743 1.00 . A A . 17 HIS NE2  1 1 
        2  2966 1 1 17 HIS O    O   1.301 10.915  17.877 1.00 . A A . 17 HIS O    1 1 
        2  2967 1 1 18 ILE C    C  -0.746 13.275  17.724 1.00 . A A . 18 ILE C    1 1 
        2  2968 1 1 18 ILE CA   C   0.696 13.544  17.277 1.00 . A A . 18 ILE CA   1 1 
        2  2969 1 1 18 ILE CB   C   0.819 14.939  16.641 1.00 . A A . 18 ILE CB   1 1 
        2  2970 1 1 18 ILE CD1  C   0.111 16.340  14.651 1.00 . A A . 18 ILE CD1  1 1 
        2  2971 1 1 18 ILE CG1  C  -0.136 15.043  15.439 1.00 . A A . 18 ILE CG1  1 1 
        2  2972 1 1 18 ILE CG2  C   2.268 15.158  16.175 1.00 . A A . 18 ILE CG2  1 1 
        2  2973 1 1 18 ILE H    H   1.241 12.768  15.371 1.00 . A A . 18 ILE H    1 1 
        2  2974 1 1 18 ILE HA   H   1.341 13.505  18.148 1.00 . A A . 18 ILE HA   1 1 
        2  2975 1 1 18 ILE HB   H   0.560 15.691  17.376 1.00 . A A . 18 ILE HB   1 1 
        2  2976 1 1 18 ILE HD11 H   0.996 16.229  14.042 1.00 . A A . 18 ILE HD11 1 1 
        2  2977 1 1 18 ILE HD12 H   0.246 17.165  15.337 1.00 . A A . 18 ILE HD12 1 1 
        2  2978 1 1 18 ILE HD13 H  -0.740 16.538  14.014 1.00 . A A . 18 ILE HD13 1 1 
        2  2979 1 1 18 ILE HG12 H   0.029 14.198  14.796 1.00 . A A . 18 ILE HG12 1 1 
        2  2980 1 1 18 ILE HG13 H  -1.156 15.035  15.785 1.00 . A A . 18 ILE HG13 1 1 
        2  2981 1 1 18 ILE HG21 H   2.946 14.818  16.937 1.00 . A A . 18 ILE HG21 1 1 
        2  2982 1 1 18 ILE HG22 H   2.435 16.208  15.992 1.00 . A A . 18 ILE HG22 1 1 
        2  2983 1 1 18 ILE HG23 H   2.446 14.602  15.262 1.00 . A A . 18 ILE HG23 1 1 
        2  2984 1 1 18 ILE N    N   1.141 12.529  16.317 1.00 . A A . 18 ILE N    1 1 
        2  2985 1 1 18 ILE O    O  -1.095 13.441  18.892 1.00 . A A . 18 ILE O    1 1 
        2  2986 1 1 19 GLU C    C  -3.128 11.359  17.970 1.00 . A A . 19 GLU C    1 1 
        2  2987 1 1 19 GLU CA   C  -2.988 12.591  17.072 1.00 . A A . 19 GLU CA   1 1 
        2  2988 1 1 19 GLU CB   C  -3.753 12.366  15.760 1.00 . A A . 19 GLU CB   1 1 
        2  2989 1 1 19 GLU CD   C  -6.031 12.066  14.742 1.00 . A A . 19 GLU CD   1 1 
        2  2990 1 1 19 GLU CG   C  -5.245 12.163  16.047 1.00 . A A . 19 GLU CG   1 1 
        2  2991 1 1 19 GLU H    H  -1.244 12.754  15.857 1.00 . A A . 19 GLU H    1 1 
        2  2992 1 1 19 GLU HA   H  -3.414 13.442  17.580 1.00 . A A . 19 GLU HA   1 1 
        2  2993 1 1 19 GLU HB2  H  -3.626 13.227  15.122 1.00 . A A . 19 GLU HB2  1 1 
        2  2994 1 1 19 GLU HB3  H  -3.362 11.490  15.265 1.00 . A A . 19 GLU HB3  1 1 
        2  2995 1 1 19 GLU HG2  H  -5.385 11.250  16.608 1.00 . A A . 19 GLU HG2  1 1 
        2  2996 1 1 19 GLU HG3  H  -5.617 12.997  16.622 1.00 . A A . 19 GLU HG3  1 1 
        2  2997 1 1 19 GLU N    N  -1.579 12.869  16.771 1.00 . A A . 19 GLU N    1 1 
        2  2998 1 1 19 GLU O    O  -3.747 11.426  19.031 1.00 . A A . 19 GLU O    1 1 
        2  2999 1 1 19 GLU OE1  O  -5.412 11.907  13.702 1.00 . A A . 19 GLU OE1  1 1 
        2  3000 1 1 19 GLU OE2  O  -7.245 12.158  14.806 1.00 . A A . 19 GLU OE2  1 1 
        2  3001 1 1 20 MET C    C  -1.322  8.822  19.138 1.00 . A A . 20 MET C    1 1 
        2  3002 1 1 20 MET CA   C  -2.604  9.000  18.328 1.00 . A A . 20 MET CA   1 1 
        2  3003 1 1 20 MET CB   C  -2.793  7.801  17.386 1.00 . A A . 20 MET CB   1 1 
        2  3004 1 1 20 MET CE   C  -5.447  7.326  14.328 1.00 . A A . 20 MET CE   1 1 
        2  3005 1 1 20 MET CG   C  -4.055  8.011  16.547 1.00 . A A . 20 MET CG   1 1 
        2  3006 1 1 20 MET H    H  -2.059 10.250  16.691 1.00 . A A . 20 MET H    1 1 
        2  3007 1 1 20 MET HA   H  -3.448  9.036  19.010 1.00 . A A . 20 MET HA   1 1 
        2  3008 1 1 20 MET HB2  H  -1.938  7.711  16.734 1.00 . A A . 20 MET HB2  1 1 
        2  3009 1 1 20 MET HB3  H  -2.898  6.895  17.965 1.00 . A A . 20 MET HB3  1 1 
        2  3010 1 1 20 MET HE1  H  -5.748  6.596  13.590 1.00 . A A . 20 MET HE1  1 1 
        2  3011 1 1 20 MET HE2  H  -4.915  8.137  13.845 1.00 . A A . 20 MET HE2  1 1 
        2  3012 1 1 20 MET HE3  H  -6.320  7.716  14.823 1.00 . A A . 20 MET HE3  1 1 
        2  3013 1 1 20 MET HG2  H  -4.898  8.183  17.201 1.00 . A A . 20 MET HG2  1 1 
        2  3014 1 1 20 MET HG3  H  -3.920  8.867  15.902 1.00 . A A . 20 MET HG3  1 1 
        2  3015 1 1 20 MET N    N  -2.539 10.245  17.546 1.00 . A A . 20 MET N    1 1 
        2  3016 1 1 20 MET O    O  -1.340  8.840  20.368 1.00 . A A . 20 MET O    1 1 
        2  3017 1 1 20 MET SD   S  -4.362  6.539  15.541 1.00 . A A . 20 MET SD   1 1 
        2  3018 1 1 21 ASN C    C   1.262  7.031  19.531 1.00 . A A . 21 ASN C    1 1 
        2  3019 1 1 21 ASN CA   C   1.100  8.470  19.075 1.00 . A A . 21 ASN CA   1 1 
        2  3020 1 1 21 ASN CB   C   1.267  9.435  20.283 1.00 . A A . 21 ASN CB   1 1 
        2  3021 1 1 21 ASN CG   C   2.742  9.750  20.547 1.00 . A A . 21 ASN CG   1 1 
        2  3022 1 1 21 ASN H    H  -0.255  8.640  17.454 1.00 . A A . 21 ASN H    1 1 
        2  3023 1 1 21 ASN HA   H   1.867  8.681  18.345 1.00 . A A . 21 ASN HA   1 1 
        2  3024 1 1 21 ASN HB2  H   0.739 10.354  20.086 1.00 . A A . 21 ASN HB2  1 1 
        2  3025 1 1 21 ASN HB3  H   0.848  8.984  21.175 1.00 . A A . 21 ASN HB3  1 1 
        2  3026 1 1 21 ASN HD21 H   2.637  9.257  22.467 1.00 . A A . 21 ASN HD21 1 1 
        2  3027 1 1 21 ASN HD22 H   4.158  9.793  21.938 1.00 . A A . 21 ASN HD22 1 1 
        2  3028 1 1 21 ASN N    N  -0.209  8.646  18.433 1.00 . A A . 21 ASN N    1 1 
        2  3029 1 1 21 ASN ND2  N   3.219  9.583  21.751 1.00 . A A . 21 ASN ND2  1 1 
        2  3030 1 1 21 ASN O    O   1.654  6.775  20.669 1.00 . A A . 21 ASN O    1 1 
        2  3031 1 1 21 ASN OD1  O   3.473 10.161  19.645 1.00 . A A . 21 ASN OD1  1 1 
        2  3032 1 1 22 GLN C    C   2.460  4.364  19.506 1.00 . A A . 22 GLN C    1 1 
        2  3033 1 1 22 GLN CA   C   1.063  4.679  18.971 1.00 . A A . 22 GLN CA   1 1 
        2  3034 1 1 22 GLN CB   C   0.788  3.828  17.720 1.00 . A A . 22 GLN CB   1 1 
        2  3035 1 1 22 GLN CD   C  -0.618  2.114  18.898 1.00 . A A . 22 GLN CD   1 1 
        2  3036 1 1 22 GLN CG   C   0.667  2.345  18.108 1.00 . A A . 22 GLN CG   1 1 
        2  3037 1 1 22 GLN H    H   0.646  6.354  17.750 1.00 . A A . 22 GLN H    1 1 
        2  3038 1 1 22 GLN HA   H   0.330  4.448  19.722 1.00 . A A . 22 GLN HA   1 1 
        2  3039 1 1 22 GLN HB2  H  -0.132  4.157  17.258 1.00 . A A . 22 GLN HB2  1 1 
        2  3040 1 1 22 GLN HB3  H   1.602  3.946  17.019 1.00 . A A . 22 GLN HB3  1 1 
        2  3041 1 1 22 GLN HE21 H  -1.786  2.289  17.303 1.00 . A A . 22 GLN HE21 1 1 
        2  3042 1 1 22 GLN HE22 H  -2.595  1.985  18.764 1.00 . A A . 22 GLN HE22 1 1 
        2  3043 1 1 22 GLN HG2  H   0.645  1.746  17.210 1.00 . A A . 22 GLN HG2  1 1 
        2  3044 1 1 22 GLN HG3  H   1.513  2.053  18.709 1.00 . A A . 22 GLN HG3  1 1 
        2  3045 1 1 22 GLN N    N   0.955  6.092  18.643 1.00 . A A . 22 GLN N    1 1 
        2  3046 1 1 22 GLN NE2  N  -1.761  2.130  18.269 1.00 . A A . 22 GLN NE2  1 1 
        2  3047 1 1 22 GLN O    O   2.614  3.597  20.457 1.00 . A A . 22 GLN O    1 1 
        2  3048 1 1 22 GLN OE1  O  -0.584  1.916  20.112 1.00 . A A . 22 GLN OE1  1 1 
        2  3049 1 1 23 SER C    C   5.754  5.874  18.825 1.00 . A A . 23 SER C    1 1 
        2  3050 1 1 23 SER CA   C   4.858  4.737  19.303 1.00 . A A . 23 SER CA   1 1 
        2  3051 1 1 23 SER CB   C   5.368  3.415  18.732 1.00 . A A . 23 SER CB   1 1 
        2  3052 1 1 23 SER H    H   3.290  5.562  18.134 1.00 . A A . 23 SER H    1 1 
        2  3053 1 1 23 SER HA   H   4.904  4.692  20.382 1.00 . A A . 23 SER HA   1 1 
        2  3054 1 1 23 SER HB2  H   6.337  3.191  19.145 1.00 . A A . 23 SER HB2  1 1 
        2  3055 1 1 23 SER HB3  H   4.677  2.623  18.988 1.00 . A A . 23 SER HB3  1 1 
        2  3056 1 1 23 SER HG   H   5.275  2.669  16.935 1.00 . A A . 23 SER HG   1 1 
        2  3057 1 1 23 SER N    N   3.472  4.960  18.887 1.00 . A A . 23 SER N    1 1 
        2  3058 1 1 23 SER O    O   6.647  5.669  18.003 1.00 . A A . 23 SER O    1 1 
        2  3059 1 1 23 SER OG   O   5.478  3.527  17.318 1.00 . A A . 23 SER OG   1 1 
        2  3060 1 1 24 GLU C    C   6.146  9.358  19.994 1.00 . A A . 24 GLU C    1 1 
        2  3061 1 1 24 GLU CA   C   6.309  8.236  18.962 1.00 . A A . 24 GLU CA   1 1 
        2  3062 1 1 24 GLU CB   C   5.890  8.715  17.554 1.00 . A A . 24 GLU CB   1 1 
        2  3063 1 1 24 GLU CD   C   8.147  8.625  16.461 1.00 . A A . 24 GLU CD   1 1 
        2  3064 1 1 24 GLU CG   C   7.015  9.546  16.909 1.00 . A A . 24 GLU CG   1 1 
        2  3065 1 1 24 GLU H    H   4.785  7.176  19.997 1.00 . A A . 24 GLU H    1 1 
        2  3066 1 1 24 GLU HA   H   7.354  7.950  18.940 1.00 . A A . 24 GLU HA   1 1 
        2  3067 1 1 24 GLU HB2  H   5.682  7.852  16.936 1.00 . A A . 24 GLU HB2  1 1 
        2  3068 1 1 24 GLU HB3  H   4.995  9.316  17.625 1.00 . A A . 24 GLU HB3  1 1 
        2  3069 1 1 24 GLU HG2  H   6.626 10.078  16.049 1.00 . A A . 24 GLU HG2  1 1 
        2  3070 1 1 24 GLU HG3  H   7.397 10.258  17.624 1.00 . A A . 24 GLU HG3  1 1 
        2  3071 1 1 24 GLU N    N   5.510  7.072  19.346 1.00 . A A . 24 GLU N    1 1 
        2  3072 1 1 24 GLU O    O   6.249  9.126  21.199 1.00 . A A . 24 GLU O    1 1 
        2  3073 1 1 24 GLU OE1  O   7.871  7.723  15.687 1.00 . A A . 24 GLU OE1  1 1 
        2  3074 1 1 24 GLU OE2  O   9.269  8.830  16.896 1.00 . A A . 24 GLU OE2  1 1 
        2  3075 1 1 25 ASP C    C   4.955 12.817  19.680 1.00 . A A . 25 ASP C    1 1 
        2  3076 1 1 25 ASP CA   C   5.727 11.720  20.393 1.00 . A A . 25 ASP CA   1 1 
        2  3077 1 1 25 ASP CB   C   7.101 12.255  20.799 1.00 . A A . 25 ASP CB   1 1 
        2  3078 1 1 25 ASP CG   C   7.820 11.233  21.676 1.00 . A A . 25 ASP CG   1 1 
        2  3079 1 1 25 ASP H    H   5.822 10.694  18.540 1.00 . A A . 25 ASP H    1 1 
        2  3080 1 1 25 ASP HA   H   5.184 11.427  21.286 1.00 . A A . 25 ASP HA   1 1 
        2  3081 1 1 25 ASP HB2  H   7.682 12.439  19.905 1.00 . A A . 25 ASP HB2  1 1 
        2  3082 1 1 25 ASP HB3  H   6.985 13.179  21.352 1.00 . A A . 25 ASP HB3  1 1 
        2  3083 1 1 25 ASP N    N   5.894 10.569  19.509 1.00 . A A . 25 ASP N    1 1 
        2  3084 1 1 25 ASP O    O   4.438 12.625  18.579 1.00 . A A . 25 ASP O    1 1 
        2  3085 1 1 25 ASP OD1  O   7.245 10.835  22.677 1.00 . A A . 25 ASP OD1  1 1 
        2  3086 1 1 25 ASP OD2  O   8.923 10.849  21.325 1.00 . A A . 25 ASP OD2  1 1 
        2  3087 1 1 26 LYS C    C   5.027 15.777  18.641 1.00 . A A . 26 LYS C    1 1 
        2  3088 1 1 26 LYS CA   C   4.170 15.108  19.730 1.00 . A A . 26 LYS CA   1 1 
        2  3089 1 1 26 LYS CB   C   3.804 16.107  20.825 1.00 . A A . 26 LYS CB   1 1 
        2  3090 1 1 26 LYS CD   C   2.445 18.137  21.402 1.00 . A A . 26 LYS CD   1 1 
        2  3091 1 1 26 LYS CE   C   3.653 18.900  21.992 1.00 . A A . 26 LYS CE   1 1 
        2  3092 1 1 26 LYS CG   C   2.880 17.193  20.263 1.00 . A A . 26 LYS CG   1 1 
        2  3093 1 1 26 LYS H    H   5.312 14.074  21.196 1.00 . A A . 26 LYS H    1 1 
        2  3094 1 1 26 LYS HA   H   3.256 14.748  19.277 1.00 . A A . 26 LYS HA   1 1 
        2  3095 1 1 26 LYS HB2  H   3.291 15.582  21.615 1.00 . A A . 26 LYS HB2  1 1 
        2  3096 1 1 26 LYS HB3  H   4.700 16.555  21.214 1.00 . A A . 26 LYS HB3  1 1 
        2  3097 1 1 26 LYS HD2  H   1.730 18.847  21.014 1.00 . A A . 26 LYS HD2  1 1 
        2  3098 1 1 26 LYS HD3  H   1.980 17.557  22.184 1.00 . A A . 26 LYS HD3  1 1 
        2  3099 1 1 26 LYS HE2  H   4.370 19.123  21.214 1.00 . A A . 26 LYS HE2  1 1 
        2  3100 1 1 26 LYS HE3  H   3.313 19.827  22.438 1.00 . A A . 26 LYS HE3  1 1 
        2  3101 1 1 26 LYS HG2  H   3.395 17.754  19.497 1.00 . A A . 26 LYS HG2  1 1 
        2  3102 1 1 26 LYS HG3  H   2.002 16.723  19.833 1.00 . A A . 26 LYS HG3  1 1 
        2  3103 1 1 26 LYS HZ1  H   5.337 18.118  22.945 1.00 . A A . 26 LYS HZ1  1 1 
        2  3104 1 1 26 LYS HZ2  H   3.997 17.078  22.941 1.00 . A A . 26 LYS HZ2  1 1 
        2  3105 1 1 26 LYS HZ3  H   4.027 18.416  23.986 1.00 . A A . 26 LYS HZ3  1 1 
        2  3106 1 1 26 LYS N    N   4.881 13.978  20.321 1.00 . A A . 26 LYS N    1 1 
        2  3107 1 1 26 LYS NZ   N   4.302 18.066  23.046 1.00 . A A . 26 LYS NZ   1 1 
        2  3108 1 1 26 LYS O    O   5.149 15.245  17.538 1.00 . A A . 26 LYS O    1 1 
        2  3109 1 1 27 ILE C    C   7.663 16.850  17.631 1.00 . A A . 27 ILE C    1 1 
        2  3110 1 1 27 ILE CA   C   6.424 17.656  17.990 1.00 . A A . 27 ILE CA   1 1 
        2  3111 1 1 27 ILE CB   C   6.826 19.006  18.572 1.00 . A A . 27 ILE CB   1 1 
        2  3112 1 1 27 ILE CD1  C   7.811 21.249  17.954 1.00 . A A . 27 ILE CD1  1 1 
        2  3113 1 1 27 ILE CG1  C   7.691 19.775  17.551 1.00 . A A . 27 ILE CG1  1 1 
        2  3114 1 1 27 ILE CG2  C   7.612 18.794  19.873 1.00 . A A . 27 ILE CG2  1 1 
        2  3115 1 1 27 ILE H    H   5.466 17.312  19.848 1.00 . A A . 27 ILE H    1 1 
        2  3116 1 1 27 ILE HA   H   5.853 17.829  17.092 1.00 . A A . 27 ILE HA   1 1 
        2  3117 1 1 27 ILE HB   H   5.933 19.575  18.788 1.00 . A A . 27 ILE HB   1 1 
        2  3118 1 1 27 ILE HD11 H   7.026 21.810  17.470 1.00 . A A . 27 ILE HD11 1 1 
        2  3119 1 1 27 ILE HD12 H   8.768 21.628  17.633 1.00 . A A . 27 ILE HD12 1 1 
        2  3120 1 1 27 ILE HD13 H   7.726 21.356  19.026 1.00 . A A . 27 ILE HD13 1 1 
        2  3121 1 1 27 ILE HG12 H   8.676 19.334  17.504 1.00 . A A . 27 ILE HG12 1 1 
        2  3122 1 1 27 ILE HG13 H   7.230 19.718  16.574 1.00 . A A . 27 ILE HG13 1 1 
        2  3123 1 1 27 ILE HG21 H   8.570 18.350  19.649 1.00 . A A . 27 ILE HG21 1 1 
        2  3124 1 1 27 ILE HG22 H   7.056 18.138  20.528 1.00 . A A . 27 ILE HG22 1 1 
        2  3125 1 1 27 ILE HG23 H   7.761 19.745  20.363 1.00 . A A . 27 ILE HG23 1 1 
        2  3126 1 1 27 ILE N    N   5.599 16.935  18.953 1.00 . A A . 27 ILE N    1 1 
        2  3127 1 1 27 ILE O    O   8.124 16.869  16.490 1.00 . A A . 27 ILE O    1 1 
        2  3128 1 1 28 HIS C    C   9.053 14.141  17.478 1.00 . A A . 28 HIS C    1 1 
        2  3129 1 1 28 HIS CA   C   9.384 15.323  18.395 1.00 . A A . 28 HIS CA   1 1 
        2  3130 1 1 28 HIS CB   C   9.916 14.813  19.737 1.00 . A A . 28 HIS CB   1 1 
        2  3131 1 1 28 HIS CD2  C   9.838 16.406  21.828 1.00 . A A . 28 HIS CD2  1 1 
        2  3132 1 1 28 HIS CE1  C  11.386 17.796  21.224 1.00 . A A . 28 HIS CE1  1 1 
        2  3133 1 1 28 HIS CG   C  10.298 15.982  20.606 1.00 . A A . 28 HIS CG   1 1 
        2  3134 1 1 28 HIS H    H   7.791 16.163  19.507 1.00 . A A . 28 HIS H    1 1 
        2  3135 1 1 28 HIS HA   H  10.149 15.926  17.927 1.00 . A A . 28 HIS HA   1 1 
        2  3136 1 1 28 HIS HB2  H   9.150 14.242  20.232 1.00 . A A . 28 HIS HB2  1 1 
        2  3137 1 1 28 HIS HB3  H  10.781 14.190  19.572 1.00 . A A . 28 HIS HB3  1 1 
        2  3138 1 1 28 HIS HD1  H  11.813 16.861  19.414 1.00 . A A . 28 HIS HD1  1 1 
        2  3139 1 1 28 HIS HD2  H   9.060 15.923  22.402 1.00 . A A . 28 HIS HD2  1 1 
        2  3140 1 1 28 HIS HE1  H  12.078 18.625  21.212 1.00 . A A . 28 HIS HE1  1 1 
        2  3141 1 1 28 HIS HE2  H  10.406 18.067  23.040 1.00 . A A . 28 HIS HE2  1 1 
        2  3142 1 1 28 HIS N    N   8.202 16.140  18.617 1.00 . A A . 28 HIS N    1 1 
        2  3143 1 1 28 HIS ND1  N  11.285 16.884  20.239 1.00 . A A . 28 HIS ND1  1 1 
        2  3144 1 1 28 HIS NE2  N  10.527 17.551  22.216 1.00 . A A . 28 HIS NE2  1 1 
        2  3145 1 1 28 HIS O    O   9.812 13.175  17.409 1.00 . A A . 28 HIS O    1 1 
        2  3146 1 1 29 ALA C    C   8.258 13.258  14.573 1.00 . A A . 29 ALA C    1 1 
        2  3147 1 1 29 ALA CA   C   7.500 13.167  15.872 1.00 . A A . 29 ALA CA   1 1 
        2  3148 1 1 29 ALA CB   C   5.999 13.265  15.599 1.00 . A A . 29 ALA CB   1 1 
        2  3149 1 1 29 ALA H    H   7.359 15.020  16.876 1.00 . A A . 29 ALA H    1 1 
        2  3150 1 1 29 ALA HA   H   7.706 12.211  16.325 1.00 . A A . 29 ALA HA   1 1 
        2  3151 1 1 29 ALA HB1  H   5.715 12.524  14.868 1.00 . A A . 29 ALA HB1  1 1 
        2  3152 1 1 29 ALA HB2  H   5.761 14.250  15.223 1.00 . A A . 29 ALA HB2  1 1 
        2  3153 1 1 29 ALA HB3  H   5.457 13.090  16.511 1.00 . A A . 29 ALA HB3  1 1 
        2  3154 1 1 29 ALA N    N   7.925 14.226  16.780 1.00 . A A . 29 ALA N    1 1 
        2  3155 1 1 29 ALA O    O   8.727 12.255  14.036 1.00 . A A . 29 ALA O    1 1 
        2  3156 1 1 30 MET C    C  10.513 14.279  12.965 1.00 . A A . 30 MET C    1 1 
        2  3157 1 1 30 MET CA   C   9.068 14.687  12.817 1.00 . A A . 30 MET CA   1 1 
        2  3158 1 1 30 MET CB   C   8.992 16.165  12.418 1.00 . A A . 30 MET CB   1 1 
        2  3159 1 1 30 MET CE   C   8.367 16.071   9.055 1.00 . A A . 30 MET CE   1 1 
        2  3160 1 1 30 MET CG   C   9.942 16.466  11.241 1.00 . A A . 30 MET CG   1 1 
        2  3161 1 1 30 MET H    H   7.975 15.239  14.527 1.00 . A A . 30 MET H    1 1 
        2  3162 1 1 30 MET HA   H   8.603 14.085  12.050 1.00 . A A . 30 MET HA   1 1 
        2  3163 1 1 30 MET HB2  H   7.980 16.404  12.131 1.00 . A A . 30 MET HB2  1 1 
        2  3164 1 1 30 MET HB3  H   9.274 16.774  13.264 1.00 . A A . 30 MET HB3  1 1 
        2  3165 1 1 30 MET HE1  H   8.768 16.874   8.462 1.00 . A A . 30 MET HE1  1 1 
        2  3166 1 1 30 MET HE2  H   7.662 16.463   9.782 1.00 . A A . 30 MET HE2  1 1 
        2  3167 1 1 30 MET HE3  H   7.869 15.368   8.408 1.00 . A A . 30 MET HE3  1 1 
        2  3168 1 1 30 MET HG2  H   9.734 17.443  10.868 1.00 . A A . 30 MET HG2  1 1 
        2  3169 1 1 30 MET HG3  H  10.963 16.439  11.583 1.00 . A A . 30 MET HG3  1 1 
        2  3170 1 1 30 MET N    N   8.370 14.476  14.054 1.00 . A A . 30 MET N    1 1 
        2  3171 1 1 30 MET O    O  11.040 13.562  12.114 1.00 . A A . 30 MET O    1 1 
        2  3172 1 1 30 MET SD   S   9.720 15.246   9.917 1.00 . A A . 30 MET SD   1 1 
        2  3173 1 1 31 ASN C    C  12.844 12.941  13.982 1.00 . A A . 31 ASN C    1 1 
        2  3174 1 1 31 ASN CA   C  12.582 14.432  14.207 1.00 . A A . 31 ASN CA   1 1 
        2  3175 1 1 31 ASN CB   C  13.002 14.799  15.636 1.00 . A A . 31 ASN CB   1 1 
        2  3176 1 1 31 ASN CG   C  14.489 14.534  15.835 1.00 . A A . 31 ASN CG   1 1 
        2  3177 1 1 31 ASN H    H  10.694 15.308  14.672 1.00 . A A . 31 ASN H    1 1 
        2  3178 1 1 31 ASN HA   H  13.164 15.005  13.512 1.00 . A A . 31 ASN HA   1 1 
        2  3179 1 1 31 ASN HB2  H  12.799 15.846  15.808 1.00 . A A . 31 ASN HB2  1 1 
        2  3180 1 1 31 ASN HB3  H  12.438 14.206  16.341 1.00 . A A . 31 ASN HB3  1 1 
        2  3181 1 1 31 ASN HD21 H  14.570 15.511  17.560 1.00 . A A . 31 ASN HD21 1 1 
        2  3182 1 1 31 ASN HD22 H  16.035 14.828  17.045 1.00 . A A . 31 ASN HD22 1 1 
        2  3183 1 1 31 ASN N    N  11.165 14.741  14.027 1.00 . A A . 31 ASN N    1 1 
        2  3184 1 1 31 ASN ND2  N  15.080 14.998  16.902 1.00 . A A . 31 ASN ND2  1 1 
        2  3185 1 1 31 ASN O    O  13.692 12.581  13.165 1.00 . A A . 31 ASN O    1 1 
        2  3186 1 1 31 ASN OD1  O  15.129 13.888  15.006 1.00 . A A . 31 ASN OD1  1 1 
        2  3187 1 1 32 SER C    C  11.954 10.227  13.065 1.00 . A A . 32 SER C    1 1 
        2  3188 1 1 32 SER CA   C  12.283 10.647  14.504 1.00 . A A . 32 SER CA   1 1 
        2  3189 1 1 32 SER CB   C  11.366  9.906  15.465 1.00 . A A . 32 SER CB   1 1 
        2  3190 1 1 32 SER H    H  11.445 12.430  15.318 1.00 . A A . 32 SER H    1 1 
        2  3191 1 1 32 SER HA   H  13.307 10.386  14.726 1.00 . A A . 32 SER HA   1 1 
        2  3192 1 1 32 SER HB2  H  10.348 10.209  15.287 1.00 . A A . 32 SER HB2  1 1 
        2  3193 1 1 32 SER HB3  H  11.459  8.841  15.303 1.00 . A A . 32 SER HB3  1 1 
        2  3194 1 1 32 SER HG   H  10.997  9.993  17.372 1.00 . A A . 32 SER HG   1 1 
        2  3195 1 1 32 SER N    N  12.105 12.086  14.682 1.00 . A A . 32 SER N    1 1 
        2  3196 1 1 32 SER O    O  12.734  9.533  12.413 1.00 . A A . 32 SER O    1 1 
        2  3197 1 1 32 SER OG   O  11.728 10.232  16.799 1.00 . A A . 32 SER OG   1 1 
        2  3198 1 1 33 TYR C    C  11.262 11.011  10.183 1.00 . A A . 33 TYR C    1 1 
        2  3199 1 1 33 TYR CA   C  10.361 10.323  11.222 1.00 . A A . 33 TYR CA   1 1 
        2  3200 1 1 33 TYR CB   C   8.907 10.776  11.015 1.00 . A A . 33 TYR CB   1 1 
        2  3201 1 1 33 TYR CD1  C   8.792 11.289   8.553 1.00 . A A . 33 TYR CD1  1 1 
        2  3202 1 1 33 TYR CD2  C   7.751  9.253   9.360 1.00 . A A . 33 TYR CD2  1 1 
        2  3203 1 1 33 TYR CE1  C   8.397 10.974   7.247 1.00 . A A . 33 TYR CE1  1 1 
        2  3204 1 1 33 TYR CE2  C   7.357  8.937   8.054 1.00 . A A . 33 TYR CE2  1 1 
        2  3205 1 1 33 TYR CG   C   8.469 10.429   9.609 1.00 . A A . 33 TYR CG   1 1 
        2  3206 1 1 33 TYR CZ   C   7.680  9.797   6.998 1.00 . A A . 33 TYR CZ   1 1 
        2  3207 1 1 33 TYR H    H  10.208 11.204  13.150 1.00 . A A . 33 TYR H    1 1 
        2  3208 1 1 33 TYR HA   H  10.417  9.253  11.087 1.00 . A A . 33 TYR HA   1 1 
        2  3209 1 1 33 TYR HB2  H   8.264 10.281  11.731 1.00 . A A . 33 TYR HB2  1 1 
        2  3210 1 1 33 TYR HB3  H   8.837 11.847  11.159 1.00 . A A . 33 TYR HB3  1 1 
        2  3211 1 1 33 TYR HD1  H   9.343 12.199   8.751 1.00 . A A . 33 TYR HD1  1 1 
        2  3212 1 1 33 TYR HD2  H   7.503  8.590  10.173 1.00 . A A . 33 TYR HD2  1 1 
        2  3213 1 1 33 TYR HE1  H   8.651 11.636   6.433 1.00 . A A . 33 TYR HE1  1 1 
        2  3214 1 1 33 TYR HE2  H   6.797  8.033   7.861 1.00 . A A . 33 TYR HE2  1 1 
        2  3215 1 1 33 TYR HH   H   6.340  9.355   5.706 1.00 . A A . 33 TYR HH   1 1 
        2  3216 1 1 33 TYR N    N  10.790 10.654  12.584 1.00 . A A . 33 TYR N    1 1 
        2  3217 1 1 33 TYR O    O  11.343 10.584   9.031 1.00 . A A . 33 TYR O    1 1 
        2  3218 1 1 33 TYR OH   O   7.293  9.484   5.709 1.00 . A A . 33 TYR OH   1 1 
        2  3219 1 1 34 TYR C    C  14.071 12.064   9.446 1.00 . A A . 34 TYR C    1 1 
        2  3220 1 1 34 TYR CA   C  12.795 12.833   9.706 1.00 . A A . 34 TYR CA   1 1 
        2  3221 1 1 34 TYR CB   C  13.152 14.196  10.330 1.00 . A A . 34 TYR CB   1 1 
        2  3222 1 1 34 TYR CD1  C  15.293 14.893   9.201 1.00 . A A . 34 TYR CD1  1 1 
        2  3223 1 1 34 TYR CD2  C  13.227 15.971   8.532 1.00 . A A . 34 TYR CD2  1 1 
        2  3224 1 1 34 TYR CE1  C  15.998 15.666   8.270 1.00 . A A . 34 TYR CE1  1 1 
        2  3225 1 1 34 TYR CE2  C  13.932 16.744   7.600 1.00 . A A . 34 TYR CE2  1 1 
        2  3226 1 1 34 TYR CG   C  13.908 15.045   9.331 1.00 . A A . 34 TYR CG   1 1 
        2  3227 1 1 34 TYR CZ   C  15.317 16.591   7.471 1.00 . A A . 34 TYR CZ   1 1 
        2  3228 1 1 34 TYR H    H  11.820 12.375  11.537 1.00 . A A . 34 TYR H    1 1 
        2  3229 1 1 34 TYR HA   H  12.286 12.999   8.767 1.00 . A A . 34 TYR HA   1 1 
        2  3230 1 1 34 TYR HB2  H  12.257 14.706  10.615 1.00 . A A . 34 TYR HB2  1 1 
        2  3231 1 1 34 TYR HB3  H  13.768 14.038  11.205 1.00 . A A . 34 TYR HB3  1 1 
        2  3232 1 1 34 TYR HD1  H  15.817 14.181   9.818 1.00 . A A . 34 TYR HD1  1 1 
        2  3233 1 1 34 TYR HD2  H  12.155 16.099   8.644 1.00 . A A . 34 TYR HD2  1 1 
        2  3234 1 1 34 TYR HE1  H  17.064 15.547   8.167 1.00 . A A . 34 TYR HE1  1 1 
        2  3235 1 1 34 TYR HE2  H  13.407 17.455   6.982 1.00 . A A . 34 TYR HE2  1 1 
        2  3236 1 1 34 TYR HH   H  16.915 17.038   6.525 1.00 . A A . 34 TYR HH   1 1 
        2  3237 1 1 34 TYR N    N  11.924 12.082  10.608 1.00 . A A . 34 TYR N    1 1 
        2  3238 1 1 34 TYR O    O  14.376 11.717   8.305 1.00 . A A . 34 TYR O    1 1 
        2  3239 1 1 34 TYR OH   O  16.009 17.356   6.553 1.00 . A A . 34 TYR OH   1 1 
        2  3240 1 1 35 ARG C    C  15.790  9.676   9.831 1.00 . A A . 35 ARG C    1 1 
        2  3241 1 1 35 ARG CA   C  16.060 11.059  10.390 1.00 . A A . 35 ARG CA   1 1 
        2  3242 1 1 35 ARG CB   C  16.743 10.951  11.757 1.00 . A A . 35 ARG CB   1 1 
        2  3243 1 1 35 ARG CD   C  16.447 10.190  14.132 1.00 . A A . 35 ARG CD   1 1 
        2  3244 1 1 35 ARG CG   C  15.867 10.135  12.719 1.00 . A A . 35 ARG CG   1 1 
        2  3245 1 1 35 ARG CZ   C  18.423  9.430  15.314 1.00 . A A . 35 ARG CZ   1 1 
        2  3246 1 1 35 ARG H    H  14.526 12.095  11.395 1.00 . A A . 35 ARG H    1 1 
        2  3247 1 1 35 ARG HA   H  16.714 11.589   9.712 1.00 . A A . 35 ARG HA   1 1 
        2  3248 1 1 35 ARG HB2  H  17.700 10.461  11.639 1.00 . A A . 35 ARG HB2  1 1 
        2  3249 1 1 35 ARG HB3  H  16.894 11.940  12.162 1.00 . A A . 35 ARG HB3  1 1 
        2  3250 1 1 35 ARG HD2  H  16.572 11.219  14.429 1.00 . A A . 35 ARG HD2  1 1 
        2  3251 1 1 35 ARG HD3  H  15.765  9.704  14.815 1.00 . A A . 35 ARG HD3  1 1 
        2  3252 1 1 35 ARG HE   H  18.106  9.120  13.361 1.00 . A A . 35 ARG HE   1 1 
        2  3253 1 1 35 ARG HG2  H  14.871 10.544  12.728 1.00 . A A . 35 ARG HG2  1 1 
        2  3254 1 1 35 ARG HG3  H  15.829  9.106  12.394 1.00 . A A . 35 ARG HG3  1 1 
        2  3255 1 1 35 ARG HH11 H  17.058 10.423  16.391 1.00 . A A . 35 ARG HH11 1 1 
        2  3256 1 1 35 ARG HH12 H  18.457  9.891  17.262 1.00 . A A . 35 ARG HH12 1 1 
        2  3257 1 1 35 ARG HH21 H  19.946  8.419  14.497 1.00 . A A . 35 ARG HH21 1 1 
        2  3258 1 1 35 ARG HH22 H  20.092  8.756  16.190 1.00 . A A . 35 ARG HH22 1 1 
        2  3259 1 1 35 ARG N    N  14.820 11.793  10.509 1.00 . A A . 35 ARG N    1 1 
        2  3260 1 1 35 ARG NE   N  17.738  9.517  14.179 1.00 . A A . 35 ARG NE   1 1 
        2  3261 1 1 35 ARG NH1  N  17.942  9.955  16.407 1.00 . A A . 35 ARG NH1  1 1 
        2  3262 1 1 35 ARG NH2  N  19.578  8.821  15.336 1.00 . A A . 35 ARG NH2  1 1 
        2  3263 1 1 35 ARG O    O  16.667  9.072   9.216 1.00 . A A . 35 ARG O    1 1 
        2  3264 1 1 36 SER C    C  14.195  7.828   8.049 1.00 . A A . 36 SER C    1 1 
        2  3265 1 1 36 SER CA   C  14.224  7.848   9.567 1.00 . A A . 36 SER CA   1 1 
        2  3266 1 1 36 SER CB   C  12.855  7.437  10.110 1.00 . A A . 36 SER CB   1 1 
        2  3267 1 1 36 SER H    H  13.921  9.695  10.549 1.00 . A A . 36 SER H    1 1 
        2  3268 1 1 36 SER HA   H  14.960  7.140   9.911 1.00 . A A . 36 SER HA   1 1 
        2  3269 1 1 36 SER HB2  H  12.879  7.430  11.187 1.00 . A A . 36 SER HB2  1 1 
        2  3270 1 1 36 SER HB3  H  12.104  8.141   9.773 1.00 . A A . 36 SER HB3  1 1 
        2  3271 1 1 36 SER HG   H  11.741  6.184   9.122 1.00 . A A . 36 SER HG   1 1 
        2  3272 1 1 36 SER N    N  14.581  9.169  10.051 1.00 . A A . 36 SER N    1 1 
        2  3273 1 1 36 SER O    O  14.760  6.932   7.421 1.00 . A A . 36 SER O    1 1 
        2  3274 1 1 36 SER OG   O  12.546  6.131   9.641 1.00 . A A . 36 SER OG   1 1 
        2  3275 1 1 37 VAL C    C  14.806  9.266   5.414 1.00 . A A . 37 VAL C    1 1 
        2  3276 1 1 37 VAL CA   C  13.451  8.896   6.004 1.00 . A A . 37 VAL CA   1 1 
        2  3277 1 1 37 VAL CB   C  12.388  9.933   5.593 1.00 . A A . 37 VAL CB   1 1 
        2  3278 1 1 37 VAL CG1  C  12.457 10.215   4.079 1.00 . A A . 37 VAL CG1  1 1 
        2  3279 1 1 37 VAL CG2  C  11.000  9.394   5.951 1.00 . A A . 37 VAL CG2  1 1 
        2  3280 1 1 37 VAL H    H  13.102  9.505   8.010 1.00 . A A . 37 VAL H    1 1 
        2  3281 1 1 37 VAL HA   H  13.164  7.926   5.618 1.00 . A A . 37 VAL HA   1 1 
        2  3282 1 1 37 VAL HB   H  12.564 10.853   6.132 1.00 . A A . 37 VAL HB   1 1 
        2  3283 1 1 37 VAL HG11 H  12.549  9.284   3.540 1.00 . A A . 37 VAL HG11 1 1 
        2  3284 1 1 37 VAL HG12 H  13.315 10.841   3.869 1.00 . A A . 37 VAL HG12 1 1 
        2  3285 1 1 37 VAL HG13 H  11.562 10.729   3.761 1.00 . A A . 37 VAL HG13 1 1 
        2  3286 1 1 37 VAL HG21 H  10.252 10.080   5.597 1.00 . A A . 37 VAL HG21 1 1 
        2  3287 1 1 37 VAL HG22 H  10.921  9.293   7.022 1.00 . A A . 37 VAL HG22 1 1 
        2  3288 1 1 37 VAL HG23 H  10.851  8.431   5.484 1.00 . A A . 37 VAL HG23 1 1 
        2  3289 1 1 37 VAL N    N  13.533  8.819   7.458 1.00 . A A . 37 VAL N    1 1 
        2  3290 1 1 37 VAL O    O  15.270  8.643   4.460 1.00 . A A . 37 VAL O    1 1 
        2  3291 1 1 38 VAL C    C  17.770  9.637   5.640 1.00 . A A . 38 VAL C    1 1 
        2  3292 1 1 38 VAL CA   C  16.726 10.738   5.479 1.00 . A A . 38 VAL CA   1 1 
        2  3293 1 1 38 VAL CB   C  17.175 12.000   6.242 1.00 . A A . 38 VAL CB   1 1 
        2  3294 1 1 38 VAL CG1  C  18.583 12.430   5.790 1.00 . A A . 38 VAL CG1  1 1 
        2  3295 1 1 38 VAL CG2  C  16.175 13.137   5.969 1.00 . A A . 38 VAL CG2  1 1 
        2  3296 1 1 38 VAL H    H  15.011 10.754   6.736 1.00 . A A . 38 VAL H    1 1 
        2  3297 1 1 38 VAL HA   H  16.633 10.973   4.431 1.00 . A A . 38 VAL HA   1 1 
        2  3298 1 1 38 VAL HB   H  17.197 11.786   7.301 1.00 . A A . 38 VAL HB   1 1 
        2  3299 1 1 38 VAL HG11 H  18.814 13.402   6.206 1.00 . A A . 38 VAL HG11 1 1 
        2  3300 1 1 38 VAL HG12 H  18.614 12.484   4.715 1.00 . A A . 38 VAL HG12 1 1 
        2  3301 1 1 38 VAL HG13 H  19.314 11.713   6.137 1.00 . A A . 38 VAL HG13 1 1 
        2  3302 1 1 38 VAL HG21 H  16.604 14.078   6.272 1.00 . A A . 38 VAL HG21 1 1 
        2  3303 1 1 38 VAL HG22 H  15.271 12.962   6.524 1.00 . A A . 38 VAL HG22 1 1 
        2  3304 1 1 38 VAL HG23 H  15.940 13.173   4.919 1.00 . A A . 38 VAL HG23 1 1 
        2  3305 1 1 38 VAL N    N  15.429 10.296   5.978 1.00 . A A . 38 VAL N    1 1 
        2  3306 1 1 38 VAL O    O  18.427  9.263   4.668 1.00 . A A . 38 VAL O    1 1 
        2  3307 1 1 39 SER C    C  18.578  6.847   6.245 1.00 . A A . 39 SER C    1 1 
        2  3308 1 1 39 SER CA   C  18.891  8.066   7.103 1.00 . A A . 39 SER CA   1 1 
        2  3309 1 1 39 SER CB   C  18.899  7.673   8.585 1.00 . A A . 39 SER CB   1 1 
        2  3310 1 1 39 SER H    H  17.368  9.458   7.593 1.00 . A A . 39 SER H    1 1 
        2  3311 1 1 39 SER HA   H  19.869  8.432   6.838 1.00 . A A . 39 SER HA   1 1 
        2  3312 1 1 39 SER HB2  H  17.986  7.156   8.833 1.00 . A A . 39 SER HB2  1 1 
        2  3313 1 1 39 SER HB3  H  19.738  7.020   8.777 1.00 . A A . 39 SER HB3  1 1 
        2  3314 1 1 39 SER HG   H  19.871  8.836   9.803 1.00 . A A . 39 SER HG   1 1 
        2  3315 1 1 39 SER N    N  17.920  9.122   6.856 1.00 . A A . 39 SER N    1 1 
        2  3316 1 1 39 SER O    O  19.435  5.986   6.046 1.00 . A A . 39 SER O    1 1 
        2  3317 1 1 39 SER OG   O  19.011  8.845   9.380 1.00 . A A . 39 SER OG   1 1 
        2  3318 1 1 40 THR C    C  17.279  5.928   3.421 1.00 . A A . 40 THR C    1 1 
        2  3319 1 1 40 THR CA   C  16.946  5.650   4.889 1.00 . A A . 40 THR CA   1 1 
        2  3320 1 1 40 THR CB   C  15.446  5.371   5.047 1.00 . A A . 40 THR CB   1 1 
        2  3321 1 1 40 THR CG2  C  14.982  4.344   3.998 1.00 . A A . 40 THR CG2  1 1 
        2  3322 1 1 40 THR H    H  16.707  7.488   5.934 1.00 . A A . 40 THR H    1 1 
        2  3323 1 1 40 THR HA   H  17.486  4.762   5.196 1.00 . A A . 40 THR HA   1 1 
        2  3324 1 1 40 THR HB   H  14.891  6.289   4.922 1.00 . A A . 40 THR HB   1 1 
        2  3325 1 1 40 THR HG1  H  14.382  4.364   6.324 1.00 . A A . 40 THR HG1  1 1 
        2  3326 1 1 40 THR HG21 H  14.885  4.831   3.037 1.00 . A A . 40 THR HG21 1 1 
        2  3327 1 1 40 THR HG22 H  14.029  3.934   4.292 1.00 . A A . 40 THR HG22 1 1 
        2  3328 1 1 40 THR HG23 H  15.713  3.548   3.921 1.00 . A A . 40 THR HG23 1 1 
        2  3329 1 1 40 THR N    N  17.348  6.773   5.743 1.00 . A A . 40 THR N    1 1 
        2  3330 1 1 40 THR O    O  17.866  5.093   2.733 1.00 . A A . 40 THR O    1 1 
        2  3331 1 1 40 THR OG1  O  15.208  4.848   6.345 1.00 . A A . 40 THR OG1  1 1 
        2  3332 1 1 41 LEU C    C  18.615  7.746   1.323 1.00 . A A . 41 LEU C    1 1 
        2  3333 1 1 41 LEU CA   C  17.128  7.481   1.557 1.00 . A A . 41 LEU CA   1 1 
        2  3334 1 1 41 LEU CB   C  16.311  8.727   1.206 1.00 . A A . 41 LEU CB   1 1 
        2  3335 1 1 41 LEU CD1  C  14.015  9.716   1.051 1.00 . A A . 41 LEU CD1  1 1 
        2  3336 1 1 41 LEU CD2  C  14.401  7.376   0.164 1.00 . A A . 41 LEU CD2  1 1 
        2  3337 1 1 41 LEU CG   C  14.800  8.412   1.253 1.00 . A A . 41 LEU CG   1 1 
        2  3338 1 1 41 LEU H    H  16.421  7.733   3.541 1.00 . A A . 41 LEU H    1 1 
        2  3339 1 1 41 LEU HA   H  16.823  6.670   0.916 1.00 . A A . 41 LEU HA   1 1 
        2  3340 1 1 41 LEU HB2  H  16.535  9.502   1.923 1.00 . A A . 41 LEU HB2  1 1 
        2  3341 1 1 41 LEU HB3  H  16.577  9.069   0.216 1.00 . A A . 41 LEU HB3  1 1 
        2  3342 1 1 41 LEU HD11 H  14.356 10.455   1.758 1.00 . A A . 41 LEU HD11 1 1 
        2  3343 1 1 41 LEU HD12 H  12.963  9.530   1.205 1.00 . A A . 41 LEU HD12 1 1 
        2  3344 1 1 41 LEU HD13 H  14.169 10.081   0.044 1.00 . A A . 41 LEU HD13 1 1 
        2  3345 1 1 41 LEU HD21 H  13.363  7.514  -0.116 1.00 . A A . 41 LEU HD21 1 1 
        2  3346 1 1 41 LEU HD22 H  14.526  6.375   0.556 1.00 . A A . 41 LEU HD22 1 1 
        2  3347 1 1 41 LEU HD23 H  15.021  7.497  -0.712 1.00 . A A . 41 LEU HD23 1 1 
        2  3348 1 1 41 LEU HG   H  14.565  8.013   2.230 1.00 . A A . 41 LEU HG   1 1 
        2  3349 1 1 41 LEU N    N  16.884  7.106   2.947 1.00 . A A . 41 LEU N    1 1 
        2  3350 1 1 41 LEU O    O  19.183  7.328   0.313 1.00 . A A . 41 LEU O    1 1 
        2  3351 1 1 42 VAL C    C  21.505  7.560   2.556 1.00 . A A . 42 VAL C    1 1 
        2  3352 1 1 42 VAL CA   C  20.660  8.768   2.171 1.00 . A A . 42 VAL CA   1 1 
        2  3353 1 1 42 VAL CB   C  21.002  9.969   3.069 1.00 . A A . 42 VAL CB   1 1 
        2  3354 1 1 42 VAL CG1  C  22.495 10.389   2.900 1.00 . A A . 42 VAL CG1  1 1 
        2  3355 1 1 42 VAL CG2  C  20.071 11.130   2.684 1.00 . A A . 42 VAL CG2  1 1 
        2  3356 1 1 42 VAL H    H  18.734  8.753   3.048 1.00 . A A . 42 VAL H    1 1 
        2  3357 1 1 42 VAL HA   H  20.889  9.032   1.146 1.00 . A A . 42 VAL HA   1 1 
        2  3358 1 1 42 VAL HB   H  20.820  9.698   4.101 1.00 . A A . 42 VAL HB   1 1 
        2  3359 1 1 42 VAL HG11 H  22.862 10.088   1.926 1.00 . A A . 42 VAL HG11 1 1 
        2  3360 1 1 42 VAL HG12 H  23.097  9.918   3.663 1.00 . A A . 42 VAL HG12 1 1 
        2  3361 1 1 42 VAL HG13 H  22.593 11.462   2.997 1.00 . A A . 42 VAL HG13 1 1 
        2  3362 1 1 42 VAL HG21 H  19.056 10.878   2.957 1.00 . A A . 42 VAL HG21 1 1 
        2  3363 1 1 42 VAL HG22 H  20.124 11.301   1.617 1.00 . A A . 42 VAL HG22 1 1 
        2  3364 1 1 42 VAL HG23 H  20.376 12.022   3.206 1.00 . A A . 42 VAL HG23 1 1 
        2  3365 1 1 42 VAL N    N  19.238  8.446   2.266 1.00 . A A . 42 VAL N    1 1 
        2  3366 1 1 42 VAL O    O  22.632  7.713   3.028 1.00 . A A . 42 VAL O    1 1 
        2  3367 1 1 43 GLN C    C  21.281  4.008   1.731 1.00 . A A . 43 GLN C    1 1 
        2  3368 1 1 43 GLN CA   C  21.668  5.126   2.692 1.00 . A A . 43 GLN CA   1 1 
        2  3369 1 1 43 GLN CB   C  21.362  4.697   4.137 1.00 . A A . 43 GLN CB   1 1 
        2  3370 1 1 43 GLN CD   C  21.885  5.157   6.550 1.00 . A A . 43 GLN CD   1 1 
        2  3371 1 1 43 GLN CG   C  22.010  5.684   5.122 1.00 . A A . 43 GLN CG   1 1 
        2  3372 1 1 43 GLN H    H  20.058  6.303   1.978 1.00 . A A . 43 GLN H    1 1 
        2  3373 1 1 43 GLN HA   H  22.722  5.288   2.599 1.00 . A A . 43 GLN HA   1 1 
        2  3374 1 1 43 GLN HB2  H  20.291  4.684   4.284 1.00 . A A . 43 GLN HB2  1 1 
        2  3375 1 1 43 GLN HB3  H  21.758  3.708   4.312 1.00 . A A . 43 GLN HB3  1 1 
        2  3376 1 1 43 GLN HE21 H  21.377  6.915   7.320 1.00 . A A . 43 GLN HE21 1 1 
        2  3377 1 1 43 GLN HE22 H  21.462  5.633   8.430 1.00 . A A . 43 GLN HE22 1 1 
        2  3378 1 1 43 GLN HG2  H  23.054  5.803   4.877 1.00 . A A . 43 GLN HG2  1 1 
        2  3379 1 1 43 GLN HG3  H  21.514  6.641   5.050 1.00 . A A . 43 GLN HG3  1 1 
        2  3380 1 1 43 GLN N    N  20.959  6.365   2.359 1.00 . A A . 43 GLN N    1 1 
        2  3381 1 1 43 GLN NE2  N  21.549  5.970   7.514 1.00 . A A . 43 GLN NE2  1 1 
        2  3382 1 1 43 GLN O    O  21.738  2.874   1.879 1.00 . A A . 43 GLN O    1 1 
        2  3383 1 1 43 GLN OE1  O  22.103  3.969   6.790 1.00 . A A . 43 GLN OE1  1 1 
        2  3384 1 1 44 ASP C    C  19.719  4.007  -1.561 1.00 . A A . 44 ASP C    1 1 
        2  3385 1 1 44 ASP CA   C  20.012  3.339  -0.230 1.00 . A A . 44 ASP CA   1 1 
        2  3386 1 1 44 ASP CB   C  18.755  2.633   0.279 1.00 . A A . 44 ASP CB   1 1 
        2  3387 1 1 44 ASP CG   C  18.405  1.467  -0.640 1.00 . A A . 44 ASP CG   1 1 
        2  3388 1 1 44 ASP H    H  20.116  5.249   0.680 1.00 . A A . 44 ASP H    1 1 
        2  3389 1 1 44 ASP HA   H  20.795  2.603  -0.376 1.00 . A A . 44 ASP HA   1 1 
        2  3390 1 1 44 ASP HB2  H  18.937  2.265   1.276 1.00 . A A . 44 ASP HB2  1 1 
        2  3391 1 1 44 ASP HB3  H  17.934  3.336   0.300 1.00 . A A . 44 ASP HB3  1 1 
        2  3392 1 1 44 ASP N    N  20.448  4.330   0.748 1.00 . A A . 44 ASP N    1 1 
        2  3393 1 1 44 ASP O    O  19.647  5.232  -1.656 1.00 . A A . 44 ASP O    1 1 
        2  3394 1 1 44 ASP OD1  O  19.236  0.585  -0.781 1.00 . A A . 44 ASP OD1  1 1 
        2  3395 1 1 44 ASP OD2  O  17.318  1.475  -1.194 1.00 . A A . 44 ASP OD2  1 1 
        2  3396 1 1 45 GLN C    C  20.462  4.469  -4.485 1.00 . A A . 45 GLN C    1 1 
        2  3397 1 1 45 GLN CA   C  19.262  3.705  -3.935 1.00 . A A . 45 GLN CA   1 1 
        2  3398 1 1 45 GLN CB   C  18.024  4.621  -3.899 1.00 . A A . 45 GLN CB   1 1 
        2  3399 1 1 45 GLN CD   C  16.367  5.847  -5.308 1.00 . A A . 45 GLN CD   1 1 
        2  3400 1 1 45 GLN CG   C  17.693  5.094  -5.310 1.00 . A A . 45 GLN CG   1 1 
        2  3401 1 1 45 GLN H    H  19.620  2.221  -2.461 1.00 . A A . 45 GLN H    1 1 
        2  3402 1 1 45 GLN HA   H  19.052  2.870  -4.587 1.00 . A A . 45 GLN HA   1 1 
        2  3403 1 1 45 GLN HB2  H  17.186  4.076  -3.493 1.00 . A A . 45 GLN HB2  1 1 
        2  3404 1 1 45 GLN HB3  H  18.218  5.482  -3.284 1.00 . A A . 45 GLN HB3  1 1 
        2  3405 1 1 45 GLN HE21 H  15.496  4.611  -6.594 1.00 . A A . 45 GLN HE21 1 1 
        2  3406 1 1 45 GLN HE22 H  14.525  5.892  -6.046 1.00 . A A . 45 GLN HE22 1 1 
        2  3407 1 1 45 GLN HG2  H  18.475  5.752  -5.654 1.00 . A A . 45 GLN HG2  1 1 
        2  3408 1 1 45 GLN HG3  H  17.622  4.243  -5.966 1.00 . A A . 45 GLN HG3  1 1 
        2  3409 1 1 45 GLN N    N  19.552  3.190  -2.596 1.00 . A A . 45 GLN N    1 1 
        2  3410 1 1 45 GLN NE2  N  15.381  5.414  -6.044 1.00 . A A . 45 GLN NE2  1 1 
        2  3411 1 1 45 GLN O    O  21.074  4.064  -5.474 1.00 . A A . 45 GLN O    1 1 
        2  3412 1 1 45 GLN OE1  O  16.224  6.852  -4.612 1.00 . A A . 45 GLN OE1  1 1 
        2  3413 1 1 46 LEU C    C  22.043  6.452  -5.791 1.00 . A A . 46 LEU C    1 1 
        2  3414 1 1 46 LEU CA   C  21.935  6.410  -4.265 1.00 . A A . 46 LEU CA   1 1 
        2  3415 1 1 46 LEU CB   C  23.230  5.844  -3.673 1.00 . A A . 46 LEU CB   1 1 
        2  3416 1 1 46 LEU CD1  C  24.160  4.953  -1.505 1.00 . A A . 46 LEU CD1  1 1 
        2  3417 1 1 46 LEU CD2  C  23.723  7.394  -1.713 1.00 . A A . 46 LEU CD2  1 1 
        2  3418 1 1 46 LEU CG   C  23.227  5.997  -2.131 1.00 . A A . 46 LEU CG   1 1 
        2  3419 1 1 46 LEU H    H  20.272  5.853  -3.052 1.00 . A A . 46 LEU H    1 1 
        2  3420 1 1 46 LEU HA   H  21.791  7.411  -3.900 1.00 . A A . 46 LEU HA   1 1 
        2  3421 1 1 46 LEU HB2  H  23.295  4.796  -3.938 1.00 . A A . 46 LEU HB2  1 1 
        2  3422 1 1 46 LEU HB3  H  24.078  6.370  -4.091 1.00 . A A . 46 LEU HB3  1 1 
        2  3423 1 1 46 LEU HD11 H  23.786  3.962  -1.717 1.00 . A A . 46 LEU HD11 1 1 
        2  3424 1 1 46 LEU HD12 H  24.198  5.102  -0.436 1.00 . A A . 46 LEU HD12 1 1 
        2  3425 1 1 46 LEU HD13 H  25.152  5.060  -1.920 1.00 . A A . 46 LEU HD13 1 1 
        2  3426 1 1 46 LEU HD21 H  24.723  7.550  -2.091 1.00 . A A . 46 LEU HD21 1 1 
        2  3427 1 1 46 LEU HD22 H  23.735  7.457  -0.636 1.00 . A A . 46 LEU HD22 1 1 
        2  3428 1 1 46 LEU HD23 H  23.068  8.154  -2.107 1.00 . A A . 46 LEU HD23 1 1 
        2  3429 1 1 46 LEU HG   H  22.223  5.846  -1.758 1.00 . A A . 46 LEU HG   1 1 
        2  3430 1 1 46 LEU N    N  20.795  5.579  -3.834 1.00 . A A . 46 LEU N    1 1 
        2  3431 1 1 46 LEU O    O  23.128  6.335  -6.359 1.00 . A A . 46 LEU O    1 1 
        2  3432 1 1 47 THR C    C  21.350  7.994  -8.407 1.00 . A A . 47 THR C    1 1 
        2  3433 1 1 47 THR CA   C  20.862  6.651  -7.902 1.00 . A A . 47 THR CA   1 1 
        2  3434 1 1 47 THR CB   C  19.438  6.381  -8.389 1.00 . A A . 47 THR CB   1 1 
        2  3435 1 1 47 THR CG2  C  18.503  7.512  -7.964 1.00 . A A . 47 THR CG2  1 1 
        2  3436 1 1 47 THR H    H  20.062  6.701  -5.941 1.00 . A A . 47 THR H    1 1 
        2  3437 1 1 47 THR HA   H  21.508  5.885  -8.291 1.00 . A A . 47 THR HA   1 1 
        2  3438 1 1 47 THR HB   H  19.089  5.453  -7.962 1.00 . A A . 47 THR HB   1 1 
        2  3439 1 1 47 THR HG1  H  18.621  5.843 -10.066 1.00 . A A . 47 THR HG1  1 1 
        2  3440 1 1 47 THR HG21 H  18.726  8.392  -8.542 1.00 . A A . 47 THR HG21 1 1 
        2  3441 1 1 47 THR HG22 H  18.639  7.728  -6.915 1.00 . A A . 47 THR HG22 1 1 
        2  3442 1 1 47 THR HG23 H  17.483  7.211  -8.141 1.00 . A A . 47 THR HG23 1 1 
        2  3443 1 1 47 THR N    N  20.897  6.612  -6.446 1.00 . A A . 47 THR N    1 1 
        2  3444 1 1 47 THR O    O  21.929  8.101  -9.488 1.00 . A A . 47 THR O    1 1 
        2  3445 1 1 47 THR OG1  O  19.436  6.276  -9.804 1.00 . A A . 47 THR OG1  1 1 
        2  3446 1 1 48 LYS C    C  21.293 11.337  -6.842 1.00 . A A . 48 LYS C    1 1 
        2  3447 1 1 48 LYS CA   C  21.498 10.374  -7.994 1.00 . A A . 48 LYS CA   1 1 
        2  3448 1 1 48 LYS CB   C  20.681 10.838  -9.198 1.00 . A A . 48 LYS CB   1 1 
        2  3449 1 1 48 LYS CD   C  20.842 12.645 -10.995 1.00 . A A . 48 LYS CD   1 1 
        2  3450 1 1 48 LYS CE   C  22.190 12.342 -11.653 1.00 . A A . 48 LYS CE   1 1 
        2  3451 1 1 48 LYS CG   C  20.932 12.347  -9.484 1.00 . A A . 48 LYS CG   1 1 
        2  3452 1 1 48 LYS H    H  20.625  8.886  -6.768 1.00 . A A . 48 LYS H    1 1 
        2  3453 1 1 48 LYS HA   H  22.547 10.366  -8.261 1.00 . A A . 48 LYS HA   1 1 
        2  3454 1 1 48 LYS HB2  H  20.951 10.239 -10.053 1.00 . A A . 48 LYS HB2  1 1 
        2  3455 1 1 48 LYS HB3  H  19.634 10.684  -8.982 1.00 . A A . 48 LYS HB3  1 1 
        2  3456 1 1 48 LYS HD2  H  20.071 12.032 -11.446 1.00 . A A . 48 LYS HD2  1 1 
        2  3457 1 1 48 LYS HD3  H  20.604 13.688 -11.143 1.00 . A A . 48 LYS HD3  1 1 
        2  3458 1 1 48 LYS HE2  H  22.929 13.034 -11.278 1.00 . A A . 48 LYS HE2  1 1 
        2  3459 1 1 48 LYS HE3  H  22.494 11.335 -11.410 1.00 . A A . 48 LYS HE3  1 1 
        2  3460 1 1 48 LYS HG2  H  20.186 12.929  -8.961 1.00 . A A . 48 LYS HG2  1 1 
        2  3461 1 1 48 LYS HG3  H  21.912 12.636  -9.116 1.00 . A A . 48 LYS HG3  1 1 
        2  3462 1 1 48 LYS HZ1  H  21.176 12.055 -13.447 1.00 . A A . 48 LYS HZ1  1 1 
        2  3463 1 1 48 LYS HZ2  H  22.865 12.000 -13.589 1.00 . A A . 48 LYS HZ2  1 1 
        2  3464 1 1 48 LYS HZ3  H  22.080 13.492 -13.382 1.00 . A A . 48 LYS HZ3  1 1 
        2  3465 1 1 48 LYS N    N  21.091  9.032  -7.618 1.00 . A A . 48 LYS N    1 1 
        2  3466 1 1 48 LYS NZ   N  22.069 12.483 -13.130 1.00 . A A . 48 LYS NZ   1 1 
        2  3467 1 1 48 LYS O    O  20.227 11.364  -6.228 1.00 . A A . 48 LYS O    1 1 
        2  3468 1 1 49 ASN C    C  20.955 13.935  -5.596 1.00 . A A . 49 ASN C    1 1 
        2  3469 1 1 49 ASN CA   C  22.229 13.096  -5.466 1.00 . A A . 49 ASN CA   1 1 
        2  3470 1 1 49 ASN CB   C  23.435 14.030  -5.483 1.00 . A A . 49 ASN CB   1 1 
        2  3471 1 1 49 ASN CG   C  24.716 13.213  -5.421 1.00 . A A . 49 ASN CG   1 1 
        2  3472 1 1 49 ASN H    H  23.144 12.063  -7.071 1.00 . A A . 49 ASN H    1 1 
        2  3473 1 1 49 ASN HA   H  22.222 12.573  -4.535 1.00 . A A . 49 ASN HA   1 1 
        2  3474 1 1 49 ASN HB2  H  23.421 14.615  -6.390 1.00 . A A . 49 ASN HB2  1 1 
        2  3475 1 1 49 ASN HB3  H  23.388 14.688  -4.627 1.00 . A A . 49 ASN HB3  1 1 
        2  3476 1 1 49 ASN HD21 H  25.712 14.414  -6.648 1.00 . A A . 49 ASN HD21 1 1 
        2  3477 1 1 49 ASN HD22 H  26.587 13.080  -6.069 1.00 . A A . 49 ASN HD22 1 1 
        2  3478 1 1 49 ASN N    N  22.318 12.130  -6.547 1.00 . A A . 49 ASN N    1 1 
        2  3479 1 1 49 ASN ND2  N  25.760 13.601  -6.103 1.00 . A A . 49 ASN ND2  1 1 
        2  3480 1 1 49 ASN O    O  20.323 14.264  -4.592 1.00 . A A . 49 ASN O    1 1 
        2  3481 1 1 49 ASN OD1  O  24.766 12.186  -4.746 1.00 . A A . 49 ASN OD1  1 1 
        2  3482 1 1 50 ALA C    C  18.120 14.286  -6.637 1.00 . A A . 50 ALA C    1 1 
        2  3483 1 1 50 ALA CA   C  19.380 15.075  -7.050 1.00 . A A . 50 ALA CA   1 1 
        2  3484 1 1 50 ALA CB   C  19.282 15.506  -8.539 1.00 . A A . 50 ALA CB   1 1 
        2  3485 1 1 50 ALA H    H  21.128 13.983  -7.590 1.00 . A A . 50 ALA H    1 1 
        2  3486 1 1 50 ALA HA   H  19.452 15.964  -6.444 1.00 . A A . 50 ALA HA   1 1 
        2  3487 1 1 50 ALA HB1  H  18.770 16.459  -8.612 1.00 . A A . 50 ALA HB1  1 1 
        2  3488 1 1 50 ALA HB2  H  18.734 14.766  -9.106 1.00 . A A . 50 ALA HB2  1 1 
        2  3489 1 1 50 ALA HB3  H  20.275 15.606  -8.954 1.00 . A A . 50 ALA HB3  1 1 
        2  3490 1 1 50 ALA N    N  20.585 14.273  -6.827 1.00 . A A . 50 ALA N    1 1 
        2  3491 1 1 50 ALA O    O  17.249 14.795  -5.931 1.00 . A A . 50 ALA O    1 1 
        2  3492 1 1 51 VAL C    C  16.657 12.133  -5.269 1.00 . A A . 51 VAL C    1 1 
        2  3493 1 1 51 VAL CA   C  16.877 12.196  -6.784 1.00 . A A . 51 VAL CA   1 1 
        2  3494 1 1 51 VAL CB   C  17.086 10.771  -7.349 1.00 . A A . 51 VAL CB   1 1 
        2  3495 1 1 51 VAL CG1  C  16.131  9.753  -6.674 1.00 . A A . 51 VAL CG1  1 1 
        2  3496 1 1 51 VAL CG2  C  16.830 10.792  -8.865 1.00 . A A . 51 VAL CG2  1 1 
        2  3497 1 1 51 VAL H    H  18.762 12.692  -7.663 1.00 . A A . 51 VAL H    1 1 
        2  3498 1 1 51 VAL HA   H  16.000 12.628  -7.234 1.00 . A A . 51 VAL HA   1 1 
        2  3499 1 1 51 VAL HB   H  18.106 10.469  -7.166 1.00 . A A . 51 VAL HB   1 1 
        2  3500 1 1 51 VAL HG11 H  16.068  8.857  -7.269 1.00 . A A . 51 VAL HG11 1 1 
        2  3501 1 1 51 VAL HG12 H  15.147 10.185  -6.572 1.00 . A A . 51 VAL HG12 1 1 
        2  3502 1 1 51 VAL HG13 H  16.512  9.501  -5.691 1.00 . A A . 51 VAL HG13 1 1 
        2  3503 1 1 51 VAL HG21 H  17.093  9.840  -9.291 1.00 . A A . 51 VAL HG21 1 1 
        2  3504 1 1 51 VAL HG22 H  17.429 11.568  -9.317 1.00 . A A . 51 VAL HG22 1 1 
        2  3505 1 1 51 VAL HG23 H  15.784 10.990  -9.052 1.00 . A A . 51 VAL HG23 1 1 
        2  3506 1 1 51 VAL N    N  18.038 13.044  -7.105 1.00 . A A . 51 VAL N    1 1 
        2  3507 1 1 51 VAL O    O  15.521 12.240  -4.807 1.00 . A A . 51 VAL O    1 1 
        2  3508 1 1 52 VAL C    C  17.460 13.311  -2.452 1.00 . A A . 52 VAL C    1 1 
        2  3509 1 1 52 VAL CA   C  17.620 11.905  -3.048 1.00 . A A . 52 VAL CA   1 1 
        2  3510 1 1 52 VAL CB   C  18.847 11.212  -2.453 1.00 . A A . 52 VAL CB   1 1 
        2  3511 1 1 52 VAL CG1  C  18.905  9.775  -2.964 1.00 . A A . 52 VAL CG1  1 1 
        2  3512 1 1 52 VAL CG2  C  20.112 11.940  -2.891 1.00 . A A . 52 VAL CG2  1 1 
        2  3513 1 1 52 VAL H    H  18.615 11.882  -4.933 1.00 . A A . 52 VAL H    1 1 
        2  3514 1 1 52 VAL HA   H  16.742 11.323  -2.789 1.00 . A A . 52 VAL HA   1 1 
        2  3515 1 1 52 VAL HB   H  18.777 11.214  -1.375 1.00 . A A . 52 VAL HB   1 1 
        2  3516 1 1 52 VAL HG11 H  18.981  9.783  -4.041 1.00 . A A . 52 VAL HG11 1 1 
        2  3517 1 1 52 VAL HG12 H  18.008  9.250  -2.669 1.00 . A A . 52 VAL HG12 1 1 
        2  3518 1 1 52 VAL HG13 H  19.768  9.280  -2.546 1.00 . A A . 52 VAL HG13 1 1 
        2  3519 1 1 52 VAL HG21 H  20.131 11.983  -3.959 1.00 . A A . 52 VAL HG21 1 1 
        2  3520 1 1 52 VAL HG22 H  20.981 11.404  -2.537 1.00 . A A . 52 VAL HG22 1 1 
        2  3521 1 1 52 VAL HG23 H  20.118 12.940  -2.489 1.00 . A A . 52 VAL HG23 1 1 
        2  3522 1 1 52 VAL N    N  17.734 11.961  -4.509 1.00 . A A . 52 VAL N    1 1 
        2  3523 1 1 52 VAL O    O  16.743 13.506  -1.471 1.00 . A A . 52 VAL O    1 1 
        2  3524 1 1 53 LEU C    C  16.652 16.198  -2.650 1.00 . A A . 53 LEU C    1 1 
        2  3525 1 1 53 LEU CA   C  18.079 15.658  -2.549 1.00 . A A . 53 LEU CA   1 1 
        2  3526 1 1 53 LEU CB   C  19.004 16.564  -3.367 1.00 . A A . 53 LEU CB   1 1 
        2  3527 1 1 53 LEU CD1  C  19.516 18.091  -1.400 1.00 . A A . 53 LEU CD1  1 1 
        2  3528 1 1 53 LEU CD2  C  19.854 18.873  -3.788 1.00 . A A . 53 LEU CD2  1 1 
        2  3529 1 1 53 LEU CG   C  18.985 18.017  -2.848 1.00 . A A . 53 LEU CG   1 1 
        2  3530 1 1 53 LEU H    H  18.705 14.064  -3.828 1.00 . A A . 53 LEU H    1 1 
        2  3531 1 1 53 LEU HA   H  18.393 15.672  -1.518 1.00 . A A . 53 LEU HA   1 1 
        2  3532 1 1 53 LEU HB2  H  20.012 16.186  -3.313 1.00 . A A . 53 LEU HB2  1 1 
        2  3533 1 1 53 LEU HB3  H  18.672 16.556  -4.386 1.00 . A A . 53 LEU HB3  1 1 
        2  3534 1 1 53 LEU HD11 H  19.869 19.091  -1.189 1.00 . A A . 53 LEU HD11 1 1 
        2  3535 1 1 53 LEU HD12 H  20.328 17.392  -1.266 1.00 . A A . 53 LEU HD12 1 1 
        2  3536 1 1 53 LEU HD13 H  18.718 17.848  -0.710 1.00 . A A . 53 LEU HD13 1 1 
        2  3537 1 1 53 LEU HD21 H  19.404 18.889  -4.771 1.00 . A A . 53 LEU HD21 1 1 
        2  3538 1 1 53 LEU HD22 H  20.845 18.449  -3.855 1.00 . A A . 53 LEU HD22 1 1 
        2  3539 1 1 53 LEU HD23 H  19.919 19.883  -3.409 1.00 . A A . 53 LEU HD23 1 1 
        2  3540 1 1 53 LEU HG   H  17.975 18.395  -2.866 1.00 . A A . 53 LEU HG   1 1 
        2  3541 1 1 53 LEU N    N  18.149 14.278  -3.049 1.00 . A A . 53 LEU N    1 1 
        2  3542 1 1 53 LEU O    O  16.134 16.775  -1.694 1.00 . A A . 53 LEU O    1 1 
        2  3543 1 1 54 LYS C    C  13.757 16.075  -2.863 1.00 . A A . 54 LYS C    1 1 
        2  3544 1 1 54 LYS CA   C  14.666 16.512  -4.018 1.00 . A A . 54 LYS CA   1 1 
        2  3545 1 1 54 LYS CB   C  14.110 15.982  -5.373 1.00 . A A . 54 LYS CB   1 1 
        2  3546 1 1 54 LYS CD   C  13.142 13.955  -6.549 1.00 . A A . 54 LYS CD   1 1 
        2  3547 1 1 54 LYS CE   C  12.582 12.548  -6.311 1.00 . A A . 54 LYS CE   1 1 
        2  3548 1 1 54 LYS CG   C  13.472 14.588  -5.198 1.00 . A A . 54 LYS CG   1 1 
        2  3549 1 1 54 LYS H    H  16.489 15.546  -4.536 1.00 . A A . 54 LYS H    1 1 
        2  3550 1 1 54 LYS HA   H  14.697 17.590  -4.050 1.00 . A A . 54 LYS HA   1 1 
        2  3551 1 1 54 LYS HB2  H  13.364 16.668  -5.749 1.00 . A A . 54 LYS HB2  1 1 
        2  3552 1 1 54 LYS HB3  H  14.921 15.912  -6.085 1.00 . A A . 54 LYS HB3  1 1 
        2  3553 1 1 54 LYS HD2  H  12.404 14.556  -7.061 1.00 . A A . 54 LYS HD2  1 1 
        2  3554 1 1 54 LYS HD3  H  14.034 13.891  -7.146 1.00 . A A . 54 LYS HD3  1 1 
        2  3555 1 1 54 LYS HE2  H  12.438 12.048  -7.257 1.00 . A A . 54 LYS HE2  1 1 
        2  3556 1 1 54 LYS HE3  H  13.277 11.981  -5.707 1.00 . A A . 54 LYS HE3  1 1 
        2  3557 1 1 54 LYS HG2  H  14.154 13.965  -4.667 1.00 . A A . 54 LYS HG2  1 1 
        2  3558 1 1 54 LYS HG3  H  12.558 14.677  -4.627 1.00 . A A . 54 LYS HG3  1 1 
        2  3559 1 1 54 LYS HZ1  H  10.765 13.493  -5.929 1.00 . A A . 54 LYS HZ1  1 1 
        2  3560 1 1 54 LYS HZ2  H  11.443 12.731  -4.574 1.00 . A A . 54 LYS HZ2  1 1 
        2  3561 1 1 54 LYS HZ3  H  10.706 11.801  -5.789 1.00 . A A . 54 LYS HZ3  1 1 
        2  3562 1 1 54 LYS N    N  16.027 16.012  -3.808 1.00 . A A . 54 LYS N    1 1 
        2  3563 1 1 54 LYS NZ   N  11.276 12.650  -5.597 1.00 . A A . 54 LYS NZ   1 1 
        2  3564 1 1 54 LYS O    O  12.890 16.824  -2.416 1.00 . A A . 54 LYS O    1 1 
        2  3565 1 1 55 ARG C    C  13.403 15.106  -0.032 1.00 . A A . 55 ARG C    1 1 
        2  3566 1 1 55 ARG CA   C  13.167 14.306  -1.308 1.00 . A A . 55 ARG CA   1 1 
        2  3567 1 1 55 ARG CB   C  13.533 12.829  -1.078 1.00 . A A . 55 ARG CB   1 1 
        2  3568 1 1 55 ARG CD   C  11.592 11.495  -2.025 1.00 . A A . 55 ARG CD   1 1 
        2  3569 1 1 55 ARG CG   C  13.038 11.942  -2.251 1.00 . A A . 55 ARG CG   1 1 
        2  3570 1 1 55 ARG CZ   C  10.392  9.980  -0.562 1.00 . A A . 55 ARG CZ   1 1 
        2  3571 1 1 55 ARG H    H  14.673 14.296  -2.790 1.00 . A A . 55 ARG H    1 1 
        2  3572 1 1 55 ARG HA   H  12.127 14.374  -1.572 1.00 . A A . 55 ARG HA   1 1 
        2  3573 1 1 55 ARG HB2  H  14.604 12.749  -1.001 1.00 . A A . 55 ARG HB2  1 1 
        2  3574 1 1 55 ARG HB3  H  13.090 12.488  -0.153 1.00 . A A . 55 ARG HB3  1 1 
        2  3575 1 1 55 ARG HD2  H  10.974 12.348  -1.800 1.00 . A A . 55 ARG HD2  1 1 
        2  3576 1 1 55 ARG HD3  H  11.225 11.013  -2.919 1.00 . A A . 55 ARG HD3  1 1 
        2  3577 1 1 55 ARG HE   H  12.360 10.339  -0.426 1.00 . A A . 55 ARG HE   1 1 
        2  3578 1 1 55 ARG HG2  H  13.095 12.492  -3.177 1.00 . A A . 55 ARG HG2  1 1 
        2  3579 1 1 55 ARG HG3  H  13.666 11.065  -2.323 1.00 . A A . 55 ARG HG3  1 1 
        2  3580 1 1 55 ARG HH11 H   9.313 10.919  -1.961 1.00 . A A . 55 ARG HH11 1 1 
        2  3581 1 1 55 ARG HH12 H   8.432  9.835  -0.937 1.00 . A A . 55 ARG HH12 1 1 
        2  3582 1 1 55 ARG HH21 H  11.213  8.911   0.920 1.00 . A A . 55 ARG HH21 1 1 
        2  3583 1 1 55 ARG HH22 H   9.510  8.697   0.692 1.00 . A A . 55 ARG HH22 1 1 
        2  3584 1 1 55 ARG N    N  13.967 14.848  -2.395 1.00 . A A . 55 ARG N    1 1 
        2  3585 1 1 55 ARG NE   N  11.537 10.555  -0.916 1.00 . A A . 55 ARG NE   1 1 
        2  3586 1 1 55 ARG NH1  N   9.293 10.267  -1.204 1.00 . A A . 55 ARG NH1  1 1 
        2  3587 1 1 55 ARG NH2  N  10.368  9.129   0.427 1.00 . A A . 55 ARG NH2  1 1 
        2  3588 1 1 55 ARG O    O  12.469 15.351   0.732 1.00 . A A . 55 ARG O    1 1 
        2  3589 1 1 56 ILE C    C  14.265 17.633   1.356 1.00 . A A . 56 ILE C    1 1 
        2  3590 1 1 56 ILE CA   C  14.984 16.285   1.378 1.00 . A A . 56 ILE CA   1 1 
        2  3591 1 1 56 ILE CB   C  16.496 16.509   1.431 1.00 . A A . 56 ILE CB   1 1 
        2  3592 1 1 56 ILE CD1  C  16.810 14.214   2.511 1.00 . A A . 56 ILE CD1  1 1 
        2  3593 1 1 56 ILE CG1  C  17.234 15.158   1.374 1.00 . A A . 56 ILE CG1  1 1 
        2  3594 1 1 56 ILE CG2  C  16.875 17.257   2.703 1.00 . A A . 56 ILE CG2  1 1 
        2  3595 1 1 56 ILE H    H  15.351 15.289  -0.453 1.00 . A A . 56 ILE H    1 1 
        2  3596 1 1 56 ILE HA   H  14.679 15.737   2.256 1.00 . A A . 56 ILE HA   1 1 
        2  3597 1 1 56 ILE HB   H  16.791 17.105   0.582 1.00 . A A . 56 ILE HB   1 1 
        2  3598 1 1 56 ILE HD11 H  16.617 14.778   3.406 1.00 . A A . 56 ILE HD11 1 1 
        2  3599 1 1 56 ILE HD12 H  17.605 13.505   2.697 1.00 . A A . 56 ILE HD12 1 1 
        2  3600 1 1 56 ILE HD13 H  15.917 13.677   2.224 1.00 . A A . 56 ILE HD13 1 1 
        2  3601 1 1 56 ILE HG12 H  17.019 14.690   0.440 1.00 . A A . 56 ILE HG12 1 1 
        2  3602 1 1 56 ILE HG13 H  18.296 15.335   1.443 1.00 . A A . 56 ILE HG13 1 1 
        2  3603 1 1 56 ILE HG21 H  17.950 17.299   2.782 1.00 . A A . 56 ILE HG21 1 1 
        2  3604 1 1 56 ILE HG22 H  16.468 16.738   3.560 1.00 . A A . 56 ILE HG22 1 1 
        2  3605 1 1 56 ILE HG23 H  16.478 18.259   2.664 1.00 . A A . 56 ILE HG23 1 1 
        2  3606 1 1 56 ILE N    N  14.647 15.514   0.192 1.00 . A A . 56 ILE N    1 1 
        2  3607 1 1 56 ILE O    O  13.608 18.004   2.328 1.00 . A A . 56 ILE O    1 1 
        2  3608 1 1 57 GLN C    C  12.256 19.550   0.395 1.00 . A A . 57 GLN C    1 1 
        2  3609 1 1 57 GLN CA   C  13.743 19.660   0.103 1.00 . A A . 57 GLN CA   1 1 
        2  3610 1 1 57 GLN CB   C  13.943 20.178  -1.329 1.00 . A A . 57 GLN CB   1 1 
        2  3611 1 1 57 GLN CD   C  15.826 21.712  -0.739 1.00 . A A . 57 GLN CD   1 1 
        2  3612 1 1 57 GLN CG   C  15.420 20.500  -1.567 1.00 . A A . 57 GLN CG   1 1 
        2  3613 1 1 57 GLN H    H  14.925 18.009  -0.497 1.00 . A A . 57 GLN H    1 1 
        2  3614 1 1 57 GLN HA   H  14.185 20.356   0.799 1.00 . A A . 57 GLN HA   1 1 
        2  3615 1 1 57 GLN HB2  H  13.623 19.420  -2.030 1.00 . A A . 57 GLN HB2  1 1 
        2  3616 1 1 57 GLN HB3  H  13.353 21.073  -1.478 1.00 . A A . 57 GLN HB3  1 1 
        2  3617 1 1 57 GLN HE21 H  17.372 20.803   0.112 1.00 . A A . 57 GLN HE21 1 1 
        2  3618 1 1 57 GLN HE22 H  17.125 22.414   0.588 1.00 . A A . 57 GLN HE22 1 1 
        2  3619 1 1 57 GLN HG2  H  16.024 19.651  -1.279 1.00 . A A . 57 GLN HG2  1 1 
        2  3620 1 1 57 GLN HG3  H  15.576 20.714  -2.612 1.00 . A A . 57 GLN HG3  1 1 
        2  3621 1 1 57 GLN N    N  14.388 18.355   0.247 1.00 . A A . 57 GLN N    1 1 
        2  3622 1 1 57 GLN NE2  N  16.861 21.638   0.052 1.00 . A A . 57 GLN NE2  1 1 
        2  3623 1 1 57 GLN O    O  11.699 20.374   1.121 1.00 . A A . 57 GLN O    1 1 
        2  3624 1 1 57 GLN OE1  O  15.181 22.759  -0.817 1.00 . A A . 57 GLN OE1  1 1 
        2  3625 1 1 58 HIS C    C   9.927 18.011   1.529 1.00 . A A . 58 HIS C    1 1 
        2  3626 1 1 58 HIS CA   C  10.193 18.321   0.059 1.00 . A A . 58 HIS CA   1 1 
        2  3627 1 1 58 HIS CB   C   9.693 17.152  -0.801 1.00 . A A . 58 HIS CB   1 1 
        2  3628 1 1 58 HIS CD2  C   8.866 17.348  -3.293 1.00 . A A . 58 HIS CD2  1 1 
        2  3629 1 1 58 HIS CE1  C  10.559 18.441  -4.089 1.00 . A A . 58 HIS CE1  1 1 
        2  3630 1 1 58 HIS CG   C   9.743 17.535  -2.254 1.00 . A A . 58 HIS CG   1 1 
        2  3631 1 1 58 HIS H    H  12.110 17.899  -0.728 1.00 . A A . 58 HIS H    1 1 
        2  3632 1 1 58 HIS HA   H   9.662 19.221  -0.219 1.00 . A A . 58 HIS HA   1 1 
        2  3633 1 1 58 HIS HB2  H  10.322 16.290  -0.635 1.00 . A A . 58 HIS HB2  1 1 
        2  3634 1 1 58 HIS HB3  H   8.676 16.912  -0.529 1.00 . A A . 58 HIS HB3  1 1 
        2  3635 1 1 58 HIS HD1  H  11.615 18.523  -2.298 1.00 . A A . 58 HIS HD1  1 1 
        2  3636 1 1 58 HIS HD2  H   7.918 16.832  -3.223 1.00 . A A . 58 HIS HD2  1 1 
        2  3637 1 1 58 HIS HE1  H  11.222 18.963  -4.761 1.00 . A A . 58 HIS HE1  1 1 
        2  3638 1 1 58 HIS HE2  H   8.972 17.938  -5.340 1.00 . A A . 58 HIS HE2  1 1 
        2  3639 1 1 58 HIS N    N  11.615 18.525  -0.159 1.00 . A A . 58 HIS N    1 1 
        2  3640 1 1 58 HIS ND1  N  10.816 18.234  -2.784 1.00 . A A . 58 HIS ND1  1 1 
        2  3641 1 1 58 HIS NE2  N   9.383 17.921  -4.451 1.00 . A A . 58 HIS NE2  1 1 
        2  3642 1 1 58 HIS O    O   8.929 18.456   2.096 1.00 . A A . 58 HIS O    1 1 
        2  3643 1 1 59 LEU C    C  10.475 18.104   4.413 1.00 . A A . 59 LEU C    1 1 
        2  3644 1 1 59 LEU CA   C  10.654 16.857   3.543 1.00 . A A . 59 LEU CA   1 1 
        2  3645 1 1 59 LEU CB   C  11.880 16.038   4.005 1.00 . A A . 59 LEU CB   1 1 
        2  3646 1 1 59 LEU CD1  C  10.776 15.574   6.248 1.00 . A A . 59 LEU CD1  1 1 
        2  3647 1 1 59 LEU CD2  C  10.553 13.878   4.377 1.00 . A A . 59 LEU CD2  1 1 
        2  3648 1 1 59 LEU CG   C  11.478 14.943   5.032 1.00 . A A . 59 LEU CG   1 1 
        2  3649 1 1 59 LEU H    H  11.599 16.916   1.633 1.00 . A A . 59 LEU H    1 1 
        2  3650 1 1 59 LEU HA   H   9.763 16.251   3.627 1.00 . A A . 59 LEU HA   1 1 
        2  3651 1 1 59 LEU HB2  H  12.325 15.570   3.145 1.00 . A A . 59 LEU HB2  1 1 
        2  3652 1 1 59 LEU HB3  H  12.609 16.694   4.462 1.00 . A A . 59 LEU HB3  1 1 
        2  3653 1 1 59 LEU HD11 H  11.264 16.498   6.510 1.00 . A A . 59 LEU HD11 1 1 
        2  3654 1 1 59 LEU HD12 H  10.831 14.886   7.082 1.00 . A A . 59 LEU HD12 1 1 
        2  3655 1 1 59 LEU HD13 H   9.738 15.767   6.017 1.00 . A A . 59 LEU HD13 1 1 
        2  3656 1 1 59 LEU HD21 H  10.664 13.893   3.302 1.00 . A A . 59 LEU HD21 1 1 
        2  3657 1 1 59 LEU HD22 H   9.516 14.075   4.632 1.00 . A A . 59 LEU HD22 1 1 
        2  3658 1 1 59 LEU HD23 H  10.828 12.901   4.745 1.00 . A A . 59 LEU HD23 1 1 
        2  3659 1 1 59 LEU HG   H  12.377 14.457   5.376 1.00 . A A . 59 LEU HG   1 1 
        2  3660 1 1 59 LEU N    N  10.823 17.241   2.137 1.00 . A A . 59 LEU N    1 1 
        2  3661 1 1 59 LEU O    O   9.789 18.060   5.435 1.00 . A A . 59 LEU O    1 1 
        2  3662 1 1 60 ASP C    C   9.505 20.893   4.815 1.00 . A A . 60 ASP C    1 1 
        2  3663 1 1 60 ASP CA   C  10.972 20.449   4.749 1.00 . A A . 60 ASP CA   1 1 
        2  3664 1 1 60 ASP CB   C  11.822 21.538   4.083 1.00 . A A . 60 ASP CB   1 1 
        2  3665 1 1 60 ASP CG   C  13.267 21.065   3.961 1.00 . A A . 60 ASP CG   1 1 
        2  3666 1 1 60 ASP H    H  11.617 19.186   3.176 1.00 . A A . 60 ASP H    1 1 
        2  3667 1 1 60 ASP HA   H  11.341 20.287   5.748 1.00 . A A . 60 ASP HA   1 1 
        2  3668 1 1 60 ASP HB2  H  11.430 21.752   3.100 1.00 . A A . 60 ASP HB2  1 1 
        2  3669 1 1 60 ASP HB3  H  11.791 22.434   4.685 1.00 . A A . 60 ASP HB3  1 1 
        2  3670 1 1 60 ASP N    N  11.084 19.210   3.997 1.00 . A A . 60 ASP N    1 1 
        2  3671 1 1 60 ASP O    O   9.079 21.512   5.791 1.00 . A A . 60 ASP O    1 1 
        2  3672 1 1 60 ASP OD1  O  13.671 20.249   4.775 1.00 . A A . 60 ASP OD1  1 1 
        2  3673 1 1 60 ASP OD2  O  13.949 21.523   3.059 1.00 . A A . 60 ASP OD2  1 1 
        2  3674 1 1 61 GLU C    C   6.554 20.344   4.875 1.00 . A A . 61 GLU C    1 1 
        2  3675 1 1 61 GLU CA   C   7.330 20.960   3.707 1.00 . A A . 61 GLU CA   1 1 
        2  3676 1 1 61 GLU CB   C   6.722 20.505   2.353 1.00 . A A . 61 GLU CB   1 1 
        2  3677 1 1 61 GLU CD   C   5.791 18.556   1.034 1.00 . A A . 61 GLU CD   1 1 
        2  3678 1 1 61 GLU CG   C   6.136 19.072   2.425 1.00 . A A . 61 GLU CG   1 1 
        2  3679 1 1 61 GLU H    H   9.142 20.092   3.018 1.00 . A A . 61 GLU H    1 1 
        2  3680 1 1 61 GLU HA   H   7.256 22.037   3.780 1.00 . A A . 61 GLU HA   1 1 
        2  3681 1 1 61 GLU HB2  H   5.929 21.186   2.070 1.00 . A A . 61 GLU HB2  1 1 
        2  3682 1 1 61 GLU HB3  H   7.494 20.534   1.599 1.00 . A A . 61 GLU HB3  1 1 
        2  3683 1 1 61 GLU HG2  H   6.840 18.402   2.889 1.00 . A A . 61 GLU HG2  1 1 
        2  3684 1 1 61 GLU HG3  H   5.234 19.090   3.014 1.00 . A A . 61 GLU HG3  1 1 
        2  3685 1 1 61 GLU N    N   8.748 20.586   3.767 1.00 . A A . 61 GLU N    1 1 
        2  3686 1 1 61 GLU O    O   5.679 20.978   5.464 1.00 . A A . 61 GLU O    1 1 
        2  3687 1 1 61 GLU OE1  O   6.547 18.804   0.110 1.00 . A A . 61 GLU OE1  1 1 
        2  3688 1 1 61 GLU OE2  O   4.778 17.886   0.927 1.00 . A A . 61 GLU OE2  1 1 
        2  3689 1 1 62 ALA C    C   6.666 18.939   7.607 1.00 . A A . 62 ALA C    1 1 
        2  3690 1 1 62 ALA CA   C   6.216 18.390   6.269 1.00 . A A . 62 ALA CA   1 1 
        2  3691 1 1 62 ALA CB   C   6.546 16.903   6.191 1.00 . A A . 62 ALA CB   1 1 
        2  3692 1 1 62 ALA H    H   7.586 18.639   4.684 1.00 . A A . 62 ALA H    1 1 
        2  3693 1 1 62 ALA HA   H   5.147 18.516   6.178 1.00 . A A . 62 ALA HA   1 1 
        2  3694 1 1 62 ALA HB1  H   5.960 16.363   6.919 1.00 . A A . 62 ALA HB1  1 1 
        2  3695 1 1 62 ALA HB2  H   7.594 16.759   6.395 1.00 . A A . 62 ALA HB2  1 1 
        2  3696 1 1 62 ALA HB3  H   6.321 16.538   5.199 1.00 . A A . 62 ALA HB3  1 1 
        2  3697 1 1 62 ALA N    N   6.880 19.094   5.189 1.00 . A A . 62 ALA N    1 1 
        2  3698 1 1 62 ALA O    O   5.844 19.241   8.473 1.00 . A A . 62 ALA O    1 1 
        2  3699 1 1 63 TYR C    C   7.856 20.857   9.428 1.00 . A A . 63 TYR C    1 1 
        2  3700 1 1 63 TYR CA   C   8.545 19.555   9.027 1.00 . A A . 63 TYR CA   1 1 
        2  3701 1 1 63 TYR CB   C  10.079 19.781   8.864 1.00 . A A . 63 TYR CB   1 1 
        2  3702 1 1 63 TYR CD1  C  10.385 22.285   8.874 1.00 . A A . 63 TYR CD1  1 1 
        2  3703 1 1 63 TYR CD2  C  11.002 21.054  10.871 1.00 . A A . 63 TYR CD2  1 1 
        2  3704 1 1 63 TYR CE1  C  10.738 23.484   9.504 1.00 . A A . 63 TYR CE1  1 1 
        2  3705 1 1 63 TYR CE2  C  11.353 22.254  11.501 1.00 . A A . 63 TYR CE2  1 1 
        2  3706 1 1 63 TYR CG   C  10.518 21.070   9.557 1.00 . A A . 63 TYR CG   1 1 
        2  3707 1 1 63 TYR CZ   C  11.221 23.469  10.818 1.00 . A A . 63 TYR CZ   1 1 
        2  3708 1 1 63 TYR H    H   8.586 18.799   7.058 1.00 . A A . 63 TYR H    1 1 
        2  3709 1 1 63 TYR HA   H   8.373 18.816   9.784 1.00 . A A . 63 TYR HA   1 1 
        2  3710 1 1 63 TYR HB2  H  10.620 18.947   9.283 1.00 . A A . 63 TYR HB2  1 1 
        2  3711 1 1 63 TYR HB3  H  10.307 19.849   7.813 1.00 . A A . 63 TYR HB3  1 1 
        2  3712 1 1 63 TYR HD1  H  10.010 22.298   7.863 1.00 . A A . 63 TYR HD1  1 1 
        2  3713 1 1 63 TYR HD2  H  11.103 20.119  11.397 1.00 . A A . 63 TYR HD2  1 1 
        2  3714 1 1 63 TYR HE1  H  10.633 24.423   8.978 1.00 . A A . 63 TYR HE1  1 1 
        2  3715 1 1 63 TYR HE2  H  11.726 22.246  12.515 1.00 . A A . 63 TYR HE2  1 1 
        2  3716 1 1 63 TYR HH   H  11.819 24.451  12.349 1.00 . A A . 63 TYR HH   1 1 
        2  3717 1 1 63 TYR N    N   7.978 19.056   7.783 1.00 . A A . 63 TYR N    1 1 
        2  3718 1 1 63 TYR O    O   7.532 21.066  10.597 1.00 . A A . 63 TYR O    1 1 
        2  3719 1 1 63 TYR OH   O  11.569 24.654  11.443 1.00 . A A . 63 TYR OH   1 1 
        2  3720 1 1 64 ASN C    C   5.565 22.810   9.122 1.00 . A A . 64 ASN C    1 1 
        2  3721 1 1 64 ASN CA   C   7.010 23.010   8.710 1.00 . A A . 64 ASN CA   1 1 
        2  3722 1 1 64 ASN CB   C   7.081 23.889   7.466 1.00 . A A . 64 ASN CB   1 1 
        2  3723 1 1 64 ASN CG   C   6.504 25.266   7.771 1.00 . A A . 64 ASN CG   1 1 
        2  3724 1 1 64 ASN H    H   7.922 21.511   7.538 1.00 . A A . 64 ASN H    1 1 
        2  3725 1 1 64 ASN HA   H   7.536 23.499   9.512 1.00 . A A . 64 ASN HA   1 1 
        2  3726 1 1 64 ASN HB2  H   8.112 23.992   7.159 1.00 . A A . 64 ASN HB2  1 1 
        2  3727 1 1 64 ASN HB3  H   6.513 23.431   6.669 1.00 . A A . 64 ASN HB3  1 1 
        2  3728 1 1 64 ASN HD21 H   6.711 25.082   9.738 1.00 . A A . 64 ASN HD21 1 1 
        2  3729 1 1 64 ASN HD22 H   6.044 26.550   9.214 1.00 . A A . 64 ASN HD22 1 1 
        2  3730 1 1 64 ASN N    N   7.642 21.732   8.450 1.00 . A A . 64 ASN N    1 1 
        2  3731 1 1 64 ASN ND2  N   6.412 25.665   9.010 1.00 . A A . 64 ASN ND2  1 1 
        2  3732 1 1 64 ASN O    O   5.031 23.539   9.957 1.00 . A A . 64 ASN O    1 1 
        2  3733 1 1 64 ASN OD1  O   6.125 25.999   6.856 1.00 . A A . 64 ASN OD1  1 1 
        2  3734 1 1 65 LYS C    C   3.407 20.949  10.245 1.00 . A A . 65 LYS C    1 1 
        2  3735 1 1 65 LYS CA   C   3.535 21.520   8.827 1.00 . A A . 65 LYS CA   1 1 
        2  3736 1 1 65 LYS CB   C   2.965 20.513   7.804 1.00 . A A . 65 LYS CB   1 1 
        2  3737 1 1 65 LYS CD   C   0.901 21.617   6.825 1.00 . A A . 65 LYS CD   1 1 
        2  3738 1 1 65 LYS CE   C  -0.625 21.683   6.886 1.00 . A A . 65 LYS CE   1 1 
        2  3739 1 1 65 LYS CG   C   1.413 20.551   7.803 1.00 . A A . 65 LYS CG   1 1 
        2  3740 1 1 65 LYS H    H   5.402 21.263   7.862 1.00 . A A . 65 LYS H    1 1 
        2  3741 1 1 65 LYS HA   H   2.969 22.438   8.768 1.00 . A A . 65 LYS HA   1 1 
        2  3742 1 1 65 LYS HB2  H   3.339 20.757   6.819 1.00 . A A . 65 LYS HB2  1 1 
        2  3743 1 1 65 LYS HB3  H   3.297 19.515   8.063 1.00 . A A . 65 LYS HB3  1 1 
        2  3744 1 1 65 LYS HD2  H   1.315 22.579   7.085 1.00 . A A . 65 LYS HD2  1 1 
        2  3745 1 1 65 LYS HD3  H   1.207 21.357   5.822 1.00 . A A . 65 LYS HD3  1 1 
        2  3746 1 1 65 LYS HE2  H  -1.044 20.734   6.584 1.00 . A A . 65 LYS HE2  1 1 
        2  3747 1 1 65 LYS HE3  H  -0.936 21.910   7.896 1.00 . A A . 65 LYS HE3  1 1 
        2  3748 1 1 65 LYS HG2  H   1.031 19.591   7.499 1.00 . A A . 65 LYS HG2  1 1 
        2  3749 1 1 65 LYS HG3  H   1.048 20.776   8.796 1.00 . A A . 65 LYS HG3  1 1 
        2  3750 1 1 65 LYS HZ1  H  -1.420 23.572   6.525 1.00 . A A . 65 LYS HZ1  1 1 
        2  3751 1 1 65 LYS HZ2  H  -1.890 22.396   5.395 1.00 . A A . 65 LYS HZ2  1 1 
        2  3752 1 1 65 LYS HZ3  H  -0.320 23.042   5.343 1.00 . A A . 65 LYS HZ3  1 1 
        2  3753 1 1 65 LYS N    N   4.926 21.812   8.519 1.00 . A A . 65 LYS N    1 1 
        2  3754 1 1 65 LYS NZ   N  -1.102 22.754   5.968 1.00 . A A . 65 LYS NZ   1 1 
        2  3755 1 1 65 LYS O    O   2.481 21.286  10.981 1.00 . A A . 65 LYS O    1 1 
        2  3756 1 1 66 VAL C    C   4.437 20.481  13.022 1.00 . A A . 66 VAL C    1 1 
        2  3757 1 1 66 VAL CA   C   4.290 19.438  11.922 1.00 . A A . 66 VAL CA   1 1 
        2  3758 1 1 66 VAL CB   C   5.393 18.352  12.034 1.00 . A A . 66 VAL CB   1 1 
        2  3759 1 1 66 VAL CG1  C   5.465 17.806  13.469 1.00 . A A . 66 VAL CG1  1 1 
        2  3760 1 1 66 VAL CG2  C   5.066 17.202  11.074 1.00 . A A . 66 VAL CG2  1 1 
        2  3761 1 1 66 VAL H    H   5.050 19.837   9.976 1.00 . A A . 66 VAL H    1 1 
        2  3762 1 1 66 VAL HA   H   3.336 18.971  12.038 1.00 . A A . 66 VAL HA   1 1 
        2  3763 1 1 66 VAL HB   H   6.356 18.769  11.772 1.00 . A A . 66 VAL HB   1 1 
        2  3764 1 1 66 VAL HG11 H   4.471 17.571  13.815 1.00 . A A . 66 VAL HG11 1 1 
        2  3765 1 1 66 VAL HG12 H   5.906 18.550  14.116 1.00 . A A . 66 VAL HG12 1 1 
        2  3766 1 1 66 VAL HG13 H   6.075 16.912  13.490 1.00 . A A . 66 VAL HG13 1 1 
        2  3767 1 1 66 VAL HG21 H   5.749 16.388  11.252 1.00 . A A . 66 VAL HG21 1 1 
        2  3768 1 1 66 VAL HG22 H   5.166 17.543  10.056 1.00 . A A . 66 VAL HG22 1 1 
        2  3769 1 1 66 VAL HG23 H   4.054 16.864  11.244 1.00 . A A . 66 VAL HG23 1 1 
        2  3770 1 1 66 VAL N    N   4.335 20.068  10.605 1.00 . A A . 66 VAL N    1 1 
        2  3771 1 1 66 VAL O    O   3.714 20.488  14.018 1.00 . A A . 66 VAL O    1 1 
        2  3772 1 1 67 LYS C    C   4.553 23.410  13.882 1.00 . A A . 67 LYS C    1 1 
        2  3773 1 1 67 LYS CA   C   5.692 22.410  13.801 1.00 . A A . 67 LYS CA   1 1 
        2  3774 1 1 67 LYS CB   C   6.961 23.094  13.355 1.00 . A A . 67 LYS CB   1 1 
        2  3775 1 1 67 LYS CD   C   8.832 21.855  14.577 1.00 . A A . 67 LYS CD   1 1 
        2  3776 1 1 67 LYS CE   C   9.777 20.645  14.518 1.00 . A A . 67 LYS CE   1 1 
        2  3777 1 1 67 LYS CG   C   8.088 22.027  13.240 1.00 . A A . 67 LYS CG   1 1 
        2  3778 1 1 67 LYS H    H   5.957 21.311  12.018 1.00 . A A . 67 LYS H    1 1 
        2  3779 1 1 67 LYS HA   H   5.853 21.969  14.764 1.00 . A A . 67 LYS HA   1 1 
        2  3780 1 1 67 LYS HB2  H   6.784 23.561  12.390 1.00 . A A . 67 LYS HB2  1 1 
        2  3781 1 1 67 LYS HB3  H   7.228 23.851  14.070 1.00 . A A . 67 LYS HB3  1 1 
        2  3782 1 1 67 LYS HD2  H   9.394 22.746  14.804 1.00 . A A . 67 LYS HD2  1 1 
        2  3783 1 1 67 LYS HD3  H   8.106 21.679  15.352 1.00 . A A . 67 LYS HD3  1 1 
        2  3784 1 1 67 LYS HE2  H  10.328 20.651  13.592 1.00 . A A . 67 LYS HE2  1 1 
        2  3785 1 1 67 LYS HE3  H  10.467 20.680  15.350 1.00 . A A . 67 LYS HE3  1 1 
        2  3786 1 1 67 LYS HG2  H   7.671 21.069  12.961 1.00 . A A . 67 LYS HG2  1 1 
        2  3787 1 1 67 LYS HG3  H   8.759 22.319  12.475 1.00 . A A . 67 LYS HG3  1 1 
        2  3788 1 1 67 LYS HZ1  H   9.136 18.808  13.777 1.00 . A A . 67 LYS HZ1  1 1 
        2  3789 1 1 67 LYS HZ2  H   7.953 19.664  14.639 1.00 . A A . 67 LYS HZ2  1 1 
        2  3790 1 1 67 LYS HZ3  H   9.211 18.886  15.473 1.00 . A A . 67 LYS HZ3  1 1 
        2  3791 1 1 67 LYS N    N   5.413 21.364  12.831 1.00 . A A . 67 LYS N    1 1 
        2  3792 1 1 67 LYS NZ   N   8.960 19.407  14.608 1.00 . A A . 67 LYS NZ   1 1 
        2  3793 1 1 67 LYS O    O   4.137 23.826  14.963 1.00 . A A . 67 LYS O    1 1 
        2  3794 1 1 68 ARG C    C   1.609 24.015  12.880 1.00 . A A . 68 ARG C    1 1 
        2  3795 1 1 68 ARG CA   C   2.933 24.728  12.639 1.00 . A A . 68 ARG CA   1 1 
        2  3796 1 1 68 ARG CB   C   2.919 25.380  11.259 1.00 . A A . 68 ARG CB   1 1 
        2  3797 1 1 68 ARG CD   C   3.986 27.135   9.816 1.00 . A A . 68 ARG CD   1 1 
        2  3798 1 1 68 ARG CG   C   4.130 26.317  11.102 1.00 . A A . 68 ARG CG   1 1 
        2  3799 1 1 68 ARG CZ   C   3.603 26.701   7.456 1.00 . A A . 68 ARG CZ   1 1 
        2  3800 1 1 68 ARG H    H   4.411 23.420  11.885 1.00 . A A . 68 ARG H    1 1 
        2  3801 1 1 68 ARG HA   H   3.058 25.499  13.390 1.00 . A A . 68 ARG HA   1 1 
        2  3802 1 1 68 ARG HB2  H   2.964 24.608  10.506 1.00 . A A . 68 ARG HB2  1 1 
        2  3803 1 1 68 ARG HB3  H   2.012 25.936  11.139 1.00 . A A . 68 ARG HB3  1 1 
        2  3804 1 1 68 ARG HD2  H   3.056 27.683   9.848 1.00 . A A . 68 ARG HD2  1 1 
        2  3805 1 1 68 ARG HD3  H   4.808 27.834   9.747 1.00 . A A . 68 ARG HD3  1 1 
        2  3806 1 1 68 ARG HE   H   4.293 25.332   8.741 1.00 . A A . 68 ARG HE   1 1 
        2  3807 1 1 68 ARG HG2  H   4.182 26.990  11.947 1.00 . A A . 68 ARG HG2  1 1 
        2  3808 1 1 68 ARG HG3  H   5.034 25.729  11.054 1.00 . A A . 68 ARG HG3  1 1 
        2  3809 1 1 68 ARG HH11 H   3.188 28.548   8.106 1.00 . A A . 68 ARG HH11 1 1 
        2  3810 1 1 68 ARG HH12 H   2.910 28.268   6.420 1.00 . A A . 68 ARG HH12 1 1 
        2  3811 1 1 68 ARG HH21 H   3.928 24.955   6.531 1.00 . A A . 68 ARG HH21 1 1 
        2  3812 1 1 68 ARG HH22 H   3.329 26.233   5.528 1.00 . A A . 68 ARG HH22 1 1 
        2  3813 1 1 68 ARG N    N   4.040 23.785  12.715 1.00 . A A . 68 ARG N    1 1 
        2  3814 1 1 68 ARG NE   N   3.993 26.259   8.646 1.00 . A A . 68 ARG NE   1 1 
        2  3815 1 1 68 ARG NH1  N   3.201 27.935   7.316 1.00 . A A . 68 ARG NH1  1 1 
        2  3816 1 1 68 ARG NH2  N   3.621 25.901   6.425 1.00 . A A . 68 ARG NH2  1 1 
        2  3817 1 1 68 ARG O    O   0.588 24.655  13.134 1.00 . A A . 68 ARG O    1 1 
        2  3818 1 1 69 GLY C    C   0.302 21.428  14.456 1.00 . A A . 69 GLY C    1 1 
        2  3819 1 1 69 GLY CA   C   0.425 21.870  13.002 1.00 . A A . 69 GLY CA   1 1 
        2  3820 1 1 69 GLY H    H   2.474 22.233  12.595 1.00 . A A . 69 GLY H    1 1 
        2  3821 1 1 69 GLY HA2  H  -0.456 22.434  12.720 1.00 . A A . 69 GLY HA2  1 1 
        2  3822 1 1 69 GLY HA3  H   0.494 20.994  12.376 1.00 . A A . 69 GLY HA3  1 1 
        2  3823 1 1 69 GLY N    N   1.631 22.688  12.800 1.00 . A A . 69 GLY N    1 1 
        2  3824 1 1 69 GLY O    O  -0.794 21.375  15.013 1.00 . A A . 69 GLY O    1 1 
        2  3825 1 1 70 GLU C    C   1.216 21.859  17.395 1.00 . A A . 70 GLU C    1 1 
        2  3826 1 1 70 GLU CA   C   1.468 20.675  16.459 1.00 . A A . 70 GLU CA   1 1 
        2  3827 1 1 70 GLU CB   C   2.826 20.011  16.756 1.00 . A A . 70 GLU CB   1 1 
        2  3828 1 1 70 GLU CD   C   4.055 21.750  18.131 1.00 . A A . 70 GLU CD   1 1 
        2  3829 1 1 70 GLU CG   C   3.945 21.068  16.765 1.00 . A A . 70 GLU CG   1 1 
        2  3830 1 1 70 GLU H    H   2.284 21.175  14.572 1.00 . A A . 70 GLU H    1 1 
        2  3831 1 1 70 GLU HA   H   0.693 19.944  16.608 1.00 . A A . 70 GLU HA   1 1 
        2  3832 1 1 70 GLU HB2  H   2.786 19.505  17.709 1.00 . A A . 70 GLU HB2  1 1 
        2  3833 1 1 70 GLU HB3  H   3.037 19.283  15.981 1.00 . A A . 70 GLU HB3  1 1 
        2  3834 1 1 70 GLU HG2  H   4.887 20.598  16.531 1.00 . A A . 70 GLU HG2  1 1 
        2  3835 1 1 70 GLU HG3  H   3.729 21.809  16.019 1.00 . A A . 70 GLU HG3  1 1 
        2  3836 1 1 70 GLU N    N   1.440 21.113  15.066 1.00 . A A . 70 GLU N    1 1 
        2  3837 1 1 70 GLU O    O   0.587 21.717  18.443 1.00 . A A . 70 GLU O    1 1 
        2  3838 1 1 70 GLU OE1  O   3.281 21.415  19.012 1.00 . A A . 70 GLU OE1  1 1 
        2  3839 1 1 70 GLU OE2  O   4.928 22.590  18.274 1.00 . A A . 70 GLU OE2  1 1 
        2  3840 1 1 71 SER C    C   0.967 25.375  16.949 1.00 . A A . 71 SER C    1 1 
        2  3841 1 1 71 SER CA   C   1.559 24.254  17.804 1.00 . A A . 71 SER CA   1 1 
        2  3842 1 1 71 SER CB   C   2.919 24.687  18.365 1.00 . A A . 71 SER CB   1 1 
        2  3843 1 1 71 SER H    H   2.212 23.079  16.160 1.00 . A A . 71 SER H    1 1 
        2  3844 1 1 71 SER HA   H   0.887 24.068  18.634 1.00 . A A . 71 SER HA   1 1 
        2  3845 1 1 71 SER HB2  H   3.677 24.559  17.611 1.00 . A A . 71 SER HB2  1 1 
        2  3846 1 1 71 SER HB3  H   2.884 25.731  18.661 1.00 . A A . 71 SER HB3  1 1 
        2  3847 1 1 71 SER HG   H   2.511 23.935  20.111 1.00 . A A . 71 SER HG   1 1 
        2  3848 1 1 71 SER N    N   1.719 23.026  17.005 1.00 . A A . 71 SER N    1 1 
        2  3849 1 1 71 SER O    O   1.587 25.860  16.003 1.00 . A A . 71 SER O    1 1 
        2  3850 1 1 71 SER OG   O   3.237 23.877  19.489 1.00 . A A . 71 SER OG   1 1 
        2  3851 1 1 72 LYS C    C  -0.420 28.219  17.047 1.00 . A A . 72 LYS C    1 1 
        2  3852 1 1 72 LYS CA   C  -0.925 26.860  16.583 1.00 . A A . 72 LYS CA   1 1 
        2  3853 1 1 72 LYS CB   C  -2.429 26.753  16.834 1.00 . A A . 72 LYS CB   1 1 
        2  3854 1 1 72 LYS CD   C  -3.249 25.543  14.716 1.00 . A A . 72 LYS CD   1 1 
        2  3855 1 1 72 LYS CE   C  -4.732 25.855  14.451 1.00 . A A . 72 LYS CE   1 1 
        2  3856 1 1 72 LYS CG   C  -2.981 25.428  16.250 1.00 . A A . 72 LYS CG   1 1 
        2  3857 1 1 72 LYS H    H  -0.692 25.363  18.069 1.00 . A A . 72 LYS H    1 1 
        2  3858 1 1 72 LYS HA   H  -0.735 26.760  15.525 1.00 . A A . 72 LYS HA   1 1 
        2  3859 1 1 72 LYS HB2  H  -2.601 26.776  17.901 1.00 . A A . 72 LYS HB2  1 1 
        2  3860 1 1 72 LYS HB3  H  -2.932 27.591  16.372 1.00 . A A . 72 LYS HB3  1 1 
        2  3861 1 1 72 LYS HD2  H  -2.645 26.330  14.290 1.00 . A A . 72 LYS HD2  1 1 
        2  3862 1 1 72 LYS HD3  H  -2.998 24.607  14.234 1.00 . A A . 72 LYS HD3  1 1 
        2  3863 1 1 72 LYS HE2  H  -4.862 26.182  13.429 1.00 . A A . 72 LYS HE2  1 1 
        2  3864 1 1 72 LYS HE3  H  -5.330 24.971  14.626 1.00 . A A . 72 LYS HE3  1 1 
        2  3865 1 1 72 LYS HG2  H  -2.260 24.637  16.430 1.00 . A A . 72 LYS HG2  1 1 
        2  3866 1 1 72 LYS HG3  H  -3.900 25.175  16.763 1.00 . A A . 72 LYS HG3  1 1 
        2  3867 1 1 72 LYS HZ1  H  -4.935 26.658  16.352 1.00 . A A . 72 LYS HZ1  1 1 
        2  3868 1 1 72 LYS HZ2  H  -6.187 27.082  15.291 1.00 . A A . 72 LYS HZ2  1 1 
        2  3869 1 1 72 LYS HZ3  H  -4.661 27.813  15.138 1.00 . A A . 72 LYS HZ3  1 1 
        2  3870 1 1 72 LYS N    N  -0.246 25.787  17.307 1.00 . A A . 72 LYS N    1 1 
        2  3871 1 1 72 LYS NZ   N  -5.163 26.933  15.378 1.00 . A A . 72 LYS NZ   1 1 
        2  3872 1 1 72 LYS O    O  -0.675 29.238  16.405 1.00 . A A . 72 LYS O    1 1 
        2  3873 1 1 73 LEU C    C   1.992 29.966  17.854 1.00 . A A . 73 LEU C    1 1 
        2  3874 1 1 73 LEU CA   C   0.836 29.469  18.712 1.00 . A A . 73 LEU CA   1 1 
        2  3875 1 1 73 LEU CB   C   1.315 29.229  20.147 1.00 . A A . 73 LEU CB   1 1 
        2  3876 1 1 73 LEU CD1  C   0.716 28.307  22.393 1.00 . A A . 73 LEU CD1  1 1 
        2  3877 1 1 73 LEU CD2  C  -1.062 29.452  21.016 1.00 . A A . 73 LEU CD2  1 1 
        2  3878 1 1 73 LEU CG   C   0.200 28.561  20.971 1.00 . A A . 73 LEU CG   1 1 
        2  3879 1 1 73 LEU H    H   0.470 27.387  18.635 1.00 . A A . 73 LEU H    1 1 
        2  3880 1 1 73 LEU HA   H   0.072 30.221  18.721 1.00 . A A . 73 LEU HA   1 1 
        2  3881 1 1 73 LEU HB2  H   2.181 28.585  20.134 1.00 . A A . 73 LEU HB2  1 1 
        2  3882 1 1 73 LEU HB3  H   1.576 30.173  20.602 1.00 . A A . 73 LEU HB3  1 1 
        2  3883 1 1 73 LEU HD11 H   1.623 27.724  22.344 1.00 . A A . 73 LEU HD11 1 1 
        2  3884 1 1 73 LEU HD12 H  -0.030 27.767  22.957 1.00 . A A . 73 LEU HD12 1 1 
        2  3885 1 1 73 LEU HD13 H   0.921 29.251  22.877 1.00 . A A . 73 LEU HD13 1 1 
        2  3886 1 1 73 LEU HD21 H  -1.613 29.346  20.093 1.00 . A A . 73 LEU HD21 1 1 
        2  3887 1 1 73 LEU HD22 H  -0.776 30.486  21.146 1.00 . A A . 73 LEU HD22 1 1 
        2  3888 1 1 73 LEU HD23 H  -1.695 29.149  21.839 1.00 . A A . 73 LEU HD23 1 1 
        2  3889 1 1 73 LEU HG   H  -0.049 27.612  20.517 1.00 . A A . 73 LEU HG   1 1 
        2  3890 1 1 73 LEU N    N   0.298 28.229  18.165 1.00 . A A . 73 LEU N    1 1 
        2  3891 1 1 73 LEU O    O   1.844 30.919  17.088 1.00 . A A . 73 LEU O    1 1 
        2  3892 1 1 74 GLU C    C   4.528 31.214  17.261 1.00 . A A . 74 GLU C    1 1 
        2  3893 1 1 74 GLU CA   C   4.326 29.702  17.212 1.00 . A A . 74 GLU CA   1 1 
        2  3894 1 1 74 GLU CB   C   4.158 29.246  15.757 1.00 . A A . 74 GLU CB   1 1 
        2  3895 1 1 74 GLU CD   C   5.491 27.135  16.040 1.00 . A A . 74 GLU CD   1 1 
        2  3896 1 1 74 GLU CG   C   4.124 27.714  15.689 1.00 . A A . 74 GLU CG   1 1 
        2  3897 1 1 74 GLU H    H   3.205 28.566  18.613 1.00 . A A . 74 GLU H    1 1 
        2  3898 1 1 74 GLU HA   H   5.196 29.221  17.633 1.00 . A A . 74 GLU HA   1 1 
        2  3899 1 1 74 GLU HB2  H   3.233 29.643  15.363 1.00 . A A . 74 GLU HB2  1 1 
        2  3900 1 1 74 GLU HB3  H   4.985 29.611  15.167 1.00 . A A . 74 GLU HB3  1 1 
        2  3901 1 1 74 GLU HG2  H   3.393 27.346  16.392 1.00 . A A . 74 GLU HG2  1 1 
        2  3902 1 1 74 GLU HG3  H   3.849 27.405  14.692 1.00 . A A . 74 GLU HG3  1 1 
        2  3903 1 1 74 GLU N    N   3.144 29.317  17.987 1.00 . A A . 74 GLU N    1 1 
        2  3904 1 1 74 GLU O    O   4.905 31.836  16.268 1.00 . A A . 74 GLU O    1 1 
        2  3905 1 1 74 GLU OE1  O   6.462 27.871  15.963 1.00 . A A . 74 GLU OE1  1 1 
        2  3906 1 1 74 GLU OE2  O   5.547 25.964  16.379 1.00 . A A . 74 GLU OE2  1 1 
        2  3907 1 1 75 HIS C    C   4.455 33.593  20.090 1.00 . A A . 75 HIS C    1 1 
        2  3908 1 1 75 HIS CA   C   4.420 33.239  18.605 1.00 . A A . 75 HIS CA   1 1 
        2  3909 1 1 75 HIS CB   C   3.257 33.969  17.926 1.00 . A A . 75 HIS CB   1 1 
        2  3910 1 1 75 HIS CD2  C   2.640 36.447  18.560 1.00 . A A . 75 HIS CD2  1 1 
        2  3911 1 1 75 HIS CE1  C   4.473 37.400  17.906 1.00 . A A . 75 HIS CE1  1 1 
        2  3912 1 1 75 HIS CG   C   3.448 35.455  18.062 1.00 . A A . 75 HIS CG   1 1 
        2  3913 1 1 75 HIS H    H   3.973 31.254  19.184 1.00 . A A . 75 HIS H    1 1 
        2  3914 1 1 75 HIS HA   H   5.346 33.560  18.149 1.00 . A A . 75 HIS HA   1 1 
        2  3915 1 1 75 HIS HB2  H   3.227 33.705  16.880 1.00 . A A . 75 HIS HB2  1 1 
        2  3916 1 1 75 HIS HB3  H   2.327 33.683  18.397 1.00 . A A . 75 HIS HB3  1 1 
        2  3917 1 1 75 HIS HD1  H   5.393 35.655  17.247 1.00 . A A . 75 HIS HD1  1 1 
        2  3918 1 1 75 HIS HD2  H   1.650 36.298  18.966 1.00 . A A . 75 HIS HD2  1 1 
        2  3919 1 1 75 HIS HE1  H   5.226 38.143  17.689 1.00 . A A . 75 HIS HE1  1 1 
        2  3920 1 1 75 HIS HE2  H   2.950 38.551  18.737 1.00 . A A . 75 HIS HE2  1 1 
        2  3921 1 1 75 HIS N    N   4.271 31.800  18.426 1.00 . A A . 75 HIS N    1 1 
        2  3922 1 1 75 HIS ND1  N   4.612 36.087  17.650 1.00 . A A . 75 HIS ND1  1 1 
        2  3923 1 1 75 HIS NE2  N   3.288 37.674  18.460 1.00 . A A . 75 HIS NE2  1 1 
        2  3924 1 1 75 HIS O    O   3.632 33.126  20.876 1.00 . A A . 75 HIS O    1 1 
        2  3925 1 1 76 HIS C    C   4.605 35.996  22.165 1.00 . A A . 76 HIS C    1 1 
        2  3926 1 1 76 HIS CA   C   5.563 34.848  21.856 1.00 . A A . 76 HIS CA   1 1 
        2  3927 1 1 76 HIS CB   C   7.000 35.300  22.113 1.00 . A A . 76 HIS CB   1 1 
        2  3928 1 1 76 HIS CD2  C   8.686 33.965  20.604 1.00 . A A . 76 HIS CD2  1 1 
        2  3929 1 1 76 HIS CE1  C   9.100 32.328  21.961 1.00 . A A . 76 HIS CE1  1 1 
        2  3930 1 1 76 HIS CG   C   7.947 34.192  21.739 1.00 . A A . 76 HIS CG   1 1 
        2  3931 1 1 76 HIS H    H   6.046 34.769  19.790 1.00 . A A . 76 HIS H    1 1 
        2  3932 1 1 76 HIS HA   H   5.337 34.017  22.511 1.00 . A A . 76 HIS HA   1 1 
        2  3933 1 1 76 HIS HB2  H   7.214 36.175  21.517 1.00 . A A . 76 HIS HB2  1 1 
        2  3934 1 1 76 HIS HB3  H   7.123 35.539  23.160 1.00 . A A . 76 HIS HB3  1 1 
        2  3935 1 1 76 HIS HD1  H   7.855 32.999  23.487 1.00 . A A . 76 HIS HD1  1 1 
        2  3936 1 1 76 HIS HD2  H   8.700 34.603  19.732 1.00 . A A . 76 HIS HD2  1 1 
        2  3937 1 1 76 HIS HE1  H   9.498 31.417  22.385 1.00 . A A . 76 HIS HE1  1 1 
        2  3938 1 1 76 HIS HE2  H  10.022 32.381  20.096 1.00 . A A . 76 HIS HE2  1 1 
        2  3939 1 1 76 HIS N    N   5.419 34.429  20.462 1.00 . A A . 76 HIS N    1 1 
        2  3940 1 1 76 HIS ND1  N   8.227 33.135  22.591 1.00 . A A . 76 HIS ND1  1 1 
        2  3941 1 1 76 HIS NE2  N   9.413 32.787  20.747 1.00 . A A . 76 HIS NE2  1 1 
        2  3942 1 1 76 HIS O    O   5.032 37.125  22.405 1.00 . A A . 76 HIS O    1 1 
        2  3943 1 1 77 HIS C    C   2.414 37.201  23.881 1.00 . A A . 77 HIS C    1 1 
        2  3944 1 1 77 HIS CA   C   2.301 36.715  22.441 1.00 . A A . 77 HIS CA   1 1 
        2  3945 1 1 77 HIS CB   C   0.902 36.142  22.201 1.00 . A A . 77 HIS CB   1 1 
        2  3946 1 1 77 HIS CD2  C  -0.641 38.135  21.458 1.00 . A A . 77 HIS CD2  1 1 
        2  3947 1 1 77 HIS CE1  C  -1.597 38.525  23.362 1.00 . A A . 77 HIS CE1  1 1 
        2  3948 1 1 77 HIS CG   C  -0.124 37.233  22.354 1.00 . A A . 77 HIS CG   1 1 
        2  3949 1 1 77 HIS H    H   3.027 34.781  21.963 1.00 . A A . 77 HIS H    1 1 
        2  3950 1 1 77 HIS HA   H   2.456 37.551  21.773 1.00 . A A . 77 HIS HA   1 1 
        2  3951 1 1 77 HIS HB2  H   0.846 35.733  21.203 1.00 . A A . 77 HIS HB2  1 1 
        2  3952 1 1 77 HIS HB3  H   0.705 35.361  22.921 1.00 . A A . 77 HIS HB3  1 1 
        2  3953 1 1 77 HIS HD1  H  -0.598 37.029  24.409 1.00 . A A . 77 HIS HD1  1 1 
        2  3954 1 1 77 HIS HD2  H  -0.368 38.202  20.415 1.00 . A A . 77 HIS HD2  1 1 
        2  3955 1 1 77 HIS HE1  H  -2.223 38.952  24.132 1.00 . A A . 77 HIS HE1  1 1 
        2  3956 1 1 77 HIS HE2  H  -2.095 39.678  21.702 1.00 . A A . 77 HIS HE2  1 1 
        2  3957 1 1 77 HIS N    N   3.310 35.697  22.161 1.00 . A A . 77 HIS N    1 1 
        2  3958 1 1 77 HIS ND1  N  -0.748 37.500  23.563 1.00 . A A . 77 HIS ND1  1 1 
        2  3959 1 1 77 HIS NE2  N  -1.572 38.949  22.096 1.00 . A A . 77 HIS NE2  1 1 
        2  3960 1 1 77 HIS O    O   2.387 38.403  24.148 1.00 . A A . 77 HIS O    1 1 
        2  3961 1 1 78 HIS C    C   4.090 37.024  26.549 1.00 . A A . 78 HIS C    1 1 
        2  3962 1 1 78 HIS CA   C   2.665 36.593  26.225 1.00 . A A . 78 HIS CA   1 1 
        2  3963 1 1 78 HIS CB   C   2.291 35.382  27.080 1.00 . A A . 78 HIS CB   1 1 
        2  3964 1 1 78 HIS CD2  C   0.367 33.893  26.089 1.00 . A A . 78 HIS CD2  1 1 
        2  3965 1 1 78 HIS CE1  C  -1.323 35.075  26.752 1.00 . A A . 78 HIS CE1  1 1 
        2  3966 1 1 78 HIS CG   C   0.878 34.968  26.772 1.00 . A A . 78 HIS CG   1 1 
        2  3967 1 1 78 HIS H    H   2.560 35.315  24.535 1.00 . A A . 78 HIS H    1 1 
        2  3968 1 1 78 HIS HA   H   1.990 37.405  26.459 1.00 . A A . 78 HIS HA   1 1 
        2  3969 1 1 78 HIS HB2  H   2.962 34.564  26.860 1.00 . A A . 78 HIS HB2  1 1 
        2  3970 1 1 78 HIS HB3  H   2.369 35.640  28.126 1.00 . A A . 78 HIS HB3  1 1 
        2  3971 1 1 78 HIS HD1  H  -0.192 36.543  27.701 1.00 . A A . 78 HIS HD1  1 1 
        2  3972 1 1 78 HIS HD2  H   0.954 33.111  25.630 1.00 . A A . 78 HIS HD2  1 1 
        2  3973 1 1 78 HIS HE1  H  -2.330 35.424  26.929 1.00 . A A . 78 HIS HE1  1 1 
        2  3974 1 1 78 HIS HE2  H  -1.648 33.331  25.665 1.00 . A A . 78 HIS HE2  1 1 
        2  3975 1 1 78 HIS N    N   2.545 36.257  24.807 1.00 . A A . 78 HIS N    1 1 
        2  3976 1 1 78 HIS ND1  N  -0.218 35.710  27.186 1.00 . A A . 78 HIS ND1  1 1 
        2  3977 1 1 78 HIS NE2  N  -1.023 33.962  26.078 1.00 . A A . 78 HIS NE2  1 1 
        2  3978 1 1 78 HIS O    O   5.030 36.699  25.823 1.00 . A A . 78 HIS O    1 1 
        2  3979 1 1 79 HIS C    C   6.258 38.959  26.906 1.00 . A A . 79 HIS C    1 1 
        2  3980 1 1 79 HIS CA   C   5.562 38.232  28.057 1.00 . A A . 79 HIS CA   1 1 
        2  3981 1 1 79 HIS CB   C   6.421 37.049  28.511 1.00 . A A . 79 HIS CB   1 1 
        2  3982 1 1 79 HIS CD2  C   5.063 35.204  29.798 1.00 . A A . 79 HIS CD2  1 1 
        2  3983 1 1 79 HIS CE1  C   5.132 36.083  31.777 1.00 . A A . 79 HIS CE1  1 1 
        2  3984 1 1 79 HIS CG   C   5.768 36.376  29.687 1.00 . A A . 79 HIS CG   1 1 
        2  3985 1 1 79 HIS H    H   3.458 37.988  28.186 1.00 . A A . 79 HIS H    1 1 
        2  3986 1 1 79 HIS HA   H   5.446 38.916  28.884 1.00 . A A . 79 HIS HA   1 1 
        2  3987 1 1 79 HIS HB2  H   6.517 36.342  27.701 1.00 . A A . 79 HIS HB2  1 1 
        2  3988 1 1 79 HIS HB3  H   7.398 37.403  28.798 1.00 . A A . 79 HIS HB3  1 1 
        2  3989 1 1 79 HIS HD1  H   6.231 37.761  31.223 1.00 . A A . 79 HIS HD1  1 1 
        2  3990 1 1 79 HIS HD2  H   4.852 34.526  28.984 1.00 . A A . 79 HIS HD2  1 1 
        2  3991 1 1 79 HIS HE1  H   4.993 36.250  32.835 1.00 . A A . 79 HIS HE1  1 1 
        2  3992 1 1 79 HIS HE2  H   4.146 34.272  31.485 1.00 . A A . 79 HIS HE2  1 1 
        2  3993 1 1 79 HIS N    N   4.243 37.760  27.646 1.00 . A A . 79 HIS N    1 1 
        2  3994 1 1 79 HIS ND1  N   5.800 36.920  30.963 1.00 . A A . 79 HIS ND1  1 1 
        2  3995 1 1 79 HIS NE2  N   4.661 35.020  31.118 1.00 . A A . 79 HIS NE2  1 1 
        2  3996 1 1 79 HIS O    O   5.625 39.314  25.912 1.00 . A A . 79 HIS O    1 1 
        2  3997 1 1 80 HIS C    C   9.810 39.473  26.106 1.00 . A A . 80 HIS C    1 1 
        2  3998 1 1 80 HIS CA   C   8.338 39.861  26.014 1.00 . A A . 80 HIS CA   1 1 
        2  3999 1 1 80 HIS CB   C   8.200 41.375  26.184 1.00 . A A . 80 HIS CB   1 1 
        2  4000 1 1 80 HIS CD2  C   5.974 42.031  24.948 1.00 . A A . 80 HIS CD2  1 1 
        2  4001 1 1 80 HIS CE1  C   4.708 42.274  26.690 1.00 . A A . 80 HIS CE1  1 1 
        2  4002 1 1 80 HIS CG   C   6.754 41.765  26.046 1.00 . A A . 80 HIS CG   1 1 
        2  4003 1 1 80 HIS H    H   8.013 38.868  27.863 1.00 . A A . 80 HIS H    1 1 
        2  4004 1 1 80 HIS HA   H   7.966 39.582  25.038 1.00 . A A . 80 HIS HA   1 1 
        2  4005 1 1 80 HIS HB2  H   8.559 41.661  27.162 1.00 . A A . 80 HIS HB2  1 1 
        2  4006 1 1 80 HIS HB3  H   8.781 41.877  25.425 1.00 . A A . 80 HIS HB3  1 1 
        2  4007 1 1 80 HIS HD1  H   6.180 41.807  28.085 1.00 . A A . 80 HIS HD1  1 1 
        2  4008 1 1 80 HIS HD2  H   6.311 41.996  23.922 1.00 . A A . 80 HIS HD2  1 1 
        2  4009 1 1 80 HIS HE1  H   3.856 42.466  27.324 1.00 . A A . 80 HIS HE1  1 1 
        2  4010 1 1 80 HIS HE2  H   3.920 42.587  24.788 1.00 . A A . 80 HIS HE2  1 1 
        2  4011 1 1 80 HIS N    N   7.561 39.174  27.049 1.00 . A A . 80 HIS N    1 1 
        2  4012 1 1 80 HIS ND1  N   5.926 41.926  27.146 1.00 . A A . 80 HIS ND1  1 1 
        2  4013 1 1 80 HIS NE2  N   4.683 42.353  25.357 1.00 . A A . 80 HIS NE2  1 1 
        2  4014 1 1 80 HIS O    O  10.369 39.590  27.185 1.00 . A A . 80 HIS O    1 1 
        2  4015 2 1  1 MET C    C  40.333 31.200   6.933 1.00 . B B .  1 MET C    1 1 
        2  4016 2 1  1 MET CA   C  41.695 31.880   6.866 1.00 . B B .  1 MET CA   1 1 
        2  4017 2 1  1 MET CB   C  41.524 33.378   6.592 1.00 . B B .  1 MET CB   1 1 
        2  4018 2 1  1 MET CE   C  40.070 35.196   3.196 1.00 . B B .  1 MET CE   1 1 
        2  4019 2 1  1 MET CG   C  41.029 33.589   5.158 1.00 . B B .  1 MET CG   1 1 
        2  4020 2 1  1 MET H1   H  43.404 31.761   5.684 1.00 . B B .  1 MET H1   1 1 
        2  4021 2 1  1 MET H2   H  41.971 31.340   4.874 1.00 . B B .  1 MET H2   1 1 
        2  4022 2 1  1 MET H3   H  42.669 30.263   5.988 1.00 . B B .  1 MET H3   1 1 
        2  4023 2 1  1 MET HA   H  42.210 31.743   7.805 1.00 . B B .  1 MET HA   1 1 
        2  4024 2 1  1 MET HB2  H  40.806 33.794   7.286 1.00 . B B .  1 MET HB2  1 1 
        2  4025 2 1  1 MET HB3  H  42.474 33.877   6.717 1.00 . B B .  1 MET HB3  1 1 
        2  4026 2 1  1 MET HE1  H  39.880 36.181   2.791 1.00 . B B .  1 MET HE1  1 1 
        2  4027 2 1  1 MET HE2  H  39.150 34.629   3.227 1.00 . B B .  1 MET HE2  1 1 
        2  4028 2 1  1 MET HE3  H  40.784 34.684   2.570 1.00 . B B .  1 MET HE3  1 1 
        2  4029 2 1  1 MET HG2  H  41.774 33.230   4.464 1.00 . B B .  1 MET HG2  1 1 
        2  4030 2 1  1 MET HG3  H  40.108 33.043   5.011 1.00 . B B .  1 MET HG3  1 1 
        2  4031 2 1  1 MET N    N  42.496 31.265   5.770 1.00 . B B .  1 MET N    1 1 
        2  4032 2 1  1 MET O    O  39.469 31.602   7.714 1.00 . B B .  1 MET O    1 1 
        2  4033 2 1  1 MET SD   S  40.738 35.352   4.871 1.00 . B B .  1 MET SD   1 1 
        2  4034 2 1  2 SER C    C  38.572 28.872   7.467 1.00 . B B .  2 SER C    1 1 
        2  4035 2 1  2 SER CA   C  38.879 29.452   6.090 1.00 . B B .  2 SER CA   1 1 
        2  4036 2 1  2 SER CB   C  38.939 28.322   5.060 1.00 . B B .  2 SER CB   1 1 
        2  4037 2 1  2 SER H    H  40.867 29.898   5.511 1.00 . B B .  2 SER H    1 1 
        2  4038 2 1  2 SER HA   H  38.091 30.134   5.812 1.00 . B B .  2 SER HA   1 1 
        2  4039 2 1  2 SER HB2  H  37.975 27.846   4.988 1.00 . B B .  2 SER HB2  1 1 
        2  4040 2 1  2 SER HB3  H  39.209 28.731   4.095 1.00 . B B .  2 SER HB3  1 1 
        2  4041 2 1  2 SER HG   H  40.639 27.398   4.852 1.00 . B B .  2 SER HG   1 1 
        2  4042 2 1  2 SER N    N  40.143 30.174   6.111 1.00 . B B .  2 SER N    1 1 
        2  4043 2 1  2 SER O    O  39.334 28.067   8.001 1.00 . B B .  2 SER O    1 1 
        2  4044 2 1  2 SER OG   O  39.903 27.362   5.469 1.00 . B B .  2 SER OG   1 1 
        2  4045 2 1  3 GLU C    C  36.286 27.489   9.227 1.00 . B B .  3 GLU C    1 1 
        2  4046 2 1  3 GLU CA   C  37.031 28.809   9.354 1.00 . B B .  3 GLU CA   1 1 
        2  4047 2 1  3 GLU CB   C  36.125 29.843  10.028 1.00 . B B .  3 GLU CB   1 1 
        2  4048 2 1  3 GLU CD   C  36.028 32.170  10.966 1.00 . B B .  3 GLU CD   1 1 
        2  4049 2 1  3 GLU CG   C  36.934 31.104  10.353 1.00 . B B .  3 GLU CG   1 1 
        2  4050 2 1  3 GLU H    H  36.875 29.931   7.561 1.00 . B B .  3 GLU H    1 1 
        2  4051 2 1  3 GLU HA   H  37.900 28.652   9.972 1.00 . B B .  3 GLU HA   1 1 
        2  4052 2 1  3 GLU HB2  H  35.314 30.098   9.361 1.00 . B B .  3 GLU HB2  1 1 
        2  4053 2 1  3 GLU HB3  H  35.724 29.432  10.943 1.00 . B B .  3 GLU HB3  1 1 
        2  4054 2 1  3 GLU HG2  H  37.718 30.855  11.053 1.00 . B B .  3 GLU HG2  1 1 
        2  4055 2 1  3 GLU HG3  H  37.375 31.489   9.445 1.00 . B B .  3 GLU HG3  1 1 
        2  4056 2 1  3 GLU N    N  37.445 29.288   8.034 1.00 . B B .  3 GLU N    1 1 
        2  4057 2 1  3 GLU O    O  35.900 27.081   8.131 1.00 . B B .  3 GLU O    1 1 
        2  4058 2 1  3 GLU OE1  O  34.853 31.895  11.142 1.00 . B B .  3 GLU OE1  1 1 
        2  4059 2 1  3 GLU OE2  O  36.527 33.246  11.252 1.00 . B B .  3 GLU OE2  1 1 
        2  4060 2 1  4 LEU C    C  36.050 24.568   9.411 1.00 . B B .  4 LEU C    1 1 
        2  4061 2 1  4 LEU CA   C  35.380 25.551  10.366 1.00 . B B .  4 LEU CA   1 1 
        2  4062 2 1  4 LEU CB   C  33.928 25.767   9.940 1.00 . B B .  4 LEU CB   1 1 
        2  4063 2 1  4 LEU CD1  C  31.849 27.104  10.301 1.00 . B B .  4 LEU CD1  1 1 
        2  4064 2 1  4 LEU CD2  C  33.260 26.459  12.285 1.00 . B B .  4 LEU CD2  1 1 
        2  4065 2 1  4 LEU CG   C  33.281 26.867  10.798 1.00 . B B .  4 LEU CG   1 1 
        2  4066 2 1  4 LEU H    H  36.416 27.197  11.202 1.00 . B B .  4 LEU H    1 1 
        2  4067 2 1  4 LEU HA   H  35.400 25.136  11.362 1.00 . B B .  4 LEU HA   1 1 
        2  4068 2 1  4 LEU HB2  H  33.902 26.065   8.904 1.00 . B B .  4 LEU HB2  1 1 
        2  4069 2 1  4 LEU HB3  H  33.379 24.847  10.064 1.00 . B B .  4 LEU HB3  1 1 
        2  4070 2 1  4 LEU HD11 H  31.875 27.386   9.259 1.00 . B B .  4 LEU HD11 1 1 
        2  4071 2 1  4 LEU HD12 H  31.396 27.899  10.876 1.00 . B B .  4 LEU HD12 1 1 
        2  4072 2 1  4 LEU HD13 H  31.269 26.200  10.417 1.00 . B B .  4 LEU HD13 1 1 
        2  4073 2 1  4 LEU HD21 H  33.003 25.416  12.372 1.00 . B B .  4 LEU HD21 1 1 
        2  4074 2 1  4 LEU HD22 H  32.529 27.053  12.819 1.00 . B B .  4 LEU HD22 1 1 
        2  4075 2 1  4 LEU HD23 H  34.233 26.630  12.723 1.00 . B B .  4 LEU HD23 1 1 
        2  4076 2 1  4 LEU HG   H  33.847 27.780  10.685 1.00 . B B .  4 LEU HG   1 1 
        2  4077 2 1  4 LEU N    N  36.086 26.823  10.358 1.00 . B B .  4 LEU N    1 1 
        2  4078 2 1  4 LEU O    O  35.429 23.606   8.958 1.00 . B B .  4 LEU O    1 1 
        2  4079 2 1  5 PHE C    C  38.130 22.531   8.789 1.00 . B B .  5 PHE C    1 1 
        2  4080 2 1  5 PHE CA   C  38.066 23.941   8.221 1.00 . B B .  5 PHE CA   1 1 
        2  4081 2 1  5 PHE CB   C  39.490 24.473   8.033 1.00 . B B .  5 PHE CB   1 1 
        2  4082 2 1  5 PHE CD1  C  40.125 23.825   5.680 1.00 . B B .  5 PHE CD1  1 1 
        2  4083 2 1  5 PHE CD2  C  41.044 22.542   7.520 1.00 . B B .  5 PHE CD2  1 1 
        2  4084 2 1  5 PHE CE1  C  40.814 23.014   4.770 1.00 . B B .  5 PHE CE1  1 1 
        2  4085 2 1  5 PHE CE2  C  41.733 21.731   6.611 1.00 . B B .  5 PHE CE2  1 1 
        2  4086 2 1  5 PHE CG   C  40.239 23.589   7.055 1.00 . B B .  5 PHE CG   1 1 
        2  4087 2 1  5 PHE CZ   C  41.617 21.967   5.236 1.00 . B B .  5 PHE CZ   1 1 
        2  4088 2 1  5 PHE H    H  37.766 25.594   9.508 1.00 . B B .  5 PHE H    1 1 
        2  4089 2 1  5 PHE HA   H  37.571 23.915   7.261 1.00 . B B .  5 PHE HA   1 1 
        2  4090 2 1  5 PHE HB2  H  39.448 25.482   7.650 1.00 . B B .  5 PHE HB2  1 1 
        2  4091 2 1  5 PHE HB3  H  39.999 24.474   8.986 1.00 . B B .  5 PHE HB3  1 1 
        2  4092 2 1  5 PHE HD1  H  39.505 24.632   5.321 1.00 . B B .  5 PHE HD1  1 1 
        2  4093 2 1  5 PHE HD2  H  41.133 22.360   8.581 1.00 . B B .  5 PHE HD2  1 1 
        2  4094 2 1  5 PHE HE1  H  40.724 23.196   3.709 1.00 . B B .  5 PHE HE1  1 1 
        2  4095 2 1  5 PHE HE2  H  42.353 20.922   6.971 1.00 . B B .  5 PHE HE2  1 1 
        2  4096 2 1  5 PHE HZ   H  42.149 21.340   4.535 1.00 . B B .  5 PHE HZ   1 1 
        2  4097 2 1  5 PHE N    N  37.323 24.812   9.117 1.00 . B B .  5 PHE N    1 1 
        2  4098 2 1  5 PHE O    O  37.872 21.557   8.081 1.00 . B B .  5 PHE O    1 1 
        2  4099 2 1  6 SER C    C  37.197 20.615  11.106 1.00 . B B .  6 SER C    1 1 
        2  4100 2 1  6 SER CA   C  38.579 21.125  10.722 1.00 . B B .  6 SER CA   1 1 
        2  4101 2 1  6 SER CB   C  39.468 21.245  11.975 1.00 . B B .  6 SER CB   1 1 
        2  4102 2 1  6 SER H    H  38.670 23.235  10.583 1.00 . B B .  6 SER H    1 1 
        2  4103 2 1  6 SER HA   H  39.028 20.419  10.040 1.00 . B B .  6 SER HA   1 1 
        2  4104 2 1  6 SER HB2  H  38.917 21.708  12.780 1.00 . B B .  6 SER HB2  1 1 
        2  4105 2 1  6 SER HB3  H  39.791 20.264  12.286 1.00 . B B .  6 SER HB3  1 1 
        2  4106 2 1  6 SER HG   H  41.344 21.702  12.172 1.00 . B B .  6 SER HG   1 1 
        2  4107 2 1  6 SER N    N  38.475 22.424  10.068 1.00 . B B .  6 SER N    1 1 
        2  4108 2 1  6 SER O    O  36.491 21.252  11.888 1.00 . B B .  6 SER O    1 1 
        2  4109 2 1  6 SER OG   O  40.601 22.045  11.672 1.00 . B B .  6 SER OG   1 1 
        2  4110 2 1  7 VAL C    C  35.388 18.671  12.391 1.00 . B B .  7 VAL C    1 1 
        2  4111 2 1  7 VAL CA   C  35.520 18.873  10.868 1.00 . B B .  7 VAL CA   1 1 
        2  4112 2 1  7 VAL CB   C  35.322 17.515  10.114 1.00 . B B .  7 VAL CB   1 1 
        2  4113 2 1  7 VAL CG1  C  33.859 17.334   9.658 1.00 . B B .  7 VAL CG1  1 1 
        2  4114 2 1  7 VAL CG2  C  36.258 17.443   8.888 1.00 . B B .  7 VAL CG2  1 1 
        2  4115 2 1  7 VAL H    H  37.420 19.001   9.944 1.00 . B B .  7 VAL H    1 1 
        2  4116 2 1  7 VAL HA   H  34.758 19.570  10.548 1.00 . B B .  7 VAL HA   1 1 
        2  4117 2 1  7 VAL HB   H  35.559 16.703  10.775 1.00 . B B .  7 VAL HB   1 1 
        2  4118 2 1  7 VAL HG11 H  33.612 18.065   8.901 1.00 . B B .  7 VAL HG11 1 1 
        2  4119 2 1  7 VAL HG12 H  33.199 17.457  10.505 1.00 . B B .  7 VAL HG12 1 1 
        2  4120 2 1  7 VAL HG13 H  33.733 16.340   9.251 1.00 . B B .  7 VAL HG13 1 1 
        2  4121 2 1  7 VAL HG21 H  36.183 18.357   8.317 1.00 . B B .  7 VAL HG21 1 1 
        2  4122 2 1  7 VAL HG22 H  35.977 16.606   8.266 1.00 . B B .  7 VAL HG22 1 1 
        2  4123 2 1  7 VAL HG23 H  37.278 17.311   9.220 1.00 . B B .  7 VAL HG23 1 1 
        2  4124 2 1  7 VAL N    N  36.815 19.466  10.560 1.00 . B B .  7 VAL N    1 1 
        2  4125 2 1  7 VAL O    O  34.344 18.996  12.957 1.00 . B B .  7 VAL O    1 1 
        2  4126 2 1  8 PRO C    C  35.787 19.132  15.277 1.00 . B B .  8 PRO C    1 1 
        2  4127 2 1  8 PRO CA   C  36.342 17.927  14.519 1.00 . B B .  8 PRO CA   1 1 
        2  4128 2 1  8 PRO CB   C  37.808 17.645  14.902 1.00 . B B .  8 PRO CB   1 1 
        2  4129 2 1  8 PRO CD   C  37.707 17.715  12.477 1.00 . B B .  8 PRO CD   1 1 
        2  4130 2 1  8 PRO CG   C  38.415 17.040  13.672 1.00 . B B .  8 PRO CG   1 1 
        2  4131 2 1  8 PRO HA   H  35.739 17.061  14.738 1.00 . B B .  8 PRO HA   1 1 
        2  4132 2 1  8 PRO HB2  H  38.316 18.573  15.159 1.00 . B B .  8 PRO HB2  1 1 
        2  4133 2 1  8 PRO HB3  H  37.861 16.952  15.730 1.00 . B B .  8 PRO HB3  1 1 
        2  4134 2 1  8 PRO HD2  H  38.284 18.553  12.142 1.00 . B B .  8 PRO HD2  1 1 
        2  4135 2 1  8 PRO HD3  H  37.562 17.020  11.668 1.00 . B B .  8 PRO HD3  1 1 
        2  4136 2 1  8 PRO HG2  H  39.487 17.235  13.652 1.00 . B B .  8 PRO HG2  1 1 
        2  4137 2 1  8 PRO HG3  H  38.238 15.972  13.651 1.00 . B B .  8 PRO HG3  1 1 
        2  4138 2 1  8 PRO N    N  36.395 18.152  13.039 1.00 . B B .  8 PRO N    1 1 
        2  4139 2 1  8 PRO O    O  35.287 18.989  16.393 1.00 . B B .  8 PRO O    1 1 
        2  4140 2 1  9 TYR C    C  33.884 21.423  15.557 1.00 . B B .  9 TYR C    1 1 
        2  4141 2 1  9 TYR CA   C  35.392 21.528  15.305 1.00 . B B .  9 TYR CA   1 1 
        2  4142 2 1  9 TYR CB   C  35.681 22.732  14.409 1.00 . B B .  9 TYR CB   1 1 
        2  4143 2 1  9 TYR CD1  C  35.875 24.738  15.933 1.00 . B B .  9 TYR CD1  1 1 
        2  4144 2 1  9 TYR CD2  C  33.798 24.377  14.735 1.00 . B B .  9 TYR CD2  1 1 
        2  4145 2 1  9 TYR CE1  C  35.336 25.890  16.519 1.00 . B B .  9 TYR CE1  1 1 
        2  4146 2 1  9 TYR CE2  C  33.260 25.528  15.322 1.00 . B B .  9 TYR CE2  1 1 
        2  4147 2 1  9 TYR CG   C  35.106 23.981  15.041 1.00 . B B .  9 TYR CG   1 1 
        2  4148 2 1  9 TYR CZ   C  34.028 26.285  16.213 1.00 . B B .  9 TYR CZ   1 1 
        2  4149 2 1  9 TYR H    H  36.294 20.365  13.785 1.00 . B B .  9 TYR H    1 1 
        2  4150 2 1  9 TYR HA   H  35.895 21.667  16.251 1.00 . B B .  9 TYR HA   1 1 
        2  4151 2 1  9 TYR HB2  H  36.750 22.843  14.286 1.00 . B B .  9 TYR HB2  1 1 
        2  4152 2 1  9 TYR HB3  H  35.227 22.576  13.442 1.00 . B B .  9 TYR HB3  1 1 
        2  4153 2 1  9 TYR HD1  H  36.883 24.433  16.170 1.00 . B B .  9 TYR HD1  1 1 
        2  4154 2 1  9 TYR HD2  H  33.204 23.788  14.054 1.00 . B B .  9 TYR HD2  1 1 
        2  4155 2 1  9 TYR HE1  H  35.931 26.473  17.208 1.00 . B B .  9 TYR HE1  1 1 
        2  4156 2 1  9 TYR HE2  H  32.249 25.831  15.082 1.00 . B B .  9 TYR HE2  1 1 
        2  4157 2 1  9 TYR HH   H  34.224 27.948  17.131 1.00 . B B .  9 TYR HH   1 1 
        2  4158 2 1  9 TYR N    N  35.886 20.312  14.674 1.00 . B B .  9 TYR N    1 1 
        2  4159 2 1  9 TYR O    O  33.392 21.862  16.596 1.00 . B B .  9 TYR O    1 1 
        2  4160 2 1  9 TYR OH   O  33.498 27.420  16.792 1.00 . B B .  9 TYR OH   1 1 
        2  4161 2 1 10 PHE C    C  31.377 19.857  15.952 1.00 . B B . 10 PHE C    1 1 
        2  4162 2 1 10 PHE CA   C  31.715 20.702  14.731 1.00 . B B . 10 PHE CA   1 1 
        2  4163 2 1 10 PHE CB   C  31.122 20.044  13.468 1.00 . B B . 10 PHE CB   1 1 
        2  4164 2 1 10 PHE CD1  C  30.176 22.126  12.434 1.00 . B B . 10 PHE CD1  1 1 
        2  4165 2 1 10 PHE CD2  C  31.881 20.918  11.202 1.00 . B B . 10 PHE CD2  1 1 
        2  4166 2 1 10 PHE CE1  C  30.102 23.071  11.403 1.00 . B B . 10 PHE CE1  1 1 
        2  4167 2 1 10 PHE CE2  C  31.806 21.862  10.172 1.00 . B B . 10 PHE CE2  1 1 
        2  4168 2 1 10 PHE CG   C  31.066 21.050  12.333 1.00 . B B . 10 PHE CG   1 1 
        2  4169 2 1 10 PHE CZ   C  30.917 22.939  10.272 1.00 . B B . 10 PHE CZ   1 1 
        2  4170 2 1 10 PHE H    H  33.608 20.517  13.793 1.00 . B B . 10 PHE H    1 1 
        2  4171 2 1 10 PHE HA   H  31.275 21.681  14.860 1.00 . B B . 10 PHE HA   1 1 
        2  4172 2 1 10 PHE HB2  H  31.734 19.200  13.184 1.00 . B B . 10 PHE HB2  1 1 
        2  4173 2 1 10 PHE HB3  H  30.119 19.698  13.677 1.00 . B B . 10 PHE HB3  1 1 
        2  4174 2 1 10 PHE HD1  H  29.553 22.223  13.300 1.00 . B B . 10 PHE HD1  1 1 
        2  4175 2 1 10 PHE HD2  H  32.561 20.087  11.125 1.00 . B B . 10 PHE HD2  1 1 
        2  4176 2 1 10 PHE HE1  H  29.419 23.904  11.482 1.00 . B B . 10 PHE HE1  1 1 
        2  4177 2 1 10 PHE HE2  H  32.435 21.760   9.299 1.00 . B B . 10 PHE HE2  1 1 
        2  4178 2 1 10 PHE HZ   H  30.854 23.665   9.476 1.00 . B B . 10 PHE HZ   1 1 
        2  4179 2 1 10 PHE N    N  33.162 20.849  14.600 1.00 . B B . 10 PHE N    1 1 
        2  4180 2 1 10 PHE O    O  30.449 20.176  16.696 1.00 . B B . 10 PHE O    1 1 
        2  4181 2 1 11 ILE C    C  32.105 18.649  18.596 1.00 . B B . 11 ILE C    1 1 
        2  4182 2 1 11 ILE CA   C  31.880 17.903  17.289 1.00 . B B . 11 ILE CA   1 1 
        2  4183 2 1 11 ILE CB   C  32.823 16.686  17.217 1.00 . B B . 11 ILE CB   1 1 
        2  4184 2 1 11 ILE CD1  C  33.535 14.787  15.727 1.00 . B B . 11 ILE CD1  1 1 
        2  4185 2 1 11 ILE CG1  C  32.451 15.837  15.991 1.00 . B B . 11 ILE CG1  1 1 
        2  4186 2 1 11 ILE CG2  C  32.676 15.829  18.491 1.00 . B B . 11 ILE CG2  1 1 
        2  4187 2 1 11 ILE H    H  32.854 18.574  15.529 1.00 . B B . 11 ILE H    1 1 
        2  4188 2 1 11 ILE HA   H  30.860 17.559  17.253 1.00 . B B . 11 ILE HA   1 1 
        2  4189 2 1 11 ILE HB   H  33.842 17.030  17.130 1.00 . B B . 11 ILE HB   1 1 
        2  4190 2 1 11 ILE HD11 H  33.354 14.321  14.772 1.00 . B B . 11 ILE HD11 1 1 
        2  4191 2 1 11 ILE HD12 H  33.507 14.040  16.504 1.00 . B B . 11 ILE HD12 1 1 
        2  4192 2 1 11 ILE HD13 H  34.506 15.259  15.714 1.00 . B B . 11 ILE HD13 1 1 
        2  4193 2 1 11 ILE HG12 H  31.516 15.343  16.183 1.00 . B B . 11 ILE HG12 1 1 
        2  4194 2 1 11 ILE HG13 H  32.350 16.470  15.119 1.00 . B B . 11 ILE HG13 1 1 
        2  4195 2 1 11 ILE HG21 H  33.178 14.884  18.353 1.00 . B B . 11 ILE HG21 1 1 
        2  4196 2 1 11 ILE HG22 H  31.627 15.652  18.682 1.00 . B B . 11 ILE HG22 1 1 
        2  4197 2 1 11 ILE HG23 H  33.115 16.350  19.333 1.00 . B B . 11 ILE HG23 1 1 
        2  4198 2 1 11 ILE N    N  32.128 18.780  16.154 1.00 . B B . 11 ILE N    1 1 
        2  4199 2 1 11 ILE O    O  31.308 18.551  19.528 1.00 . B B . 11 ILE O    1 1 
        2  4200 2 1 12 GLU C    C  32.325 20.928  20.364 1.00 . B B . 12 GLU C    1 1 
        2  4201 2 1 12 GLU CA   C  33.538 20.134  19.870 1.00 . B B . 12 GLU CA   1 1 
        2  4202 2 1 12 GLU CB   C  34.693 21.098  19.571 1.00 . B B . 12 GLU CB   1 1 
        2  4203 2 1 12 GLU CD   C  36.369 22.648  20.598 1.00 . B B . 12 GLU CD   1 1 
        2  4204 2 1 12 GLU CG   C  35.190 21.718  20.874 1.00 . B B . 12 GLU CG   1 1 
        2  4205 2 1 12 GLU H    H  33.805 19.432  17.885 1.00 . B B . 12 GLU H    1 1 
        2  4206 2 1 12 GLU HA   H  33.845 19.443  20.637 1.00 . B B . 12 GLU HA   1 1 
        2  4207 2 1 12 GLU HB2  H  35.499 20.555  19.099 1.00 . B B . 12 GLU HB2  1 1 
        2  4208 2 1 12 GLU HB3  H  34.350 21.881  18.910 1.00 . B B . 12 GLU HB3  1 1 
        2  4209 2 1 12 GLU HG2  H  34.390 22.278  21.332 1.00 . B B . 12 GLU HG2  1 1 
        2  4210 2 1 12 GLU HG3  H  35.503 20.928  21.539 1.00 . B B . 12 GLU HG3  1 1 
        2  4211 2 1 12 GLU N    N  33.206 19.391  18.660 1.00 . B B . 12 GLU N    1 1 
        2  4212 2 1 12 GLU O    O  32.182 21.167  21.563 1.00 . B B . 12 GLU O    1 1 
        2  4213 2 1 12 GLU OE1  O  36.901 22.591  19.503 1.00 . B B . 12 GLU OE1  1 1 
        2  4214 2 1 12 GLU OE2  O  36.720 23.405  21.489 1.00 . B B . 12 GLU OE2  1 1 
        2  4215 2 1 13 ASN C    C  29.226 21.121  20.454 1.00 . B B . 13 ASN C    1 1 
        2  4216 2 1 13 ASN CA   C  30.244 22.048  19.800 1.00 . B B . 13 ASN CA   1 1 
        2  4217 2 1 13 ASN CB   C  29.637 22.689  18.558 1.00 . B B . 13 ASN CB   1 1 
        2  4218 2 1 13 ASN CG   C  30.679 23.566  17.874 1.00 . B B . 13 ASN CG   1 1 
        2  4219 2 1 13 ASN H    H  31.616 21.091  18.499 1.00 . B B . 13 ASN H    1 1 
        2  4220 2 1 13 ASN HA   H  30.504 22.833  20.501 1.00 . B B . 13 ASN HA   1 1 
        2  4221 2 1 13 ASN HB2  H  29.311 21.918  17.880 1.00 . B B . 13 ASN HB2  1 1 
        2  4222 2 1 13 ASN HB3  H  28.792 23.297  18.845 1.00 . B B . 13 ASN HB3  1 1 
        2  4223 2 1 13 ASN HD21 H  31.708 23.897  19.540 1.00 . B B . 13 ASN HD21 1 1 
        2  4224 2 1 13 ASN HD22 H  32.327 24.640  18.144 1.00 . B B . 13 ASN HD22 1 1 
        2  4225 2 1 13 ASN N    N  31.450 21.311  19.440 1.00 . B B . 13 ASN N    1 1 
        2  4226 2 1 13 ASN ND2  N  31.652 24.078  18.577 1.00 . B B . 13 ASN ND2  1 1 
        2  4227 2 1 13 ASN O    O  28.545 21.498  21.408 1.00 . B B . 13 ASN O    1 1 
        2  4228 2 1 13 ASN OD1  O  30.603 23.792  16.666 1.00 . B B . 13 ASN OD1  1 1 
        2  4229 2 1 14 LEU C    C  28.609 18.448  21.819 1.00 . B B . 14 LEU C    1 1 
        2  4230 2 1 14 LEU CA   C  28.174 18.927  20.440 1.00 . B B . 14 LEU CA   1 1 
        2  4231 2 1 14 LEU CB   C  28.107 17.722  19.487 1.00 . B B . 14 LEU CB   1 1 
        2  4232 2 1 14 LEU CD1  C  28.023 17.012  17.067 1.00 . B B . 14 LEU CD1  1 1 
        2  4233 2 1 14 LEU CD2  C  26.670 18.984  17.840 1.00 . B B . 14 LEU CD2  1 1 
        2  4234 2 1 14 LEU CG   C  27.979 18.207  18.030 1.00 . B B . 14 LEU CG   1 1 
        2  4235 2 1 14 LEU H    H  29.690 19.663  19.165 1.00 . B B . 14 LEU H    1 1 
        2  4236 2 1 14 LEU HA   H  27.198 19.377  20.519 1.00 . B B . 14 LEU HA   1 1 
        2  4237 2 1 14 LEU HB2  H  29.005 17.130  19.586 1.00 . B B . 14 LEU HB2  1 1 
        2  4238 2 1 14 LEU HB3  H  27.248 17.116  19.737 1.00 . B B . 14 LEU HB3  1 1 
        2  4239 2 1 14 LEU HD11 H  28.181 17.373  16.061 1.00 . B B . 14 LEU HD11 1 1 
        2  4240 2 1 14 LEU HD12 H  27.092 16.477  17.110 1.00 . B B . 14 LEU HD12 1 1 
        2  4241 2 1 14 LEU HD13 H  28.832 16.350  17.338 1.00 . B B . 14 LEU HD13 1 1 
        2  4242 2 1 14 LEU HD21 H  25.854 18.445  18.298 1.00 . B B . 14 LEU HD21 1 1 
        2  4243 2 1 14 LEU HD22 H  26.476 19.099  16.788 1.00 . B B . 14 LEU HD22 1 1 
        2  4244 2 1 14 LEU HD23 H  26.759 19.959  18.292 1.00 . B B . 14 LEU HD23 1 1 
        2  4245 2 1 14 LEU HG   H  28.806 18.853  17.801 1.00 . B B . 14 LEU HG   1 1 
        2  4246 2 1 14 LEU N    N  29.120 19.908  19.923 1.00 . B B . 14 LEU N    1 1 
        2  4247 2 1 14 LEU O    O  27.804 18.367  22.746 1.00 . B B . 14 LEU O    1 1 
        2  4248 2 1 15 LYS C    C  30.340 18.739  24.269 1.00 . B B . 15 LYS C    1 1 
        2  4249 2 1 15 LYS CA   C  30.454 17.661  23.198 1.00 . B B . 15 LYS CA   1 1 
        2  4250 2 1 15 LYS CB   C  31.913 17.235  23.021 1.00 . B B . 15 LYS CB   1 1 
        2  4251 2 1 15 LYS CD   C  33.803 15.985  24.114 1.00 . B B . 15 LYS CD   1 1 
        2  4252 2 1 15 LYS CE   C  34.843 17.023  23.674 1.00 . B B . 15 LYS CE   1 1 
        2  4253 2 1 15 LYS CG   C  32.437 16.647  24.338 1.00 . B B . 15 LYS CG   1 1 
        2  4254 2 1 15 LYS H    H  30.489 18.214  21.170 1.00 . B B . 15 LYS H    1 1 
        2  4255 2 1 15 LYS HA   H  29.887 16.804  23.504 1.00 . B B . 15 LYS HA   1 1 
        2  4256 2 1 15 LYS HB2  H  31.978 16.490  22.241 1.00 . B B . 15 LYS HB2  1 1 
        2  4257 2 1 15 LYS HB3  H  32.504 18.096  22.749 1.00 . B B . 15 LYS HB3  1 1 
        2  4258 2 1 15 LYS HD2  H  34.128 15.526  25.037 1.00 . B B . 15 LYS HD2  1 1 
        2  4259 2 1 15 LYS HD3  H  33.709 15.224  23.352 1.00 . B B . 15 LYS HD3  1 1 
        2  4260 2 1 15 LYS HE2  H  34.696 17.269  22.632 1.00 . B B . 15 LYS HE2  1 1 
        2  4261 2 1 15 LYS HE3  H  34.747 17.917  24.273 1.00 . B B . 15 LYS HE3  1 1 
        2  4262 2 1 15 LYS HG2  H  32.536 17.436  25.069 1.00 . B B . 15 LYS HG2  1 1 
        2  4263 2 1 15 LYS HG3  H  31.742 15.907  24.703 1.00 . B B . 15 LYS HG3  1 1 
        2  4264 2 1 15 LYS HZ1  H  36.144 15.535  24.331 1.00 . B B . 15 LYS HZ1  1 1 
        2  4265 2 1 15 LYS HZ2  H  36.785 17.103  24.425 1.00 . B B . 15 LYS HZ2  1 1 
        2  4266 2 1 15 LYS HZ3  H  36.655 16.328  22.919 1.00 . B B . 15 LYS HZ3  1 1 
        2  4267 2 1 15 LYS N    N  29.893 18.129  21.943 1.00 . B B . 15 LYS N    1 1 
        2  4268 2 1 15 LYS NZ   N  36.210 16.454  23.851 1.00 . B B . 15 LYS NZ   1 1 
        2  4269 2 1 15 LYS O    O  30.316 18.455  25.466 1.00 . B B . 15 LYS O    1 1 
        2  4270 2 1 16 GLN C    C  28.900 21.061  25.524 1.00 . B B . 16 GLN C    1 1 
        2  4271 2 1 16 GLN CA   C  30.202 21.116  24.743 1.00 . B B . 16 GLN CA   1 1 
        2  4272 2 1 16 GLN CB   C  30.301 22.435  23.977 1.00 . B B . 16 GLN CB   1 1 
        2  4273 2 1 16 GLN CD   C  30.588 24.906  24.223 1.00 . B B . 16 GLN CD   1 1 
        2  4274 2 1 16 GLN CG   C  30.279 23.607  24.960 1.00 . B B . 16 GLN CG   1 1 
        2  4275 2 1 16 GLN H    H  30.317 20.155  22.855 1.00 . B B . 16 GLN H    1 1 
        2  4276 2 1 16 GLN HA   H  31.015 21.060  25.439 1.00 . B B . 16 GLN HA   1 1 
        2  4277 2 1 16 GLN HB2  H  31.223 22.451  23.414 1.00 . B B . 16 GLN HB2  1 1 
        2  4278 2 1 16 GLN HB3  H  29.468 22.524  23.302 1.00 . B B . 16 GLN HB3  1 1 
        2  4279 2 1 16 GLN HE21 H  29.894 26.067  25.675 1.00 . B B . 16 GLN HE21 1 1 
        2  4280 2 1 16 GLN HE22 H  30.494 26.887  24.315 1.00 . B B . 16 GLN HE22 1 1 
        2  4281 2 1 16 GLN HG2  H  29.299 23.679  25.410 1.00 . B B . 16 GLN HG2  1 1 
        2  4282 2 1 16 GLN HG3  H  31.016 23.447  25.732 1.00 . B B . 16 GLN HG3  1 1 
        2  4283 2 1 16 GLN N    N  30.294 19.990  23.820 1.00 . B B . 16 GLN N    1 1 
        2  4284 2 1 16 GLN NE2  N  30.303 26.048  24.785 1.00 . B B . 16 GLN NE2  1 1 
        2  4285 2 1 16 GLN O    O  28.833 21.528  26.661 1.00 . B B . 16 GLN O    1 1 
        2  4286 2 1 16 GLN OE1  O  31.103 24.879  23.105 1.00 . B B . 16 GLN OE1  1 1 
        2  4287 2 1 17 HIS C    C  26.553 19.206  26.558 1.00 . B B . 17 HIS C    1 1 
        2  4288 2 1 17 HIS CA   C  26.587 20.404  25.600 1.00 . B B . 17 HIS CA   1 1 
        2  4289 2 1 17 HIS CB   C  25.487 20.228  24.566 1.00 . B B . 17 HIS CB   1 1 
        2  4290 2 1 17 HIS CD2  C  23.342 19.107  25.559 1.00 . B B . 17 HIS CD2  1 1 
        2  4291 2 1 17 HIS CE1  C  22.367 20.892  26.306 1.00 . B B . 17 HIS CE1  1 1 
        2  4292 2 1 17 HIS CG   C  24.171 20.164  25.271 1.00 . B B . 17 HIS CG   1 1 
        2  4293 2 1 17 HIS H    H  27.976 20.137  24.007 1.00 . B B . 17 HIS H    1 1 
        2  4294 2 1 17 HIS HA   H  26.390 21.313  26.149 1.00 . B B . 17 HIS HA   1 1 
        2  4295 2 1 17 HIS HB2  H  25.495 21.068  23.882 1.00 . B B . 17 HIS HB2  1 1 
        2  4296 2 1 17 HIS HB3  H  25.651 19.312  24.019 1.00 . B B . 17 HIS HB3  1 1 
        2  4297 2 1 17 HIS HD1  H  23.860 22.212  25.708 1.00 . B B . 17 HIS HD1  1 1 
        2  4298 2 1 17 HIS HD2  H  23.543 18.075  25.312 1.00 . B B . 17 HIS HD2  1 1 
        2  4299 2 1 17 HIS HE1  H  21.677 21.549  26.809 1.00 . B B . 17 HIS HE1  1 1 
        2  4300 2 1 17 HIS HE2  H  21.446 19.038  26.534 1.00 . B B . 17 HIS HE2  1 1 
        2  4301 2 1 17 HIS N    N  27.864 20.493  24.913 1.00 . B B . 17 HIS N    1 1 
        2  4302 2 1 17 HIS ND1  N  23.528 21.291  25.756 1.00 . B B . 17 HIS ND1  1 1 
        2  4303 2 1 17 HIS NE2  N  22.204 19.569  26.213 1.00 . B B . 17 HIS NE2  1 1 
        2  4304 2 1 17 HIS O    O  26.408 19.375  27.769 1.00 . B B . 17 HIS O    1 1 
        2  4305 2 1 18 ILE C    C  27.632 16.920  28.009 1.00 . B B . 18 ILE C    1 1 
        2  4306 2 1 18 ILE CA   C  26.671 16.788  26.823 1.00 . B B . 18 ILE CA   1 1 
        2  4307 2 1 18 ILE CB   C  27.070 15.561  25.951 1.00 . B B . 18 ILE CB   1 1 
        2  4308 2 1 18 ILE CD1  C  29.001 14.395  24.776 1.00 . B B . 18 ILE CD1  1 1 
        2  4309 2 1 18 ILE CG1  C  28.615 15.463  25.810 1.00 . B B . 18 ILE CG1  1 1 
        2  4310 2 1 18 ILE CG2  C  26.428 15.700  24.557 1.00 . B B . 18 ILE CG2  1 1 
        2  4311 2 1 18 ILE H    H  26.811 17.932  25.035 1.00 . B B . 18 ILE H    1 1 
        2  4312 2 1 18 ILE HA   H  25.665 16.642  27.198 1.00 . B B . 18 ILE HA   1 1 
        2  4313 2 1 18 ILE HB   H  26.700 14.663  26.424 1.00 . B B . 18 ILE HB   1 1 
        2  4314 2 1 18 ILE HD11 H  28.757 14.741  23.783 1.00 . B B . 18 ILE HD11 1 1 
        2  4315 2 1 18 ILE HD12 H  28.458 13.485  24.983 1.00 . B B . 18 ILE HD12 1 1 
        2  4316 2 1 18 ILE HD13 H  30.064 14.200  24.836 1.00 . B B . 18 ILE HD13 1 1 
        2  4317 2 1 18 ILE HG12 H  29.004 16.419  25.516 1.00 . B B . 18 ILE HG12 1 1 
        2  4318 2 1 18 ILE HG13 H  29.048 15.189  26.762 1.00 . B B . 18 ILE HG13 1 1 
        2  4319 2 1 18 ILE HG21 H  25.403 16.015  24.658 1.00 . B B . 18 ILE HG21 1 1 
        2  4320 2 1 18 ILE HG22 H  26.460 14.746  24.052 1.00 . B B . 18 ILE HG22 1 1 
        2  4321 2 1 18 ILE HG23 H  26.972 16.432  23.976 1.00 . B B . 18 ILE HG23 1 1 
        2  4322 2 1 18 ILE N    N  26.698 18.005  26.007 1.00 . B B . 18 ILE N    1 1 
        2  4323 2 1 18 ILE O    O  27.354 16.455  29.114 1.00 . B B . 18 ILE O    1 1 
        2  4324 2 1 19 GLU C    C  29.323 18.801  29.803 1.00 . B B . 19 GLU C    1 1 
        2  4325 2 1 19 GLU CA   C  29.772 17.745  28.807 1.00 . B B . 19 GLU CA   1 1 
        2  4326 2 1 19 GLU CB   C  31.102 18.173  28.166 1.00 . B B . 19 GLU CB   1 1 
        2  4327 2 1 19 GLU CD   C  33.549 18.570  28.588 1.00 . B B . 19 GLU CD   1 1 
        2  4328 2 1 19 GLU CG   C  32.198 18.274  29.233 1.00 . B B . 19 GLU CG   1 1 
        2  4329 2 1 19 GLU H    H  28.935 17.913  26.859 1.00 . B B . 19 GLU H    1 1 
        2  4330 2 1 19 GLU HA   H  29.919 16.809  29.324 1.00 . B B . 19 GLU HA   1 1 
        2  4331 2 1 19 GLU HB2  H  31.389 17.445  27.422 1.00 . B B . 19 GLU HB2  1 1 
        2  4332 2 1 19 GLU HB3  H  30.974 19.136  27.692 1.00 . B B . 19 GLU HB3  1 1 
        2  4333 2 1 19 GLU HG2  H  31.957 19.069  29.922 1.00 . B B . 19 GLU HG2  1 1 
        2  4334 2 1 19 GLU HG3  H  32.262 17.341  29.771 1.00 . B B . 19 GLU HG3  1 1 
        2  4335 2 1 19 GLU N    N  28.768 17.564  27.759 1.00 . B B . 19 GLU N    1 1 
        2  4336 2 1 19 GLU O    O  29.243 18.537  31.003 1.00 . B B . 19 GLU O    1 1 
        2  4337 2 1 19 GLU OE1  O  33.576 18.918  27.420 1.00 . B B . 19 GLU OE1  1 1 
        2  4338 2 1 19 GLU OE2  O  34.542 18.438  29.284 1.00 . B B . 19 GLU OE2  1 1 
        2  4339 2 1 20 MET C    C  27.036 21.237  30.049 1.00 . B B . 20 MET C    1 1 
        2  4340 2 1 20 MET CA   C  28.557 21.092  30.153 1.00 . B B . 20 MET CA   1 1 
        2  4341 2 1 20 MET CB   C  29.251 22.408  29.735 1.00 . B B . 20 MET CB   1 1 
        2  4342 2 1 20 MET CE   C  33.134 21.821  28.413 1.00 . B B . 20 MET CE   1 1 
        2  4343 2 1 20 MET CG   C  30.793 22.249  29.715 1.00 . B B . 20 MET CG   1 1 
        2  4344 2 1 20 MET H    H  29.098 20.145  28.338 1.00 . B B . 20 MET H    1 1 
        2  4345 2 1 20 MET HA   H  28.810 20.885  31.186 1.00 . B B . 20 MET HA   1 1 
        2  4346 2 1 20 MET HB2  H  28.904 22.691  28.752 1.00 . B B . 20 MET HB2  1 1 
        2  4347 2 1 20 MET HB3  H  28.979 23.183  30.439 1.00 . B B . 20 MET HB3  1 1 
        2  4348 2 1 20 MET HE1  H  33.313 21.157  29.246 1.00 . B B . 20 MET HE1  1 1 
        2  4349 2 1 20 MET HE2  H  33.467 22.820  28.663 1.00 . B B . 20 MET HE2  1 1 
        2  4350 2 1 20 MET HE3  H  33.679 21.469  27.551 1.00 . B B . 20 MET HE3  1 1 
        2  4351 2 1 20 MET HG2  H  31.256 23.176  30.024 1.00 . B B . 20 MET HG2  1 1 
        2  4352 2 1 20 MET HG3  H  31.097 21.462  30.391 1.00 . B B . 20 MET HG3  1 1 
        2  4353 2 1 20 MET N    N  29.016 19.992  29.302 1.00 . B B . 20 MET N    1 1 
        2  4354 2 1 20 MET O    O  26.295 20.314  30.386 1.00 . B B . 20 MET O    1 1 
        2  4355 2 1 20 MET SD   S  31.364 21.850  28.040 1.00 . B B . 20 MET SD   1 1 
        2  4356 2 1 21 ASN C    C  24.915 24.031  28.853 1.00 . B B . 21 ASN C    1 1 
        2  4357 2 1 21 ASN CA   C  25.151 22.658  29.468 1.00 . B B . 21 ASN CA   1 1 
        2  4358 2 1 21 ASN CB   C  24.484 22.593  30.845 1.00 . B B . 21 ASN CB   1 1 
        2  4359 2 1 21 ASN CG   C  25.220 23.507  31.822 1.00 . B B . 21 ASN CG   1 1 
        2  4360 2 1 21 ASN H    H  27.219 23.102  29.348 1.00 . B B . 21 ASN H    1 1 
        2  4361 2 1 21 ASN HA   H  24.707 21.906  28.821 1.00 . B B . 21 ASN HA   1 1 
        2  4362 2 1 21 ASN HB2  H  23.455 22.911  30.765 1.00 . B B . 21 ASN HB2  1 1 
        2  4363 2 1 21 ASN HB3  H  24.514 21.582  31.214 1.00 . B B . 21 ASN HB3  1 1 
        2  4364 2 1 21 ASN HD21 H  23.760 23.472  33.165 1.00 . B B . 21 ASN HD21 1 1 
        2  4365 2 1 21 ASN HD22 H  25.112 24.407  33.587 1.00 . B B . 21 ASN HD22 1 1 
        2  4366 2 1 21 ASN N    N  26.582 22.403  29.601 1.00 . B B . 21 ASN N    1 1 
        2  4367 2 1 21 ASN ND2  N  24.648 23.821  32.952 1.00 . B B . 21 ASN ND2  1 1 
        2  4368 2 1 21 ASN O    O  24.516 24.967  29.546 1.00 . B B . 21 ASN O    1 1 
        2  4369 2 1 21 ASN OD1  O  26.335 23.950  31.548 1.00 . B B . 21 ASN OD1  1 1 
        2  4370 2 1 22 GLN C    C  23.483 25.633  26.551 1.00 . B B . 22 GLN C    1 1 
        2  4371 2 1 22 GLN CA   C  24.962 25.419  26.861 1.00 . B B . 22 GLN CA   1 1 
        2  4372 2 1 22 GLN CB   C  25.776 25.436  25.562 1.00 . B B . 22 GLN CB   1 1 
        2  4373 2 1 22 GLN CD   C  26.596 26.892  23.697 1.00 . B B . 22 GLN CD   1 1 
        2  4374 2 1 22 GLN CG   C  25.657 26.810  24.897 1.00 . B B . 22 GLN CG   1 1 
        2  4375 2 1 22 GLN H    H  25.473 23.365  27.049 1.00 . B B . 22 GLN H    1 1 
        2  4376 2 1 22 GLN HA   H  25.306 26.225  27.496 1.00 . B B . 22 GLN HA   1 1 
        2  4377 2 1 22 GLN HB2  H  26.813 25.235  25.789 1.00 . B B . 22 GLN HB2  1 1 
        2  4378 2 1 22 GLN HB3  H  25.401 24.678  24.890 1.00 . B B . 22 GLN HB3  1 1 
        2  4379 2 1 22 GLN HE21 H  27.637 28.415  24.432 1.00 . B B . 22 GLN HE21 1 1 
        2  4380 2 1 22 GLN HE22 H  28.145 27.856  22.912 1.00 . B B . 22 GLN HE22 1 1 
        2  4381 2 1 22 GLN HG2  H  24.642 26.963  24.565 1.00 . B B . 22 GLN HG2  1 1 
        2  4382 2 1 22 GLN HG3  H  25.922 27.577  25.609 1.00 . B B . 22 GLN HG3  1 1 
        2  4383 2 1 22 GLN N    N  25.155 24.145  27.550 1.00 . B B . 22 GLN N    1 1 
        2  4384 2 1 22 GLN NE2  N  27.537 27.796  23.678 1.00 . B B . 22 GLN NE2  1 1 
        2  4385 2 1 22 GLN O    O  22.816 26.463  27.167 1.00 . B B . 22 GLN O    1 1 
        2  4386 2 1 22 GLN OE1  O  26.466 26.116  22.750 1.00 . B B . 22 GLN OE1  1 1 
        2  4387 2 1 23 SER C    C  21.213 23.894  24.201 1.00 . B B . 23 SER C    1 1 
        2  4388 2 1 23 SER CA   C  21.578 24.984  25.201 1.00 . B B . 23 SER CA   1 1 
        2  4389 2 1 23 SER CB   C  21.316 26.359  24.580 1.00 . B B . 23 SER CB   1 1 
        2  4390 2 1 23 SER H    H  23.560 24.227  25.128 1.00 . B B . 23 SER H    1 1 
        2  4391 2 1 23 SER HA   H  20.963 24.876  26.082 1.00 . B B . 23 SER HA   1 1 
        2  4392 2 1 23 SER HB2  H  20.323 26.388  24.164 1.00 . B B . 23 SER HB2  1 1 
        2  4393 2 1 23 SER HB3  H  21.405 27.122  25.341 1.00 . B B . 23 SER HB3  1 1 
        2  4394 2 1 23 SER HG   H  22.284 27.534  23.368 1.00 . B B . 23 SER HG   1 1 
        2  4395 2 1 23 SER N    N  22.980 24.872  25.584 1.00 . B B . 23 SER N    1 1 
        2  4396 2 1 23 SER O    O  21.252 24.118  22.990 1.00 . B B . 23 SER O    1 1 
        2  4397 2 1 23 SER OG   O  22.263 26.591  23.545 1.00 . B B . 23 SER OG   1 1 
        2  4398 2 1 24 GLU C    C  19.894 20.444  24.655 1.00 . B B . 24 GLU C    1 1 
        2  4399 2 1 24 GLU CA   C  20.499 21.599  23.833 1.00 . B B . 24 GLU CA   1 1 
        2  4400 2 1 24 GLU CB   C  21.755 21.142  23.045 1.00 . B B . 24 GLU CB   1 1 
        2  4401 2 1 24 GLU CD   C  20.915 21.729  20.752 1.00 . B B . 24 GLU CD   1 1 
        2  4402 2 1 24 GLU CG   C  21.382 20.591  21.658 1.00 . B B . 24 GLU CG   1 1 
        2  4403 2 1 24 GLU H    H  20.849 22.596  25.680 1.00 . B B . 24 GLU H    1 1 
        2  4404 2 1 24 GLU HA   H  19.747 21.943  23.134 1.00 . B B . 24 GLU HA   1 1 
        2  4405 2 1 24 GLU HB2  H  22.424 21.979  22.928 1.00 . B B . 24 GLU HB2  1 1 
        2  4406 2 1 24 GLU HB3  H  22.266 20.381  23.589 1.00 . B B . 24 GLU HB3  1 1 
        2  4407 2 1 24 GLU HG2  H  22.260 20.127  21.223 1.00 . B B . 24 GLU HG2  1 1 
        2  4408 2 1 24 GLU HG3  H  20.592 19.859  21.758 1.00 . B B . 24 GLU HG3  1 1 
        2  4409 2 1 24 GLU N    N  20.863 22.717  24.707 1.00 . B B . 24 GLU N    1 1 
        2  4410 2 1 24 GLU O    O  19.049 20.673  25.521 1.00 . B B . 24 GLU O    1 1 
        2  4411 2 1 24 GLU OE1  O  21.435 22.821  20.914 1.00 . B B . 24 GLU OE1  1 1 
        2  4412 2 1 24 GLU OE2  O  20.062 21.498  19.912 1.00 . B B . 24 GLU OE2  1 1 
        2  4413 2 1 25 ASP C    C  20.955 17.109  25.481 1.00 . B B . 25 ASP C    1 1 
        2  4414 2 1 25 ASP CA   C  19.810 18.034  25.088 1.00 . B B . 25 ASP CA   1 1 
        2  4415 2 1 25 ASP CB   C  18.824 17.281  24.180 1.00 . B B . 25 ASP CB   1 1 
        2  4416 2 1 25 ASP CG   C  17.585 18.138  23.935 1.00 . B B . 25 ASP CG   1 1 
        2  4417 2 1 25 ASP H    H  21.003 19.097  23.675 1.00 . B B . 25 ASP H    1 1 
        2  4418 2 1 25 ASP HA   H  19.287 18.336  25.992 1.00 . B B . 25 ASP HA   1 1 
        2  4419 2 1 25 ASP HB2  H  19.305 17.059  23.235 1.00 . B B . 25 ASP HB2  1 1 
        2  4420 2 1 25 ASP HB3  H  18.526 16.354  24.655 1.00 . B B . 25 ASP HB3  1 1 
        2  4421 2 1 25 ASP N    N  20.329 19.219  24.374 1.00 . B B . 25 ASP N    1 1 
        2  4422 2 1 25 ASP O    O  21.594 17.303  26.515 1.00 . B B . 25 ASP O    1 1 
        2  4423 2 1 25 ASP OD1  O  17.347 19.038  24.723 1.00 . B B . 25 ASP OD1  1 1 
        2  4424 2 1 25 ASP OD2  O  16.888 17.877  22.968 1.00 . B B . 25 ASP OD2  1 1 
        2  4425 2 1 26 LYS C    C  22.638 14.382  23.659 1.00 . B B . 26 LYS C    1 1 
        2  4426 2 1 26 LYS CA   C  22.287 15.166  24.925 1.00 . B B . 26 LYS CA   1 1 
        2  4427 2 1 26 LYS CB   C  21.884 14.229  26.063 1.00 . B B . 26 LYS CB   1 1 
        2  4428 2 1 26 LYS CD   C  22.650 12.446  27.617 1.00 . B B . 26 LYS CD   1 1 
        2  4429 2 1 26 LYS CE   C  23.839 11.595  28.053 1.00 . B B . 26 LYS CE   1 1 
        2  4430 2 1 26 LYS CG   C  23.074 13.358  26.466 1.00 . B B . 26 LYS CG   1 1 
        2  4431 2 1 26 LYS H    H  20.667 15.995  23.843 1.00 . B B . 26 LYS H    1 1 
        2  4432 2 1 26 LYS HA   H  23.159 15.720  25.233 1.00 . B B . 26 LYS HA   1 1 
        2  4433 2 1 26 LYS HB2  H  21.582 14.825  26.914 1.00 . B B . 26 LYS HB2  1 1 
        2  4434 2 1 26 LYS HB3  H  21.064 13.605  25.752 1.00 . B B . 26 LYS HB3  1 1 
        2  4435 2 1 26 LYS HD2  H  22.308 13.047  28.448 1.00 . B B . 26 LYS HD2  1 1 
        2  4436 2 1 26 LYS HD3  H  21.850 11.799  27.287 1.00 . B B . 26 LYS HD3  1 1 
        2  4437 2 1 26 LYS HE2  H  24.157 10.973  27.229 1.00 . B B . 26 LYS HE2  1 1 
        2  4438 2 1 26 LYS HE3  H  24.650 12.241  28.352 1.00 . B B . 26 LYS HE3  1 1 
        2  4439 2 1 26 LYS HG2  H  23.387 12.757  25.623 1.00 . B B . 26 LYS HG2  1 1 
        2  4440 2 1 26 LYS HG3  H  23.893 13.990  26.786 1.00 . B B . 26 LYS HG3  1 1 
        2  4441 2 1 26 LYS HZ1  H  22.737 11.236  29.781 1.00 . B B . 26 LYS HZ1  1 1 
        2  4442 2 1 26 LYS HZ2  H  24.275 10.522  29.780 1.00 . B B . 26 LYS HZ2  1 1 
        2  4443 2 1 26 LYS HZ3  H  23.028  9.848  28.844 1.00 . B B . 26 LYS HZ3  1 1 
        2  4444 2 1 26 LYS N    N  21.209 16.100  24.653 1.00 . B B . 26 LYS N    1 1 
        2  4445 2 1 26 LYS NZ   N  23.440 10.736  29.202 1.00 . B B . 26 LYS NZ   1 1 
        2  4446 2 1 26 LYS O    O  23.365 14.882  22.800 1.00 . B B . 26 LYS O    1 1 
        2  4447 2 1 27 ILE C    C  21.796 12.968  21.138 1.00 . B B . 27 ILE C    1 1 
        2  4448 2 1 27 ILE CA   C  22.406 12.333  22.384 1.00 . B B . 27 ILE CA   1 1 
        2  4449 2 1 27 ILE CB   C  21.853 10.903  22.599 1.00 . B B . 27 ILE CB   1 1 
        2  4450 2 1 27 ILE CD1  C  23.984  9.472  22.704 1.00 . B B . 27 ILE CD1  1 1 
        2  4451 2 1 27 ILE CG1  C  22.817 10.087  23.506 1.00 . B B . 27 ILE CG1  1 1 
        2  4452 2 1 27 ILE CG2  C  21.654 10.182  21.245 1.00 . B B . 27 ILE CG2  1 1 
        2  4453 2 1 27 ILE H    H  21.557 12.813  24.271 1.00 . B B . 27 ILE H    1 1 
        2  4454 2 1 27 ILE HA   H  23.475 12.284  22.242 1.00 . B B . 27 ILE HA   1 1 
        2  4455 2 1 27 ILE HB   H  20.892 10.985  23.089 1.00 . B B . 27 ILE HB   1 1 
        2  4456 2 1 27 ILE HD11 H  24.335 10.166  21.956 1.00 . B B . 27 ILE HD11 1 1 
        2  4457 2 1 27 ILE HD12 H  23.647  8.567  22.220 1.00 . B B . 27 ILE HD12 1 1 
        2  4458 2 1 27 ILE HD13 H  24.790  9.236  23.380 1.00 . B B . 27 ILE HD13 1 1 
        2  4459 2 1 27 ILE HG12 H  23.224 10.735  24.271 1.00 . B B . 27 ILE HG12 1 1 
        2  4460 2 1 27 ILE HG13 H  22.264  9.291  23.980 1.00 . B B . 27 ILE HG13 1 1 
        2  4461 2 1 27 ILE HG21 H  20.760 10.554  20.763 1.00 . B B . 27 ILE HG21 1 1 
        2  4462 2 1 27 ILE HG22 H  21.556  9.119  21.407 1.00 . B B . 27 ILE HG22 1 1 
        2  4463 2 1 27 ILE HG23 H  22.508 10.375  20.615 1.00 . B B . 27 ILE HG23 1 1 
        2  4464 2 1 27 ILE N    N  22.129 13.159  23.556 1.00 . B B . 27 ILE N    1 1 
        2  4465 2 1 27 ILE O    O  22.411 12.951  20.071 1.00 . B B . 27 ILE O    1 1 
        2  4466 2 1 28 HIS C    C  20.593 15.429  19.750 1.00 . B B . 28 HIS C    1 1 
        2  4467 2 1 28 HIS CA   C  19.915 14.119  20.128 1.00 . B B . 28 HIS CA   1 1 
        2  4468 2 1 28 HIS CB   C  18.451 14.374  20.475 1.00 . B B . 28 HIS CB   1 1 
        2  4469 2 1 28 HIS CD2  C  17.566 12.640  22.238 1.00 . B B . 28 HIS CD2  1 1 
        2  4470 2 1 28 HIS CE1  C  16.890 11.108  20.863 1.00 . B B . 28 HIS CE1  1 1 
        2  4471 2 1 28 HIS CG   C  17.834 13.096  20.970 1.00 . B B . 28 HIS CG   1 1 
        2  4472 2 1 28 HIS H    H  20.146 13.491  22.143 1.00 . B B . 28 HIS H    1 1 
        2  4473 2 1 28 HIS HA   H  19.959 13.446  19.284 1.00 . B B . 28 HIS HA   1 1 
        2  4474 2 1 28 HIS HB2  H  18.387 15.130  21.245 1.00 . B B . 28 HIS HB2  1 1 
        2  4475 2 1 28 HIS HB3  H  17.925 14.710  19.594 1.00 . B B . 28 HIS HB3  1 1 
        2  4476 2 1 28 HIS HD1  H  17.446 12.118  19.131 1.00 . B B . 28 HIS HD1  1 1 
        2  4477 2 1 28 HIS HD2  H  17.792 13.171  23.150 1.00 . B B . 28 HIS HD2  1 1 
        2  4478 2 1 28 HIS HE1  H  16.477 10.193  20.462 1.00 . B B . 28 HIS HE1  1 1 
        2  4479 2 1 28 HIS HE2  H  16.680 10.820  22.915 1.00 . B B . 28 HIS HE2  1 1 
        2  4480 2 1 28 HIS N    N  20.588 13.507  21.268 1.00 . B B . 28 HIS N    1 1 
        2  4481 2 1 28 HIS ND1  N  17.393 12.102  20.110 1.00 . B B . 28 HIS ND1  1 1 
        2  4482 2 1 28 HIS NE2  N  16.970 11.385  22.167 1.00 . B B . 28 HIS NE2  1 1 
        2  4483 2 1 28 HIS O    O  20.356 15.972  18.672 1.00 . B B . 28 HIS O    1 1 
        2  4484 2 1 29 ALA C    C  22.690 17.243  18.974 1.00 . B B . 29 ALA C    1 1 
        2  4485 2 1 29 ALA CA   C  22.138 17.200  20.399 1.00 . B B . 29 ALA CA   1 1 
        2  4486 2 1 29 ALA CB   C  23.305 17.339  21.384 1.00 . B B . 29 ALA CB   1 1 
        2  4487 2 1 29 ALA H    H  21.585 15.461  21.488 1.00 . B B . 29 ALA H    1 1 
        2  4488 2 1 29 ALA HA   H  21.456 18.018  20.539 1.00 . B B . 29 ALA HA   1 1 
        2  4489 2 1 29 ALA HB1  H  22.936 17.258  22.395 1.00 . B B . 29 ALA HB1  1 1 
        2  4490 2 1 29 ALA HB2  H  23.779 18.300  21.250 1.00 . B B . 29 ALA HB2  1 1 
        2  4491 2 1 29 ALA HB3  H  24.026 16.556  21.199 1.00 . B B . 29 ALA HB3  1 1 
        2  4492 2 1 29 ALA N    N  21.434 15.937  20.646 1.00 . B B . 29 ALA N    1 1 
        2  4493 2 1 29 ALA O    O  22.617 18.274  18.305 1.00 . B B . 29 ALA O    1 1 
        2  4494 2 1 30 MET C    C  22.617 16.186  16.152 1.00 . B B . 30 MET C    1 1 
        2  4495 2 1 30 MET CA   C  23.752 16.034  17.158 1.00 . B B . 30 MET CA   1 1 
        2  4496 2 1 30 MET CB   C  24.449 14.670  16.936 1.00 . B B . 30 MET CB   1 1 
        2  4497 2 1 30 MET CE   C  22.606 11.243  17.363 1.00 . B B . 30 MET CE   1 1 
        2  4498 2 1 30 MET CG   C  23.839 13.632  17.878 1.00 . B B . 30 MET CG   1 1 
        2  4499 2 1 30 MET H    H  23.253 15.325  19.087 1.00 . B B . 30 MET H    1 1 
        2  4500 2 1 30 MET HA   H  24.465 16.832  17.007 1.00 . B B . 30 MET HA   1 1 
        2  4501 2 1 30 MET HB2  H  24.316 14.344  15.911 1.00 . B B . 30 MET HB2  1 1 
        2  4502 2 1 30 MET HB3  H  25.505 14.757  17.142 1.00 . B B . 30 MET HB3  1 1 
        2  4503 2 1 30 MET HE1  H  22.647 10.243  16.970 1.00 . B B . 30 MET HE1  1 1 
        2  4504 2 1 30 MET HE2  H  21.929 11.841  16.768 1.00 . B B . 30 MET HE2  1 1 
        2  4505 2 1 30 MET HE3  H  22.255 11.219  18.380 1.00 . B B . 30 MET HE3  1 1 
        2  4506 2 1 30 MET HG2  H  24.229 13.785  18.870 1.00 . B B . 30 MET HG2  1 1 
        2  4507 2 1 30 MET HG3  H  22.766 13.752  17.891 1.00 . B B . 30 MET HG3  1 1 
        2  4508 2 1 30 MET N    N  23.221 16.116  18.510 1.00 . B B . 30 MET N    1 1 
        2  4509 2 1 30 MET O    O  22.742 16.965  15.206 1.00 . B B . 30 MET O    1 1 
        2  4510 2 1 30 MET SD   S  24.266 11.970  17.308 1.00 . B B . 30 MET SD   1 1 
        2  4511 2 1 31 ASN C    C  19.904 16.959  15.285 1.00 . B B . 31 ASN C    1 1 
        2  4512 2 1 31 ASN CA   C  20.414 15.522  15.406 1.00 . B B . 31 ASN CA   1 1 
        2  4513 2 1 31 ASN CB   C  19.278 14.614  15.887 1.00 . B B . 31 ASN CB   1 1 
        2  4514 2 1 31 ASN CG   C  18.153 14.592  14.860 1.00 . B B . 31 ASN CG   1 1 
        2  4515 2 1 31 ASN H    H  21.485 14.845  17.114 1.00 . B B . 31 ASN H    1 1 
        2  4516 2 1 31 ASN HA   H  20.746 15.183  14.438 1.00 . B B . 31 ASN HA   1 1 
        2  4517 2 1 31 ASN HB2  H  19.656 13.609  16.024 1.00 . B B . 31 ASN HB2  1 1 
        2  4518 2 1 31 ASN HB3  H  18.895 14.983  16.827 1.00 . B B . 31 ASN HB3  1 1 
        2  4519 2 1 31 ASN HD21 H  17.763 12.664  15.126 1.00 . B B . 31 ASN HD21 1 1 
        2  4520 2 1 31 ASN HD22 H  16.789 13.450  13.979 1.00 . B B . 31 ASN HD22 1 1 
        2  4521 2 1 31 ASN N    N  21.528 15.448  16.343 1.00 . B B . 31 ASN N    1 1 
        2  4522 2 1 31 ASN ND2  N  17.516 13.476  14.636 1.00 . B B . 31 ASN ND2  1 1 
        2  4523 2 1 31 ASN O    O  19.723 17.473  14.181 1.00 . B B . 31 ASN O    1 1 
        2  4524 2 1 31 ASN OD1  O  17.843 15.614  14.246 1.00 . B B . 31 ASN OD1  1 1 
        2  4525 2 1 32 SER C    C  20.212 19.918  15.761 1.00 . B B . 32 SER C    1 1 
        2  4526 2 1 32 SER CA   C  19.197 18.979  16.425 1.00 . B B . 32 SER CA   1 1 
        2  4527 2 1 32 SER CB   C  18.940 19.432  17.862 1.00 . B B . 32 SER CB   1 1 
        2  4528 2 1 32 SER H    H  19.843 17.141  17.277 1.00 . B B . 32 SER H    1 1 
        2  4529 2 1 32 SER HA   H  18.268 19.024  15.876 1.00 . B B . 32 SER HA   1 1 
        2  4530 2 1 32 SER HB2  H  18.213 18.782  18.320 1.00 . B B . 32 SER HB2  1 1 
        2  4531 2 1 32 SER HB3  H  19.866 19.385  18.422 1.00 . B B . 32 SER HB3  1 1 
        2  4532 2 1 32 SER HG   H  19.190 21.358  17.927 1.00 . B B . 32 SER HG   1 1 
        2  4533 2 1 32 SER N    N  19.681 17.601  16.426 1.00 . B B . 32 SER N    1 1 
        2  4534 2 1 32 SER O    O  19.857 20.778  14.956 1.00 . B B . 32 SER O    1 1 
        2  4535 2 1 32 SER OG   O  18.441 20.761  17.856 1.00 . B B . 32 SER OG   1 1 
        2  4536 2 1 33 TYR C    C  22.849 20.174  14.120 1.00 . B B . 33 TYR C    1 1 
        2  4537 2 1 33 TYR CA   C  22.550 20.564  15.569 1.00 . B B . 33 TYR CA   1 1 
        2  4538 2 1 33 TYR CB   C  23.809 20.392  16.423 1.00 . B B . 33 TYR CB   1 1 
        2  4539 2 1 33 TYR CD1  C  25.761 20.706  14.863 1.00 . B B . 33 TYR CD1  1 1 
        2  4540 2 1 33 TYR CD2  C  25.090 22.559  16.277 1.00 . B B . 33 TYR CD2  1 1 
        2  4541 2 1 33 TYR CE1  C  26.780 21.495  14.314 1.00 . B B . 33 TYR CE1  1 1 
        2  4542 2 1 33 TYR CE2  C  26.109 23.346  15.729 1.00 . B B . 33 TYR CE2  1 1 
        2  4543 2 1 33 TYR CG   C  24.916 21.238  15.845 1.00 . B B . 33 TYR CG   1 1 
        2  4544 2 1 33 TYR CZ   C  26.954 22.815  14.746 1.00 . B B . 33 TYR CZ   1 1 
        2  4545 2 1 33 TYR H    H  21.703 19.037  16.765 1.00 . B B . 33 TYR H    1 1 
        2  4546 2 1 33 TYR HA   H  22.251 21.604  15.598 1.00 . B B . 33 TYR HA   1 1 
        2  4547 2 1 33 TYR HB2  H  23.599 20.704  17.438 1.00 . B B . 33 TYR HB2  1 1 
        2  4548 2 1 33 TYR HB3  H  24.105 19.350  16.423 1.00 . B B . 33 TYR HB3  1 1 
        2  4549 2 1 33 TYR HD1  H  25.624 19.684  14.533 1.00 . B B . 33 TYR HD1  1 1 
        2  4550 2 1 33 TYR HD2  H  24.440 22.966  17.035 1.00 . B B . 33 TYR HD2  1 1 
        2  4551 2 1 33 TYR HE1  H  27.432 21.077  13.557 1.00 . B B . 33 TYR HE1  1 1 
        2  4552 2 1 33 TYR HE2  H  26.248 24.363  16.063 1.00 . B B . 33 TYR HE2  1 1 
        2  4553 2 1 33 TYR HH   H  27.658 24.522  14.278 1.00 . B B . 33 TYR HH   1 1 
        2  4554 2 1 33 TYR N    N  21.480 19.739  16.119 1.00 . B B . 33 TYR N    1 1 
        2  4555 2 1 33 TYR O    O  22.969 21.024  13.239 1.00 . B B . 33 TYR O    1 1 
        2  4556 2 1 33 TYR OH   O  27.943 23.608  14.209 1.00 . B B . 33 TYR OH   1 1 
        2  4557 2 1 34 TYR C    C  22.319 18.971  11.542 1.00 . B B . 34 TYR C    1 1 
        2  4558 2 1 34 TYR CA   C  23.258 18.346  12.561 1.00 . B B . 34 TYR CA   1 1 
        2  4559 2 1 34 TYR CB   C  23.106 16.813  12.550 1.00 . B B . 34 TYR CB   1 1 
        2  4560 2 1 34 TYR CD1  C  22.428 16.220  10.191 1.00 . B B . 34 TYR CD1  1 1 
        2  4561 2 1 34 TYR CD2  C  24.722 15.840  10.879 1.00 . B B . 34 TYR CD2  1 1 
        2  4562 2 1 34 TYR CE1  C  22.733 15.742   8.911 1.00 . B B . 34 TYR CE1  1 1 
        2  4563 2 1 34 TYR CE2  C  25.027 15.362   9.598 1.00 . B B . 34 TYR CE2  1 1 
        2  4564 2 1 34 TYR CG   C  23.423 16.269  11.174 1.00 . B B . 34 TYR CG   1 1 
        2  4565 2 1 34 TYR CZ   C  24.033 15.313   8.614 1.00 . B B . 34 TYR CZ   1 1 
        2  4566 2 1 34 TYR H    H  22.864 18.238  14.631 1.00 . B B . 34 TYR H    1 1 
        2  4567 2 1 34 TYR HA   H  24.271 18.598  12.301 1.00 . B B . 34 TYR HA   1 1 
        2  4568 2 1 34 TYR HB2  H  23.790 16.383  13.267 1.00 . B B . 34 TYR HB2  1 1 
        2  4569 2 1 34 TYR HB3  H  22.092 16.552  12.819 1.00 . B B . 34 TYR HB3  1 1 
        2  4570 2 1 34 TYR HD1  H  21.425 16.550  10.420 1.00 . B B . 34 TYR HD1  1 1 
        2  4571 2 1 34 TYR HD2  H  25.491 15.873  11.642 1.00 . B B . 34 TYR HD2  1 1 
        2  4572 2 1 34 TYR HE1  H  21.966 15.703   8.153 1.00 . B B . 34 TYR HE1  1 1 
        2  4573 2 1 34 TYR HE2  H  26.028 15.033   9.370 1.00 . B B . 34 TYR HE2  1 1 
        2  4574 2 1 34 TYR HH   H  25.249 15.049   7.168 1.00 . B B . 34 TYR HH   1 1 
        2  4575 2 1 34 TYR N    N  22.968 18.870  13.889 1.00 . B B . 34 TYR N    1 1 
        2  4576 2 1 34 TYR O    O  22.735 19.317  10.437 1.00 . B B . 34 TYR O    1 1 
        2  4577 2 1 34 TYR OH   O  24.329 14.844   7.352 1.00 . B B . 34 TYR OH   1 1 
        2  4578 2 1 35 ARG C    C  20.309 21.221  10.913 1.00 . B B . 35 ARG C    1 1 
        2  4579 2 1 35 ARG CA   C  20.066 19.720  11.033 1.00 . B B . 35 ARG CA   1 1 
        2  4580 2 1 35 ARG CB   C  18.655 19.466  11.565 1.00 . B B . 35 ARG CB   1 1 
        2  4581 2 1 35 ARG CD   C  16.214 19.672  11.073 1.00 . B B . 35 ARG CD   1 1 
        2  4582 2 1 35 ARG CG   C  17.619 19.984  10.560 1.00 . B B . 35 ARG CG   1 1 
        2  4583 2 1 35 ARG CZ   C  14.861 17.719  11.566 1.00 . B B . 35 ARG CZ   1 1 
        2  4584 2 1 35 ARG H    H  20.779 18.830  12.813 1.00 . B B . 35 ARG H    1 1 
        2  4585 2 1 35 ARG HA   H  20.153 19.274  10.052 1.00 . B B . 35 ARG HA   1 1 
        2  4586 2 1 35 ARG HB2  H  18.514 18.405  11.713 1.00 . B B . 35 ARG HB2  1 1 
        2  4587 2 1 35 ARG HB3  H  18.528 19.980  12.505 1.00 . B B . 35 ARG HB3  1 1 
        2  4588 2 1 35 ARG HD2  H  16.096 20.080  12.065 1.00 . B B . 35 ARG HD2  1 1 
        2  4589 2 1 35 ARG HD3  H  15.487 20.122  10.413 1.00 . B B . 35 ARG HD3  1 1 
        2  4590 2 1 35 ARG HE   H  16.714 17.628  10.812 1.00 . B B . 35 ARG HE   1 1 
        2  4591 2 1 35 ARG HG2  H  17.726 21.052  10.442 1.00 . B B . 35 ARG HG2  1 1 
        2  4592 2 1 35 ARG HG3  H  17.767 19.499   9.607 1.00 . B B . 35 ARG HG3  1 1 
        2  4593 2 1 35 ARG HH11 H  14.035 19.503  11.943 1.00 . B B . 35 ARG HH11 1 1 
        2  4594 2 1 35 ARG HH12 H  13.048 18.128  12.310 1.00 . B B . 35 ARG HH12 1 1 
        2  4595 2 1 35 ARG HH21 H  15.426 15.819  11.293 1.00 . B B . 35 ARG HH21 1 1 
        2  4596 2 1 35 ARG HH22 H  13.836 16.042  11.942 1.00 . B B . 35 ARG HH22 1 1 
        2  4597 2 1 35 ARG N    N  21.054 19.123  11.919 1.00 . B B . 35 ARG N    1 1 
        2  4598 2 1 35 ARG NE   N  16.002 18.230  11.117 1.00 . B B . 35 ARG NE   1 1 
        2  4599 2 1 35 ARG NH1  N  13.906 18.513  11.971 1.00 . B B . 35 ARG NH1  1 1 
        2  4600 2 1 35 ARG NH2  N  14.694 16.426  11.603 1.00 . B B . 35 ARG NH2  1 1 
        2  4601 2 1 35 ARG O    O  20.009 21.818   9.880 1.00 . B B . 35 ARG O    1 1 
        2  4602 2 1 36 SER C    C  22.109 23.608  10.870 1.00 . B B . 36 SER C    1 1 
        2  4603 2 1 36 SER CA   C  21.110 23.258  11.965 1.00 . B B . 36 SER CA   1 1 
        2  4604 2 1 36 SER CB   C  21.659 23.711  13.324 1.00 . B B . 36 SER CB   1 1 
        2  4605 2 1 36 SER H    H  21.064 21.299  12.766 1.00 . B B . 36 SER H    1 1 
        2  4606 2 1 36 SER HA   H  20.186 23.781  11.773 1.00 . B B . 36 SER HA   1 1 
        2  4607 2 1 36 SER HB2  H  21.033 23.332  14.114 1.00 . B B . 36 SER HB2  1 1 
        2  4608 2 1 36 SER HB3  H  22.665 23.338  13.454 1.00 . B B . 36 SER HB3  1 1 
        2  4609 2 1 36 SER HG   H  21.177 25.404  14.147 1.00 . B B . 36 SER HG   1 1 
        2  4610 2 1 36 SER N    N  20.845 21.825  11.969 1.00 . B B . 36 SER N    1 1 
        2  4611 2 1 36 SER O    O  21.934 24.594  10.156 1.00 . B B . 36 SER O    1 1 
        2  4612 2 1 36 SER OG   O  21.665 25.131  13.369 1.00 . B B . 36 SER OG   1 1 
        2  4613 2 1 37 VAL C    C  23.631 22.686   8.334 1.00 . B B . 37 VAL C    1 1 
        2  4614 2 1 37 VAL CA   C  24.171 23.033   9.715 1.00 . B B . 37 VAL CA   1 1 
        2  4615 2 1 37 VAL CB   C  25.425 22.198  10.006 1.00 . B B . 37 VAL CB   1 1 
        2  4616 2 1 37 VAL CG1  C  26.485 22.425   8.915 1.00 . B B . 37 VAL CG1  1 1 
        2  4617 2 1 37 VAL CG2  C  25.996 22.612  11.365 1.00 . B B . 37 VAL CG2  1 1 
        2  4618 2 1 37 VAL H    H  23.241 22.024  11.339 1.00 . B B . 37 VAL H    1 1 
        2  4619 2 1 37 VAL HA   H  24.444 24.080   9.729 1.00 . B B . 37 VAL HA   1 1 
        2  4620 2 1 37 VAL HB   H  25.157 21.151  10.032 1.00 . B B . 37 VAL HB   1 1 
        2  4621 2 1 37 VAL HG11 H  26.630 23.485   8.773 1.00 . B B . 37 VAL HG11 1 1 
        2  4622 2 1 37 VAL HG12 H  26.157 21.976   7.987 1.00 . B B . 37 VAL HG12 1 1 
        2  4623 2 1 37 VAL HG13 H  27.421 21.973   9.217 1.00 . B B . 37 VAL HG13 1 1 
        2  4624 2 1 37 VAL HG21 H  26.119 23.686  11.395 1.00 . B B . 37 VAL HG21 1 1 
        2  4625 2 1 37 VAL HG22 H  26.954 22.137  11.509 1.00 . B B . 37 VAL HG22 1 1 
        2  4626 2 1 37 VAL HG23 H  25.319 22.304  12.147 1.00 . B B . 37 VAL HG23 1 1 
        2  4627 2 1 37 VAL N    N  23.153 22.796  10.740 1.00 . B B . 37 VAL N    1 1 
        2  4628 2 1 37 VAL O    O  23.844 23.417   7.368 1.00 . B B . 37 VAL O    1 1 
        2  4629 2 1 38 VAL C    C  21.520 22.210   6.345 1.00 . B B . 38 VAL C    1 1 
        2  4630 2 1 38 VAL CA   C  22.389 21.115   6.960 1.00 . B B . 38 VAL CA   1 1 
        2  4631 2 1 38 VAL CB   C  21.541 19.841   7.158 1.00 . B B . 38 VAL CB   1 1 
        2  4632 2 1 38 VAL CG1  C  20.915 19.406   5.814 1.00 . B B . 38 VAL CG1  1 1 
        2  4633 2 1 38 VAL CG2  C  22.409 18.693   7.752 1.00 . B B . 38 VAL CG2  1 1 
        2  4634 2 1 38 VAL H    H  22.801 21.013   9.053 1.00 . B B . 38 VAL H    1 1 
        2  4635 2 1 38 VAL HA   H  23.202 20.897   6.293 1.00 . B B . 38 VAL HA   1 1 
        2  4636 2 1 38 VAL HB   H  20.738 20.077   7.846 1.00 . B B . 38 VAL HB   1 1 
        2  4637 2 1 38 VAL HG11 H  20.473 18.427   5.927 1.00 . B B . 38 VAL HG11 1 1 
        2  4638 2 1 38 VAL HG12 H  21.677 19.370   5.051 1.00 . B B . 38 VAL HG12 1 1 
        2  4639 2 1 38 VAL HG13 H  20.150 20.112   5.527 1.00 . B B . 38 VAL HG13 1 1 
        2  4640 2 1 38 VAL HG21 H  23.321 19.094   8.178 1.00 . B B . 38 VAL HG21 1 1 
        2  4641 2 1 38 VAL HG22 H  22.665 17.974   6.985 1.00 . B B . 38 VAL HG22 1 1 
        2  4642 2 1 38 VAL HG23 H  21.852 18.192   8.525 1.00 . B B . 38 VAL HG23 1 1 
        2  4643 2 1 38 VAL N    N  22.939 21.555   8.248 1.00 . B B . 38 VAL N    1 1 
        2  4644 2 1 38 VAL O    O  21.651 22.507   5.158 1.00 . B B . 38 VAL O    1 1 
        2  4645 2 1 39 SER C    C  20.597 25.019   6.100 1.00 . B B . 39 SER C    1 1 
        2  4646 2 1 39 SER CA   C  19.774 23.868   6.658 1.00 . B B . 39 SER CA   1 1 
        2  4647 2 1 39 SER CB   C  18.886 24.378   7.790 1.00 . B B . 39 SER CB   1 1 
        2  4648 2 1 39 SER H    H  20.587 22.531   8.087 1.00 . B B . 39 SER H    1 1 
        2  4649 2 1 39 SER HA   H  19.145 23.472   5.874 1.00 . B B . 39 SER HA   1 1 
        2  4650 2 1 39 SER HB2  H  18.293 23.566   8.177 1.00 . B B . 39 SER HB2  1 1 
        2  4651 2 1 39 SER HB3  H  19.508 24.778   8.580 1.00 . B B . 39 SER HB3  1 1 
        2  4652 2 1 39 SER HG   H  18.139 26.172   7.830 1.00 . B B . 39 SER HG   1 1 
        2  4653 2 1 39 SER N    N  20.648 22.810   7.150 1.00 . B B . 39 SER N    1 1 
        2  4654 2 1 39 SER O    O  20.268 25.584   5.057 1.00 . B B . 39 SER O    1 1 
        2  4655 2 1 39 SER OG   O  18.023 25.389   7.288 1.00 . B B . 39 SER OG   1 1 
        2  4656 2 1 40 THR C    C  23.357 26.027   5.135 1.00 . B B . 40 THR C    1 1 
        2  4657 2 1 40 THR CA   C  22.542 26.449   6.357 1.00 . B B . 40 THR CA   1 1 
        2  4658 2 1 40 THR CB   C  23.491 26.851   7.488 1.00 . B B . 40 THR CB   1 1 
        2  4659 2 1 40 THR CG2  C  24.291 28.092   7.079 1.00 . B B . 40 THR CG2  1 1 
        2  4660 2 1 40 THR H    H  21.886 24.877   7.625 1.00 . B B . 40 THR H    1 1 
        2  4661 2 1 40 THR HA   H  21.934 27.301   6.100 1.00 . B B . 40 THR HA   1 1 
        2  4662 2 1 40 THR HB   H  24.173 26.039   7.685 1.00 . B B . 40 THR HB   1 1 
        2  4663 2 1 40 THR HG1  H  23.168 26.688   9.398 1.00 . B B . 40 THR HG1  1 1 
        2  4664 2 1 40 THR HG21 H  23.614 28.870   6.758 1.00 . B B . 40 THR HG21 1 1 
        2  4665 2 1 40 THR HG22 H  24.959 27.839   6.267 1.00 . B B . 40 THR HG22 1 1 
        2  4666 2 1 40 THR HG23 H  24.867 28.442   7.921 1.00 . B B . 40 THR HG23 1 1 
        2  4667 2 1 40 THR N    N  21.673 25.363   6.800 1.00 . B B . 40 THR N    1 1 
        2  4668 2 1 40 THR O    O  23.472 26.767   4.159 1.00 . B B . 40 THR O    1 1 
        2  4669 2 1 40 THR OG1  O  22.742 27.131   8.661 1.00 . B B . 40 THR OG1  1 1 
        2  4670 2 1 41 LEU C    C  23.971 24.365   2.791 1.00 . B B . 41 LEU C    1 1 
        2  4671 2 1 41 LEU CA   C  24.747 24.312   4.109 1.00 . B B . 41 LEU CA   1 1 
        2  4672 2 1 41 LEU CB   C  25.205 22.856   4.411 1.00 . B B . 41 LEU CB   1 1 
        2  4673 2 1 41 LEU CD1  C  27.471 23.254   3.315 1.00 . B B . 41 LEU CD1  1 1 
        2  4674 2 1 41 LEU CD2  C  27.120 23.695   5.845 1.00 . B B . 41 LEU CD2  1 1 
        2  4675 2 1 41 LEU CG   C  26.737 22.804   4.623 1.00 . B B . 41 LEU CG   1 1 
        2  4676 2 1 41 LEU H    H  23.802 24.284   6.011 1.00 . B B . 41 LEU H    1 1 
        2  4677 2 1 41 LEU HA   H  25.612 24.953   4.014 1.00 . B B . 41 LEU HA   1 1 
        2  4678 2 1 41 LEU HB2  H  24.714 22.510   5.309 1.00 . B B . 41 LEU HB2  1 1 
        2  4679 2 1 41 LEU HB3  H  24.944 22.199   3.595 1.00 . B B . 41 LEU HB3  1 1 
        2  4680 2 1 41 LEU HD11 H  28.236 22.539   3.071 1.00 . B B . 41 LEU HD11 1 1 
        2  4681 2 1 41 LEU HD12 H  27.928 24.225   3.450 1.00 . B B . 41 LEU HD12 1 1 
        2  4682 2 1 41 LEU HD13 H  26.770 23.310   2.490 1.00 . B B . 41 LEU HD13 1 1 
        2  4683 2 1 41 LEU HD21 H  26.256 23.860   6.475 1.00 . B B . 41 LEU HD21 1 1 
        2  4684 2 1 41 LEU HD22 H  27.501 24.651   5.510 1.00 . B B . 41 LEU HD22 1 1 
        2  4685 2 1 41 LEU HD23 H  27.880 23.194   6.424 1.00 . B B . 41 LEU HD23 1 1 
        2  4686 2 1 41 LEU HG   H  27.016 21.783   4.831 1.00 . B B . 41 LEU HG   1 1 
        2  4687 2 1 41 LEU N    N  23.929 24.830   5.208 1.00 . B B . 41 LEU N    1 1 
        2  4688 2 1 41 LEU O    O  24.557 24.529   1.721 1.00 . B B . 41 LEU O    1 1 
        2  4689 2 1 42 VAL C    C  21.357 25.700   1.402 1.00 . B B . 42 VAL C    1 1 
        2  4690 2 1 42 VAL CA   C  21.811 24.270   1.683 1.00 . B B . 42 VAL CA   1 1 
        2  4691 2 1 42 VAL CB   C  20.604 23.350   1.876 1.00 . B B . 42 VAL CB   1 1 
        2  4692 2 1 42 VAL CG1  C  19.677 23.435   0.654 1.00 . B B . 42 VAL CG1  1 1 
        2  4693 2 1 42 VAL CG2  C  21.108 21.909   2.047 1.00 . B B . 42 VAL CG2  1 1 
        2  4694 2 1 42 VAL H    H  22.239 24.102   3.760 1.00 . B B . 42 VAL H    1 1 
        2  4695 2 1 42 VAL HA   H  22.379 23.914   0.829 1.00 . B B . 42 VAL HA   1 1 
        2  4696 2 1 42 VAL HB   H  20.061 23.649   2.761 1.00 . B B . 42 VAL HB   1 1 
        2  4697 2 1 42 VAL HG11 H  19.165 24.388   0.655 1.00 . B B . 42 VAL HG11 1 1 
        2  4698 2 1 42 VAL HG12 H  18.952 22.641   0.697 1.00 . B B . 42 VAL HG12 1 1 
        2  4699 2 1 42 VAL HG13 H  20.257 23.342  -0.253 1.00 . B B . 42 VAL HG13 1 1 
        2  4700 2 1 42 VAL HG21 H  21.845 21.876   2.838 1.00 . B B . 42 VAL HG21 1 1 
        2  4701 2 1 42 VAL HG22 H  21.563 21.575   1.122 1.00 . B B . 42 VAL HG22 1 1 
        2  4702 2 1 42 VAL HG23 H  20.281 21.262   2.298 1.00 . B B . 42 VAL HG23 1 1 
        2  4703 2 1 42 VAL N    N  22.652 24.230   2.881 1.00 . B B . 42 VAL N    1 1 
        2  4704 2 1 42 VAL O    O  21.103 26.065   0.254 1.00 . B B . 42 VAL O    1 1 
        2  4705 2 1 43 GLN C    C  21.941 28.738   1.702 1.00 . B B . 43 GLN C    1 1 
        2  4706 2 1 43 GLN CA   C  20.819 27.893   2.309 1.00 . B B . 43 GLN CA   1 1 
        2  4707 2 1 43 GLN CB   C  20.417 28.465   3.679 1.00 . B B . 43 GLN CB   1 1 
        2  4708 2 1 43 GLN CD   C  18.280 29.508   2.875 1.00 . B B . 43 GLN CD   1 1 
        2  4709 2 1 43 GLN CG   C  19.644 29.782   3.507 1.00 . B B . 43 GLN CG   1 1 
        2  4710 2 1 43 GLN H    H  21.464 26.157   3.347 1.00 . B B . 43 GLN H    1 1 
        2  4711 2 1 43 GLN HA   H  19.966 27.927   1.645 1.00 . B B . 43 GLN HA   1 1 
        2  4712 2 1 43 GLN HB2  H  19.794 27.751   4.194 1.00 . B B . 43 GLN HB2  1 1 
        2  4713 2 1 43 GLN HB3  H  21.305 28.651   4.264 1.00 . B B . 43 GLN HB3  1 1 
        2  4714 2 1 43 GLN HE21 H  18.090 31.334   2.120 1.00 . B B . 43 GLN HE21 1 1 
        2  4715 2 1 43 GLN HE22 H  16.800 30.278   1.799 1.00 . B B . 43 GLN HE22 1 1 
        2  4716 2 1 43 GLN HG2  H  19.503 30.239   4.475 1.00 . B B . 43 GLN HG2  1 1 
        2  4717 2 1 43 GLN HG3  H  20.205 30.450   2.875 1.00 . B B . 43 GLN HG3  1 1 
        2  4718 2 1 43 GLN N    N  21.248 26.502   2.456 1.00 . B B . 43 GLN N    1 1 
        2  4719 2 1 43 GLN NE2  N  17.672 30.452   2.211 1.00 . B B . 43 GLN NE2  1 1 
        2  4720 2 1 43 GLN O    O  21.686 29.796   1.129 1.00 . B B . 43 GLN O    1 1 
        2  4721 2 1 43 GLN OE1  O  17.760 28.399   2.989 1.00 . B B . 43 GLN OE1  1 1 
        2  4722 2 1 44 ASP C    C  24.467 28.731  -0.193 1.00 . B B . 44 ASP C    1 1 
        2  4723 2 1 44 ASP CA   C  24.332 28.988   1.301 1.00 . B B . 44 ASP CA   1 1 
        2  4724 2 1 44 ASP CB   C  25.622 28.539   2.009 1.00 . B B . 44 ASP CB   1 1 
        2  4725 2 1 44 ASP CG   C  25.904 27.059   1.738 1.00 . B B . 44 ASP CG   1 1 
        2  4726 2 1 44 ASP H    H  23.321 27.418   2.305 1.00 . B B . 44 ASP H    1 1 
        2  4727 2 1 44 ASP HA   H  24.200 30.048   1.463 1.00 . B B . 44 ASP HA   1 1 
        2  4728 2 1 44 ASP HB2  H  26.449 29.129   1.642 1.00 . B B . 44 ASP HB2  1 1 
        2  4729 2 1 44 ASP HB3  H  25.515 28.693   3.072 1.00 . B B . 44 ASP HB3  1 1 
        2  4730 2 1 44 ASP N    N  23.177 28.267   1.838 1.00 . B B . 44 ASP N    1 1 
        2  4731 2 1 44 ASP O    O  23.631 28.063  -0.800 1.00 . B B . 44 ASP O    1 1 
        2  4732 2 1 44 ASP OD1  O  25.333 26.534   0.796 1.00 . B B . 44 ASP OD1  1 1 
        2  4733 2 1 44 ASP OD2  O  26.673 26.472   2.482 1.00 . B B . 44 ASP OD2  1 1 
        2  4734 2 1 45 GLN C    C  25.535 27.632  -2.615 1.00 . B B . 45 GLN C    1 1 
        2  4735 2 1 45 GLN CA   C  25.787 29.083  -2.206 1.00 . B B . 45 GLN CA   1 1 
        2  4736 2 1 45 GLN CB   C  27.235 29.465  -2.525 1.00 . B B . 45 GLN CB   1 1 
        2  4737 2 1 45 GLN CD   C  29.634 28.993  -1.962 1.00 . B B . 45 GLN CD   1 1 
        2  4738 2 1 45 GLN CG   C  28.200 28.497  -1.820 1.00 . B B . 45 GLN CG   1 1 
        2  4739 2 1 45 GLN H    H  26.164 29.792  -0.246 1.00 . B B . 45 GLN H    1 1 
        2  4740 2 1 45 GLN HA   H  25.125 29.726  -2.768 1.00 . B B . 45 GLN HA   1 1 
        2  4741 2 1 45 GLN HB2  H  27.390 29.415  -3.593 1.00 . B B . 45 GLN HB2  1 1 
        2  4742 2 1 45 GLN HB3  H  27.420 30.470  -2.181 1.00 . B B . 45 GLN HB3  1 1 
        2  4743 2 1 45 GLN HE21 H  30.437 27.233  -1.519 1.00 . B B . 45 GLN HE21 1 1 
        2  4744 2 1 45 GLN HE22 H  31.546 28.473  -1.852 1.00 . B B . 45 GLN HE22 1 1 
        2  4745 2 1 45 GLN HG2  H  27.944 28.434  -0.773 1.00 . B B . 45 GLN HG2  1 1 
        2  4746 2 1 45 GLN HG3  H  28.123 27.511  -2.267 1.00 . B B . 45 GLN HG3  1 1 
        2  4747 2 1 45 GLN N    N  25.531 29.269  -0.781 1.00 . B B . 45 GLN N    1 1 
        2  4748 2 1 45 GLN NE2  N  30.622 28.164  -1.760 1.00 . B B . 45 GLN NE2  1 1 
        2  4749 2 1 45 GLN O    O  25.844 26.697  -1.876 1.00 . B B . 45 GLN O    1 1 
        2  4750 2 1 45 GLN OE1  O  29.863 30.164  -2.265 1.00 . B B . 45 GLN OE1  1 1 
        2  4751 2 1 46 LEU C    C  25.338 25.908  -5.665 1.00 . B B . 46 LEU C    1 1 
        2  4752 2 1 46 LEU CA   C  24.657 26.121  -4.321 1.00 . B B . 46 LEU CA   1 1 
        2  4753 2 1 46 LEU CB   C  23.130 25.991  -4.463 1.00 . B B . 46 LEU CB   1 1 
        2  4754 2 1 46 LEU CD1  C  21.021 26.279  -3.088 1.00 . B B . 46 LEU CD1  1 1 
        2  4755 2 1 46 LEU CD2  C  22.441 24.252  -2.727 1.00 . B B . 46 LEU CD2  1 1 
        2  4756 2 1 46 LEU CG   C  22.465 25.756  -3.075 1.00 . B B . 46 LEU CG   1 1 
        2  4757 2 1 46 LEU H    H  24.740 28.240  -4.349 1.00 . B B . 46 LEU H    1 1 
        2  4758 2 1 46 LEU HA   H  25.016 25.364  -3.639 1.00 . B B . 46 LEU HA   1 1 
        2  4759 2 1 46 LEU HB2  H  22.756 26.913  -4.889 1.00 . B B . 46 LEU HB2  1 1 
        2  4760 2 1 46 LEU HB3  H  22.891 25.171  -5.126 1.00 . B B . 46 LEU HB3  1 1 
        2  4761 2 1 46 LEU HD11 H  20.538 26.028  -2.156 1.00 . B B . 46 LEU HD11 1 1 
        2  4762 2 1 46 LEU HD12 H  20.481 25.826  -3.907 1.00 . B B . 46 LEU HD12 1 1 
        2  4763 2 1 46 LEU HD13 H  21.029 27.351  -3.212 1.00 . B B . 46 LEU HD13 1 1 
        2  4764 2 1 46 LEU HD21 H  21.748 23.739  -3.378 1.00 . B B . 46 LEU HD21 1 1 
        2  4765 2 1 46 LEU HD22 H  22.123 24.130  -1.701 1.00 . B B . 46 LEU HD22 1 1 
        2  4766 2 1 46 LEU HD23 H  23.424 23.829  -2.849 1.00 . B B . 46 LEU HD23 1 1 
        2  4767 2 1 46 LEU HG   H  23.023 26.288  -2.315 1.00 . B B . 46 LEU HG   1 1 
        2  4768 2 1 46 LEU N    N  24.964 27.458  -3.803 1.00 . B B . 46 LEU N    1 1 
        2  4769 2 1 46 LEU O    O  24.678 25.684  -6.680 1.00 . B B . 46 LEU O    1 1 
        2  4770 2 1 47 THR C    C  27.216 24.361  -7.413 1.00 . B B . 47 THR C    1 1 
        2  4771 2 1 47 THR CA   C  27.432 25.771  -6.882 1.00 . B B . 47 THR CA   1 1 
        2  4772 2 1 47 THR CB   C  28.926 26.005  -6.608 1.00 . B B . 47 THR CB   1 1 
        2  4773 2 1 47 THR CG2  C  29.336 25.300  -5.310 1.00 . B B . 47 THR CG2  1 1 
        2  4774 2 1 47 THR H    H  27.140 26.146  -4.825 1.00 . B B . 47 THR H    1 1 
        2  4775 2 1 47 THR HA   H  27.097 26.475  -7.622 1.00 . B B . 47 THR HA   1 1 
        2  4776 2 1 47 THR HB   H  29.117 27.063  -6.511 1.00 . B B . 47 THR HB   1 1 
        2  4777 2 1 47 THR HG1  H  29.285 25.789  -8.503 1.00 . B B . 47 THR HG1  1 1 
        2  4778 2 1 47 THR HG21 H  28.995 24.279  -5.333 1.00 . B B . 47 THR HG21 1 1 
        2  4779 2 1 47 THR HG22 H  28.895 25.809  -4.465 1.00 . B B . 47 THR HG22 1 1 
        2  4780 2 1 47 THR HG23 H  30.411 25.318  -5.215 1.00 . B B . 47 THR HG23 1 1 
        2  4781 2 1 47 THR N    N  26.666 25.964  -5.664 1.00 . B B . 47 THR N    1 1 
        2  4782 2 1 47 THR O    O  27.258 24.127  -8.621 1.00 . B B . 47 THR O    1 1 
        2  4783 2 1 47 THR OG1  O  29.685 25.483  -7.686 1.00 . B B . 47 THR OG1  1 1 
        2  4784 2 1 48 LYS C    C  26.257 21.221  -5.694 1.00 . B B . 48 LYS C    1 1 
        2  4785 2 1 48 LYS CA   C  26.771 22.033  -6.880 1.00 . B B . 48 LYS CA   1 1 
        2  4786 2 1 48 LYS CB   C  28.080 21.420  -7.379 1.00 . B B . 48 LYS CB   1 1 
        2  4787 2 1 48 LYS CD   C  27.453 20.222  -9.522 1.00 . B B . 48 LYS CD   1 1 
        2  4788 2 1 48 LYS CE   C  27.115 18.863 -10.131 1.00 . B B . 48 LYS CE   1 1 
        2  4789 2 1 48 LYS CG   C  27.823 20.047  -8.042 1.00 . B B . 48 LYS CG   1 1 
        2  4790 2 1 48 LYS H    H  26.972 23.666  -5.551 1.00 . B B . 48 LYS H    1 1 
        2  4791 2 1 48 LYS HA   H  26.036 21.997  -7.668 1.00 . B B . 48 LYS HA   1 1 
        2  4792 2 1 48 LYS HB2  H  28.538 22.092  -8.088 1.00 . B B . 48 LYS HB2  1 1 
        2  4793 2 1 48 LYS HB3  H  28.746 21.290  -6.539 1.00 . B B . 48 LYS HB3  1 1 
        2  4794 2 1 48 LYS HD2  H  26.601 20.876  -9.614 1.00 . B B . 48 LYS HD2  1 1 
        2  4795 2 1 48 LYS HD3  H  28.291 20.650 -10.051 1.00 . B B . 48 LYS HD3  1 1 
        2  4796 2 1 48 LYS HE2  H  27.974 18.212 -10.069 1.00 . B B . 48 LYS HE2  1 1 
        2  4797 2 1 48 LYS HE3  H  26.286 18.423  -9.593 1.00 . B B . 48 LYS HE3  1 1 
        2  4798 2 1 48 LYS HG2  H  28.719 19.449  -7.973 1.00 . B B . 48 LYS HG2  1 1 
        2  4799 2 1 48 LYS HG3  H  27.020 19.535  -7.531 1.00 . B B . 48 LYS HG3  1 1 
        2  4800 2 1 48 LYS HZ1  H  27.084 18.264 -12.125 1.00 . B B . 48 LYS HZ1  1 1 
        2  4801 2 1 48 LYS HZ2  H  27.159 19.944 -11.905 1.00 . B B . 48 LYS HZ2  1 1 
        2  4802 2 1 48 LYS HZ3  H  25.699 19.119 -11.634 1.00 . B B . 48 LYS HZ3  1 1 
        2  4803 2 1 48 LYS N    N  26.995 23.420  -6.500 1.00 . B B . 48 LYS N    1 1 
        2  4804 2 1 48 LYS NZ   N  26.736 19.062 -11.557 1.00 . B B . 48 LYS NZ   1 1 
        2  4805 2 1 48 LYS O    O  26.869 21.212  -4.625 1.00 . B B . 48 LYS O    1 1 
        2  4806 2 1 49 ASN C    C  25.632 18.845  -4.181 1.00 . B B . 49 ASN C    1 1 
        2  4807 2 1 49 ASN CA   C  24.556 19.710  -4.834 1.00 . B B . 49 ASN CA   1 1 
        2  4808 2 1 49 ASN CB   C  23.464 18.805  -5.417 1.00 . B B . 49 ASN CB   1 1 
        2  4809 2 1 49 ASN CG   C  23.994 18.072  -6.648 1.00 . B B . 49 ASN CG   1 1 
        2  4810 2 1 49 ASN H    H  24.692 20.580  -6.764 1.00 . B B . 49 ASN H    1 1 
        2  4811 2 1 49 ASN HA   H  24.113 20.345  -4.088 1.00 . B B . 49 ASN HA   1 1 
        2  4812 2 1 49 ASN HB2  H  23.157 18.082  -4.673 1.00 . B B . 49 ASN HB2  1 1 
        2  4813 2 1 49 ASN HB3  H  22.615 19.408  -5.700 1.00 . B B . 49 ASN HB3  1 1 
        2  4814 2 1 49 ASN HD21 H  22.186 17.728  -7.392 1.00 . B B . 49 ASN HD21 1 1 
        2  4815 2 1 49 ASN HD22 H  23.477 17.135  -8.320 1.00 . B B . 49 ASN HD22 1 1 
        2  4816 2 1 49 ASN N    N  25.136 20.536  -5.891 1.00 . B B . 49 ASN N    1 1 
        2  4817 2 1 49 ASN ND2  N  23.148 17.607  -7.526 1.00 . B B . 49 ASN ND2  1 1 
        2  4818 2 1 49 ASN O    O  25.520 18.505  -3.003 1.00 . B B . 49 ASN O    1 1 
        2  4819 2 1 49 ASN OD1  O  25.204 17.932  -6.820 1.00 . B B . 49 ASN OD1  1 1 
        2  4820 2 1 50 ALA C    C  28.628 18.512  -3.447 1.00 . B B . 50 ALA C    1 1 
        2  4821 2 1 50 ALA CA   C  27.751 17.687  -4.402 1.00 . B B . 50 ALA CA   1 1 
        2  4822 2 1 50 ALA CB   C  28.626 17.156  -5.547 1.00 . B B . 50 ALA CB   1 1 
        2  4823 2 1 50 ALA H    H  26.706 18.804  -5.869 1.00 . B B . 50 ALA H    1 1 
        2  4824 2 1 50 ALA HA   H  27.332 16.843  -3.888 1.00 . B B . 50 ALA HA   1 1 
        2  4825 2 1 50 ALA HB1  H  29.393 16.514  -5.139 1.00 . B B . 50 ALA HB1  1 1 
        2  4826 2 1 50 ALA HB2  H  29.086 17.985  -6.061 1.00 . B B . 50 ALA HB2  1 1 
        2  4827 2 1 50 ALA HB3  H  28.018 16.593  -6.240 1.00 . B B . 50 ALA HB3  1 1 
        2  4828 2 1 50 ALA N    N  26.670 18.503  -4.937 1.00 . B B . 50 ALA N    1 1 
        2  4829 2 1 50 ALA O    O  28.898 18.107  -2.316 1.00 . B B . 50 ALA O    1 1 
        2  4830 2 1 51 VAL C    C  29.332 20.748  -1.712 1.00 . B B . 51 VAL C    1 1 
        2  4831 2 1 51 VAL CA   C  29.930 20.550  -3.108 1.00 . B B . 51 VAL CA   1 1 
        2  4832 2 1 51 VAL CB   C  30.094 21.924  -3.808 1.00 . B B . 51 VAL CB   1 1 
        2  4833 2 1 51 VAL CG1  C  30.625 23.000  -2.824 1.00 . B B . 51 VAL CG1  1 1 
        2  4834 2 1 51 VAL CG2  C  31.067 21.795  -5.002 1.00 . B B . 51 VAL CG2  1 1 
        2  4835 2 1 51 VAL H    H  28.819 19.943  -4.833 1.00 . B B . 51 VAL H    1 1 
        2  4836 2 1 51 VAL HA   H  30.893 20.091  -3.010 1.00 . B B . 51 VAL HA   1 1 
        2  4837 2 1 51 VAL HB   H  29.128 22.235  -4.172 1.00 . B B . 51 VAL HB   1 1 
        2  4838 2 1 51 VAL HG11 H  30.987 23.856  -3.378 1.00 . B B . 51 VAL HG11 1 1 
        2  4839 2 1 51 VAL HG12 H  31.429 22.588  -2.232 1.00 . B B . 51 VAL HG12 1 1 
        2  4840 2 1 51 VAL HG13 H  29.824 23.314  -2.168 1.00 . B B . 51 VAL HG13 1 1 
        2  4841 2 1 51 VAL HG21 H  30.949 22.651  -5.652 1.00 . B B . 51 VAL HG21 1 1 
        2  4842 2 1 51 VAL HG22 H  30.849 20.893  -5.553 1.00 . B B . 51 VAL HG22 1 1 
        2  4843 2 1 51 VAL HG23 H  32.085 21.755  -4.642 1.00 . B B . 51 VAL HG23 1 1 
        2  4844 2 1 51 VAL N    N  29.067 19.672  -3.925 1.00 . B B . 51 VAL N    1 1 
        2  4845 2 1 51 VAL O    O  30.040 20.663  -0.709 1.00 . B B . 51 VAL O    1 1 
        2  4846 2 1 52 VAL C    C  27.201 19.865   0.368 1.00 . B B . 52 VAL C    1 1 
        2  4847 2 1 52 VAL CA   C  27.355 21.197  -0.369 1.00 . B B . 52 VAL CA   1 1 
        2  4848 2 1 52 VAL CB   C  25.973 21.837  -0.591 1.00 . B B . 52 VAL CB   1 1 
        2  4849 2 1 52 VAL CG1  C  26.158 23.241  -1.170 1.00 . B B . 52 VAL CG1  1 1 
        2  4850 2 1 52 VAL CG2  C  25.168 20.995  -1.584 1.00 . B B . 52 VAL CG2  1 1 
        2  4851 2 1 52 VAL H    H  27.513 21.059  -2.488 1.00 . B B . 52 VAL H    1 1 
        2  4852 2 1 52 VAL HA   H  27.955 21.863   0.239 1.00 . B B . 52 VAL HA   1 1 
        2  4853 2 1 52 VAL HB   H  25.438 21.897   0.352 1.00 . B B . 52 VAL HB   1 1 
        2  4854 2 1 52 VAL HG11 H  25.199 23.728  -1.246 1.00 . B B . 52 VAL HG11 1 1 
        2  4855 2 1 52 VAL HG12 H  26.606 23.168  -2.151 1.00 . B B . 52 VAL HG12 1 1 
        2  4856 2 1 52 VAL HG13 H  26.804 23.817  -0.524 1.00 . B B . 52 VAL HG13 1 1 
        2  4857 2 1 52 VAL HG21 H  24.228 21.485  -1.791 1.00 . B B . 52 VAL HG21 1 1 
        2  4858 2 1 52 VAL HG22 H  24.979 20.018  -1.166 1.00 . B B . 52 VAL HG22 1 1 
        2  4859 2 1 52 VAL HG23 H  25.725 20.894  -2.497 1.00 . B B . 52 VAL HG23 1 1 
        2  4860 2 1 52 VAL N    N  28.028 21.003  -1.657 1.00 . B B . 52 VAL N    1 1 
        2  4861 2 1 52 VAL O    O  27.282 19.802   1.595 1.00 . B B . 52 VAL O    1 1 
        2  4862 2 1 53 LEU C    C  28.100 16.979   0.815 1.00 . B B . 53 LEU C    1 1 
        2  4863 2 1 53 LEU CA   C  26.790 17.466   0.184 1.00 . B B . 53 LEU CA   1 1 
        2  4864 2 1 53 LEU CB   C  26.317 16.482  -0.900 1.00 . B B . 53 LEU CB   1 1 
        2  4865 2 1 53 LEU CD1  C  24.387 15.750  -2.347 1.00 . B B . 53 LEU CD1  1 1 
        2  4866 2 1 53 LEU CD2  C  24.105 15.768   0.165 1.00 . B B . 53 LEU CD2  1 1 
        2  4867 2 1 53 LEU CG   C  24.775 16.479  -1.044 1.00 . B B . 53 LEU CG   1 1 
        2  4868 2 1 53 LEU H    H  26.910 18.915  -1.369 1.00 . B B . 53 LEU H    1 1 
        2  4869 2 1 53 LEU HA   H  26.048 17.524   0.960 1.00 . B B . 53 LEU HA   1 1 
        2  4870 2 1 53 LEU HB2  H  26.746 16.798  -1.822 1.00 . B B . 53 LEU HB2  1 1 
        2  4871 2 1 53 LEU HB3  H  26.657 15.480  -0.677 1.00 . B B . 53 LEU HB3  1 1 
        2  4872 2 1 53 LEU HD11 H  23.316 15.796  -2.480 1.00 . B B . 53 LEU HD11 1 1 
        2  4873 2 1 53 LEU HD12 H  24.698 14.716  -2.292 1.00 . B B . 53 LEU HD12 1 1 
        2  4874 2 1 53 LEU HD13 H  24.874 16.224  -3.183 1.00 . B B . 53 LEU HD13 1 1 
        2  4875 2 1 53 LEU HD21 H  23.113 15.436  -0.111 1.00 . B B . 53 LEU HD21 1 1 
        2  4876 2 1 53 LEU HD22 H  24.023 16.454   0.995 1.00 . B B . 53 LEU HD22 1 1 
        2  4877 2 1 53 LEU HD23 H  24.690 14.913   0.468 1.00 . B B . 53 LEU HD23 1 1 
        2  4878 2 1 53 LEU HG   H  24.428 17.502  -1.092 1.00 . B B . 53 LEU HG   1 1 
        2  4879 2 1 53 LEU N    N  26.964 18.805  -0.397 1.00 . B B . 53 LEU N    1 1 
        2  4880 2 1 53 LEU O    O  28.076 16.193   1.761 1.00 . B B . 53 LEU O    1 1 
        2  4881 2 1 54 LYS C    C  30.565 17.271   2.336 1.00 . B B . 54 LYS C    1 1 
        2  4882 2 1 54 LYS CA   C  30.522 17.033   0.833 1.00 . B B . 54 LYS CA   1 1 
        2  4883 2 1 54 LYS CB   C  31.661 17.815   0.152 1.00 . B B . 54 LYS CB   1 1 
        2  4884 2 1 54 LYS CD   C  32.994 18.088  -1.923 1.00 . B B . 54 LYS CD   1 1 
        2  4885 2 1 54 LYS CE   C  33.223 17.559  -3.339 1.00 . B B . 54 LYS CE   1 1 
        2  4886 2 1 54 LYS CG   C  31.921 17.252  -1.244 1.00 . B B . 54 LYS CG   1 1 
        2  4887 2 1 54 LYS H    H  29.186 18.078  -0.457 1.00 . B B . 54 LYS H    1 1 
        2  4888 2 1 54 LYS HA   H  30.657 15.977   0.646 1.00 . B B . 54 LYS HA   1 1 
        2  4889 2 1 54 LYS HB2  H  31.380 18.853   0.070 1.00 . B B . 54 LYS HB2  1 1 
        2  4890 2 1 54 LYS HB3  H  32.566 17.737   0.739 1.00 . B B . 54 LYS HB3  1 1 
        2  4891 2 1 54 LYS HD2  H  32.673 19.117  -1.958 1.00 . B B . 54 LYS HD2  1 1 
        2  4892 2 1 54 LYS HD3  H  33.913 18.020  -1.361 1.00 . B B . 54 LYS HD3  1 1 
        2  4893 2 1 54 LYS HE2  H  34.013 18.120  -3.810 1.00 . B B . 54 LYS HE2  1 1 
        2  4894 2 1 54 LYS HE3  H  33.501 16.517  -3.289 1.00 . B B . 54 LYS HE3  1 1 
        2  4895 2 1 54 LYS HG2  H  32.259 16.227  -1.160 1.00 . B B . 54 LYS HG2  1 1 
        2  4896 2 1 54 LYS HG3  H  31.019 17.284  -1.824 1.00 . B B . 54 LYS HG3  1 1 
        2  4897 2 1 54 LYS HZ1  H  32.204 17.768  -5.144 1.00 . B B . 54 LYS HZ1  1 1 
        2  4898 2 1 54 LYS HZ2  H  31.461 18.553  -3.840 1.00 . B B . 54 LYS HZ2  1 1 
        2  4899 2 1 54 LYS HZ3  H  31.364 16.864  -3.978 1.00 . B B . 54 LYS HZ3  1 1 
        2  4900 2 1 54 LYS N    N  29.227 17.453   0.297 1.00 . B B . 54 LYS N    1 1 
        2  4901 2 1 54 LYS NZ   N  31.967 17.697  -4.135 1.00 . B B . 54 LYS NZ   1 1 
        2  4902 2 1 54 LYS O    O  31.023 16.414   3.090 1.00 . B B . 54 LYS O    1 1 
        2  4903 2 1 55 ARG C    C  29.083 17.891   4.926 1.00 . B B . 55 ARG C    1 1 
        2  4904 2 1 55 ARG CA   C  30.084 18.765   4.182 1.00 . B B . 55 ARG CA   1 1 
        2  4905 2 1 55 ARG CB   C  29.719 20.240   4.390 1.00 . B B . 55 ARG CB   1 1 
        2  4906 2 1 55 ARG CD   C  30.918 22.473   4.579 1.00 . B B . 55 ARG CD   1 1 
        2  4907 2 1 55 ARG CG   C  30.809 21.166   3.779 1.00 . B B . 55 ARG CG   1 1 
        2  4908 2 1 55 ARG CZ   C  32.433 24.377   4.612 1.00 . B B . 55 ARG CZ   1 1 
        2  4909 2 1 55 ARG H    H  29.740 19.082   2.119 1.00 . B B . 55 ARG H    1 1 
        2  4910 2 1 55 ARG HA   H  31.070 18.588   4.592 1.00 . B B . 55 ARG HA   1 1 
        2  4911 2 1 55 ARG HB2  H  28.768 20.427   3.913 1.00 . B B . 55 ARG HB2  1 1 
        2  4912 2 1 55 ARG HB3  H  29.628 20.432   5.450 1.00 . B B . 55 ARG HB3  1 1 
        2  4913 2 1 55 ARG HD2  H  29.949 22.942   4.640 1.00 . B B . 55 ARG HD2  1 1 
        2  4914 2 1 55 ARG HD3  H  31.262 22.242   5.580 1.00 . B B . 55 ARG HD3  1 1 
        2  4915 2 1 55 ARG HE   H  32.074 23.270   2.981 1.00 . B B . 55 ARG HE   1 1 
        2  4916 2 1 55 ARG HG2  H  31.769 20.672   3.788 1.00 . B B . 55 ARG HG2  1 1 
        2  4917 2 1 55 ARG HG3  H  30.545 21.404   2.756 1.00 . B B . 55 ARG HG3  1 1 
        2  4918 2 1 55 ARG HH11 H  31.516 23.925   6.333 1.00 . B B . 55 ARG HH11 1 1 
        2  4919 2 1 55 ARG HH12 H  32.589 25.283   6.390 1.00 . B B . 55 ARG HH12 1 1 
        2  4920 2 1 55 ARG HH21 H  33.482 25.055   3.047 1.00 . B B . 55 ARG HH21 1 1 
        2  4921 2 1 55 ARG HH22 H  33.702 25.922   4.530 1.00 . B B . 55 ARG HH22 1 1 
        2  4922 2 1 55 ARG N    N  30.093 18.436   2.767 1.00 . B B . 55 ARG N    1 1 
        2  4923 2 1 55 ARG NE   N  31.861 23.389   3.931 1.00 . B B . 55 ARG NE   1 1 
        2  4924 2 1 55 ARG NH1  N  32.157 24.542   5.877 1.00 . B B . 55 ARG NH1  1 1 
        2  4925 2 1 55 ARG NH2  N  33.271 25.181   4.017 1.00 . B B . 55 ARG NH2  1 1 
        2  4926 2 1 55 ARG O    O  29.352 17.459   6.047 1.00 . B B . 55 ARG O    1 1 
        2  4927 2 1 56 ILE C    C  27.431 15.403   5.179 1.00 . B B . 56 ILE C    1 1 
        2  4928 2 1 56 ILE CA   C  26.912 16.817   4.946 1.00 . B B . 56 ILE CA   1 1 
        2  4929 2 1 56 ILE CB   C  25.667 16.770   4.055 1.00 . B B . 56 ILE CB   1 1 
        2  4930 2 1 56 ILE CD1  C  25.065 19.113   4.872 1.00 . B B . 56 ILE CD1  1 1 
        2  4931 2 1 56 ILE CG1  C  25.252 18.193   3.659 1.00 . B B . 56 ILE CG1  1 1 
        2  4932 2 1 56 ILE CG2  C  24.517 16.080   4.785 1.00 . B B . 56 ILE CG2  1 1 
        2  4933 2 1 56 ILE H    H  27.778 18.005   3.414 1.00 . B B . 56 ILE H    1 1 
        2  4934 2 1 56 ILE HA   H  26.650 17.258   5.894 1.00 . B B . 56 ILE HA   1 1 
        2  4935 2 1 56 ILE HB   H  25.896 16.209   3.161 1.00 . B B . 56 ILE HB   1 1 
        2  4936 2 1 56 ILE HD11 H  24.472 19.962   4.571 1.00 . B B . 56 ILE HD11 1 1 
        2  4937 2 1 56 ILE HD12 H  26.029 19.459   5.219 1.00 . B B . 56 ILE HD12 1 1 
        2  4938 2 1 56 ILE HD13 H  24.563 18.585   5.664 1.00 . B B . 56 ILE HD13 1 1 
        2  4939 2 1 56 ILE HG12 H  26.011 18.607   3.038 1.00 . B B . 56 ILE HG12 1 1 
        2  4940 2 1 56 ILE HG13 H  24.326 18.149   3.105 1.00 . B B . 56 ILE HG13 1 1 
        2  4941 2 1 56 ILE HG21 H  23.637 16.106   4.160 1.00 . B B . 56 ILE HG21 1 1 
        2  4942 2 1 56 ILE HG22 H  24.316 16.593   5.712 1.00 . B B . 56 ILE HG22 1 1 
        2  4943 2 1 56 ILE HG23 H  24.783 15.053   4.987 1.00 . B B . 56 ILE HG23 1 1 
        2  4944 2 1 56 ILE N    N  27.937 17.633   4.306 1.00 . B B . 56 ILE N    1 1 
        2  4945 2 1 56 ILE O    O  27.376 14.895   6.300 1.00 . B B . 56 ILE O    1 1 
        2  4946 2 1 57 GLN C    C  29.580 13.373   5.277 1.00 . B B . 57 GLN C    1 1 
        2  4947 2 1 57 GLN CA   C  28.475 13.423   4.229 1.00 . B B . 57 GLN CA   1 1 
        2  4948 2 1 57 GLN CB   C  29.036 12.979   2.877 1.00 . B B . 57 GLN CB   1 1 
        2  4949 2 1 57 GLN CD   C  28.439 12.438   0.516 1.00 . B B . 57 GLN CD   1 1 
        2  4950 2 1 57 GLN CG   C  27.901 12.910   1.859 1.00 . B B . 57 GLN CG   1 1 
        2  4951 2 1 57 GLN H    H  27.958 15.228   3.257 1.00 . B B . 57 GLN H    1 1 
        2  4952 2 1 57 GLN HA   H  27.681 12.750   4.516 1.00 . B B . 57 GLN HA   1 1 
        2  4953 2 1 57 GLN HB2  H  29.780 13.689   2.544 1.00 . B B . 57 GLN HB2  1 1 
        2  4954 2 1 57 GLN HB3  H  29.488 12.003   2.976 1.00 . B B . 57 GLN HB3  1 1 
        2  4955 2 1 57 GLN HE21 H  27.366 10.767   0.511 1.00 . B B . 57 GLN HE21 1 1 
        2  4956 2 1 57 GLN HE22 H  28.366 10.992  -0.842 1.00 . B B . 57 GLN HE22 1 1 
        2  4957 2 1 57 GLN HG2  H  27.145 12.223   2.209 1.00 . B B . 57 GLN HG2  1 1 
        2  4958 2 1 57 GLN HG3  H  27.467 13.893   1.745 1.00 . B B . 57 GLN HG3  1 1 
        2  4959 2 1 57 GLN N    N  27.941 14.776   4.126 1.00 . B B . 57 GLN N    1 1 
        2  4960 2 1 57 GLN NE2  N  28.022 11.306   0.019 1.00 . B B . 57 GLN NE2  1 1 
        2  4961 2 1 57 GLN O    O  29.698 12.396   6.017 1.00 . B B . 57 GLN O    1 1 
        2  4962 2 1 57 GLN OE1  O  29.264 13.116  -0.097 1.00 . B B . 57 GLN OE1  1 1 
        2  4963 2 1 58 HIS C    C  30.930 14.779   7.708 1.00 . B B . 58 HIS C    1 1 
        2  4964 2 1 58 HIS CA   C  31.475 14.497   6.308 1.00 . B B . 58 HIS CA   1 1 
        2  4965 2 1 58 HIS CB   C  32.469 15.600   5.915 1.00 . B B . 58 HIS CB   1 1 
        2  4966 2 1 58 HIS CD2  C  33.592 15.929   3.556 1.00 . B B . 58 HIS CD2  1 1 
        2  4967 2 1 58 HIS CE1  C  34.190 13.874   3.213 1.00 . B B . 58 HIS CE1  1 1 
        2  4968 2 1 58 HIS CG   C  33.191 15.208   4.653 1.00 . B B . 58 HIS CG   1 1 
        2  4969 2 1 58 HIS H    H  30.243 15.178   4.724 1.00 . B B . 58 HIS H    1 1 
        2  4970 2 1 58 HIS HA   H  31.995 13.546   6.321 1.00 . B B . 58 HIS HA   1 1 
        2  4971 2 1 58 HIS HB2  H  31.934 16.525   5.751 1.00 . B B . 58 HIS HB2  1 1 
        2  4972 2 1 58 HIS HB3  H  33.189 15.738   6.710 1.00 . B B . 58 HIS HB3  1 1 
        2  4973 2 1 58 HIS HD1  H  33.441 13.135   5.008 1.00 . B B . 58 HIS HD1  1 1 
        2  4974 2 1 58 HIS HD2  H  33.439 16.990   3.418 1.00 . B B . 58 HIS HD2  1 1 
        2  4975 2 1 58 HIS HE1  H  34.600 12.984   2.761 1.00 . B B . 58 HIS HE1  1 1 
        2  4976 2 1 58 HIS HE2  H  34.606 15.326   1.779 1.00 . B B . 58 HIS HE2  1 1 
        2  4977 2 1 58 HIS N    N  30.384 14.428   5.338 1.00 . B B . 58 HIS N    1 1 
        2  4978 2 1 58 HIS ND1  N  33.583 13.901   4.412 1.00 . B B . 58 HIS ND1  1 1 
        2  4979 2 1 58 HIS NE2  N  34.223 15.084   2.647 1.00 . B B . 58 HIS NE2  1 1 
        2  4980 2 1 58 HIS O    O  31.351 14.157   8.684 1.00 . B B . 58 HIS O    1 1 
        2  4981 2 1 59 LEU C    C  28.836 14.846   9.775 1.00 . B B . 59 LEU C    1 1 
        2  4982 2 1 59 LEU CA   C  29.413 16.084   9.089 1.00 . B B . 59 LEU CA   1 1 
        2  4983 2 1 59 LEU CB   C  28.302 17.127   8.898 1.00 . B B . 59 LEU CB   1 1 
        2  4984 2 1 59 LEU CD1  C  28.922 18.484  10.981 1.00 . B B . 59 LEU CD1  1 1 
        2  4985 2 1 59 LEU CD2  C  26.571 18.529  10.046 1.00 . B B . 59 LEU CD2  1 1 
        2  4986 2 1 59 LEU CG   C  27.818 17.664  10.268 1.00 . B B . 59 LEU CG   1 1 
        2  4987 2 1 59 LEU H    H  29.701 16.183   6.985 1.00 . B B . 59 LEU H    1 1 
        2  4988 2 1 59 LEU HA   H  30.185 16.503   9.714 1.00 . B B . 59 LEU HA   1 1 
        2  4989 2 1 59 LEU HB2  H  28.677 17.945   8.301 1.00 . B B . 59 LEU HB2  1 1 
        2  4990 2 1 59 LEU HB3  H  27.471 16.667   8.385 1.00 . B B . 59 LEU HB3  1 1 
        2  4991 2 1 59 LEU HD11 H  29.543 17.818  11.566 1.00 . B B . 59 LEU HD11 1 1 
        2  4992 2 1 59 LEU HD12 H  28.469 19.210  11.647 1.00 . B B . 59 LEU HD12 1 1 
        2  4993 2 1 59 LEU HD13 H  29.533 19.000  10.257 1.00 . B B . 59 LEU HD13 1 1 
        2  4994 2 1 59 LEU HD21 H  26.212 18.884  10.999 1.00 . B B . 59 LEU HD21 1 1 
        2  4995 2 1 59 LEU HD22 H  25.806 17.933   9.573 1.00 . B B . 59 LEU HD22 1 1 
        2  4996 2 1 59 LEU HD23 H  26.816 19.370   9.415 1.00 . B B . 59 LEU HD23 1 1 
        2  4997 2 1 59 LEU HG   H  27.554 16.836  10.901 1.00 . B B . 59 LEU HG   1 1 
        2  4998 2 1 59 LEU N    N  29.997 15.721   7.797 1.00 . B B . 59 LEU N    1 1 
        2  4999 2 1 59 LEU O    O  28.800 14.770  11.003 1.00 . B B . 59 LEU O    1 1 
        2  5000 2 1 60 ASP C    C  28.764 12.043  10.555 1.00 . B B . 60 ASP C    1 1 
        2  5001 2 1 60 ASP CA   C  27.817 12.655   9.529 1.00 . B B . 60 ASP CA   1 1 
        2  5002 2 1 60 ASP CB   C  27.548 11.640   8.407 1.00 . B B . 60 ASP CB   1 1 
        2  5003 2 1 60 ASP CG   C  26.455 12.161   7.483 1.00 . B B . 60 ASP CG   1 1 
        2  5004 2 1 60 ASP H    H  28.443 13.998   8.005 1.00 . B B . 60 ASP H    1 1 
        2  5005 2 1 60 ASP HA   H  26.882 12.889  10.017 1.00 . B B . 60 ASP HA   1 1 
        2  5006 2 1 60 ASP HB2  H  28.453 11.480   7.841 1.00 . B B . 60 ASP HB2  1 1 
        2  5007 2 1 60 ASP HB3  H  27.228 10.703   8.839 1.00 . B B . 60 ASP HB3  1 1 
        2  5008 2 1 60 ASP N    N  28.390 13.882   8.977 1.00 . B B . 60 ASP N    1 1 
        2  5009 2 1 60 ASP O    O  28.327 11.520  11.580 1.00 . B B . 60 ASP O    1 1 
        2  5010 2 1 60 ASP OD1  O  25.652 12.955   7.946 1.00 . B B . 60 ASP OD1  1 1 
        2  5011 2 1 60 ASP OD2  O  26.430 11.760   6.331 1.00 . B B . 60 ASP OD2  1 1 
        2  5012 2 1 61 GLU C    C  30.868 12.109  12.587 1.00 . B B . 61 GLU C    1 1 
        2  5013 2 1 61 GLU CA   C  31.060 11.551  11.177 1.00 . B B . 61 GLU CA   1 1 
        2  5014 2 1 61 GLU CB   C  32.476 11.883  10.663 1.00 . B B . 61 GLU CB   1 1 
        2  5015 2 1 61 GLU CD   C  34.055 13.793  10.187 1.00 . B B . 61 GLU CD   1 1 
        2  5016 2 1 61 GLU CG   C  32.881 13.327  11.042 1.00 . B B . 61 GLU CG   1 1 
        2  5017 2 1 61 GLU H    H  30.351 12.531   9.438 1.00 . B B . 61 GLU H    1 1 
        2  5018 2 1 61 GLU HA   H  30.943 10.477  11.210 1.00 . B B . 61 GLU HA   1 1 
        2  5019 2 1 61 GLU HB2  H  33.186 11.192  11.101 1.00 . B B . 61 GLU HB2  1 1 
        2  5020 2 1 61 GLU HB3  H  32.490 11.775   9.589 1.00 . B B . 61 GLU HB3  1 1 
        2  5021 2 1 61 GLU HG2  H  32.045 13.992  10.900 1.00 . B B . 61 GLU HG2  1 1 
        2  5022 2 1 61 GLU HG3  H  33.174 13.355  12.084 1.00 . B B . 61 GLU HG3  1 1 
        2  5023 2 1 61 GLU N    N  30.061 12.103  10.270 1.00 . B B . 61 GLU N    1 1 
        2  5024 2 1 61 GLU O    O  31.180 11.441  13.573 1.00 . B B . 61 GLU O    1 1 
        2  5025 2 1 61 GLU OE1  O  34.048 13.522   8.997 1.00 . B B . 61 GLU OE1  1 1 
        2  5026 2 1 61 GLU OE2  O  34.936 14.436  10.734 1.00 . B B . 61 GLU OE2  1 1 
        2  5027 2 1 62 ALA C    C  28.999 13.293  14.694 1.00 . B B . 62 ALA C    1 1 
        2  5028 2 1 62 ALA CA   C  30.147 13.963  13.965 1.00 . B B . 62 ALA CA   1 1 
        2  5029 2 1 62 ALA CB   C  29.839 15.453  13.800 1.00 . B B . 62 ALA CB   1 1 
        2  5030 2 1 62 ALA H    H  30.135 13.822  11.855 1.00 . B B . 62 ALA H    1 1 
        2  5031 2 1 62 ALA HA   H  31.039 13.855  14.550 1.00 . B B . 62 ALA HA   1 1 
        2  5032 2 1 62 ALA HB1  H  29.752 15.915  14.775 1.00 . B B . 62 ALA HB1  1 1 
        2  5033 2 1 62 ALA HB2  H  28.910 15.571  13.266 1.00 . B B . 62 ALA HB2  1 1 
        2  5034 2 1 62 ALA HB3  H  30.636 15.928  13.248 1.00 . B B . 62 ALA HB3  1 1 
        2  5035 2 1 62 ALA N    N  30.364 13.336  12.674 1.00 . B B . 62 ALA N    1 1 
        2  5036 2 1 62 ALA O    O  29.153 12.858  15.836 1.00 . B B . 62 ALA O    1 1 
        2  5037 2 1 63 TYR C    C  27.036 11.212  15.214 1.00 . B B . 63 TYR C    1 1 
        2  5038 2 1 63 TYR CA   C  26.671 12.593  14.638 1.00 . B B . 63 TYR CA   1 1 
        2  5039 2 1 63 TYR CB   C  25.536 12.461  13.572 1.00 . B B . 63 TYR CB   1 1 
        2  5040 2 1 63 TYR CD1  C  25.594 10.023  12.924 1.00 . B B . 63 TYR CD1  1 1 
        2  5041 2 1 63 TYR CD2  C  23.739 10.798  14.281 1.00 . B B . 63 TYR CD2  1 1 
        2  5042 2 1 63 TYR CE1  C  25.073  8.724  12.954 1.00 . B B . 63 TYR CE1  1 1 
        2  5043 2 1 63 TYR CE2  C  23.218  9.500  14.311 1.00 . B B . 63 TYR CE2  1 1 
        2  5044 2 1 63 TYR CG   C  24.927 11.060  13.587 1.00 . B B . 63 TYR CG   1 1 
        2  5045 2 1 63 TYR CZ   C  23.885  8.462  13.648 1.00 . B B . 63 TYR CZ   1 1 
        2  5046 2 1 63 TYR H    H  27.781 13.575  13.131 1.00 . B B . 63 TYR H    1 1 
        2  5047 2 1 63 TYR HA   H  26.336 13.238  15.432 1.00 . B B . 63 TYR HA   1 1 
        2  5048 2 1 63 TYR HB2  H  24.761 13.190  13.772 1.00 . B B . 63 TYR HB2  1 1 
        2  5049 2 1 63 TYR HB3  H  25.951 12.654  12.592 1.00 . B B . 63 TYR HB3  1 1 
        2  5050 2 1 63 TYR HD1  H  26.509 10.222  12.392 1.00 . B B . 63 TYR HD1  1 1 
        2  5051 2 1 63 TYR HD2  H  23.229 11.598  14.792 1.00 . B B . 63 TYR HD2  1 1 
        2  5052 2 1 63 TYR HE1  H  25.588  7.924  12.445 1.00 . B B . 63 TYR HE1  1 1 
        2  5053 2 1 63 TYR HE2  H  22.305  9.294  14.851 1.00 . B B . 63 TYR HE2  1 1 
        2  5054 2 1 63 TYR HH   H  22.422  7.230  13.760 1.00 . B B . 63 TYR HH   1 1 
        2  5055 2 1 63 TYR N    N  27.846 13.211  14.038 1.00 . B B . 63 TYR N    1 1 
        2  5056 2 1 63 TYR O    O  26.546 10.810  16.270 1.00 . B B . 63 TYR O    1 1 
        2  5057 2 1 63 TYR OH   O  23.376  7.174  13.679 1.00 . B B . 63 TYR OH   1 1 
        2  5058 2 1 64 ASN C    C  29.256  9.223  16.089 1.00 . B B . 64 ASN C    1 1 
        2  5059 2 1 64 ASN CA   C  28.300  9.151  14.909 1.00 . B B . 64 ASN CA   1 1 
        2  5060 2 1 64 ASN CB   C  28.962  8.420  13.743 1.00 . B B . 64 ASN CB   1 1 
        2  5061 2 1 64 ASN CG   C  29.348  7.006  14.161 1.00 . B B . 64 ASN CG   1 1 
        2  5062 2 1 64 ASN H    H  28.241 10.860  13.654 1.00 . B B . 64 ASN H    1 1 
        2  5063 2 1 64 ASN HA   H  27.427  8.593  15.213 1.00 . B B . 64 ASN HA   1 1 
        2  5064 2 1 64 ASN HB2  H  28.267  8.372  12.916 1.00 . B B . 64 ASN HB2  1 1 
        2  5065 2 1 64 ASN HB3  H  29.846  8.959  13.437 1.00 . B B . 64 ASN HB3  1 1 
        2  5066 2 1 64 ASN HD21 H  30.945  6.928  12.984 1.00 . B B . 64 ASN HD21 1 1 
        2  5067 2 1 64 ASN HD22 H  30.649  5.529  13.899 1.00 . B B . 64 ASN HD22 1 1 
        2  5068 2 1 64 ASN N    N  27.882 10.489  14.488 1.00 . B B . 64 ASN N    1 1 
        2  5069 2 1 64 ASN ND2  N  30.402  6.441  13.639 1.00 . B B . 64 ASN ND2  1 1 
        2  5070 2 1 64 ASN O    O  29.207  8.402  17.004 1.00 . B B . 64 ASN O    1 1 
        2  5071 2 1 64 ASN OD1  O  28.671  6.400  14.992 1.00 . B B . 64 ASN OD1  1 1 
        2  5072 2 1 65 LYS C    C  30.401 10.655  18.448 1.00 . B B . 65 LYS C    1 1 
        2  5073 2 1 65 LYS CA   C  31.112 10.389  17.120 1.00 . B B . 65 LYS CA   1 1 
        2  5074 2 1 65 LYS CB   C  32.047 11.560  16.770 1.00 . B B . 65 LYS CB   1 1 
        2  5075 2 1 65 LYS CD   C  34.341 10.543  16.438 1.00 . B B . 65 LYS CD   1 1 
        2  5076 2 1 65 LYS CE   C  35.369 10.110  15.396 1.00 . B B . 65 LYS CE   1 1 
        2  5077 2 1 65 LYS CG   C  33.114 11.128  15.731 1.00 . B B . 65 LYS CG   1 1 
        2  5078 2 1 65 LYS H    H  30.133 10.839  15.297 1.00 . B B . 65 LYS H    1 1 
        2  5079 2 1 65 LYS HA   H  31.695  9.485  17.215 1.00 . B B . 65 LYS HA   1 1 
        2  5080 2 1 65 LYS HB2  H  31.450 12.357  16.354 1.00 . B B . 65 LYS HB2  1 1 
        2  5081 2 1 65 LYS HB3  H  32.537 11.920  17.666 1.00 . B B . 65 LYS HB3  1 1 
        2  5082 2 1 65 LYS HD2  H  34.774 11.298  17.080 1.00 . B B . 65 LYS HD2  1 1 
        2  5083 2 1 65 LYS HD3  H  34.050  9.692  17.033 1.00 . B B . 65 LYS HD3  1 1 
        2  5084 2 1 65 LYS HE2  H  34.941  9.348  14.760 1.00 . B B . 65 LYS HE2  1 1 
        2  5085 2 1 65 LYS HE3  H  35.659 10.959  14.795 1.00 . B B . 65 LYS HE3  1 1 
        2  5086 2 1 65 LYS HG2  H  32.702 10.378  15.069 1.00 . B B . 65 LYS HG2  1 1 
        2  5087 2 1 65 LYS HG3  H  33.419 11.982  15.151 1.00 . B B . 65 LYS HG3  1 1 
        2  5088 2 1 65 LYS HZ1  H  37.148 10.350  16.442 1.00 . B B . 65 LYS HZ1  1 1 
        2  5089 2 1 65 LYS HZ2  H  37.113  8.979  15.442 1.00 . B B . 65 LYS HZ2  1 1 
        2  5090 2 1 65 LYS HZ3  H  36.248  8.985  16.903 1.00 . B B . 65 LYS HZ3  1 1 
        2  5091 2 1 65 LYS N    N  30.140 10.215  16.052 1.00 . B B . 65 LYS N    1 1 
        2  5092 2 1 65 LYS NZ   N  36.560  9.564  16.097 1.00 . B B . 65 LYS NZ   1 1 
        2  5093 2 1 65 LYS O    O  30.824 10.149  19.487 1.00 . B B . 65 LYS O    1 1 
        2  5094 2 1 66 VAL C    C  28.077 10.484  20.271 1.00 . B B . 66 VAL C    1 1 
        2  5095 2 1 66 VAL CA   C  28.611 11.761  19.629 1.00 . B B . 66 VAL CA   1 1 
        2  5096 2 1 66 VAL CB   C  27.444 12.730  19.319 1.00 . B B . 66 VAL CB   1 1 
        2  5097 2 1 66 VAL CG1  C  26.576 12.940  20.576 1.00 . B B . 66 VAL CG1  1 1 
        2  5098 2 1 66 VAL CG2  C  28.021 14.074  18.843 1.00 . B B . 66 VAL CG2  1 1 
        2  5099 2 1 66 VAL H    H  29.040 11.819  17.552 1.00 . B B . 66 VAL H    1 1 
        2  5100 2 1 66 VAL HA   H  29.286 12.239  20.318 1.00 . B B . 66 VAL HA   1 1 
        2  5101 2 1 66 VAL HB   H  26.825 12.313  18.532 1.00 . B B . 66 VAL HB   1 1 
        2  5102 2 1 66 VAL HG11 H  25.953 13.815  20.453 1.00 . B B . 66 VAL HG11 1 1 
        2  5103 2 1 66 VAL HG12 H  27.210 13.075  21.439 1.00 . B B . 66 VAL HG12 1 1 
        2  5104 2 1 66 VAL HG13 H  25.946 12.073  20.727 1.00 . B B . 66 VAL HG13 1 1 
        2  5105 2 1 66 VAL HG21 H  28.449 13.950  17.859 1.00 . B B . 66 VAL HG21 1 1 
        2  5106 2 1 66 VAL HG22 H  28.786 14.410  19.528 1.00 . B B . 66 VAL HG22 1 1 
        2  5107 2 1 66 VAL HG23 H  27.233 14.810  18.800 1.00 . B B . 66 VAL HG23 1 1 
        2  5108 2 1 66 VAL N    N  29.332 11.444  18.410 1.00 . B B . 66 VAL N    1 1 
        2  5109 2 1 66 VAL O    O  28.264 10.252  21.465 1.00 . B B . 66 VAL O    1 1 
        2  5110 2 1 67 LYS C    C  27.939  7.385  20.243 1.00 . B B . 67 LYS C    1 1 
        2  5111 2 1 67 LYS CA   C  26.851  8.412  19.983 1.00 . B B . 67 LYS CA   1 1 
        2  5112 2 1 67 LYS CB   C  25.866  7.850  18.967 1.00 . B B . 67 LYS CB   1 1 
        2  5113 2 1 67 LYS CD   C  23.337  8.164  18.791 1.00 . B B . 67 LYS CD   1 1 
        2  5114 2 1 67 LYS CE   C  23.157  7.281  17.559 1.00 . B B . 67 LYS CE   1 1 
        2  5115 2 1 67 LYS CG   C  24.707  8.866  18.752 1.00 . B B . 67 LYS CG   1 1 
        2  5116 2 1 67 LYS H    H  27.284  9.902  18.527 1.00 . B B . 67 LYS H    1 1 
        2  5117 2 1 67 LYS HA   H  26.324  8.605  20.908 1.00 . B B . 67 LYS HA   1 1 
        2  5118 2 1 67 LYS HB2  H  26.398  7.684  18.034 1.00 . B B . 67 LYS HB2  1 1 
        2  5119 2 1 67 LYS HB3  H  25.487  6.908  19.326 1.00 . B B . 67 LYS HB3  1 1 
        2  5120 2 1 67 LYS HD2  H  23.274  7.559  19.684 1.00 . B B . 67 LYS HD2  1 1 
        2  5121 2 1 67 LYS HD3  H  22.557  8.905  18.815 1.00 . B B . 67 LYS HD3  1 1 
        2  5122 2 1 67 LYS HE2  H  23.329  7.868  16.669 1.00 . B B . 67 LYS HE2  1 1 
        2  5123 2 1 67 LYS HE3  H  23.863  6.467  17.595 1.00 . B B . 67 LYS HE3  1 1 
        2  5124 2 1 67 LYS HG2  H  24.723  9.625  19.526 1.00 . B B . 67 LYS HG2  1 1 
        2  5125 2 1 67 LYS HG3  H  24.840  9.347  17.794 1.00 . B B . 67 LYS HG3  1 1 
        2  5126 2 1 67 LYS HZ1  H  21.554  6.370  16.582 1.00 . B B . 67 LYS HZ1  1 1 
        2  5127 2 1 67 LYS HZ2  H  21.089  7.486  17.771 1.00 . B B . 67 LYS HZ2  1 1 
        2  5128 2 1 67 LYS HZ3  H  21.684  5.960  18.225 1.00 . B B . 67 LYS HZ3  1 1 
        2  5129 2 1 67 LYS N    N  27.403  9.665  19.471 1.00 . B B . 67 LYS N    1 1 
        2  5130 2 1 67 LYS NZ   N  21.765  6.734  17.532 1.00 . B B . 67 LYS NZ   1 1 
        2  5131 2 1 67 LYS O    O  28.010  6.778  21.313 1.00 . B B . 67 LYS O    1 1 
        2  5132 2 1 68 ARG C    C  30.744  6.547  20.535 1.00 . B B . 68 ARG C    1 1 
        2  5133 2 1 68 ARG CA   C  29.871  6.230  19.336 1.00 . B B . 68 ARG CA   1 1 
        2  5134 2 1 68 ARG CB   C  30.703  6.258  18.050 1.00 . B B . 68 ARG CB   1 1 
        2  5135 2 1 68 ARG CD   C  32.430  5.027  16.718 1.00 . B B . 68 ARG CD   1 1 
        2  5136 2 1 68 ARG CG   C  31.705  5.105  18.063 1.00 . B B . 68 ARG CG   1 1 
        2  5137 2 1 68 ARG CZ   C  34.480  6.285  17.115 1.00 . B B . 68 ARG CZ   1 1 
        2  5138 2 1 68 ARG H    H  28.689  7.704  18.415 1.00 . B B . 68 ARG H    1 1 
        2  5139 2 1 68 ARG HA   H  29.446  5.245  19.461 1.00 . B B . 68 ARG HA   1 1 
        2  5140 2 1 68 ARG HB2  H  30.046  6.158  17.198 1.00 . B B . 68 ARG HB2  1 1 
        2  5141 2 1 68 ARG HB3  H  31.235  7.196  17.985 1.00 . B B . 68 ARG HB3  1 1 
        2  5142 2 1 68 ARG HD2  H  33.027  4.129  16.686 1.00 . B B . 68 ARG HD2  1 1 
        2  5143 2 1 68 ARG HD3  H  31.696  4.993  15.923 1.00 . B B . 68 ARG HD3  1 1 
        2  5144 2 1 68 ARG HE   H  32.979  6.932  15.963 1.00 . B B . 68 ARG HE   1 1 
        2  5145 2 1 68 ARG HG2  H  32.420  5.266  18.852 1.00 . B B . 68 ARG HG2  1 1 
        2  5146 2 1 68 ARG HG3  H  31.179  4.179  18.237 1.00 . B B . 68 ARG HG3  1 1 
        2  5147 2 1 68 ARG HH11 H  34.342  4.502  18.015 1.00 . B B . 68 ARG HH11 1 1 
        2  5148 2 1 68 ARG HH12 H  35.805  5.380  18.310 1.00 . B B . 68 ARG HH12 1 1 
        2  5149 2 1 68 ARG HH21 H  34.891  8.088  16.348 1.00 . B B . 68 ARG HH21 1 1 
        2  5150 2 1 68 ARG HH22 H  36.117  7.409  17.367 1.00 . B B . 68 ARG HH22 1 1 
        2  5151 2 1 68 ARG N    N  28.794  7.192  19.244 1.00 . B B . 68 ARG N    1 1 
        2  5152 2 1 68 ARG NE   N  33.288  6.196  16.532 1.00 . B B . 68 ARG NE   1 1 
        2  5153 2 1 68 ARG NH1  N  34.909  5.313  17.873 1.00 . B B . 68 ARG NH1  1 1 
        2  5154 2 1 68 ARG NH2  N  35.219  7.344  16.929 1.00 . B B . 68 ARG NH2  1 1 
        2  5155 2 1 68 ARG O    O  31.300  5.649  21.166 1.00 . B B . 68 ARG O    1 1 
        2  5156 2 1 69 GLY C    C  30.915  8.040  23.293 1.00 . B B . 69 GLY C    1 1 
        2  5157 2 1 69 GLY CA   C  31.656  8.274  21.982 1.00 . B B . 69 GLY CA   1 1 
        2  5158 2 1 69 GLY H    H  30.389  8.505  20.313 1.00 . B B . 69 GLY H    1 1 
        2  5159 2 1 69 GLY HA2  H  32.596  7.738  21.992 1.00 . B B . 69 GLY HA2  1 1 
        2  5160 2 1 69 GLY HA3  H  31.851  9.328  21.874 1.00 . B B . 69 GLY HA3  1 1 
        2  5161 2 1 69 GLY N    N  30.856  7.833  20.853 1.00 . B B . 69 GLY N    1 1 
        2  5162 2 1 69 GLY O    O  31.500  8.128  24.373 1.00 . B B . 69 GLY O    1 1 
        2  5163 2 1 70 GLU C    C  28.534  6.007  24.548 1.00 . B B . 70 GLU C    1 1 
        2  5164 2 1 70 GLU CA   C  28.794  7.498  24.377 1.00 . B B . 70 GLU CA   1 1 
        2  5165 2 1 70 GLU CB   C  27.467  8.249  24.220 1.00 . B B . 70 GLU CB   1 1 
        2  5166 2 1 70 GLU CD   C  27.881 10.231  25.732 1.00 . B B . 70 GLU CD   1 1 
        2  5167 2 1 70 GLU CG   C  27.715  9.771  24.285 1.00 . B B . 70 GLU CG   1 1 
        2  5168 2 1 70 GLU H    H  29.211  7.687  22.303 1.00 . B B . 70 GLU H    1 1 
        2  5169 2 1 70 GLU HA   H  29.298  7.867  25.260 1.00 . B B . 70 GLU HA   1 1 
        2  5170 2 1 70 GLU HB2  H  27.027  7.995  23.265 1.00 . B B . 70 GLU HB2  1 1 
        2  5171 2 1 70 GLU HB3  H  26.791  7.958  25.013 1.00 . B B . 70 GLU HB3  1 1 
        2  5172 2 1 70 GLU HG2  H  28.619 10.011  23.745 1.00 . B B . 70 GLU HG2  1 1 
        2  5173 2 1 70 GLU HG3  H  26.885 10.291  23.832 1.00 . B B . 70 GLU HG3  1 1 
        2  5174 2 1 70 GLU N    N  29.624  7.744  23.191 1.00 . B B . 70 GLU N    1 1 
        2  5175 2 1 70 GLU O    O  29.046  5.185  23.789 1.00 . B B . 70 GLU O    1 1 
        2  5176 2 1 70 GLU OE1  O  27.030  9.903  26.542 1.00 . B B . 70 GLU OE1  1 1 
        2  5177 2 1 70 GLU OE2  O  28.862 10.901  26.006 1.00 . B B . 70 GLU OE2  1 1 
        2  5178 2 1 71 SER C    C  28.689  3.416  25.848 1.00 . B B . 71 SER C    1 1 
        2  5179 2 1 71 SER CA   C  27.419  4.265  25.826 1.00 . B B . 71 SER CA   1 1 
        2  5180 2 1 71 SER CB   C  26.470  3.735  24.751 1.00 . B B . 71 SER CB   1 1 
        2  5181 2 1 71 SER H    H  27.358  6.362  26.129 1.00 . B B . 71 SER H    1 1 
        2  5182 2 1 71 SER HA   H  26.931  4.195  26.787 1.00 . B B . 71 SER HA   1 1 
        2  5183 2 1 71 SER HB2  H  26.094  2.769  25.042 1.00 . B B . 71 SER HB2  1 1 
        2  5184 2 1 71 SER HB3  H  25.640  4.421  24.634 1.00 . B B . 71 SER HB3  1 1 
        2  5185 2 1 71 SER HG   H  27.035  4.417  23.017 1.00 . B B . 71 SER HG   1 1 
        2  5186 2 1 71 SER N    N  27.738  5.664  25.555 1.00 . B B . 71 SER N    1 1 
        2  5187 2 1 71 SER O    O  29.776  3.918  26.134 1.00 . B B . 71 SER O    1 1 
        2  5188 2 1 71 SER OG   O  27.175  3.612  23.521 1.00 . B B . 71 SER OG   1 1 
        2  5189 2 1 72 LYS C    C  30.481  1.326  26.834 1.00 . B B . 72 LYS C    1 1 
        2  5190 2 1 72 LYS CA   C  29.691  1.223  25.526 1.00 . B B . 72 LYS CA   1 1 
        2  5191 2 1 72 LYS CB   C  30.607  1.565  24.345 1.00 . B B . 72 LYS CB   1 1 
        2  5192 2 1 72 LYS CD   C  30.785  1.654  21.847 1.00 . B B . 72 LYS CD   1 1 
        2  5193 2 1 72 LYS CE   C  30.038  1.402  20.535 1.00 . B B . 72 LYS CE   1 1 
        2  5194 2 1 72 LYS CG   C  29.886  1.271  23.026 1.00 . B B . 72 LYS CG   1 1 
        2  5195 2 1 72 LYS H    H  27.653  1.786  25.320 1.00 . B B . 72 LYS H    1 1 
        2  5196 2 1 72 LYS HA   H  29.335  0.210  25.412 1.00 . B B . 72 LYS HA   1 1 
        2  5197 2 1 72 LYS HB2  H  30.868  2.613  24.387 1.00 . B B . 72 LYS HB2  1 1 
        2  5198 2 1 72 LYS HB3  H  31.505  0.969  24.402 1.00 . B B . 72 LYS HB3  1 1 
        2  5199 2 1 72 LYS HD2  H  31.045  2.700  21.918 1.00 . B B . 72 LYS HD2  1 1 
        2  5200 2 1 72 LYS HD3  H  31.683  1.056  21.868 1.00 . B B . 72 LYS HD3  1 1 
        2  5201 2 1 72 LYS HE2  H  29.137  1.997  20.512 1.00 . B B . 72 LYS HE2  1 1 
        2  5202 2 1 72 LYS HE3  H  30.671  1.674  19.701 1.00 . B B . 72 LYS HE3  1 1 
        2  5203 2 1 72 LYS HG2  H  29.651  0.216  22.972 1.00 . B B . 72 LYS HG2  1 1 
        2  5204 2 1 72 LYS HG3  H  28.972  1.844  22.980 1.00 . B B . 72 LYS HG3  1 1 
        2  5205 2 1 72 LYS HZ1  H  30.500 -0.620  20.714 1.00 . B B . 72 LYS HZ1  1 1 
        2  5206 2 1 72 LYS HZ2  H  29.415 -0.269  19.460 1.00 . B B . 72 LYS HZ2  1 1 
        2  5207 2 1 72 LYS HZ3  H  28.883 -0.245  21.073 1.00 . B B . 72 LYS HZ3  1 1 
        2  5208 2 1 72 LYS N    N  28.544  2.131  25.540 1.00 . B B . 72 LYS N    1 1 
        2  5209 2 1 72 LYS NZ   N  29.683 -0.042  20.438 1.00 . B B . 72 LYS NZ   1 1 
        2  5210 2 1 72 LYS O    O  30.239  0.575  27.780 1.00 . B B . 72 LYS O    1 1 
        2  5211 2 1 73 LEU C    C  31.482  3.275  29.112 1.00 . B B . 73 LEU C    1 1 
        2  5212 2 1 73 LEU CA   C  32.250  2.467  28.066 1.00 . B B . 73 LEU CA   1 1 
        2  5213 2 1 73 LEU CB   C  33.538  3.209  27.679 1.00 . B B . 73 LEU CB   1 1 
        2  5214 2 1 73 LEU CD1  C  35.466  3.296  26.091 1.00 . B B . 73 LEU CD1  1 1 
        2  5215 2 1 73 LEU CD2  C  34.472  1.064  26.709 1.00 . B B . 73 LEU CD2  1 1 
        2  5216 2 1 73 LEU CG   C  34.171  2.555  26.442 1.00 . B B . 73 LEU CG   1 1 
        2  5217 2 1 73 LEU H    H  31.571  2.832  26.093 1.00 . B B . 73 LEU H    1 1 
        2  5218 2 1 73 LEU HA   H  32.511  1.510  28.493 1.00 . B B . 73 LEU HA   1 1 
        2  5219 2 1 73 LEU HB2  H  33.308  4.240  27.454 1.00 . B B . 73 LEU HB2  1 1 
        2  5220 2 1 73 LEU HB3  H  34.240  3.169  28.501 1.00 . B B . 73 LEU HB3  1 1 
        2  5221 2 1 73 LEU HD11 H  35.930  2.830  25.233 1.00 . B B . 73 LEU HD11 1 1 
        2  5222 2 1 73 LEU HD12 H  36.144  3.258  26.932 1.00 . B B . 73 LEU HD12 1 1 
        2  5223 2 1 73 LEU HD13 H  35.237  4.326  25.860 1.00 . B B . 73 LEU HD13 1 1 
        2  5224 2 1 73 LEU HD21 H  34.912  0.949  27.689 1.00 . B B . 73 LEU HD21 1 1 
        2  5225 2 1 73 LEU HD22 H  35.158  0.691  25.961 1.00 . B B . 73 LEU HD22 1 1 
        2  5226 2 1 73 LEU HD23 H  33.555  0.496  26.657 1.00 . B B . 73 LEU HD23 1 1 
        2  5227 2 1 73 LEU HG   H  33.485  2.637  25.610 1.00 . B B . 73 LEU HG   1 1 
        2  5228 2 1 73 LEU N    N  31.422  2.263  26.876 1.00 . B B . 73 LEU N    1 1 
        2  5229 2 1 73 LEU O    O  31.998  3.550  30.196 1.00 . B B . 73 LEU O    1 1 
        2  5230 2 1 74 GLU C    C  30.124  5.697  30.121 1.00 . B B . 74 GLU C    1 1 
        2  5231 2 1 74 GLU CA   C  29.409  4.422  29.690 1.00 . B B . 74 GLU CA   1 1 
        2  5232 2 1 74 GLU CB   C  29.063  3.585  30.925 1.00 . B B . 74 GLU CB   1 1 
        2  5233 2 1 74 GLU CD   C  27.881  1.528  31.739 1.00 . B B . 74 GLU CD   1 1 
        2  5234 2 1 74 GLU CG   C  28.190  2.395  30.518 1.00 . B B . 74 GLU CG   1 1 
        2  5235 2 1 74 GLU H    H  29.892  3.400  27.903 1.00 . B B . 74 GLU H    1 1 
        2  5236 2 1 74 GLU HA   H  28.495  4.688  29.182 1.00 . B B . 74 GLU HA   1 1 
        2  5237 2 1 74 GLU HB2  H  29.971  3.223  31.379 1.00 . B B . 74 GLU HB2  1 1 
        2  5238 2 1 74 GLU HB3  H  28.525  4.195  31.636 1.00 . B B . 74 GLU HB3  1 1 
        2  5239 2 1 74 GLU HG2  H  27.266  2.758  30.093 1.00 . B B . 74 GLU HG2  1 1 
        2  5240 2 1 74 GLU HG3  H  28.714  1.802  29.784 1.00 . B B . 74 GLU HG3  1 1 
        2  5241 2 1 74 GLU N    N  30.251  3.648  28.781 1.00 . B B . 74 GLU N    1 1 
        2  5242 2 1 74 GLU O    O  29.673  6.404  31.021 1.00 . B B . 74 GLU O    1 1 
        2  5243 2 1 74 GLU OE1  O  28.279  1.908  32.827 1.00 . B B . 74 GLU OE1  1 1 
        2  5244 2 1 74 GLU OE2  O  27.242  0.503  31.564 1.00 . B B . 74 GLU OE2  1 1 
        2  5245 2 1 75 HIS C    C  32.460  7.161  31.259 1.00 . B B . 75 HIS C    1 1 
        2  5246 2 1 75 HIS CA   C  32.035  7.173  29.789 1.00 . B B . 75 HIS CA   1 1 
        2  5247 2 1 75 HIS CB   C  31.223  8.441  29.495 1.00 . B B . 75 HIS CB   1 1 
        2  5248 2 1 75 HIS CD2  C  32.059 10.627  30.693 1.00 . B B . 75 HIS CD2  1 1 
        2  5249 2 1 75 HIS CE1  C  33.676 11.128  29.340 1.00 . B B . 75 HIS CE1  1 1 
        2  5250 2 1 75 HIS CG   C  32.081  9.655  29.722 1.00 . B B . 75 HIS CG   1 1 
        2  5251 2 1 75 HIS H    H  31.559  5.382  28.762 1.00 . B B . 75 HIS H    1 1 
        2  5252 2 1 75 HIS HA   H  32.919  7.177  29.171 1.00 . B B . 75 HIS HA   1 1 
        2  5253 2 1 75 HIS HB2  H  30.890  8.426  28.467 1.00 . B B . 75 HIS HB2  1 1 
        2  5254 2 1 75 HIS HB3  H  30.367  8.487  30.148 1.00 . B B . 75 HIS HB3  1 1 
        2  5255 2 1 75 HIS HD1  H  33.400  9.502  28.070 1.00 . B B . 75 HIS HD1  1 1 
        2  5256 2 1 75 HIS HD2  H  31.364 10.664  31.518 1.00 . B B . 75 HIS HD2  1 1 
        2  5257 2 1 75 HIS HE1  H  34.512 11.629  28.877 1.00 . B B . 75 HIS HE1  1 1 
        2  5258 2 1 75 HIS HE2  H  33.284 12.351  30.977 1.00 . B B . 75 HIS HE2  1 1 
        2  5259 2 1 75 HIS N    N  31.248  5.982  29.470 1.00 . B B . 75 HIS N    1 1 
        2  5260 2 1 75 HIS ND1  N  33.121  9.995  28.869 1.00 . B B . 75 HIS ND1  1 1 
        2  5261 2 1 75 HIS NE2  N  33.068 11.555  30.449 1.00 . B B . 75 HIS NE2  1 1 
        2  5262 2 1 75 HIS O    O  31.720  6.683  32.120 1.00 . B B . 75 HIS O    1 1 
        2  5263 2 1 76 HIS C    C  33.766  9.042  33.581 1.00 . B B . 76 HIS C    1 1 
        2  5264 2 1 76 HIS CA   C  34.162  7.733  32.908 1.00 . B B . 76 HIS CA   1 1 
        2  5265 2 1 76 HIS CB   C  35.687  7.602  32.898 1.00 . B B . 76 HIS CB   1 1 
        2  5266 2 1 76 HIS CD2  C  36.719  5.963  31.122 1.00 . B B . 76 HIS CD2  1 1 
        2  5267 2 1 76 HIS CE1  C  36.264  4.090  32.114 1.00 . B B . 76 HIS CE1  1 1 
        2  5268 2 1 76 HIS CG   C  36.071  6.279  32.292 1.00 . B B . 76 HIS CG   1 1 
        2  5269 2 1 76 HIS H    H  34.194  8.054  30.810 1.00 . B B . 76 HIS H    1 1 
        2  5270 2 1 76 HIS HA   H  33.751  6.909  33.480 1.00 . B B . 76 HIS HA   1 1 
        2  5271 2 1 76 HIS HB2  H  36.114  8.403  32.314 1.00 . B B . 76 HIS HB2  1 1 
        2  5272 2 1 76 HIS HB3  H  36.061  7.654  33.910 1.00 . B B . 76 HIS HB3  1 1 
        2  5273 2 1 76 HIS HD1  H  35.332  4.949  33.765 1.00 . B B . 76 HIS HD1  1 1 
        2  5274 2 1 76 HIS HD2  H  37.078  6.677  30.397 1.00 . B B . 76 HIS HD2  1 1 
        2  5275 2 1 76 HIS HE1  H  36.186  3.037  32.340 1.00 . B B . 76 HIS HE1  1 1 
        2  5276 2 1 76 HIS HE2  H  37.254  4.075  30.283 1.00 . B B . 76 HIS HE2  1 1 
        2  5277 2 1 76 HIS N    N  33.648  7.687  31.537 1.00 . B B . 76 HIS N    1 1 
        2  5278 2 1 76 HIS ND1  N  35.791  5.070  32.908 1.00 . B B . 76 HIS ND1  1 1 
        2  5279 2 1 76 HIS NE2  N  36.838  4.581  31.013 1.00 . B B . 76 HIS NE2  1 1 
        2  5280 2 1 76 HIS O    O  33.787 10.105  32.960 1.00 . B B . 76 HIS O    1 1 
        2  5281 2 1 77 HIS C    C  33.393 10.001  37.082 1.00 . B B . 77 HIS C    1 1 
        2  5282 2 1 77 HIS CA   C  32.997 10.141  35.618 1.00 . B B . 77 HIS CA   1 1 
        2  5283 2 1 77 HIS CB   C  31.482 10.331  35.507 1.00 . B B . 77 HIS CB   1 1 
        2  5284 2 1 77 HIS CD2  C  30.100  8.899  37.225 1.00 . B B . 77 HIS CD2  1 1 
        2  5285 2 1 77 HIS CE1  C  30.030  7.045  36.107 1.00 . B B . 77 HIS CE1  1 1 
        2  5286 2 1 77 HIS CG   C  30.779  9.117  36.052 1.00 . B B . 77 HIS CG   1 1 
        2  5287 2 1 77 HIS H    H  33.407  8.082  35.300 1.00 . B B . 77 HIS H    1 1 
        2  5288 2 1 77 HIS HA   H  33.486 11.018  35.213 1.00 . B B . 77 HIS HA   1 1 
        2  5289 2 1 77 HIS HB2  H  31.185 11.202  36.074 1.00 . B B . 77 HIS HB2  1 1 
        2  5290 2 1 77 HIS HB3  H  31.211 10.467  34.471 1.00 . B B . 77 HIS HB3  1 1 
        2  5291 2 1 77 HIS HD1  H  31.112  7.744  34.473 1.00 . B B . 77 HIS HD1  1 1 
        2  5292 2 1 77 HIS HD2  H  29.954  9.633  38.003 1.00 . B B . 77 HIS HD2  1 1 
        2  5293 2 1 77 HIS HE1  H  29.825  6.026  35.815 1.00 . B B . 77 HIS HE1  1 1 
        2  5294 2 1 77 HIS HE2  H  29.111  7.163  37.972 1.00 . B B . 77 HIS HE2  1 1 
        2  5295 2 1 77 HIS N    N  33.404  8.956  34.857 1.00 . B B . 77 HIS N    1 1 
        2  5296 2 1 77 HIS ND1  N  30.721  7.920  35.354 1.00 . B B . 77 HIS ND1  1 1 
        2  5297 2 1 77 HIS NE2  N  29.628  7.591  37.258 1.00 . B B . 77 HIS NE2  1 1 
        2  5298 2 1 77 HIS O    O  33.095 10.872  37.899 1.00 . B B . 77 HIS O    1 1 
        2  5299 2 1 78 HIS C    C  35.532  9.702  39.199 1.00 . B B . 78 HIS C    1 1 
        2  5300 2 1 78 HIS CA   C  34.500  8.661  38.777 1.00 . B B . 78 HIS CA   1 1 
        2  5301 2 1 78 HIS CB   C  35.102  7.259  38.893 1.00 . B B . 78 HIS CB   1 1 
        2  5302 2 1 78 HIS CD2  C  36.707  6.855  40.936 1.00 . B B . 78 HIS CD2  1 1 
        2  5303 2 1 78 HIS CE1  C  35.201  6.623  42.478 1.00 . B B . 78 HIS CE1  1 1 
        2  5304 2 1 78 HIS CG   C  35.487  6.994  40.324 1.00 . B B . 78 HIS CG   1 1 
        2  5305 2 1 78 HIS H    H  34.276  8.243  36.714 1.00 . B B . 78 HIS H    1 1 
        2  5306 2 1 78 HIS HA   H  33.644  8.730  39.433 1.00 . B B . 78 HIS HA   1 1 
        2  5307 2 1 78 HIS HB2  H  34.375  6.527  38.574 1.00 . B B . 78 HIS HB2  1 1 
        2  5308 2 1 78 HIS HB3  H  35.980  7.192  38.268 1.00 . B B . 78 HIS HB3  1 1 
        2  5309 2 1 78 HIS HD1  H  33.567  6.888  41.216 1.00 . B B . 78 HIS HD1  1 1 
        2  5310 2 1 78 HIS HD2  H  37.663  6.918  40.439 1.00 . B B . 78 HIS HD2  1 1 
        2  5311 2 1 78 HIS HE1  H  34.721  6.469  43.432 1.00 . B B . 78 HIS HE1  1 1 
        2  5312 2 1 78 HIS HE2  H  37.218  6.484  42.974 1.00 . B B . 78 HIS HE2  1 1 
        2  5313 2 1 78 HIS N    N  34.067  8.903  37.408 1.00 . B B . 78 HIS N    1 1 
        2  5314 2 1 78 HIS ND1  N  34.540  6.843  41.327 1.00 . B B . 78 HIS ND1  1 1 
        2  5315 2 1 78 HIS NE2  N  36.525  6.620  42.297 1.00 . B B . 78 HIS NE2  1 1 
        2  5316 2 1 78 HIS O    O  35.477 10.229  40.312 1.00 . B B . 78 HIS O    1 1 
        2  5317 2 1 79 HIS C    C  36.902 12.340  38.865 1.00 . B B . 79 HIS C    1 1 
        2  5318 2 1 79 HIS CA   C  37.516 10.968  38.600 1.00 . B B . 79 HIS CA   1 1 
        2  5319 2 1 79 HIS CB   C  38.492 11.060  37.420 1.00 . B B . 79 HIS CB   1 1 
        2  5320 2 1 79 HIS CD2  C  40.359  9.263  37.871 1.00 . B B . 79 HIS CD2  1 1 
        2  5321 2 1 79 HIS CE1  C  39.662  7.735  36.502 1.00 . B B . 79 HIS CE1  1 1 
        2  5322 2 1 79 HIS CG   C  39.227  9.754  37.269 1.00 . B B . 79 HIS CG   1 1 
        2  5323 2 1 79 HIS H    H  36.468  9.540  37.438 1.00 . B B . 79 HIS H    1 1 
        2  5324 2 1 79 HIS HA   H  38.058 10.653  39.479 1.00 . B B . 79 HIS HA   1 1 
        2  5325 2 1 79 HIS HB2  H  37.943 11.270  36.515 1.00 . B B . 79 HIS HB2  1 1 
        2  5326 2 1 79 HIS HB3  H  39.203 11.852  37.602 1.00 . B B . 79 HIS HB3  1 1 
        2  5327 2 1 79 HIS HD1  H  38.013  8.803  35.817 1.00 . B B . 79 HIS HD1  1 1 
        2  5328 2 1 79 HIS HD2  H  40.949  9.788  38.608 1.00 . B B . 79 HIS HD2  1 1 
        2  5329 2 1 79 HIS HE1  H  39.581  6.818  35.937 1.00 . B B . 79 HIS HE1  1 1 
        2  5330 2 1 79 HIS HE2  H  41.377  7.402  37.635 1.00 . B B . 79 HIS HE2  1 1 
        2  5331 2 1 79 HIS N    N  36.474  9.992  38.307 1.00 . B B . 79 HIS N    1 1 
        2  5332 2 1 79 HIS ND1  N  38.799  8.762  36.400 1.00 . B B . 79 HIS ND1  1 1 
        2  5333 2 1 79 HIS NE2  N  40.632  7.989  37.384 1.00 . B B . 79 HIS NE2  1 1 
        2  5334 2 1 79 HIS O    O  37.324 13.053  39.775 1.00 . B B . 79 HIS O    1 1 
        2  5335 2 1 80 HIS C    C  33.994 14.065  37.344 1.00 . B B . 80 HIS C    1 1 
        2  5336 2 1 80 HIS CA   C  35.241 13.993  38.222 1.00 . B B . 80 HIS CA   1 1 
        2  5337 2 1 80 HIS CB   C  36.202 15.122  37.844 1.00 . B B . 80 HIS CB   1 1 
        2  5338 2 1 80 HIS CD2  C  36.320 15.619  35.266 1.00 . B B . 80 HIS CD2  1 1 
        2  5339 2 1 80 HIS CE1  C  37.738 14.077  34.712 1.00 . B B . 80 HIS CE1  1 1 
        2  5340 2 1 80 HIS CG   C  36.646 14.948  36.417 1.00 . B B . 80 HIS CG   1 1 
        2  5341 2 1 80 HIS H    H  35.610 12.094  37.356 1.00 . B B . 80 HIS H    1 1 
        2  5342 2 1 80 HIS HA   H  34.948 14.115  39.254 1.00 . B B . 80 HIS HA   1 1 
        2  5343 2 1 80 HIS HB2  H  35.701 16.073  37.951 1.00 . B B . 80 HIS HB2  1 1 
        2  5344 2 1 80 HIS HB3  H  37.063 15.093  38.495 1.00 . B B . 80 HIS HB3  1 1 
        2  5345 2 1 80 HIS HD1  H  37.981 13.315  36.632 1.00 . B B . 80 HIS HD1  1 1 
        2  5346 2 1 80 HIS HD2  H  35.632 16.450  35.204 1.00 . B B . 80 HIS HD2  1 1 
        2  5347 2 1 80 HIS HE1  H  38.395 13.442  34.138 1.00 . B B . 80 HIS HE1  1 1 
        2  5348 2 1 80 HIS HE2  H  36.970 15.348  33.251 1.00 . B B . 80 HIS HE2  1 1 
        2  5349 2 1 80 HIS N    N  35.905 12.703  38.065 1.00 . B B . 80 HIS N    1 1 
        2  5350 2 1 80 HIS ND1  N  37.553 13.969  36.040 1.00 . B B . 80 HIS ND1  1 1 
        2  5351 2 1 80 HIS NE2  N  37.010 15.069  34.190 1.00 . B B . 80 HIS NE2  1 1 
        2  5352 2 1 80 HIS O    O  32.988 14.569  37.817 1.00 . B B . 80 HIS O    1 1 
        3  5353 1 1  1 MET C    C  -0.032 -0.408  -3.428 1.00 . A A .  1 MET C    1 1 
        3  5354 1 1  1 MET CA   C  -0.939 -1.447  -4.080 1.00 . A A .  1 MET CA   1 1 
        3  5355 1 1  1 MET CB   C  -1.650 -0.833  -5.290 1.00 . A A .  1 MET CB   1 1 
        3  5356 1 1  1 MET CE   C  -4.276 -2.635  -7.889 1.00 . A A .  1 MET CE   1 1 
        3  5357 1 1  1 MET CG   C  -2.424 -1.921  -6.039 1.00 . A A .  1 MET CG   1 1 
        3  5358 1 1  1 MET H1   H  -2.499 -1.081  -2.752 1.00 . A A .  1 MET H1   1 1 
        3  5359 1 1  1 MET H2   H  -1.478 -2.357  -2.287 1.00 . A A .  1 MET H2   1 1 
        3  5360 1 1  1 MET H3   H  -2.602 -2.578  -3.542 1.00 . A A .  1 MET H3   1 1 
        3  5361 1 1  1 MET HA   H  -0.347 -2.292  -4.399 1.00 . A A .  1 MET HA   1 1 
        3  5362 1 1  1 MET HB2  H  -2.336 -0.068  -4.954 1.00 . A A .  1 MET HB2  1 1 
        3  5363 1 1  1 MET HB3  H  -0.919 -0.394  -5.953 1.00 . A A .  1 MET HB3  1 1 
        3  5364 1 1  1 MET HE1  H  -5.079 -2.740  -7.171 1.00 . A A .  1 MET HE1  1 1 
        3  5365 1 1  1 MET HE2  H  -3.655 -3.520  -7.874 1.00 . A A .  1 MET HE2  1 1 
        3  5366 1 1  1 MET HE3  H  -4.693 -2.508  -8.875 1.00 . A A .  1 MET HE3  1 1 
        3  5367 1 1  1 MET HG2  H  -1.738 -2.681  -6.382 1.00 . A A .  1 MET HG2  1 1 
        3  5368 1 1  1 MET HG3  H  -3.152 -2.366  -5.376 1.00 . A A .  1 MET HG3  1 1 
        3  5369 1 1  1 MET N    N  -1.957 -1.900  -3.090 1.00 . A A .  1 MET N    1 1 
        3  5370 1 1  1 MET O    O   0.884  0.115  -4.063 1.00 . A A .  1 MET O    1 1 
        3  5371 1 1  1 MET SD   S  -3.273 -1.191  -7.462 1.00 . A A .  1 MET SD   1 1 
        3  5372 1 1  2 SER C    C   0.568  2.189  -2.202 1.00 . A A .  2 SER C    1 1 
        3  5373 1 1  2 SER CA   C   0.508  0.867  -1.431 1.00 . A A .  2 SER CA   1 1 
        3  5374 1 1  2 SER CB   C   1.927  0.320  -1.211 1.00 . A A .  2 SER CB   1 1 
        3  5375 1 1  2 SER H    H  -1.035 -0.563  -1.703 1.00 . A A .  2 SER H    1 1 
        3  5376 1 1  2 SER HA   H   0.050  1.045  -0.469 1.00 . A A .  2 SER HA   1 1 
        3  5377 1 1  2 SER HB2  H   2.423  0.884  -0.437 1.00 . A A .  2 SER HB2  1 1 
        3  5378 1 1  2 SER HB3  H   1.868 -0.719  -0.912 1.00 . A A .  2 SER HB3  1 1 
        3  5379 1 1  2 SER HG   H   2.283 -0.165  -3.060 1.00 . A A .  2 SER HG   1 1 
        3  5380 1 1  2 SER N    N  -0.292 -0.114  -2.159 1.00 . A A .  2 SER N    1 1 
        3  5381 1 1  2 SER O    O   1.353  2.335  -3.139 1.00 . A A .  2 SER O    1 1 
        3  5382 1 1  2 SER OG   O   2.669  0.435  -2.417 1.00 . A A .  2 SER OG   1 1 
        3  5383 1 1  3 GLU C    C   0.550  5.468  -1.678 1.00 . A A .  3 GLU C    1 1 
        3  5384 1 1  3 GLU CA   C  -0.302  4.463  -2.457 1.00 . A A .  3 GLU CA   1 1 
        3  5385 1 1  3 GLU CB   C  -1.767  4.961  -2.564 1.00 . A A .  3 GLU CB   1 1 
        3  5386 1 1  3 GLU CD   C  -1.113  7.282  -3.292 1.00 . A A .  3 GLU CD   1 1 
        3  5387 1 1  3 GLU CG   C  -1.908  6.034  -3.662 1.00 . A A .  3 GLU CG   1 1 
        3  5388 1 1  3 GLU H    H  -0.865  2.971  -1.044 1.00 . A A .  3 GLU H    1 1 
        3  5389 1 1  3 GLU HA   H   0.109  4.373  -3.457 1.00 . A A .  3 GLU HA   1 1 
        3  5390 1 1  3 GLU HB2  H  -2.405  4.124  -2.812 1.00 . A A .  3 GLU HB2  1 1 
        3  5391 1 1  3 GLU HB3  H  -2.083  5.377  -1.618 1.00 . A A .  3 GLU HB3  1 1 
        3  5392 1 1  3 GLU HG2  H  -1.541  5.642  -4.600 1.00 . A A .  3 GLU HG2  1 1 
        3  5393 1 1  3 GLU HG3  H  -2.951  6.296  -3.772 1.00 . A A .  3 GLU HG3  1 1 
        3  5394 1 1  3 GLU N    N  -0.263  3.144  -1.797 1.00 . A A .  3 GLU N    1 1 
        3  5395 1 1  3 GLU O    O   0.272  5.784  -0.521 1.00 . A A .  3 GLU O    1 1 
        3  5396 1 1  3 GLU OE1  O  -1.142  7.658  -2.131 1.00 . A A .  3 GLU OE1  1 1 
        3  5397 1 1  3 GLU OE2  O  -0.480  7.839  -4.173 1.00 . A A .  3 GLU OE2  1 1 
        3  5398 1 1  4 LEU C    C   2.992  7.941  -2.755 1.00 . A A .  4 LEU C    1 1 
        3  5399 1 1  4 LEU CA   C   2.498  6.940  -1.718 1.00 . A A .  4 LEU CA   1 1 
        3  5400 1 1  4 LEU CB   C   3.703  6.216  -1.083 1.00 . A A .  4 LEU CB   1 1 
        3  5401 1 1  4 LEU CD1  C   5.851  5.156  -1.966 1.00 . A A .  4 LEU CD1  1 1 
        3  5402 1 1  4 LEU CD2  C   3.770  3.784  -1.830 1.00 . A A .  4 LEU CD2  1 1 
        3  5403 1 1  4 LEU CG   C   4.319  5.195  -2.094 1.00 . A A .  4 LEU CG   1 1 
        3  5404 1 1  4 LEU H    H   1.765  5.680  -3.255 1.00 . A A .  4 LEU H    1 1 
        3  5405 1 1  4 LEU HA   H   1.974  7.487  -0.952 1.00 . A A .  4 LEU HA   1 1 
        3  5406 1 1  4 LEU HB2  H   4.446  6.955  -0.798 1.00 . A A .  4 LEU HB2  1 1 
        3  5407 1 1  4 LEU HB3  H   3.372  5.698  -0.190 1.00 . A A .  4 LEU HB3  1 1 
        3  5408 1 1  4 LEU HD11 H   6.247  4.383  -2.608 1.00 . A A .  4 LEU HD11 1 1 
        3  5409 1 1  4 LEU HD12 H   6.124  4.949  -0.941 1.00 . A A .  4 LEU HD12 1 1 
        3  5410 1 1  4 LEU HD13 H   6.259  6.111  -2.260 1.00 . A A .  4 LEU HD13 1 1 
        3  5411 1 1  4 LEU HD21 H   4.088  3.125  -2.622 1.00 . A A .  4 LEU HD21 1 1 
        3  5412 1 1  4 LEU HD22 H   2.691  3.818  -1.798 1.00 . A A .  4 LEU HD22 1 1 
        3  5413 1 1  4 LEU HD23 H   4.148  3.419  -0.884 1.00 . A A .  4 LEU HD23 1 1 
        3  5414 1 1  4 LEU HG   H   4.070  5.484  -3.106 1.00 . A A .  4 LEU HG   1 1 
        3  5415 1 1  4 LEU N    N   1.592  5.968  -2.334 1.00 . A A .  4 LEU N    1 1 
        3  5416 1 1  4 LEU O    O   3.812  8.804  -2.444 1.00 . A A .  4 LEU O    1 1 
        3  5417 1 1  5 PHE C    C   2.510 10.165  -4.701 1.00 . A A .  5 PHE C    1 1 
        3  5418 1 1  5 PHE CA   C   2.891  8.733  -5.046 1.00 . A A .  5 PHE CA   1 1 
        3  5419 1 1  5 PHE CB   C   2.212  8.332  -6.356 1.00 . A A .  5 PHE CB   1 1 
        3  5420 1 1  5 PHE CD1  C   3.829  6.721  -7.435 1.00 . A A .  5 PHE CD1  1 1 
        3  5421 1 1  5 PHE CD2  C   1.833  5.834  -6.382 1.00 . A A .  5 PHE CD2  1 1 
        3  5422 1 1  5 PHE CE1  C   4.223  5.424  -7.782 1.00 . A A .  5 PHE CE1  1 1 
        3  5423 1 1  5 PHE CE2  C   2.227  4.536  -6.728 1.00 . A A .  5 PHE CE2  1 1 
        3  5424 1 1  5 PHE CG   C   2.634  6.927  -6.735 1.00 . A A .  5 PHE CG   1 1 
        3  5425 1 1  5 PHE CZ   C   3.422  4.331  -7.429 1.00 . A A .  5 PHE CZ   1 1 
        3  5426 1 1  5 PHE H    H   1.836  7.122  -4.169 1.00 . A A .  5 PHE H    1 1 
        3  5427 1 1  5 PHE HA   H   3.961  8.671  -5.173 1.00 . A A .  5 PHE HA   1 1 
        3  5428 1 1  5 PHE HB2  H   1.140  8.373  -6.231 1.00 . A A .  5 PHE HB2  1 1 
        3  5429 1 1  5 PHE HB3  H   2.509  9.018  -7.135 1.00 . A A .  5 PHE HB3  1 1 
        3  5430 1 1  5 PHE HD1  H   4.446  7.565  -7.708 1.00 . A A .  5 PHE HD1  1 1 
        3  5431 1 1  5 PHE HD2  H   0.911  5.993  -5.842 1.00 . A A .  5 PHE HD2  1 1 
        3  5432 1 1  5 PHE HE1  H   5.144  5.266  -8.322 1.00 . A A .  5 PHE HE1  1 1 
        3  5433 1 1  5 PHE HE2  H   1.609  3.694  -6.456 1.00 . A A .  5 PHE HE2  1 1 
        3  5434 1 1  5 PHE HZ   H   3.726  3.330  -7.696 1.00 . A A .  5 PHE HZ   1 1 
        3  5435 1 1  5 PHE N    N   2.487  7.830  -3.979 1.00 . A A .  5 PHE N    1 1 
        3  5436 1 1  5 PHE O    O   3.292 11.095  -4.897 1.00 . A A .  5 PHE O    1 1 
        3  5437 1 1  6 SER C    C   1.541 12.178  -2.580 1.00 . A A .  6 SER C    1 1 
        3  5438 1 1  6 SER CA   C   0.804 11.655  -3.819 1.00 . A A .  6 SER CA   1 1 
        3  5439 1 1  6 SER CB   C  -0.712 11.546  -3.559 1.00 . A A .  6 SER CB   1 1 
        3  5440 1 1  6 SER H    H   0.719  9.556  -4.045 1.00 . A A .  6 SER H    1 1 
        3  5441 1 1  6 SER HA   H   0.972 12.334  -4.647 1.00 . A A .  6 SER HA   1 1 
        3  5442 1 1  6 SER HB2  H  -0.896 11.217  -2.550 1.00 . A A .  6 SER HB2  1 1 
        3  5443 1 1  6 SER HB3  H  -1.186 12.504  -3.718 1.00 . A A .  6 SER HB3  1 1 
        3  5444 1 1  6 SER HG   H  -1.705 11.079  -5.165 1.00 . A A .  6 SER HG   1 1 
        3  5445 1 1  6 SER N    N   1.299 10.335  -4.179 1.00 . A A .  6 SER N    1 1 
        3  5446 1 1  6 SER O    O   1.687 11.458  -1.592 1.00 . A A .  6 SER O    1 1 
        3  5447 1 1  6 SER OG   O  -1.266 10.598  -4.460 1.00 . A A .  6 SER OG   1 1 
        3  5448 1 1  7 VAL C    C   1.803 14.081  -0.279 1.00 . A A .  7 VAL C    1 1 
        3  5449 1 1  7 VAL CA   C   2.722 14.019  -1.517 1.00 . A A .  7 VAL CA   1 1 
        3  5450 1 1  7 VAL CB   C   3.267 15.450  -1.875 1.00 . A A .  7 VAL CB   1 1 
        3  5451 1 1  7 VAL CG1  C   4.650 15.698  -1.235 1.00 . A A .  7 VAL CG1  1 1 
        3  5452 1 1  7 VAL CG2  C   3.394 15.601  -3.403 1.00 . A A .  7 VAL CG2  1 1 
        3  5453 1 1  7 VAL H    H   1.860 13.948  -3.458 1.00 . A A .  7 VAL H    1 1 
        3  5454 1 1  7 VAL HA   H   3.554 13.372  -1.283 1.00 . A A .  7 VAL HA   1 1 
        3  5455 1 1  7 VAL HB   H   2.586 16.201  -1.505 1.00 . A A .  7 VAL HB   1 1 
        3  5456 1 1  7 VAL HG11 H   4.952 16.717  -1.427 1.00 . A A .  7 VAL HG11 1 1 
        3  5457 1 1  7 VAL HG12 H   5.376 15.025  -1.666 1.00 . A A .  7 VAL HG12 1 1 
        3  5458 1 1  7 VAL HG13 H   4.594 15.535  -0.169 1.00 . A A .  7 VAL HG13 1 1 
        3  5459 1 1  7 VAL HG21 H   3.952 16.498  -3.639 1.00 . A A .  7 VAL HG21 1 1 
        3  5460 1 1  7 VAL HG22 H   2.409 15.672  -3.841 1.00 . A A .  7 VAL HG22 1 1 
        3  5461 1 1  7 VAL HG23 H   3.908 14.742  -3.809 1.00 . A A .  7 VAL HG23 1 1 
        3  5462 1 1  7 VAL N    N   2.006 13.421  -2.645 1.00 . A A .  7 VAL N    1 1 
        3  5463 1 1  7 VAL O    O   2.247 13.757   0.822 1.00 . A A .  7 VAL O    1 1 
        3  5464 1 1  8 PRO C    C  -0.378 13.279   1.553 1.00 . A A .  8 PRO C    1 1 
        3  5465 1 1  8 PRO CA   C  -0.372 14.560   0.718 1.00 . A A .  8 PRO CA   1 1 
        3  5466 1 1  8 PRO CB   C  -1.748 14.807   0.059 1.00 . A A .  8 PRO CB   1 1 
        3  5467 1 1  8 PRO CD   C  -0.102 14.882  -1.698 1.00 . A A .  8 PRO CD   1 1 
        3  5468 1 1  8 PRO CG   C  -1.421 15.507  -1.222 1.00 . A A .  8 PRO CG   1 1 
        3  5469 1 1  8 PRO HA   H  -0.114 15.407   1.340 1.00 . A A .  8 PRO HA   1 1 
        3  5470 1 1  8 PRO HB2  H  -2.250 13.862  -0.142 1.00 . A A .  8 PRO HB2  1 1 
        3  5471 1 1  8 PRO HB3  H  -2.374 15.434   0.683 1.00 . A A .  8 PRO HB3  1 1 
        3  5472 1 1  8 PRO HD2  H  -0.312 14.024  -2.307 1.00 . A A .  8 PRO HD2  1 1 
        3  5473 1 1  8 PRO HD3  H   0.490 15.600  -2.238 1.00 . A A .  8 PRO HD3  1 1 
        3  5474 1 1  8 PRO HG2  H  -2.211 15.350  -1.954 1.00 . A A .  8 PRO HG2  1 1 
        3  5475 1 1  8 PRO HG3  H  -1.285 16.565  -1.047 1.00 . A A .  8 PRO HG3  1 1 
        3  5476 1 1  8 PRO N    N   0.570 14.477  -0.440 1.00 . A A .  8 PRO N    1 1 
        3  5477 1 1  8 PRO O    O  -0.675 13.320   2.747 1.00 . A A .  8 PRO O    1 1 
        3  5478 1 1  9 TYR C    C   0.995 10.873   2.734 1.00 . A A .  9 TYR C    1 1 
        3  5479 1 1  9 TYR CA   C  -0.052 10.866   1.621 1.00 . A A .  9 TYR CA   1 1 
        3  5480 1 1  9 TYR CB   C   0.240  9.726   0.634 1.00 . A A .  9 TYR CB   1 1 
        3  5481 1 1  9 TYR CD1  C  -1.012  7.877   1.794 1.00 . A A .  9 TYR CD1  1 1 
        3  5482 1 1  9 TYR CD2  C   1.399  7.690   1.616 1.00 . A A .  9 TYR CD2  1 1 
        3  5483 1 1  9 TYR CE1  C  -1.057  6.651   2.467 1.00 . A A .  9 TYR CE1  1 1 
        3  5484 1 1  9 TYR CE2  C   1.354  6.464   2.290 1.00 . A A .  9 TYR CE2  1 1 
        3  5485 1 1  9 TYR CG   C   0.216  8.397   1.368 1.00 . A A .  9 TYR CG   1 1 
        3  5486 1 1  9 TYR CZ   C   0.126  5.944   2.715 1.00 . A A .  9 TYR CZ   1 1 
        3  5487 1 1  9 TYR H    H   0.161 12.178  -0.030 1.00 . A A .  9 TYR H    1 1 
        3  5488 1 1  9 TYR HA   H  -1.024 10.700   2.062 1.00 . A A .  9 TYR HA   1 1 
        3  5489 1 1  9 TYR HB2  H  -0.517  9.721  -0.140 1.00 . A A .  9 TYR HB2  1 1 
        3  5490 1 1  9 TYR HB3  H   1.210  9.880   0.182 1.00 . A A .  9 TYR HB3  1 1 
        3  5491 1 1  9 TYR HD1  H  -1.924  8.423   1.603 1.00 . A A .  9 TYR HD1  1 1 
        3  5492 1 1  9 TYR HD2  H   2.349  8.094   1.295 1.00 . A A .  9 TYR HD2  1 1 
        3  5493 1 1  9 TYR HE1  H  -2.004  6.249   2.794 1.00 . A A .  9 TYR HE1  1 1 
        3  5494 1 1  9 TYR HE2  H   2.267  5.916   2.470 1.00 . A A .  9 TYR HE2  1 1 
        3  5495 1 1  9 TYR HH   H   0.001  4.039   2.721 1.00 . A A .  9 TYR HH   1 1 
        3  5496 1 1  9 TYR N    N  -0.067 12.151   0.923 1.00 . A A .  9 TYR N    1 1 
        3  5497 1 1  9 TYR O    O   0.745 10.385   3.836 1.00 . A A .  9 TYR O    1 1 
        3  5498 1 1  9 TYR OH   O   0.081  4.734   3.378 1.00 . A A .  9 TYR OH   1 1 
        3  5499 1 1 10 PHE C    C   2.772 12.259   4.665 1.00 . A A . 10 PHE C    1 1 
        3  5500 1 1 10 PHE CA   C   3.242 11.492   3.423 1.00 . A A . 10 PHE CA   1 1 
        3  5501 1 1 10 PHE CB   C   4.499 12.178   2.789 1.00 . A A . 10 PHE CB   1 1 
        3  5502 1 1 10 PHE CD1  C   5.143  9.980   1.703 1.00 . A A . 10 PHE CD1  1 1 
        3  5503 1 1 10 PHE CD2  C   6.895 11.332   2.694 1.00 . A A . 10 PHE CD2  1 1 
        3  5504 1 1 10 PHE CE1  C   6.091  9.016   1.341 1.00 . A A . 10 PHE CE1  1 1 
        3  5505 1 1 10 PHE CE2  C   7.844 10.368   2.332 1.00 . A A . 10 PHE CE2  1 1 
        3  5506 1 1 10 PHE CG   C   5.545 11.138   2.380 1.00 . A A . 10 PHE CG   1 1 
        3  5507 1 1 10 PHE CZ   C   7.442  9.210   1.656 1.00 . A A . 10 PHE CZ   1 1 
        3  5508 1 1 10 PHE H    H   2.309 11.801   1.542 1.00 . A A . 10 PHE H    1 1 
        3  5509 1 1 10 PHE HA   H   3.490 10.486   3.726 1.00 . A A . 10 PHE HA   1 1 
        3  5510 1 1 10 PHE HB2  H   4.192 12.726   1.910 1.00 . A A . 10 PHE HB2  1 1 
        3  5511 1 1 10 PHE HB3  H   4.940 12.874   3.496 1.00 . A A . 10 PHE HB3  1 1 
        3  5512 1 1 10 PHE HD1  H   4.100  9.832   1.461 1.00 . A A . 10 PHE HD1  1 1 
        3  5513 1 1 10 PHE HD2  H   7.206 12.223   3.216 1.00 . A A . 10 PHE HD2  1 1 
        3  5514 1 1 10 PHE HE1  H   5.781  8.123   0.821 1.00 . A A . 10 PHE HE1  1 1 
        3  5515 1 1 10 PHE HE2  H   8.885 10.521   2.569 1.00 . A A . 10 PHE HE2  1 1 
        3  5516 1 1 10 PHE HZ   H   8.175  8.467   1.385 1.00 . A A . 10 PHE HZ   1 1 
        3  5517 1 1 10 PHE N    N   2.166 11.428   2.437 1.00 . A A . 10 PHE N    1 1 
        3  5518 1 1 10 PHE O    O   3.035 11.841   5.792 1.00 . A A . 10 PHE O    1 1 
        3  5519 1 1 11 ILE C    C   0.509 13.455   6.336 1.00 . A A . 11 ILE C    1 1 
        3  5520 1 1 11 ILE CA   C   1.602 14.197   5.563 1.00 . A A . 11 ILE CA   1 1 
        3  5521 1 1 11 ILE CB   C   1.061 15.533   5.027 1.00 . A A . 11 ILE CB   1 1 
        3  5522 1 1 11 ILE CD1  C   1.604 17.496   3.544 1.00 . A A . 11 ILE CD1  1 1 
        3  5523 1 1 11 ILE CG1  C   2.133 16.187   4.135 1.00 . A A . 11 ILE CG1  1 1 
        3  5524 1 1 11 ILE CG2  C   0.728 16.473   6.199 1.00 . A A . 11 ILE CG2  1 1 
        3  5525 1 1 11 ILE H    H   1.911 13.665   3.530 1.00 . A A . 11 ILE H    1 1 
        3  5526 1 1 11 ILE HA   H   2.421 14.402   6.230 1.00 . A A . 11 ILE HA   1 1 
        3  5527 1 1 11 ILE HB   H   0.170 15.356   4.445 1.00 . A A . 11 ILE HB   1 1 
        3  5528 1 1 11 ILE HD11 H   0.622 17.335   3.122 1.00 . A A . 11 ILE HD11 1 1 
        3  5529 1 1 11 ILE HD12 H   2.275 17.837   2.772 1.00 . A A . 11 ILE HD12 1 1 
        3  5530 1 1 11 ILE HD13 H   1.543 18.242   4.322 1.00 . A A . 11 ILE HD13 1 1 
        3  5531 1 1 11 ILE HG12 H   3.018 16.386   4.717 1.00 . A A . 11 ILE HG12 1 1 
        3  5532 1 1 11 ILE HG13 H   2.384 15.516   3.328 1.00 . A A . 11 ILE HG13 1 1 
        3  5533 1 1 11 ILE HG21 H   1.636 16.726   6.727 1.00 . A A . 11 ILE HG21 1 1 
        3  5534 1 1 11 ILE HG22 H   0.044 15.986   6.876 1.00 . A A . 11 ILE HG22 1 1 
        3  5535 1 1 11 ILE HG23 H   0.269 17.376   5.822 1.00 . A A . 11 ILE HG23 1 1 
        3  5536 1 1 11 ILE N    N   2.091 13.380   4.450 1.00 . A A . 11 ILE N    1 1 
        3  5537 1 1 11 ILE O    O   0.486 13.454   7.567 1.00 . A A . 11 ILE O    1 1 
        3  5538 1 1 12 GLU C    C  -0.969 11.096   7.255 1.00 . A A . 12 GLU C    1 1 
        3  5539 1 1 12 GLU CA   C  -1.506 12.091   6.215 1.00 . A A . 12 GLU CA   1 1 
        3  5540 1 1 12 GLU CB   C  -2.295 11.336   5.121 1.00 . A A . 12 GLU CB   1 1 
        3  5541 1 1 12 GLU CD   C  -4.383 12.732   5.219 1.00 . A A . 12 GLU CD   1 1 
        3  5542 1 1 12 GLU CG   C  -3.206 12.305   4.346 1.00 . A A . 12 GLU CG   1 1 
        3  5543 1 1 12 GLU H    H  -0.333 12.867   4.618 1.00 . A A . 12 GLU H    1 1 
        3  5544 1 1 12 GLU HA   H  -2.166 12.789   6.711 1.00 . A A . 12 GLU HA   1 1 
        3  5545 1 1 12 GLU HB2  H  -1.596 10.883   4.434 1.00 . A A . 12 GLU HB2  1 1 
        3  5546 1 1 12 GLU HB3  H  -2.902 10.560   5.572 1.00 . A A . 12 GLU HB3  1 1 
        3  5547 1 1 12 GLU HG2  H  -2.643 13.180   4.061 1.00 . A A . 12 GLU HG2  1 1 
        3  5548 1 1 12 GLU HG3  H  -3.579 11.815   3.459 1.00 . A A . 12 GLU HG3  1 1 
        3  5549 1 1 12 GLU N    N  -0.402 12.832   5.595 1.00 . A A . 12 GLU N    1 1 
        3  5550 1 1 12 GLU O    O  -1.620 10.847   8.270 1.00 . A A . 12 GLU O    1 1 
        3  5551 1 1 12 GLU OE1  O  -5.038 11.853   5.755 1.00 . A A . 12 GLU OE1  1 1 
        3  5552 1 1 12 GLU OE2  O  -4.617 13.923   5.334 1.00 . A A . 12 GLU OE2  1 1 
        3  5553 1 1 13 ASN C    C   1.215 10.295   9.232 1.00 . A A . 13 ASN C    1 1 
        3  5554 1 1 13 ASN CA   C   0.825  9.594   7.927 1.00 . A A . 13 ASN CA   1 1 
        3  5555 1 1 13 ASN CB   C   2.066  8.957   7.279 1.00 . A A . 13 ASN CB   1 1 
        3  5556 1 1 13 ASN CG   C   1.646  8.047   6.125 1.00 . A A . 13 ASN CG   1 1 
        3  5557 1 1 13 ASN H    H   0.687 10.781   6.175 1.00 . A A . 13 ASN H    1 1 
        3  5558 1 1 13 ASN HA   H   0.109  8.816   8.153 1.00 . A A . 13 ASN HA   1 1 
        3  5559 1 1 13 ASN HB2  H   2.714  9.734   6.903 1.00 . A A . 13 ASN HB2  1 1 
        3  5560 1 1 13 ASN HB3  H   2.598  8.372   8.015 1.00 . A A . 13 ASN HB3  1 1 
        3  5561 1 1 13 ASN HD21 H   3.433  8.064   5.258 1.00 . A A . 13 ASN HD21 1 1 
        3  5562 1 1 13 ASN HD22 H   2.248  7.147   4.459 1.00 . A A . 13 ASN HD22 1 1 
        3  5563 1 1 13 ASN N    N   0.213 10.545   7.001 1.00 . A A . 13 ASN N    1 1 
        3  5564 1 1 13 ASN ND2  N   2.515  7.725   5.206 1.00 . A A . 13 ASN ND2  1 1 
        3  5565 1 1 13 ASN O    O   1.197  9.694  10.306 1.00 . A A . 13 ASN O    1 1 
        3  5566 1 1 13 ASN OD1  O   0.493  7.620   6.061 1.00 . A A . 13 ASN OD1  1 1 
        3  5567 1 1 14 LEU C    C   0.784 12.682  11.158 1.00 . A A . 14 LEU C    1 1 
        3  5568 1 1 14 LEU CA   C   1.982 12.368  10.282 1.00 . A A . 14 LEU CA   1 1 
        3  5569 1 1 14 LEU CB   C   2.624 13.679   9.805 1.00 . A A . 14 LEU CB   1 1 
        3  5570 1 1 14 LEU CD1  C   4.298 14.659   8.186 1.00 . A A . 14 LEU CD1  1 1 
        3  5571 1 1 14 LEU CD2  C   4.728 12.416   9.245 1.00 . A A . 14 LEU CD2  1 1 
        3  5572 1 1 14 LEU CG   C   3.651 13.368   8.710 1.00 . A A . 14 LEU CG   1 1 
        3  5573 1 1 14 LEU H    H   1.572 11.997   8.240 1.00 . A A . 14 LEU H    1 1 
        3  5574 1 1 14 LEU HA   H   2.699 11.815  10.868 1.00 . A A . 14 LEU HA   1 1 
        3  5575 1 1 14 LEU HB2  H   1.863 14.339   9.408 1.00 . A A . 14 LEU HB2  1 1 
        3  5576 1 1 14 LEU HB3  H   3.122 14.161  10.635 1.00 . A A . 14 LEU HB3  1 1 
        3  5577 1 1 14 LEU HD11 H   4.744 14.450   7.228 1.00 . A A . 14 LEU HD11 1 1 
        3  5578 1 1 14 LEU HD12 H   5.065 14.994   8.870 1.00 . A A . 14 LEU HD12 1 1 
        3  5579 1 1 14 LEU HD13 H   3.549 15.431   8.072 1.00 . A A . 14 LEU HD13 1 1 
        3  5580 1 1 14 LEU HD21 H   5.577 12.449   8.593 1.00 . A A . 14 LEU HD21 1 1 
        3  5581 1 1 14 LEU HD22 H   4.339 11.410   9.267 1.00 . A A . 14 LEU HD22 1 1 
        3  5582 1 1 14 LEU HD23 H   5.028 12.713  10.242 1.00 . A A . 14 LEU HD23 1 1 
        3  5583 1 1 14 LEU HG   H   3.147 12.892   7.892 1.00 . A A . 14 LEU HG   1 1 
        3  5584 1 1 14 LEU N    N   1.578 11.569   9.122 1.00 . A A . 14 LEU N    1 1 
        3  5585 1 1 14 LEU O    O   0.875 12.683  12.386 1.00 . A A . 14 LEU O    1 1 
        3  5586 1 1 15 LYS C    C  -1.887 12.198  12.253 1.00 . A A . 15 LYS C    1 1 
        3  5587 1 1 15 LYS CA   C  -1.568 13.288  11.232 1.00 . A A . 15 LYS CA   1 1 
        3  5588 1 1 15 LYS CB   C  -2.733 13.437  10.243 1.00 . A A . 15 LYS CB   1 1 
        3  5589 1 1 15 LYS CD   C  -5.108 14.201   9.989 1.00 . A A . 15 LYS CD   1 1 
        3  5590 1 1 15 LYS CE   C  -6.338 14.718  10.740 1.00 . A A . 15 LYS CE   1 1 
        3  5591 1 1 15 LYS CG   C  -3.970 13.958  10.983 1.00 . A A . 15 LYS CG   1 1 
        3  5592 1 1 15 LYS H    H  -0.360 12.942   9.537 1.00 . A A . 15 LYS H    1 1 
        3  5593 1 1 15 LYS HA   H  -1.428 14.226  11.739 1.00 . A A . 15 LYS HA   1 1 
        3  5594 1 1 15 LYS HB2  H  -2.457 14.135   9.465 1.00 . A A . 15 LYS HB2  1 1 
        3  5595 1 1 15 LYS HB3  H  -2.958 12.477   9.803 1.00 . A A . 15 LYS HB3  1 1 
        3  5596 1 1 15 LYS HD2  H  -4.797 14.934   9.258 1.00 . A A . 15 LYS HD2  1 1 
        3  5597 1 1 15 LYS HD3  H  -5.355 13.277   9.490 1.00 . A A . 15 LYS HD3  1 1 
        3  5598 1 1 15 LYS HE2  H  -7.161 14.829  10.051 1.00 . A A . 15 LYS HE2  1 1 
        3  5599 1 1 15 LYS HE3  H  -6.608 14.013  11.513 1.00 . A A . 15 LYS HE3  1 1 
        3  5600 1 1 15 LYS HG2  H  -4.284 13.230  11.716 1.00 . A A . 15 LYS HG2  1 1 
        3  5601 1 1 15 LYS HG3  H  -3.726 14.886  11.479 1.00 . A A . 15 LYS HG3  1 1 
        3  5602 1 1 15 LYS HZ1  H  -6.865 16.652  11.305 1.00 . A A . 15 LYS HZ1  1 1 
        3  5603 1 1 15 LYS HZ2  H  -5.239 16.485  10.851 1.00 . A A . 15 LYS HZ2  1 1 
        3  5604 1 1 15 LYS HZ3  H  -5.764 15.899  12.357 1.00 . A A . 15 LYS HZ3  1 1 
        3  5605 1 1 15 LYS N    N  -0.347 12.958  10.516 1.00 . A A . 15 LYS N    1 1 
        3  5606 1 1 15 LYS NZ   N  -6.028 16.038  11.360 1.00 . A A . 15 LYS NZ   1 1 
        3  5607 1 1 15 LYS O    O  -2.415 12.479  13.329 1.00 . A A . 15 LYS O    1 1 
        3  5608 1 1 16 GLN C    C  -0.930  9.932  14.043 1.00 . A A . 16 GLN C    1 1 
        3  5609 1 1 16 GLN CA   C  -1.813  9.831  12.804 1.00 . A A . 16 GLN CA   1 1 
        3  5610 1 1 16 GLN CB   C  -1.545  8.511  12.072 1.00 . A A . 16 GLN CB   1 1 
        3  5611 1 1 16 GLN CD   C  -1.818  6.020  12.215 1.00 . A A . 16 GLN CD   1 1 
        3  5612 1 1 16 GLN CG   C  -1.870  7.331  12.995 1.00 . A A . 16 GLN CG   1 1 
        3  5613 1 1 16 GLN H    H  -1.147 10.791  11.037 1.00 . A A . 16 GLN H    1 1 
        3  5614 1 1 16 GLN HA   H  -2.844  9.847  13.120 1.00 . A A . 16 GLN HA   1 1 
        3  5615 1 1 16 GLN HB2  H  -2.164  8.459  11.187 1.00 . A A . 16 GLN HB2  1 1 
        3  5616 1 1 16 GLN HB3  H  -0.505  8.464  11.786 1.00 . A A . 16 GLN HB3  1 1 
        3  5617 1 1 16 GLN HE21 H  -2.215  4.895  13.803 1.00 . A A . 16 GLN HE21 1 1 
        3  5618 1 1 16 GLN HE22 H  -1.999  4.048  12.348 1.00 . A A . 16 GLN HE22 1 1 
        3  5619 1 1 16 GLN HG2  H  -1.149  7.293  13.799 1.00 . A A . 16 GLN HG2  1 1 
        3  5620 1 1 16 GLN HG3  H  -2.858  7.459  13.409 1.00 . A A . 16 GLN HG3  1 1 
        3  5621 1 1 16 GLN N    N  -1.566 10.955  11.908 1.00 . A A . 16 GLN N    1 1 
        3  5622 1 1 16 GLN NE2  N  -2.028  4.894  12.841 1.00 . A A . 16 GLN NE2  1 1 
        3  5623 1 1 16 GLN O    O  -1.357  9.581  15.143 1.00 . A A . 16 GLN O    1 1 
        3  5624 1 1 16 GLN OE1  O  -1.578  6.021  11.008 1.00 . A A . 16 GLN OE1  1 1 
        3  5625 1 1 17 HIS C    C   0.664 11.494  16.033 1.00 . A A . 17 HIS C    1 1 
        3  5626 1 1 17 HIS CA   C   1.219 10.529  14.985 1.00 . A A . 17 HIS CA   1 1 
        3  5627 1 1 17 HIS CB   C   2.575 11.036  14.483 1.00 . A A . 17 HIS CB   1 1 
        3  5628 1 1 17 HIS CD2  C   2.781  8.810  13.098 1.00 . A A . 17 HIS CD2  1 1 
        3  5629 1 1 17 HIS CE1  C   4.323  9.443  11.712 1.00 . A A . 17 HIS CE1  1 1 
        3  5630 1 1 17 HIS CG   C   3.095 10.108  13.417 1.00 . A A . 17 HIS CG   1 1 
        3  5631 1 1 17 HIS H    H   0.584 10.670  12.962 1.00 . A A . 17 HIS H    1 1 
        3  5632 1 1 17 HIS HA   H   1.355  9.560  15.440 1.00 . A A . 17 HIS HA   1 1 
        3  5633 1 1 17 HIS HB2  H   2.462 12.028  14.072 1.00 . A A . 17 HIS HB2  1 1 
        3  5634 1 1 17 HIS HB3  H   3.276 11.064  15.304 1.00 . A A . 17 HIS HB3  1 1 
        3  5635 1 1 17 HIS HD1  H   4.520 11.366  12.481 1.00 . A A . 17 HIS HD1  1 1 
        3  5636 1 1 17 HIS HD2  H   2.042  8.206  13.600 1.00 . A A . 17 HIS HD2  1 1 
        3  5637 1 1 17 HIS HE1  H   5.043  9.452  10.910 1.00 . A A . 17 HIS HE1  1 1 
        3  5638 1 1 17 HIS HE2  H   3.545  7.516  11.582 1.00 . A A . 17 HIS HE2  1 1 
        3  5639 1 1 17 HIS N    N   0.299 10.406  13.861 1.00 . A A . 17 HIS N    1 1 
        3  5640 1 1 17 HIS ND1  N   4.080 10.491  12.520 1.00 . A A . 17 HIS ND1  1 1 
        3  5641 1 1 17 HIS NE2  N   3.558  8.392  12.021 1.00 . A A . 17 HIS NE2  1 1 
        3  5642 1 1 17 HIS O    O   0.584 11.161  17.215 1.00 . A A . 17 HIS O    1 1 
        3  5643 1 1 18 ILE C    C  -1.703 13.324  16.918 1.00 . A A . 18 ILE C    1 1 
        3  5644 1 1 18 ILE CA   C  -0.272 13.696  16.497 1.00 . A A . 18 ILE CA   1 1 
        3  5645 1 1 18 ILE CB   C  -0.248 15.081  15.813 1.00 . A A . 18 ILE CB   1 1 
        3  5646 1 1 18 ILE CD1  C  -1.005 16.356  13.763 1.00 . A A . 18 ILE CD1  1 1 
        3  5647 1 1 18 ILE CG1  C  -1.168 15.068  14.582 1.00 . A A . 18 ILE CG1  1 1 
        3  5648 1 1 18 ILE CG2  C   1.192 15.416  15.377 1.00 . A A . 18 ILE CG2  1 1 
        3  5649 1 1 18 ILE H    H   0.371 12.898  14.637 1.00 . A A . 18 ILE H    1 1 
        3  5650 1 1 18 ILE HA   H   0.344 13.744  17.384 1.00 . A A . 18 ILE HA   1 1 
        3  5651 1 1 18 ILE HB   H  -0.594 15.831  16.513 1.00 . A A . 18 ILE HB   1 1 
        3  5652 1 1 18 ILE HD11 H  -0.080 16.311  13.204 1.00 . A A . 18 ILE HD11 1 1 
        3  5653 1 1 18 ILE HD12 H  -0.984 17.209  14.427 1.00 . A A . 18 ILE HD12 1 1 
        3  5654 1 1 18 ILE HD13 H  -1.833 16.452  13.079 1.00 . A A . 18 ILE HD13 1 1 
        3  5655 1 1 18 ILE HG12 H  -0.917 14.221  13.971 1.00 . A A . 18 ILE HG12 1 1 
        3  5656 1 1 18 ILE HG13 H  -2.195 14.989  14.901 1.00 . A A . 18 ILE HG13 1 1 
        3  5657 1 1 18 ILE HG21 H   1.259 16.465  15.126 1.00 . A A . 18 ILE HG21 1 1 
        3  5658 1 1 18 ILE HG22 H   1.461 14.823  14.511 1.00 . A A . 18 ILE HG22 1 1 
        3  5659 1 1 18 ILE HG23 H   1.868 15.202  16.180 1.00 . A A . 18 ILE HG23 1 1 
        3  5660 1 1 18 ILE N    N   0.284 12.688  15.590 1.00 . A A . 18 ILE N    1 1 
        3  5661 1 1 18 ILE O    O  -2.069 13.440  18.087 1.00 . A A . 18 ILE O    1 1 
        3  5662 1 1 19 GLU C    C  -3.937 11.291  17.150 1.00 . A A . 19 GLU C    1 1 
        3  5663 1 1 19 GLU CA   C  -3.890 12.509  16.237 1.00 . A A . 19 GLU CA   1 1 
        3  5664 1 1 19 GLU CB   C  -4.630 12.204  14.923 1.00 . A A . 19 GLU CB   1 1 
        3  5665 1 1 19 GLU CD   C  -6.804 13.250  15.626 1.00 . A A . 19 GLU CD   1 1 
        3  5666 1 1 19 GLU CG   C  -6.129 11.958  15.174 1.00 . A A . 19 GLU CG   1 1 
        3  5667 1 1 19 GLU H    H  -2.153 12.811  15.036 1.00 . A A . 19 GLU H    1 1 
        3  5668 1 1 19 GLU HA   H  -4.380 13.332  16.732 1.00 . A A . 19 GLU HA   1 1 
        3  5669 1 1 19 GLU HB2  H  -4.521 13.043  14.254 1.00 . A A . 19 GLU HB2  1 1 
        3  5670 1 1 19 GLU HB3  H  -4.199 11.325  14.468 1.00 . A A . 19 GLU HB3  1 1 
        3  5671 1 1 19 GLU HG2  H  -6.589 11.621  14.255 1.00 . A A . 19 GLU HG2  1 1 
        3  5672 1 1 19 GLU HG3  H  -6.259 11.199  15.932 1.00 . A A . 19 GLU HG3  1 1 
        3  5673 1 1 19 GLU N    N  -2.500 12.882  15.950 1.00 . A A . 19 GLU N    1 1 
        3  5674 1 1 19 GLU O    O  -4.604 11.309  18.184 1.00 . A A . 19 GLU O    1 1 
        3  5675 1 1 19 GLU OE1  O  -6.251 14.304  15.358 1.00 . A A . 19 GLU OE1  1 1 
        3  5676 1 1 19 GLU OE2  O  -7.862 13.167  16.228 1.00 . A A . 19 GLU OE2  1 1 
        3  5677 1 1 20 MET C    C  -1.861  8.897  18.301 1.00 . A A . 20 MET C    1 1 
        3  5678 1 1 20 MET CA   C  -3.187  9.002  17.559 1.00 . A A . 20 MET CA   1 1 
        3  5679 1 1 20 MET CB   C  -3.356  7.785  16.644 1.00 . A A . 20 MET CB   1 1 
        3  5680 1 1 20 MET CE   C  -5.932  7.170  13.558 1.00 . A A . 20 MET CE   1 1 
        3  5681 1 1 20 MET CG   C  -4.651  7.930  15.843 1.00 . A A . 20 MET CG   1 1 
        3  5682 1 1 20 MET H    H  -2.711 10.279  15.933 1.00 . A A . 20 MET H    1 1 
        3  5683 1 1 20 MET HA   H  -3.992  8.998  18.286 1.00 . A A . 20 MET HA   1 1 
        3  5684 1 1 20 MET HB2  H  -2.518  7.714  15.971 1.00 . A A . 20 MET HB2  1 1 
        3  5685 1 1 20 MET HB3  H  -3.410  6.891  17.244 1.00 . A A . 20 MET HB3  1 1 
        3  5686 1 1 20 MET HE1  H  -6.661  7.839  13.994 1.00 . A A . 20 MET HE1  1 1 
        3  5687 1 1 20 MET HE2  H  -6.436  6.389  13.005 1.00 . A A . 20 MET HE2  1 1 
        3  5688 1 1 20 MET HE3  H  -5.292  7.725  12.890 1.00 . A A . 20 MET HE3  1 1 
        3  5689 1 1 20 MET HG2  H  -5.477  8.087  16.520 1.00 . A A . 20 MET HG2  1 1 
        3  5690 1 1 20 MET HG3  H  -4.564  8.778  15.178 1.00 . A A . 20 MET HG3  1 1 
        3  5691 1 1 20 MET N    N  -3.225 10.236  16.767 1.00 . A A . 20 MET N    1 1 
        3  5692 1 1 20 MET O    O  -1.160  9.890  18.496 1.00 . A A . 20 MET O    1 1 
        3  5693 1 1 20 MET SD   S  -4.935  6.425  14.875 1.00 . A A . 20 MET SD   1 1 
        3  5694 1 1 21 ASN C    C   0.172  6.009  19.273 1.00 . A A . 21 ASN C    1 1 
        3  5695 1 1 21 ASN CA   C  -0.281  7.450  19.450 1.00 . A A . 21 ASN CA   1 1 
        3  5696 1 1 21 ASN CB   C  -0.487  7.746  20.936 1.00 . A A . 21 ASN CB   1 1 
        3  5697 1 1 21 ASN CG   C   0.836  7.614  21.684 1.00 . A A . 21 ASN CG   1 1 
        3  5698 1 1 21 ASN H    H  -2.125  6.928  18.538 1.00 . A A . 21 ASN H    1 1 
        3  5699 1 1 21 ASN HA   H   0.492  8.105  19.068 1.00 . A A . 21 ASN HA   1 1 
        3  5700 1 1 21 ASN HB2  H  -0.864  8.752  21.051 1.00 . A A . 21 ASN HB2  1 1 
        3  5701 1 1 21 ASN HB3  H  -1.200  7.047  21.345 1.00 . A A . 21 ASN HB3  1 1 
        3  5702 1 1 21 ASN HD21 H   0.004  7.792  23.478 1.00 . A A . 21 ASN HD21 1 1 
        3  5703 1 1 21 ASN HD22 H   1.688  7.582  23.477 1.00 . A A . 21 ASN HD22 1 1 
        3  5704 1 1 21 ASN N    N  -1.528  7.682  18.723 1.00 . A A . 21 ASN N    1 1 
        3  5705 1 1 21 ASN ND2  N   0.843  7.667  22.988 1.00 . A A . 21 ASN ND2  1 1 
        3  5706 1 1 21 ASN O    O   0.455  5.316  20.250 1.00 . A A . 21 ASN O    1 1 
        3  5707 1 1 21 ASN OD1  O   1.888  7.452  21.066 1.00 . A A . 21 ASN OD1  1 1 
        3  5708 1 1 22 GLN C    C   2.069  3.947  18.288 1.00 . A A . 22 GLN C    1 1 
        3  5709 1 1 22 GLN CA   C   0.670  4.197  17.738 1.00 . A A . 22 GLN CA   1 1 
        3  5710 1 1 22 GLN CB   C   0.668  3.959  16.226 1.00 . A A . 22 GLN CB   1 1 
        3  5711 1 1 22 GLN CD   C   0.831  2.205  14.445 1.00 . A A . 22 GLN CD   1 1 
        3  5712 1 1 22 GLN CG   C   1.008  2.495  15.931 1.00 . A A . 22 GLN CG   1 1 
        3  5713 1 1 22 GLN H    H   0.011  6.161  17.283 1.00 . A A . 22 GLN H    1 1 
        3  5714 1 1 22 GLN HA   H  -0.021  3.511  18.201 1.00 . A A . 22 GLN HA   1 1 
        3  5715 1 1 22 GLN HB2  H  -0.309  4.191  15.827 1.00 . A A . 22 GLN HB2  1 1 
        3  5716 1 1 22 GLN HB3  H   1.406  4.597  15.762 1.00 . A A . 22 GLN HB3  1 1 
        3  5717 1 1 22 GLN HE21 H   1.830  0.491  14.513 1.00 . A A . 22 GLN HE21 1 1 
        3  5718 1 1 22 GLN HE22 H   1.230  0.922  12.984 1.00 . A A . 22 GLN HE22 1 1 
        3  5719 1 1 22 GLN HG2  H   2.034  2.300  16.210 1.00 . A A . 22 GLN HG2  1 1 
        3  5720 1 1 22 GLN HG3  H   0.354  1.852  16.500 1.00 . A A . 22 GLN HG3  1 1 
        3  5721 1 1 22 GLN N    N   0.249  5.564  18.023 1.00 . A A . 22 GLN N    1 1 
        3  5722 1 1 22 GLN NE2  N   1.339  1.115  13.938 1.00 . A A . 22 GLN NE2  1 1 
        3  5723 1 1 22 GLN O    O   2.306  2.967  18.995 1.00 . A A . 22 GLN O    1 1 
        3  5724 1 1 22 GLN OE1  O   0.206  2.987  13.729 1.00 . A A . 22 GLN OE1  1 1 
        3  5725 1 1 23 SER C    C   5.203  5.910  17.960 1.00 . A A . 23 SER C    1 1 
        3  5726 1 1 23 SER CA   C   4.374  4.717  18.424 1.00 . A A . 23 SER CA   1 1 
        3  5727 1 1 23 SER CB   C   5.011  3.428  17.887 1.00 . A A . 23 SER CB   1 1 
        3  5728 1 1 23 SER H    H   2.749  5.603  17.392 1.00 . A A . 23 SER H    1 1 
        3  5729 1 1 23 SER HA   H   4.377  4.684  19.505 1.00 . A A . 23 SER HA   1 1 
        3  5730 1 1 23 SER HB2  H   6.064  3.418  18.120 1.00 . A A . 23 SER HB2  1 1 
        3  5731 1 1 23 SER HB3  H   4.541  2.570  18.345 1.00 . A A . 23 SER HB3  1 1 
        3  5732 1 1 23 SER HG   H   5.179  4.205  16.113 1.00 . A A . 23 SER HG   1 1 
        3  5733 1 1 23 SER N    N   2.995  4.842  17.959 1.00 . A A . 23 SER N    1 1 
        3  5734 1 1 23 SER O    O   6.052  5.773  17.080 1.00 . A A . 23 SER O    1 1 
        3  5735 1 1 23 SER OG   O   4.850  3.380  16.476 1.00 . A A . 23 SER OG   1 1 
        3  5736 1 1 24 GLU C    C   5.461  9.389  19.201 1.00 . A A . 24 GLU C    1 1 
        3  5737 1 1 24 GLU CA   C   5.708  8.271  18.184 1.00 . A A . 24 GLU CA   1 1 
        3  5738 1 1 24 GLU CB   C   5.311  8.723  16.755 1.00 . A A . 24 GLU CB   1 1 
        3  5739 1 1 24 GLU CD   C   7.623  8.696  15.765 1.00 . A A . 24 GLU CD   1 1 
        3  5740 1 1 24 GLU CG   C   6.435  9.585  16.138 1.00 . A A . 24 GLU CG   1 1 
        3  5741 1 1 24 GLU H    H   4.270  7.124  19.250 1.00 . A A . 24 GLU H    1 1 
        3  5742 1 1 24 GLU HA   H   6.763  8.031  18.198 1.00 . A A . 24 GLU HA   1 1 
        3  5743 1 1 24 GLU HB2  H   5.146  7.849  16.140 1.00 . A A . 24 GLU HB2  1 1 
        3  5744 1 1 24 GLU HB3  H   4.396  9.299  16.792 1.00 . A A . 24 GLU HB3  1 1 
        3  5745 1 1 24 GLU HG2  H   6.064 10.076  15.248 1.00 . A A . 24 GLU HG2  1 1 
        3  5746 1 1 24 GLU HG3  H   6.756 10.330  16.851 1.00 . A A . 24 GLU HG3  1 1 
        3  5747 1 1 24 GLU N    N   4.959  7.074  18.555 1.00 . A A . 24 GLU N    1 1 
        3  5748 1 1 24 GLU O    O   5.534  9.161  20.409 1.00 . A A . 24 GLU O    1 1 
        3  5749 1 1 24 GLU OE1  O   7.378  7.569  15.366 1.00 . A A . 24 GLU OE1  1 1 
        3  5750 1 1 24 GLU OE2  O   8.748  9.156  15.863 1.00 . A A . 24 GLU OE2  1 1 
        3  5751 1 1 25 ASP C    C   4.070 12.766  18.874 1.00 . A A . 25 ASP C    1 1 
        3  5752 1 1 25 ASP CA   C   4.932 11.734  19.580 1.00 . A A . 25 ASP CA   1 1 
        3  5753 1 1 25 ASP CB   C   6.271 12.366  19.960 1.00 . A A . 25 ASP CB   1 1 
        3  5754 1 1 25 ASP CG   C   7.090 11.385  20.792 1.00 . A A . 25 ASP CG   1 1 
        3  5755 1 1 25 ASP H    H   5.129 10.712  17.736 1.00 . A A . 25 ASP H    1 1 
        3  5756 1 1 25 ASP HA   H   4.426 11.411  20.479 1.00 . A A . 25 ASP HA   1 1 
        3  5757 1 1 25 ASP HB2  H   6.812 12.617  19.055 1.00 . A A . 25 ASP HB2  1 1 
        3  5758 1 1 25 ASP HB3  H   6.100 13.263  20.536 1.00 . A A . 25 ASP HB3  1 1 
        3  5759 1 1 25 ASP N    N   5.173 10.589  18.707 1.00 . A A . 25 ASP N    1 1 
        3  5760 1 1 25 ASP O    O   3.474 12.490  17.833 1.00 . A A . 25 ASP O    1 1 
        3  5761 1 1 25 ASP OD1  O   6.561 10.879  21.767 1.00 . A A . 25 ASP OD1  1 1 
        3  5762 1 1 25 ASP OD2  O   8.230 11.143  20.431 1.00 . A A . 25 ASP OD2  1 1 
        3  5763 1 1 26 LYS C    C   4.024 15.758  17.774 1.00 . A A . 26 LYS C    1 1 
        3  5764 1 1 26 LYS CA   C   3.219 15.040  18.864 1.00 . A A . 26 LYS CA   1 1 
        3  5765 1 1 26 LYS CB   C   2.783 16.013  19.969 1.00 . A A . 26 LYS CB   1 1 
        3  5766 1 1 26 LYS CD   C   1.271 17.923  20.535 1.00 . A A . 26 LYS CD   1 1 
        3  5767 1 1 26 LYS CE   C   0.085 18.759  20.051 1.00 . A A . 26 LYS CE   1 1 
        3  5768 1 1 26 LYS CG   C   1.728 16.979  19.419 1.00 . A A . 26 LYS CG   1 1 
        3  5769 1 1 26 LYS H    H   4.507 14.127  20.275 1.00 . A A . 26 LYS H    1 1 
        3  5770 1 1 26 LYS HA   H   2.328 14.618  18.410 1.00 . A A . 26 LYS HA   1 1 
        3  5771 1 1 26 LYS HB2  H   2.352 15.447  20.785 1.00 . A A . 26 LYS HB2  1 1 
        3  5772 1 1 26 LYS HB3  H   3.633 16.567  20.332 1.00 . A A . 26 LYS HB3  1 1 
        3  5773 1 1 26 LYS HD2  H   0.978 17.348  21.400 1.00 . A A . 26 LYS HD2  1 1 
        3  5774 1 1 26 LYS HD3  H   2.085 18.583  20.801 1.00 . A A . 26 LYS HD3  1 1 
        3  5775 1 1 26 LYS HE2  H   0.373 19.342  19.193 1.00 . A A . 26 LYS HE2  1 1 
        3  5776 1 1 26 LYS HE3  H  -0.727 18.101  19.780 1.00 . A A . 26 LYS HE3  1 1 
        3  5777 1 1 26 LYS HG2  H   2.156 17.552  18.609 1.00 . A A . 26 LYS HG2  1 1 
        3  5778 1 1 26 LYS HG3  H   0.880 16.417  19.051 1.00 . A A . 26 LYS HG3  1 1 
        3  5779 1 1 26 LYS HZ1  H  -0.268 19.186  22.058 1.00 . A A . 26 LYS HZ1  1 1 
        3  5780 1 1 26 LYS HZ2  H  -1.356 19.932  20.990 1.00 . A A . 26 LYS HZ2  1 1 
        3  5781 1 1 26 LYS HZ3  H   0.228 20.527  21.140 1.00 . A A . 26 LYS HZ3  1 1 
        3  5782 1 1 26 LYS N    N   4.011 13.965  19.446 1.00 . A A . 26 LYS N    1 1 
        3  5783 1 1 26 LYS NZ   N  -0.361 19.669  21.142 1.00 . A A . 26 LYS NZ   1 1 
        3  5784 1 1 26 LYS O    O   4.166 15.228  16.672 1.00 . A A . 26 LYS O    1 1 
        3  5785 1 1 27 ILE C    C   6.590 16.954  16.743 1.00 . A A . 27 ILE C    1 1 
        3  5786 1 1 27 ILE CA   C   5.311 17.708  17.106 1.00 . A A . 27 ILE CA   1 1 
        3  5787 1 1 27 ILE CB   C   5.659 19.086  17.683 1.00 . A A . 27 ILE CB   1 1 
        3  5788 1 1 27 ILE CD1  C   6.439 21.422  17.053 1.00 . A A . 27 ILE CD1  1 1 
        3  5789 1 1 27 ILE CG1  C   6.309 19.961  16.588 1.00 . A A . 27 ILE CG1  1 1 
        3  5790 1 1 27 ILE CG2  C   6.614 18.940  18.878 1.00 . A A . 27 ILE CG2  1 1 
        3  5791 1 1 27 ILE H    H   4.386 17.322  18.970 1.00 . A A . 27 ILE H    1 1 
        3  5792 1 1 27 ILE HA   H   4.724 17.852  16.214 1.00 . A A . 27 ILE HA   1 1 
        3  5793 1 1 27 ILE HB   H   4.753 19.563  18.019 1.00 . A A . 27 ILE HB   1 1 
        3  5794 1 1 27 ILE HD11 H   5.734 22.028  16.502 1.00 . A A . 27 ILE HD11 1 1 
        3  5795 1 1 27 ILE HD12 H   7.441 21.770  16.854 1.00 . A A . 27 ILE HD12 1 1 
        3  5796 1 1 27 ILE HD13 H   6.236 21.508  18.112 1.00 . A A . 27 ILE HD13 1 1 
        3  5797 1 1 27 ILE HG12 H   7.289 19.575  16.353 1.00 . A A . 27 ILE HG12 1 1 
        3  5798 1 1 27 ILE HG13 H   5.698 19.937  15.697 1.00 . A A . 27 ILE HG13 1 1 
        3  5799 1 1 27 ILE HG21 H   6.675 19.880  19.409 1.00 . A A . 27 ILE HG21 1 1 
        3  5800 1 1 27 ILE HG22 H   7.597 18.663  18.527 1.00 . A A . 27 ILE HG22 1 1 
        3  5801 1 1 27 ILE HG23 H   6.243 18.175  19.547 1.00 . A A . 27 ILE HG23 1 1 
        3  5802 1 1 27 ILE N    N   4.531 16.949  18.075 1.00 . A A . 27 ILE N    1 1 
        3  5803 1 1 27 ILE O    O   7.009 16.954  15.586 1.00 . A A . 27 ILE O    1 1 
        3  5804 1 1 28 HIS C    C   8.188 14.387  16.544 1.00 . A A . 28 HIS C    1 1 
        3  5805 1 1 28 HIS CA   C   8.441 15.571  17.494 1.00 . A A . 28 HIS CA   1 1 
        3  5806 1 1 28 HIS CB   C   9.018 15.080  18.823 1.00 . A A . 28 HIS CB   1 1 
        3  5807 1 1 28 HIS CD2  C  11.589 14.930  18.320 1.00 . A A . 28 HIS CD2  1 1 
        3  5808 1 1 28 HIS CE1  C  11.802 12.775  18.374 1.00 . A A . 28 HIS CE1  1 1 
        3  5809 1 1 28 HIS CG   C  10.345 14.415  18.587 1.00 . A A . 28 HIS CG   1 1 
        3  5810 1 1 28 HIS H    H   6.828 16.361  18.640 1.00 . A A . 28 HIS H    1 1 
        3  5811 1 1 28 HIS HA   H   9.162 16.229  17.029 1.00 . A A . 28 HIS HA   1 1 
        3  5812 1 1 28 HIS HB2  H   9.157 15.925  19.480 1.00 . A A . 28 HIS HB2  1 1 
        3  5813 1 1 28 HIS HB3  H   8.339 14.380  19.278 1.00 . A A . 28 HIS HB3  1 1 
        3  5814 1 1 28 HIS HD1  H   9.801 12.377  18.786 1.00 . A A . 28 HIS HD1  1 1 
        3  5815 1 1 28 HIS HD2  H  11.820 15.981  18.229 1.00 . A A . 28 HIS HD2  1 1 
        3  5816 1 1 28 HIS HE1  H  12.221 11.780  18.338 1.00 . A A . 28 HIS HE1  1 1 
        3  5817 1 1 28 HIS HE2  H  13.466 13.967  17.997 1.00 . A A . 28 HIS HE2  1 1 
        3  5818 1 1 28 HIS N    N   7.209 16.326  17.738 1.00 . A A . 28 HIS N    1 1 
        3  5819 1 1 28 HIS ND1  N  10.505 13.038  18.617 1.00 . A A . 28 HIS ND1  1 1 
        3  5820 1 1 28 HIS NE2  N  12.507 13.893  18.186 1.00 . A A . 28 HIS NE2  1 1 
        3  5821 1 1 28 HIS O    O   9.056 13.535  16.357 1.00 . A A . 28 HIS O    1 1 
        3  5822 1 1 29 ALA C    C   7.308 13.530  13.644 1.00 . A A . 29 ALA C    1 1 
        3  5823 1 1 29 ALA CA   C   6.641 13.293  15.000 1.00 . A A . 29 ALA CA   1 1 
        3  5824 1 1 29 ALA CB   C   5.121 13.247  14.822 1.00 . A A . 29 ALA CB   1 1 
        3  5825 1 1 29 ALA H    H   6.348 15.061  16.133 1.00 . A A . 29 ALA H    1 1 
        3  5826 1 1 29 ALA HA   H   6.973 12.340  15.388 1.00 . A A . 29 ALA HA   1 1 
        3  5827 1 1 29 ALA HB1  H   4.765 14.214  14.499 1.00 . A A . 29 ALA HB1  1 1 
        3  5828 1 1 29 ALA HB2  H   4.656 12.988  15.762 1.00 . A A . 29 ALA HB2  1 1 
        3  5829 1 1 29 ALA HB3  H   4.868 12.504  14.079 1.00 . A A . 29 ALA HB3  1 1 
        3  5830 1 1 29 ALA N    N   7.001 14.355  15.946 1.00 . A A . 29 ALA N    1 1 
        3  5831 1 1 29 ALA O    O   7.840 12.606  13.029 1.00 . A A . 29 ALA O    1 1 
        3  5832 1 1 30 MET C    C   9.366 14.901  11.945 1.00 . A A . 30 MET C    1 1 
        3  5833 1 1 30 MET CA   C   7.858 15.135  11.904 1.00 . A A . 30 MET CA   1 1 
        3  5834 1 1 30 MET CB   C   7.566 16.629  11.578 1.00 . A A . 30 MET CB   1 1 
        3  5835 1 1 30 MET CE   C   9.553 19.205  13.416 1.00 . A A . 30 MET CE   1 1 
        3  5836 1 1 30 MET CG   C   7.506 17.448  12.887 1.00 . A A . 30 MET CG   1 1 
        3  5837 1 1 30 MET H    H   6.825 15.471  13.717 1.00 . A A . 30 MET H    1 1 
        3  5838 1 1 30 MET HA   H   7.429 14.514  11.130 1.00 . A A . 30 MET HA   1 1 
        3  5839 1 1 30 MET HB2  H   8.344 17.029  10.937 1.00 . A A . 30 MET HB2  1 1 
        3  5840 1 1 30 MET HB3  H   6.617 16.710  11.062 1.00 . A A . 30 MET HB3  1 1 
        3  5841 1 1 30 MET HE1  H  10.002 20.179  13.316 1.00 . A A . 30 MET HE1  1 1 
        3  5842 1 1 30 MET HE2  H  10.200 18.457  12.979 1.00 . A A . 30 MET HE2  1 1 
        3  5843 1 1 30 MET HE3  H   9.410 18.984  14.463 1.00 . A A . 30 MET HE3  1 1 
        3  5844 1 1 30 MET HG2  H   6.504 17.407  13.294 1.00 . A A . 30 MET HG2  1 1 
        3  5845 1 1 30 MET HG3  H   8.197 17.029  13.604 1.00 . A A . 30 MET HG3  1 1 
        3  5846 1 1 30 MET N    N   7.263 14.775  13.183 1.00 . A A . 30 MET N    1 1 
        3  5847 1 1 30 MET O    O   9.917 14.314  11.014 1.00 . A A . 30 MET O    1 1 
        3  5848 1 1 30 MET SD   S   7.947 19.183  12.566 1.00 . A A . 30 MET SD   1 1 
        3  5849 1 1 31 ASN C    C  11.855 13.710  12.920 1.00 . A A . 31 ASN C    1 1 
        3  5850 1 1 31 ASN CA   C  11.473 15.179  13.109 1.00 . A A . 31 ASN CA   1 1 
        3  5851 1 1 31 ASN CB   C  11.949 15.653  14.485 1.00 . A A . 31 ASN CB   1 1 
        3  5852 1 1 31 ASN CG   C  13.461 15.492  14.605 1.00 . A A . 31 ASN CG   1 1 
        3  5853 1 1 31 ASN H    H   9.534 15.813  13.719 1.00 . A A . 31 ASN H    1 1 
        3  5854 1 1 31 ASN HA   H  11.957 15.772  12.348 1.00 . A A . 31 ASN HA   1 1 
        3  5855 1 1 31 ASN HB2  H  11.687 16.693  14.617 1.00 . A A . 31 ASN HB2  1 1 
        3  5856 1 1 31 ASN HB3  H  11.466 15.064  15.251 1.00 . A A . 31 ASN HB3  1 1 
        3  5857 1 1 31 ASN HD21 H  13.415 15.091  16.549 1.00 . A A . 31 ASN HD21 1 1 
        3  5858 1 1 31 ASN HD22 H  14.960 15.099  15.846 1.00 . A A . 31 ASN HD22 1 1 
        3  5859 1 1 31 ASN N    N  10.025 15.352  13.008 1.00 . A A . 31 ASN N    1 1 
        3  5860 1 1 31 ASN ND2  N  13.990 15.204  15.763 1.00 . A A . 31 ASN ND2  1 1 
        3  5861 1 1 31 ASN O    O  12.744 13.393  12.130 1.00 . A A . 31 ASN O    1 1 
        3  5862 1 1 31 ASN OD1  O  14.180 15.640  13.617 1.00 . A A . 31 ASN OD1  1 1 
        3  5863 1 1 32 SER C    C  11.133 10.889  12.113 1.00 . A A . 32 SER C    1 1 
        3  5864 1 1 32 SER CA   C  11.462 11.397  13.517 1.00 . A A . 32 SER CA   1 1 
        3  5865 1 1 32 SER CB   C  10.624 10.631  14.536 1.00 . A A . 32 SER CB   1 1 
        3  5866 1 1 32 SER H    H  10.475 13.132  14.251 1.00 . A A . 32 SER H    1 1 
        3  5867 1 1 32 SER HA   H  12.507 11.226  13.723 1.00 . A A . 32 SER HA   1 1 
        3  5868 1 1 32 SER HB2  H  10.776  9.571  14.411 1.00 . A A . 32 SER HB2  1 1 
        3  5869 1 1 32 SER HB3  H  10.917 10.921  15.536 1.00 . A A . 32 SER HB3  1 1 
        3  5870 1 1 32 SER HG   H   9.016 11.661  14.907 1.00 . A A . 32 SER HG   1 1 
        3  5871 1 1 32 SER N    N  11.173 12.822  13.636 1.00 . A A . 32 SER N    1 1 
        3  5872 1 1 32 SER O    O  11.977 10.297  11.440 1.00 . A A . 32 SER O    1 1 
        3  5873 1 1 32 SER OG   O   9.251 10.935  14.323 1.00 . A A . 32 SER OG   1 1 
        3  5874 1 1 33 TYR C    C  10.310 11.363   9.267 1.00 . A A . 33 TYR C    1 1 
        3  5875 1 1 33 TYR CA   C   9.458 10.703  10.356 1.00 . A A . 33 TYR CA   1 1 
        3  5876 1 1 33 TYR CB   C   7.983 11.083  10.160 1.00 . A A . 33 TYR CB   1 1 
        3  5877 1 1 33 TYR CD1  C   7.808 11.568   7.696 1.00 . A A . 33 TYR CD1  1 1 
        3  5878 1 1 33 TYR CD2  C   6.905  9.476   8.525 1.00 . A A . 33 TYR CD2  1 1 
        3  5879 1 1 33 TYR CE1  C   7.425 11.218   6.396 1.00 . A A . 33 TYR CE1  1 1 
        3  5880 1 1 33 TYR CE2  C   6.522  9.127   7.225 1.00 . A A . 33 TYR CE2  1 1 
        3  5881 1 1 33 TYR CG   C   7.548 10.697   8.761 1.00 . A A . 33 TYR CG   1 1 
        3  5882 1 1 33 TYR CZ   C   6.782  9.998   6.160 1.00 . A A . 33 TYR CZ   1 1 
        3  5883 1 1 33 TYR H    H   9.270 11.608  12.257 1.00 . A A . 33 TYR H    1 1 
        3  5884 1 1 33 TYR HA   H   9.557  9.632  10.282 1.00 . A A . 33 TYR HA   1 1 
        3  5885 1 1 33 TYR HB2  H   7.377 10.565  10.890 1.00 . A A . 33 TYR HB2  1 1 
        3  5886 1 1 33 TYR HB3  H   7.866 12.152  10.294 1.00 . A A . 33 TYR HB3  1 1 
        3  5887 1 1 33 TYR HD1  H   8.299 12.515   7.886 1.00 . A A . 33 TYR HD1  1 1 
        3  5888 1 1 33 TYR HD2  H   6.706  8.805   9.346 1.00 . A A . 33 TYR HD2  1 1 
        3  5889 1 1 33 TYR HE1  H   7.625 11.891   5.574 1.00 . A A . 33 TYR HE1  1 1 
        3  5890 1 1 33 TYR HE2  H   6.023  8.186   7.043 1.00 . A A . 33 TYR HE2  1 1 
        3  5891 1 1 33 TYR HH   H   6.528  8.708   4.775 1.00 . A A . 33 TYR HH   1 1 
        3  5892 1 1 33 TYR N    N   9.901 11.132  11.677 1.00 . A A . 33 TYR N    1 1 
        3  5893 1 1 33 TYR O    O  10.710 10.725   8.293 1.00 . A A . 33 TYR O    1 1 
        3  5894 1 1 33 TYR OH   O   6.401  9.654   4.879 1.00 . A A . 33 TYR OH   1 1 
        3  5895 1 1 34 TYR C    C  12.713 12.726   8.263 1.00 . A A . 34 TYR C    1 1 
        3  5896 1 1 34 TYR CA   C  11.370 13.409   8.481 1.00 . A A . 34 TYR CA   1 1 
        3  5897 1 1 34 TYR CB   C  11.579 14.857   8.981 1.00 . A A . 34 TYR CB   1 1 
        3  5898 1 1 34 TYR CD1  C  13.869 15.530   8.162 1.00 . A A . 34 TYR CD1  1 1 
        3  5899 1 1 34 TYR CD2  C  11.924 16.388   6.996 1.00 . A A . 34 TYR CD2  1 1 
        3  5900 1 1 34 TYR CE1  C  14.705 16.212   7.269 1.00 . A A . 34 TYR CE1  1 1 
        3  5901 1 1 34 TYR CE2  C  12.760 17.070   6.103 1.00 . A A . 34 TYR CE2  1 1 
        3  5902 1 1 34 TYR CG   C  12.479 15.619   8.025 1.00 . A A . 34 TYR CG   1 1 
        3  5903 1 1 34 TYR CZ   C  14.150 16.982   6.240 1.00 . A A . 34 TYR CZ   1 1 
        3  5904 1 1 34 TYR H    H  10.233 13.110  10.242 1.00 . A A . 34 TYR H    1 1 
        3  5905 1 1 34 TYR HA   H  10.838 13.438   7.545 1.00 . A A . 34 TYR HA   1 1 
        3  5906 1 1 34 TYR HB2  H  10.621 15.353   9.037 1.00 . A A . 34 TYR HB2  1 1 
        3  5907 1 1 34 TYR HB3  H  12.030 14.837   9.963 1.00 . A A . 34 TYR HB3  1 1 
        3  5908 1 1 34 TYR HD1  H  14.297 14.937   8.957 1.00 . A A . 34 TYR HD1  1 1 
        3  5909 1 1 34 TYR HD2  H  10.849 16.460   6.894 1.00 . A A . 34 TYR HD2  1 1 
        3  5910 1 1 34 TYR HE1  H  15.777 16.144   7.375 1.00 . A A . 34 TYR HE1  1 1 
        3  5911 1 1 34 TYR HE2  H  12.331 17.664   5.309 1.00 . A A . 34 TYR HE2  1 1 
        3  5912 1 1 34 TYR HH   H  14.464 18.363   4.959 1.00 . A A . 34 TYR HH   1 1 
        3  5913 1 1 34 TYR N    N  10.578 12.652   9.447 1.00 . A A . 34 TYR N    1 1 
        3  5914 1 1 34 TYR O    O  13.133 12.526   7.123 1.00 . A A . 34 TYR O    1 1 
        3  5915 1 1 34 TYR OH   O  14.974 17.657   5.362 1.00 . A A . 34 TYR OH   1 1 
        3  5916 1 1 35 ARG C    C  14.485 10.226   8.901 1.00 . A A . 35 ARG C    1 1 
        3  5917 1 1 35 ARG CA   C  14.670 11.692   9.289 1.00 . A A . 35 ARG CA   1 1 
        3  5918 1 1 35 ARG CB   C  15.408 11.810  10.625 1.00 . A A . 35 ARG CB   1 1 
        3  5919 1 1 35 ARG CD   C  17.625 11.498  11.744 1.00 . A A . 35 ARG CD   1 1 
        3  5920 1 1 35 ARG CG   C  16.816 11.216  10.484 1.00 . A A . 35 ARG CG   1 1 
        3  5921 1 1 35 ARG CZ   C  19.911 11.261  12.510 1.00 . A A . 35 ARG CZ   1 1 
        3  5922 1 1 35 ARG H    H  12.998 12.553  10.237 1.00 . A A . 35 ARG H    1 1 
        3  5923 1 1 35 ARG HA   H  15.271 12.170   8.527 1.00 . A A . 35 ARG HA   1 1 
        3  5924 1 1 35 ARG HB2  H  15.479 12.853  10.903 1.00 . A A . 35 ARG HB2  1 1 
        3  5925 1 1 35 ARG HB3  H  14.866 11.269  11.386 1.00 . A A . 35 ARG HB3  1 1 
        3  5926 1 1 35 ARG HD2  H  17.612 12.557  11.951 1.00 . A A . 35 ARG HD2  1 1 
        3  5927 1 1 35 ARG HD3  H  17.190 10.964  12.575 1.00 . A A . 35 ARG HD3  1 1 
        3  5928 1 1 35 ARG HE   H  19.264 10.620  10.723 1.00 . A A . 35 ARG HE   1 1 
        3  5929 1 1 35 ARG HG2  H  16.743 10.150  10.340 1.00 . A A . 35 ARG HG2  1 1 
        3  5930 1 1 35 ARG HG3  H  17.315 11.661   9.634 1.00 . A A . 35 ARG HG3  1 1 
        3  5931 1 1 35 ARG HH11 H  18.633 12.177  13.748 1.00 . A A . 35 ARG HH11 1 1 
        3  5932 1 1 35 ARG HH12 H  20.255 12.011  14.333 1.00 . A A . 35 ARG HH12 1 1 
        3  5933 1 1 35 ARG HH21 H  21.395 10.389  11.487 1.00 . A A . 35 ARG HH21 1 1 
        3  5934 1 1 35 ARG HH22 H  21.819 10.998  13.052 1.00 . A A . 35 ARG HH22 1 1 
        3  5935 1 1 35 ARG N    N  13.382 12.368   9.354 1.00 . A A . 35 ARG N    1 1 
        3  5936 1 1 35 ARG NE   N  19.005 11.066  11.558 1.00 . A A . 35 ARG NE   1 1 
        3  5937 1 1 35 ARG NH1  N  19.574 11.863  13.618 1.00 . A A . 35 ARG NH1  1 1 
        3  5938 1 1 35 ARG NH2  N  21.138 10.851  12.338 1.00 . A A . 35 ARG NH2  1 1 
        3  5939 1 1 35 ARG O    O  15.425  9.571   8.451 1.00 . A A . 35 ARG O    1 1 
        3  5940 1 1 36 SER C    C  13.039  8.094   7.273 1.00 . A A . 36 SER C    1 1 
        3  5941 1 1 36 SER CA   C  12.994  8.315   8.780 1.00 . A A . 36 SER CA   1 1 
        3  5942 1 1 36 SER CB   C  11.615  7.901   9.311 1.00 . A A . 36 SER CB   1 1 
        3  5943 1 1 36 SER H    H  12.564 10.282   9.462 1.00 . A A . 36 SER H    1 1 
        3  5944 1 1 36 SER HA   H  13.744  7.691   9.247 1.00 . A A . 36 SER HA   1 1 
        3  5945 1 1 36 SER HB2  H  11.511  8.203  10.339 1.00 . A A . 36 SER HB2  1 1 
        3  5946 1 1 36 SER HB3  H  10.841  8.373   8.720 1.00 . A A . 36 SER HB3  1 1 
        3  5947 1 1 36 SER HG   H  11.376  6.251   8.301 1.00 . A A . 36 SER HG   1 1 
        3  5948 1 1 36 SER N    N  13.275  9.713   9.101 1.00 . A A . 36 SER N    1 1 
        3  5949 1 1 36 SER O    O  13.703  7.176   6.792 1.00 . A A . 36 SER O    1 1 
        3  5950 1 1 36 SER OG   O  11.488  6.486   9.226 1.00 . A A . 36 SER OG   1 1 
        3  5951 1 1 37 VAL C    C  13.587  9.310   4.462 1.00 . A A . 37 VAL C    1 1 
        3  5952 1 1 37 VAL CA   C  12.288  8.804   5.076 1.00 . A A . 37 VAL CA   1 1 
        3  5953 1 1 37 VAL CB   C  11.090  9.573   4.482 1.00 . A A . 37 VAL CB   1 1 
        3  5954 1 1 37 VAL CG1  C   9.822  9.205   5.255 1.00 . A A . 37 VAL CG1  1 1 
        3  5955 1 1 37 VAL CG2  C  11.332 11.096   4.552 1.00 . A A . 37 VAL CG2  1 1 
        3  5956 1 1 37 VAL H    H  11.809  9.644   6.973 1.00 . A A . 37 VAL H    1 1 
        3  5957 1 1 37 VAL HA   H  12.177  7.758   4.822 1.00 . A A . 37 VAL HA   1 1 
        3  5958 1 1 37 VAL HB   H  10.964  9.281   3.446 1.00 . A A . 37 VAL HB   1 1 
        3  5959 1 1 37 VAL HG11 H   8.966  9.609   4.743 1.00 . A A . 37 VAL HG11 1 1 
        3  5960 1 1 37 VAL HG12 H   9.876  9.615   6.252 1.00 . A A . 37 VAL HG12 1 1 
        3  5961 1 1 37 VAL HG13 H   9.733  8.130   5.309 1.00 . A A . 37 VAL HG13 1 1 
        3  5962 1 1 37 VAL HG21 H  11.696 11.360   5.535 1.00 . A A . 37 VAL HG21 1 1 
        3  5963 1 1 37 VAL HG22 H  10.411 11.624   4.351 1.00 . A A . 37 VAL HG22 1 1 
        3  5964 1 1 37 VAL HG23 H  12.071 11.376   3.808 1.00 . A A . 37 VAL HG23 1 1 
        3  5965 1 1 37 VAL N    N  12.318  8.931   6.534 1.00 . A A . 37 VAL N    1 1 
        3  5966 1 1 37 VAL O    O  14.163  8.662   3.588 1.00 . A A . 37 VAL O    1 1 
        3  5967 1 1 38 VAL C    C  16.416 10.065   4.535 1.00 . A A . 38 VAL C    1 1 
        3  5968 1 1 38 VAL CA   C  15.267 11.053   4.382 1.00 . A A . 38 VAL CA   1 1 
        3  5969 1 1 38 VAL CB   C  15.584 12.370   5.124 1.00 . A A . 38 VAL CB   1 1 
        3  5970 1 1 38 VAL CG1  C  17.002 12.872   4.771 1.00 . A A . 38 VAL CG1  1 1 
        3  5971 1 1 38 VAL CG2  C  14.550 13.438   4.731 1.00 . A A . 38 VAL CG2  1 1 
        3  5972 1 1 38 VAL H    H  13.541 10.945   5.616 1.00 . A A . 38 VAL H    1 1 
        3  5973 1 1 38 VAL HA   H  15.126 11.266   3.330 1.00 . A A . 38 VAL HA   1 1 
        3  5974 1 1 38 VAL HB   H  15.529 12.193   6.185 1.00 . A A . 38 VAL HB   1 1 
        3  5975 1 1 38 VAL HG11 H  17.740 12.247   5.258 1.00 . A A . 38 VAL HG11 1 1 
        3  5976 1 1 38 VAL HG12 H  17.124 13.891   5.109 1.00 . A A . 38 VAL HG12 1 1 
        3  5977 1 1 38 VAL HG13 H  17.145 12.827   3.702 1.00 . A A . 38 VAL HG13 1 1 
        3  5978 1 1 38 VAL HG21 H  14.737 13.763   3.716 1.00 . A A . 38 VAL HG21 1 1 
        3  5979 1 1 38 VAL HG22 H  14.633 14.281   5.401 1.00 . A A . 38 VAL HG22 1 1 
        3  5980 1 1 38 VAL HG23 H  13.555 13.022   4.798 1.00 . A A . 38 VAL HG23 1 1 
        3  5981 1 1 38 VAL N    N  14.041 10.473   4.919 1.00 . A A . 38 VAL N    1 1 
        3  5982 1 1 38 VAL O    O  17.149  9.828   3.575 1.00 . A A . 38 VAL O    1 1 
        3  5983 1 1 39 SER C    C  17.458  7.326   5.046 1.00 . A A . 39 SER C    1 1 
        3  5984 1 1 39 SER CA   C  17.632  8.533   5.959 1.00 . A A . 39 SER CA   1 1 
        3  5985 1 1 39 SER CB   C  17.616  8.084   7.421 1.00 . A A . 39 SER CB   1 1 
        3  5986 1 1 39 SER H    H  15.958  9.720   6.453 1.00 . A A . 39 SER H    1 1 
        3  5987 1 1 39 SER HA   H  18.582  9.000   5.747 1.00 . A A . 39 SER HA   1 1 
        3  5988 1 1 39 SER HB2  H  16.663  7.638   7.654 1.00 . A A . 39 SER HB2  1 1 
        3  5989 1 1 39 SER HB3  H  18.400  7.357   7.582 1.00 . A A . 39 SER HB3  1 1 
        3  5990 1 1 39 SER HG   H  18.766  9.346   8.352 1.00 . A A . 39 SER HG   1 1 
        3  5991 1 1 39 SER N    N  16.573  9.493   5.725 1.00 . A A . 39 SER N    1 1 
        3  5992 1 1 39 SER O    O  18.434  6.821   4.491 1.00 . A A . 39 SER O    1 1 
        3  5993 1 1 39 SER OG   O  17.821  9.212   8.261 1.00 . A A . 39 SER OG   1 1 
        3  5994 1 1 40 THR C    C  16.154  6.053   2.579 1.00 . A A . 40 THR C    1 1 
        3  5995 1 1 40 THR CA   C  15.947  5.705   4.053 1.00 . A A . 40 THR CA   1 1 
        3  5996 1 1 40 THR CB   C  14.506  5.225   4.267 1.00 . A A . 40 THR CB   1 1 
        3  5997 1 1 40 THR CG2  C  14.245  3.986   3.404 1.00 . A A . 40 THR CG2  1 1 
        3  5998 1 1 40 THR H    H  15.482  7.304   5.366 1.00 . A A . 40 THR H    1 1 
        3  5999 1 1 40 THR HA   H  16.622  4.904   4.321 1.00 . A A . 40 THR HA   1 1 
        3  6000 1 1 40 THR HB   H  13.818  6.008   3.987 1.00 . A A . 40 THR HB   1 1 
        3  6001 1 1 40 THR HG1  H  14.188  3.941   5.695 1.00 . A A . 40 THR HG1  1 1 
        3  6002 1 1 40 THR HG21 H  15.045  3.269   3.544 1.00 . A A . 40 THR HG21 1 1 
        3  6003 1 1 40 THR HG22 H  14.200  4.273   2.364 1.00 . A A . 40 THR HG22 1 1 
        3  6004 1 1 40 THR HG23 H  13.307  3.539   3.694 1.00 . A A . 40 THR HG23 1 1 
        3  6005 1 1 40 THR N    N  16.222  6.860   4.900 1.00 . A A . 40 THR N    1 1 
        3  6006 1 1 40 THR O    O  16.793  5.306   1.839 1.00 . A A . 40 THR O    1 1 
        3  6007 1 1 40 THR OG1  O  14.321  4.890   5.636 1.00 . A A . 40 THR OG1  1 1 
        3  6008 1 1 41 LEU C    C  17.204  7.872   0.428 1.00 . A A . 41 LEU C    1 1 
        3  6009 1 1 41 LEU CA   C  15.734  7.628   0.777 1.00 . A A . 41 LEU CA   1 1 
        3  6010 1 1 41 LEU CB   C  14.916  8.910   0.557 1.00 . A A . 41 LEU CB   1 1 
        3  6011 1 1 41 LEU CD1  C  12.635  9.948   0.639 1.00 . A A . 41 LEU CD1  1 1 
        3  6012 1 1 41 LEU CD2  C  12.961  7.772  -0.629 1.00 . A A . 41 LEU CD2  1 1 
        3  6013 1 1 41 LEU CG   C  13.399  8.612   0.605 1.00 . A A . 41 LEU CG   1 1 
        3  6014 1 1 41 LEU H    H  15.109  7.746   2.798 1.00 . A A . 41 LEU H    1 1 
        3  6015 1 1 41 LEU HA   H  15.355  6.853   0.132 1.00 . A A . 41 LEU HA   1 1 
        3  6016 1 1 41 LEU HB2  H  15.161  9.613   1.337 1.00 . A A . 41 LEU HB2  1 1 
        3  6017 1 1 41 LEU HB3  H  15.165  9.344  -0.401 1.00 . A A . 41 LEU HB3  1 1 
        3  6018 1 1 41 LEU HD11 H  11.573  9.758   0.682 1.00 . A A . 41 LEU HD11 1 1 
        3  6019 1 1 41 LEU HD12 H  12.864 10.517  -0.252 1.00 . A A . 41 LEU HD12 1 1 
        3  6020 1 1 41 LEU HD13 H  12.937 10.510   1.510 1.00 . A A . 41 LEU HD13 1 1 
        3  6021 1 1 41 LEU HD21 H  13.040  6.723  -0.389 1.00 . A A . 41 LEU HD21 1 1 
        3  6022 1 1 41 LEU HD22 H  13.593  7.990  -1.479 1.00 . A A . 41 LEU HD22 1 1 
        3  6023 1 1 41 LEU HD23 H  11.932  7.993  -0.887 1.00 . A A . 41 LEU HD23 1 1 
        3  6024 1 1 41 LEU HG   H  13.177  8.058   1.505 1.00 . A A . 41 LEU HG   1 1 
        3  6025 1 1 41 LEU N    N  15.607  7.190   2.163 1.00 . A A . 41 LEU N    1 1 
        3  6026 1 1 41 LEU O    O  17.614  7.703  -0.721 1.00 . A A . 41 LEU O    1 1 
        3  6027 1 1 42 VAL C    C  20.233  7.234   1.343 1.00 . A A . 42 VAL C    1 1 
        3  6028 1 1 42 VAL CA   C  19.427  8.531   1.216 1.00 . A A . 42 VAL CA   1 1 
        3  6029 1 1 42 VAL CB   C  19.926  9.580   2.235 1.00 . A A . 42 VAL CB   1 1 
        3  6030 1 1 42 VAL CG1  C  21.463  9.719   2.163 1.00 . A A . 42 VAL CG1  1 1 
        3  6031 1 1 42 VAL CG2  C  19.273 10.944   1.921 1.00 . A A . 42 VAL CG2  1 1 
        3  6032 1 1 42 VAL H    H  17.605  8.388   2.320 1.00 . A A . 42 VAL H    1 1 
        3  6033 1 1 42 VAL HA   H  19.579  8.926   0.218 1.00 . A A . 42 VAL HA   1 1 
        3  6034 1 1 42 VAL HB   H  19.644  9.268   3.229 1.00 . A A . 42 VAL HB   1 1 
        3  6035 1 1 42 VAL HG11 H  21.776 10.603   2.699 1.00 . A A . 42 VAL HG11 1 1 
        3  6036 1 1 42 VAL HG12 H  21.771  9.798   1.130 1.00 . A A . 42 VAL HG12 1 1 
        3  6037 1 1 42 VAL HG13 H  21.925  8.849   2.608 1.00 . A A . 42 VAL HG13 1 1 
        3  6038 1 1 42 VAL HG21 H  19.753 11.389   1.060 1.00 . A A . 42 VAL HG21 1 1 
        3  6039 1 1 42 VAL HG22 H  19.386 11.600   2.772 1.00 . A A . 42 VAL HG22 1 1 
        3  6040 1 1 42 VAL HG23 H  18.223 10.810   1.710 1.00 . A A . 42 VAL HG23 1 1 
        3  6041 1 1 42 VAL N    N  17.987  8.271   1.425 1.00 . A A . 42 VAL N    1 1 
        3  6042 1 1 42 VAL O    O  21.197  7.022   0.607 1.00 . A A . 42 VAL O    1 1 
        3  6043 1 1 43 GLN C    C  20.325  4.191   1.289 1.00 . A A . 43 GLN C    1 1 
        3  6044 1 1 43 GLN CA   C  20.530  5.111   2.491 1.00 . A A . 43 GLN CA   1 1 
        3  6045 1 1 43 GLN CB   C  20.021  4.432   3.784 1.00 . A A . 43 GLN CB   1 1 
        3  6046 1 1 43 GLN CD   C  19.973  4.617   6.294 1.00 . A A . 43 GLN CD   1 1 
        3  6047 1 1 43 GLN CG   C  20.678  5.077   5.021 1.00 . A A . 43 GLN CG   1 1 
        3  6048 1 1 43 GLN H    H  19.060  6.603   2.837 1.00 . A A . 43 GLN H    1 1 
        3  6049 1 1 43 GLN HA   H  21.587  5.303   2.590 1.00 . A A . 43 GLN HA   1 1 
        3  6050 1 1 43 GLN HB2  H  18.949  4.549   3.844 1.00 . A A . 43 GLN HB2  1 1 
        3  6051 1 1 43 GLN HB3  H  20.264  3.376   3.766 1.00 . A A . 43 GLN HB3  1 1 
        3  6052 1 1 43 GLN HE21 H  21.168  5.645   7.502 1.00 . A A . 43 GLN HE21 1 1 
        3  6053 1 1 43 GLN HE22 H  19.949  4.751   8.275 1.00 . A A . 43 GLN HE22 1 1 
        3  6054 1 1 43 GLN HG2  H  21.715  4.778   5.064 1.00 . A A . 43 GLN HG2  1 1 
        3  6055 1 1 43 GLN HG3  H  20.625  6.151   4.945 1.00 . A A . 43 GLN HG3  1 1 
        3  6056 1 1 43 GLN N    N  19.836  6.380   2.281 1.00 . A A . 43 GLN N    1 1 
        3  6057 1 1 43 GLN NE2  N  20.400  5.038   7.454 1.00 . A A . 43 GLN NE2  1 1 
        3  6058 1 1 43 GLN O    O  20.925  3.118   1.222 1.00 . A A . 43 GLN O    1 1 
        3  6059 1 1 43 GLN OE1  O  19.013  3.849   6.231 1.00 . A A . 43 GLN OE1  1 1 
        3  6060 1 1 44 ASP C    C  18.886  4.701  -2.019 1.00 . A A . 44 ASP C    1 1 
        3  6061 1 1 44 ASP CA   C  19.202  3.806  -0.834 1.00 . A A . 44 ASP CA   1 1 
        3  6062 1 1 44 ASP CB   C  18.011  2.882  -0.546 1.00 . A A . 44 ASP CB   1 1 
        3  6063 1 1 44 ASP CG   C  16.737  3.688  -0.285 1.00 . A A . 44 ASP CG   1 1 
        3  6064 1 1 44 ASP H    H  19.031  5.472   0.459 1.00 . A A . 44 ASP H    1 1 
        3  6065 1 1 44 ASP HA   H  20.059  3.198  -1.083 1.00 . A A . 44 ASP HA   1 1 
        3  6066 1 1 44 ASP HB2  H  17.853  2.230  -1.389 1.00 . A A . 44 ASP HB2  1 1 
        3  6067 1 1 44 ASP HB3  H  18.235  2.291   0.328 1.00 . A A . 44 ASP HB3  1 1 
        3  6068 1 1 44 ASP N    N  19.481  4.608   0.352 1.00 . A A . 44 ASP N    1 1 
        3  6069 1 1 44 ASP O    O  18.626  5.893  -1.859 1.00 . A A . 44 ASP O    1 1 
        3  6070 1 1 44 ASP OD1  O  16.751  4.885  -0.525 1.00 . A A . 44 ASP OD1  1 1 
        3  6071 1 1 44 ASP OD2  O  15.772  3.095   0.169 1.00 . A A . 44 ASP OD2  1 1 
        3  6072 1 1 45 GLN C    C  19.832  5.625  -4.942 1.00 . A A . 45 GLN C    1 1 
        3  6073 1 1 45 GLN CA   C  18.593  4.876  -4.451 1.00 . A A . 45 GLN CA   1 1 
        3  6074 1 1 45 GLN CB   C  17.431  5.880  -4.220 1.00 . A A . 45 GLN CB   1 1 
        3  6075 1 1 45 GLN CD   C  15.734  7.348  -5.298 1.00 . A A . 45 GLN CD   1 1 
        3  6076 1 1 45 GLN CG   C  16.918  6.420  -5.545 1.00 . A A . 45 GLN CG   1 1 
        3  6077 1 1 45 GLN H    H  19.114  3.163  -3.280 1.00 . A A . 45 GLN H    1 1 
        3  6078 1 1 45 GLN HA   H  18.294  4.173  -5.216 1.00 . A A . 45 GLN HA   1 1 
        3  6079 1 1 45 GLN HB2  H  16.627  5.386  -3.696 1.00 . A A . 45 GLN HB2  1 1 
        3  6080 1 1 45 GLN HB3  H  17.782  6.712  -3.635 1.00 . A A . 45 GLN HB3  1 1 
        3  6081 1 1 45 GLN HE21 H  15.902  8.278  -7.043 1.00 . A A . 45 GLN HE21 1 1 
        3  6082 1 1 45 GLN HE22 H  14.639  8.825  -6.048 1.00 . A A . 45 GLN HE22 1 1 
        3  6083 1 1 45 GLN HG2  H  17.709  6.971  -6.019 1.00 . A A . 45 GLN HG2  1 1 
        3  6084 1 1 45 GLN HG3  H  16.613  5.600  -6.174 1.00 . A A . 45 GLN HG3  1 1 
        3  6085 1 1 45 GLN N    N  18.901  4.117  -3.213 1.00 . A A . 45 GLN N    1 1 
        3  6086 1 1 45 GLN NE2  N  15.396  8.222  -6.206 1.00 . A A . 45 GLN NE2  1 1 
        3  6087 1 1 45 GLN O    O  20.450  5.236  -5.933 1.00 . A A . 45 GLN O    1 1 
        3  6088 1 1 45 GLN OE1  O  15.099  7.271  -4.246 1.00 . A A . 45 GLN OE1  1 1 
        3  6089 1 1 46 LEU C    C  21.413  7.722  -6.129 1.00 . A A . 46 LEU C    1 1 
        3  6090 1 1 46 LEU CA   C  21.365  7.491  -4.612 1.00 . A A . 46 LEU CA   1 1 
        3  6091 1 1 46 LEU CB   C  22.634  6.761  -4.148 1.00 . A A . 46 LEU CB   1 1 
        3  6092 1 1 46 LEU CD1  C  23.549  5.510  -2.149 1.00 . A A . 46 LEU CD1  1 1 
        3  6093 1 1 46 LEU CD2  C  23.337  7.981  -2.023 1.00 . A A . 46 LEU CD2  1 1 
        3  6094 1 1 46 LEU CG   C  22.696  6.706  -2.594 1.00 . A A . 46 LEU CG   1 1 
        3  6095 1 1 46 LEU H    H  19.661  6.957  -3.457 1.00 . A A . 46 LEU H    1 1 
        3  6096 1 1 46 LEU HA   H  21.307  8.443  -4.115 1.00 . A A . 46 LEU HA   1 1 
        3  6097 1 1 46 LEU HB2  H  22.609  5.754  -4.547 1.00 . A A . 46 LEU HB2  1 1 
        3  6098 1 1 46 LEU HB3  H  23.507  7.271  -4.531 1.00 . A A . 46 LEU HB3  1 1 
        3  6099 1 1 46 LEU HD11 H  23.647  5.513  -1.073 1.00 . A A . 46 LEU HD11 1 1 
        3  6100 1 1 46 LEU HD12 H  24.528  5.580  -2.601 1.00 . A A . 46 LEU HD12 1 1 
        3  6101 1 1 46 LEU HD13 H  23.073  4.594  -2.464 1.00 . A A . 46 LEU HD13 1 1 
        3  6102 1 1 46 LEU HD21 H  23.362  7.913  -0.945 1.00 . A A . 46 LEU HD21 1 1 
        3  6103 1 1 46 LEU HD22 H  22.763  8.846  -2.314 1.00 . A A . 46 LEU HD22 1 1 
        3  6104 1 1 46 LEU HD23 H  24.347  8.075  -2.399 1.00 . A A . 46 LEU HD23 1 1 
        3  6105 1 1 46 LEU HG   H  21.697  6.598  -2.195 1.00 . A A . 46 LEU HG   1 1 
        3  6106 1 1 46 LEU N    N  20.191  6.694  -4.239 1.00 . A A . 46 LEU N    1 1 
        3  6107 1 1 46 LEU O    O  22.470  7.628  -6.754 1.00 . A A . 46 LEU O    1 1 
        3  6108 1 1 47 THR C    C  21.007  9.451  -8.529 1.00 . A A . 47 THR C    1 1 
        3  6109 1 1 47 THR CA   C  20.165  8.251  -8.138 1.00 . A A . 47 THR CA   1 1 
        3  6110 1 1 47 THR CB   C  18.695  8.472  -8.535 1.00 . A A . 47 THR CB   1 1 
        3  6111 1 1 47 THR CG2  C  18.581  8.913  -9.997 1.00 . A A . 47 THR CG2  1 1 
        3  6112 1 1 47 THR H    H  19.444  8.081  -6.158 1.00 . A A . 47 THR H    1 1 
        3  6113 1 1 47 THR HA   H  20.538  7.386  -8.654 1.00 . A A . 47 THR HA   1 1 
        3  6114 1 1 47 THR HB   H  18.267  9.233  -7.900 1.00 . A A . 47 THR HB   1 1 
        3  6115 1 1 47 THR HG1  H  18.271  6.641  -9.032 1.00 . A A . 47 THR HG1  1 1 
        3  6116 1 1 47 THR HG21 H  18.941  9.927 -10.095 1.00 . A A . 47 THR HG21 1 1 
        3  6117 1 1 47 THR HG22 H  17.547  8.868 -10.302 1.00 . A A . 47 THR HG22 1 1 
        3  6118 1 1 47 THR HG23 H  19.173  8.259 -10.618 1.00 . A A . 47 THR HG23 1 1 
        3  6119 1 1 47 THR N    N  20.254  8.020  -6.707 1.00 . A A . 47 THR N    1 1 
        3  6120 1 1 47 THR O    O  21.629  9.480  -9.590 1.00 . A A . 47 THR O    1 1 
        3  6121 1 1 47 THR OG1  O  17.977  7.260  -8.359 1.00 . A A . 47 THR OG1  1 1 
        3  6122 1 1 48 LYS C    C  21.606 12.665  -6.769 1.00 . A A . 48 LYS C    1 1 
        3  6123 1 1 48 LYS CA   C  21.752 11.685  -7.931 1.00 . A A . 48 LYS CA   1 1 
        3  6124 1 1 48 LYS CB   C  21.234 12.349  -9.214 1.00 . A A . 48 LYS CB   1 1 
        3  6125 1 1 48 LYS CD   C  21.643 14.166 -10.871 1.00 . A A . 48 LYS CD   1 1 
        3  6126 1 1 48 LYS CE   C  22.507 15.392 -11.185 1.00 . A A . 48 LYS CE   1 1 
        3  6127 1 1 48 LYS CG   C  22.087 13.563  -9.541 1.00 . A A . 48 LYS CG   1 1 
        3  6128 1 1 48 LYS H    H  20.489 10.382  -6.834 1.00 . A A . 48 LYS H    1 1 
        3  6129 1 1 48 LYS HA   H  22.796 11.440  -8.063 1.00 . A A . 48 LYS HA   1 1 
        3  6130 1 1 48 LYS HB2  H  21.274 11.658 -10.036 1.00 . A A . 48 LYS HB2  1 1 
        3  6131 1 1 48 LYS HB3  H  20.219 12.665  -9.064 1.00 . A A . 48 LYS HB3  1 1 
        3  6132 1 1 48 LYS HD2  H  21.759 13.431 -11.654 1.00 . A A . 48 LYS HD2  1 1 
        3  6133 1 1 48 LYS HD3  H  20.607 14.463 -10.803 1.00 . A A . 48 LYS HD3  1 1 
        3  6134 1 1 48 LYS HE2  H  22.053 15.956 -11.986 1.00 . A A . 48 LYS HE2  1 1 
        3  6135 1 1 48 LYS HE3  H  22.593 16.019 -10.305 1.00 . A A . 48 LYS HE3  1 1 
        3  6136 1 1 48 LYS HG2  H  21.967 14.295  -8.769 1.00 . A A . 48 LYS HG2  1 1 
        3  6137 1 1 48 LYS HG3  H  23.121 13.269  -9.606 1.00 . A A . 48 LYS HG3  1 1 
        3  6138 1 1 48 LYS HZ1  H  23.907 13.900 -11.571 1.00 . A A . 48 LYS HZ1  1 1 
        3  6139 1 1 48 LYS HZ2  H  24.575 15.334 -10.961 1.00 . A A . 48 LYS HZ2  1 1 
        3  6140 1 1 48 LYS HZ3  H  24.051 15.263 -12.576 1.00 . A A . 48 LYS HZ3  1 1 
        3  6141 1 1 48 LYS N    N  21.003 10.461  -7.665 1.00 . A A . 48 LYS N    1 1 
        3  6142 1 1 48 LYS NZ   N  23.862 14.938 -11.605 1.00 . A A . 48 LYS NZ   1 1 
        3  6143 1 1 48 LYS O    O  20.547 12.746  -6.147 1.00 . A A . 48 LYS O    1 1 
        3  6144 1 1 49 ASN C    C  21.504 15.391  -5.609 1.00 . A A . 49 ASN C    1 1 
        3  6145 1 1 49 ASN CA   C  22.636 14.385  -5.399 1.00 . A A . 49 ASN CA   1 1 
        3  6146 1 1 49 ASN CB   C  23.965 15.137  -5.323 1.00 . A A . 49 ASN CB   1 1 
        3  6147 1 1 49 ASN CG   C  25.113 14.149  -5.158 1.00 . A A . 49 ASN CG   1 1 
        3  6148 1 1 49 ASN H    H  23.487 13.303  -7.020 1.00 . A A . 49 ASN H    1 1 
        3  6149 1 1 49 ASN HA   H  22.475 13.865  -4.473 1.00 . A A . 49 ASN HA   1 1 
        3  6150 1 1 49 ASN HB2  H  24.109 15.707  -6.228 1.00 . A A . 49 ASN HB2  1 1 
        3  6151 1 1 49 ASN HB3  H  23.947 15.807  -4.476 1.00 . A A . 49 ASN HB3  1 1 
        3  6152 1 1 49 ASN HD21 H  24.054 12.874  -4.067 1.00 . A A . 49 ASN HD21 1 1 
        3  6153 1 1 49 ASN HD22 H  25.660 12.414  -4.363 1.00 . A A . 49 ASN HD22 1 1 
        3  6154 1 1 49 ASN N    N  22.670 13.411  -6.490 1.00 . A A . 49 ASN N    1 1 
        3  6155 1 1 49 ASN ND2  N  24.927 13.055  -4.472 1.00 . A A . 49 ASN ND2  1 1 
        3  6156 1 1 49 ASN O    O  20.811 15.763  -4.662 1.00 . A A . 49 ASN O    1 1 
        3  6157 1 1 49 ASN OD1  O  26.208 14.378  -5.673 1.00 . A A . 49 ASN OD1  1 1 
        3  6158 1 1 50 ALA C    C  18.873 16.154  -6.939 1.00 . A A . 50 ALA C    1 1 
        3  6159 1 1 50 ALA CA   C  20.258 16.779  -7.158 1.00 . A A . 50 ALA CA   1 1 
        3  6160 1 1 50 ALA CB   C  20.375 17.249  -8.612 1.00 . A A . 50 ALA CB   1 1 
        3  6161 1 1 50 ALA H    H  21.904 15.491  -7.568 1.00 . A A . 50 ALA H    1 1 
        3  6162 1 1 50 ALA HA   H  20.365 17.635  -6.511 1.00 . A A . 50 ALA HA   1 1 
        3  6163 1 1 50 ALA HB1  H  21.377 17.601  -8.803 1.00 . A A . 50 ALA HB1  1 1 
        3  6164 1 1 50 ALA HB2  H  19.673 18.050  -8.786 1.00 . A A . 50 ALA HB2  1 1 
        3  6165 1 1 50 ALA HB3  H  20.152 16.427  -9.275 1.00 . A A . 50 ALA HB3  1 1 
        3  6166 1 1 50 ALA N    N  21.320 15.821  -6.853 1.00 . A A . 50 ALA N    1 1 
        3  6167 1 1 50 ALA O    O  18.003 16.749  -6.302 1.00 . A A . 50 ALA O    1 1 
        3  6168 1 1 51 VAL C    C  16.952 14.207  -5.870 1.00 . A A . 51 VAL C    1 1 
        3  6169 1 1 51 VAL CA   C  17.383 14.284  -7.334 1.00 . A A . 51 VAL CA   1 1 
        3  6170 1 1 51 VAL CB   C  17.500 12.853  -7.923 1.00 . A A . 51 VAL CB   1 1 
        3  6171 1 1 51 VAL CG1  C  16.314 11.955  -7.492 1.00 . A A . 51 VAL CG1  1 1 
        3  6172 1 1 51 VAL CG2  C  17.548 12.929  -9.460 1.00 . A A . 51 VAL CG2  1 1 
        3  6173 1 1 51 VAL H    H  19.413 14.526  -7.969 1.00 . A A . 51 VAL H    1 1 
        3  6174 1 1 51 VAL HA   H  16.642 14.833  -7.890 1.00 . A A . 51 VAL HA   1 1 
        3  6175 1 1 51 VAL HB   H  18.415 12.406  -7.563 1.00 . A A . 51 VAL HB   1 1 
        3  6176 1 1 51 VAL HG11 H  15.390 12.500  -7.602 1.00 . A A . 51 VAL HG11 1 1 
        3  6177 1 1 51 VAL HG12 H  16.439 11.662  -6.458 1.00 . A A . 51 VAL HG12 1 1 
        3  6178 1 1 51 VAL HG13 H  16.286 11.064  -8.110 1.00 . A A . 51 VAL HG13 1 1 
        3  6179 1 1 51 VAL HG21 H  18.230 13.710  -9.768 1.00 . A A . 51 VAL HG21 1 1 
        3  6180 1 1 51 VAL HG22 H  16.562 13.143  -9.844 1.00 . A A . 51 VAL HG22 1 1 
        3  6181 1 1 51 VAL HG23 H  17.886 11.984  -9.851 1.00 . A A . 51 VAL HG23 1 1 
        3  6182 1 1 51 VAL N    N  18.684 14.952  -7.471 1.00 . A A . 51 VAL N    1 1 
        3  6183 1 1 51 VAL O    O  15.967 14.826  -5.467 1.00 . A A . 51 VAL O    1 1 
        3  6184 1 1 52 VAL C    C  17.104 14.673  -3.013 1.00 . A A . 52 VAL C    1 1 
        3  6185 1 1 52 VAL CA   C  17.374 13.307  -3.660 1.00 . A A . 52 VAL CA   1 1 
        3  6186 1 1 52 VAL CB   C  18.532 12.623  -2.920 1.00 . A A . 52 VAL CB   1 1 
        3  6187 1 1 52 VAL CG1  C  18.823 11.253  -3.540 1.00 . A A . 52 VAL CG1  1 1 
        3  6188 1 1 52 VAL CG2  C  19.791 13.487  -3.030 1.00 . A A . 52 VAL CG2  1 1 
        3  6189 1 1 52 VAL H    H  18.482 12.985  -5.454 1.00 . A A . 52 VAL H    1 1 
        3  6190 1 1 52 VAL HA   H  16.489 12.701  -3.578 1.00 . A A . 52 VAL HA   1 1 
        3  6191 1 1 52 VAL HB   H  18.270 12.500  -1.880 1.00 . A A . 52 VAL HB   1 1 
        3  6192 1 1 52 VAL HG11 H  17.945 10.632  -3.478 1.00 . A A . 52 VAL HG11 1 1 
        3  6193 1 1 52 VAL HG12 H  19.634 10.787  -2.998 1.00 . A A . 52 VAL HG12 1 1 
        3  6194 1 1 52 VAL HG13 H  19.110 11.376  -4.575 1.00 . A A . 52 VAL HG13 1 1 
        3  6195 1 1 52 VAL HG21 H  19.652 14.412  -2.489 1.00 . A A . 52 VAL HG21 1 1 
        3  6196 1 1 52 VAL HG22 H  19.977 13.700  -4.066 1.00 . A A . 52 VAL HG22 1 1 
        3  6197 1 1 52 VAL HG23 H  20.634 12.956  -2.615 1.00 . A A . 52 VAL HG23 1 1 
        3  6198 1 1 52 VAL N    N  17.709 13.456  -5.077 1.00 . A A . 52 VAL N    1 1 
        3  6199 1 1 52 VAL O    O  16.278 14.795  -2.108 1.00 . A A . 52 VAL O    1 1 
        3  6200 1 1 53 LEU C    C  16.180 17.502  -3.150 1.00 . A A . 53 LEU C    1 1 
        3  6201 1 1 53 LEU CA   C  17.628 17.041  -2.959 1.00 . A A . 53 LEU CA   1 1 
        3  6202 1 1 53 LEU CB   C  18.619 18.026  -3.660 1.00 . A A . 53 LEU CB   1 1 
        3  6203 1 1 53 LEU CD1  C  18.632 19.731  -1.780 1.00 . A A . 53 LEU CD1  1 1 
        3  6204 1 1 53 LEU CD2  C  20.326 17.825  -1.762 1.00 . A A . 53 LEU CD2  1 1 
        3  6205 1 1 53 LEU CG   C  19.502 18.803  -2.650 1.00 . A A . 53 LEU CG   1 1 
        3  6206 1 1 53 LEU H    H  18.442 15.538  -4.224 1.00 . A A . 53 LEU H    1 1 
        3  6207 1 1 53 LEU HA   H  17.831 16.998  -1.907 1.00 . A A . 53 LEU HA   1 1 
        3  6208 1 1 53 LEU HB2  H  19.263 17.461  -4.309 1.00 . A A . 53 LEU HB2  1 1 
        3  6209 1 1 53 LEU HB3  H  18.070 18.738  -4.259 1.00 . A A . 53 LEU HB3  1 1 
        3  6210 1 1 53 LEU HD11 H  18.051 19.145  -1.084 1.00 . A A . 53 LEU HD11 1 1 
        3  6211 1 1 53 LEU HD12 H  17.971 20.303  -2.414 1.00 . A A . 53 LEU HD12 1 1 
        3  6212 1 1 53 LEU HD13 H  19.270 20.405  -1.226 1.00 . A A . 53 LEU HD13 1 1 
        3  6213 1 1 53 LEU HD21 H  21.316 18.233  -1.613 1.00 . A A . 53 LEU HD21 1 1 
        3  6214 1 1 53 LEU HD22 H  20.413 16.859  -2.244 1.00 . A A . 53 LEU HD22 1 1 
        3  6215 1 1 53 LEU HD23 H  19.847 17.694  -0.798 1.00 . A A . 53 LEU HD23 1 1 
        3  6216 1 1 53 LEU HG   H  20.189 19.417  -3.211 1.00 . A A . 53 LEU HG   1 1 
        3  6217 1 1 53 LEU N    N  17.797 15.695  -3.503 1.00 . A A . 53 LEU N    1 1 
        3  6218 1 1 53 LEU O    O  15.589 18.115  -2.261 1.00 . A A . 53 LEU O    1 1 
        3  6219 1 1 54 LYS C    C  13.291 16.988  -3.619 1.00 . A A . 54 LYS C    1 1 
        3  6220 1 1 54 LYS CA   C  14.249 17.597  -4.626 1.00 . A A . 54 LYS CA   1 1 
        3  6221 1 1 54 LYS CB   C  13.883 17.109  -6.032 1.00 . A A . 54 LYS CB   1 1 
        3  6222 1 1 54 LYS CD   C  14.651 17.119  -8.444 1.00 . A A . 54 LYS CD   1 1 
        3  6223 1 1 54 LYS CE   C  13.339 17.543  -9.123 1.00 . A A . 54 LYS CE   1 1 
        3  6224 1 1 54 LYS CG   C  14.803 17.784  -7.061 1.00 . A A . 54 LYS CG   1 1 
        3  6225 1 1 54 LYS H    H  16.137 16.712  -4.989 1.00 . A A . 54 LYS H    1 1 
        3  6226 1 1 54 LYS HA   H  14.169 18.672  -4.594 1.00 . A A . 54 LYS HA   1 1 
        3  6227 1 1 54 LYS HB2  H  13.996 16.038  -6.081 1.00 . A A . 54 LYS HB2  1 1 
        3  6228 1 1 54 LYS HB3  H  12.858 17.372  -6.244 1.00 . A A . 54 LYS HB3  1 1 
        3  6229 1 1 54 LYS HD2  H  15.481 17.413  -9.070 1.00 . A A . 54 LYS HD2  1 1 
        3  6230 1 1 54 LYS HD3  H  14.662 16.041  -8.329 1.00 . A A . 54 LYS HD3  1 1 
        3  6231 1 1 54 LYS HE2  H  13.320 17.148 -10.128 1.00 . A A . 54 LYS HE2  1 1 
        3  6232 1 1 54 LYS HE3  H  12.500 17.147  -8.570 1.00 . A A . 54 LYS HE3  1 1 
        3  6233 1 1 54 LYS HG2  H  14.554 18.831  -7.133 1.00 . A A . 54 LYS HG2  1 1 
        3  6234 1 1 54 LYS HG3  H  15.831 17.687  -6.734 1.00 . A A . 54 LYS HG3  1 1 
        3  6235 1 1 54 LYS HZ1  H  14.157 19.453  -8.934 1.00 . A A . 54 LYS HZ1  1 1 
        3  6236 1 1 54 LYS HZ2  H  12.516 19.358  -8.514 1.00 . A A . 54 LYS HZ2  1 1 
        3  6237 1 1 54 LYS HZ3  H  12.976 19.319 -10.148 1.00 . A A . 54 LYS HZ3  1 1 
        3  6238 1 1 54 LYS N    N  15.619 17.202  -4.317 1.00 . A A . 54 LYS N    1 1 
        3  6239 1 1 54 LYS NZ   N  13.240 19.031  -9.183 1.00 . A A . 54 LYS NZ   1 1 
        3  6240 1 1 54 LYS O    O  12.360 17.648  -3.155 1.00 . A A . 54 LYS O    1 1 
        3  6241 1 1 55 ARG C    C  12.801 15.678  -0.954 1.00 . A A . 55 ARG C    1 1 
        3  6242 1 1 55 ARG CA   C  12.677 15.033  -2.329 1.00 . A A . 55 ARG CA   1 1 
        3  6243 1 1 55 ARG CB   C  13.092 13.558  -2.253 1.00 . A A . 55 ARG CB   1 1 
        3  6244 1 1 55 ARG CD   C  13.155 11.385  -3.491 1.00 . A A . 55 ARG CD   1 1 
        3  6245 1 1 55 ARG CG   C  12.748 12.856  -3.572 1.00 . A A . 55 ARG CG   1 1 
        3  6246 1 1 55 ARG CZ   C  12.807  9.378  -4.823 1.00 . A A . 55 ARG CZ   1 1 
        3  6247 1 1 55 ARG H    H  14.278 15.248  -3.681 1.00 . A A . 55 ARG H    1 1 
        3  6248 1 1 55 ARG HA   H  11.651 15.096  -2.655 1.00 . A A . 55 ARG HA   1 1 
        3  6249 1 1 55 ARG HB2  H  14.157 13.493  -2.079 1.00 . A A . 55 ARG HB2  1 1 
        3  6250 1 1 55 ARG HB3  H  12.566 13.074  -1.444 1.00 . A A . 55 ARG HB3  1 1 
        3  6251 1 1 55 ARG HD2  H  14.214 11.318  -3.292 1.00 . A A . 55 ARG HD2  1 1 
        3  6252 1 1 55 ARG HD3  H  12.611 10.912  -2.684 1.00 . A A . 55 ARG HD3  1 1 
        3  6253 1 1 55 ARG HE   H  12.694 11.237  -5.557 1.00 . A A . 55 ARG HE   1 1 
        3  6254 1 1 55 ARG HG2  H  11.685 12.928  -3.751 1.00 . A A . 55 ARG HG2  1 1 
        3  6255 1 1 55 ARG HG3  H  13.282 13.331  -4.382 1.00 . A A . 55 ARG HG3  1 1 
        3  6256 1 1 55 ARG HH11 H  13.218  9.104  -2.887 1.00 . A A . 55 ARG HH11 1 1 
        3  6257 1 1 55 ARG HH12 H  12.982  7.659  -3.813 1.00 . A A . 55 ARG HH12 1 1 
        3  6258 1 1 55 ARG HH21 H  12.384  9.350  -6.782 1.00 . A A . 55 ARG HH21 1 1 
        3  6259 1 1 55 ARG HH22 H  12.509  7.800  -6.020 1.00 . A A . 55 ARG HH22 1 1 
        3  6260 1 1 55 ARG N    N  13.521 15.724  -3.279 1.00 . A A . 55 ARG N    1 1 
        3  6261 1 1 55 ARG NE   N  12.857 10.704  -4.750 1.00 . A A . 55 ARG NE   1 1 
        3  6262 1 1 55 ARG NH1  N  13.019  8.656  -3.757 1.00 . A A . 55 ARG NH1  1 1 
        3  6263 1 1 55 ARG NH2  N  12.546  8.797  -5.963 1.00 . A A . 55 ARG NH2  1 1 
        3  6264 1 1 55 ARG O    O  11.804 15.853  -0.253 1.00 . A A . 55 ARG O    1 1 
        3  6265 1 1 56 ILE C    C  13.650 18.044   0.766 1.00 . A A . 56 ILE C    1 1 
        3  6266 1 1 56 ILE CA   C  14.263 16.651   0.726 1.00 . A A . 56 ILE CA   1 1 
        3  6267 1 1 56 ILE CB   C  15.775 16.744   0.979 1.00 . A A . 56 ILE CB   1 1 
        3  6268 1 1 56 ILE CD1  C  17.888 15.408   1.015 1.00 . A A . 56 ILE CD1  1 1 
        3  6269 1 1 56 ILE CG1  C  16.365 15.326   1.036 1.00 . A A . 56 ILE CG1  1 1 
        3  6270 1 1 56 ILE CG2  C  16.046 17.463   2.313 1.00 . A A . 56 ILE CG2  1 1 
        3  6271 1 1 56 ILE H    H  14.782 15.864  -1.171 1.00 . A A . 56 ILE H    1 1 
        3  6272 1 1 56 ILE HA   H  13.816 16.046   1.500 1.00 . A A . 56 ILE HA   1 1 
        3  6273 1 1 56 ILE HB   H  16.235 17.299   0.174 1.00 . A A . 56 ILE HB   1 1 
        3  6274 1 1 56 ILE HD11 H  18.304 14.421   1.128 1.00 . A A . 56 ILE HD11 1 1 
        3  6275 1 1 56 ILE HD12 H  18.225 16.038   1.823 1.00 . A A . 56 ILE HD12 1 1 
        3  6276 1 1 56 ILE HD13 H  18.205 15.828   0.079 1.00 . A A . 56 ILE HD13 1 1 
        3  6277 1 1 56 ILE HG12 H  16.041 14.832   1.939 1.00 . A A . 56 ILE HG12 1 1 
        3  6278 1 1 56 ILE HG13 H  16.033 14.762   0.180 1.00 . A A . 56 ILE HG13 1 1 
        3  6279 1 1 56 ILE HG21 H  15.451 17.010   3.091 1.00 . A A . 56 ILE HG21 1 1 
        3  6280 1 1 56 ILE HG22 H  15.788 18.506   2.222 1.00 . A A . 56 ILE HG22 1 1 
        3  6281 1 1 56 ILE HG23 H  17.092 17.379   2.565 1.00 . A A . 56 ILE HG23 1 1 
        3  6282 1 1 56 ILE N    N  14.025 16.027  -0.571 1.00 . A A . 56 ILE N    1 1 
        3  6283 1 1 56 ILE O    O  12.900 18.373   1.685 1.00 . A A . 56 ILE O    1 1 
        3  6284 1 1 57 GLN C    C  11.940 20.190  -0.288 1.00 . A A . 57 GLN C    1 1 
        3  6285 1 1 57 GLN CA   C  13.453 20.215  -0.304 1.00 . A A . 57 GLN CA   1 1 
        3  6286 1 1 57 GLN CB   C  13.946 20.903  -1.586 1.00 . A A . 57 GLN CB   1 1 
        3  6287 1 1 57 GLN CD   C  15.755 22.271  -0.503 1.00 . A A . 57 GLN CD   1 1 
        3  6288 1 1 57 GLN CG   C  15.458 21.148  -1.495 1.00 . A A . 57 GLN CG   1 1 
        3  6289 1 1 57 GLN H    H  14.573 18.542  -0.939 1.00 . A A . 57 GLN H    1 1 
        3  6290 1 1 57 GLN HA   H  13.804 20.771   0.552 1.00 . A A . 57 GLN HA   1 1 
        3  6291 1 1 57 GLN HB2  H  13.736 20.269  -2.435 1.00 . A A . 57 GLN HB2  1 1 
        3  6292 1 1 57 GLN HB3  H  13.436 21.849  -1.711 1.00 . A A . 57 GLN HB3  1 1 
        3  6293 1 1 57 GLN HE21 H  15.797 23.679  -1.902 1.00 . A A . 57 GLN HE21 1 1 
        3  6294 1 1 57 GLN HE22 H  16.083 24.220  -0.318 1.00 . A A . 57 GLN HE22 1 1 
        3  6295 1 1 57 GLN HG2  H  15.945 20.242  -1.168 1.00 . A A . 57 GLN HG2  1 1 
        3  6296 1 1 57 GLN HG3  H  15.835 21.424  -2.468 1.00 . A A . 57 GLN HG3  1 1 
        3  6297 1 1 57 GLN N    N  13.971 18.859  -0.234 1.00 . A A . 57 GLN N    1 1 
        3  6298 1 1 57 GLN NE2  N  15.889 23.491  -0.944 1.00 . A A . 57 GLN NE2  1 1 
        3  6299 1 1 57 GLN O    O  11.310 21.017   0.371 1.00 . A A . 57 GLN O    1 1 
        3  6300 1 1 57 GLN OE1  O  15.867 22.032   0.700 1.00 . A A . 57 GLN OE1  1 1 
        3  6301 1 1 58 HIS C    C   9.359 18.618   0.265 1.00 . A A . 58 HIS C    1 1 
        3  6302 1 1 58 HIS CA   C   9.902 19.130  -1.068 1.00 . A A . 58 HIS CA   1 1 
        3  6303 1 1 58 HIS CB   C   9.489 18.181  -2.205 1.00 . A A . 58 HIS CB   1 1 
        3  6304 1 1 58 HIS CD2  C  10.213 18.280  -4.737 1.00 . A A . 58 HIS CD2  1 1 
        3  6305 1 1 58 HIS CE1  C  10.054 20.423  -5.021 1.00 . A A . 58 HIS CE1  1 1 
        3  6306 1 1 58 HIS CG   C   9.808 18.812  -3.537 1.00 . A A . 58 HIS CG   1 1 
        3  6307 1 1 58 HIS H    H  11.906 18.613  -1.520 1.00 . A A . 58 HIS H    1 1 
        3  6308 1 1 58 HIS HA   H   9.480 20.108  -1.259 1.00 . A A . 58 HIS HA   1 1 
        3  6309 1 1 58 HIS HB2  H  10.027 17.250  -2.111 1.00 . A A . 58 HIS HB2  1 1 
        3  6310 1 1 58 HIS HB3  H   8.427 17.990  -2.147 1.00 . A A . 58 HIS HB3  1 1 
        3  6311 1 1 58 HIS HD1  H   9.445 20.848  -3.078 1.00 . A A . 58 HIS HD1  1 1 
        3  6312 1 1 58 HIS HD2  H  10.382 17.231  -4.927 1.00 . A A . 58 HIS HD2  1 1 
        3  6313 1 1 58 HIS HE1  H  10.070 21.406  -5.469 1.00 . A A . 58 HIS HE1  1 1 
        3  6314 1 1 58 HIS HE2  H  10.644 19.210  -6.609 1.00 . A A . 58 HIS HE2  1 1 
        3  6315 1 1 58 HIS N    N  11.353 19.244  -1.014 1.00 . A A . 58 HIS N    1 1 
        3  6316 1 1 58 HIS ND1  N   9.714 20.180  -3.742 1.00 . A A . 58 HIS ND1  1 1 
        3  6317 1 1 58 HIS NE2  N  10.368 19.299  -5.672 1.00 . A A . 58 HIS NE2  1 1 
        3  6318 1 1 58 HIS O    O   8.337 19.100   0.754 1.00 . A A . 58 HIS O    1 1 
        3  6319 1 1 59 LEU C    C   9.408 18.185   3.154 1.00 . A A . 59 LEU C    1 1 
        3  6320 1 1 59 LEU CA   C   9.597 17.076   2.114 1.00 . A A . 59 LEU CA   1 1 
        3  6321 1 1 59 LEU CB   C  10.616 16.052   2.625 1.00 . A A . 59 LEU CB   1 1 
        3  6322 1 1 59 LEU CD1  C   8.808 14.531   3.602 1.00 . A A . 59 LEU CD1  1 1 
        3  6323 1 1 59 LEU CD2  C  11.211 14.378   4.352 1.00 . A A . 59 LEU CD2  1 1 
        3  6324 1 1 59 LEU CG   C  10.107 15.328   3.888 1.00 . A A . 59 LEU CG   1 1 
        3  6325 1 1 59 LEU H    H  10.851 17.291   0.404 1.00 . A A . 59 LEU H    1 1 
        3  6326 1 1 59 LEU HA   H   8.651 16.586   1.953 1.00 . A A . 59 LEU HA   1 1 
        3  6327 1 1 59 LEU HB2  H  10.802 15.320   1.853 1.00 . A A . 59 LEU HB2  1 1 
        3  6328 1 1 59 LEU HB3  H  11.536 16.562   2.860 1.00 . A A . 59 LEU HB3  1 1 
        3  6329 1 1 59 LEU HD11 H   7.956 15.185   3.717 1.00 . A A . 59 LEU HD11 1 1 
        3  6330 1 1 59 LEU HD12 H   8.714 13.711   4.305 1.00 . A A . 59 LEU HD12 1 1 
        3  6331 1 1 59 LEU HD13 H   8.826 14.136   2.594 1.00 . A A . 59 LEU HD13 1 1 
        3  6332 1 1 59 LEU HD21 H  10.874 13.835   5.218 1.00 . A A . 59 LEU HD21 1 1 
        3  6333 1 1 59 LEU HD22 H  12.091 14.951   4.602 1.00 . A A . 59 LEU HD22 1 1 
        3  6334 1 1 59 LEU HD23 H  11.444 13.683   3.557 1.00 . A A . 59 LEU HD23 1 1 
        3  6335 1 1 59 LEU HG   H   9.914 16.050   4.666 1.00 . A A . 59 LEU HG   1 1 
        3  6336 1 1 59 LEU N    N  10.044 17.636   0.841 1.00 . A A . 59 LEU N    1 1 
        3  6337 1 1 59 LEU O    O   8.675 18.007   4.127 1.00 . A A . 59 LEU O    1 1 
        3  6338 1 1 60 ASP C    C   8.502 20.861   4.026 1.00 . A A . 60 ASP C    1 1 
        3  6339 1 1 60 ASP CA   C   9.969 20.431   3.882 1.00 . A A . 60 ASP CA   1 1 
        3  6340 1 1 60 ASP CB   C  10.823 21.634   3.398 1.00 . A A . 60 ASP CB   1 1 
        3  6341 1 1 60 ASP CG   C  10.101 22.411   2.291 1.00 . A A . 60 ASP CG   1 1 
        3  6342 1 1 60 ASP H    H  10.646 19.400   2.155 1.00 . A A . 60 ASP H    1 1 
        3  6343 1 1 60 ASP HA   H  10.336 20.109   4.848 1.00 . A A . 60 ASP HA   1 1 
        3  6344 1 1 60 ASP HB2  H  11.013 22.301   4.228 1.00 . A A . 60 ASP HB2  1 1 
        3  6345 1 1 60 ASP HB3  H  11.767 21.271   3.016 1.00 . A A . 60 ASP HB3  1 1 
        3  6346 1 1 60 ASP N    N  10.076 19.315   2.948 1.00 . A A . 60 ASP N    1 1 
        3  6347 1 1 60 ASP O    O   8.099 21.354   5.079 1.00 . A A . 60 ASP O    1 1 
        3  6348 1 1 60 ASP OD1  O   9.396 21.779   1.522 1.00 . A A . 60 ASP OD1  1 1 
        3  6349 1 1 60 ASP OD2  O  10.243 23.622   2.248 1.00 . A A . 60 ASP OD2  1 1 
        3  6350 1 1 61 GLU C    C   5.573 20.291   4.057 1.00 . A A . 61 GLU C    1 1 
        3  6351 1 1 61 GLU CA   C   6.318 21.070   2.981 1.00 . A A . 61 GLU CA   1 1 
        3  6352 1 1 61 GLU CB   C   5.689 20.812   1.592 1.00 . A A . 61 GLU CB   1 1 
        3  6353 1 1 61 GLU CD   C   5.207 19.003  -0.101 1.00 . A A . 61 GLU CD   1 1 
        3  6354 1 1 61 GLU CG   C   5.402 19.307   1.382 1.00 . A A . 61 GLU CG   1 1 
        3  6355 1 1 61 GLU H    H   8.100 20.289   2.151 1.00 . A A . 61 GLU H    1 1 
        3  6356 1 1 61 GLU HA   H   6.248 22.124   3.206 1.00 . A A . 61 GLU HA   1 1 
        3  6357 1 1 61 GLU HB2  H   4.763 21.366   1.507 1.00 . A A . 61 GLU HB2  1 1 
        3  6358 1 1 61 GLU HB3  H   6.376 21.154   0.832 1.00 . A A . 61 GLU HB3  1 1 
        3  6359 1 1 61 GLU HG2  H   6.228 18.723   1.758 1.00 . A A . 61 GLU HG2  1 1 
        3  6360 1 1 61 GLU HG3  H   4.504 19.034   1.921 1.00 . A A . 61 GLU HG3  1 1 
        3  6361 1 1 61 GLU N    N   7.724 20.687   2.963 1.00 . A A . 61 GLU N    1 1 
        3  6362 1 1 61 GLU O    O   4.628 20.798   4.662 1.00 . A A . 61 GLU O    1 1 
        3  6363 1 1 61 GLU OE1  O   6.201 18.749  -0.761 1.00 . A A . 61 GLU OE1  1 1 
        3  6364 1 1 61 GLU OE2  O   4.073 19.010  -0.551 1.00 . A A . 61 GLU OE2  1 1 
        3  6365 1 1 62 ALA C    C   5.741 18.658   6.691 1.00 . A A . 62 ALA C    1 1 
        3  6366 1 1 62 ALA CA   C   5.364 18.204   5.282 1.00 . A A . 62 ALA CA   1 1 
        3  6367 1 1 62 ALA CB   C   5.793 16.754   5.066 1.00 . A A . 62 ALA CB   1 1 
        3  6368 1 1 62 ALA H    H   6.750 18.697   3.768 1.00 . A A . 62 ALA H    1 1 
        3  6369 1 1 62 ALA HA   H   4.293 18.274   5.176 1.00 . A A . 62 ALA HA   1 1 
        3  6370 1 1 62 ALA HB1  H   5.189 16.108   5.676 1.00 . A A . 62 ALA HB1  1 1 
        3  6371 1 1 62 ALA HB2  H   6.834 16.638   5.337 1.00 . A A . 62 ALA HB2  1 1 
        3  6372 1 1 62 ALA HB3  H   5.663 16.493   4.026 1.00 . A A . 62 ALA HB3  1 1 
        3  6373 1 1 62 ALA N    N   5.992 19.049   4.280 1.00 . A A . 62 ALA N    1 1 
        3  6374 1 1 62 ALA O    O   4.863 18.968   7.496 1.00 . A A . 62 ALA O    1 1 
        3  6375 1 1 63 TYR C    C   6.846 20.435   8.704 1.00 . A A . 63 TYR C    1 1 
        3  6376 1 1 63 TYR CA   C   7.523 19.118   8.302 1.00 . A A . 63 TYR CA   1 1 
        3  6377 1 1 63 TYR CB   C   9.088 19.281   8.265 1.00 . A A . 63 TYR CB   1 1 
        3  6378 1 1 63 TYR CD1  C   9.454 21.773   8.148 1.00 . A A . 63 TYR CD1  1 1 
        3  6379 1 1 63 TYR CD2  C   9.937 20.652  10.243 1.00 . A A . 63 TYR CD2  1 1 
        3  6380 1 1 63 TYR CE1  C   9.801 23.001   8.725 1.00 . A A . 63 TYR CE1  1 1 
        3  6381 1 1 63 TYR CE2  C  10.283 21.880  10.820 1.00 . A A . 63 TYR CE2  1 1 
        3  6382 1 1 63 TYR CG   C   9.522 20.599   8.907 1.00 . A A . 63 TYR CG   1 1 
        3  6383 1 1 63 TYR CZ   C  10.215 23.054  10.061 1.00 . A A . 63 TYR CZ   1 1 
        3  6384 1 1 63 TYR H    H   7.692 18.439   6.300 1.00 . A A . 63 TYR H    1 1 
        3  6385 1 1 63 TYR HA   H   7.263 18.354   9.023 1.00 . A A . 63 TYR HA   1 1 
        3  6386 1 1 63 TYR HB2  H   9.558 18.458   8.790 1.00 . A A . 63 TYR HB2  1 1 
        3  6387 1 1 63 TYR HB3  H   9.416 19.269   7.233 1.00 . A A . 63 TYR HB3  1 1 
        3  6388 1 1 63 TYR HD1  H   9.136 21.733   7.122 1.00 . A A . 63 TYR HD1  1 1 
        3  6389 1 1 63 TYR HD2  H   9.990 19.745  10.828 1.00 . A A . 63 TYR HD2  1 1 
        3  6390 1 1 63 TYR HE1  H   9.745 23.907   8.139 1.00 . A A . 63 TYR HE1  1 1 
        3  6391 1 1 63 TYR HE2  H  10.603 21.924  11.849 1.00 . A A . 63 TYR HE2  1 1 
        3  6392 1 1 63 TYR HH   H   9.806 24.857  10.530 1.00 . A A . 63 TYR HH   1 1 
        3  6393 1 1 63 TYR N    N   7.037 18.697   6.982 1.00 . A A . 63 TYR N    1 1 
        3  6394 1 1 63 TYR O    O   6.508 20.643   9.869 1.00 . A A . 63 TYR O    1 1 
        3  6395 1 1 63 TYR OH   O  10.553 24.263  10.630 1.00 . A A . 63 TYR OH   1 1 
        3  6396 1 1 64 ASN C    C   4.567 22.464   8.266 1.00 . A A . 64 ASN C    1 1 
        3  6397 1 1 64 ASN CA   C   6.057 22.619   7.989 1.00 . A A . 64 ASN CA   1 1 
        3  6398 1 1 64 ASN CB   C   6.258 23.537   6.785 1.00 . A A . 64 ASN CB   1 1 
        3  6399 1 1 64 ASN CG   C   5.684 24.917   7.084 1.00 . A A . 64 ASN CG   1 1 
        3  6400 1 1 64 ASN H    H   6.964 21.104   6.821 1.00 . A A . 64 ASN H    1 1 
        3  6401 1 1 64 ASN HA   H   6.529 23.072   8.850 1.00 . A A . 64 ASN HA   1 1 
        3  6402 1 1 64 ASN HB2  H   7.316 23.627   6.577 1.00 . A A . 64 ASN HB2  1 1 
        3  6403 1 1 64 ASN HB3  H   5.758 23.119   5.925 1.00 . A A . 64 ASN HB3  1 1 
        3  6404 1 1 64 ASN HD21 H   5.037 25.217   5.232 1.00 . A A . 64 ASN HD21 1 1 
        3  6405 1 1 64 ASN HD22 H   4.730 26.481   6.321 1.00 . A A . 64 ASN HD22 1 1 
        3  6406 1 1 64 ASN N    N   6.676 21.325   7.731 1.00 . A A . 64 ASN N    1 1 
        3  6407 1 1 64 ASN ND2  N   5.102 25.595   6.133 1.00 . A A . 64 ASN ND2  1 1 
        3  6408 1 1 64 ASN O    O   4.009 23.136   9.134 1.00 . A A . 64 ASN O    1 1 
        3  6409 1 1 64 ASN OD1  O   5.767 25.389   8.218 1.00 . A A . 64 ASN OD1  1 1 
        3  6410 1 1 65 LYS C    C   2.177 20.889   9.098 1.00 . A A . 65 LYS C    1 1 
        3  6411 1 1 65 LYS CA   C   2.489 21.368   7.673 1.00 . A A . 65 LYS CA   1 1 
        3  6412 1 1 65 LYS CB   C   2.003 20.332   6.630 1.00 . A A . 65 LYS CB   1 1 
        3  6413 1 1 65 LYS CD   C  -0.372 20.564   7.501 1.00 . A A . 65 LYS CD   1 1 
        3  6414 1 1 65 LYS CE   C  -1.835 20.383   7.084 1.00 . A A . 65 LYS CE   1 1 
        3  6415 1 1 65 LYS CG   C   0.525 20.554   6.251 1.00 . A A . 65 LYS CG   1 1 
        3  6416 1 1 65 LYS H    H   4.420 21.071   6.836 1.00 . A A . 65 LYS H    1 1 
        3  6417 1 1 65 LYS HA   H   1.986 22.309   7.503 1.00 . A A . 65 LYS HA   1 1 
        3  6418 1 1 65 LYS HB2  H   2.601 20.427   5.742 1.00 . A A . 65 LYS HB2  1 1 
        3  6419 1 1 65 LYS HB3  H   2.121 19.331   7.024 1.00 . A A . 65 LYS HB3  1 1 
        3  6420 1 1 65 LYS HD2  H  -0.085 19.764   8.168 1.00 . A A . 65 LYS HD2  1 1 
        3  6421 1 1 65 LYS HD3  H  -0.270 21.511   8.006 1.00 . A A . 65 LYS HD3  1 1 
        3  6422 1 1 65 LYS HE2  H  -2.475 20.522   7.941 1.00 . A A . 65 LYS HE2  1 1 
        3  6423 1 1 65 LYS HE3  H  -2.085 21.110   6.324 1.00 . A A . 65 LYS HE3  1 1 
        3  6424 1 1 65 LYS HG2  H   0.430 21.500   5.734 1.00 . A A . 65 LYS HG2  1 1 
        3  6425 1 1 65 LYS HG3  H   0.211 19.758   5.590 1.00 . A A . 65 LYS HG3  1 1 
        3  6426 1 1 65 LYS HZ1  H  -1.117 18.497   6.572 1.00 . A A . 65 LYS HZ1  1 1 
        3  6427 1 1 65 LYS HZ2  H  -2.345 19.068   5.552 1.00 . A A . 65 LYS HZ2  1 1 
        3  6428 1 1 65 LYS HZ3  H  -2.729 18.503   7.108 1.00 . A A . 65 LYS HZ3  1 1 
        3  6429 1 1 65 LYS N    N   3.924 21.577   7.513 1.00 . A A . 65 LYS N    1 1 
        3  6430 1 1 65 LYS NZ   N  -2.021 19.009   6.537 1.00 . A A . 65 LYS NZ   1 1 
        3  6431 1 1 65 LYS O    O   1.265 21.402   9.747 1.00 . A A . 65 LYS O    1 1 
        3  6432 1 1 66 VAL C    C   2.730 20.502  11.936 1.00 . A A . 66 VAL C    1 1 
        3  6433 1 1 66 VAL CA   C   2.706 19.379  10.907 1.00 . A A . 66 VAL CA   1 1 
        3  6434 1 1 66 VAL CB   C   3.790 18.336  11.252 1.00 . A A . 66 VAL CB   1 1 
        3  6435 1 1 66 VAL CG1  C   3.582 17.815  12.686 1.00 . A A . 66 VAL CG1  1 1 
        3  6436 1 1 66 VAL CG2  C   3.714 17.168  10.255 1.00 . A A . 66 VAL CG2  1 1 
        3  6437 1 1 66 VAL H    H   3.653 19.540   9.010 1.00 . A A . 66 VAL H    1 1 
        3  6438 1 1 66 VAL HA   H   1.739 18.897  10.932 1.00 . A A . 66 VAL HA   1 1 
        3  6439 1 1 66 VAL HB   H   4.768 18.799  11.187 1.00 . A A . 66 VAL HB   1 1 
        3  6440 1 1 66 VAL HG11 H   3.869 18.580  13.394 1.00 . A A . 66 VAL HG11 1 1 
        3  6441 1 1 66 VAL HG12 H   4.191 16.936  12.846 1.00 . A A . 66 VAL HG12 1 1 
        3  6442 1 1 66 VAL HG13 H   2.542 17.562  12.832 1.00 . A A . 66 VAL HG13 1 1 
        3  6443 1 1 66 VAL HG21 H   4.301 16.342  10.627 1.00 . A A . 66 VAL HG21 1 1 
        3  6444 1 1 66 VAL HG22 H   4.104 17.485   9.298 1.00 . A A . 66 VAL HG22 1 1 
        3  6445 1 1 66 VAL HG23 H   2.688 16.851  10.137 1.00 . A A . 66 VAL HG23 1 1 
        3  6446 1 1 66 VAL N    N   2.942 19.911   9.572 1.00 . A A . 66 VAL N    1 1 
        3  6447 1 1 66 VAL O    O   1.783 20.683  12.701 1.00 . A A . 66 VAL O    1 1 
        3  6448 1 1 67 LYS C    C   2.864 23.384  12.698 1.00 . A A . 67 LYS C    1 1 
        3  6449 1 1 67 LYS CA   C   3.962 22.351  12.894 1.00 . A A . 67 LYS CA   1 1 
        3  6450 1 1 67 LYS CB   C   5.318 23.018  12.698 1.00 . A A . 67 LYS CB   1 1 
        3  6451 1 1 67 LYS CD   C   7.579 22.513  13.791 1.00 . A A . 67 LYS CD   1 1 
        3  6452 1 1 67 LYS CE   C   8.281 23.721  13.141 1.00 . A A . 67 LYS CE   1 1 
        3  6453 1 1 67 LYS CG   C   6.458 21.970  12.891 1.00 . A A . 67 LYS CG   1 1 
        3  6454 1 1 67 LYS H    H   4.549 21.063  11.316 1.00 . A A . 67 LYS H    1 1 
        3  6455 1 1 67 LYS HA   H   3.909 21.962  13.895 1.00 . A A . 67 LYS HA   1 1 
        3  6456 1 1 67 LYS HB2  H   5.359 23.436  11.694 1.00 . A A . 67 LYS HB2  1 1 
        3  6457 1 1 67 LYS HB3  H   5.410 23.814  13.412 1.00 . A A . 67 LYS HB3  1 1 
        3  6458 1 1 67 LYS HD2  H   7.153 22.812  14.735 1.00 . A A . 67 LYS HD2  1 1 
        3  6459 1 1 67 LYS HD3  H   8.298 21.726  13.958 1.00 . A A . 67 LYS HD3  1 1 
        3  6460 1 1 67 LYS HE2  H   8.542 23.486  12.120 1.00 . A A . 67 LYS HE2  1 1 
        3  6461 1 1 67 LYS HE3  H   7.621 24.578  13.154 1.00 . A A . 67 LYS HE3  1 1 
        3  6462 1 1 67 LYS HG2  H   6.065 21.067  13.345 1.00 . A A . 67 LYS HG2  1 1 
        3  6463 1 1 67 LYS HG3  H   6.869 21.713  11.928 1.00 . A A . 67 LYS HG3  1 1 
        3  6464 1 1 67 LYS HZ1  H   9.766 25.049  13.777 1.00 . A A . 67 LYS HZ1  1 1 
        3  6465 1 1 67 LYS HZ2  H  10.306 23.453  13.577 1.00 . A A . 67 LYS HZ2  1 1 
        3  6466 1 1 67 LYS HZ3  H   9.357 23.865  14.925 1.00 . A A . 67 LYS HZ3  1 1 
        3  6467 1 1 67 LYS N    N   3.826 21.254  11.949 1.00 . A A . 67 LYS N    1 1 
        3  6468 1 1 67 LYS NZ   N   9.522 24.046  13.912 1.00 . A A . 67 LYS NZ   1 1 
        3  6469 1 1 67 LYS O    O   2.235 23.827  13.659 1.00 . A A . 67 LYS O    1 1 
        3  6470 1 1 68 ARG C    C   0.256 24.237  11.641 1.00 . A A . 68 ARG C    1 1 
        3  6471 1 1 68 ARG CA   C   1.603 24.725  11.129 1.00 . A A . 68 ARG CA   1 1 
        3  6472 1 1 68 ARG CB   C   1.556 24.949   9.601 1.00 . A A . 68 ARG CB   1 1 
        3  6473 1 1 68 ARG CD   C   1.872 27.443   9.238 1.00 . A A . 68 ARG CD   1 1 
        3  6474 1 1 68 ARG CG   C   0.855 26.287   9.258 1.00 . A A . 68 ARG CG   1 1 
        3  6475 1 1 68 ARG CZ   C   0.622 29.325  10.153 1.00 . A A . 68 ARG CZ   1 1 
        3  6476 1 1 68 ARG H    H   3.158 23.367  10.718 1.00 . A A . 68 ARG H    1 1 
        3  6477 1 1 68 ARG HA   H   1.843 25.656  11.619 1.00 . A A . 68 ARG HA   1 1 
        3  6478 1 1 68 ARG HB2  H   2.565 24.961   9.218 1.00 . A A . 68 ARG HB2  1 1 
        3  6479 1 1 68 ARG HB3  H   1.017 24.129   9.137 1.00 . A A . 68 ARG HB3  1 1 
        3  6480 1 1 68 ARG HD2  H   2.454 27.433  10.147 1.00 . A A . 68 ARG HD2  1 1 
        3  6481 1 1 68 ARG HD3  H   2.536 27.312   8.393 1.00 . A A . 68 ARG HD3  1 1 
        3  6482 1 1 68 ARG HE   H   1.126 29.153   8.227 1.00 . A A . 68 ARG HE   1 1 
        3  6483 1 1 68 ARG HG2  H   0.399 26.209   8.282 1.00 . A A . 68 ARG HG2  1 1 
        3  6484 1 1 68 ARG HG3  H   0.092 26.495   9.991 1.00 . A A . 68 ARG HG3  1 1 
        3  6485 1 1 68 ARG HH11 H   1.136 27.887  11.448 1.00 . A A . 68 ARG HH11 1 1 
        3  6486 1 1 68 ARG HH12 H   0.255 29.218  12.119 1.00 . A A . 68 ARG HH12 1 1 
        3  6487 1 1 68 ARG HH21 H  -0.021 30.902   9.101 1.00 . A A . 68 ARG HH21 1 1 
        3  6488 1 1 68 ARG HH22 H  -0.400 30.925  10.790 1.00 . A A . 68 ARG HH22 1 1 
        3  6489 1 1 68 ARG N    N   2.625 23.754  11.444 1.00 . A A . 68 ARG N    1 1 
        3  6490 1 1 68 ARG NE   N   1.179 28.725   9.107 1.00 . A A . 68 ARG NE   1 1 
        3  6491 1 1 68 ARG NH1  N   0.676 28.766  11.331 1.00 . A A . 68 ARG NH1  1 1 
        3  6492 1 1 68 ARG NH2  N   0.021 30.474  10.003 1.00 . A A . 68 ARG NH2  1 1 
        3  6493 1 1 68 ARG O    O  -0.702 25.008  11.710 1.00 . A A . 68 ARG O    1 1 
        3  6494 1 1 69 GLY C    C  -1.006 22.240  14.023 1.00 . A A . 69 GLY C    1 1 
        3  6495 1 1 69 GLY CA   C  -1.045 22.351  12.503 1.00 . A A . 69 GLY CA   1 1 
        3  6496 1 1 69 GLY H    H   0.979 22.392  11.919 1.00 . A A . 69 GLY H    1 1 
        3  6497 1 1 69 GLY HA2  H  -1.903 22.938  12.209 1.00 . A A . 69 GLY HA2  1 1 
        3  6498 1 1 69 GLY HA3  H  -1.137 21.359  12.085 1.00 . A A . 69 GLY HA3  1 1 
        3  6499 1 1 69 GLY N    N   0.183 22.958  11.995 1.00 . A A . 69 GLY N    1 1 
        3  6500 1 1 69 GLY O    O  -2.052 22.191  14.671 1.00 . A A . 69 GLY O    1 1 
        3  6501 1 1 70 GLU C    C  -0.409 23.213  16.729 1.00 . A A . 70 GLU C    1 1 
        3  6502 1 1 70 GLU CA   C   0.355 22.090  16.032 1.00 . A A . 70 GLU CA   1 1 
        3  6503 1 1 70 GLU CB   C   1.850 22.158  16.402 1.00 . A A . 70 GLU CB   1 1 
        3  6504 1 1 70 GLU CD   C   2.147 19.739  16.971 1.00 . A A . 70 GLU CD   1 1 
        3  6505 1 1 70 GLU CG   C   2.554 20.851  16.012 1.00 . A A . 70 GLU CG   1 1 
        3  6506 1 1 70 GLU H    H   0.995 22.236  14.018 1.00 . A A . 70 GLU H    1 1 
        3  6507 1 1 70 GLU HA   H  -0.048 21.143  16.361 1.00 . A A . 70 GLU HA   1 1 
        3  6508 1 1 70 GLU HB2  H   2.308 22.982  15.879 1.00 . A A . 70 GLU HB2  1 1 
        3  6509 1 1 70 GLU HB3  H   1.954 22.315  17.469 1.00 . A A . 70 GLU HB3  1 1 
        3  6510 1 1 70 GLU HG2  H   2.281 20.577  15.006 1.00 . A A . 70 GLU HG2  1 1 
        3  6511 1 1 70 GLU HG3  H   3.619 20.993  16.067 1.00 . A A . 70 GLU HG3  1 1 
        3  6512 1 1 70 GLU N    N   0.197 22.193  14.585 1.00 . A A . 70 GLU N    1 1 
        3  6513 1 1 70 GLU O    O  -1.634 23.159  16.842 1.00 . A A . 70 GLU O    1 1 
        3  6514 1 1 70 GLU OE1  O   2.405 19.899  18.153 1.00 . A A . 70 GLU OE1  1 1 
        3  6515 1 1 70 GLU OE2  O   1.596 18.748  16.522 1.00 . A A . 70 GLU OE2  1 1 
        3  6516 1 1 71 SER C    C   0.686 26.496  18.046 1.00 . A A . 71 SER C    1 1 
        3  6517 1 1 71 SER CA   C  -0.305 25.339  17.891 1.00 . A A . 71 SER CA   1 1 
        3  6518 1 1 71 SER CB   C  -0.810 24.871  19.255 1.00 . A A . 71 SER CB   1 1 
        3  6519 1 1 71 SER H    H   1.290 24.209  17.086 1.00 . A A . 71 SER H    1 1 
        3  6520 1 1 71 SER HA   H  -1.146 25.686  17.312 1.00 . A A . 71 SER HA   1 1 
        3  6521 1 1 71 SER HB2  H  -1.391 25.651  19.714 1.00 . A A . 71 SER HB2  1 1 
        3  6522 1 1 71 SER HB3  H  -1.426 23.994  19.120 1.00 . A A . 71 SER HB3  1 1 
        3  6523 1 1 71 SER HG   H   0.447 23.611  20.041 1.00 . A A . 71 SER HG   1 1 
        3  6524 1 1 71 SER N    N   0.317 24.219  17.205 1.00 . A A . 71 SER N    1 1 
        3  6525 1 1 71 SER O    O   1.310 26.931  17.078 1.00 . A A . 71 SER O    1 1 
        3  6526 1 1 71 SER OG   O   0.300 24.559  20.087 1.00 . A A . 71 SER OG   1 1 
        3  6527 1 1 72 LYS C    C   2.081 28.142  21.040 1.00 . A A . 72 LYS C    1 1 
        3  6528 1 1 72 LYS CA   C   1.730 28.097  19.550 1.00 . A A . 72 LYS CA   1 1 
        3  6529 1 1 72 LYS CB   C   1.065 29.420  19.105 1.00 . A A . 72 LYS CB   1 1 
        3  6530 1 1 72 LYS CD   C  -1.034 30.786  19.185 1.00 . A A . 72 LYS CD   1 1 
        3  6531 1 1 72 LYS CE   C  -2.465 30.839  19.723 1.00 . A A . 72 LYS CE   1 1 
        3  6532 1 1 72 LYS CG   C  -0.411 29.433  19.530 1.00 . A A . 72 LYS CG   1 1 
        3  6533 1 1 72 LYS H    H   0.300 26.597  20.008 1.00 . A A . 72 LYS H    1 1 
        3  6534 1 1 72 LYS HA   H   2.646 27.960  18.988 1.00 . A A . 72 LYS HA   1 1 
        3  6535 1 1 72 LYS HB2  H   1.575 30.260  19.554 1.00 . A A . 72 LYS HB2  1 1 
        3  6536 1 1 72 LYS HB3  H   1.121 29.506  18.027 1.00 . A A . 72 LYS HB3  1 1 
        3  6537 1 1 72 LYS HD2  H  -0.450 31.576  19.635 1.00 . A A . 72 LYS HD2  1 1 
        3  6538 1 1 72 LYS HD3  H  -1.049 30.915  18.113 1.00 . A A . 72 LYS HD3  1 1 
        3  6539 1 1 72 LYS HE2  H  -2.461 30.624  20.781 1.00 . A A . 72 LYS HE2  1 1 
        3  6540 1 1 72 LYS HE3  H  -2.875 31.825  19.559 1.00 . A A . 72 LYS HE3  1 1 
        3  6541 1 1 72 LYS HG2  H  -0.943 28.653  19.004 1.00 . A A . 72 LYS HG2  1 1 
        3  6542 1 1 72 LYS HG3  H  -0.488 29.266  20.590 1.00 . A A . 72 LYS HG3  1 1 
        3  6543 1 1 72 LYS HZ1  H  -2.909 29.660  18.066 1.00 . A A . 72 LYS HZ1  1 1 
        3  6544 1 1 72 LYS HZ2  H  -4.274 30.184  18.925 1.00 . A A . 72 LYS HZ2  1 1 
        3  6545 1 1 72 LYS HZ3  H  -3.301 28.941  19.554 1.00 . A A . 72 LYS HZ3  1 1 
        3  6546 1 1 72 LYS N    N   0.824 26.984  19.275 1.00 . A A . 72 LYS N    1 1 
        3  6547 1 1 72 LYS NZ   N  -3.300 29.830  19.013 1.00 . A A . 72 LYS NZ   1 1 
        3  6548 1 1 72 LYS O    O   1.470 28.882  21.811 1.00 . A A . 72 LYS O    1 1 
        3  6549 1 1 73 LEU C    C   4.756 26.441  22.958 1.00 . A A . 73 LEU C    1 1 
        3  6550 1 1 73 LEU CA   C   3.495 27.294  22.822 1.00 . A A . 73 LEU CA   1 1 
        3  6551 1 1 73 LEU CB   C   2.373 26.691  23.703 1.00 . A A . 73 LEU CB   1 1 
        3  6552 1 1 73 LEU CD1  C   2.044 28.374  25.583 1.00 . A A . 73 LEU CD1  1 1 
        3  6553 1 1 73 LEU CD2  C   1.985 25.930  26.094 1.00 . A A . 73 LEU CD2  1 1 
        3  6554 1 1 73 LEU CG   C   2.633 27.005  25.206 1.00 . A A . 73 LEU CG   1 1 
        3  6555 1 1 73 LEU H    H   3.520 26.777  20.772 1.00 . A A . 73 LEU H    1 1 
        3  6556 1 1 73 LEU HA   H   3.712 28.293  23.155 1.00 . A A . 73 LEU HA   1 1 
        3  6557 1 1 73 LEU HB2  H   1.419 27.104  23.401 1.00 . A A . 73 LEU HB2  1 1 
        3  6558 1 1 73 LEU HB3  H   2.349 25.617  23.555 1.00 . A A . 73 LEU HB3  1 1 
        3  6559 1 1 73 LEU HD11 H   0.970 28.351  25.455 1.00 . A A . 73 LEU HD11 1 1 
        3  6560 1 1 73 LEU HD12 H   2.463 29.141  24.953 1.00 . A A . 73 LEU HD12 1 1 
        3  6561 1 1 73 LEU HD13 H   2.277 28.590  26.615 1.00 . A A . 73 LEU HD13 1 1 
        3  6562 1 1 73 LEU HD21 H   2.486 24.987  25.936 1.00 . A A . 73 LEU HD21 1 1 
        3  6563 1 1 73 LEU HD22 H   0.941 25.831  25.838 1.00 . A A . 73 LEU HD22 1 1 
        3  6564 1 1 73 LEU HD23 H   2.077 26.216  27.132 1.00 . A A . 73 LEU HD23 1 1 
        3  6565 1 1 73 LEU HG   H   3.699 27.018  25.390 1.00 . A A . 73 LEU HG   1 1 
        3  6566 1 1 73 LEU N    N   3.069 27.345  21.431 1.00 . A A . 73 LEU N    1 1 
        3  6567 1 1 73 LEU O    O   4.807 25.535  23.790 1.00 . A A . 73 LEU O    1 1 
        3  6568 1 1 74 GLU C    C   7.988 26.612  23.180 1.00 . A A . 74 GLU C    1 1 
        3  6569 1 1 74 GLU CA   C   7.021 25.978  22.187 1.00 . A A . 74 GLU CA   1 1 
        3  6570 1 1 74 GLU CB   C   7.651 25.948  20.788 1.00 . A A . 74 GLU CB   1 1 
        3  6571 1 1 74 GLU CD   C   7.238 25.331  18.394 1.00 . A A . 74 GLU CD   1 1 
        3  6572 1 1 74 GLU CG   C   6.589 25.536  19.760 1.00 . A A . 74 GLU CG   1 1 
        3  6573 1 1 74 GLU H    H   5.670 27.469  21.503 1.00 . A A . 74 GLU H    1 1 
        3  6574 1 1 74 GLU HA   H   6.824 24.958  22.496 1.00 . A A . 74 GLU HA   1 1 
        3  6575 1 1 74 GLU HB2  H   8.032 26.929  20.538 1.00 . A A . 74 GLU HB2  1 1 
        3  6576 1 1 74 GLU HB3  H   8.461 25.233  20.769 1.00 . A A . 74 GLU HB3  1 1 
        3  6577 1 1 74 GLU HG2  H   6.111 24.619  20.075 1.00 . A A . 74 GLU HG2  1 1 
        3  6578 1 1 74 GLU HG3  H   5.847 26.316  19.685 1.00 . A A . 74 GLU HG3  1 1 
        3  6579 1 1 74 GLU N    N   5.767 26.736  22.147 1.00 . A A . 74 GLU N    1 1 
        3  6580 1 1 74 GLU O    O   9.054 27.098  22.803 1.00 . A A . 74 GLU O    1 1 
        3  6581 1 1 74 GLU OE1  O   8.025 26.177  18.002 1.00 . A A . 74 GLU OE1  1 1 
        3  6582 1 1 74 GLU OE2  O   6.952 24.324  17.769 1.00 . A A . 74 GLU OE2  1 1 
        3  6583 1 1 75 HIS C    C   8.694 28.658  25.233 1.00 . A A . 75 HIS C    1 1 
        3  6584 1 1 75 HIS CA   C   8.431 27.184  25.509 1.00 . A A . 75 HIS CA   1 1 
        3  6585 1 1 75 HIS CB   C   9.761 26.432  25.625 1.00 . A A . 75 HIS CB   1 1 
        3  6586 1 1 75 HIS CD2  C   9.589 23.883  24.996 1.00 . A A . 75 HIS CD2  1 1 
        3  6587 1 1 75 HIS CE1  C   8.928 23.132  26.917 1.00 . A A . 75 HIS CE1  1 1 
        3  6588 1 1 75 HIS CG   C   9.491 24.966  25.834 1.00 . A A . 75 HIS CG   1 1 
        3  6589 1 1 75 HIS H    H   6.744 26.206  24.695 1.00 . A A . 75 HIS H    1 1 
        3  6590 1 1 75 HIS HA   H   7.902 27.097  26.447 1.00 . A A . 75 HIS HA   1 1 
        3  6591 1 1 75 HIS HB2  H  10.341 26.569  24.725 1.00 . A A . 75 HIS HB2  1 1 
        3  6592 1 1 75 HIS HB3  H  10.314 26.815  26.470 1.00 . A A . 75 HIS HB3  1 1 
        3  6593 1 1 75 HIS HD1  H   8.899 24.983  27.868 1.00 . A A . 75 HIS HD1  1 1 
        3  6594 1 1 75 HIS HD2  H   9.895 23.923  23.960 1.00 . A A . 75 HIS HD2  1 1 
        3  6595 1 1 75 HIS HE1  H   8.606 22.472  27.709 1.00 . A A . 75 HIS HE1  1 1 
        3  6596 1 1 75 HIS HE2  H   9.209 21.810  25.333 1.00 . A A . 75 HIS HE2  1 1 
        3  6597 1 1 75 HIS N    N   7.605 26.607  24.453 1.00 . A A . 75 HIS N    1 1 
        3  6598 1 1 75 HIS ND1  N   9.068 24.463  27.054 1.00 . A A . 75 HIS ND1  1 1 
        3  6599 1 1 75 HIS NE2  N   9.233 22.726  25.682 1.00 . A A . 75 HIS NE2  1 1 
        3  6600 1 1 75 HIS O    O   9.773 29.031  24.773 1.00 . A A . 75 HIS O    1 1 
        3  6601 1 1 76 HIS C    C   8.236 31.211  23.849 1.00 . A A . 76 HIS C    1 1 
        3  6602 1 1 76 HIS CA   C   7.825 30.931  25.290 1.00 . A A . 76 HIS CA   1 1 
        3  6603 1 1 76 HIS CB   C   8.863 31.519  26.248 1.00 . A A . 76 HIS CB   1 1 
        3  6604 1 1 76 HIS CD2  C   7.849 31.994  28.628 1.00 . A A . 76 HIS CD2  1 1 
        3  6605 1 1 76 HIS CE1  C   8.219 30.054  29.519 1.00 . A A . 76 HIS CE1  1 1 
        3  6606 1 1 76 HIS CG   C   8.460 31.225  27.668 1.00 . A A . 76 HIS CG   1 1 
        3  6607 1 1 76 HIS H    H   6.861 29.140  25.876 1.00 . A A . 76 HIS H    1 1 
        3  6608 1 1 76 HIS HA   H   6.870 31.399  25.479 1.00 . A A . 76 HIS HA   1 1 
        3  6609 1 1 76 HIS HB2  H   9.829 31.077  26.050 1.00 . A A . 76 HIS HB2  1 1 
        3  6610 1 1 76 HIS HB3  H   8.920 32.588  26.105 1.00 . A A . 76 HIS HB3  1 1 
        3  6611 1 1 76 HIS HD1  H   9.110 29.216  27.836 1.00 . A A . 76 HIS HD1  1 1 
        3  6612 1 1 76 HIS HD2  H   7.534 33.019  28.497 1.00 . A A . 76 HIS HD2  1 1 
        3  6613 1 1 76 HIS HE1  H   8.260 29.234  30.222 1.00 . A A . 76 HIS HE1  1 1 
        3  6614 1 1 76 HIS HE2  H   7.296 31.546  30.640 1.00 . A A . 76 HIS HE2  1 1 
        3  6615 1 1 76 HIS N    N   7.699 29.494  25.511 1.00 . A A . 76 HIS N    1 1 
        3  6616 1 1 76 HIS ND1  N   8.686 29.992  28.259 1.00 . A A . 76 HIS ND1  1 1 
        3  6617 1 1 76 HIS NE2  N   7.698 31.252  29.796 1.00 . A A . 76 HIS NE2  1 1 
        3  6618 1 1 76 HIS O    O   9.424 31.316  23.543 1.00 . A A . 76 HIS O    1 1 
        3  6619 1 1 77 HIS C    C   7.916 33.054  21.355 1.00 . A A . 77 HIS C    1 1 
        3  6620 1 1 77 HIS CA   C   7.521 31.594  21.555 1.00 . A A . 77 HIS CA   1 1 
        3  6621 1 1 77 HIS CB   C   6.279 31.270  20.712 1.00 . A A . 77 HIS CB   1 1 
        3  6622 1 1 77 HIS CD2  C   7.676 30.774  18.543 1.00 . A A . 77 HIS CD2  1 1 
        3  6623 1 1 77 HIS CE1  C   6.446 31.848  17.117 1.00 . A A . 77 HIS CE1  1 1 
        3  6624 1 1 77 HIS CG   C   6.630 31.317  19.248 1.00 . A A . 77 HIS CG   1 1 
        3  6625 1 1 77 HIS H    H   6.321 31.237  23.268 1.00 . A A . 77 HIS H    1 1 
        3  6626 1 1 77 HIS HA   H   8.339 30.963  21.230 1.00 . A A . 77 HIS HA   1 1 
        3  6627 1 1 77 HIS HB2  H   5.924 30.281  20.963 1.00 . A A . 77 HIS HB2  1 1 
        3  6628 1 1 77 HIS HB3  H   5.503 31.992  20.919 1.00 . A A . 77 HIS HB3  1 1 
        3  6629 1 1 77 HIS HD1  H   5.036 32.496  18.503 1.00 . A A . 77 HIS HD1  1 1 
        3  6630 1 1 77 HIS HD2  H   8.468 30.175  18.966 1.00 . A A . 77 HIS HD2  1 1 
        3  6631 1 1 77 HIS HE1  H   6.066 32.272  16.200 1.00 . A A . 77 HIS HE1  1 1 
        3  6632 1 1 77 HIS HE2  H   8.160 30.860  16.466 1.00 . A A . 77 HIS HE2  1 1 
        3  6633 1 1 77 HIS N    N   7.249 31.330  22.967 1.00 . A A . 77 HIS N    1 1 
        3  6634 1 1 77 HIS ND1  N   5.859 31.997  18.319 1.00 . A A . 77 HIS ND1  1 1 
        3  6635 1 1 77 HIS NE2  N   7.557 31.110  17.197 1.00 . A A . 77 HIS NE2  1 1 
        3  6636 1 1 77 HIS O    O   7.080 33.954  21.441 1.00 . A A . 77 HIS O    1 1 
        3  6637 1 1 78 HIS C    C   8.891 35.340  19.785 1.00 . A A . 78 HIS C    1 1 
        3  6638 1 1 78 HIS CA   C   9.697 34.635  20.873 1.00 . A A . 78 HIS CA   1 1 
        3  6639 1 1 78 HIS CB   C  11.175 34.590  20.474 1.00 . A A . 78 HIS CB   1 1 
        3  6640 1 1 78 HIS CD2  C  11.634 37.090  21.145 1.00 . A A . 78 HIS CD2  1 1 
        3  6641 1 1 78 HIS CE1  C  12.721 37.698  19.373 1.00 . A A . 78 HIS CE1  1 1 
        3  6642 1 1 78 HIS CG   C  11.702 35.991  20.324 1.00 . A A . 78 HIS CG   1 1 
        3  6643 1 1 78 HIS H    H   9.818 32.524  21.028 1.00 . A A . 78 HIS H    1 1 
        3  6644 1 1 78 HIS HA   H   9.602 35.191  21.794 1.00 . A A . 78 HIS HA   1 1 
        3  6645 1 1 78 HIS HB2  H  11.738 34.073  21.237 1.00 . A A . 78 HIS HB2  1 1 
        3  6646 1 1 78 HIS HB3  H  11.277 34.066  19.535 1.00 . A A . 78 HIS HB3  1 1 
        3  6647 1 1 78 HIS HD1  H  12.619 35.851  18.420 1.00 . A A . 78 HIS HD1  1 1 
        3  6648 1 1 78 HIS HD2  H  11.154 37.115  22.112 1.00 . A A . 78 HIS HD2  1 1 
        3  6649 1 1 78 HIS HE1  H  13.270 38.287  18.653 1.00 . A A . 78 HIS HE1  1 1 
        3  6650 1 1 78 HIS HE2  H  12.384 39.072  20.899 1.00 . A A . 78 HIS HE2  1 1 
        3  6651 1 1 78 HIS N    N   9.197 33.280  21.085 1.00 . A A . 78 HIS N    1 1 
        3  6652 1 1 78 HIS ND1  N  12.400 36.403  19.199 1.00 . A A . 78 HIS ND1  1 1 
        3  6653 1 1 78 HIS NE2  N  12.278 38.166  20.542 1.00 . A A . 78 HIS NE2  1 1 
        3  6654 1 1 78 HIS O    O   8.039 36.180  20.075 1.00 . A A . 78 HIS O    1 1 
        3  6655 1 1 79 HIS C    C   6.968 35.303  17.496 1.00 . A A . 79 HIS C    1 1 
        3  6656 1 1 79 HIS CA   C   8.463 35.595  17.409 1.00 . A A . 79 HIS CA   1 1 
        3  6657 1 1 79 HIS CB   C   9.014 35.044  16.092 1.00 . A A . 79 HIS CB   1 1 
        3  6658 1 1 79 HIS CD2  C  11.070 36.579  15.524 1.00 . A A . 79 HIS CD2  1 1 
        3  6659 1 1 79 HIS CE1  C  12.652 35.195  16.052 1.00 . A A . 79 HIS CE1  1 1 
        3  6660 1 1 79 HIS CG   C  10.462 35.425  15.953 1.00 . A A . 79 HIS CG   1 1 
        3  6661 1 1 79 HIS H    H   9.856 34.314  18.362 1.00 . A A . 79 HIS H    1 1 
        3  6662 1 1 79 HIS HA   H   8.614 36.663  17.432 1.00 . A A . 79 HIS HA   1 1 
        3  6663 1 1 79 HIS HB2  H   8.923 33.967  16.087 1.00 . A A . 79 HIS HB2  1 1 
        3  6664 1 1 79 HIS HB3  H   8.453 35.456  15.267 1.00 . A A . 79 HIS HB3  1 1 
        3  6665 1 1 79 HIS HD1  H  11.390 33.644  16.626 1.00 . A A . 79 HIS HD1  1 1 
        3  6666 1 1 79 HIS HD2  H  10.554 37.466  15.188 1.00 . A A . 79 HIS HD2  1 1 
        3  6667 1 1 79 HIS HE1  H  13.626 34.761  16.220 1.00 . A A . 79 HIS HE1  1 1 
        3  6668 1 1 79 HIS HE2  H  13.134 37.092  15.343 1.00 . A A . 79 HIS HE2  1 1 
        3  6669 1 1 79 HIS N    N   9.166 34.990  18.533 1.00 . A A . 79 HIS N    1 1 
        3  6670 1 1 79 HIS ND1  N  11.490 34.557  16.285 1.00 . A A . 79 HIS ND1  1 1 
        3  6671 1 1 79 HIS NE2  N  12.453 36.431  15.587 1.00 . A A . 79 HIS NE2  1 1 
        3  6672 1 1 79 HIS O    O   6.547 34.369  18.178 1.00 . A A . 79 HIS O    1 1 
        3  6673 1 1 80 HIS C    C   4.349 34.604  16.152 1.00 . A A . 80 HIS C    1 1 
        3  6674 1 1 80 HIS CA   C   4.725 35.928  16.810 1.00 . A A . 80 HIS CA   1 1 
        3  6675 1 1 80 HIS CB   C   4.049 37.080  16.064 1.00 . A A . 80 HIS CB   1 1 
        3  6676 1 1 80 HIS CD2  C   3.721 38.986  17.844 1.00 . A A . 80 HIS CD2  1 1 
        3  6677 1 1 80 HIS CE1  C   5.354 40.272  17.232 1.00 . A A . 80 HIS CE1  1 1 
        3  6678 1 1 80 HIS CG   C   4.331 38.374  16.777 1.00 . A A . 80 HIS CG   1 1 
        3  6679 1 1 80 HIS H    H   6.564 36.837  16.275 1.00 . A A . 80 HIS H    1 1 
        3  6680 1 1 80 HIS HA   H   4.378 35.921  17.832 1.00 . A A . 80 HIS HA   1 1 
        3  6681 1 1 80 HIS HB2  H   4.436 37.133  15.057 1.00 . A A . 80 HIS HB2  1 1 
        3  6682 1 1 80 HIS HB3  H   2.983 36.912  16.032 1.00 . A A . 80 HIS HB3  1 1 
        3  6683 1 1 80 HIS HD1  H   6.001 39.060  15.669 1.00 . A A . 80 HIS HD1  1 1 
        3  6684 1 1 80 HIS HD2  H   2.868 38.597  18.381 1.00 . A A . 80 HIS HD2  1 1 
        3  6685 1 1 80 HIS HE1  H   6.053 41.093  17.179 1.00 . A A . 80 HIS HE1  1 1 
        3  6686 1 1 80 HIS HE2  H   4.149 40.826  18.838 1.00 . A A . 80 HIS HE2  1 1 
        3  6687 1 1 80 HIS N    N   6.172 36.109  16.801 1.00 . A A . 80 HIS N    1 1 
        3  6688 1 1 80 HIS ND1  N   5.370 39.212  16.403 1.00 . A A . 80 HIS ND1  1 1 
        3  6689 1 1 80 HIS NE2  N   4.369 40.185  18.130 1.00 . A A . 80 HIS NE2  1 1 
        3  6690 1 1 80 HIS O    O   3.196 34.218  16.259 1.00 . A A . 80 HIS O    1 1 
        3  6691 2 1  1 MET C    C  40.709 32.100  10.320 1.00 . B B .  1 MET C    1 1 
        3  6692 2 1  1 MET CA   C  40.496 32.548  11.761 1.00 . B B .  1 MET CA   1 1 
        3  6693 2 1  1 MET CB   C  39.112 33.190  11.908 1.00 . B B .  1 MET CB   1 1 
        3  6694 2 1  1 MET CE   C  37.147 32.471  15.259 1.00 . B B .  1 MET CE   1 1 
        3  6695 2 1  1 MET CG   C  38.858 33.561  13.376 1.00 . B B .  1 MET CG   1 1 
        3  6696 2 1  1 MET H1   H  41.367 34.434  11.621 1.00 . B B .  1 MET H1   1 1 
        3  6697 2 1  1 MET H2   H  42.480 33.174  11.864 1.00 . B B .  1 MET H2   1 1 
        3  6698 2 1  1 MET H3   H  41.514 33.718  13.152 1.00 . B B .  1 MET H3   1 1 
        3  6699 2 1  1 MET HA   H  40.569 31.693  12.415 1.00 . B B .  1 MET HA   1 1 
        3  6700 2 1  1 MET HB2  H  39.066 34.080  11.299 1.00 . B B .  1 MET HB2  1 1 
        3  6701 2 1  1 MET HB3  H  38.358 32.491  11.581 1.00 . B B .  1 MET HB3  1 1 
        3  6702 2 1  1 MET HE1  H  36.892 31.667  15.936 1.00 . B B .  1 MET HE1  1 1 
        3  6703 2 1  1 MET HE2  H  36.344 32.618  14.550 1.00 . B B .  1 MET HE2  1 1 
        3  6704 2 1  1 MET HE3  H  37.294 33.379  15.824 1.00 . B B .  1 MET HE3  1 1 
        3  6705 2 1  1 MET HG2  H  39.696 34.133  13.750 1.00 . B B .  1 MET HG2  1 1 
        3  6706 2 1  1 MET HG3  H  37.961 34.160  13.441 1.00 . B B .  1 MET HG3  1 1 
        3  6707 2 1  1 MET N    N  41.543 33.544  12.127 1.00 . B B .  1 MET N    1 1 
        3  6708 2 1  1 MET O    O  40.490 32.866   9.382 1.00 . B B .  1 MET O    1 1 
        3  6709 2 1  1 MET SD   S  38.672 32.047  14.368 1.00 . B B .  1 MET SD   1 1 
        3  6710 2 1  2 SER C    C  41.309 28.786   8.836 1.00 . B B .  2 SER C    1 1 
        3  6711 2 1  2 SER CA   C  41.382 30.307   8.814 1.00 . B B .  2 SER CA   1 1 
        3  6712 2 1  2 SER CB   C  42.759 30.749   8.316 1.00 . B B .  2 SER CB   1 1 
        3  6713 2 1  2 SER H    H  41.297 30.288  10.936 1.00 . B B .  2 SER H    1 1 
        3  6714 2 1  2 SER HA   H  40.631 30.678   8.129 1.00 . B B .  2 SER HA   1 1 
        3  6715 2 1  2 SER HB2  H  43.528 30.275   8.903 1.00 . B B .  2 SER HB2  1 1 
        3  6716 2 1  2 SER HB3  H  42.874 30.465   7.278 1.00 . B B .  2 SER HB3  1 1 
        3  6717 2 1  2 SER HG   H  42.726 32.380   9.371 1.00 . B B .  2 SER HG   1 1 
        3  6718 2 1  2 SER N    N  41.139 30.853  10.151 1.00 . B B .  2 SER N    1 1 
        3  6719 2 1  2 SER O    O  41.374 28.139   7.790 1.00 . B B .  2 SER O    1 1 
        3  6720 2 1  2 SER OG   O  42.872 32.158   8.449 1.00 . B B .  2 SER OG   1 1 
        3  6721 2 1  3 GLU C    C  39.755 26.263   9.660 1.00 . B B .  3 GLU C    1 1 
        3  6722 2 1  3 GLU CA   C  41.094 26.771  10.175 1.00 . B B .  3 GLU CA   1 1 
        3  6723 2 1  3 GLU CB   C  41.281 26.388  11.650 1.00 . B B .  3 GLU CB   1 1 
        3  6724 2 1  3 GLU CD   C  42.858 26.431  13.600 1.00 . B B .  3 GLU CD   1 1 
        3  6725 2 1  3 GLU CG   C  42.697 26.745  12.112 1.00 . B B .  3 GLU CG   1 1 
        3  6726 2 1  3 GLU H    H  41.131 28.785  10.830 1.00 . B B .  3 GLU H    1 1 
        3  6727 2 1  3 GLU HA   H  41.863 26.304   9.598 1.00 . B B .  3 GLU HA   1 1 
        3  6728 2 1  3 GLU HB2  H  40.562 26.921  12.252 1.00 . B B .  3 GLU HB2  1 1 
        3  6729 2 1  3 GLU HB3  H  41.128 25.325  11.765 1.00 . B B .  3 GLU HB3  1 1 
        3  6730 2 1  3 GLU HG2  H  43.416 26.171  11.546 1.00 . B B .  3 GLU HG2  1 1 
        3  6731 2 1  3 GLU HG3  H  42.873 27.798  11.950 1.00 . B B .  3 GLU HG3  1 1 
        3  6732 2 1  3 GLU N    N  41.177 28.219  10.031 1.00 . B B .  3 GLU N    1 1 
        3  6733 2 1  3 GLU O    O  39.409 26.451   8.493 1.00 . B B .  3 GLU O    1 1 
        3  6734 2 1  3 GLU OE1  O  41.928 25.890  14.175 1.00 . B B .  3 GLU OE1  1 1 
        3  6735 2 1  3 GLU OE2  O  43.909 26.737  14.139 1.00 . B B .  3 GLU OE2  1 1 
        3  6736 2 1  4 LEU C    C  37.848 24.013   9.067 1.00 . B B .  4 LEU C    1 1 
        3  6737 2 1  4 LEU CA   C  37.704 25.069  10.173 1.00 . B B .  4 LEU CA   1 1 
        3  6738 2 1  4 LEU CB   C  36.774 26.197   9.701 1.00 . B B .  4 LEU CB   1 1 
        3  6739 2 1  4 LEU CD1  C  35.899 28.485  10.173 1.00 . B B .  4 LEU CD1  1 1 
        3  6740 2 1  4 LEU CD2  C  36.251 26.875  12.083 1.00 . B B .  4 LEU CD2  1 1 
        3  6741 2 1  4 LEU CG   C  36.780 27.353  10.713 1.00 . B B .  4 LEU CG   1 1 
        3  6742 2 1  4 LEU H    H  39.330 25.491  11.457 1.00 . B B .  4 LEU H    1 1 
        3  6743 2 1  4 LEU HA   H  37.282 24.601  11.035 1.00 . B B .  4 LEU HA   1 1 
        3  6744 2 1  4 LEU HB2  H  37.104 26.563   8.743 1.00 . B B .  4 LEU HB2  1 1 
        3  6745 2 1  4 LEU HB3  H  35.768 25.815   9.609 1.00 . B B .  4 LEU HB3  1 1 
        3  6746 2 1  4 LEU HD11 H  36.276 28.806   9.214 1.00 . B B .  4 LEU HD11 1 1 
        3  6747 2 1  4 LEU HD12 H  35.916 29.316  10.863 1.00 . B B .  4 LEU HD12 1 1 
        3  6748 2 1  4 LEU HD13 H  34.885 28.130  10.062 1.00 . B B .  4 LEU HD13 1 1 
        3  6749 2 1  4 LEU HD21 H  37.037 26.350  12.606 1.00 . B B .  4 LEU HD21 1 1 
        3  6750 2 1  4 LEU HD22 H  35.406 26.214  11.945 1.00 . B B .  4 LEU HD22 1 1 
        3  6751 2 1  4 LEU HD23 H  35.944 27.727  12.676 1.00 . B B .  4 LEU HD23 1 1 
        3  6752 2 1  4 LEU HG   H  37.791 27.720  10.827 1.00 . B B .  4 LEU HG   1 1 
        3  6753 2 1  4 LEU N    N  39.003 25.611  10.541 1.00 . B B .  4 LEU N    1 1 
        3  6754 2 1  4 LEU O    O  36.881 23.346   8.698 1.00 . B B .  4 LEU O    1 1 
        3  6755 2 1  5 PHE C    C  39.270 21.470   8.068 1.00 . B B .  5 PHE C    1 1 
        3  6756 2 1  5 PHE CA   C  39.332 22.889   7.500 1.00 . B B .  5 PHE CA   1 1 
        3  6757 2 1  5 PHE CB   C  40.717 23.148   6.857 1.00 . B B .  5 PHE CB   1 1 
        3  6758 2 1  5 PHE CD1  C  39.993 24.098   4.647 1.00 . B B .  5 PHE CD1  1 1 
        3  6759 2 1  5 PHE CD2  C  41.173 25.560   6.181 1.00 . B B .  5 PHE CD2  1 1 
        3  6760 2 1  5 PHE CE1  C  39.898 25.144   3.722 1.00 . B B .  5 PHE CE1  1 1 
        3  6761 2 1  5 PHE CE2  C  41.078 26.606   5.256 1.00 . B B .  5 PHE CE2  1 1 
        3  6762 2 1  5 PHE CG   C  40.630 24.305   5.876 1.00 . B B .  5 PHE CG   1 1 
        3  6763 2 1  5 PHE CZ   C  40.440 26.399   4.027 1.00 . B B .  5 PHE CZ   1 1 
        3  6764 2 1  5 PHE H    H  39.798 24.427   8.886 1.00 . B B .  5 PHE H    1 1 
        3  6765 2 1  5 PHE HA   H  38.568 22.983   6.736 1.00 . B B .  5 PHE HA   1 1 
        3  6766 2 1  5 PHE HB2  H  41.434 23.379   7.631 1.00 . B B .  5 PHE HB2  1 1 
        3  6767 2 1  5 PHE HB3  H  41.042 22.262   6.325 1.00 . B B .  5 PHE HB3  1 1 
        3  6768 2 1  5 PHE HD1  H  39.575 23.130   4.414 1.00 . B B .  5 PHE HD1  1 1 
        3  6769 2 1  5 PHE HD2  H  41.665 25.719   7.130 1.00 . B B .  5 PHE HD2  1 1 
        3  6770 2 1  5 PHE HE1  H  39.407 24.984   2.775 1.00 . B B .  5 PHE HE1  1 1 
        3  6771 2 1  5 PHE HE2  H  41.498 27.573   5.487 1.00 . B B .  5 PHE HE2  1 1 
        3  6772 2 1  5 PHE HZ   H  40.367 27.206   3.314 1.00 . B B .  5 PHE HZ   1 1 
        3  6773 2 1  5 PHE N    N  39.065 23.868   8.553 1.00 . B B .  5 PHE N    1 1 
        3  6774 2 1  5 PHE O    O  38.862 20.535   7.380 1.00 . B B .  5 PHE O    1 1 
        3  6775 2 1  6 SER C    C  38.283 19.583  10.322 1.00 . B B .  6 SER C    1 1 
        3  6776 2 1  6 SER CA   C  39.701 20.011   9.962 1.00 . B B .  6 SER CA   1 1 
        3  6777 2 1  6 SER CB   C  40.583 20.088  11.230 1.00 . B B .  6 SER CB   1 1 
        3  6778 2 1  6 SER H    H  40.002 22.101   9.821 1.00 . B B .  6 SER H    1 1 
        3  6779 2 1  6 SER HA   H  40.124 19.284   9.278 1.00 . B B .  6 SER HA   1 1 
        3  6780 2 1  6 SER HB2  H  41.137 19.172  11.366 1.00 . B B .  6 SER HB2  1 1 
        3  6781 2 1  6 SER HB3  H  41.290 20.902  11.119 1.00 . B B .  6 SER HB3  1 1 
        3  6782 2 1  6 SER HG   H  39.270 19.521  12.555 1.00 . B B .  6 SER HG   1 1 
        3  6783 2 1  6 SER N    N  39.688 21.319   9.320 1.00 . B B .  6 SER N    1 1 
        3  6784 2 1  6 SER O    O  37.516 20.367  10.881 1.00 . B B .  6 SER O    1 1 
        3  6785 2 1  6 SER OG   O  39.767 20.324  12.373 1.00 . B B .  6 SER OG   1 1 
        3  6786 2 1  7 VAL C    C  36.482 17.571  11.819 1.00 . B B .  7 VAL C    1 1 
        3  6787 2 1  7 VAL CA   C  36.608 17.822  10.308 1.00 . B B .  7 VAL CA   1 1 
        3  6788 2 1  7 VAL CB   C  36.323 16.513   9.514 1.00 . B B .  7 VAL CB   1 1 
        3  6789 2 1  7 VAL CG1  C  34.805 16.284   9.351 1.00 . B B .  7 VAL CG1  1 1 
        3  6790 2 1  7 VAL CG2  C  36.966 16.606   8.122 1.00 . B B .  7 VAL CG2  1 1 
        3  6791 2 1  7 VAL H    H  38.590 17.761   9.552 1.00 . B B .  7 VAL H    1 1 
        3  6792 2 1  7 VAL HA   H  35.877 18.568  10.030 1.00 . B B .  7 VAL HA   1 1 
        3  6793 2 1  7 VAL HB   H  36.742 15.673  10.042 1.00 . B B .  7 VAL HB   1 1 
        3  6794 2 1  7 VAL HG11 H  34.379 17.078   8.753 1.00 . B B .  7 VAL HG11 1 1 
        3  6795 2 1  7 VAL HG12 H  34.330 16.270  10.320 1.00 . B B .  7 VAL HG12 1 1 
        3  6796 2 1  7 VAL HG13 H  34.636 15.336   8.856 1.00 . B B .  7 VAL HG13 1 1 
        3  6797 2 1  7 VAL HG21 H  36.652 17.521   7.639 1.00 . B B .  7 VAL HG21 1 1 
        3  6798 2 1  7 VAL HG22 H  36.658 15.760   7.523 1.00 . B B .  7 VAL HG22 1 1 
        3  6799 2 1  7 VAL HG23 H  38.041 16.602   8.220 1.00 . B B .  7 VAL HG23 1 1 
        3  6800 2 1  7 VAL N    N  37.938 18.341   9.997 1.00 . B B .  7 VAL N    1 1 
        3  6801 2 1  7 VAL O    O  35.420 17.828  12.386 1.00 . B B .  7 VAL O    1 1 
        3  6802 2 1  8 PRO C    C  36.998 18.040  14.713 1.00 . B B .  8 PRO C    1 1 
        3  6803 2 1  8 PRO CA   C  37.454 16.816  13.926 1.00 . B B .  8 PRO CA   1 1 
        3  6804 2 1  8 PRO CB   C  38.907 16.423  14.290 1.00 . B B .  8 PRO CB   1 1 
        3  6805 2 1  8 PRO CD   C  38.852 16.763  11.920 1.00 . B B .  8 PRO CD   1 1 
        3  6806 2 1  8 PRO CG   C  39.473 15.891  13.013 1.00 . B B .  8 PRO CG   1 1 
        3  6807 2 1  8 PRO HA   H  36.793 15.985  14.122 1.00 . B B .  8 PRO HA   1 1 
        3  6808 2 1  8 PRO HB2  H  39.469 17.295  14.619 1.00 . B B .  8 PRO HB2  1 1 
        3  6809 2 1  8 PRO HB3  H  38.925 15.659  15.059 1.00 . B B .  8 PRO HB3  1 1 
        3  6810 2 1  8 PRO HD2  H  39.435 17.664  11.794 1.00 . B B .  8 PRO HD2  1 1 
        3  6811 2 1  8 PRO HD3  H  38.774 16.226  10.993 1.00 . B B .  8 PRO HD3  1 1 
        3  6812 2 1  8 PRO HG2  H  40.556 15.978  13.010 1.00 . B B .  8 PRO HG2  1 1 
        3  6813 2 1  8 PRO HG3  H  39.181 14.860  12.871 1.00 . B B .  8 PRO HG3  1 1 
        3  6814 2 1  8 PRO N    N  37.511 17.089  12.461 1.00 . B B .  8 PRO N    1 1 
        3  6815 2 1  8 PRO O    O  36.415 17.900  15.788 1.00 . B B .  8 PRO O    1 1 
        3  6816 2 1  9 TYR C    C  35.383 20.540  15.040 1.00 . B B .  9 TYR C    1 1 
        3  6817 2 1  9 TYR CA   C  36.900 20.468  14.867 1.00 . B B .  9 TYR CA   1 1 
        3  6818 2 1  9 TYR CB   C  37.393 21.685  14.062 1.00 . B B .  9 TYR CB   1 1 
        3  6819 2 1  9 TYR CD1  C  37.834 23.344  15.903 1.00 . B B .  9 TYR CD1  1 1 
        3  6820 2 1  9 TYR CD2  C  35.957 23.746  14.423 1.00 . B B .  9 TYR CD2  1 1 
        3  6821 2 1  9 TYR CE1  C  37.533 24.517  16.605 1.00 . B B .  9 TYR CE1  1 1 
        3  6822 2 1  9 TYR CE2  C  35.655 24.920  15.124 1.00 . B B .  9 TYR CE2  1 1 
        3  6823 2 1  9 TYR CG   C  37.046 22.958  14.812 1.00 . B B .  9 TYR CG   1 1 
        3  6824 2 1  9 TYR CZ   C  36.444 25.305  16.215 1.00 . B B .  9 TYR CZ   1 1 
        3  6825 2 1  9 TYR H    H  37.742 19.280  13.329 1.00 . B B .  9 TYR H    1 1 
        3  6826 2 1  9 TYR HA   H  37.363 20.487  15.842 1.00 . B B .  9 TYR HA   1 1 
        3  6827 2 1  9 TYR HB2  H  38.468 21.624  13.936 1.00 . B B .  9 TYR HB2  1 1 
        3  6828 2 1  9 TYR HB3  H  36.923 21.694  13.088 1.00 . B B .  9 TYR HB3  1 1 
        3  6829 2 1  9 TYR HD1  H  38.674 22.736  16.204 1.00 . B B .  9 TYR HD1  1 1 
        3  6830 2 1  9 TYR HD2  H  35.348 23.449  13.581 1.00 . B B .  9 TYR HD2  1 1 
        3  6831 2 1  9 TYR HE1  H  38.140 24.815  17.447 1.00 . B B .  9 TYR HE1  1 1 
        3  6832 2 1  9 TYR HE2  H  34.814 25.528  14.825 1.00 . B B .  9 TYR HE2  1 1 
        3  6833 2 1  9 TYR HH   H  36.194 26.269  17.845 1.00 . B B .  9 TYR HH   1 1 
        3  6834 2 1  9 TYR N    N  37.276 19.229  14.190 1.00 . B B .  9 TYR N    1 1 
        3  6835 2 1  9 TYR O    O  34.889 20.899  16.109 1.00 . B B .  9 TYR O    1 1 
        3  6836 2 1  9 TYR OH   O  36.145 26.463  16.906 1.00 . B B .  9 TYR OH   1 1 
        3  6837 2 1 10 PHE C    C  32.683 19.309  15.154 1.00 . B B . 10 PHE C    1 1 
        3  6838 2 1 10 PHE CA   C  33.192 20.224  14.032 1.00 . B B . 10 PHE CA   1 1 
        3  6839 2 1 10 PHE CB   C  32.612 19.779  12.648 1.00 . B B . 10 PHE CB   1 1 
        3  6840 2 1 10 PHE CD1  C  32.901 22.118  11.726 1.00 . B B . 10 PHE CD1  1 1 
        3  6841 2 1 10 PHE CD2  C  30.810 20.965  11.305 1.00 . B B . 10 PHE CD2  1 1 
        3  6842 2 1 10 PHE CE1  C  32.429 23.232  11.022 1.00 . B B . 10 PHE CE1  1 1 
        3  6843 2 1 10 PHE CE2  C  30.337 22.079  10.601 1.00 . B B . 10 PHE CE2  1 1 
        3  6844 2 1 10 PHE CG   C  32.092 20.984  11.868 1.00 . B B . 10 PHE CG   1 1 
        3  6845 2 1 10 PHE CZ   C  31.147 23.212  10.459 1.00 . B B . 10 PHE CZ   1 1 
        3  6846 2 1 10 PHE H    H  35.101 19.919  13.158 1.00 . B B . 10 PHE H    1 1 
        3  6847 2 1 10 PHE HA   H  32.876 21.234  14.252 1.00 . B B . 10 PHE HA   1 1 
        3  6848 2 1 10 PHE HB2  H  33.397 19.306  12.075 1.00 . B B . 10 PHE HB2  1 1 
        3  6849 2 1 10 PHE HB3  H  31.807 19.062  12.791 1.00 . B B . 10 PHE HB3  1 1 
        3  6850 2 1 10 PHE HD1  H  33.891 22.133  12.162 1.00 . B B . 10 PHE HD1  1 1 
        3  6851 2 1 10 PHE HD2  H  30.183 20.092  11.414 1.00 . B B . 10 PHE HD2  1 1 
        3  6852 2 1 10 PHE HE1  H  33.053 24.106  10.914 1.00 . B B . 10 PHE HE1  1 1 
        3  6853 2 1 10 PHE HE2  H  29.354 22.066  10.172 1.00 . B B . 10 PHE HE2  1 1 
        3  6854 2 1 10 PHE HZ   H  30.776 24.069   9.920 1.00 . B B . 10 PHE HZ   1 1 
        3  6855 2 1 10 PHE N    N  34.653 20.197  13.984 1.00 . B B . 10 PHE N    1 1 
        3  6856 2 1 10 PHE O    O  31.702 19.630  15.825 1.00 . B B . 10 PHE O    1 1 
        3  6857 2 1 11 ILE C    C  33.226 17.796  17.770 1.00 . B B . 11 ILE C    1 1 
        3  6858 2 1 11 ILE CA   C  32.946 17.227  16.380 1.00 . B B . 11 ILE CA   1 1 
        3  6859 2 1 11 ILE CB   C  33.703 15.904  16.192 1.00 . B B . 11 ILE CB   1 1 
        3  6860 2 1 11 ILE CD1  C  34.286 14.122  14.509 1.00 . B B . 11 ILE CD1  1 1 
        3  6861 2 1 11 ILE CG1  C  33.511 15.420  14.744 1.00 . B B . 11 ILE CG1  1 1 
        3  6862 2 1 11 ILE CG2  C  33.154 14.847  17.162 1.00 . B B . 11 ILE CG2  1 1 
        3  6863 2 1 11 ILE H    H  34.125 17.972  14.779 1.00 . B B . 11 ILE H    1 1 
        3  6864 2 1 11 ILE HA   H  31.891 17.035  16.287 1.00 . B B . 11 ILE HA   1 1 
        3  6865 2 1 11 ILE HB   H  34.754 16.059  16.386 1.00 . B B . 11 ILE HB   1 1 
        3  6866 2 1 11 ILE HD11 H  34.266 13.879  13.458 1.00 . B B . 11 ILE HD11 1 1 
        3  6867 2 1 11 ILE HD12 H  33.825 13.322  15.071 1.00 . B B . 11 ILE HD12 1 1 
        3  6868 2 1 11 ILE HD13 H  35.308 14.247  14.833 1.00 . B B . 11 ILE HD13 1 1 
        3  6869 2 1 11 ILE HG12 H  32.464 15.250  14.556 1.00 . B B . 11 ILE HG12 1 1 
        3  6870 2 1 11 ILE HG13 H  33.876 16.173  14.064 1.00 . B B . 11 ILE HG13 1 1 
        3  6871 2 1 11 ILE HG21 H  32.112 14.663  16.944 1.00 . B B . 11 ILE HG21 1 1 
        3  6872 2 1 11 ILE HG22 H  33.251 15.197  18.178 1.00 . B B . 11 ILE HG22 1 1 
        3  6873 2 1 11 ILE HG23 H  33.713 13.931  17.050 1.00 . B B . 11 ILE HG23 1 1 
        3  6874 2 1 11 ILE N    N  33.350 18.175  15.343 1.00 . B B . 11 ILE N    1 1 
        3  6875 2 1 11 ILE O    O  32.384 17.743  18.666 1.00 . B B . 11 ILE O    1 1 
        3  6876 2 1 12 GLU C    C  33.775 19.904  19.725 1.00 . B B . 12 GLU C    1 1 
        3  6877 2 1 12 GLU CA   C  34.830 18.906  19.230 1.00 . B B . 12 GLU CA   1 1 
        3  6878 2 1 12 GLU CB   C  36.185 19.623  19.092 1.00 . B B . 12 GLU CB   1 1 
        3  6879 2 1 12 GLU CD   C  38.624 19.310  18.576 1.00 . B B . 12 GLU CD   1 1 
        3  6880 2 1 12 GLU CG   C  37.307 18.597  18.881 1.00 . B B . 12 GLU CG   1 1 
        3  6881 2 1 12 GLU H    H  35.061 18.346  17.189 1.00 . B B . 12 GLU H    1 1 
        3  6882 2 1 12 GLU HA   H  34.927 18.110  19.955 1.00 . B B . 12 GLU HA   1 1 
        3  6883 2 1 12 GLU HB2  H  36.149 20.292  18.245 1.00 . B B . 12 GLU HB2  1 1 
        3  6884 2 1 12 GLU HB3  H  36.390 20.192  19.988 1.00 . B B . 12 GLU HB3  1 1 
        3  6885 2 1 12 GLU HG2  H  37.422 18.008  19.779 1.00 . B B . 12 GLU HG2  1 1 
        3  6886 2 1 12 GLU HG3  H  37.053 17.948  18.061 1.00 . B B . 12 GLU HG3  1 1 
        3  6887 2 1 12 GLU N    N  34.430 18.332  17.939 1.00 . B B . 12 GLU N    1 1 
        3  6888 2 1 12 GLU O    O  33.641 20.121  20.929 1.00 . B B . 12 GLU O    1 1 
        3  6889 2 1 12 GLU OE1  O  38.634 20.530  18.598 1.00 . B B . 12 GLU OE1  1 1 
        3  6890 2 1 12 GLU OE2  O  39.599 18.625  18.316 1.00 . B B . 12 GLU OE2  1 1 
        3  6891 2 1 13 ASN C    C  30.819 20.733  19.838 1.00 . B B . 13 ASN C    1 1 
        3  6892 2 1 13 ASN CA   C  31.982 21.447  19.156 1.00 . B B . 13 ASN CA   1 1 
        3  6893 2 1 13 ASN CB   C  31.480 22.183  17.911 1.00 . B B . 13 ASN CB   1 1 
        3  6894 2 1 13 ASN CG   C  30.425 23.217  18.300 1.00 . B B . 13 ASN CG   1 1 
        3  6895 2 1 13 ASN H    H  33.179 20.278  17.851 1.00 . B B . 13 ASN H    1 1 
        3  6896 2 1 13 ASN HA   H  32.395 22.171  19.843 1.00 . B B . 13 ASN HA   1 1 
        3  6897 2 1 13 ASN HB2  H  32.309 22.681  17.430 1.00 . B B . 13 ASN HB2  1 1 
        3  6898 2 1 13 ASN HB3  H  31.044 21.471  17.226 1.00 . B B . 13 ASN HB3  1 1 
        3  6899 2 1 13 ASN HD21 H  31.042 23.366  20.182 1.00 . B B . 13 ASN HD21 1 1 
        3  6900 2 1 13 ASN HD22 H  29.718 24.345  19.772 1.00 . B B . 13 ASN HD22 1 1 
        3  6901 2 1 13 ASN N    N  33.027 20.489  18.796 1.00 . B B . 13 ASN N    1 1 
        3  6902 2 1 13 ASN ND2  N  30.392 23.680  19.520 1.00 . B B . 13 ASN ND2  1 1 
        3  6903 2 1 13 ASN O    O  30.136 21.300  20.691 1.00 . B B . 13 ASN O    1 1 
        3  6904 2 1 13 ASN OD1  O  29.607 23.609  17.468 1.00 . B B . 13 ASN OD1  1 1 
        3  6905 2 1 14 LEU C    C  29.849 18.251  21.426 1.00 . B B . 14 LEU C    1 1 
        3  6906 2 1 14 LEU CA   C  29.516 18.679  20.006 1.00 . B B . 14 LEU CA   1 1 
        3  6907 2 1 14 LEU CB   C  29.297 17.439  19.134 1.00 . B B . 14 LEU CB   1 1 
        3  6908 2 1 14 LEU CD1  C  28.975 16.600  16.805 1.00 . B B . 14 LEU CD1  1 1 
        3  6909 2 1 14 LEU CD2  C  28.129 18.885  17.430 1.00 . B B . 14 LEU CD2  1 1 
        3  6910 2 1 14 LEU CG   C  29.237 17.844  17.659 1.00 . B B . 14 LEU CG   1 1 
        3  6911 2 1 14 LEU H    H  31.172 19.084  18.761 1.00 . B B . 14 LEU H    1 1 
        3  6912 2 1 14 LEU HA   H  28.607 19.261  20.030 1.00 . B B . 14 LEU HA   1 1 
        3  6913 2 1 14 LEU HB2  H  30.111 16.741  19.278 1.00 . B B . 14 LEU HB2  1 1 
        3  6914 2 1 14 LEU HB3  H  28.366 16.968  19.410 1.00 . B B . 14 LEU HB3  1 1 
        3  6915 2 1 14 LEU HD11 H  29.843 15.955  16.835 1.00 . B B . 14 LEU HD11 1 1 
        3  6916 2 1 14 LEU HD12 H  28.784 16.901  15.787 1.00 . B B . 14 LEU HD12 1 1 
        3  6917 2 1 14 LEU HD13 H  28.115 16.069  17.188 1.00 . B B . 14 LEU HD13 1 1 
        3  6918 2 1 14 LEU HD21 H  28.462 19.848  17.788 1.00 . B B . 14 LEU HD21 1 1 
        3  6919 2 1 14 LEU HD22 H  27.230 18.591  17.956 1.00 . B B . 14 LEU HD22 1 1 
        3  6920 2 1 14 LEU HD23 H  27.924 18.956  16.380 1.00 . B B . 14 LEU HD23 1 1 
        3  6921 2 1 14 LEU HG   H  30.185 18.271  17.372 1.00 . B B . 14 LEU HG   1 1 
        3  6922 2 1 14 LEU N    N  30.595 19.484  19.444 1.00 . B B . 14 LEU N    1 1 
        3  6923 2 1 14 LEU O    O  28.985 18.237  22.303 1.00 . B B . 14 LEU O    1 1 
        3  6924 2 1 15 LYS C    C  31.288 18.550  23.996 1.00 . B B . 15 LYS C    1 1 
        3  6925 2 1 15 LYS CA   C  31.561 17.461  22.958 1.00 . B B . 15 LYS CA   1 1 
        3  6926 2 1 15 LYS CB   C  33.061 17.135  22.918 1.00 . B B . 15 LYS CB   1 1 
        3  6927 2 1 15 LYS CD   C  34.785 15.558  22.019 1.00 . B B . 15 LYS CD   1 1 
        3  6928 2 1 15 LYS CE   C  35.008 14.311  21.163 1.00 . B B . 15 LYS CE   1 1 
        3  6929 2 1 15 LYS CG   C  33.295 15.895  22.046 1.00 . B B . 15 LYS CG   1 1 
        3  6930 2 1 15 LYS H    H  31.757 17.929  20.912 1.00 . B B . 15 LYS H    1 1 
        3  6931 2 1 15 LYS HA   H  31.024 16.569  23.226 1.00 . B B . 15 LYS HA   1 1 
        3  6932 2 1 15 LYS HB2  H  33.601 17.973  22.504 1.00 . B B . 15 LYS HB2  1 1 
        3  6933 2 1 15 LYS HB3  H  33.416 16.937  23.919 1.00 . B B . 15 LYS HB3  1 1 
        3  6934 2 1 15 LYS HD2  H  35.336 16.388  21.599 1.00 . B B . 15 LYS HD2  1 1 
        3  6935 2 1 15 LYS HD3  H  35.131 15.367  23.024 1.00 . B B . 15 LYS HD3  1 1 
        3  6936 2 1 15 LYS HE2  H  34.462 13.481  21.586 1.00 . B B . 15 LYS HE2  1 1 
        3  6937 2 1 15 LYS HE3  H  34.659 14.497  20.158 1.00 . B B . 15 LYS HE3  1 1 
        3  6938 2 1 15 LYS HG2  H  32.745 15.059  22.454 1.00 . B B . 15 LYS HG2  1 1 
        3  6939 2 1 15 LYS HG3  H  32.955 16.093  21.041 1.00 . B B . 15 LYS HG3  1 1 
        3  6940 2 1 15 LYS HZ1  H  36.707 13.422  21.969 1.00 . B B . 15 LYS HZ1  1 1 
        3  6941 2 1 15 LYS HZ2  H  37.011 14.870  21.139 1.00 . B B . 15 LYS HZ2  1 1 
        3  6942 2 1 15 LYS HZ3  H  36.678 13.448  20.271 1.00 . B B . 15 LYS HZ3  1 1 
        3  6943 2 1 15 LYS N    N  31.111 17.898  21.648 1.00 . B B . 15 LYS N    1 1 
        3  6944 2 1 15 LYS NZ   N  36.461 13.988  21.133 1.00 . B B . 15 LYS NZ   1 1 
        3  6945 2 1 15 LYS O    O  31.017 18.260  25.162 1.00 . B B . 15 LYS O    1 1 
        3  6946 2 1 16 GLN C    C  29.669 20.961  24.900 1.00 . B B . 16 GLN C    1 1 
        3  6947 2 1 16 GLN CA   C  31.127 20.934  24.456 1.00 . B B . 16 GLN CA   1 1 
        3  6948 2 1 16 GLN CB   C  31.490 22.241  23.745 1.00 . B B . 16 GLN CB   1 1 
        3  6949 2 1 16 GLN CD   C  31.865 24.696  24.084 1.00 . B B . 16 GLN CD   1 1 
        3  6950 2 1 16 GLN CG   C  31.296 23.423  24.701 1.00 . B B . 16 GLN CG   1 1 
        3  6951 2 1 16 GLN H    H  31.591 19.973  22.622 1.00 . B B . 16 GLN H    1 1 
        3  6952 2 1 16 GLN HA   H  31.741 20.838  25.335 1.00 . B B . 16 GLN HA   1 1 
        3  6953 2 1 16 GLN HB2  H  32.522 22.200  23.425 1.00 . B B . 16 GLN HB2  1 1 
        3  6954 2 1 16 GLN HB3  H  30.852 22.371  22.883 1.00 . B B . 16 GLN HB3  1 1 
        3  6955 2 1 16 GLN HE21 H  33.118 25.033  25.587 1.00 . B B . 16 GLN HE21 1 1 
        3  6956 2 1 16 GLN HE22 H  33.164 26.177  24.333 1.00 . B B . 16 GLN HE22 1 1 
        3  6957 2 1 16 GLN HG2  H  30.242 23.561  24.894 1.00 . B B . 16 GLN HG2  1 1 
        3  6958 2 1 16 GLN HG3  H  31.805 23.222  25.632 1.00 . B B . 16 GLN HG3  1 1 
        3  6959 2 1 16 GLN N    N  31.371 19.803  23.562 1.00 . B B . 16 GLN N    1 1 
        3  6960 2 1 16 GLN NE2  N  32.793 25.357  24.721 1.00 . B B . 16 GLN NE2  1 1 
        3  6961 2 1 16 GLN O    O  29.362 21.415  26.003 1.00 . B B . 16 GLN O    1 1 
        3  6962 2 1 16 GLN OE1  O  31.449 25.105  22.999 1.00 . B B . 16 GLN OE1  1 1 
        3  6963 2 1 17 HIS C    C  27.068 19.457  25.489 1.00 . B B . 17 HIS C    1 1 
        3  6964 2 1 17 HIS CA   C  27.353 20.468  24.376 1.00 . B B . 17 HIS CA   1 1 
        3  6965 2 1 17 HIS CB   C  26.520 20.114  23.139 1.00 . B B . 17 HIS CB   1 1 
        3  6966 2 1 17 HIS CD2  C  27.511 22.284  22.036 1.00 . B B . 17 HIS CD2  1 1 
        3  6967 2 1 17 HIS CE1  C  26.384 22.241  20.186 1.00 . B B . 17 HIS CE1  1 1 
        3  6968 2 1 17 HIS CG   C  26.710 21.170  22.084 1.00 . B B . 17 HIS CG   1 1 
        3  6969 2 1 17 HIS H    H  29.080 20.132  23.176 1.00 . B B . 17 HIS H    1 1 
        3  6970 2 1 17 HIS HA   H  27.063 21.452  24.718 1.00 . B B . 17 HIS HA   1 1 
        3  6971 2 1 17 HIS HB2  H  26.831 19.156  22.753 1.00 . B B . 17 HIS HB2  1 1 
        3  6972 2 1 17 HIS HB3  H  25.475 20.068  23.413 1.00 . B B . 17 HIS HB3  1 1 
        3  6973 2 1 17 HIS HD1  H  25.342 20.492  20.615 1.00 . B B . 17 HIS HD1  1 1 
        3  6974 2 1 17 HIS HD2  H  28.201 22.588  22.809 1.00 . B B . 17 HIS HD2  1 1 
        3  6975 2 1 17 HIS HE1  H  25.992 22.498  19.215 1.00 . B B . 17 HIS HE1  1 1 
        3  6976 2 1 17 HIS HE2  H  27.741 23.782  20.533 1.00 . B B . 17 HIS HE2  1 1 
        3  6977 2 1 17 HIS N    N  28.777 20.481  24.041 1.00 . B B . 17 HIS N    1 1 
        3  6978 2 1 17 HIS ND1  N  26.000 21.163  20.894 1.00 . B B . 17 HIS ND1  1 1 
        3  6979 2 1 17 HIS NE2  N  27.303 22.959  20.837 1.00 . B B . 17 HIS NE2  1 1 
        3  6980 2 1 17 HIS O    O  26.446 19.792  26.497 1.00 . B B . 17 HIS O    1 1 
        3  6981 2 1 18 ILE C    C  28.209 17.396  27.515 1.00 . B B . 18 ILE C    1 1 
        3  6982 2 1 18 ILE CA   C  27.316 17.170  26.292 1.00 . B B . 18 ILE CA   1 1 
        3  6983 2 1 18 ILE CB   C  27.602 15.788  25.657 1.00 . B B . 18 ILE CB   1 1 
        3  6984 2 1 18 ILE CD1  C  29.376 14.448  24.425 1.00 . B B . 18 ILE CD1  1 1 
        3  6985 2 1 18 ILE CG1  C  29.097 15.676  25.308 1.00 . B B . 18 ILE CG1  1 1 
        3  6986 2 1 18 ILE CG2  C  26.754 15.627  24.381 1.00 . B B . 18 ILE CG2  1 1 
        3  6987 2 1 18 ILE H    H  28.014 18.015  24.473 1.00 . B B . 18 ILE H    1 1 
        3  6988 2 1 18 ILE HA   H  26.283 17.192  26.612 1.00 . B B . 18 ILE HA   1 1 
        3  6989 2 1 18 ILE HB   H  27.338 15.010  26.365 1.00 . B B . 18 ILE HB   1 1 
        3  6990 2 1 18 ILE HD11 H  28.841 13.593  24.809 1.00 . B B . 18 ILE HD11 1 1 
        3  6991 2 1 18 ILE HD12 H  30.436 14.241  24.429 1.00 . B B . 18 ILE HD12 1 1 
        3  6992 2 1 18 ILE HD13 H  29.054 14.650  23.412 1.00 . B B . 18 ILE HD13 1 1 
        3  6993 2 1 18 ILE HG12 H  29.396 16.564  24.786 1.00 . B B . 18 ILE HG12 1 1 
        3  6994 2 1 18 ILE HG13 H  29.670 15.585  26.217 1.00 . B B . 18 ILE HG13 1 1 
        3  6995 2 1 18 ILE HG21 H  26.732 14.586  24.090 1.00 . B B . 18 ILE HG21 1 1 
        3  6996 2 1 18 ILE HG22 H  27.182 16.215  23.579 1.00 . B B . 18 ILE HG22 1 1 
        3  6997 2 1 18 ILE HG23 H  25.753 15.963  24.571 1.00 . B B . 18 ILE HG23 1 1 
        3  6998 2 1 18 ILE N    N  27.525 18.224  25.296 1.00 . B B . 18 ILE N    1 1 
        3  6999 2 1 18 ILE O    O  27.766 17.269  28.657 1.00 . B B . 18 ILE O    1 1 
        3  7000 2 1 19 GLU C    C  29.989 19.156  29.193 1.00 . B B . 19 GLU C    1 1 
        3  7001 2 1 19 GLU CA   C  30.417 17.959  28.351 1.00 . B B . 19 GLU CA   1 1 
        3  7002 2 1 19 GLU CB   C  31.817 18.200  27.777 1.00 . B B . 19 GLU CB   1 1 
        3  7003 2 1 19 GLU CD   C  34.255 18.414  28.330 1.00 . B B . 19 GLU CD   1 1 
        3  7004 2 1 19 GLU CG   C  32.847 18.280  28.909 1.00 . B B . 19 GLU CG   1 1 
        3  7005 2 1 19 GLU H    H  29.767 17.816  26.331 1.00 . B B . 19 GLU H    1 1 
        3  7006 2 1 19 GLU HA   H  30.447 17.083  28.981 1.00 . B B . 19 GLU HA   1 1 
        3  7007 2 1 19 GLU HB2  H  32.077 17.387  27.117 1.00 . B B . 19 GLU HB2  1 1 
        3  7008 2 1 19 GLU HB3  H  31.824 19.129  27.227 1.00 . B B . 19 GLU HB3  1 1 
        3  7009 2 1 19 GLU HG2  H  32.633 19.138  29.530 1.00 . B B . 19 GLU HG2  1 1 
        3  7010 2 1 19 GLU HG3  H  32.792 17.383  29.507 1.00 . B B . 19 GLU HG3  1 1 
        3  7011 2 1 19 GLU N    N  29.470 17.729  27.261 1.00 . B B . 19 GLU N    1 1 
        3  7012 2 1 19 GLU O    O  29.859 19.041  30.412 1.00 . B B . 19 GLU O    1 1 
        3  7013 2 1 19 GLU OE1  O  34.408 18.205  27.138 1.00 . B B . 19 GLU OE1  1 1 
        3  7014 2 1 19 GLU OE2  O  35.160 18.711  29.092 1.00 . B B . 19 GLU OE2  1 1 
        3  7015 2 1 20 MET C    C  27.806 21.630  29.193 1.00 . B B . 20 MET C    1 1 
        3  7016 2 1 20 MET CA   C  29.326 21.504  29.255 1.00 . B B . 20 MET CA   1 1 
        3  7017 2 1 20 MET CB   C  29.984 22.759  28.641 1.00 . B B . 20 MET CB   1 1 
        3  7018 2 1 20 MET CE   C  33.880 21.546  29.038 1.00 . B B . 20 MET CE   1 1 
        3  7019 2 1 20 MET CG   C  31.451 22.472  28.335 1.00 . B B . 20 MET CG   1 1 
        3  7020 2 1 20 MET H    H  29.875 20.325  27.573 1.00 . B B . 20 MET H    1 1 
        3  7021 2 1 20 MET HA   H  29.619 21.437  30.299 1.00 . B B . 20 MET HA   1 1 
        3  7022 2 1 20 MET HB2  H  29.476 23.033  27.727 1.00 . B B . 20 MET HB2  1 1 
        3  7023 2 1 20 MET HB3  H  29.921 23.581  29.340 1.00 . B B . 20 MET HB3  1 1 
        3  7024 2 1 20 MET HE1  H  34.481 20.930  29.689 1.00 . B B . 20 MET HE1  1 1 
        3  7025 2 1 20 MET HE2  H  34.383 22.486  28.856 1.00 . B B . 20 MET HE2  1 1 
        3  7026 2 1 20 MET HE3  H  33.727 21.035  28.098 1.00 . B B . 20 MET HE3  1 1 
        3  7027 2 1 20 MET HG2  H  31.514 21.727  27.558 1.00 . B B . 20 MET HG2  1 1 
        3  7028 2 1 20 MET HG3  H  31.932 23.381  28.004 1.00 . B B . 20 MET HG3  1 1 
        3  7029 2 1 20 MET N    N  29.756 20.292  28.545 1.00 . B B . 20 MET N    1 1 
        3  7030 2 1 20 MET O    O  27.084 20.633  29.187 1.00 . B B . 20 MET O    1 1 
        3  7031 2 1 20 MET SD   S  32.283 21.864  29.819 1.00 . B B . 20 MET SD   1 1 
        3  7032 2 1 21 ASN C    C  25.627 24.586  28.856 1.00 . B B . 21 ASN C    1 1 
        3  7033 2 1 21 ASN CA   C  25.894 23.114  29.105 1.00 . B B . 21 ASN CA   1 1 
        3  7034 2 1 21 ASN CB   C  25.237 22.693  30.422 1.00 . B B . 21 ASN CB   1 1 
        3  7035 2 1 21 ASN CG   C  23.719 22.808  30.314 1.00 . B B . 21 ASN CG   1 1 
        3  7036 2 1 21 ASN H    H  27.949 23.627  29.165 1.00 . B B . 21 ASN H    1 1 
        3  7037 2 1 21 ASN HA   H  25.466 22.538  28.299 1.00 . B B . 21 ASN HA   1 1 
        3  7038 2 1 21 ASN HB2  H  25.502 21.671  30.646 1.00 . B B . 21 ASN HB2  1 1 
        3  7039 2 1 21 ASN HB3  H  25.587 23.335  31.218 1.00 . B B . 21 ASN HB3  1 1 
        3  7040 2 1 21 ASN HD21 H  23.515 21.123  29.283 1.00 . B B . 21 ASN HD21 1 1 
        3  7041 2 1 21 ASN HD22 H  22.070 21.951  29.615 1.00 . B B . 21 ASN HD22 1 1 
        3  7042 2 1 21 ASN N    N  27.327 22.870  29.158 1.00 . B B . 21 ASN N    1 1 
        3  7043 2 1 21 ASN ND2  N  23.046 21.885  29.684 1.00 . B B . 21 ASN ND2  1 1 
        3  7044 2 1 21 ASN O    O  24.772 25.187  29.507 1.00 . B B . 21 ASN O    1 1 
        3  7045 2 1 21 ASN OD1  O  23.132 23.765  30.819 1.00 . B B . 21 ASN OD1  1 1 
        3  7046 2 1 22 GLN C    C  24.723 26.882  27.261 1.00 . B B . 22 GLN C    1 1 
        3  7047 2 1 22 GLN CA   C  26.183 26.580  27.596 1.00 . B B . 22 GLN CA   1 1 
        3  7048 2 1 22 GLN CB   C  27.071 26.954  26.406 1.00 . B B . 22 GLN CB   1 1 
        3  7049 2 1 22 GLN CD   C  29.423 27.306  25.640 1.00 . B B . 22 GLN CD   1 1 
        3  7050 2 1 22 GLN CG   C  28.544 26.885  26.811 1.00 . B B . 22 GLN CG   1 1 
        3  7051 2 1 22 GLN H    H  27.024 24.638  27.424 1.00 . B B . 22 GLN H    1 1 
        3  7052 2 1 22 GLN HA   H  26.476 27.169  28.452 1.00 . B B . 22 GLN HA   1 1 
        3  7053 2 1 22 GLN HB2  H  26.891 26.257  25.601 1.00 . B B . 22 GLN HB2  1 1 
        3  7054 2 1 22 GLN HB3  H  26.837 27.955  26.077 1.00 . B B . 22 GLN HB3  1 1 
        3  7055 2 1 22 GLN HE21 H  29.631 25.458  24.943 1.00 . B B . 22 GLN HE21 1 1 
        3  7056 2 1 22 GLN HE22 H  30.426 26.663  24.051 1.00 . B B . 22 GLN HE22 1 1 
        3  7057 2 1 22 GLN HG2  H  28.717 27.547  27.646 1.00 . B B . 22 GLN HG2  1 1 
        3  7058 2 1 22 GLN HG3  H  28.791 25.873  27.098 1.00 . B B . 22 GLN HG3  1 1 
        3  7059 2 1 22 GLN N    N  26.357 25.167  27.910 1.00 . B B . 22 GLN N    1 1 
        3  7060 2 1 22 GLN NE2  N  29.864 26.400  24.810 1.00 . B B . 22 GLN NE2  1 1 
        3  7061 2 1 22 GLN O    O  24.150 27.855  27.752 1.00 . B B . 22 GLN O    1 1 
        3  7062 2 1 22 GLN OE1  O  29.723 28.489  25.480 1.00 . B B . 22 GLN OE1  1 1 
        3  7063 2 1 23 SER C    C  22.308 25.142  25.044 1.00 . B B . 23 SER C    1 1 
        3  7064 2 1 23 SER CA   C  22.731 26.222  26.033 1.00 . B B . 23 SER CA   1 1 
        3  7065 2 1 23 SER CB   C  22.536 27.603  25.388 1.00 . B B . 23 SER CB   1 1 
        3  7066 2 1 23 SER H    H  24.635 25.279  26.065 1.00 . B B . 23 SER H    1 1 
        3  7067 2 1 23 SER HA   H  22.106 26.153  26.914 1.00 . B B . 23 SER HA   1 1 
        3  7068 2 1 23 SER HB2  H  22.467 28.363  26.150 1.00 . B B . 23 SER HB2  1 1 
        3  7069 2 1 23 SER HB3  H  23.379 27.819  24.745 1.00 . B B . 23 SER HB3  1 1 
        3  7070 2 1 23 SER HG   H  20.830 26.823  24.872 1.00 . B B . 23 SER HG   1 1 
        3  7071 2 1 23 SER N    N  24.128 26.037  26.425 1.00 . B B . 23 SER N    1 1 
        3  7072 2 1 23 SER O    O  22.066 25.425  23.871 1.00 . B B . 23 SER O    1 1 
        3  7073 2 1 23 SER OG   O  21.334 27.603  24.629 1.00 . B B . 23 SER OG   1 1 
        3  7074 2 1 24 GLU C    C  21.344 21.607  25.501 1.00 . B B . 24 GLU C    1 1 
        3  7075 2 1 24 GLU CA   C  21.822 22.796  24.658 1.00 . B B . 24 GLU CA   1 1 
        3  7076 2 1 24 GLU CB   C  23.009 22.393  23.753 1.00 . B B . 24 GLU CB   1 1 
        3  7077 2 1 24 GLU CD   C  21.829 22.626  21.547 1.00 . B B . 24 GLU CD   1 1 
        3  7078 2 1 24 GLU CG   C  22.496 21.641  22.506 1.00 . B B . 24 GLU CG   1 1 
        3  7079 2 1 24 GLU H    H  22.427 23.738  26.466 1.00 . B B . 24 GLU H    1 1 
        3  7080 2 1 24 GLU HA   H  20.997 23.120  24.035 1.00 . B B . 24 GLU HA   1 1 
        3  7081 2 1 24 GLU HB2  H  23.536 23.287  23.447 1.00 . B B . 24 GLU HB2  1 1 
        3  7082 2 1 24 GLU HB3  H  23.690 21.758  24.303 1.00 . B B . 24 GLU HB3  1 1 
        3  7083 2 1 24 GLU HG2  H  23.328 21.164  22.004 1.00 . B B . 24 GLU HG2  1 1 
        3  7084 2 1 24 GLU HG3  H  21.779 20.890  22.801 1.00 . B B . 24 GLU HG3  1 1 
        3  7085 2 1 24 GLU N    N  22.222 23.905  25.522 1.00 . B B . 24 GLU N    1 1 
        3  7086 2 1 24 GLU O    O  20.524 21.771  26.403 1.00 . B B . 24 GLU O    1 1 
        3  7087 2 1 24 GLU OE1  O  22.345 23.724  21.415 1.00 . B B . 24 GLU OE1  1 1 
        3  7088 2 1 24 GLU OE2  O  20.819 22.272  20.961 1.00 . B B . 24 GLU OE2  1 1 
        3  7089 2 1 25 ASP C    C  22.521 18.123  25.728 1.00 . B B . 25 ASP C    1 1 
        3  7090 2 1 25 ASP CA   C  21.475 19.210  25.921 1.00 . B B . 25 ASP CA   1 1 
        3  7091 2 1 25 ASP CB   C  20.119 18.706  25.403 1.00 . B B . 25 ASP CB   1 1 
        3  7092 2 1 25 ASP CG   C  19.011 19.672  25.812 1.00 . B B . 25 ASP CG   1 1 
        3  7093 2 1 25 ASP H    H  22.511 20.349  24.469 1.00 . B B . 25 ASP H    1 1 
        3  7094 2 1 25 ASP HA   H  21.394 19.429  26.975 1.00 . B B . 25 ASP HA   1 1 
        3  7095 2 1 25 ASP HB2  H  20.157 18.634  24.323 1.00 . B B . 25 ASP HB2  1 1 
        3  7096 2 1 25 ASP HB3  H  19.908 17.730  25.819 1.00 . B B . 25 ASP HB3  1 1 
        3  7097 2 1 25 ASP N    N  21.860 20.420  25.199 1.00 . B B . 25 ASP N    1 1 
        3  7098 2 1 25 ASP O    O  23.591 18.356  25.165 1.00 . B B . 25 ASP O    1 1 
        3  7099 2 1 25 ASP OD1  O  18.911 19.953  26.995 1.00 . B B . 25 ASP OD1  1 1 
        3  7100 2 1 25 ASP OD2  O  18.298 20.135  24.938 1.00 . B B . 25 ASP OD2  1 1 
        3  7101 2 1 26 LYS C    C  23.051 15.227  24.643 1.00 . B B . 26 LYS C    1 1 
        3  7102 2 1 26 LYS CA   C  23.111 15.796  26.069 1.00 . B B . 26 LYS CA   1 1 
        3  7103 2 1 26 LYS CB   C  22.757 14.728  27.113 1.00 . B B . 26 LYS CB   1 1 
        3  7104 2 1 26 LYS CD   C  23.518 12.614  28.242 1.00 . B B . 26 LYS CD   1 1 
        3  7105 2 1 26 LYS CE   C  22.181 11.887  27.966 1.00 . B B . 26 LYS CE   1 1 
        3  7106 2 1 26 LYS CG   C  23.830 13.631  27.130 1.00 . B B . 26 LYS CG   1 1 
        3  7107 2 1 26 LYS H    H  21.330 16.796  26.638 1.00 . B B . 26 LYS H    1 1 
        3  7108 2 1 26 LYS HA   H  24.120 16.137  26.260 1.00 . B B . 26 LYS HA   1 1 
        3  7109 2 1 26 LYS HB2  H  22.708 15.190  28.089 1.00 . B B . 26 LYS HB2  1 1 
        3  7110 2 1 26 LYS HB3  H  21.800 14.299  26.873 1.00 . B B . 26 LYS HB3  1 1 
        3  7111 2 1 26 LYS HD2  H  24.319 11.887  28.287 1.00 . B B . 26 LYS HD2  1 1 
        3  7112 2 1 26 LYS HD3  H  23.453 13.128  29.187 1.00 . B B . 26 LYS HD3  1 1 
        3  7113 2 1 26 LYS HE2  H  22.040 11.750  26.902 1.00 . B B . 26 LYS HE2  1 1 
        3  7114 2 1 26 LYS HE3  H  22.190 10.917  28.448 1.00 . B B . 26 LYS HE3  1 1 
        3  7115 2 1 26 LYS HG2  H  23.854 13.128  26.176 1.00 . B B . 26 LYS HG2  1 1 
        3  7116 2 1 26 LYS HG3  H  24.796 14.082  27.320 1.00 . B B . 26 LYS HG3  1 1 
        3  7117 2 1 26 LYS HZ1  H  20.621 12.183  29.317 1.00 . B B . 26 LYS HZ1  1 1 
        3  7118 2 1 26 LYS HZ2  H  20.336 12.837  27.778 1.00 . B B . 26 LYS HZ2  1 1 
        3  7119 2 1 26 LYS HZ3  H  21.406 13.613  28.844 1.00 . B B . 26 LYS HZ3  1 1 
        3  7120 2 1 26 LYS N    N  22.197 16.923  26.198 1.00 . B B . 26 LYS N    1 1 
        3  7121 2 1 26 LYS NZ   N  21.051 12.691  28.519 1.00 . B B . 26 LYS NZ   1 1 
        3  7122 2 1 26 LYS O    O  23.580 15.840  23.715 1.00 . B B . 26 LYS O    1 1 
        3  7123 2 1 27 ILE C    C  21.476 14.299  22.234 1.00 . B B . 27 ILE C    1 1 
        3  7124 2 1 27 ILE CA   C  22.321 13.442  23.170 1.00 . B B . 27 ILE CA   1 1 
        3  7125 2 1 27 ILE CB   C  21.709 12.048  23.312 1.00 . B B . 27 ILE CB   1 1 
        3  7126 2 1 27 ILE CD1  C  21.404  9.856  22.127 1.00 . B B . 27 ILE CD1  1 1 
        3  7127 2 1 27 ILE CG1  C  21.706 11.344  21.941 1.00 . B B . 27 ILE CG1  1 1 
        3  7128 2 1 27 ILE CG2  C  20.276 12.157  23.849 1.00 . B B . 27 ILE CG2  1 1 
        3  7129 2 1 27 ILE H    H  22.025 13.622  25.258 1.00 . B B . 27 ILE H    1 1 
        3  7130 2 1 27 ILE HA   H  23.308 13.335  22.748 1.00 . B B . 27 ILE HA   1 1 
        3  7131 2 1 27 ILE HB   H  22.304 11.477  24.008 1.00 . B B . 27 ILE HB   1 1 
        3  7132 2 1 27 ILE HD11 H  20.530  9.736  22.748 1.00 . B B . 27 ILE HD11 1 1 
        3  7133 2 1 27 ILE HD12 H  22.250  9.382  22.599 1.00 . B B . 27 ILE HD12 1 1 
        3  7134 2 1 27 ILE HD13 H  21.228  9.403  21.165 1.00 . B B . 27 ILE HD13 1 1 
        3  7135 2 1 27 ILE HG12 H  20.953 11.788  21.306 1.00 . B B . 27 ILE HG12 1 1 
        3  7136 2 1 27 ILE HG13 H  22.675 11.449  21.471 1.00 . B B . 27 ILE HG13 1 1 
        3  7137 2 1 27 ILE HG21 H  20.263 12.798  24.720 1.00 . B B . 27 ILE HG21 1 1 
        3  7138 2 1 27 ILE HG22 H  19.921 11.175  24.121 1.00 . B B . 27 ILE HG22 1 1 
        3  7139 2 1 27 ILE HG23 H  19.633 12.573  23.086 1.00 . B B . 27 ILE HG23 1 1 
        3  7140 2 1 27 ILE N    N  22.428 14.065  24.482 1.00 . B B . 27 ILE N    1 1 
        3  7141 2 1 27 ILE O    O  21.713 14.329  21.026 1.00 . B B . 27 ILE O    1 1 
        3  7142 2 1 28 HIS C    C  20.412 17.028  21.418 1.00 . B B . 28 HIS C    1 1 
        3  7143 2 1 28 HIS CA   C  19.620 15.846  21.996 1.00 . B B . 28 HIS CA   1 1 
        3  7144 2 1 28 HIS CB   C  18.456 16.352  22.860 1.00 . B B . 28 HIS CB   1 1 
        3  7145 2 1 28 HIS CD2  C  17.146 14.651  24.383 1.00 . B B . 28 HIS CD2  1 1 
        3  7146 2 1 28 HIS CE1  C  16.089 13.581  22.823 1.00 . B B . 28 HIS CE1  1 1 
        3  7147 2 1 28 HIS CG   C  17.526 15.211  23.189 1.00 . B B . 28 HIS CG   1 1 
        3  7148 2 1 28 HIS H    H  20.346 14.925  23.762 1.00 . B B . 28 HIS H    1 1 
        3  7149 2 1 28 HIS HA   H  19.219 15.269  21.172 1.00 . B B . 28 HIS HA   1 1 
        3  7150 2 1 28 HIS HB2  H  18.848 16.761  23.776 1.00 . B B . 28 HIS HB2  1 1 
        3  7151 2 1 28 HIS HB3  H  17.911 17.119  22.327 1.00 . B B . 28 HIS HB3  1 1 
        3  7152 2 1 28 HIS HD1  H  16.895 14.667  21.241 1.00 . B B . 28 HIS HD1  1 1 
        3  7153 2 1 28 HIS HD2  H  17.499 14.959  25.356 1.00 . B B . 28 HIS HD2  1 1 
        3  7154 2 1 28 HIS HE1  H  15.446 12.883  22.307 1.00 . B B . 28 HIS HE1  1 1 
        3  7155 2 1 28 HIS HE2  H  15.804 13.048  24.815 1.00 . B B . 28 HIS HE2  1 1 
        3  7156 2 1 28 HIS N    N  20.488 14.988  22.795 1.00 . B B . 28 HIS N    1 1 
        3  7157 2 1 28 HIS ND1  N  16.840 14.513  22.208 1.00 . B B . 28 HIS ND1  1 1 
        3  7158 2 1 28 HIS NE2  N  16.238 13.622  24.150 1.00 . B B . 28 HIS NE2  1 1 
        3  7159 2 1 28 HIS O    O  19.832 17.937  20.826 1.00 . B B . 28 HIS O    1 1 
        3  7160 2 1 29 ALA C    C  22.801 17.899  19.563 1.00 . B B . 29 ALA C    1 1 
        3  7161 2 1 29 ALA CA   C  22.601 18.059  21.066 1.00 . B B . 29 ALA CA   1 1 
        3  7162 2 1 29 ALA CB   C  23.965 18.007  21.765 1.00 . B B . 29 ALA CB   1 1 
        3  7163 2 1 29 ALA H    H  22.138 16.249  22.067 1.00 . B B . 29 ALA H    1 1 
        3  7164 2 1 29 ALA HA   H  22.148 19.022  21.258 1.00 . B B . 29 ALA HA   1 1 
        3  7165 2 1 29 ALA HB1  H  24.397 17.025  21.642 1.00 . B B . 29 ALA HB1  1 1 
        3  7166 2 1 29 ALA HB2  H  23.839 18.214  22.815 1.00 . B B . 29 ALA HB2  1 1 
        3  7167 2 1 29 ALA HB3  H  24.621 18.747  21.330 1.00 . B B . 29 ALA HB3  1 1 
        3  7168 2 1 29 ALA N    N  21.730 16.999  21.586 1.00 . B B . 29 ALA N    1 1 
        3  7169 2 1 29 ALA O    O  22.771 18.871  18.807 1.00 . B B . 29 ALA O    1 1 
        3  7170 2 1 30 MET C    C  22.024 16.801  16.914 1.00 . B B . 30 MET C    1 1 
        3  7171 2 1 30 MET CA   C  23.230 16.365  17.734 1.00 . B B . 30 MET CA   1 1 
        3  7172 2 1 30 MET CB   C  23.470 14.852  17.547 1.00 . B B . 30 MET CB   1 1 
        3  7173 2 1 30 MET CE   C  20.839 11.778  18.484 1.00 . B B . 30 MET CE   1 1 
        3  7174 2 1 30 MET CG   C  22.165 14.066  17.811 1.00 . B B . 30 MET CG   1 1 
        3  7175 2 1 30 MET H    H  23.030 15.923  19.786 1.00 . B B . 30 MET H    1 1 
        3  7176 2 1 30 MET HA   H  24.103 16.901  17.391 1.00 . B B . 30 MET HA   1 1 
        3  7177 2 1 30 MET HB2  H  23.804 14.668  16.534 1.00 . B B . 30 MET HB2  1 1 
        3  7178 2 1 30 MET HB3  H  24.232 14.521  18.237 1.00 . B B . 30 MET HB3  1 1 
        3  7179 2 1 30 MET HE1  H  20.302 12.556  19.008 1.00 . B B . 30 MET HE1  1 1 
        3  7180 2 1 30 MET HE2  H  20.859 10.881  19.089 1.00 . B B . 30 MET HE2  1 1 
        3  7181 2 1 30 MET HE3  H  20.337 11.567  17.553 1.00 . B B . 30 MET HE3  1 1 
        3  7182 2 1 30 MET HG2  H  21.656 14.486  18.661 1.00 . B B . 30 MET HG2  1 1 
        3  7183 2 1 30 MET HG3  H  21.524 14.129  16.943 1.00 . B B . 30 MET HG3  1 1 
        3  7184 2 1 30 MET N    N  23.018 16.659  19.139 1.00 . B B . 30 MET N    1 1 
        3  7185 2 1 30 MET O    O  22.182 17.452  15.881 1.00 . B B . 30 MET O    1 1 
        3  7186 2 1 30 MET SD   S  22.539 12.328  18.151 1.00 . B B . 30 MET SD   1 1 
        3  7187 2 1 31 ASN C    C  19.577 18.316  16.384 1.00 . B B . 31 ASN C    1 1 
        3  7188 2 1 31 ASN CA   C  19.617 16.812  16.640 1.00 . B B . 31 ASN CA   1 1 
        3  7189 2 1 31 ASN CB   C  18.386 16.408  17.452 1.00 . B B . 31 ASN CB   1 1 
        3  7190 2 1 31 ASN CG   C  18.429 14.915  17.759 1.00 . B B . 31 ASN CG   1 1 
        3  7191 2 1 31 ASN H    H  20.762 15.932  18.201 1.00 . B B . 31 ASN H    1 1 
        3  7192 2 1 31 ASN HA   H  19.603 16.289  15.697 1.00 . B B . 31 ASN HA   1 1 
        3  7193 2 1 31 ASN HB2  H  18.372 16.963  18.379 1.00 . B B . 31 ASN HB2  1 1 
        3  7194 2 1 31 ASN HB3  H  17.494 16.631  16.887 1.00 . B B . 31 ASN HB3  1 1 
        3  7195 2 1 31 ASN HD21 H  18.254 14.373  15.858 1.00 . B B . 31 ASN HD21 1 1 
        3  7196 2 1 31 ASN HD22 H  18.367 13.095  16.969 1.00 . B B . 31 ASN HD22 1 1 
        3  7197 2 1 31 ASN N    N  20.827 16.450  17.372 1.00 . B B . 31 ASN N    1 1 
        3  7198 2 1 31 ASN ND2  N  18.343 14.057  16.780 1.00 . B B . 31 ASN ND2  1 1 
        3  7199 2 1 31 ASN O    O  19.253 18.751  15.279 1.00 . B B . 31 ASN O    1 1 
        3  7200 2 1 31 ASN OD1  O  18.534 14.521  18.920 1.00 . B B . 31 ASN OD1  1 1 
        3  7201 2 1 32 SER C    C  21.070 20.995  16.332 1.00 . B B . 32 SER C    1 1 
        3  7202 2 1 32 SER CA   C  19.925 20.552  17.241 1.00 . B B . 32 SER CA   1 1 
        3  7203 2 1 32 SER CB   C  20.099 21.206  18.605 1.00 . B B . 32 SER CB   1 1 
        3  7204 2 1 32 SER H    H  20.171 18.700  18.256 1.00 . B B . 32 SER H    1 1 
        3  7205 2 1 32 SER HA   H  18.985 20.871  16.815 1.00 . B B . 32 SER HA   1 1 
        3  7206 2 1 32 SER HB2  H  20.125 22.277  18.495 1.00 . B B . 32 SER HB2  1 1 
        3  7207 2 1 32 SER HB3  H  19.271 20.930  19.245 1.00 . B B . 32 SER HB3  1 1 
        3  7208 2 1 32 SER HG   H  21.144 20.458  20.065 1.00 . B B . 32 SER HG   1 1 
        3  7209 2 1 32 SER N    N  19.922 19.102  17.398 1.00 . B B . 32 SER N    1 1 
        3  7210 2 1 32 SER O    O  20.852 21.674  15.328 1.00 . B B . 32 SER O    1 1 
        3  7211 2 1 32 SER OG   O  21.323 20.762  19.172 1.00 . B B . 32 SER OG   1 1 
        3  7212 2 1 33 TYR C    C  23.349 20.419  14.476 1.00 . B B . 33 TYR C    1 1 
        3  7213 2 1 33 TYR CA   C  23.468 20.959  15.908 1.00 . B B . 33 TYR CA   1 1 
        3  7214 2 1 33 TYR CB   C  24.720 20.371  16.576 1.00 . B B . 33 TYR CB   1 1 
        3  7215 2 1 33 TYR CD1  C  26.265 19.893  14.644 1.00 . B B . 33 TYR CD1  1 1 
        3  7216 2 1 33 TYR CD2  C  26.714 21.827  16.036 1.00 . B B . 33 TYR CD2  1 1 
        3  7217 2 1 33 TYR CE1  C  27.378 20.204  13.854 1.00 . B B . 33 TYR CE1  1 1 
        3  7218 2 1 33 TYR CE2  C  27.827 22.138  15.246 1.00 . B B . 33 TYR CE2  1 1 
        3  7219 2 1 33 TYR CG   C  25.933 20.705  15.736 1.00 . B B . 33 TYR CG   1 1 
        3  7220 2 1 33 TYR CZ   C  28.159 21.326  14.154 1.00 . B B . 33 TYR CZ   1 1 
        3  7221 2 1 33 TYR H    H  22.401 20.064  17.501 1.00 . B B . 33 TYR H    1 1 
        3  7222 2 1 33 TYR HA   H  23.560 22.033  15.875 1.00 . B B . 33 TYR HA   1 1 
        3  7223 2 1 33 TYR HB2  H  24.834 20.788  17.568 1.00 . B B . 33 TYR HB2  1 1 
        3  7224 2 1 33 TYR HB3  H  24.619 19.295  16.653 1.00 . B B . 33 TYR HB3  1 1 
        3  7225 2 1 33 TYR HD1  H  25.662 19.023  14.421 1.00 . B B . 33 TYR HD1  1 1 
        3  7226 2 1 33 TYR HD2  H  26.458 22.452  16.877 1.00 . B B . 33 TYR HD2  1 1 
        3  7227 2 1 33 TYR HE1  H  27.635 19.578  13.013 1.00 . B B . 33 TYR HE1  1 1 
        3  7228 2 1 33 TYR HE2  H  28.431 23.002  15.477 1.00 . B B . 33 TYR HE2  1 1 
        3  7229 2 1 33 TYR HH   H  28.952 22.143  12.624 1.00 . B B . 33 TYR HH   1 1 
        3  7230 2 1 33 TYR N    N  22.288 20.603  16.691 1.00 . B B . 33 TYR N    1 1 
        3  7231 2 1 33 TYR O    O  23.612 21.126  13.504 1.00 . B B . 33 TYR O    1 1 
        3  7232 2 1 33 TYR OH   O  29.256 21.634  13.379 1.00 . B B . 33 TYR OH   1 1 
        3  7233 2 1 34 TYR C    C  21.856 19.332  12.184 1.00 . B B . 34 TYR C    1 1 
        3  7234 2 1 34 TYR CA   C  22.800 18.517  13.060 1.00 . B B . 34 TYR CA   1 1 
        3  7235 2 1 34 TYR CB   C  22.246 17.089  13.233 1.00 . B B . 34 TYR CB   1 1 
        3  7236 2 1 34 TYR CD1  C  20.854 16.601  11.189 1.00 . B B . 34 TYR CD1  1 1 
        3  7237 2 1 34 TYR CD2  C  23.096 15.685  11.307 1.00 . B B . 34 TYR CD2  1 1 
        3  7238 2 1 34 TYR CE1  C  20.681 16.016   9.930 1.00 . B B . 34 TYR CE1  1 1 
        3  7239 2 1 34 TYR CE2  C  22.923 15.099  10.047 1.00 . B B . 34 TYR CE2  1 1 
        3  7240 2 1 34 TYR CG   C  22.062 16.436  11.878 1.00 . B B . 34 TYR CG   1 1 
        3  7241 2 1 34 TYR CZ   C  21.715 15.265   9.359 1.00 . B B . 34 TYR CZ   1 1 
        3  7242 2 1 34 TYR H    H  22.752 18.641  15.177 1.00 . B B . 34 TYR H    1 1 
        3  7243 2 1 34 TYR HA   H  23.767 18.462  12.582 1.00 . B B . 34 TYR HA   1 1 
        3  7244 2 1 34 TYR HB2  H  22.936 16.504  13.823 1.00 . B B . 34 TYR HB2  1 1 
        3  7245 2 1 34 TYR HB3  H  21.291 17.136  13.737 1.00 . B B . 34 TYR HB3  1 1 
        3  7246 2 1 34 TYR HD1  H  20.056 17.180  11.631 1.00 . B B . 34 TYR HD1  1 1 
        3  7247 2 1 34 TYR HD2  H  24.029 15.551  11.845 1.00 . B B . 34 TYR HD2  1 1 
        3  7248 2 1 34 TYR HE1  H  19.752 16.146   9.398 1.00 . B B . 34 TYR HE1  1 1 
        3  7249 2 1 34 TYR HE2  H  23.718 14.524   9.604 1.00 . B B . 34 TYR HE2  1 1 
        3  7250 2 1 34 TYR HH   H  22.093 15.158   7.489 1.00 . B B . 34 TYR HH   1 1 
        3  7251 2 1 34 TYR N    N  22.948 19.157  14.366 1.00 . B B . 34 TYR N    1 1 
        3  7252 2 1 34 TYR O    O  22.168 19.623  11.030 1.00 . B B . 34 TYR O    1 1 
        3  7253 2 1 34 TYR OH   O  21.544 14.685   8.117 1.00 . B B . 34 TYR OH   1 1 
        3  7254 2 1 35 ARG C    C  20.220 21.918  11.817 1.00 . B B . 35 ARG C    1 1 
        3  7255 2 1 35 ARG CA   C  19.724 20.486  11.999 1.00 . B B . 35 ARG CA   1 1 
        3  7256 2 1 35 ARG CB   C  18.386 20.489  12.740 1.00 . B B . 35 ARG CB   1 1 
        3  7257 2 1 35 ARG CD   C  15.967 21.088  12.565 1.00 . B B . 35 ARG CD   1 1 
        3  7258 2 1 35 ARG CG   C  17.334 21.216  11.896 1.00 . B B . 35 ARG CG   1 1 
        3  7259 2 1 35 ARG CZ   C  14.426 19.321  13.192 1.00 . B B . 35 ARG CZ   1 1 
        3  7260 2 1 35 ARG H    H  20.509 19.439  13.661 1.00 . B B . 35 ARG H    1 1 
        3  7261 2 1 35 ARG HA   H  19.579 20.042  11.023 1.00 . B B . 35 ARG HA   1 1 
        3  7262 2 1 35 ARG HB2  H  18.069 19.470  12.915 1.00 . B B . 35 ARG HB2  1 1 
        3  7263 2 1 35 ARG HB3  H  18.500 20.997  13.686 1.00 . B B . 35 ARG HB3  1 1 
        3  7264 2 1 35 ARG HD2  H  16.032 21.439  13.583 1.00 . B B . 35 ARG HD2  1 1 
        3  7265 2 1 35 ARG HD3  H  15.249 21.688  12.025 1.00 . B B . 35 ARG HD3  1 1 
        3  7266 2 1 35 ARG HE   H  16.074 19.025  12.091 1.00 . B B . 35 ARG HE   1 1 
        3  7267 2 1 35 ARG HG2  H  17.594 22.261  11.812 1.00 . B B . 35 ARG HG2  1 1 
        3  7268 2 1 35 ARG HG3  H  17.292 20.774  10.912 1.00 . B B . 35 ARG HG3  1 1 
        3  7269 2 1 35 ARG HH11 H  13.981 21.167  13.826 1.00 . B B . 35 ARG HH11 1 1 
        3  7270 2 1 35 ARG HH12 H  12.868 19.924  14.293 1.00 . B B . 35 ARG HH12 1 1 
        3  7271 2 1 35 ARG HH21 H  14.620 17.390  12.701 1.00 . B B . 35 ARG HH21 1 1 
        3  7272 2 1 35 ARG HH22 H  13.230 17.785  13.656 1.00 . B B . 35 ARG HH22 1 1 
        3  7273 2 1 35 ARG N    N  20.704 19.699  12.737 1.00 . B B . 35 ARG N    1 1 
        3  7274 2 1 35 ARG NE   N  15.535 19.696  12.562 1.00 . B B . 35 ARG NE   1 1 
        3  7275 2 1 35 ARG NH1  N  13.701 20.206  13.819 1.00 . B B . 35 ARG NH1  1 1 
        3  7276 2 1 35 ARG NH2  N  14.063 18.068  13.183 1.00 . B B . 35 ARG NH2  1 1 
        3  7277 2 1 35 ARG O    O  19.799 22.613  10.892 1.00 . B B . 35 ARG O    1 1 
        3  7278 2 1 36 SER C    C  22.565 23.852  11.419 1.00 . B B . 36 SER C    1 1 
        3  7279 2 1 36 SER CA   C  21.647 23.709  12.626 1.00 . B B . 36 SER CA   1 1 
        3  7280 2 1 36 SER CB   C  22.421 24.047  13.904 1.00 . B B . 36 SER CB   1 1 
        3  7281 2 1 36 SER H    H  21.409 21.755  13.419 1.00 . B B . 36 SER H    1 1 
        3  7282 2 1 36 SER HA   H  20.828 24.406  12.527 1.00 . B B . 36 SER HA   1 1 
        3  7283 2 1 36 SER HB2  H  21.807 23.846  14.767 1.00 . B B . 36 SER HB2  1 1 
        3  7284 2 1 36 SER HB3  H  23.316 23.444  13.954 1.00 . B B . 36 SER HB3  1 1 
        3  7285 2 1 36 SER HG   H  23.323 25.601  14.653 1.00 . B B . 36 SER HG   1 1 
        3  7286 2 1 36 SER N    N  21.110 22.353  12.702 1.00 . B B . 36 SER N    1 1 
        3  7287 2 1 36 SER O    O  22.418 24.776  10.619 1.00 . B B . 36 SER O    1 1 
        3  7288 2 1 36 SER OG   O  22.769 25.425  13.888 1.00 . B B . 36 SER OG   1 1 
        3  7289 2 1 37 VAL C    C  23.717 22.686   8.855 1.00 . B B . 37 VAL C    1 1 
        3  7290 2 1 37 VAL CA   C  24.446 22.984  10.173 1.00 . B B . 37 VAL CA   1 1 
        3  7291 2 1 37 VAL CB   C  25.580 21.950  10.383 1.00 . B B . 37 VAL CB   1 1 
        3  7292 2 1 37 VAL CG1  C  26.383 21.765   9.073 1.00 . B B . 37 VAL CG1  1 1 
        3  7293 2 1 37 VAL CG2  C  26.517 22.425  11.510 1.00 . B B . 37 VAL CG2  1 1 
        3  7294 2 1 37 VAL H    H  23.586 22.218  11.962 1.00 . B B . 37 VAL H    1 1 
        3  7295 2 1 37 VAL HA   H  24.881 23.972  10.115 1.00 . B B . 37 VAL HA   1 1 
        3  7296 2 1 37 VAL HB   H  25.141 21.003  10.666 1.00 . B B . 37 VAL HB   1 1 
        3  7297 2 1 37 VAL HG11 H  27.336 21.321   9.280 1.00 . B B . 37 VAL HG11 1 1 
        3  7298 2 1 37 VAL HG12 H  26.535 22.724   8.600 1.00 . B B . 37 VAL HG12 1 1 
        3  7299 2 1 37 VAL HG13 H  25.827 21.119   8.402 1.00 . B B . 37 VAL HG13 1 1 
        3  7300 2 1 37 VAL HG21 H  25.966 22.478  12.437 1.00 . B B . 37 VAL HG21 1 1 
        3  7301 2 1 37 VAL HG22 H  26.913 23.401  11.267 1.00 . B B . 37 VAL HG22 1 1 
        3  7302 2 1 37 VAL HG23 H  27.333 21.724  11.618 1.00 . B B . 37 VAL HG23 1 1 
        3  7303 2 1 37 VAL N    N  23.516 22.931  11.294 1.00 . B B . 37 VAL N    1 1 
        3  7304 2 1 37 VAL O    O  23.754 23.491   7.925 1.00 . B B . 37 VAL O    1 1 
        3  7305 2 1 38 VAL C    C  21.473 22.294   7.076 1.00 . B B . 38 VAL C    1 1 
        3  7306 2 1 38 VAL CA   C  22.354 21.142   7.565 1.00 . B B . 38 VAL CA   1 1 
        3  7307 2 1 38 VAL CB   C  21.497 19.894   7.848 1.00 . B B . 38 VAL CB   1 1 
        3  7308 2 1 38 VAL CG1  C  20.610 19.556   6.634 1.00 . B B . 38 VAL CG1  1 1 
        3  7309 2 1 38 VAL CG2  C  22.424 18.711   8.147 1.00 . B B . 38 VAL CG2  1 1 
        3  7310 2 1 38 VAL H    H  23.072 20.927   9.559 1.00 . B B . 38 VAL H    1 1 
        3  7311 2 1 38 VAL HA   H  23.073 20.905   6.795 1.00 . B B . 38 VAL HA   1 1 
        3  7312 2 1 38 VAL HB   H  20.867 20.082   8.706 1.00 . B B . 38 VAL HB   1 1 
        3  7313 2 1 38 VAL HG11 H  21.207 19.574   5.734 1.00 . B B . 38 VAL HG11 1 1 
        3  7314 2 1 38 VAL HG12 H  19.816 20.285   6.551 1.00 . B B . 38 VAL HG12 1 1 
        3  7315 2 1 38 VAL HG13 H  20.177 18.573   6.760 1.00 . B B . 38 VAL HG13 1 1 
        3  7316 2 1 38 VAL HG21 H  22.966 18.448   7.255 1.00 . B B . 38 VAL HG21 1 1 
        3  7317 2 1 38 VAL HG22 H  21.836 17.870   8.468 1.00 . B B . 38 VAL HG22 1 1 
        3  7318 2 1 38 VAL HG23 H  23.124 18.983   8.924 1.00 . B B . 38 VAL HG23 1 1 
        3  7319 2 1 38 VAL N    N  23.067 21.529   8.786 1.00 . B B . 38 VAL N    1 1 
        3  7320 2 1 38 VAL O    O  21.531 22.657   5.901 1.00 . B B . 38 VAL O    1 1 
        3  7321 2 1 39 SER C    C  20.640 25.133   7.047 1.00 . B B . 39 SER C    1 1 
        3  7322 2 1 39 SER CA   C  19.810 23.976   7.608 1.00 . B B . 39 SER CA   1 1 
        3  7323 2 1 39 SER CB   C  19.028 24.443   8.838 1.00 . B B . 39 SER CB   1 1 
        3  7324 2 1 39 SER H    H  20.670 22.534   8.894 1.00 . B B . 39 SER H    1 1 
        3  7325 2 1 39 SER HA   H  19.111 23.646   6.854 1.00 . B B . 39 SER HA   1 1 
        3  7326 2 1 39 SER HB2  H  19.713 24.685   9.633 1.00 . B B . 39 SER HB2  1 1 
        3  7327 2 1 39 SER HB3  H  18.450 25.322   8.585 1.00 . B B . 39 SER HB3  1 1 
        3  7328 2 1 39 SER HG   H  18.331 23.238  10.201 1.00 . B B . 39 SER HG   1 1 
        3  7329 2 1 39 SER N    N  20.674 22.865   7.972 1.00 . B B . 39 SER N    1 1 
        3  7330 2 1 39 SER O    O  20.204 25.831   6.132 1.00 . B B . 39 SER O    1 1 
        3  7331 2 1 39 SER OG   O  18.163 23.399   9.269 1.00 . B B . 39 SER OG   1 1 
        3  7332 2 1 40 THR C    C  23.300 26.101   5.773 1.00 . B B . 40 THR C    1 1 
        3  7333 2 1 40 THR CA   C  22.714 26.410   7.151 1.00 . B B . 40 THR CA   1 1 
        3  7334 2 1 40 THR CB   C  23.862 26.598   8.151 1.00 . B B . 40 THR CB   1 1 
        3  7335 2 1 40 THR CG2  C  24.680 27.834   7.779 1.00 . B B . 40 THR CG2  1 1 
        3  7336 2 1 40 THR H    H  22.125 24.746   8.333 1.00 . B B . 40 THR H    1 1 
        3  7337 2 1 40 THR HA   H  22.149 27.329   7.094 1.00 . B B . 40 THR HA   1 1 
        3  7338 2 1 40 THR HB   H  24.506 25.734   8.123 1.00 . B B . 40 THR HB   1 1 
        3  7339 2 1 40 THR HG1  H  23.893 27.365   9.937 1.00 . B B . 40 THR HG1  1 1 
        3  7340 2 1 40 THR HG21 H  25.163 27.671   6.826 1.00 . B B . 40 THR HG21 1 1 
        3  7341 2 1 40 THR HG22 H  25.429 28.008   8.536 1.00 . B B . 40 THR HG22 1 1 
        3  7342 2 1 40 THR HG23 H  24.028 28.692   7.714 1.00 . B B . 40 THR HG23 1 1 
        3  7343 2 1 40 THR N    N  21.829 25.334   7.607 1.00 . B B . 40 THR N    1 1 
        3  7344 2 1 40 THR O    O  23.249 26.929   4.863 1.00 . B B . 40 THR O    1 1 
        3  7345 2 1 40 THR OG1  O  23.336 26.744   9.462 1.00 . B B . 40 THR OG1  1 1 
        3  7346 2 1 41 LEU C    C  23.469 24.681   3.212 1.00 . B B . 41 LEU C    1 1 
        3  7347 2 1 41 LEU CA   C  24.460 24.491   4.363 1.00 . B B . 41 LEU CA   1 1 
        3  7348 2 1 41 LEU CB   C  24.885 23.023   4.448 1.00 . B B . 41 LEU CB   1 1 
        3  7349 2 1 41 LEU CD1  C  26.239 21.323   5.674 1.00 . B B . 41 LEU CD1  1 1 
        3  7350 2 1 41 LEU CD2  C  27.292 23.536   5.119 1.00 . B B . 41 LEU CD2  1 1 
        3  7351 2 1 41 LEU CG   C  25.977 22.824   5.518 1.00 . B B . 41 LEU CG   1 1 
        3  7352 2 1 41 LEU H    H  23.864 24.282   6.389 1.00 . B B . 41 LEU H    1 1 
        3  7353 2 1 41 LEU HA   H  25.325 25.101   4.170 1.00 . B B . 41 LEU HA   1 1 
        3  7354 2 1 41 LEU HB2  H  24.025 22.427   4.708 1.00 . B B . 41 LEU HB2  1 1 
        3  7355 2 1 41 LEU HB3  H  25.263 22.703   3.489 1.00 . B B . 41 LEU HB3  1 1 
        3  7356 2 1 41 LEU HD11 H  27.055 21.173   6.361 1.00 . B B . 41 LEU HD11 1 1 
        3  7357 2 1 41 LEU HD12 H  26.495 20.903   4.712 1.00 . B B . 41 LEU HD12 1 1 
        3  7358 2 1 41 LEU HD13 H  25.352 20.840   6.054 1.00 . B B . 41 LEU HD13 1 1 
        3  7359 2 1 41 LEU HD21 H  27.228 24.582   5.373 1.00 . B B . 41 LEU HD21 1 1 
        3  7360 2 1 41 LEU HD22 H  27.463 23.431   4.055 1.00 . B B . 41 LEU HD22 1 1 
        3  7361 2 1 41 LEU HD23 H  28.124 23.103   5.660 1.00 . B B . 41 LEU HD23 1 1 
        3  7362 2 1 41 LEU HG   H  25.627 23.221   6.458 1.00 . B B . 41 LEU HG   1 1 
        3  7363 2 1 41 LEU N    N  23.852 24.901   5.629 1.00 . B B . 41 LEU N    1 1 
        3  7364 2 1 41 LEU O    O  23.853 25.065   2.107 1.00 . B B . 41 LEU O    1 1 
        3  7365 2 1 42 VAL C    C  20.743 26.045   2.347 1.00 . B B . 42 VAL C    1 1 
        3  7366 2 1 42 VAL CA   C  21.140 24.582   2.473 1.00 . B B . 42 VAL CA   1 1 
        3  7367 2 1 42 VAL CB   C  19.915 23.737   2.843 1.00 . B B . 42 VAL CB   1 1 
        3  7368 2 1 42 VAL CG1  C  18.806 23.916   1.791 1.00 . B B . 42 VAL CG1  1 1 
        3  7369 2 1 42 VAL CG2  C  20.337 22.265   2.901 1.00 . B B . 42 VAL CG2  1 1 
        3  7370 2 1 42 VAL H    H  21.948 24.118   4.385 1.00 . B B . 42 VAL H    1 1 
        3  7371 2 1 42 VAL HA   H  21.512 24.245   1.514 1.00 . B B . 42 VAL HA   1 1 
        3  7372 2 1 42 VAL HB   H  19.548 24.050   3.807 1.00 . B B . 42 VAL HB   1 1 
        3  7373 2 1 42 VAL HG11 H  18.388 24.910   1.874 1.00 . B B . 42 VAL HG11 1 1 
        3  7374 2 1 42 VAL HG12 H  18.026 23.185   1.957 1.00 . B B . 42 VAL HG12 1 1 
        3  7375 2 1 42 VAL HG13 H  19.218 23.783   0.801 1.00 . B B . 42 VAL HG13 1 1 
        3  7376 2 1 42 VAL HG21 H  21.160 22.155   3.590 1.00 . B B . 42 VAL HG21 1 1 
        3  7377 2 1 42 VAL HG22 H  20.650 21.941   1.919 1.00 . B B . 42 VAL HG22 1 1 
        3  7378 2 1 42 VAL HG23 H  19.504 21.663   3.232 1.00 . B B . 42 VAL HG23 1 1 
        3  7379 2 1 42 VAL N    N  22.195 24.422   3.486 1.00 . B B . 42 VAL N    1 1 
        3  7380 2 1 42 VAL O    O  20.480 26.537   1.249 1.00 . B B . 42 VAL O    1 1 
        3  7381 2 1 43 GLN C    C  21.485 28.997   4.000 1.00 . B B . 43 GLN C    1 1 
        3  7382 2 1 43 GLN CA   C  20.316 28.153   3.517 1.00 . B B . 43 GLN CA   1 1 
        3  7383 2 1 43 GLN CB   C  19.108 28.356   4.446 1.00 . B B . 43 GLN CB   1 1 
        3  7384 2 1 43 GLN CD   C  17.362 30.002   5.195 1.00 . B B . 43 GLN CD   1 1 
        3  7385 2 1 43 GLN CG   C  18.614 29.806   4.344 1.00 . B B . 43 GLN CG   1 1 
        3  7386 2 1 43 GLN H    H  20.915 26.293   4.326 1.00 . B B . 43 GLN H    1 1 
        3  7387 2 1 43 GLN HA   H  20.042 28.490   2.525 1.00 . B B . 43 GLN HA   1 1 
        3  7388 2 1 43 GLN HB2  H  18.312 27.684   4.155 1.00 . B B . 43 GLN HB2  1 1 
        3  7389 2 1 43 GLN HB3  H  19.398 28.150   5.465 1.00 . B B . 43 GLN HB3  1 1 
        3  7390 2 1 43 GLN HE21 H  16.205 30.456   3.646 1.00 . B B . 43 GLN HE21 1 1 
        3  7391 2 1 43 GLN HE22 H  15.432 30.465   5.157 1.00 . B B . 43 GLN HE22 1 1 
        3  7392 2 1 43 GLN HG2  H  19.388 30.475   4.689 1.00 . B B . 43 GLN HG2  1 1 
        3  7393 2 1 43 GLN HG3  H  18.382 30.031   3.313 1.00 . B B . 43 GLN HG3  1 1 
        3  7394 2 1 43 GLN N    N  20.694 26.737   3.480 1.00 . B B . 43 GLN N    1 1 
        3  7395 2 1 43 GLN NE2  N  16.240 30.334   4.618 1.00 . B B . 43 GLN NE2  1 1 
        3  7396 2 1 43 GLN O    O  21.529 29.434   5.151 1.00 . B B . 43 GLN O    1 1 
        3  7397 2 1 43 GLN OE1  O  17.408 29.853   6.416 1.00 . B B . 43 GLN OE1  1 1 
        3  7398 2 1 44 ASP C    C  24.515 30.215   2.199 1.00 . B B . 44 ASP C    1 1 
        3  7399 2 1 44 ASP CA   C  23.613 30.063   3.421 1.00 . B B . 44 ASP CA   1 1 
        3  7400 2 1 44 ASP CB   C  24.444 29.434   4.557 1.00 . B B . 44 ASP CB   1 1 
        3  7401 2 1 44 ASP CG   C  25.527 30.408   5.019 1.00 . B B . 44 ASP CG   1 1 
        3  7402 2 1 44 ASP H    H  22.343 28.865   2.197 1.00 . B B . 44 ASP H    1 1 
        3  7403 2 1 44 ASP HA   H  23.282 31.044   3.733 1.00 . B B . 44 ASP HA   1 1 
        3  7404 2 1 44 ASP HB2  H  23.807 29.202   5.391 1.00 . B B . 44 ASP HB2  1 1 
        3  7405 2 1 44 ASP HB3  H  24.912 28.526   4.204 1.00 . B B . 44 ASP HB3  1 1 
        3  7406 2 1 44 ASP N    N  22.430 29.240   3.098 1.00 . B B . 44 ASP N    1 1 
        3  7407 2 1 44 ASP O    O  24.649 31.294   1.623 1.00 . B B . 44 ASP O    1 1 
        3  7408 2 1 44 ASP OD1  O  25.191 31.551   5.278 1.00 . B B . 44 ASP OD1  1 1 
        3  7409 2 1 44 ASP OD2  O  26.666 29.988   5.138 1.00 . B B . 44 ASP OD2  1 1 
        3  7410 2 1 45 GLN C    C  25.282 28.866  -0.625 1.00 . B B . 45 GLN C    1 1 
        3  7411 2 1 45 GLN CA   C  26.056 29.105   0.668 1.00 . B B . 45 GLN CA   1 1 
        3  7412 2 1 45 GLN CB   C  27.111 28.003   0.850 1.00 . B B . 45 GLN CB   1 1 
        3  7413 2 1 45 GLN CD   C  28.874 29.306  -0.378 1.00 . B B . 45 GLN CD   1 1 
        3  7414 2 1 45 GLN CG   C  28.096 27.992  -0.331 1.00 . B B . 45 GLN CG   1 1 
        3  7415 2 1 45 GLN H    H  25.001 28.276   2.317 1.00 . B B . 45 GLN H    1 1 
        3  7416 2 1 45 GLN HA   H  26.559 30.061   0.605 1.00 . B B . 45 GLN HA   1 1 
        3  7417 2 1 45 GLN HB2  H  27.655 28.178   1.768 1.00 . B B . 45 GLN HB2  1 1 
        3  7418 2 1 45 GLN HB3  H  26.616 27.047   0.907 1.00 . B B . 45 GLN HB3  1 1 
        3  7419 2 1 45 GLN HE21 H  28.828 29.456  -2.358 1.00 . B B . 45 GLN HE21 1 1 
        3  7420 2 1 45 GLN HE22 H  29.630 30.718  -1.554 1.00 . B B . 45 GLN HE22 1 1 
        3  7421 2 1 45 GLN HG2  H  28.788 27.174  -0.200 1.00 . B B . 45 GLN HG2  1 1 
        3  7422 2 1 45 GLN HG3  H  27.557 27.855  -1.256 1.00 . B B . 45 GLN HG3  1 1 
        3  7423 2 1 45 GLN N    N  25.146 29.108   1.820 1.00 . B B . 45 GLN N    1 1 
        3  7424 2 1 45 GLN NE2  N  29.133 29.873  -1.524 1.00 . B B . 45 GLN NE2  1 1 
        3  7425 2 1 45 GLN O    O  25.067 29.789  -1.411 1.00 . B B . 45 GLN O    1 1 
        3  7426 2 1 45 GLN OE1  O  29.242 29.836   0.671 1.00 . B B . 45 GLN OE1  1 1 
        3  7427 2 1 46 LEU C    C  25.041 27.332  -3.275 1.00 . B B . 46 LEU C    1 1 
        3  7428 2 1 46 LEU CA   C  24.125 27.257  -2.040 1.00 . B B . 46 LEU CA   1 1 
        3  7429 2 1 46 LEU CB   C  22.887 28.191  -2.186 1.00 . B B . 46 LEU CB   1 1 
        3  7430 2 1 46 LEU CD1  C  20.465 28.373  -2.793 1.00 . B B . 46 LEU CD1  1 1 
        3  7431 2 1 46 LEU CD2  C  21.975 26.940  -4.172 1.00 . B B . 46 LEU CD2  1 1 
        3  7432 2 1 46 LEU CG   C  21.673 27.434  -2.753 1.00 . B B . 46 LEU CG   1 1 
        3  7433 2 1 46 LEU H    H  25.069 26.927  -0.177 1.00 . B B . 46 LEU H    1 1 
        3  7434 2 1 46 LEU HA   H  23.794 26.233  -1.927 1.00 . B B . 46 LEU HA   1 1 
        3  7435 2 1 46 LEU HB2  H  22.625 28.575  -1.208 1.00 . B B . 46 LEU HB2  1 1 
        3  7436 2 1 46 LEU HB3  H  23.123 29.022  -2.836 1.00 . B B . 46 LEU HB3  1 1 
        3  7437 2 1 46 LEU HD11 H  20.692 29.225  -3.417 1.00 . B B . 46 LEU HD11 1 1 
        3  7438 2 1 46 LEU HD12 H  20.237 28.711  -1.793 1.00 . B B . 46 LEU HD12 1 1 
        3  7439 2 1 46 LEU HD13 H  19.611 27.849  -3.199 1.00 . B B . 46 LEU HD13 1 1 
        3  7440 2 1 46 LEU HD21 H  22.771 26.210  -4.140 1.00 . B B . 46 LEU HD21 1 1 
        3  7441 2 1 46 LEU HD22 H  22.274 27.775  -4.789 1.00 . B B . 46 LEU HD22 1 1 
        3  7442 2 1 46 LEU HD23 H  21.088 26.484  -4.591 1.00 . B B . 46 LEU HD23 1 1 
        3  7443 2 1 46 LEU HG   H  21.451 26.592  -2.114 1.00 . B B . 46 LEU HG   1 1 
        3  7444 2 1 46 LEU N    N  24.869 27.622  -0.839 1.00 . B B . 46 LEU N    1 1 
        3  7445 2 1 46 LEU O    O  24.642 27.837  -4.325 1.00 . B B . 46 LEU O    1 1 
        3  7446 2 1 47 THR C    C  26.937 25.684  -5.212 1.00 . B B . 47 THR C    1 1 
        3  7447 2 1 47 THR CA   C  27.222 26.828  -4.248 1.00 . B B . 47 THR CA   1 1 
        3  7448 2 1 47 THR CB   C  28.662 26.700  -3.721 1.00 . B B . 47 THR CB   1 1 
        3  7449 2 1 47 THR CG2  C  28.778 25.506  -2.772 1.00 . B B . 47 THR CG2  1 1 
        3  7450 2 1 47 THR H    H  26.521 26.429  -2.276 1.00 . B B . 47 THR H    1 1 
        3  7451 2 1 47 THR HA   H  27.137 27.760  -4.784 1.00 . B B . 47 THR HA   1 1 
        3  7452 2 1 47 THR HB   H  28.939 27.601  -3.195 1.00 . B B . 47 THR HB   1 1 
        3  7453 2 1 47 THR HG1  H  29.650 25.556  -4.946 1.00 . B B . 47 THR HG1  1 1 
        3  7454 2 1 47 THR HG21 H  29.798 25.429  -2.428 1.00 . B B . 47 THR HG21 1 1 
        3  7455 2 1 47 THR HG22 H  28.506 24.600  -3.296 1.00 . B B . 47 THR HG22 1 1 
        3  7456 2 1 47 THR HG23 H  28.123 25.643  -1.926 1.00 . B B . 47 THR HG23 1 1 
        3  7457 2 1 47 THR N    N  26.258 26.818  -3.136 1.00 . B B . 47 THR N    1 1 
        3  7458 2 1 47 THR O    O  27.246 25.757  -6.401 1.00 . B B . 47 THR O    1 1 
        3  7459 2 1 47 THR OG1  O  29.548 26.502  -4.815 1.00 . B B . 47 THR OG1  1 1 
        3  7460 2 1 48 LYS C    C  25.337 22.367  -4.653 1.00 . B B . 48 LYS C    1 1 
        3  7461 2 1 48 LYS CA   C  26.029 23.439  -5.496 1.00 . B B . 48 LYS CA   1 1 
        3  7462 2 1 48 LYS CB   C  27.309 22.838  -6.101 1.00 . B B . 48 LYS CB   1 1 
        3  7463 2 1 48 LYS CD   C  28.201 21.242  -7.793 1.00 . B B . 48 LYS CD   1 1 
        3  7464 2 1 48 LYS CE   C  27.831 20.170  -8.815 1.00 . B B . 48 LYS CE   1 1 
        3  7465 2 1 48 LYS CG   C  26.939 21.732  -7.087 1.00 . B B . 48 LYS CG   1 1 
        3  7466 2 1 48 LYS H    H  26.129 24.614  -3.726 1.00 . B B . 48 LYS H    1 1 
        3  7467 2 1 48 LYS HA   H  25.370 23.740  -6.297 1.00 . B B . 48 LYS HA   1 1 
        3  7468 2 1 48 LYS HB2  H  27.871 23.599  -6.615 1.00 . B B . 48 LYS HB2  1 1 
        3  7469 2 1 48 LYS HB3  H  27.914 22.421  -5.316 1.00 . B B . 48 LYS HB3  1 1 
        3  7470 2 1 48 LYS HD2  H  28.675 22.072  -8.296 1.00 . B B . 48 LYS HD2  1 1 
        3  7471 2 1 48 LYS HD3  H  28.880 20.824  -7.066 1.00 . B B . 48 LYS HD3  1 1 
        3  7472 2 1 48 LYS HE2  H  27.354 19.342  -8.315 1.00 . B B . 48 LYS HE2  1 1 
        3  7473 2 1 48 LYS HE3  H  27.154 20.587  -9.545 1.00 . B B . 48 LYS HE3  1 1 
        3  7474 2 1 48 LYS HG2  H  26.490 20.912  -6.547 1.00 . B B . 48 LYS HG2  1 1 
        3  7475 2 1 48 LYS HG3  H  26.242 22.112  -7.815 1.00 . B B . 48 LYS HG3  1 1 
        3  7476 2 1 48 LYS HZ1  H  29.879 19.795  -8.851 1.00 . B B . 48 LYS HZ1  1 1 
        3  7477 2 1 48 LYS HZ2  H  29.239 20.275 -10.347 1.00 . B B . 48 LYS HZ2  1 1 
        3  7478 2 1 48 LYS HZ3  H  28.959 18.702  -9.770 1.00 . B B . 48 LYS HZ3  1 1 
        3  7479 2 1 48 LYS N    N  26.353 24.615  -4.680 1.00 . B B . 48 LYS N    1 1 
        3  7480 2 1 48 LYS NZ   N  29.070 19.700  -9.497 1.00 . B B . 48 LYS NZ   1 1 
        3  7481 2 1 48 LYS O    O  25.655 22.205  -3.475 1.00 . B B . 48 LYS O    1 1 
        3  7482 2 1 49 ASN C    C  24.667 19.467  -4.127 1.00 . B B . 49 ASN C    1 1 
        3  7483 2 1 49 ASN CA   C  23.700 20.575  -4.547 1.00 . B B . 49 ASN CA   1 1 
        3  7484 2 1 49 ASN CB   C  22.604 19.974  -5.435 1.00 . B B . 49 ASN CB   1 1 
        3  7485 2 1 49 ASN CG   C  23.222 19.389  -6.700 1.00 . B B . 49 ASN CG   1 1 
        3  7486 2 1 49 ASN H    H  24.198 21.809  -6.202 1.00 . B B . 49 ASN H    1 1 
        3  7487 2 1 49 ASN HA   H  23.242 20.995  -3.670 1.00 . B B . 49 ASN HA   1 1 
        3  7488 2 1 49 ASN HB2  H  22.094 19.192  -4.892 1.00 . B B . 49 ASN HB2  1 1 
        3  7489 2 1 49 ASN HB3  H  21.895 20.743  -5.706 1.00 . B B . 49 ASN HB3  1 1 
        3  7490 2 1 49 ASN HD21 H  22.372 17.609  -6.472 1.00 . B B . 49 ASN HD21 1 1 
        3  7491 2 1 49 ASN HD22 H  23.357 17.771  -7.844 1.00 . B B . 49 ASN HD22 1 1 
        3  7492 2 1 49 ASN N    N  24.410 21.634  -5.261 1.00 . B B . 49 ASN N    1 1 
        3  7493 2 1 49 ASN ND2  N  22.963 18.154  -7.033 1.00 . B B . 49 ASN ND2  1 1 
        3  7494 2 1 49 ASN O    O  24.626 18.983  -2.996 1.00 . B B . 49 ASN O    1 1 
        3  7495 2 1 49 ASN OD1  O  23.957 20.078  -7.407 1.00 . B B . 49 ASN OD1  1 1 
        3  7496 2 1 50 ALA C    C  27.397 18.416  -3.582 1.00 . B B . 50 ALA C    1 1 
        3  7497 2 1 50 ALA CA   C  26.499 18.016  -4.755 1.00 . B B . 50 ALA CA   1 1 
        3  7498 2 1 50 ALA CB   C  27.371 17.725  -5.981 1.00 . B B . 50 ALA CB   1 1 
        3  7499 2 1 50 ALA H    H  25.521 19.491  -5.938 1.00 . B B . 50 ALA H    1 1 
        3  7500 2 1 50 ALA HA   H  25.962 17.120  -4.493 1.00 . B B . 50 ALA HA   1 1 
        3  7501 2 1 50 ALA HB1  H  28.024 18.566  -6.168 1.00 . B B . 50 ALA HB1  1 1 
        3  7502 2 1 50 ALA HB2  H  26.741 17.556  -6.842 1.00 . B B . 50 ALA HB2  1 1 
        3  7503 2 1 50 ALA HB3  H  27.967 16.846  -5.793 1.00 . B B . 50 ALA HB3  1 1 
        3  7504 2 1 50 ALA N    N  25.534 19.070  -5.053 1.00 . B B . 50 ALA N    1 1 
        3  7505 2 1 50 ALA O    O  27.719 17.590  -2.728 1.00 . B B . 50 ALA O    1 1 
        3  7506 2 1 51 VAL C    C  28.033 19.904  -1.101 1.00 . B B . 51 VAL C    1 1 
        3  7507 2 1 51 VAL CA   C  28.679 20.142  -2.470 1.00 . B B . 51 VAL CA   1 1 
        3  7508 2 1 51 VAL CB   C  28.971 21.657  -2.666 1.00 . B B . 51 VAL CB   1 1 
        3  7509 2 1 51 VAL CG1  C  29.479 22.305  -1.354 1.00 . B B . 51 VAL CG1  1 1 
        3  7510 2 1 51 VAL CG2  C  30.031 21.846  -3.775 1.00 . B B . 51 VAL CG2  1 1 
        3  7511 2 1 51 VAL H    H  27.510 20.297  -4.258 1.00 . B B . 51 VAL H    1 1 
        3  7512 2 1 51 VAL HA   H  29.610 19.595  -2.515 1.00 . B B . 51 VAL HA   1 1 
        3  7513 2 1 51 VAL HB   H  28.055 22.150  -2.964 1.00 . B B . 51 VAL HB   1 1 
        3  7514 2 1 51 VAL HG11 H  28.644 22.467  -0.684 1.00 . B B . 51 VAL HG11 1 1 
        3  7515 2 1 51 VAL HG12 H  29.949 23.252  -1.566 1.00 . B B . 51 VAL HG12 1 1 
        3  7516 2 1 51 VAL HG13 H  30.195 21.649  -0.883 1.00 . B B . 51 VAL HG13 1 1 
        3  7517 2 1 51 VAL HG21 H  30.023 22.875  -4.109 1.00 . B B . 51 VAL HG21 1 1 
        3  7518 2 1 51 VAL HG22 H  29.810 21.194  -4.608 1.00 . B B . 51 VAL HG22 1 1 
        3  7519 2 1 51 VAL HG23 H  31.009 21.605  -3.384 1.00 . B B . 51 VAL HG23 1 1 
        3  7520 2 1 51 VAL N    N  27.798 19.683  -3.550 1.00 . B B . 51 VAL N    1 1 
        3  7521 2 1 51 VAL O    O  28.561 19.146  -0.287 1.00 . B B . 51 VAL O    1 1 
        3  7522 2 1 52 VAL C    C  25.969 18.889   0.702 1.00 . B B . 52 VAL C    1 1 
        3  7523 2 1 52 VAL CA   C  26.213 20.376   0.413 1.00 . B B . 52 VAL CA   1 1 
        3  7524 2 1 52 VAL CB   C  24.876 21.136   0.394 1.00 . B B . 52 VAL CB   1 1 
        3  7525 2 1 52 VAL CG1  C  25.130 22.641   0.302 1.00 . B B . 52 VAL CG1  1 1 
        3  7526 2 1 52 VAL CG2  C  24.061 20.710  -0.825 1.00 . B B . 52 VAL CG2  1 1 
        3  7527 2 1 52 VAL H    H  26.520 21.136  -1.547 1.00 . B B . 52 VAL H    1 1 
        3  7528 2 1 52 VAL HA   H  26.839 20.782   1.191 1.00 . B B . 52 VAL HA   1 1 
        3  7529 2 1 52 VAL HB   H  24.315 20.919   1.296 1.00 . B B . 52 VAL HB   1 1 
        3  7530 2 1 52 VAL HG11 H  25.634 22.869  -0.627 1.00 . B B . 52 VAL HG11 1 1 
        3  7531 2 1 52 VAL HG12 H  25.741 22.957   1.132 1.00 . B B . 52 VAL HG12 1 1 
        3  7532 2 1 52 VAL HG13 H  24.184 23.162   0.333 1.00 . B B . 52 VAL HG13 1 1 
        3  7533 2 1 52 VAL HG21 H  24.613 20.951  -1.718 1.00 . B B . 52 VAL HG21 1 1 
        3  7534 2 1 52 VAL HG22 H  23.120 21.241  -0.830 1.00 . B B . 52 VAL HG22 1 1 
        3  7535 2 1 52 VAL HG23 H  23.874 19.647  -0.787 1.00 . B B . 52 VAL HG23 1 1 
        3  7536 2 1 52 VAL N    N  26.893 20.544  -0.861 1.00 . B B . 52 VAL N    1 1 
        3  7537 2 1 52 VAL O    O  26.000 18.460   1.856 1.00 . B B . 52 VAL O    1 1 
        3  7538 2 1 53 LEU C    C  26.609 16.013   0.569 1.00 . B B . 53 LEU C    1 1 
        3  7539 2 1 53 LEU CA   C  25.456 16.693  -0.174 1.00 . B B . 53 LEU CA   1 1 
        3  7540 2 1 53 LEU CB   C  25.256 16.033  -1.563 1.00 . B B . 53 LEU CB   1 1 
        3  7541 2 1 53 LEU CD1  C  24.856 13.815  -0.429 1.00 . B B . 53 LEU CD1  1 1 
        3  7542 2 1 53 LEU CD2  C  22.870 15.242  -1.116 1.00 . B B . 53 LEU CD2  1 1 
        3  7543 2 1 53 LEU CG   C  24.320 14.807  -1.476 1.00 . B B . 53 LEU CG   1 1 
        3  7544 2 1 53 LEU H    H  25.713 18.514  -1.247 1.00 . B B . 53 LEU H    1 1 
        3  7545 2 1 53 LEU HA   H  24.556 16.588   0.411 1.00 . B B . 53 LEU HA   1 1 
        3  7546 2 1 53 LEU HB2  H  24.830 16.756  -2.237 1.00 . B B . 53 LEU HB2  1 1 
        3  7547 2 1 53 LEU HB3  H  26.214 15.716  -1.954 1.00 . B B . 53 LEU HB3  1 1 
        3  7548 2 1 53 LEU HD11 H  24.666 14.202   0.562 1.00 . B B . 53 LEU HD11 1 1 
        3  7549 2 1 53 LEU HD12 H  25.921 13.678  -0.565 1.00 . B B . 53 LEU HD12 1 1 
        3  7550 2 1 53 LEU HD13 H  24.351 12.868  -0.544 1.00 . B B . 53 LEU HD13 1 1 
        3  7551 2 1 53 LEU HD21 H  22.707 16.281  -1.370 1.00 . B B . 53 LEU HD21 1 1 
        3  7552 2 1 53 LEU HD22 H  22.690 15.107  -0.054 1.00 . B B . 53 LEU HD22 1 1 
        3  7553 2 1 53 LEU HD23 H  22.173 14.633  -1.672 1.00 . B B . 53 LEU HD23 1 1 
        3  7554 2 1 53 LEU HG   H  24.308 14.316  -2.438 1.00 . B B . 53 LEU HG   1 1 
        3  7555 2 1 53 LEU N    N  25.725 18.117  -0.351 1.00 . B B . 53 LEU N    1 1 
        3  7556 2 1 53 LEU O    O  26.414 15.469   1.656 1.00 . B B . 53 LEU O    1 1 
        3  7557 2 1 54 LYS C    C  29.192 16.026   2.000 1.00 . B B . 54 LYS C    1 1 
        3  7558 2 1 54 LYS CA   C  28.966 15.430   0.616 1.00 . B B . 54 LYS CA   1 1 
        3  7559 2 1 54 LYS CB   C  30.223 15.620  -0.261 1.00 . B B . 54 LYS CB   1 1 
        3  7560 2 1 54 LYS CD   C  31.607 17.413  -1.441 1.00 . B B . 54 LYS CD   1 1 
        3  7561 2 1 54 LYS CE   C  31.623 16.679  -2.785 1.00 . B B . 54 LYS CE   1 1 
        3  7562 2 1 54 LYS CG   C  30.336 17.096  -0.649 1.00 . B B . 54 LYS CG   1 1 
        3  7563 2 1 54 LYS H    H  27.899 16.505  -0.881 1.00 . B B . 54 LYS H    1 1 
        3  7564 2 1 54 LYS HA   H  28.772 14.370   0.721 1.00 . B B . 54 LYS HA   1 1 
        3  7565 2 1 54 LYS HB2  H  31.103 15.315   0.289 1.00 . B B . 54 LYS HB2  1 1 
        3  7566 2 1 54 LYS HB3  H  30.128 15.020  -1.150 1.00 . B B . 54 LYS HB3  1 1 
        3  7567 2 1 54 LYS HD2  H  31.622 18.478  -1.630 1.00 . B B . 54 LYS HD2  1 1 
        3  7568 2 1 54 LYS HD3  H  32.474 17.139  -0.866 1.00 . B B . 54 LYS HD3  1 1 
        3  7569 2 1 54 LYS HE2  H  31.868 15.640  -2.629 1.00 . B B . 54 LYS HE2  1 1 
        3  7570 2 1 54 LYS HE3  H  30.656 16.758  -3.256 1.00 . B B . 54 LYS HE3  1 1 
        3  7571 2 1 54 LYS HG2  H  29.496 17.353  -1.250 1.00 . B B . 54 LYS HG2  1 1 
        3  7572 2 1 54 LYS HG3  H  30.337 17.693   0.247 1.00 . B B . 54 LYS HG3  1 1 
        3  7573 2 1 54 LYS HZ1  H  33.370 17.778  -3.079 1.00 . B B . 54 LYS HZ1  1 1 
        3  7574 2 1 54 LYS HZ2  H  32.201 18.004  -4.286 1.00 . B B . 54 LYS HZ2  1 1 
        3  7575 2 1 54 LYS HZ3  H  33.109 16.569  -4.244 1.00 . B B . 54 LYS HZ3  1 1 
        3  7576 2 1 54 LYS N    N  27.803 16.058  -0.014 1.00 . B B . 54 LYS N    1 1 
        3  7577 2 1 54 LYS NZ   N  32.653 17.305  -3.665 1.00 . B B . 54 LYS NZ   1 1 
        3  7578 2 1 54 LYS O    O  29.601 15.325   2.926 1.00 . B B . 54 LYS O    1 1 
        3  7579 2 1 55 ARG C    C  28.167 17.415   4.454 1.00 . B B . 55 ARG C    1 1 
        3  7580 2 1 55 ARG CA   C  29.102 18.006   3.404 1.00 . B B . 55 ARG CA   1 1 
        3  7581 2 1 55 ARG CB   C  28.832 19.508   3.235 1.00 . B B . 55 ARG CB   1 1 
        3  7582 2 1 55 ARG CD   C  30.780 20.186   4.738 1.00 . B B . 55 ARG CD   1 1 
        3  7583 2 1 55 ARG CG   C  29.255 20.281   4.498 1.00 . B B . 55 ARG CG   1 1 
        3  7584 2 1 55 ARG CZ   C  31.315 22.557   4.799 1.00 . B B . 55 ARG CZ   1 1 
        3  7585 2 1 55 ARG H    H  28.601 17.829   1.364 1.00 . B B . 55 ARG H    1 1 
        3  7586 2 1 55 ARG HA   H  30.119 17.859   3.721 1.00 . B B . 55 ARG HA   1 1 
        3  7587 2 1 55 ARG HB2  H  29.384 19.881   2.384 1.00 . B B . 55 ARG HB2  1 1 
        3  7588 2 1 55 ARG HB3  H  27.777 19.660   3.068 1.00 . B B . 55 ARG HB3  1 1 
        3  7589 2 1 55 ARG HD2  H  31.001 19.324   5.355 1.00 . B B . 55 ARG HD2  1 1 
        3  7590 2 1 55 ARG HD3  H  31.299 20.084   3.794 1.00 . B B . 55 ARG HD3  1 1 
        3  7591 2 1 55 ARG HE   H  31.552 21.322   6.355 1.00 . B B . 55 ARG HE   1 1 
        3  7592 2 1 55 ARG HG2  H  28.986 21.317   4.376 1.00 . B B . 55 ARG HG2  1 1 
        3  7593 2 1 55 ARG HG3  H  28.733 19.874   5.351 1.00 . B B . 55 ARG HG3  1 1 
        3  7594 2 1 55 ARG HH11 H  30.569 21.853   3.079 1.00 . B B . 55 ARG HH11 1 1 
        3  7595 2 1 55 ARG HH12 H  30.959 23.540   3.092 1.00 . B B . 55 ARG HH12 1 1 
        3  7596 2 1 55 ARG HH21 H  32.075 23.532   6.374 1.00 . B B . 55 ARG HH21 1 1 
        3  7597 2 1 55 ARG HH22 H  31.811 24.490   4.956 1.00 . B B . 55 ARG HH22 1 1 
        3  7598 2 1 55 ARG N    N  28.925 17.320   2.136 1.00 . B B . 55 ARG N    1 1 
        3  7599 2 1 55 ARG NE   N  31.258 21.385   5.422 1.00 . B B . 55 ARG NE   1 1 
        3  7600 2 1 55 ARG NH1  N  30.916 22.658   3.560 1.00 . B B . 55 ARG NH1  1 1 
        3  7601 2 1 55 ARG NH2  N  31.769 23.608   5.425 1.00 . B B . 55 ARG NH2  1 1 
        3  7602 2 1 55 ARG O    O  28.526 17.320   5.628 1.00 . B B . 55 ARG O    1 1 
        3  7603 2 1 56 ILE C    C  26.441 15.033   5.359 1.00 . B B . 56 ILE C    1 1 
        3  7604 2 1 56 ILE CA   C  26.000 16.430   4.942 1.00 . B B . 56 ILE CA   1 1 
        3  7605 2 1 56 ILE CB   C  24.615 16.378   4.264 1.00 . B B . 56 ILE CB   1 1 
        3  7606 2 1 56 ILE CD1  C  22.876 17.796   3.162 1.00 . B B . 56 ILE CD1  1 1 
        3  7607 2 1 56 ILE CG1  C  24.074 17.810   4.102 1.00 . B B . 56 ILE CG1  1 1 
        3  7608 2 1 56 ILE CG2  C  23.626 15.551   5.110 1.00 . B B . 56 ILE CG2  1 1 
        3  7609 2 1 56 ILE H    H  26.741 17.121   3.080 1.00 . B B . 56 ILE H    1 1 
        3  7610 2 1 56 ILE HA   H  25.929 17.045   5.831 1.00 . B B . 56 ILE HA   1 1 
        3  7611 2 1 56 ILE HB   H  24.720 15.921   3.292 1.00 . B B . 56 ILE HB   1 1 
        3  7612 2 1 56 ILE HD11 H  22.459 18.787   3.095 1.00 . B B . 56 ILE HD11 1 1 
        3  7613 2 1 56 ILE HD12 H  22.133 17.113   3.543 1.00 . B B . 56 ILE HD12 1 1 
        3  7614 2 1 56 ILE HD13 H  23.198 17.470   2.187 1.00 . B B . 56 ILE HD13 1 1 
        3  7615 2 1 56 ILE HG12 H  23.773 18.192   5.060 1.00 . B B . 56 ILE HG12 1 1 
        3  7616 2 1 56 ILE HG13 H  24.835 18.444   3.697 1.00 . B B . 56 ILE HG13 1 1 
        3  7617 2 1 56 ILE HG21 H  22.617 15.719   4.764 1.00 . B B . 56 ILE HG21 1 1 
        3  7618 2 1 56 ILE HG22 H  23.705 15.847   6.147 1.00 . B B . 56 ILE HG22 1 1 
        3  7619 2 1 56 ILE HG23 H  23.863 14.503   5.016 1.00 . B B . 56 ILE HG23 1 1 
        3  7620 2 1 56 ILE N    N  26.972 17.021   4.028 1.00 . B B . 56 ILE N    1 1 
        3  7621 2 1 56 ILE O    O  26.392 14.687   6.540 1.00 . B B . 56 ILE O    1 1 
        3  7622 2 1 57 GLN C    C  28.399 12.870   5.704 1.00 . B B . 57 GLN C    1 1 
        3  7623 2 1 57 GLN CA   C  27.303 12.870   4.651 1.00 . B B . 57 GLN CA   1 1 
        3  7624 2 1 57 GLN CB   C  27.825 12.229   3.359 1.00 . B B . 57 GLN CB   1 1 
        3  7625 2 1 57 GLN CD   C  27.197 11.517   1.051 1.00 . B B . 57 GLN CD   1 1 
        3  7626 2 1 57 GLN CG   C  26.672 12.072   2.367 1.00 . B B . 57 GLN CG   1 1 
        3  7627 2 1 57 GLN H    H  26.880 14.561   3.464 1.00 . B B . 57 GLN H    1 1 
        3  7628 2 1 57 GLN HA   H  26.465 12.292   5.014 1.00 . B B . 57 GLN HA   1 1 
        3  7629 2 1 57 GLN HB2  H  28.590 12.859   2.926 1.00 . B B . 57 GLN HB2  1 1 
        3  7630 2 1 57 GLN HB3  H  28.241 11.257   3.579 1.00 . B B . 57 GLN HB3  1 1 
        3  7631 2 1 57 GLN HE21 H  25.557 10.469   0.664 1.00 . B B . 57 GLN HE21 1 1 
        3  7632 2 1 57 GLN HE22 H  26.785 10.351  -0.502 1.00 . B B . 57 GLN HE22 1 1 
        3  7633 2 1 57 GLN HG2  H  25.939 11.395   2.778 1.00 . B B . 57 GLN HG2  1 1 
        3  7634 2 1 57 GLN HG3  H  26.216 13.035   2.195 1.00 . B B . 57 GLN HG3  1 1 
        3  7635 2 1 57 GLN N    N  26.862 14.231   4.387 1.00 . B B . 57 GLN N    1 1 
        3  7636 2 1 57 GLN NE2  N  26.451 10.712   0.345 1.00 . B B . 57 GLN NE2  1 1 
        3  7637 2 1 57 GLN O    O  28.592 11.879   6.409 1.00 . B B . 57 GLN O    1 1 
        3  7638 2 1 57 GLN OE1  O  28.321 11.826   0.654 1.00 . B B . 57 GLN OE1  1 1 
        3  7639 2 1 58 HIS C    C  29.610 14.159   8.197 1.00 . B B . 58 HIS C    1 1 
        3  7640 2 1 58 HIS CA   C  30.186 14.097   6.789 1.00 . B B . 58 HIS CA   1 1 
        3  7641 2 1 58 HIS CB   C  31.028 15.353   6.523 1.00 . B B . 58 HIS CB   1 1 
        3  7642 2 1 58 HIS CD2  C  31.683 14.237   4.238 1.00 . B B . 58 HIS CD2  1 1 
        3  7643 2 1 58 HIS CE1  C  32.854 15.859   3.406 1.00 . B B . 58 HIS CE1  1 1 
        3  7644 2 1 58 HIS CG   C  31.672 15.251   5.164 1.00 . B B . 58 HIS CG   1 1 
        3  7645 2 1 58 HIS H    H  28.915 14.743   5.223 1.00 . B B . 58 HIS H    1 1 
        3  7646 2 1 58 HIS HA   H  30.826 13.230   6.713 1.00 . B B . 58 HIS HA   1 1 
        3  7647 2 1 58 HIS HB2  H  30.401 16.226   6.563 1.00 . B B . 58 HIS HB2  1 1 
        3  7648 2 1 58 HIS HB3  H  31.798 15.430   7.277 1.00 . B B . 58 HIS HB3  1 1 
        3  7649 2 1 58 HIS HD1  H  32.612 17.146   5.024 1.00 . B B . 58 HIS HD1  1 1 
        3  7650 2 1 58 HIS HD2  H  31.181 13.289   4.348 1.00 . B B . 58 HIS HD2  1 1 
        3  7651 2 1 58 HIS HE1  H  33.467 16.454   2.742 1.00 . B B . 58 HIS HE1  1 1 
        3  7652 2 1 58 HIS HE2  H  32.607 14.103   2.318 1.00 . B B . 58 HIS HE2  1 1 
        3  7653 2 1 58 HIS N    N  29.113 13.985   5.811 1.00 . B B . 58 HIS N    1 1 
        3  7654 2 1 58 HIS ND1  N  32.425 16.275   4.612 1.00 . B B . 58 HIS ND1  1 1 
        3  7655 2 1 58 HIS NE2  N  32.430 14.624   3.129 1.00 . B B . 58 HIS NE2  1 1 
        3  7656 2 1 58 HIS O    O  30.105 13.497   9.109 1.00 . B B . 58 HIS O    1 1 
        3  7657 2 1 59 LEU C    C  27.612 13.731  10.282 1.00 . B B . 59 LEU C    1 1 
        3  7658 2 1 59 LEU CA   C  27.949 15.107   9.695 1.00 . B B . 59 LEU CA   1 1 
        3  7659 2 1 59 LEU CB   C  26.673 15.991   9.594 1.00 . B B . 59 LEU CB   1 1 
        3  7660 2 1 59 LEU CD1  C  26.969 17.021  11.914 1.00 . B B . 59 LEU CD1  1 1 
        3  7661 2 1 59 LEU CD2  C  28.054 18.101   9.856 1.00 . B B . 59 LEU CD2  1 1 
        3  7662 2 1 59 LEU CG   C  26.831 17.310  10.387 1.00 . B B . 59 LEU CG   1 1 
        3  7663 2 1 59 LEU H    H  28.217 15.470   7.607 1.00 . B B . 59 LEU H    1 1 
        3  7664 2 1 59 LEU HA   H  28.667 15.573  10.351 1.00 . B B . 59 LEU HA   1 1 
        3  7665 2 1 59 LEU HB2  H  26.507 16.229   8.560 1.00 . B B . 59 LEU HB2  1 1 
        3  7666 2 1 59 LEU HB3  H  25.816 15.459   9.975 1.00 . B B . 59 LEU HB3  1 1 
        3  7667 2 1 59 LEU HD11 H  26.734 15.986  12.129 1.00 . B B . 59 LEU HD11 1 1 
        3  7668 2 1 59 LEU HD12 H  26.282 17.657  12.451 1.00 . B B . 59 LEU HD12 1 1 
        3  7669 2 1 59 LEU HD13 H  27.979 17.232  12.249 1.00 . B B . 59 LEU HD13 1 1 
        3  7670 2 1 59 LEU HD21 H  27.808 19.144   9.850 1.00 . B B . 59 LEU HD21 1 1 
        3  7671 2 1 59 LEU HD22 H  28.302 17.787   8.850 1.00 . B B . 59 LEU HD22 1 1 
        3  7672 2 1 59 LEU HD23 H  28.909 17.941  10.502 1.00 . B B . 59 LEU HD23 1 1 
        3  7673 2 1 59 LEU HG   H  25.944 17.905  10.238 1.00 . B B . 59 LEU HG   1 1 
        3  7674 2 1 59 LEU N    N  28.569 14.966   8.371 1.00 . B B . 59 LEU N    1 1 
        3  7675 2 1 59 LEU O    O  27.450 13.593  11.495 1.00 . B B . 59 LEU O    1 1 
        3  7676 2 1 60 ASP C    C  28.235 10.909  10.887 1.00 . B B . 60 ASP C    1 1 
        3  7677 2 1 60 ASP CA   C  27.178 11.390   9.892 1.00 . B B . 60 ASP CA   1 1 
        3  7678 2 1 60 ASP CB   C  27.088 10.404   8.718 1.00 . B B . 60 ASP CB   1 1 
        3  7679 2 1 60 ASP CG   C  25.975 10.828   7.762 1.00 . B B . 60 ASP CG   1 1 
        3  7680 2 1 60 ASP H    H  27.645 12.896   8.463 1.00 . B B . 60 ASP H    1 1 
        3  7681 2 1 60 ASP HA   H  26.218 11.426  10.388 1.00 . B B . 60 ASP HA   1 1 
        3  7682 2 1 60 ASP HB2  H  28.028 10.382   8.191 1.00 . B B . 60 ASP HB2  1 1 
        3  7683 2 1 60 ASP HB3  H  26.867  9.415   9.099 1.00 . B B . 60 ASP HB3  1 1 
        3  7684 2 1 60 ASP N    N  27.506 12.727   9.418 1.00 . B B . 60 ASP N    1 1 
        3  7685 2 1 60 ASP O    O  27.898 10.356  11.934 1.00 . B B . 60 ASP O    1 1 
        3  7686 2 1 60 ASP OD1  O  25.101 11.561   8.194 1.00 . B B . 60 ASP OD1  1 1 
        3  7687 2 1 60 ASP OD2  O  26.022 10.427   6.611 1.00 . B B . 60 ASP OD2  1 1 
        3  7688 2 1 61 GLU C    C  30.557 11.445  12.750 1.00 . B B . 61 GLU C    1 1 
        3  7689 2 1 61 GLU CA   C  30.603 10.689  11.420 1.00 . B B . 61 GLU CA   1 1 
        3  7690 2 1 61 GLU CB   C  31.959 10.929  10.702 1.00 . B B . 61 GLU CB   1 1 
        3  7691 2 1 61 GLU CD   C  33.540 12.710   9.846 1.00 . B B . 61 GLU CD   1 1 
        3  7692 2 1 61 GLU CG   C  32.435 12.395  10.855 1.00 . B B . 61 GLU CG   1 1 
        3  7693 2 1 61 GLU H    H  29.713 11.554   9.702 1.00 . B B . 61 GLU H    1 1 
        3  7694 2 1 61 GLU HA   H  30.496  9.634  11.626 1.00 . B B . 61 GLU HA   1 1 
        3  7695 2 1 61 GLU HB2  H  32.710 10.272  11.120 1.00 . B B . 61 GLU HB2  1 1 
        3  7696 2 1 61 GLU HB3  H  31.839 10.704   9.653 1.00 . B B . 61 GLU HB3  1 1 
        3  7697 2 1 61 GLU HG2  H  31.606 13.065  10.702 1.00 . B B . 61 GLU HG2  1 1 
        3  7698 2 1 61 GLU HG3  H  32.821 12.541  11.853 1.00 . B B . 61 GLU HG3  1 1 
        3  7699 2 1 61 GLU N    N  29.504 11.108  10.550 1.00 . B B . 61 GLU N    1 1 
        3  7700 2 1 61 GLU O    O  30.858 10.890  13.807 1.00 . B B . 61 GLU O    1 1 
        3  7701 2 1 61 GLU OE1  O  33.233 12.796   8.668 1.00 . B B . 61 GLU OE1  1 1 
        3  7702 2 1 61 GLU OE2  O  34.670 12.885  10.271 1.00 . B B . 61 GLU OE2  1 1 
        3  7703 2 1 62 ALA C    C  28.908 13.166  14.726 1.00 . B B . 62 ALA C    1 1 
        3  7704 2 1 62 ALA CA   C  30.113 13.552  13.873 1.00 . B B . 62 ALA CA   1 1 
        3  7705 2 1 62 ALA CB   C  30.012 15.017  13.459 1.00 . B B . 62 ALA CB   1 1 
        3  7706 2 1 62 ALA H    H  29.965 13.112  11.812 1.00 . B B . 62 ALA H    1 1 
        3  7707 2 1 62 ALA HA   H  31.009 13.415  14.461 1.00 . B B . 62 ALA HA   1 1 
        3  7708 2 1 62 ALA HB1  H  29.046 15.200  13.008 1.00 . B B . 62 ALA HB1  1 1 
        3  7709 2 1 62 ALA HB2  H  30.788 15.240  12.743 1.00 . B B . 62 ALA HB2  1 1 
        3  7710 2 1 62 ALA HB3  H  30.131 15.645  14.325 1.00 . B B . 62 ALA HB3  1 1 
        3  7711 2 1 62 ALA N    N  30.193 12.722  12.682 1.00 . B B . 62 ALA N    1 1 
        3  7712 2 1 62 ALA O    O  29.051 12.884  15.915 1.00 . B B . 62 ALA O    1 1 
        3  7713 2 1 63 TYR C    C  26.699 11.487  15.609 1.00 . B B . 63 TYR C    1 1 
        3  7714 2 1 63 TYR CA   C  26.494 12.801  14.820 1.00 . B B . 63 TYR CA   1 1 
        3  7715 2 1 63 TYR CB   C  25.322 12.662  13.783 1.00 . B B . 63 TYR CB   1 1 
        3  7716 2 1 63 TYR CD1  C  24.849 10.193  13.659 1.00 . B B . 63 TYR CD1  1 1 
        3  7717 2 1 63 TYR CD2  C  23.300 11.590  14.896 1.00 . B B . 63 TYR CD2  1 1 
        3  7718 2 1 63 TYR CE1  C  24.094  9.062  13.992 1.00 . B B . 63 TYR CE1  1 1 
        3  7719 2 1 63 TYR CE2  C  22.546 10.459  15.229 1.00 . B B . 63 TYR CE2  1 1 
        3  7720 2 1 63 TYR CG   C  24.452 11.457  14.111 1.00 . B B . 63 TYR CG   1 1 
        3  7721 2 1 63 TYR CZ   C  22.943  9.195  14.777 1.00 . B B . 63 TYR CZ   1 1 
        3  7722 2 1 63 TYR H    H  27.673 13.387  13.166 1.00 . B B . 63 TYR H    1 1 
        3  7723 2 1 63 TYR HA   H  26.259 13.604  15.508 1.00 . B B . 63 TYR HA   1 1 
        3  7724 2 1 63 TYR HB2  H  24.712 13.557  13.791 1.00 . B B . 63 TYR HB2  1 1 
        3  7725 2 1 63 TYR HB3  H  25.742 12.535  12.795 1.00 . B B . 63 TYR HB3  1 1 
        3  7726 2 1 63 TYR HD1  H  25.739 10.091  13.054 1.00 . B B . 63 TYR HD1  1 1 
        3  7727 2 1 63 TYR HD2  H  22.996 12.566  15.245 1.00 . B B . 63 TYR HD2  1 1 
        3  7728 2 1 63 TYR HE1  H  24.402  8.088  13.642 1.00 . B B . 63 TYR HE1  1 1 
        3  7729 2 1 63 TYR HE2  H  21.658 10.562  15.831 1.00 . B B . 63 TYR HE2  1 1 
        3  7730 2 1 63 TYR HH   H  22.047  7.575  14.311 1.00 . B B . 63 TYR HH   1 1 
        3  7731 2 1 63 TYR N    N  27.727 13.153  14.116 1.00 . B B . 63 TYR N    1 1 
        3  7732 2 1 63 TYR O    O  26.179 11.320  16.712 1.00 . B B . 63 TYR O    1 1 
        3  7733 2 1 63 TYR OH   O  22.199  8.082  15.112 1.00 . B B . 63 TYR OH   1 1 
        3  7734 2 1 64 ASN C    C  28.544  9.447  16.903 1.00 . B B . 64 ASN C    1 1 
        3  7735 2 1 64 ASN CA   C  27.710  9.271  15.640 1.00 . B B . 64 ASN CA   1 1 
        3  7736 2 1 64 ASN CB   C  28.447  8.358  14.657 1.00 . B B . 64 ASN CB   1 1 
        3  7737 2 1 64 ASN CG   C  28.723  7.003  15.302 1.00 . B B . 64 ASN CG   1 1 
        3  7738 2 1 64 ASN H    H  27.834 10.751  14.133 1.00 . B B . 64 ASN H    1 1 
        3  7739 2 1 64 ASN HA   H  26.769  8.809  15.906 1.00 . B B . 64 ASN HA   1 1 
        3  7740 2 1 64 ASN HB2  H  27.837  8.216  13.776 1.00 . B B . 64 ASN HB2  1 1 
        3  7741 2 1 64 ASN HB3  H  29.382  8.816  14.374 1.00 . B B . 64 ASN HB3  1 1 
        3  7742 2 1 64 ASN HD21 H  26.886  6.318  14.987 1.00 . B B . 64 ASN HD21 1 1 
        3  7743 2 1 64 ASN HD22 H  27.938  5.239  15.765 1.00 . B B . 64 ASN HD22 1 1 
        3  7744 2 1 64 ASN N    N  27.446 10.563  15.013 1.00 . B B . 64 ASN N    1 1 
        3  7745 2 1 64 ASN ND2  N  27.770  6.114  15.356 1.00 . B B . 64 ASN ND2  1 1 
        3  7746 2 1 64 ASN O    O  28.346  8.744  17.894 1.00 . B B . 64 ASN O    1 1 
        3  7747 2 1 64 ASN OD1  O  29.829  6.754  15.782 1.00 . B B . 64 ASN OD1  1 1 
        3  7748 2 1 65 LYS C    C  29.498 10.928  19.257 1.00 . B B . 65 LYS C    1 1 
        3  7749 2 1 65 LYS CA   C  30.337 10.636  18.009 1.00 . B B . 65 LYS CA   1 1 
        3  7750 2 1 65 LYS CB   C  31.257 11.840  17.728 1.00 . B B . 65 LYS CB   1 1 
        3  7751 2 1 65 LYS CD   C  33.628 11.061  18.203 1.00 . B B . 65 LYS CD   1 1 
        3  7752 2 1 65 LYS CE   C  34.744 11.065  19.242 1.00 . B B . 65 LYS CE   1 1 
        3  7753 2 1 65 LYS CG   C  32.435 11.865  18.743 1.00 . B B . 65 LYS CG   1 1 
        3  7754 2 1 65 LYS H    H  29.594 10.919  16.044 1.00 . B B . 65 LYS H    1 1 
        3  7755 2 1 65 LYS HA   H  30.944  9.760  18.188 1.00 . B B . 65 LYS HA   1 1 
        3  7756 2 1 65 LYS HB2  H  31.638 11.765  16.716 1.00 . B B . 65 LYS HB2  1 1 
        3  7757 2 1 65 LYS HB3  H  30.683 12.756  17.816 1.00 . B B . 65 LYS HB3  1 1 
        3  7758 2 1 65 LYS HD2  H  33.320 10.044  18.004 1.00 . B B . 65 LYS HD2  1 1 
        3  7759 2 1 65 LYS HD3  H  33.985 11.514  17.290 1.00 . B B . 65 LYS HD3  1 1 
        3  7760 2 1 65 LYS HE2  H  35.609 10.552  18.848 1.00 . B B . 65 LYS HE2  1 1 
        3  7761 2 1 65 LYS HE3  H  35.006 12.084  19.485 1.00 . B B . 65 LYS HE3  1 1 
        3  7762 2 1 65 LYS HG2  H  32.746 12.884  18.917 1.00 . B B . 65 LYS HG2  1 1 
        3  7763 2 1 65 LYS HG3  H  32.118 11.435  19.685 1.00 . B B . 65 LYS HG3  1 1 
        3  7764 2 1 65 LYS HZ1  H  34.343 11.008  21.283 1.00 . B B . 65 LYS HZ1  1 1 
        3  7765 2 1 65 LYS HZ2  H  34.846  9.523  20.636 1.00 . B B . 65 LYS HZ2  1 1 
        3  7766 2 1 65 LYS HZ3  H  33.271 10.088  20.338 1.00 . B B . 65 LYS HZ3  1 1 
        3  7767 2 1 65 LYS N    N  29.481 10.389  16.860 1.00 . B B . 65 LYS N    1 1 
        3  7768 2 1 65 LYS NZ   N  34.266 10.369  20.468 1.00 . B B . 65 LYS NZ   1 1 
        3  7769 2 1 65 LYS O    O  29.826 10.486  20.358 1.00 . B B . 65 LYS O    1 1 
        3  7770 2 1 66 VAL C    C  26.851 10.813  20.731 1.00 . B B . 66 VAL C    1 1 
        3  7771 2 1 66 VAL CA   C  27.544 12.042  20.178 1.00 . B B . 66 VAL CA   1 1 
        3  7772 2 1 66 VAL CB   C  26.514 13.076  19.710 1.00 . B B . 66 VAL CB   1 1 
        3  7773 2 1 66 VAL CG1  C  25.572 13.442  20.868 1.00 . B B . 66 VAL CG1  1 1 
        3  7774 2 1 66 VAL CG2  C  27.255 14.328  19.243 1.00 . B B . 66 VAL CG2  1 1 
        3  7775 2 1 66 VAL H    H  28.207 12.004  18.171 1.00 . B B . 66 VAL H    1 1 
        3  7776 2 1 66 VAL HA   H  28.135 12.474  20.958 1.00 . B B . 66 VAL HA   1 1 
        3  7777 2 1 66 VAL HB   H  25.940 12.668  18.889 1.00 . B B . 66 VAL HB   1 1 
        3  7778 2 1 66 VAL HG11 H  26.157 13.689  21.743 1.00 . B B . 66 VAL HG11 1 1 
        3  7779 2 1 66 VAL HG12 H  24.930 12.602  21.093 1.00 . B B . 66 VAL HG12 1 1 
        3  7780 2 1 66 VAL HG13 H  24.966 14.291  20.589 1.00 . B B . 66 VAL HG13 1 1 
        3  7781 2 1 66 VAL HG21 H  26.548 15.039  18.845 1.00 . B B . 66 VAL HG21 1 1 
        3  7782 2 1 66 VAL HG22 H  27.969 14.058  18.478 1.00 . B B . 66 VAL HG22 1 1 
        3  7783 2 1 66 VAL HG23 H  27.774 14.764  20.082 1.00 . B B . 66 VAL HG23 1 1 
        3  7784 2 1 66 VAL N    N  28.419 11.680  19.071 1.00 . B B . 66 VAL N    1 1 
        3  7785 2 1 66 VAL O    O  26.660 10.663  21.938 1.00 . B B . 66 VAL O    1 1 
        3  7786 2 1 67 LYS C    C  26.646  7.809  20.998 1.00 . B B . 67 LYS C    1 1 
        3  7787 2 1 67 LYS CA   C  25.758  8.714  20.181 1.00 . B B . 67 LYS CA   1 1 
        3  7788 2 1 67 LYS CB   C  25.365  8.028  18.894 1.00 . B B . 67 LYS CB   1 1 
        3  7789 2 1 67 LYS CD   C  22.987  8.852  18.411 1.00 . B B . 67 LYS CD   1 1 
        3  7790 2 1 67 LYS CE   C  22.424  7.463  18.006 1.00 . B B . 67 LYS CE   1 1 
        3  7791 2 1 67 LYS CG   C  24.483  8.994  18.059 1.00 . B B . 67 LYS CG   1 1 
        3  7792 2 1 67 LYS H    H  26.636 10.103  18.872 1.00 . B B . 67 LYS H    1 1 
        3  7793 2 1 67 LYS HA   H  24.868  8.953  20.730 1.00 . B B . 67 LYS HA   1 1 
        3  7794 2 1 67 LYS HB2  H  26.267  7.781  18.345 1.00 . B B . 67 LYS HB2  1 1 
        3  7795 2 1 67 LYS HB3  H  24.831  7.122  19.112 1.00 . B B . 67 LYS HB3  1 1 
        3  7796 2 1 67 LYS HD2  H  22.858  9.009  19.478 1.00 . B B . 67 LYS HD2  1 1 
        3  7797 2 1 67 LYS HD3  H  22.443  9.615  17.884 1.00 . B B . 67 LYS HD3  1 1 
        3  7798 2 1 67 LYS HE2  H  23.019  7.029  17.212 1.00 . B B . 67 LYS HE2  1 1 
        3  7799 2 1 67 LYS HE3  H  22.432  6.796  18.861 1.00 . B B . 67 LYS HE3  1 1 
        3  7800 2 1 67 LYS HG2  H  24.773 10.021  18.234 1.00 . B B . 67 LYS HG2  1 1 
        3  7801 2 1 67 LYS HG3  H  24.635  8.791  17.032 1.00 . B B . 67 LYS HG3  1 1 
        3  7802 2 1 67 LYS HZ1  H  20.361  7.566  18.333 1.00 . B B . 67 LYS HZ1  1 1 
        3  7803 2 1 67 LYS HZ2  H  20.787  6.882  16.839 1.00 . B B . 67 LYS HZ2  1 1 
        3  7804 2 1 67 LYS HZ3  H  20.911  8.561  17.071 1.00 . B B . 67 LYS HZ3  1 1 
        3  7805 2 1 67 LYS N    N  26.456  9.930  19.820 1.00 . B B . 67 LYS N    1 1 
        3  7806 2 1 67 LYS NZ   N  21.015  7.630  17.526 1.00 . B B . 67 LYS NZ   1 1 
        3  7807 2 1 67 LYS O    O  26.248  7.283  22.038 1.00 . B B . 67 LYS O    1 1 
        3  7808 2 1 68 ARG C    C  29.592  7.602  22.281 1.00 . B B . 68 ARG C    1 1 
        3  7809 2 1 68 ARG CA   C  28.852  6.793  21.211 1.00 . B B . 68 ARG CA   1 1 
        3  7810 2 1 68 ARG CB   C  29.844  6.246  20.162 1.00 . B B . 68 ARG CB   1 1 
        3  7811 2 1 68 ARG CD   C  29.600  3.710  20.328 1.00 . B B . 68 ARG CD   1 1 
        3  7812 2 1 68 ARG CG   C  29.297  4.960  19.481 1.00 . B B . 68 ARG CG   1 1 
        3  7813 2 1 68 ARG CZ   C  31.560  2.449  21.026 1.00 . B B . 68 ARG CZ   1 1 
        3  7814 2 1 68 ARG H    H  28.138  8.078  19.690 1.00 . B B . 68 ARG H    1 1 
        3  7815 2 1 68 ARG HA   H  28.345  5.970  21.695 1.00 . B B . 68 ARG HA   1 1 
        3  7816 2 1 68 ARG HB2  H  29.990  7.009  19.406 1.00 . B B . 68 ARG HB2  1 1 
        3  7817 2 1 68 ARG HB3  H  30.790  6.040  20.630 1.00 . B B . 68 ARG HB3  1 1 
        3  7818 2 1 68 ARG HD2  H  29.259  3.856  21.339 1.00 . B B . 68 ARG HD2  1 1 
        3  7819 2 1 68 ARG HD3  H  29.087  2.863  19.898 1.00 . B B . 68 ARG HD3  1 1 
        3  7820 2 1 68 ARG HE   H  31.624  4.027  19.801 1.00 . B B . 68 ARG HE   1 1 
        3  7821 2 1 68 ARG HG2  H  28.228  5.048  19.347 1.00 . B B . 68 ARG HG2  1 1 
        3  7822 2 1 68 ARG HG3  H  29.763  4.845  18.512 1.00 . B B . 68 ARG HG3  1 1 
        3  7823 2 1 68 ARG HH11 H  29.803  1.847  21.777 1.00 . B B . 68 ARG HH11 1 1 
        3  7824 2 1 68 ARG HH12 H  31.185  0.925  22.270 1.00 . B B . 68 ARG HH12 1 1 
        3  7825 2 1 68 ARG HH21 H  33.436  2.820  20.435 1.00 . B B . 68 ARG HH21 1 1 
        3  7826 2 1 68 ARG HH22 H  33.241  1.476  21.511 1.00 . B B . 68 ARG HH22 1 1 
        3  7827 2 1 68 ARG N    N  27.875  7.634  20.524 1.00 . B B . 68 ARG N    1 1 
        3  7828 2 1 68 ARG NE   N  31.034  3.453  20.331 1.00 . B B . 68 ARG NE   1 1 
        3  7829 2 1 68 ARG NH1  N  30.790  1.681  21.747 1.00 . B B . 68 ARG NH1  1 1 
        3  7830 2 1 68 ARG NH2  N  32.846  2.232  20.987 1.00 . B B . 68 ARG NH2  1 1 
        3  7831 2 1 68 ARG O    O  30.293  7.038  23.121 1.00 . B B . 68 ARG O    1 1 
        3  7832 2 1 69 GLY C    C  29.177 10.095  24.407 1.00 . B B . 69 GLY C    1 1 
        3  7833 2 1 69 GLY CA   C  30.085  9.820  23.210 1.00 . B B . 69 GLY CA   1 1 
        3  7834 2 1 69 GLY H    H  28.860  9.314  21.547 1.00 . B B . 69 GLY H    1 1 
        3  7835 2 1 69 GLY HA2  H  31.011  9.382  23.560 1.00 . B B . 69 GLY HA2  1 1 
        3  7836 2 1 69 GLY HA3  H  30.306 10.760  22.722 1.00 . B B . 69 GLY HA3  1 1 
        3  7837 2 1 69 GLY N    N  29.430  8.920  22.240 1.00 . B B . 69 GLY N    1 1 
        3  7838 2 1 69 GLY O    O  29.639 10.195  25.544 1.00 . B B . 69 GLY O    1 1 
        3  7839 2 1 70 GLU C    C  26.810  9.281  26.134 1.00 . B B . 70 GLU C    1 1 
        3  7840 2 1 70 GLU CA   C  26.911 10.481  25.198 1.00 . B B . 70 GLU CA   1 1 
        3  7841 2 1 70 GLU CB   C  25.531 10.792  24.585 1.00 . B B . 70 GLU CB   1 1 
        3  7842 2 1 70 GLU CD   C  23.862  8.855  24.688 1.00 . B B . 70 GLU CD   1 1 
        3  7843 2 1 70 GLU CG   C  24.966  9.533  23.869 1.00 . B B . 70 GLU CG   1 1 
        3  7844 2 1 70 GLU H    H  27.570 10.126  23.215 1.00 . B B . 70 GLU H    1 1 
        3  7845 2 1 70 GLU HA   H  27.234 11.335  25.762 1.00 . B B . 70 GLU HA   1 1 
        3  7846 2 1 70 GLU HB2  H  24.858 11.116  25.368 1.00 . B B . 70 GLU HB2  1 1 
        3  7847 2 1 70 GLU HB3  H  25.640 11.596  23.865 1.00 . B B . 70 GLU HB3  1 1 
        3  7848 2 1 70 GLU HG2  H  24.562  9.815  22.911 1.00 . B B . 70 GLU HG2  1 1 
        3  7849 2 1 70 GLU HG3  H  25.763  8.824  23.714 1.00 . B B . 70 GLU HG3  1 1 
        3  7850 2 1 70 GLU N    N  27.881 10.215  24.140 1.00 . B B . 70 GLU N    1 1 
        3  7851 2 1 70 GLU O    O  27.659  8.389  26.116 1.00 . B B . 70 GLU O    1 1 
        3  7852 2 1 70 GLU OE1  O  23.050  9.558  25.268 1.00 . B B . 70 GLU OE1  1 1 
        3  7853 2 1 70 GLU OE2  O  23.857  7.636  24.722 1.00 . B B . 70 GLU OE2  1 1 
        3  7854 2 1 71 SER C    C  25.798  6.810  27.233 1.00 . B B . 71 SER C    1 1 
        3  7855 2 1 71 SER CA   C  25.562  8.168  27.903 1.00 . B B . 71 SER CA   1 1 
        3  7856 2 1 71 SER CB   C  24.139  8.215  28.454 1.00 . B B . 71 SER CB   1 1 
        3  7857 2 1 71 SER H    H  25.121 10.006  26.926 1.00 . B B . 71 SER H    1 1 
        3  7858 2 1 71 SER HA   H  26.256  8.282  28.722 1.00 . B B . 71 SER HA   1 1 
        3  7859 2 1 71 SER HB2  H  24.014  9.096  29.059 1.00 . B B . 71 SER HB2  1 1 
        3  7860 2 1 71 SER HB3  H  23.438  8.242  27.630 1.00 . B B . 71 SER HB3  1 1 
        3  7861 2 1 71 SER HG   H  23.554  6.376  28.679 1.00 . B B . 71 SER HG   1 1 
        3  7862 2 1 71 SER N    N  25.766  9.269  26.956 1.00 . B B . 71 SER N    1 1 
        3  7863 2 1 71 SER O    O  25.010  6.374  26.394 1.00 . B B . 71 SER O    1 1 
        3  7864 2 1 71 SER OG   O  23.908  7.061  29.249 1.00 . B B . 71 SER OG   1 1 
        3  7865 2 1 72 LYS C    C  28.534  4.316  27.607 1.00 . B B . 72 LYS C    1 1 
        3  7866 2 1 72 LYS CA   C  27.223  4.848  27.021 1.00 . B B . 72 LYS CA   1 1 
        3  7867 2 1 72 LYS CB   C  27.338  4.958  25.462 1.00 . B B . 72 LYS CB   1 1 
        3  7868 2 1 72 LYS CD   C  26.434  4.162  23.273 1.00 . B B . 72 LYS CD   1 1 
        3  7869 2 1 72 LYS CE   C  25.529  3.137  22.599 1.00 . B B . 72 LYS CE   1 1 
        3  7870 2 1 72 LYS CG   C  26.407  3.946  24.780 1.00 . B B . 72 LYS CG   1 1 
        3  7871 2 1 72 LYS H    H  27.486  6.553  28.278 1.00 . B B . 72 LYS H    1 1 
        3  7872 2 1 72 LYS HA   H  26.435  4.158  27.283 1.00 . B B . 72 LYS HA   1 1 
        3  7873 2 1 72 LYS HB2  H  27.065  5.954  25.147 1.00 . B B . 72 LYS HB2  1 1 
        3  7874 2 1 72 LYS HB3  H  28.356  4.764  25.141 1.00 . B B . 72 LYS HB3  1 1 
        3  7875 2 1 72 LYS HD2  H  26.083  5.153  23.050 1.00 . B B . 72 LYS HD2  1 1 
        3  7876 2 1 72 LYS HD3  H  27.444  4.043  22.909 1.00 . B B . 72 LYS HD3  1 1 
        3  7877 2 1 72 LYS HE2  H  25.888  2.141  22.815 1.00 . B B . 72 LYS HE2  1 1 
        3  7878 2 1 72 LYS HE3  H  24.522  3.246  22.973 1.00 . B B . 72 LYS HE3  1 1 
        3  7879 2 1 72 LYS HG2  H  26.735  2.944  25.008 1.00 . B B . 72 LYS HG2  1 1 
        3  7880 2 1 72 LYS HG3  H  25.399  4.088  25.142 1.00 . B B . 72 LYS HG3  1 1 
        3  7881 2 1 72 LYS HZ1  H  26.488  3.151  20.753 1.00 . B B . 72 LYS HZ1  1 1 
        3  7882 2 1 72 LYS HZ2  H  25.306  4.355  20.928 1.00 . B B . 72 LYS HZ2  1 1 
        3  7883 2 1 72 LYS HZ3  H  24.841  2.740  20.677 1.00 . B B . 72 LYS HZ3  1 1 
        3  7884 2 1 72 LYS N    N  26.895  6.157  27.605 1.00 . B B . 72 LYS N    1 1 
        3  7885 2 1 72 LYS NZ   N  25.542  3.363  21.129 1.00 . B B . 72 LYS NZ   1 1 
        3  7886 2 1 72 LYS O    O  29.111  3.356  27.098 1.00 . B B . 72 LYS O    1 1 
        3  7887 2 1 73 LEU C    C  30.448  5.358  30.589 1.00 . B B . 73 LEU C    1 1 
        3  7888 2 1 73 LEU CA   C  30.240  4.550  29.310 1.00 . B B . 73 LEU CA   1 1 
        3  7889 2 1 73 LEU CB   C  31.434  4.743  28.333 1.00 . B B . 73 LEU CB   1 1 
        3  7890 2 1 73 LEU CD1  C  32.690  2.657  29.096 1.00 . B B . 73 LEU CD1  1 1 
        3  7891 2 1 73 LEU CD2  C  33.926  4.598  28.033 1.00 . B B . 73 LEU CD2  1 1 
        3  7892 2 1 73 LEU CG   C  32.748  4.200  28.944 1.00 . B B . 73 LEU CG   1 1 
        3  7893 2 1 73 LEU H    H  28.496  5.717  29.036 1.00 . B B . 73 LEU H    1 1 
        3  7894 2 1 73 LEU HA   H  30.170  3.510  29.569 1.00 . B B . 73 LEU HA   1 1 
        3  7895 2 1 73 LEU HB2  H  31.236  4.216  27.412 1.00 . B B . 73 LEU HB2  1 1 
        3  7896 2 1 73 LEU HB3  H  31.552  5.791  28.112 1.00 . B B . 73 LEU HB3  1 1 
        3  7897 2 1 73 LEU HD11 H  32.216  2.411  30.034 1.00 . B B . 73 LEU HD11 1 1 
        3  7898 2 1 73 LEU HD12 H  33.691  2.245  29.091 1.00 . B B . 73 LEU HD12 1 1 
        3  7899 2 1 73 LEU HD13 H  32.123  2.217  28.284 1.00 . B B . 73 LEU HD13 1 1 
        3  7900 2 1 73 LEU HD21 H  34.853  4.267  28.477 1.00 . B B . 73 LEU HD21 1 1 
        3  7901 2 1 73 LEU HD22 H  33.944  5.672  27.917 1.00 . B B . 73 LEU HD22 1 1 
        3  7902 2 1 73 LEU HD23 H  33.808  4.134  27.064 1.00 . B B . 73 LEU HD23 1 1 
        3  7903 2 1 73 LEU HG   H  32.892  4.638  29.918 1.00 . B B . 73 LEU HG   1 1 
        3  7904 2 1 73 LEU N    N  28.999  4.958  28.673 1.00 . B B . 73 LEU N    1 1 
        3  7905 2 1 73 LEU O    O  29.889  5.039  31.638 1.00 . B B . 73 LEU O    1 1 
        3  7906 2 1 74 GLU C    C  31.677  6.430  32.957 1.00 . B B . 74 GLU C    1 1 
        3  7907 2 1 74 GLU CA   C  31.579  7.259  31.664 1.00 . B B . 74 GLU CA   1 1 
        3  7908 2 1 74 GLU CB   C  30.509  8.377  31.824 1.00 . B B . 74 GLU CB   1 1 
        3  7909 2 1 74 GLU CD   C  28.080  8.870  32.331 1.00 . B B . 74 GLU CD   1 1 
        3  7910 2 1 74 GLU CG   C  29.102  7.780  32.006 1.00 . B B . 74 GLU CG   1 1 
        3  7911 2 1 74 GLU H    H  31.691  6.602  29.632 1.00 . B B . 74 GLU H    1 1 
        3  7912 2 1 74 GLU HA   H  32.534  7.730  31.498 1.00 . B B . 74 GLU HA   1 1 
        3  7913 2 1 74 GLU HB2  H  30.748  8.982  32.686 1.00 . B B . 74 GLU HB2  1 1 
        3  7914 2 1 74 GLU HB3  H  30.515  9.002  30.943 1.00 . B B . 74 GLU HB3  1 1 
        3  7915 2 1 74 GLU HG2  H  28.799  7.299  31.089 1.00 . B B . 74 GLU HG2  1 1 
        3  7916 2 1 74 GLU HG3  H  29.111  7.056  32.804 1.00 . B B . 74 GLU HG3  1 1 
        3  7917 2 1 74 GLU N    N  31.273  6.395  30.494 1.00 . B B . 74 GLU N    1 1 
        3  7918 2 1 74 GLU O    O  31.479  6.939  34.060 1.00 . B B . 74 GLU O    1 1 
        3  7919 2 1 74 GLU OE1  O  28.438  9.845  32.970 1.00 . B B . 74 GLU OE1  1 1 
        3  7920 2 1 74 GLU OE2  O  26.936  8.687  31.947 1.00 . B B . 74 GLU OE2  1 1 
        3  7921 2 1 75 HIS C    C  32.896  4.833  35.038 1.00 . B B . 75 HIS C    1 1 
        3  7922 2 1 75 HIS CA   C  32.053  4.219  33.926 1.00 . B B . 75 HIS CA   1 1 
        3  7923 2 1 75 HIS CB   C  32.668  2.880  33.453 1.00 . B B . 75 HIS CB   1 1 
        3  7924 2 1 75 HIS CD2  C  34.576  2.309  31.730 1.00 . B B . 75 HIS CD2  1 1 
        3  7925 2 1 75 HIS CE1  C  35.350  4.312  31.441 1.00 . B B . 75 HIS CE1  1 1 
        3  7926 2 1 75 HIS CG   C  33.824  3.144  32.520 1.00 . B B . 75 HIS CG   1 1 
        3  7927 2 1 75 HIS H    H  32.101  4.789  31.891 1.00 . B B . 75 HIS H    1 1 
        3  7928 2 1 75 HIS HA   H  31.059  4.029  34.313 1.00 . B B . 75 HIS HA   1 1 
        3  7929 2 1 75 HIS HB2  H  33.015  2.312  34.305 1.00 . B B . 75 HIS HB2  1 1 
        3  7930 2 1 75 HIS HB3  H  31.915  2.305  32.927 1.00 . B B . 75 HIS HB3  1 1 
        3  7931 2 1 75 HIS HD1  H  34.019  5.241  32.742 1.00 . B B . 75 HIS HD1  1 1 
        3  7932 2 1 75 HIS HD2  H  34.442  1.240  31.649 1.00 . B B . 75 HIS HD2  1 1 
        3  7933 2 1 75 HIS HE1  H  35.941  5.147  31.095 1.00 . B B . 75 HIS HE1  1 1 
        3  7934 2 1 75 HIS HE2  H  36.212  2.714  30.420 1.00 . B B . 75 HIS HE2  1 1 
        3  7935 2 1 75 HIS N    N  31.952  5.140  32.794 1.00 . B B . 75 HIS N    1 1 
        3  7936 2 1 75 HIS ND1  N  34.336  4.416  32.320 1.00 . B B . 75 HIS ND1  1 1 
        3  7937 2 1 75 HIS NE2  N  35.538  3.049  31.050 1.00 . B B . 75 HIS NE2  1 1 
        3  7938 2 1 75 HIS O    O  32.366  5.479  35.941 1.00 . B B . 75 HIS O    1 1 
        3  7939 2 1 76 HIS C    C  35.746  6.470  35.470 1.00 . B B . 76 HIS C    1 1 
        3  7940 2 1 76 HIS CA   C  35.124  5.171  35.968 1.00 . B B . 76 HIS CA   1 1 
        3  7941 2 1 76 HIS CB   C  36.222  4.147  36.254 1.00 . B B . 76 HIS CB   1 1 
        3  7942 2 1 76 HIS CD2  C  35.374  2.547  38.160 1.00 . B B . 76 HIS CD2  1 1 
        3  7943 2 1 76 HIS CE1  C  34.651  0.929  36.912 1.00 . B B . 76 HIS CE1  1 1 
        3  7944 2 1 76 HIS CG   C  35.603  2.916  36.858 1.00 . B B . 76 HIS CG   1 1 
        3  7945 2 1 76 HIS H    H  34.575  4.107  34.223 1.00 . B B . 76 HIS H    1 1 
        3  7946 2 1 76 HIS HA   H  34.590  5.372  36.892 1.00 . B B . 76 HIS HA   1 1 
        3  7947 2 1 76 HIS HB2  H  36.723  3.885  35.332 1.00 . B B . 76 HIS HB2  1 1 
        3  7948 2 1 76 HIS HB3  H  36.938  4.566  36.946 1.00 . B B . 76 HIS HB3  1 1 
        3  7949 2 1 76 HIS HD1  H  35.144  1.826  35.100 1.00 . B B . 76 HIS HD1  1 1 
        3  7950 2 1 76 HIS HD2  H  35.615  3.144  39.027 1.00 . B B . 76 HIS HD2  1 1 
        3  7951 2 1 76 HIS HE1  H  34.211 -0.001  36.586 1.00 . B B . 76 HIS HE1  1 1 
        3  7952 2 1 76 HIS HE2  H  34.492  0.787  38.983 1.00 . B B . 76 HIS HE2  1 1 
        3  7953 2 1 76 HIS N    N  34.208  4.631  34.966 1.00 . B B . 76 HIS N    1 1 
        3  7954 2 1 76 HIS ND1  N  35.134  1.869  36.079 1.00 . B B . 76 HIS ND1  1 1 
        3  7955 2 1 76 HIS NE2  N  34.773  1.292  38.192 1.00 . B B . 76 HIS NE2  1 1 
        3  7956 2 1 76 HIS O    O  35.781  6.741  34.270 1.00 . B B . 76 HIS O    1 1 
        3  7957 2 1 77 HIS C    C  37.694  9.069  37.212 1.00 . B B . 77 HIS C    1 1 
        3  7958 2 1 77 HIS CA   C  36.862  8.548  36.053 1.00 . B B . 77 HIS CA   1 1 
        3  7959 2 1 77 HIS CB   C  35.781  9.573  35.685 1.00 . B B . 77 HIS CB   1 1 
        3  7960 2 1 77 HIS CD2  C  37.036 11.140  33.986 1.00 . B B . 77 HIS CD2  1 1 
        3  7961 2 1 77 HIS CE1  C  37.155 12.915  35.222 1.00 . B B . 77 HIS CE1  1 1 
        3  7962 2 1 77 HIS CG   C  36.429 10.835  35.179 1.00 . B B . 77 HIS CG   1 1 
        3  7963 2 1 77 HIS H    H  36.186  7.004  37.348 1.00 . B B . 77 HIS H    1 1 
        3  7964 2 1 77 HIS HA   H  37.512  8.405  35.201 1.00 . B B . 77 HIS HA   1 1 
        3  7965 2 1 77 HIS HB2  H  35.147  9.162  34.915 1.00 . B B . 77 HIS HB2  1 1 
        3  7966 2 1 77 HIS HB3  H  35.186  9.800  36.558 1.00 . B B . 77 HIS HB3  1 1 
        3  7967 2 1 77 HIS HD1  H  36.173 12.095  36.863 1.00 . B B . 77 HIS HD1  1 1 
        3  7968 2 1 77 HIS HD2  H  37.139 10.464  33.150 1.00 . B B . 77 HIS HD2  1 1 
        3  7969 2 1 77 HIS HE1  H  37.365 13.917  35.568 1.00 . B B . 77 HIS HE1  1 1 
        3  7970 2 1 77 HIS HE2  H  37.961 12.937  33.302 1.00 . B B . 77 HIS HE2  1 1 
        3  7971 2 1 77 HIS N    N  36.242  7.272  36.407 1.00 . B B . 77 HIS N    1 1 
        3  7972 2 1 77 HIS ND1  N  36.517 11.982  35.952 1.00 . B B . 77 HIS ND1  1 1 
        3  7973 2 1 77 HIS NE2  N  37.494 12.453  34.015 1.00 . B B . 77 HIS NE2  1 1 
        3  7974 2 1 77 HIS O    O  37.278  9.006  38.368 1.00 . B B . 77 HIS O    1 1 
        3  7975 2 1 78 HIS C    C  39.227 11.420  38.466 1.00 . B B . 78 HIS C    1 1 
        3  7976 2 1 78 HIS CA   C  39.772 10.109  37.914 1.00 . B B . 78 HIS CA   1 1 
        3  7977 2 1 78 HIS CB   C  41.163 10.336  37.315 1.00 . B B . 78 HIS CB   1 1 
        3  7978 2 1 78 HIS CD2  C  42.419  8.044  37.600 1.00 . B B . 78 HIS CD2  1 1 
        3  7979 2 1 78 HIS CE1  C  42.310  7.365  35.546 1.00 . B B . 78 HIS CE1  1 1 
        3  7980 2 1 78 HIS CG   C  41.754  9.016  36.895 1.00 . B B . 78 HIS CG   1 1 
        3  7981 2 1 78 HIS H    H  39.158  9.605  35.956 1.00 . B B . 78 HIS H    1 1 
        3  7982 2 1 78 HIS HA   H  39.852  9.395  38.722 1.00 . B B . 78 HIS HA   1 1 
        3  7983 2 1 78 HIS HB2  H  41.084 10.985  36.455 1.00 . B B . 78 HIS HB2  1 1 
        3  7984 2 1 78 HIS HB3  H  41.801 10.796  38.055 1.00 . B B . 78 HIS HB3  1 1 
        3  7985 2 1 78 HIS HD1  H  41.283  9.026  34.829 1.00 . B B . 78 HIS HD1  1 1 
        3  7986 2 1 78 HIS HD2  H  42.636  8.081  38.657 1.00 . B B . 78 HIS HD2  1 1 
        3  7987 2 1 78 HIS HE1  H  42.418  6.769  34.651 1.00 . B B . 78 HIS HE1  1 1 
        3  7988 2 1 78 HIS HE2  H  43.248  6.179  36.977 1.00 . B B . 78 HIS HE2  1 1 
        3  7989 2 1 78 HIS N    N  38.879  9.581  36.895 1.00 . B B . 78 HIS N    1 1 
        3  7990 2 1 78 HIS ND1  N  41.696  8.561  35.586 1.00 . B B . 78 HIS ND1  1 1 
        3  7991 2 1 78 HIS NE2  N  42.769  7.002  36.747 1.00 . B B . 78 HIS NE2  1 1 
        3  7992 2 1 78 HIS O    O  38.563 12.179  37.760 1.00 . B B . 78 HIS O    1 1 
        3  7993 2 1 79 HIS C    C  39.565 14.128  39.635 1.00 . B B . 79 HIS C    1 1 
        3  7994 2 1 79 HIS CA   C  39.045 12.901  40.378 1.00 . B B . 79 HIS CA   1 1 
        3  7995 2 1 79 HIS CB   C  39.523 12.937  41.833 1.00 . B B . 79 HIS CB   1 1 
        3  7996 2 1 79 HIS CD2  C  37.691 11.744  43.297 1.00 . B B . 79 HIS CD2  1 1 
        3  7997 2 1 79 HIS CE1  C  38.643  9.805  43.473 1.00 . B B . 79 HIS CE1  1 1 
        3  7998 2 1 79 HIS CG   C  38.875 11.818  42.606 1.00 . B B . 79 HIS CG   1 1 
        3  7999 2 1 79 HIS H    H  40.050 11.039  40.250 1.00 . B B . 79 HIS H    1 1 
        3  8000 2 1 79 HIS HA   H  37.965 12.914  40.362 1.00 . B B . 79 HIS HA   1 1 
        3  8001 2 1 79 HIS HB2  H  40.596 12.818  41.860 1.00 . B B . 79 HIS HB2  1 1 
        3  8002 2 1 79 HIS HB3  H  39.254 13.883  42.278 1.00 . B B . 79 HIS HB3  1 1 
        3  8003 2 1 79 HIS HD1  H  40.325 10.294  42.351 1.00 . B B . 79 HIS HD1  1 1 
        3  8004 2 1 79 HIS HD2  H  36.980 12.550  43.400 1.00 . B B . 79 HIS HD2  1 1 
        3  8005 2 1 79 HIS HE1  H  38.844  8.777  43.736 1.00 . B B . 79 HIS HE1  1 1 
        3  8006 2 1 79 HIS HE2  H  36.800 10.138  44.384 1.00 . B B . 79 HIS HE2  1 1 
        3  8007 2 1 79 HIS N    N  39.516 11.680  39.737 1.00 . B B . 79 HIS N    1 1 
        3  8008 2 1 79 HIS ND1  N  39.465 10.570  42.732 1.00 . B B . 79 HIS ND1  1 1 
        3  8009 2 1 79 HIS NE2  N  37.546 10.472  43.843 1.00 . B B . 79 HIS NE2  1 1 
        3  8010 2 1 79 HIS O    O  38.832 15.093  39.419 1.00 . B B . 79 HIS O    1 1 
        3  8011 2 1 80 HIS C    C  40.968 15.229  37.076 1.00 . B B . 80 HIS C    1 1 
        3  8012 2 1 80 HIS CA   C  41.449 15.198  38.525 1.00 . B B . 80 HIS CA   1 1 
        3  8013 2 1 80 HIS CB   C  42.972 15.062  38.557 1.00 . B B . 80 HIS CB   1 1 
        3  8014 2 1 80 HIS CD2  C  43.797 12.568  38.471 1.00 . B B . 80 HIS CD2  1 1 
        3  8015 2 1 80 HIS CE1  C  43.786 12.306  36.320 1.00 . B B . 80 HIS CE1  1 1 
        3  8016 2 1 80 HIS CG   C  43.376 13.757  37.928 1.00 . B B . 80 HIS CG   1 1 
        3  8017 2 1 80 HIS H    H  41.373 13.289  39.447 1.00 . B B . 80 HIS H    1 1 
        3  8018 2 1 80 HIS HA   H  41.174 16.128  39.004 1.00 . B B . 80 HIS HA   1 1 
        3  8019 2 1 80 HIS HB2  H  43.417 15.880  38.008 1.00 . B B . 80 HIS HB2  1 1 
        3  8020 2 1 80 HIS HB3  H  43.314 15.089  39.581 1.00 . B B . 80 HIS HB3  1 1 
        3  8021 2 1 80 HIS HD1  H  43.124 14.229  35.878 1.00 . B B . 80 HIS HD1  1 1 
        3  8022 2 1 80 HIS HD2  H  43.910 12.373  39.527 1.00 . B B . 80 HIS HD2  1 1 
        3  8023 2 1 80 HIS HE1  H  43.884 11.874  35.335 1.00 . B B . 80 HIS HE1  1 1 
        3  8024 2 1 80 HIS HE2  H  44.367 10.730  37.550 1.00 . B B . 80 HIS HE2  1 1 
        3  8025 2 1 80 HIS N    N  40.836 14.084  39.247 1.00 . B B . 80 HIS N    1 1 
        3  8026 2 1 80 HIS ND1  N  43.376 13.566  36.555 1.00 . B B . 80 HIS ND1  1 1 
        3  8027 2 1 80 HIS NE2  N  44.055 11.654  37.454 1.00 . B B . 80 HIS NE2  1 1 
        3  8028 2 1 80 HIS O    O  40.835 14.165  36.494 1.00 . B B . 80 HIS O    1 1 
        4  8029 1 1  1 MET C    C  -3.879  6.646  -7.955 1.00 . A A .  1 MET C    1 1 
        4  8030 1 1  1 MET CA   C  -4.780  7.823  -8.312 1.00 . A A .  1 MET CA   1 1 
        4  8031 1 1  1 MET CB   C  -4.907  7.939  -9.832 1.00 . A A .  1 MET CB   1 1 
        4  8032 1 1  1 MET CE   C  -7.427  7.886 -12.161 1.00 . A A .  1 MET CE   1 1 
        4  8033 1 1  1 MET CG   C  -5.927  9.027 -10.177 1.00 . A A .  1 MET CG   1 1 
        4  8034 1 1  1 MET H1   H  -3.779  9.633  -8.550 1.00 . A A .  1 MET H1   1 1 
        4  8035 1 1  1 MET H2   H  -3.439  8.841  -7.086 1.00 . A A .  1 MET H2   1 1 
        4  8036 1 1  1 MET H3   H  -4.926  9.637  -7.300 1.00 . A A .  1 MET H3   1 1 
        4  8037 1 1  1 MET HA   H  -5.758  7.670  -7.879 1.00 . A A .  1 MET HA   1 1 
        4  8038 1 1  1 MET HB2  H  -3.946  8.200 -10.253 1.00 . A A .  1 MET HB2  1 1 
        4  8039 1 1  1 MET HB3  H  -5.234  6.996 -10.240 1.00 . A A .  1 MET HB3  1 1 
        4  8040 1 1  1 MET HE1  H  -7.636  7.739 -13.212 1.00 . A A .  1 MET HE1  1 1 
        4  8041 1 1  1 MET HE2  H  -8.321  8.226 -11.656 1.00 . A A .  1 MET HE2  1 1 
        4  8042 1 1  1 MET HE3  H  -7.105  6.954 -11.728 1.00 . A A .  1 MET HE3  1 1 
        4  8043 1 1  1 MET HG2  H  -6.876  8.789  -9.720 1.00 . A A .  1 MET HG2  1 1 
        4  8044 1 1  1 MET HG3  H  -5.577  9.976  -9.800 1.00 . A A .  1 MET HG3  1 1 
        4  8045 1 1  1 MET N    N  -4.186  9.078  -7.771 1.00 . A A .  1 MET N    1 1 
        4  8046 1 1  1 MET O    O  -4.309  5.691  -7.308 1.00 . A A .  1 MET O    1 1 
        4  8047 1 1  1 MET SD   S  -6.123  9.132 -11.977 1.00 . A A .  1 MET SD   1 1 
        4  8048 1 1  2 SER C    C  -1.154  5.758  -6.671 1.00 . A A .  2 SER C    1 1 
        4  8049 1 1  2 SER CA   C  -1.654  5.661  -8.109 1.00 . A A .  2 SER CA   1 1 
        4  8050 1 1  2 SER CB   C  -0.466  5.769  -9.078 1.00 . A A .  2 SER CB   1 1 
        4  8051 1 1  2 SER H    H  -2.337  7.507  -8.896 1.00 . A A .  2 SER H    1 1 
        4  8052 1 1  2 SER HA   H  -2.134  4.699  -8.247 1.00 . A A .  2 SER HA   1 1 
        4  8053 1 1  2 SER HB2  H   0.008  4.806  -9.192 1.00 . A A .  2 SER HB2  1 1 
        4  8054 1 1  2 SER HB3  H  -0.823  6.106 -10.043 1.00 . A A .  2 SER HB3  1 1 
        4  8055 1 1  2 SER HG   H   0.931  6.276  -7.823 1.00 . A A .  2 SER HG   1 1 
        4  8056 1 1  2 SER N    N  -2.623  6.722  -8.384 1.00 . A A .  2 SER N    1 1 
        4  8057 1 1  2 SER O    O  -1.550  6.652  -5.924 1.00 . A A .  2 SER O    1 1 
        4  8058 1 1  2 SER OG   O   0.484  6.693  -8.563 1.00 . A A .  2 SER OG   1 1 
        4  8059 1 1  3 GLU C    C   1.224  5.994  -4.752 1.00 . A A .  3 GLU C    1 1 
        4  8060 1 1  3 GLU CA   C   0.270  4.822  -4.943 1.00 . A A .  3 GLU CA   1 1 
        4  8061 1 1  3 GLU CB   C   1.016  3.510  -4.689 1.00 . A A .  3 GLU CB   1 1 
        4  8062 1 1  3 GLU CD   C   0.761  1.020  -4.483 1.00 . A A .  3 GLU CD   1 1 
        4  8063 1 1  3 GLU CG   C   0.022  2.344  -4.680 1.00 . A A .  3 GLU CG   1 1 
        4  8064 1 1  3 GLU H    H  -0.002  4.142  -6.930 1.00 . A A .  3 GLU H    1 1 
        4  8065 1 1  3 GLU HA   H  -0.533  4.912  -4.229 1.00 . A A .  3 GLU HA   1 1 
        4  8066 1 1  3 GLU HB2  H   1.745  3.356  -5.472 1.00 . A A .  3 GLU HB2  1 1 
        4  8067 1 1  3 GLU HB3  H   1.518  3.557  -3.734 1.00 . A A .  3 GLU HB3  1 1 
        4  8068 1 1  3 GLU HG2  H  -0.683  2.484  -3.874 1.00 . A A .  3 GLU HG2  1 1 
        4  8069 1 1  3 GLU HG3  H  -0.509  2.320  -5.620 1.00 . A A .  3 GLU HG3  1 1 
        4  8070 1 1  3 GLU N    N  -0.280  4.830  -6.292 1.00 . A A .  3 GLU N    1 1 
        4  8071 1 1  3 GLU O    O   1.904  6.418  -5.688 1.00 . A A .  3 GLU O    1 1 
        4  8072 1 1  3 GLU OE1  O   1.968  1.056  -4.313 1.00 . A A .  3 GLU OE1  1 1 
        4  8073 1 1  3 GLU OE2  O   0.104 -0.007  -4.501 1.00 . A A .  3 GLU OE2  1 1 
        4  8074 1 1  4 LEU C    C   1.909  8.790  -4.191 1.00 . A A .  4 LEU C    1 1 
        4  8075 1 1  4 LEU CA   C   2.150  7.635  -3.221 1.00 . A A .  4 LEU CA   1 1 
        4  8076 1 1  4 LEU CB   C   3.606  7.178  -3.318 1.00 . A A .  4 LEU CB   1 1 
        4  8077 1 1  4 LEU CD1  C   5.286  5.466  -2.628 1.00 . A A .  4 LEU CD1  1 1 
        4  8078 1 1  4 LEU CD2  C   3.545  6.216  -0.968 1.00 . A A .  4 LEU CD2  1 1 
        4  8079 1 1  4 LEU CG   C   3.834  5.923  -2.458 1.00 . A A .  4 LEU CG   1 1 
        4  8080 1 1  4 LEU H    H   0.705  6.135  -2.825 1.00 . A A .  4 LEU H    1 1 
        4  8081 1 1  4 LEU HA   H   1.953  7.980  -2.220 1.00 . A A .  4 LEU HA   1 1 
        4  8082 1 1  4 LEU HB2  H   3.836  6.947  -4.349 1.00 . A A .  4 LEU HB2  1 1 
        4  8083 1 1  4 LEU HB3  H   4.254  7.969  -2.976 1.00 . A A .  4 LEU HB3  1 1 
        4  8084 1 1  4 LEU HD11 H   5.952  6.272  -2.359 1.00 . A A .  4 LEU HD11 1 1 
        4  8085 1 1  4 LEU HD12 H   5.456  5.187  -3.659 1.00 . A A .  4 LEU HD12 1 1 
        4  8086 1 1  4 LEU HD13 H   5.472  4.615  -1.990 1.00 . A A .  4 LEU HD13 1 1 
        4  8087 1 1  4 LEU HD21 H   3.945  7.184  -0.694 1.00 . A A .  4 LEU HD21 1 1 
        4  8088 1 1  4 LEU HD22 H   4.002  5.453  -0.351 1.00 . A A .  4 LEU HD22 1 1 
        4  8089 1 1  4 LEU HD23 H   2.480  6.206  -0.798 1.00 . A A .  4 LEU HD23 1 1 
        4  8090 1 1  4 LEU HG   H   3.177  5.137  -2.803 1.00 . A A .  4 LEU HG   1 1 
        4  8091 1 1  4 LEU N    N   1.270  6.514  -3.530 1.00 . A A .  4 LEU N    1 1 
        4  8092 1 1  4 LEU O    O   2.677  9.751  -4.237 1.00 . A A .  4 LEU O    1 1 
        4  8093 1 1  5 PHE C    C   0.259 11.056  -5.209 1.00 . A A .  5 PHE C    1 1 
        4  8094 1 1  5 PHE CA   C   0.497  9.733  -5.921 1.00 . A A .  5 PHE CA   1 1 
        4  8095 1 1  5 PHE CB   C  -0.760  9.340  -6.706 1