NMR Restraints Grid

Result table
 (Save to zip file containing files for each block)

image mrblock_id pdb_id bmrb_id cing stage program type subtype item_count
400830 1v63 10111 cing 4-filtered-FRED STAR entry full 2076


data_FRED_restraints_with_modified_coordinates_PDB_code_1v63

# This FRED archive file contains, for PDB entry <1v63>:
# 
# - Coordinates and sequence information from the PDB mmCIF file
# - NMR restraints from the PDB MR file
# 
# In this file, the coordinates and NMR restraints share the same atom names,
# and in this way can differ from the data deposited at the wwPDB. To achieve
# this aim, the NMR restraints were parsed from their original format files, and
# the coordinates and NMR restraints information were subsequently harmonized.
# 
# Due to the complexity of this harmonization process and the filtering process
# used in creating these files, the NMR restraints information in these files
# may differ significantly from that in the originally deposited file. Other 
# modifications could have occurred to the NMR restraints information, or data 
# could have been lost because of parsing or conversion errors. The PDB file 
# remains the authoritative reference for the atomic coordinates and the 
# originally deposited restraints files remain the primary reference for these 
# data.
# 
# This file is generated at the BioMagResBank (BMRB) in collaboration with the 
# PDBe (formerly MSD) group at the European Bioinformatics Institute (EBI) and 
# the CMBI/IMM group at the Radboud University of Nijmegen.
# 
# Several software packages were used to produce this file:
# 
# - Wattos (BMRB and CMBI/IMM).
# - FormatConverter and NMRStarExport (PDBe).
# - CCPN framework (http://www.ccpn.ac.uk/).
# 
# More information about this process can be found in the references below.
# Please cite the original reference for this PDB entry.
# 
# JF Doreleijers, A Nederveen, W Vranken, J Lin, AM Bonvin, R Kaptein, JL
# Markley, and EL Ulrich (2005). BioMagResBank databases DOCR and FRED
# containing converted and filtered sets of experimental NMR restraints and
# coordinates from over 500 protein PDB structures. J. Biomol. NMR 32, 1-12.
# 
# WF Vranken, W Boucher, TJ Stevens, RH Fogh, A Pajon, M Llinas, EL Ulrich, JL
# Markley, J Ionides, ED Laue (2005). The CCPN data model for NMR spectroscopy:
# development of a software pipeline. Proteins 59, 687-696. 
# 
# JF Doreleijers, W Vranken, C Penkett, J Lin, CF Schulte, G Vuister, G Vriend,
# JL Markley, EL Ulrich. BioMagResBank database `NMR Restraints Grid` with
# curated sets of experimental NMR restraints for over 4,000 protein and nucleic
# acid PDB entries. (in preparation)




save_Conversion_project_for_entry_Name_1
    _Study_list.Sf_category  study_list
    _Study_list.Entry_ID     1
    _Study_list.ID           1

    loop_
       _Study.ID
       _Study.Name
       _Study.Type
       _Study.Details
       _Study.Entry_ID
       _Study.Study_list_ID

       1 "Conversion project for entry 1" NMR . 1 1 
    stop_

save_


save_originalConstraints_1
    _Entry.Sf_category          entry_information
    _Entry.ID                   1
    _Entry.Title                "Data for entry 1"
    _Entry.NMR_STAR_version     3.1.0.8
    _Entry.Experimental_method  NMR
    _Entry.Details              .

save_


save_assembly_1v63
    _Assembly.Sf_category           assembly
    _Assembly.Entry_ID              1
    _Assembly.ID                    1
    _Assembly.Name                  1v63
    _Assembly.Number_of_components  1
    _Assembly.Organic_ligands       .
    _Assembly.Metal_ions            .
    _Assembly.Paramagnetic          .
    _Assembly.Thiol_state           "not present"
    _Assembly.Molecular_mass        11578.95

    loop_
       _Entity_assembly.ID
       _Entity_assembly.Entity_assembly_name
       _Entity_assembly.Entity_ID
       _Entity_assembly.Entity_label
       _Entity_assembly.Asym_ID
       _Entity_assembly.Details
       _Entity_assembly.Entry_ID
       _Entity_assembly.Assembly_ID

       1 . 1 $Nucleolar_transcription_factor_1 A . 1 1 
    stop_

save_


save_Nucleolar_transcription_factor_1
    _Entity.Sf_category                  entity
    _Entity.Entry_ID                     1
    _Entity.ID                           1
    _Entity.Name                         "Nucleolar transcription factor 1"
    _Entity.Type                         polymer
    _Entity.Polymer_type                 polypeptide(L)
    _Entity.Polymer_seq_one_letter_code  GSSGSSGPKKPPMNGYQKFSQELLSNGELNHLPLKERMVEIGSRWQRISQSQKEHYKKLAEEQQRQYKVHLDLWVKSLSPQDRAAYKEYISNKRKSGPSSG
    _Entity.Number_of_monomers           101

    loop_
       _Entity_comp_index.ID
       _Entity_comp_index.Comp_ID
       _Entity_comp_index.Comp_label
       _Entity_comp_index.Entry_ID
       _Entity_comp_index.Entity_ID

         1 GLY . 1 1 
         2 SER . 1 1 
         3 SER . 1 1 
         4 GLY . 1 1 
         5 SER . 1 1 
         6 SER . 1 1 
         7 GLY . 1 1 
         8 PRO . 1 1 
         9 LYS . 1 1 
        10 LYS . 1 1 
        11 PRO . 1 1 
        12 PRO . 1 1 
        13 MET . 1 1 
        14 ASN . 1 1 
        15 GLY . 1 1 
        16 TYR . 1 1 
        17 GLN . 1 1 
        18 LYS . 1 1 
        19 PHE . 1 1 
        20 SER . 1 1 
        21 GLN . 1 1 
        22 GLU . 1 1 
        23 LEU . 1 1 
        24 LEU . 1 1 
        25 SER . 1 1 
        26 ASN . 1 1 
        27 GLY . 1 1 
        28 GLU . 1 1 
        29 LEU . 1 1 
        30 ASN . 1 1 
        31 HIS . 1 1 
        32 LEU . 1 1 
        33 PRO . 1 1 
        34 LEU . 1 1 
        35 LYS . 1 1 
        36 GLU . 1 1 
        37 ARG . 1 1 
        38 MET . 1 1 
        39 VAL . 1 1 
        40 GLU . 1 1 
        41 ILE . 1 1 
        42 GLY . 1 1 
        43 SER . 1 1 
        44 ARG . 1 1 
        45 TRP . 1 1 
        46 GLN . 1 1 
        47 ARG . 1 1 
        48 ILE . 1 1 
        49 SER . 1 1 
        50 GLN . 1 1 
        51 SER . 1 1 
        52 GLN . 1 1 
        53 LYS . 1 1 
        54 GLU . 1 1 
        55 HIS . 1 1 
        56 TYR . 1 1 
        57 LYS . 1 1 
        58 LYS . 1 1 
        59 LEU . 1 1 
        60 ALA . 1 1 
        61 GLU . 1 1 
        62 GLU . 1 1 
        63 GLN . 1 1 
        64 GLN . 1 1 
        65 ARG . 1 1 
        66 GLN . 1 1 
        67 TYR . 1 1 
        68 LYS . 1 1 
        69 VAL . 1 1 
        70 HIS . 1 1 
        71 LEU . 1 1 
        72 ASP . 1 1 
        73 LEU . 1 1 
        74 TRP . 1 1 
        75 VAL . 1 1 
        76 LYS . 1 1 
        77 SER . 1 1 
        78 LEU . 1 1 
        79 SER . 1 1 
        80 PRO . 1 1 
        81 GLN . 1 1 
        82 ASP . 1 1 
        83 ARG . 1 1 
        84 ALA . 1 1 
        85 ALA . 1 1 
        86 TYR . 1 1 
        87 LYS . 1 1 
        88 GLU . 1 1 
        89 TYR . 1 1 
        90 ILE . 1 1 
        91 SER . 1 1 
        92 ASN . 1 1 
        93 LYS . 1 1 
        94 ARG . 1 1 
        95 LYS . 1 1 
        96 SER . 1 1 
        97 GLY . 1 1 
        98 PRO . 1 1 
        99 SER . 1 1 
       100 SER . 1 1 
       101 GLY . 1 1 
    stop_

    loop_
       _Entity_poly_seq.Mon_ID
       _Entity_poly_seq.Num
       _Entity_poly_seq.Comp_index_ID
       _Entity_poly_seq.Entry_ID
       _Entity_poly_seq.Entity_ID

       GLY   1   1 1 1 
       SER   2   2 1 1 
       SER   3   3 1 1 
       GLY   4   4 1 1 
       SER   5   5 1 1 
       SER   6   6 1 1 
       GLY   7   7 1 1 
       PRO   8   8 1 1 
       LYS   9   9 1 1 
       LYS  10  10 1 1 
       PRO  11  11 1 1 
       PRO  12  12 1 1 
       MET  13  13 1 1 
       ASN  14  14 1 1 
       GLY  15  15 1 1 
       TYR  16  16 1 1 
       GLN  17  17 1 1 
       LYS  18  18 1 1 
       PHE  19  19 1 1 
       SER  20  20 1 1 
       GLN  21  21 1 1 
       GLU  22  22 1 1 
       LEU  23  23 1 1 
       LEU  24  24 1 1 
       SER  25  25 1 1 
       ASN  26  26 1 1 
       GLY  27  27 1 1 
       GLU  28  28 1 1 
       LEU  29  29 1 1 
       ASN  30  30 1 1 
       HIS  31  31 1 1 
       LEU  32  32 1 1 
       PRO  33  33 1 1 
       LEU  34  34 1 1 
       LYS  35  35 1 1 
       GLU  36  36 1 1 
       ARG  37  37 1 1 
       MET  38  38 1 1 
       VAL  39  39 1 1 
       GLU  40  40 1 1 
       ILE  41  41 1 1 
       GLY  42  42 1 1 
       SER  43  43 1 1 
       ARG  44  44 1 1 
       TRP  45  45 1 1 
       GLN  46  46 1 1 
       ARG  47  47 1 1 
       ILE  48  48 1 1 
       SER  49  49 1 1 
       GLN  50  50 1 1 
       SER  51  51 1 1 
       GLN  52  52 1 1 
       LYS  53  53 1 1 
       GLU  54  54 1 1 
       HIS  55  55 1 1 
       TYR  56  56 1 1 
       LYS  57  57 1 1 
       LYS  58  58 1 1 
       LEU  59  59 1 1 
       ALA  60  60 1 1 
       GLU  61  61 1 1 
       GLU  62  62 1 1 
       GLN  63  63 1 1 
       GLN  64  64 1 1 
       ARG  65  65 1 1 
       GLN  66  66 1 1 
       TYR  67  67 1 1 
       LYS  68  68 1 1 
       VAL  69  69 1 1 
       HIS  70  70 1 1 
       LEU  71  71 1 1 
       ASP  72  72 1 1 
       LEU  73  73 1 1 
       TRP  74  74 1 1 
       VAL  75  75 1 1 
       LYS  76  76 1 1 
       SER  77  77 1 1 
       LEU  78  78 1 1 
       SER  79  79 1 1 
       PRO  80  80 1 1 
       GLN  81  81 1 1 
       ASP  82  82 1 1 
       ARG  83  83 1 1 
       ALA  84  84 1 1 
       ALA  85  85 1 1 
       TYR  86  86 1 1 
       LYS  87  87 1 1 
       GLU  88  88 1 1 
       TYR  89  89 1 1 
       ILE  90  90 1 1 
       SER  91  91 1 1 
       ASN  92  92 1 1 
       LYS  93  93 1 1 
       ARG  94  94 1 1 
       LYS  95  95 1 1 
       SER  96  96 1 1 
       GLY  97  97 1 1 
       PRO  98  98 1 1 
       SER  99  99 1 1 
       SER 100 100 1 1 
       GLY 101 101 1 1 
    stop_

save_


save_DYANA/DIANA_distance_constraints_3_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  1
    _Distance_constraint_list.Constraint_type     NOE
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

          1 1 . . . 1 1 
          2 1 . . . 1 1 
          3 1 . . . 1 1 
          4 1 . . . 1 1 
          5 1 . . . 1 1 
          6 1 . . . 1 1 
          7 1 . . . 1 1 
          8 1 . . . 1 1 
          9 1 . . . 1 1 
         10 1 . . . 1 1 
         11 1 . . . 1 1 
         12 1 . . . 1 1 
         13 1 . . . 1 1 
         14 1 . . . 1 1 
         15 1 . . . 1 1 
         16 1 . . . 1 1 
         17 1 . . . 1 1 
         18 1 . . . 1 1 
         19 1 . . . 1 1 
         20 1 . . . 1 1 
         21 1 . . . 1 1 
         22 1 . . . 1 1 
         23 1 . . . 1 1 
         24 1 . . . 1 1 
         25 1 . . . 1 1 
         26 1 . . . 1 1 
         27 1 . . . 1 1 
         28 1 . . . 1 1 
         29 1 . . . 1 1 
         30 1 . . . 1 1 
         31 1 . . . 1 1 
         32 1 . . . 1 1 
         33 1 . . . 1 1 
         34 1 . . . 1 1 
         35 1 . . . 1 1 
         36 1 . . . 1 1 
         37 1 . . . 1 1 
         38 1 . . . 1 1 
         39 1 . . . 1 1 
         40 1 . . . 1 1 
         41 1 . . . 1 1 
         42 1 . . . 1 1 
         43 1 . . . 1 1 
         44 1 . . . 1 1 
         45 1 . . . 1 1 
         46 1 . . . 1 1 
         47 1 . . . 1 1 
         48 1 . . . 1 1 
         49 1 . . . 1 1 
         50 1 . . . 1 1 
         51 1 . . . 1 1 
         52 1 . . . 1 1 
         53 1 . . . 1 1 
         54 1 . . . 1 1 
         55 1 . . . 1 1 
         56 1 . . . 1 1 
         57 1 . . . 1 1 
         58 1 . . . 1 1 
         59 1 . . . 1 1 
         60 1 . . . 1 1 
         61 1 . . . 1 1 
         62 1 . . . 1 1 
         63 1 . . . 1 1 
         64 1 . . . 1 1 
         65 1 . . . 1 1 
         66 1 . . . 1 1 
         67 1 . . . 1 1 
         68 1 . . . 1 1 
         69 1 . . . 1 1 
         70 1 . . . 1 1 
         71 1 . . . 1 1 
         72 1 . . . 1 1 
         73 1 . . . 1 1 
         74 1 . . . 1 1 
         75 1 . . . 1 1 
         76 1 . . . 1 1 
         77 1 . . . 1 1 
         78 1 . . . 1 1 
         79 1 . . . 1 1 
         80 1 . . . 1 1 
         81 1 . . . 1 1 
         82 1 . . . 1 1 
         83 1 . . . 1 1 
         84 1 . . . 1 1 
         85 1 . . . 1 1 
         86 1 . . . 1 1 
         87 1 . . . 1 1 
         88 1 . . . 1 1 
         89 1 . . . 1 1 
         90 1 . . . 1 1 
         91 1 . . . 1 1 
         92 1 . . . 1 1 
         93 1 . . . 1 1 
         94 1 . . . 1 1 
         95 1 . . . 1 1 
         96 1 . . . 1 1 
         97 1 . . . 1 1 
         98 1 . . . 1 1 
         99 1 . . . 1 1 
        100 1 . . . 1 1 
        101 1 . . . 1 1 
        102 1 . . . 1 1 
        103 1 . . . 1 1 
        104 1 . . . 1 1 
        105 1 . . . 1 1 
        106 1 . . . 1 1 
        107 1 . . . 1 1 
        108 1 . . . 1 1 
        109 1 . . . 1 1 
        110 1 . . . 1 1 
        111 1 . . . 1 1 
        112 1 . . . 1 1 
        113 1 . . . 1 1 
        114 1 . . . 1 1 
        115 1 . . . 1 1 
        116 1 . . . 1 1 
        117 1 . . . 1 1 
        118 1 . . . 1 1 
        119 1 . . . 1 1 
        120 1 . . . 1 1 
        121 1 . . . 1 1 
        122 1 . . . 1 1 
        123 1 . . . 1 1 
        124 1 . . . 1 1 
        125 1 . . . 1 1 
        126 1 . . . 1 1 
        127 1 . . . 1 1 
        128 1 . . . 1 1 
        129 1 . . . 1 1 
        130 1 . . . 1 1 
        131 1 . . . 1 1 
        132 1 . . . 1 1 
        133 1 . . . 1 1 
        134 1 . . . 1 1 
        135 1 . . . 1 1 
        136 1 . . . 1 1 
        137 1 . . . 1 1 
        138 1 . . . 1 1 
        139 1 . . . 1 1 
        140 1 . . . 1 1 
        141 1 . . . 1 1 
        142 1 . . . 1 1 
        143 1 . . . 1 1 
        144 1 . . . 1 1 
        145 1 . . . 1 1 
        146 1 . . . 1 1 
        147 1 . . . 1 1 
        148 1 . . . 1 1 
        149 1 . . . 1 1 
        150 1 . . . 1 1 
        151 1 . . . 1 1 
        152 1 . . . 1 1 
        153 1 . . . 1 1 
        154 1 . . . 1 1 
        155 1 . . . 1 1 
        156 1 . . . 1 1 
        157 1 . . . 1 1 
        158 1 . . . 1 1 
        159 1 . . . 1 1 
        160 1 . . . 1 1 
        161 1 . . . 1 1 
        162 1 . . . 1 1 
        163 1 . . . 1 1 
        164 1 . . . 1 1 
        165 1 . . . 1 1 
        166 1 . . . 1 1 
        167 1 . . . 1 1 
        168 1 . . . 1 1 
        169 1 . . . 1 1 
        170 1 . . . 1 1 
        171 1 . . . 1 1 
        172 1 . . . 1 1 
        173 1 . . . 1 1 
        174 1 . . . 1 1 
        175 1 . . . 1 1 
        176 1 . . . 1 1 
        177 1 . . . 1 1 
        178 1 . . . 1 1 
        179 1 . . . 1 1 
        180 1 . . . 1 1 
        181 1 . . . 1 1 
        182 1 . . . 1 1 
        183 1 . . . 1 1 
        184 1 . . . 1 1 
        185 1 . . . 1 1 
        186 1 . . . 1 1 
        187 1 . . . 1 1 
        188 1 . . . 1 1 
        189 1 . . . 1 1 
        190 1 . . . 1 1 
        191 1 . . . 1 1 
        192 1 . . . 1 1 
        193 1 . . . 1 1 
        194 1 . . . 1 1 
        195 1 . . . 1 1 
        196 1 . . . 1 1 
        197 1 . . . 1 1 
        198 1 . . . 1 1 
        199 1 . . . 1 1 
        200 1 . . . 1 1 
        201 1 . . . 1 1 
        202 1 . . . 1 1 
        203 1 . . . 1 1 
        204 1 . . . 1 1 
        205 1 . . . 1 1 
        206 1 . . . 1 1 
        207 1 . . . 1 1 
        208 1 . . . 1 1 
        209 1 . . . 1 1 
        210 1 . . . 1 1 
        211 1 . . . 1 1 
        212 1 . . . 1 1 
        213 1 . . . 1 1 
        214 1 . . . 1 1 
        215 1 . . . 1 1 
        216 1 . . . 1 1 
        217 1 . . . 1 1 
        218 1 . . . 1 1 
        219 1 . . . 1 1 
        220 1 . . . 1 1 
        221 1 . . . 1 1 
        222 1 . . . 1 1 
        223 1 . . . 1 1 
        224 1 . . . 1 1 
        225 1 . . . 1 1 
        226 1 . . . 1 1 
        227 1 . . . 1 1 
        228 1 . . . 1 1 
        229 1 . . . 1 1 
        230 1 . . . 1 1 
        231 1 . . . 1 1 
        232 1 . . . 1 1 
        233 1 . . . 1 1 
        234 1 . . . 1 1 
        235 1 . . . 1 1 
        236 1 . . . 1 1 
        237 1 . . . 1 1 
        238 1 . . . 1 1 
        239 1 . . . 1 1 
        240 1 . . . 1 1 
        241 1 . . . 1 1 
        242 1 . . . 1 1 
        243 1 . . . 1 1 
        244 1 . . . 1 1 
        245 1 . . . 1 1 
        246 1 . . . 1 1 
        247 1 . . . 1 1 
        248 1 . . . 1 1 
        249 1 . . . 1 1 
        250 1 . . . 1 1 
        251 1 . . . 1 1 
        252 1 . . . 1 1 
        253 1 . . . 1 1 
        254 1 . . . 1 1 
        255 1 . . . 1 1 
        256 1 . . . 1 1 
        257 1 . . . 1 1 
        258 1 . . . 1 1 
        259 1 . . . 1 1 
        260 1 . . . 1 1 
        261 1 . . . 1 1 
        262 1 . . . 1 1 
        263 1 . . . 1 1 
        264 1 . . . 1 1 
        265 1 . . . 1 1 
        266 1 . . . 1 1 
        267 1 . . . 1 1 
        268 1 . . . 1 1 
        269 1 . . . 1 1 
        270 1 . . . 1 1 
        271 1 . . . 1 1 
        272 1 . . . 1 1 
        273 1 . . . 1 1 
        274 1 . . . 1 1 
        275 1 . . . 1 1 
        276 1 . . . 1 1 
        277 1 . . . 1 1 
        278 1 . . . 1 1 
        279 1 . . . 1 1 
        280 1 . . . 1 1 
        281 1 . . . 1 1 
        282 1 . . . 1 1 
        283 1 . . . 1 1 
        284 1 . . . 1 1 
        285 1 . . . 1 1 
        286 1 . . . 1 1 
        287 1 . . . 1 1 
        288 1 . . . 1 1 
        289 1 . . . 1 1 
        290 1 . . . 1 1 
        291 1 . . . 1 1 
        292 1 . . . 1 1 
        293 1 . . . 1 1 
        294 1 . . . 1 1 
        295 1 . . . 1 1 
        296 1 . . . 1 1 
        297 1 . . . 1 1 
        298 1 . . . 1 1 
        299 1 . . . 1 1 
        300 1 . . . 1 1 
        301 1 . . . 1 1 
        302 1 . . . 1 1 
        303 1 . . . 1 1 
        304 1 . . . 1 1 
        305 1 . . . 1 1 
        306 1 . . . 1 1 
        307 1 . . . 1 1 
        308 1 . . . 1 1 
        309 1 . . . 1 1 
        310 1 . . . 1 1 
        311 1 . . . 1 1 
        312 1 . . . 1 1 
        313 1 . . . 1 1 
        314 1 . . . 1 1 
        315 1 . . . 1 1 
        316 1 . . . 1 1 
        317 1 . . . 1 1 
        318 1 . . . 1 1 
        319 1 . . . 1 1 
        320 1 . . . 1 1 
        321 1 . . . 1 1 
        322 1 . . . 1 1 
        323 1 . . . 1 1 
        324 1 . . . 1 1 
        325 1 . . . 1 1 
        326 1 . . . 1 1 
        327 1 . . . 1 1 
        328 1 . . . 1 1 
        329 1 . . . 1 1 
        330 1 . . . 1 1 
        331 1 . . . 1 1 
        332 1 . . . 1 1 
        333 1 . . . 1 1 
        334 1 . . . 1 1 
        335 1 . . . 1 1 
        336 1 . . . 1 1 
        337 1 . . . 1 1 
        338 1 . . . 1 1 
        339 1 . . . 1 1 
        340 1 . . . 1 1 
        341 1 . . . 1 1 
        342 1 . . . 1 1 
        343 1 . . . 1 1 
        344 1 . . . 1 1 
        345 1 . . . 1 1 
        346 1 . . . 1 1 
        347 1 . . . 1 1 
        348 1 . . . 1 1 
        349 1 . . . 1 1 
        350 1 . . . 1 1 
        351 1 . . . 1 1 
        352 1 . . . 1 1 
        353 1 . . . 1 1 
        354 1 . . . 1 1 
        355 1 . . . 1 1 
        356 1 . . . 1 1 
        357 1 . . . 1 1 
        358 1 . . . 1 1 
        359 1 . . . 1 1 
        360 1 . . . 1 1 
        361 1 . . . 1 1 
        362 1 . . . 1 1 
        363 1 . . . 1 1 
        364 1 . . . 1 1 
        365 1 . . . 1 1 
        366 1 . . . 1 1 
        367 1 . . . 1 1 
        368 1 . . . 1 1 
        369 1 . . . 1 1 
        370 1 . . . 1 1 
        371 1 . . . 1 1 
        372 1 . . . 1 1 
        373 1 . . . 1 1 
        374 1 . . . 1 1 
        375 1 . . . 1 1 
        376 1 . . . 1 1 
        377 1 . . . 1 1 
        378 1 . . . 1 1 
        379 1 . . . 1 1 
        380 1 . . . 1 1 
        381 1 . . . 1 1 
        382 1 . . . 1 1 
        383 1 . . . 1 1 
        384 1 . . . 1 1 
        385 1 . . . 1 1 
        386 1 . . . 1 1 
        387 1 . . . 1 1 
        388 1 . . . 1 1 
        389 1 . . . 1 1 
        390 1 . . . 1 1 
        391 1 . . . 1 1 
        392 1 . . . 1 1 
        393 1 . . . 1 1 
        394 1 . . . 1 1 
        395 1 . . . 1 1 
        396 1 . . . 1 1 
        397 1 . . . 1 1 
        398 1 . . . 1 1 
        399 1 . . . 1 1 
        400 1 . . . 1 1 
        401 1 . . . 1 1 
        402 1 . . . 1 1 
        403 1 . . . 1 1 
        404 1 . . . 1 1 
        405 1 . . . 1 1 
        406 1 . . . 1 1 
        407 1 . . . 1 1 
        408 1 . . . 1 1 
        409 1 . . . 1 1 
        410 1 . . . 1 1 
        411 1 . . . 1 1 
        412 1 . . . 1 1 
        413 1 . . . 1 1 
        414 1 . . . 1 1 
        415 1 . . . 1 1 
        416 1 . . . 1 1 
        417 1 . . . 1 1 
        418 1 . . . 1 1 
        419 1 . . . 1 1 
        420 1 . . . 1 1 
        421 1 . . . 1 1 
        422 1 . . . 1 1 
        423 1 . . . 1 1 
        424 1 . . . 1 1 
        425 1 . . . 1 1 
        426 1 . . . 1 1 
        427 1 . . . 1 1 
        428 1 . . . 1 1 
        429 1 . . . 1 1 
        430 1 . . . 1 1 
        431 1 . . . 1 1 
        432 1 . . . 1 1 
        433 1 . . . 1 1 
        434 1 . . . 1 1 
        435 1 . . . 1 1 
        436 1 . . . 1 1 
        437 1 . . . 1 1 
        438 1 . . . 1 1 
        439 1 . . . 1 1 
        440 1 . . . 1 1 
        441 1 . . . 1 1 
        442 1 . . . 1 1 
        443 1 . . . 1 1 
        444 1 . . . 1 1 
        445 1 . . . 1 1 
        446 1 . . . 1 1 
        447 1 . . . 1 1 
        448 1 . . . 1 1 
        449 1 . . . 1 1 
        450 1 . . . 1 1 
        451 1 . . . 1 1 
        452 1 . . . 1 1 
        453 1 . . . 1 1 
        454 1 . . . 1 1 
        455 1 . . . 1 1 
        456 1 . . . 1 1 
        457 1 . . . 1 1 
        458 1 . . . 1 1 
        459 1 . . . 1 1 
        460 1 . . . 1 1 
        461 1 . . . 1 1 
        462 1 . . . 1 1 
        463 1 . . . 1 1 
        464 1 . . . 1 1 
        465 1 . . . 1 1 
        466 1 . . . 1 1 
        467 1 . . . 1 1 
        468 1 . . . 1 1 
        469 1 . . . 1 1 
        470 1 . . . 1 1 
        471 1 . . . 1 1 
        472 1 . . . 1 1 
        473 1 . . . 1 1 
        474 1 . . . 1 1 
        475 1 . . . 1 1 
        476 1 . . . 1 1 
        477 1 . . . 1 1 
        478 1 . . . 1 1 
        479 1 . . . 1 1 
        480 1 . . . 1 1 
        481 1 . . . 1 1 
        482 1 . . . 1 1 
        483 1 . . . 1 1 
        484 1 . . . 1 1 
        485 1 . . . 1 1 
        486 1 . . . 1 1 
        487 1 . . . 1 1 
        488 1 . . . 1 1 
        489 1 . . . 1 1 
        490 1 . . . 1 1 
        491 1 . . . 1 1 
        492 1 . . . 1 1 
        493 1 . . . 1 1 
        494 1 . . . 1 1 
        495 1 . . . 1 1 
        496 1 . . . 1 1 
        497 1 . . . 1 1 
        498 1 . . . 1 1 
        499 1 . . . 1 1 
        500 1 . . . 1 1 
        501 1 . . . 1 1 
        502 1 . . . 1 1 
        503 1 . . . 1 1 
        504 1 . . . 1 1 
        505 1 . . . 1 1 
        506 1 . . . 1 1 
        507 1 . . . 1 1 
        508 1 . . . 1 1 
        509 1 . . . 1 1 
        510 1 . . . 1 1 
        511 1 . . . 1 1 
        512 1 . . . 1 1 
        513 1 . . . 1 1 
        514 1 . . . 1 1 
        515 1 . . . 1 1 
        516 1 . . . 1 1 
        517 1 . . . 1 1 
        518 1 . . . 1 1 
        519 1 . . . 1 1 
        520 1 . . . 1 1 
        521 1 . . . 1 1 
        522 1 . . . 1 1 
        523 1 . . . 1 1 
        524 1 . . . 1 1 
        525 1 . . . 1 1 
        526 1 . . . 1 1 
        527 1 . . . 1 1 
        528 1 . . . 1 1 
        529 1 . . . 1 1 
        530 1 . . . 1 1 
        531 1 . . . 1 1 
        532 1 . . . 1 1 
        533 1 . . . 1 1 
        534 1 . . . 1 1 
        535 1 . . . 1 1 
        536 1 . . . 1 1 
        537 1 . . . 1 1 
        538 1 . . . 1 1 
        539 1 . . . 1 1 
        540 1 . . . 1 1 
        541 1 . . . 1 1 
        542 1 . . . 1 1 
        543 1 . . . 1 1 
        544 1 . . . 1 1 
        545 1 . . . 1 1 
        546 1 . . . 1 1 
        547 1 . . . 1 1 
        548 1 . . . 1 1 
        549 1 . . . 1 1 
        550 1 . . . 1 1 
        551 1 . . . 1 1 
        552 1 . . . 1 1 
        553 1 . . . 1 1 
        554 1 . . . 1 1 
        555 1 . . . 1 1 
        556 1 . . . 1 1 
        557 1 . . . 1 1 
        558 1 . . . 1 1 
        559 1 . . . 1 1 
        560 1 . . . 1 1 
        561 1 . . . 1 1 
        562 1 . . . 1 1 
        563 1 . . . 1 1 
        564 1 . . . 1 1 
        565 1 . . . 1 1 
        566 1 . . . 1 1 
        567 1 . . . 1 1 
        568 1 . . . 1 1 
        569 1 . . . 1 1 
        570 1 . . . 1 1 
        571 1 . . . 1 1 
        572 1 . . . 1 1 
        573 1 . . . 1 1 
        574 1 . . . 1 1 
        575 1 . . . 1 1 
        576 1 . . . 1 1 
        577 1 . . . 1 1 
        578 1 . . . 1 1 
        579 1 . . . 1 1 
        580 1 . . . 1 1 
        581 1 . . . 1 1 
        582 1 . . . 1 1 
        583 1 . . . 1 1 
        584 1 . . . 1 1 
        585 1 . . . 1 1 
        586 1 . . . 1 1 
        587 1 . . . 1 1 
        588 1 . . . 1 1 
        589 1 . . . 1 1 
        590 1 . . . 1 1 
        591 1 . . . 1 1 
        592 1 . . . 1 1 
        593 1 . . . 1 1 
        594 1 . . . 1 1 
        595 1 . . . 1 1 
        596 1 . . . 1 1 
        597 1 . . . 1 1 
        598 1 . . . 1 1 
        599 1 . . . 1 1 
        600 1 . . . 1 1 
        601 1 . . . 1 1 
        602 1 . . . 1 1 
        603 1 . . . 1 1 
        604 1 . . . 1 1 
        605 1 . . . 1 1 
        606 1 . . . 1 1 
        607 1 . . . 1 1 
        608 1 . . . 1 1 
        609 1 . . . 1 1 
        610 1 . . . 1 1 
        611 1 . . . 1 1 
        612 1 . . . 1 1 
        613 1 . . . 1 1 
        614 1 . . . 1 1 
        615 1 . . . 1 1 
        616 1 . . . 1 1 
        617 1 . . . 1 1 
        618 1 . . . 1 1 
        619 1 . . . 1 1 
        620 1 . . . 1 1 
        621 1 . . . 1 1 
        622 1 . . . 1 1 
        623 1 . . . 1 1 
        624 1 . . . 1 1 
        625 1 . . . 1 1 
        626 1 . . . 1 1 
        627 1 . . . 1 1 
        628 1 . . . 1 1 
        629 1 . . . 1 1 
        630 1 . . . 1 1 
        631 1 . . . 1 1 
        632 1 . . . 1 1 
        633 1 . . . 1 1 
        634 1 . . . 1 1 
        635 1 . . . 1 1 
        636 1 . . . 1 1 
        637 1 . . . 1 1 
        638 1 . . . 1 1 
        639 1 . . . 1 1 
        640 1 . . . 1 1 
        641 1 . . . 1 1 
        642 1 . . . 1 1 
        643 1 . . . 1 1 
        644 1 . . . 1 1 
        645 1 . . . 1 1 
        646 1 . . . 1 1 
        647 1 . . . 1 1 
        648 1 . . . 1 1 
        649 1 . . . 1 1 
        650 1 . . . 1 1 
        651 1 . . . 1 1 
        652 1 . . . 1 1 
        653 1 . . . 1 1 
        654 1 . . . 1 1 
        655 1 . . . 1 1 
        656 1 . . . 1 1 
        657 1 . . . 1 1 
        658 1 . . . 1 1 
        659 1 . . . 1 1 
        660 1 . . . 1 1 
        661 1 . . . 1 1 
        662 1 . . . 1 1 
        663 1 . . . 1 1 
        664 1 . . . 1 1 
        665 1 . . . 1 1 
        666 1 . . . 1 1 
        667 1 . . . 1 1 
        668 1 . . . 1 1 
        669 1 . . . 1 1 
        670 1 . . . 1 1 
        671 1 . . . 1 1 
        672 1 . . . 1 1 
        673 1 . . . 1 1 
        674 1 . . . 1 1 
        675 1 . . . 1 1 
        676 1 . . . 1 1 
        677 1 . . . 1 1 
        678 1 . . . 1 1 
        679 1 . . . 1 1 
        680 1 . . . 1 1 
        681 1 . . . 1 1 
        682 1 . . . 1 1 
        683 1 . . . 1 1 
        684 1 . . . 1 1 
        685 1 . . . 1 1 
        686 1 . . . 1 1 
        687 1 . . . 1 1 
        688 1 . . . 1 1 
        689 1 . . . 1 1 
        690 1 . . . 1 1 
        691 1 . . . 1 1 
        692 1 . . . 1 1 
        693 1 . . . 1 1 
        694 1 . . . 1 1 
        695 1 . . . 1 1 
        696 1 . . . 1 1 
        697 1 . . . 1 1 
        698 1 . . . 1 1 
        699 1 . . . 1 1 
        700 1 . . . 1 1 
        701 1 . . . 1 1 
        702 1 . . . 1 1 
        703 1 . . . 1 1 
        704 1 . . . 1 1 
        705 1 . . . 1 1 
        706 1 . . . 1 1 
        707 1 . . . 1 1 
        708 1 . . . 1 1 
        709 1 . . . 1 1 
        710 1 . . . 1 1 
        711 1 . . . 1 1 
        712 1 . . . 1 1 
        713 1 . . . 1 1 
        714 1 . . . 1 1 
        715 1 . . . 1 1 
        716 1 . . . 1 1 
        717 1 . . . 1 1 
        718 1 . . . 1 1 
        719 1 . . . 1 1 
        720 1 . . . 1 1 
        721 1 . . . 1 1 
        722 1 . . . 1 1 
        723 1 . . . 1 1 
        724 1 . . . 1 1 
        725 1 . . . 1 1 
        726 1 . . . 1 1 
        727 1 . . . 1 1 
        728 1 . . . 1 1 
        729 1 . . . 1 1 
        730 1 . . . 1 1 
        731 1 . . . 1 1 
        732 1 . . . 1 1 
        733 1 . . . 1 1 
        734 1 . . . 1 1 
        735 1 . . . 1 1 
        736 1 . . . 1 1 
        737 1 . . . 1 1 
        738 1 . . . 1 1 
        739 1 . . . 1 1 
        740 1 . . . 1 1 
        741 1 . . . 1 1 
        742 1 . . . 1 1 
        743 1 . . . 1 1 
        744 1 . . . 1 1 
        745 1 . . . 1 1 
        746 1 . . . 1 1 
        747 1 . . . 1 1 
        748 1 . . . 1 1 
        749 1 . . . 1 1 
        750 1 . . . 1 1 
        751 1 . . . 1 1 
        752 1 . . . 1 1 
        753 1 . . . 1 1 
        754 1 . . . 1 1 
        755 1 . . . 1 1 
        756 1 . . . 1 1 
        757 1 . . . 1 1 
        758 1 . . . 1 1 
        759 1 . . . 1 1 
        760 1 . . . 1 1 
        761 1 . . . 1 1 
        762 1 . . . 1 1 
        763 1 . . . 1 1 
        764 1 . . . 1 1 
        765 1 . . . 1 1 
        766 1 . . . 1 1 
        767 1 . . . 1 1 
        768 1 . . . 1 1 
        769 1 . . . 1 1 
        770 1 . . . 1 1 
        771 1 . . . 1 1 
        772 1 . . . 1 1 
        773 1 . . . 1 1 
        774 1 . . . 1 1 
        775 1 . . . 1 1 
        776 1 . . . 1 1 
        777 1 . . . 1 1 
        778 1 . . . 1 1 
        779 1 . . . 1 1 
        780 1 . . . 1 1 
        781 1 . . . 1 1 
        782 1 . . . 1 1 
        783 1 . . . 1 1 
        784 1 . . . 1 1 
        785 1 . . . 1 1 
        786 1 . . . 1 1 
        787 1 . . . 1 1 
        788 1 . . . 1 1 
        789 1 . . . 1 1 
        790 1 . . . 1 1 
        791 1 . . . 1 1 
        792 1 . . . 1 1 
        793 1 . . . 1 1 
        794 1 . . . 1 1 
        795 1 . . . 1 1 
        796 1 . . . 1 1 
        797 1 . . . 1 1 
        798 1 . . . 1 1 
        799 1 . . . 1 1 
        800 1 . . . 1 1 
        801 1 . . . 1 1 
        802 1 . . . 1 1 
        803 1 . . . 1 1 
        804 1 . . . 1 1 
        805 1 . . . 1 1 
        806 1 . . . 1 1 
        807 1 . . . 1 1 
        808 1 . . . 1 1 
        809 1 . . . 1 1 
        810 1 . . . 1 1 
        811 1 . . . 1 1 
        812 1 . . . 1 1 
        813 1 . . . 1 1 
        814 1 . . . 1 1 
        815 1 . . . 1 1 
        816 1 . . . 1 1 
        817 1 . . . 1 1 
        818 1 . . . 1 1 
        819 1 . . . 1 1 
        820 1 . . . 1 1 
        821 1 . . . 1 1 
        822 1 . . . 1 1 
        823 1 . . . 1 1 
        824 1 . . . 1 1 
        825 1 . . . 1 1 
        826 1 . . . 1 1 
        827 1 . . . 1 1 
        828 1 . . . 1 1 
        829 1 . . . 1 1 
        830 1 . . . 1 1 
        831 1 . . . 1 1 
        832 1 . . . 1 1 
        833 1 . . . 1 1 
        834 1 . . . 1 1 
        835 1 . . . 1 1 
        836 1 . . . 1 1 
        837 1 . . . 1 1 
        838 1 . . . 1 1 
        839 1 . . . 1 1 
        840 1 . . . 1 1 
        841 1 . . . 1 1 
        842 1 . . . 1 1 
        843 1 . . . 1 1 
        844 1 . . . 1 1 
        845 1 . . . 1 1 
        846 1 . . . 1 1 
        847 1 . . . 1 1 
        848 1 . . . 1 1 
        849 1 . . . 1 1 
        850 1 . . . 1 1 
        851 1 . . . 1 1 
        852 1 . . . 1 1 
        853 1 . . . 1 1 
        854 1 . . . 1 1 
        855 1 . . . 1 1 
        856 1 . . . 1 1 
        857 1 . . . 1 1 
        858 1 . . . 1 1 
        859 1 . . . 1 1 
        860 1 . . . 1 1 
        861 1 . . . 1 1 
        862 1 . . . 1 1 
        863 1 . . . 1 1 
        864 1 . . . 1 1 
        865 1 . . . 1 1 
        866 1 . . . 1 1 
        867 1 . . . 1 1 
        868 1 . . . 1 1 
        869 1 . . . 1 1 
        870 1 . . . 1 1 
        871 1 . . . 1 1 
        872 1 . . . 1 1 
        873 1 . . . 1 1 
        874 1 . . . 1 1 
        875 1 . . . 1 1 
        876 1 . . . 1 1 
        877 1 . . . 1 1 
        878 1 . . . 1 1 
        879 1 . . . 1 1 
        880 1 . . . 1 1 
        881 1 . . . 1 1 
        882 1 . . . 1 1 
        883 1 . . . 1 1 
        884 1 . . . 1 1 
        885 1 . . . 1 1 
        886 1 . . . 1 1 
        887 1 . . . 1 1 
        888 1 . . . 1 1 
        889 1 . . . 1 1 
        890 1 . . . 1 1 
        891 1 . . . 1 1 
        892 1 . . . 1 1 
        893 1 . . . 1 1 
        894 1 . . . 1 1 
        895 1 . . . 1 1 
        896 1 . . . 1 1 
        897 1 . . . 1 1 
        898 1 . . . 1 1 
        899 1 . . . 1 1 
        900 1 . . . 1 1 
        901 1 . . . 1 1 
        902 1 . . . 1 1 
        903 1 . . . 1 1 
        904 1 . . . 1 1 
        905 1 . . . 1 1 
        906 1 . . . 1 1 
        907 1 . . . 1 1 
        908 1 . . . 1 1 
        909 1 . . . 1 1 
        910 1 . . . 1 1 
        911 1 . . . 1 1 
        912 1 . . . 1 1 
        913 1 . . . 1 1 
        914 1 . . . 1 1 
        915 1 . . . 1 1 
        916 1 . . . 1 1 
        917 1 . . . 1 1 
        918 1 . . . 1 1 
        919 1 . . . 1 1 
        920 1 . . . 1 1 
        921 1 . . . 1 1 
        922 1 . . . 1 1 
        923 1 . . . 1 1 
        924 1 . . . 1 1 
        925 1 . . . 1 1 
        926 1 . . . 1 1 
        927 1 . . . 1 1 
        928 1 . . . 1 1 
        929 1 . . . 1 1 
        930 1 . . . 1 1 
        931 1 . . . 1 1 
        932 1 . . . 1 1 
        933 1 . . . 1 1 
        934 1 . . . 1 1 
        935 1 . . . 1 1 
        936 1 . . . 1 1 
        937 1 . . . 1 1 
        938 1 . . . 1 1 
        939 1 . . . 1 1 
        940 1 . . . 1 1 
        941 1 . . . 1 1 
        942 1 . . . 1 1 
        943 1 . . . 1 1 
        944 1 . . . 1 1 
        945 1 . . . 1 1 
        946 1 . . . 1 1 
        947 1 . . . 1 1 
        948 1 . . . 1 1 
        949 1 . . . 1 1 
        950 1 . . . 1 1 
        951 1 . . . 1 1 
        952 1 . . . 1 1 
        953 1 . . . 1 1 
        954 1 . . . 1 1 
        955 1 . . . 1 1 
        956 1 . . . 1 1 
        957 1 . . . 1 1 
        958 1 . . . 1 1 
        959 1 . . . 1 1 
        960 1 . . . 1 1 
        961 1 . . . 1 1 
        962 1 . . . 1 1 
        963 1 . . . 1 1 
        964 1 . . . 1 1 
        965 1 . . . 1 1 
        966 1 . . . 1 1 
        967 1 . . . 1 1 
        968 1 . . . 1 1 
        969 1 . . . 1 1 
        970 1 . . . 1 1 
        971 1 . . . 1 1 
        972 1 . . . 1 1 
        973 1 . . . 1 1 
        974 1 . . . 1 1 
        975 1 . . . 1 1 
        976 1 . . . 1 1 
        977 1 . . . 1 1 
        978 1 . . . 1 1 
        979 1 . . . 1 1 
        980 1 . . . 1 1 
        981 1 . . . 1 1 
        982 1 . . . 1 1 
        983 1 . . . 1 1 
        984 1 . . . 1 1 
        985 1 . . . 1 1 
        986 1 . . . 1 1 
        987 1 . . . 1 1 
        988 1 . . . 1 1 
        989 1 . . . 1 1 
        990 1 . . . 1 1 
        991 1 . . . 1 1 
        992 1 . . . 1 1 
        993 1 . . . 1 1 
        994 1 . . . 1 1 
        995 1 . . . 1 1 
        996 1 . . . 1 1 
        997 1 . . . 1 1 
        998 1 . . . 1 1 
        999 1 . . . 1 1 
       1000 1 . . . 1 1 
       1001 1 . . . 1 1 
       1002 1 . . . 1 1 
       1003 1 . . . 1 1 
       1004 1 . . . 1 1 
       1005 1 . . . 1 1 
       1006 1 . . . 1 1 
       1007 1 . . . 1 1 
       1008 1 . . . 1 1 
       1009 1 . . . 1 1 
       1010 1 . . . 1 1 
       1011 1 . . . 1 1 
       1012 1 . . . 1 1 
       1013 1 . . . 1 1 
       1014 1 . . . 1 1 
       1015 1 . . . 1 1 
       1016 1 . . . 1 1 
       1017 1 . . . 1 1 
       1018 1 . . . 1 1 
       1019 1 . . . 1 1 
       1020 1 . . . 1 1 
       1021 1 . . . 1 1 
       1022 1 . . . 1 1 
       1023 1 . . . 1 1 
       1024 1 . . . 1 1 
       1025 1 . . . 1 1 
       1026 1 . . . 1 1 
       1027 1 . . . 1 1 
       1028 1 . . . 1 1 
       1029 1 . . . 1 1 
       1030 1 . . . 1 1 
       1031 1 . . . 1 1 
       1032 1 . . . 1 1 
       1033 1 . . . 1 1 
       1034 1 . . . 1 1 
       1035 1 . . . 1 1 
       1036 1 . . . 1 1 
       1037 1 . . . 1 1 
       1038 1 . . . 1 1 
       1039 1 . . . 1 1 
       1040 1 . . . 1 1 
       1041 1 . . . 1 1 
       1042 1 . . . 1 1 
       1043 1 . . . 1 1 
       1044 1 . . . 1 1 
       1045 1 . . . 1 1 
       1046 1 . . . 1 1 
       1047 1 . . . 1 1 
       1048 1 . . . 1 1 
       1049 1 . . . 1 1 
       1050 1 . . . 1 1 
       1051 1 . . . 1 1 
       1052 1 . . . 1 1 
       1053 1 . . . 1 1 
       1054 1 . . . 1 1 
       1055 1 . . . 1 1 
       1056 1 . . . 1 1 
       1057 1 . . . 1 1 
       1058 1 . . . 1 1 
       1059 1 . . . 1 1 
       1060 1 . . . 1 1 
       1061 1 . . . 1 1 
       1062 1 . . . 1 1 
       1063 1 . . . 1 1 
       1064 1 . . . 1 1 
       1065 1 . . . 1 1 
       1066 1 . . . 1 1 
       1067 1 . . . 1 1 
       1068 1 . . . 1 1 
       1069 1 . . . 1 1 
       1070 1 . . . 1 1 
       1071 1 . . . 1 1 
       1072 1 . . . 1 1 
       1073 1 . . . 1 1 
       1074 1 . . . 1 1 
       1075 1 . . . 1 1 
       1076 1 . . . 1 1 
       1077 1 . . . 1 1 
       1078 1 . . . 1 1 
       1079 1 . . . 1 1 
       1080 1 . . . 1 1 
       1081 1 . . . 1 1 
       1082 1 . . . 1 1 
       1083 1 . . . 1 1 
       1084 1 . . . 1 1 
       1085 1 . . . 1 1 
       1086 1 . . . 1 1 
       1087 1 . . . 1 1 
       1088 1 . . . 1 1 
       1089 1 . . . 1 1 
       1090 1 . . . 1 1 
       1091 1 . . . 1 1 
       1092 1 . . . 1 1 
       1093 1 . . . 1 1 
       1094 1 . . . 1 1 
       1095 1 . . . 1 1 
       1096 1 . . . 1 1 
       1097 1 . . . 1 1 
       1098 1 . . . 1 1 
       1099 1 . . . 1 1 
       1100 1 . . . 1 1 
       1101 1 . . . 1 1 
       1102 1 . . . 1 1 
       1103 1 . . . 1 1 
       1104 1 . . . 1 1 
       1105 1 . . . 1 1 
       1106 1 . . . 1 1 
       1107 1 . . . 1 1 
       1108 1 . . . 1 1 
       1109 1 . . . 1 1 
       1110 1 . . . 1 1 
       1111 1 . . . 1 1 
       1112 1 . . . 1 1 
       1113 1 . . . 1 1 
       1114 1 . . . 1 1 
       1115 1 . . . 1 1 
       1116 1 . . . 1 1 
       1117 1 . . . 1 1 
       1118 1 . . . 1 1 
       1119 1 . . . 1 1 
       1120 1 . . . 1 1 
       1121 1 . . . 1 1 
       1122 1 . . . 1 1 
       1123 1 . . . 1 1 
       1124 1 . . . 1 1 
       1125 1 . . . 1 1 
       1126 1 . . . 1 1 
       1127 1 . . . 1 1 
       1128 1 . . . 1 1 
       1129 1 . . . 1 1 
       1130 1 . . . 1 1 
       1131 1 . . . 1 1 
       1132 1 . . . 1 1 
       1133 1 . . . 1 1 
       1134 1 . . . 1 1 
       1135 1 . . . 1 1 
       1136 1 . . . 1 1 
       1137 1 . . . 1 1 
       1138 1 . . . 1 1 
       1139 1 . . . 1 1 
       1140 1 . . . 1 1 
       1141 1 . . . 1 1 
       1142 1 . . . 1 1 
       1143 1 . . . 1 1 
       1144 1 . . . 1 1 
       1145 1 . . . 1 1 
       1146 1 . . . 1 1 
       1147 1 . . . 1 1 
       1148 1 . . . 1 1 
       1149 1 . . . 1 1 
       1150 1 . . . 1 1 
       1151 1 . . . 1 1 
       1152 1 . . . 1 1 
       1153 1 . . . 1 1 
       1154 1 . . . 1 1 
       1155 1 . . . 1 1 
       1156 1 . . . 1 1 
       1157 1 . . . 1 1 
       1158 1 . . . 1 1 
       1159 1 . . . 1 1 
       1160 1 . . . 1 1 
       1161 1 . . . 1 1 
       1162 1 . . . 1 1 
       1163 1 . . . 1 1 
       1164 1 . . . 1 1 
       1165 1 . . . 1 1 
       1166 1 . . . 1 1 
       1167 1 . . . 1 1 
       1168 1 . . . 1 1 
       1169 1 . . . 1 1 
       1170 1 . . . 1 1 
       1171 1 . . . 1 1 
       1172 1 . . . 1 1 
       1173 1 . . . 1 1 
       1174 1 . . . 1 1 
       1175 1 . . . 1 1 
       1176 1 . . . 1 1 
       1177 1 . . . 1 1 
       1178 1 . . . 1 1 
       1179 1 . . . 1 1 
       1180 1 . . . 1 1 
       1181 1 . . . 1 1 
       1182 1 . . . 1 1 
       1183 1 . . . 1 1 
       1184 1 . . . 1 1 
       1185 1 . . . 1 1 
       1186 1 . . . 1 1 
       1187 1 . . . 1 1 
       1188 1 . . . 1 1 
       1189 1 . . . 1 1 
       1190 1 . . . 1 1 
       1191 1 . . . 1 1 
       1192 1 . . . 1 1 
       1193 1 . . . 1 1 
       1194 1 . . . 1 1 
       1195 1 . . . 1 1 
       1196 1 . . . 1 1 
       1197 1 . . . 1 1 
       1198 1 . . . 1 1 
       1199 1 . . . 1 1 
       1200 1 . . . 1 1 
       1201 1 . . . 1 1 
       1202 1 . . . 1 1 
       1203 1 . . . 1 1 
       1204 1 . . . 1 1 
       1205 1 . . . 1 1 
       1206 1 . . . 1 1 
       1207 1 . . . 1 1 
       1208 1 . . . 1 1 
       1209 1 . . . 1 1 
       1210 1 . . . 1 1 
       1211 1 . . . 1 1 
       1212 1 . . . 1 1 
       1213 1 . . . 1 1 
       1214 1 . . . 1 1 
       1215 1 . . . 1 1 
       1216 1 . . . 1 1 
       1217 1 . . . 1 1 
       1218 1 . . . 1 1 
       1219 1 . . . 1 1 
       1220 1 . . . 1 1 
       1221 1 . . . 1 1 
       1222 1 . . . 1 1 
       1223 1 . . . 1 1 
       1224 1 . . . 1 1 
       1225 1 . . . 1 1 
       1226 1 . . . 1 1 
       1227 1 . . . 1 1 
       1228 1 . . . 1 1 
       1229 1 . . . 1 1 
       1230 1 . . . 1 1 
       1231 1 . . . 1 1 
       1232 1 . . . 1 1 
       1233 1 . . . 1 1 
       1234 1 . . . 1 1 
       1235 1 . . . 1 1 
       1236 1 . . . 1 1 
       1237 1 . . . 1 1 
       1238 1 . . . 1 1 
       1239 1 . . . 1 1 
       1240 1 . . . 1 1 
       1241 1 . . . 1 1 
       1242 1 . . . 1 1 
       1243 1 . . . 1 1 
       1244 1 . . . 1 1 
       1245 1 . . . 1 1 
       1246 1 . . . 1 1 
       1247 1 . . . 1 1 
       1248 1 . . . 1 1 
       1249 1 . . . 1 1 
       1250 1 . . . 1 1 
       1251 1 . . . 1 1 
       1252 1 . . . 1 1 
       1253 1 . . . 1 1 
       1254 1 . . . 1 1 
       1255 1 . . . 1 1 
       1256 1 . . . 1 1 
       1257 1 . . . 1 1 
       1258 1 . . . 1 1 
       1259 1 . . . 1 1 
       1260 1 . . . 1 1 
       1261 1 . . . 1 1 
       1262 1 . . . 1 1 
       1263 1 . . . 1 1 
       1264 1 . . . 1 1 
       1265 1 . . . 1 1 
       1266 1 . . . 1 1 
       1267 1 . . . 1 1 
       1268 1 . . . 1 1 
       1269 1 . . . 1 1 
       1270 1 . . . 1 1 
       1271 1 . . . 1 1 
       1272 1 . . . 1 1 
       1273 1 . . . 1 1 
       1274 1 . . . 1 1 
       1275 1 . . . 1 1 
       1276 1 . . . 1 1 
       1277 1 . . . 1 1 
       1278 1 . . . 1 1 
       1279 1 . . . 1 1 
       1280 1 . . . 1 1 
       1281 1 . . . 1 1 
       1282 1 . . . 1 1 
       1283 1 . . . 1 1 
       1284 1 . . . 1 1 
       1285 1 . . . 1 1 
       1286 1 . . . 1 1 
       1287 1 . . . 1 1 
       1288 1 . . . 1 1 
       1289 1 . . . 1 1 
       1290 1 . . . 1 1 
       1291 1 . . . 1 1 
       1292 1 . . . 1 1 
       1293 1 . . . 1 1 
       1294 1 . . . 1 1 
       1295 1 . . . 1 1 
       1296 1 . . . 1 1 
       1297 1 . . . 1 1 
       1298 1 . . . 1 1 
       1299 1 . . . 1 1 
       1300 1 . . . 1 1 
       1301 1 . . . 1 1 
       1302 1 . . . 1 1 
       1303 1 . . . 1 1 
       1304 1 . . . 1 1 
       1305 1 . . . 1 1 
       1306 1 . . . 1 1 
       1307 1 . . . 1 1 
       1308 1 . . . 1 1 
       1309 1 . . . 1 1 
       1310 1 . . . 1 1 
       1311 1 . . . 1 1 
       1312 1 . . . 1 1 
       1313 1 . . . 1 1 
       1314 1 . . . 1 1 
       1315 1 . . . 1 1 
       1316 1 . . . 1 1 
       1317 1 . . . 1 1 
       1318 1 . . . 1 1 
       1319 1 . . . 1 1 
       1320 1 . . . 1 1 
       1321 1 . . . 1 1 
       1322 1 . . . 1 1 
       1323 1 . . . 1 1 
       1324 1 . . . 1 1 
       1325 1 . . . 1 1 
       1326 1 . . . 1 1 
       1327 1 . . . 1 1 
       1328 1 . . . 1 1 
       1329 1 . . . 1 1 
       1330 1 . . . 1 1 
       1331 1 . . . 1 1 
       1332 1 . . . 1 1 
       1333 1 . . . 1 1 
       1334 1 . . . 1 1 
       1335 1 . . . 1 1 
       1336 1 . . . 1 1 
       1337 1 . . . 1 1 
       1338 1 . . . 1 1 
       1339 1 . . . 1 1 
       1340 1 . . . 1 1 
       1341 1 . . . 1 1 
       1342 1 . . . 1 1 
       1343 1 . . . 1 1 
       1344 1 . . . 1 1 
       1345 1 . . . 1 1 
       1346 1 . . . 1 1 
       1347 1 . . . 1 1 
       1348 1 . . . 1 1 
       1349 1 . . . 1 1 
       1350 1 . . . 1 1 
       1351 1 . . . 1 1 
       1352 1 . . . 1 1 
       1353 1 . . . 1 1 
       1354 1 . . . 1 1 
       1355 1 . . . 1 1 
       1356 1 . . . 1 1 
       1357 1 . . . 1 1 
       1358 1 . . . 1 1 
       1359 1 . . . 1 1 
       1360 1 . . . 1 1 
       1361 1 . . . 1 1 
       1362 1 . . . 1 1 
       1363 1 . . . 1 1 
       1364 1 . . . 1 1 
       1365 1 . . . 1 1 
       1366 1 . . . 1 1 
       1367 1 . . . 1 1 
       1368 1 . . . 1 1 
       1369 1 . . . 1 1 
       1370 1 . . . 1 1 
       1371 1 . . . 1 1 
       1372 1 . . . 1 1 
       1373 1 . . . 1 1 
       1374 1 . . . 1 1 
       1375 1 . . . 1 1 
       1376 1 . . . 1 1 
       1377 1 . . . 1 1 
       1378 1 . . . 1 1 
       1379 1 . . . 1 1 
       1380 1 . . . 1 1 
       1381 1 . . . 1 1 
       1382 1 . . . 1 1 
       1383 1 . . . 1 1 
       1384 1 . . . 1 1 
       1385 1 . . . 1 1 
       1386 1 . . . 1 1 
       1387 1 . . . 1 1 
       1388 1 . . . 1 1 
       1389 1 . . . 1 1 
       1390 1 . . . 1 1 
       1391 1 . . . 1 1 
       1392 1 . . . 1 1 
       1393 1 . . . 1 1 
       1394 1 . . . 1 1 
       1395 1 . . . 1 1 
       1396 1 . . . 1 1 
       1397 1 . . . 1 1 
       1398 1 . . . 1 1 
       1399 1 . . . 1 1 
       1400 1 . . . 1 1 
       1401 1 . . . 1 1 
       1402 1 . . . 1 1 
       1403 1 . . . 1 1 
       1404 1 . . . 1 1 
       1405 1 . . . 1 1 
       1406 1 . . . 1 1 
       1407 1 . . . 1 1 
       1408 1 . . . 1 1 
       1409 1 . . . 1 1 
       1410 1 . . . 1 1 
       1411 1 . . . 1 1 
       1412 1 . . . 1 1 
       1413 1 . . . 1 1 
       1414 1 . . . 1 1 
       1415 1 . . . 1 1 
       1416 1 . . . 1 1 
       1417 1 . . . 1 1 
       1418 1 . . . 1 1 
       1419 1 . . . 1 1 
       1420 1 . . . 1 1 
       1421 1 . . . 1 1 
       1422 1 . . . 1 1 
       1423 1 . . . 1 1 
       1424 1 . . . 1 1 
       1425 1 . . . 1 1 
       1426 1 . . . 1 1 
       1427 1 . . . 1 1 
       1428 1 . . . 1 1 
       1429 1 . . . 1 1 
       1430 1 . . . 1 1 
       1431 1 . . . 1 1 
       1432 1 . . . 1 1 
       1433 1 . . . 1 1 
       1434 1 . . . 1 1 
       1435 1 . . . 1 1 
       1436 1 . . . 1 1 
       1437 1 . . . 1 1 
       1438 1 . . . 1 1 
       1439 1 . . . 1 1 
       1440 1 . . . 1 1 
       1441 1 . . . 1 1 
       1442 1 . . . 1 1 
       1443 1 . . . 1 1 
       1444 1 . . . 1 1 
       1445 1 . . . 1 1 
       1446 1 . . . 1 1 
       1447 1 . . . 1 1 
       1448 1 . . . 1 1 
       1449 1 . . . 1 1 
       1450 1 . . . 1 1 
       1451 1 . . . 1 1 
       1452 1 . . . 1 1 
       1453 1 . . . 1 1 
       1454 1 . . . 1 1 
       1455 1 . . . 1 1 
       1456 1 . . . 1 1 
       1457 1 . . . 1 1 
       1458 1 . . . 1 1 
       1459 1 . . . 1 1 
       1460 1 . . . 1 1 
       1461 1 . . . 1 1 
       1462 1 . . . 1 1 
       1463 1 . . . 1 1 
       1464 1 . . . 1 1 
       1465 1 . . . 1 1 
       1466 1 . . . 1 1 
       1467 1 . . . 1 1 
       1468 1 . . . 1 1 
       1469 1 . . . 1 1 
       1470 1 . . . 1 1 
       1471 1 . . . 1 1 
       1472 1 . . . 1 1 
       1473 1 . . . 1 1 
       1474 1 . . . 1 1 
       1475 1 . . . 1 1 
       1476 1 . . . 1 1 
       1477 1 . . . 1 1 
       1478 1 . . . 1 1 
       1479 1 . . . 1 1 
       1480 1 . . . 1 1 
       1481 1 . . . 1 1 
       1482 1 . . . 1 1 
       1483 1 . . . 1 1 
       1484 1 . . . 1 1 
       1485 1 . . . 1 1 
       1486 1 . . . 1 1 
       1487 1 . . . 1 1 
       1488 1 . . . 1 1 
       1489 1 . . . 1 1 
       1490 1 . . . 1 1 
       1491 1 . . . 1 1 
       1492 1 . . . 1 1 
       1493 1 . . . 1 1 
       1494 1 . . . 1 1 
       1495 1 . . . 1 1 
       1496 1 . . . 1 1 
       1497 1 . . . 1 1 
       1498 1 . . . 1 1 
       1499 1 . . . 1 1 
       1500 1 . . . 1 1 
       1501 1 . . . 1 1 
       1502 1 . . . 1 1 
       1503 1 . . . 1 1 
       1504 1 . . . 1 1 
       1505 1 . . . 1 1 
       1506 1 . . . 1 1 
       1507 1 . . . 1 1 
       1508 1 . . . 1 1 
       1509 1 . . . 1 1 
       1510 1 . . . 1 1 
       1511 1 . . . 1 1 
       1512 1 . . . 1 1 
       1513 1 . . . 1 1 
       1514 1 . . . 1 1 
       1515 1 . . . 1 1 
       1516 1 . . . 1 1 
       1517 1 . . . 1 1 
       1518 1 . . . 1 1 
       1519 1 . . . 1 1 
       1520 1 . . . 1 1 
       1521 1 . . . 1 1 
       1522 1 . . . 1 1 
       1523 1 . . . 1 1 
       1524 1 . . . 1 1 
       1525 1 . . . 1 1 
       1526 1 . . . 1 1 
       1527 1 . . . 1 1 
       1528 1 . . . 1 1 
       1529 1 . . . 1 1 
       1530 1 . . . 1 1 
       1531 1 . . . 1 1 
       1532 1 . . . 1 1 
       1533 1 . . . 1 1 
       1534 1 . . . 1 1 
       1535 1 . . . 1 1 
       1536 1 . . . 1 1 
       1537 1 . . . 1 1 
       1538 1 . . . 1 1 
       1539 1 . . . 1 1 
       1540 1 . . . 1 1 
       1541 1 . . . 1 1 
       1542 1 . . . 1 1 
       1543 1 . . . 1 1 
       1544 1 . . . 1 1 
       1545 1 . . . 1 1 
       1546 1 . . . 1 1 
       1547 1 . . . 1 1 
       1548 1 . . . 1 1 
       1549 1 . . . 1 1 
       1550 1 . . . 1 1 
       1551 1 . . . 1 1 
       1552 1 . . . 1 1 
       1553 1 . . . 1 1 
       1554 1 . . . 1 1 
       1555 1 . . . 1 1 
       1556 1 . . . 1 1 
       1557 1 . . . 1 1 
       1558 1 . . . 1 1 
       1559 1 . . . 1 1 
       1560 1 . . . 1 1 
       1561 1 . . . 1 1 
       1562 1 . . . 1 1 
       1563 1 . . . 1 1 
       1564 1 . . . 1 1 
       1565 1 . . . 1 1 
       1566 1 . . . 1 1 
       1567 1 . . . 1 1 
       1568 1 . . . 1 1 
       1569 1 . . . 1 1 
       1570 1 . . . 1 1 
       1571 1 . . . 1 1 
       1572 1 . . . 1 1 
       1573 1 . . . 1 1 
       1574 1 . . . 1 1 
       1575 1 . . . 1 1 
       1576 1 . . . 1 1 
       1577 1 . . . 1 1 
       1578 1 . . . 1 1 
       1579 1 . . . 1 1 
       1580 1 . . . 1 1 
       1581 1 . . . 1 1 
       1582 1 . . . 1 1 
       1583 1 . . . 1 1 
       1584 1 . . . 1 1 
       1585 1 . . . 1 1 
       1586 1 . . . 1 1 
       1587 1 . . . 1 1 
       1588 1 . . . 1 1 
       1589 1 . . . 1 1 
       1590 1 . . . 1 1 
       1591 1 . . . 1 1 
       1592 1 . . . 1 1 
       1593 1 . . . 1 1 
       1594 1 . . . 1 1 
       1595 1 . . . 1 1 
       1596 1 . . . 1 1 
       1597 1 . . . 1 1 
       1598 1 . . . 1 1 
       1599 1 . . . 1 1 
       1600 1 . . . 1 1 
       1601 1 . . . 1 1 
       1602 1 . . . 1 1 
       1603 1 . . . 1 1 
       1604 1 . . . 1 1 
       1605 1 . . . 1 1 
       1606 1 . . . 1 1 
       1607 1 . . . 1 1 
       1608 1 . . . 1 1 
       1609 1 . . . 1 1 
       1610 1 . . . 1 1 
       1611 1 . . . 1 1 
       1612 1 . . . 1 1 
       1613 1 . . . 1 1 
       1614 1 . . . 1 1 
       1615 1 . . . 1 1 
       1616 1 . . . 1 1 
       1617 1 . . . 1 1 
       1618 1 . . . 1 1 
       1619 1 . . . 1 1 
       1620 1 . . . 1 1 
       1621 1 . . . 1 1 
       1622 1 . . . 1 1 
       1623 1 . . . 1 1 
       1624 1 . . . 1 1 
       1625 1 . . . 1 1 
       1626 1 . . . 1 1 
       1627 1 . . . 1 1 
       1628 1 . . . 1 1 
       1629 1 . . . 1 1 
       1630 1 . . . 1 1 
       1631 1 . . . 1 1 
       1632 1 . . . 1 1 
       1633 1 . . . 1 1 
       1634 1 . . . 1 1 
       1635 1 . . . 1 1 
       1636 1 . . . 1 1 
       1637 1 . . . 1 1 
       1638 1 . . . 1 1 
       1639 1 . . . 1 1 
       1640 1 . . . 1 1 
       1641 1 . . . 1 1 
       1642 1 . . . 1 1 
       1643 1 . . . 1 1 
       1644 1 . . . 1 1 
       1645 1 . . . 1 1 
       1646 1 . . . 1 1 
       1647 1 . . . 1 1 
       1648 1 . . . 1 1 
       1649 1 . . . 1 1 
       1650 1 . . . 1 1 
       1651 1 . . . 1 1 
       1652 1 . . . 1 1 
       1653 1 . . . 1 1 
       1654 1 . . . 1 1 
       1655 1 . . . 1 1 
       1656 1 . . . 1 1 
       1657 1 . . . 1 1 
       1658 1 . . . 1 1 
       1659 1 . . . 1 1 
       1660 1 . . . 1 1 
       1661 1 . . . 1 1 
       1662 1 . . . 1 1 
       1663 1 . . . 1 1 
       1664 1 . . . 1 1 
       1665 1 . . . 1 1 
       1666 1 . . . 1 1 
       1667 1 . . . 1 1 
       1668 1 . . . 1 1 
       1669 1 . . . 1 1 
       1670 1 . . . 1 1 
       1671 1 . . . 1 1 
       1672 1 . . . 1 1 
       1673 1 . . . 1 1 
       1674 1 . . . 1 1 
       1675 1 . . . 1 1 
       1676 1 . . . 1 1 
       1677 1 . . . 1 1 
       1678 1 . . . 1 1 
       1679 1 . . . 1 1 
       1680 1 . . . 1 1 
       1681 1 . . . 1 1 
       1682 1 . . . 1 1 
       1683 1 . . . 1 1 
       1684 1 . . . 1 1 
       1685 1 . . . 1 1 
       1686 1 . . . 1 1 
       1687 1 . . . 1 1 
       1688 1 . . . 1 1 
       1689 1 . . . 1 1 
       1690 1 . . . 1 1 
       1691 1 . . . 1 1 
       1692 1 . . . 1 1 
       1693 1 . . . 1 1 
       1694 1 . . . 1 1 
       1695 1 . . . 1 1 
       1696 1 . . . 1 1 
       1697 1 . . . 1 1 
       1698 1 . . . 1 1 
       1699 1 . . . 1 1 
       1700 1 . . . 1 1 
       1701 1 . . . 1 1 
       1702 1 . . . 1 1 
       1703 1 . . . 1 1 
       1704 1 . . . 1 1 
       1705 1 . . . 1 1 
       1706 1 . . . 1 1 
       1707 1 . . . 1 1 
       1708 1 . . . 1 1 
       1709 1 . . . 1 1 
       1710 1 . . . 1 1 
       1711 1 . . . 1 1 
       1712 1 . . . 1 1 
       1713 1 . . . 1 1 
       1714 1 . . . 1 1 
       1715 1 . . . 1 1 
       1716 1 . . . 1 1 
       1717 1 . . . 1 1 
       1718 1 . . . 1 1 
       1719 1 . . . 1 1 
       1720 1 . . . 1 1 
       1721 1 . . . 1 1 
       1722 1 . . . 1 1 
       1723 1 . . . 1 1 
       1724 1 . . . 1 1 
       1725 1 . . . 1 1 
       1726 1 . . . 1 1 
       1727 1 . . . 1 1 
       1728 1 . . . 1 1 
       1729 1 . . . 1 1 
       1730 1 . . . 1 1 
       1731 1 . . . 1 1 
       1732 1 . . . 1 1 
       1733 1 . . . 1 1 
       1734 1 . . . 1 1 
       1735 1 . . . 1 1 
       1736 1 . . . 1 1 
       1737 1 . . . 1 1 
       1738 1 . . . 1 1 
       1739 1 . . . 1 1 
       1740 1 . . . 1 1 
       1741 1 . . . 1 1 
       1742 1 . . . 1 1 
       1743 1 . . . 1 1 
       1744 1 . . . 1 1 
       1745 1 . . . 1 1 
       1746 1 . . . 1 1 
       1747 1 . . . 1 1 
       1748 1 . . . 1 1 
       1749 1 . . . 1 1 
       1750 1 . . . 1 1 
       1751 1 . . . 1 1 
       1752 1 . . . 1 1 
       1753 1 . . . 1 1 
       1754 1 . . . 1 1 
       1755 1 . . . 1 1 
       1756 1 . . . 1 1 
       1757 1 . . . 1 1 
       1758 1 . . . 1 1 
       1759 1 . . . 1 1 
       1760 1 . . . 1 1 
       1761 1 . . . 1 1 
       1762 1 . . . 1 1 
       1763 1 . . . 1 1 
       1764 1 . . . 1 1 
       1765 1 . . . 1 1 
       1766 1 . . . 1 1 
       1767 1 . . . 1 1 
       1768 1 . . . 1 1 
       1769 1 . . . 1 1 
       1770 1 . . . 1 1 
       1771 1 . . . 1 1 
       1772 1 . . . 1 1 
       1773 1 . . . 1 1 
       1774 1 . . . 1 1 
       1775 1 . . . 1 1 
       1776 1 . . . 1 1 
       1777 1 . . . 1 1 
       1778 1 . . . 1 1 
       1779 1 . . . 1 1 
       1780 1 . . . 1 1 
       1781 1 . . . 1 1 
       1782 1 . . . 1 1 
       1783 1 . . . 1 1 
       1784 1 . . . 1 1 
       1785 1 . . . 1 1 
       1786 1 . . . 1 1 
       1787 1 . . . 1 1 
       1788 1 . . . 1 1 
       1789 1 . . . 1 1 
       1790 1 . . . 1 1 
       1791 1 . . . 1 1 
       1792 1 . . . 1 1 
       1793 1 . . . 1 1 
       1794 1 . . . 1 1 
       1795 1 . . . 1 1 
       1796 1 . . . 1 1 
       1797 1 . . . 1 1 
       1798 1 . . . 1 1 
       1799 1 . . . 1 1 
       1800 1 . . . 1 1 
       1801 1 . . . 1 1 
       1802 1 . . . 1 1 
       1803 1 . . . 1 1 
       1804 1 . . . 1 1 
       1805 1 . . . 1 1 
       1806 1 . . . 1 1 
       1807 1 . . . 1 1 
       1808 1 . . . 1 1 
       1809 1 . . . 1 1 
       1810 1 . . . 1 1 
       1811 1 . . . 1 1 
       1812 1 . . . 1 1 
       1813 1 . . . 1 1 
       1814 1 . . . 1 1 
       1815 1 . . . 1 1 
       1816 1 . . . 1 1 
       1817 1 . . . 1 1 
       1818 1 . . . 1 1 
       1819 1 . . . 1 1 
       1820 1 . . . 1 1 
       1821 1 . . . 1 1 
       1822 1 . . . 1 1 
       1823 1 . . . 1 1 
       1824 1 . . . 1 1 
       1825 1 . . . 1 1 
       1826 1 . . . 1 1 
       1827 1 . . . 1 1 
       1828 1 . . . 1 1 
       1829 1 . . . 1 1 
       1830 1 . . . 1 1 
       1831 1 . . . 1 1 
       1832 1 . . . 1 1 
       1833 1 . . . 1 1 
       1834 1 . . . 1 1 
       1835 1 . . . 1 1 
       1836 1 . . . 1 1 
       1837 1 . . . 1 1 
       1838 1 . . . 1 1 
       1839 1 . . . 1 1 
       1840 1 . . . 1 1 
       1841 1 . . . 1 1 
       1842 1 . . . 1 1 
       1843 1 . . . 1 1 
       1844 1 . . . 1 1 
       1845 1 . . . 1 1 
       1846 1 . . . 1 1 
       1847 1 . . . 1 1 
       1848 1 . . . 1 1 
       1849 1 . . . 1 1 
       1850 1 . . . 1 1 
       1851 1 . . . 1 1 
       1852 1 . . . 1 1 
       1853 1 . . . 1 1 
       1854 1 . . . 1 1 
       1855 1 . . . 1 1 
       1856 1 . . . 1 1 
       1857 1 . . . 1 1 
       1858 1 . . . 1 1 
       1859 1 . . . 1 1 
       1860 1 . . . 1 1 
       1861 1 . . . 1 1 
       1862 1 . . . 1 1 
       1863 1 . . . 1 1 
       1864 1 . . . 1 1 
       1865 1 . . . 1 1 
       1866 1 . . . 1 1 
       1867 1 . . . 1 1 
       1868 1 . . . 1 1 
       1869 1 . . . 1 1 
       1870 1 . . . 1 1 
       1871 1 . . . 1 1 
       1872 1 . . . 1 1 
       1873 1 . . . 1 1 
       1874 1 . . . 1 1 
       1875 1 . . . 1 1 
       1876 1 . . . 1 1 
       1877 1 . . . 1 1 
       1878 1 . . . 1 1 
       1879 1 . . . 1 1 
       1880 1 . . . 1 1 
       1881 1 . . . 1 1 
       1882 1 . . . 1 1 
       1883 1 . . . 1 1 
       1884 1 . . . 1 1 
       1885 1 . . . 1 1 
       1886 1 . . . 1 1 
       1887 1 . . . 1 1 
       1888 1 . . . 1 1 
       1889 1 . . . 1 1 
       1890 1 . . . 1 1 
       1891 1 . . . 1 1 
       1892 1 . . . 1 1 
       1893 1 . . . 1 1 
       1894 1 . . . 1 1 
       1895 1 . . . 1 1 
       1896 1 . . . 1 1 
       1897 1 . . . 1 1 
       1898 1 . . . 1 1 
       1899 1 . . . 1 1 
       1900 1 . . . 1 1 
       1901 1 . . . 1 1 
       1902 1 . . . 1 1 
       1903 1 . . . 1 1 
       1904 1 . . . 1 1 
       1905 1 . . . 1 1 
       1906 1 . . . 1 1 
       1907 1 . . . 1 1 
       1908 1 . . . 1 1 
       1909 1 . . . 1 1 
       1910 1 . . . 1 1 
       1911 1 . . . 1 1 
       1912 1 . . . 1 1 
       1913 1 . . . 1 1 
       1914 1 . . . 1 1 
       1915 1 . . . 1 1 
       1916 1 . . . 1 1 
       1917 1 . . . 1 1 
       1918 1 . . . 1 1 
       1919 1 . . . 1 1 
       1920 1 . . . 1 1 
       1921 1 . . . 1 1 
       1922 1 . . . 1 1 
       1923 1 . . . 1 1 
       1924 1 . . . 1 1 
       1925 1 . . . 1 1 
       1926 1 . . . 1 1 
       1927 1 . . . 1 1 
       1928 1 . . . 1 1 
       1929 1 . . . 1 1 
       1930 1 . . . 1 1 
       1931 1 . . . 1 1 
       1932 1 . . . 1 1 
       1933 1 . . . 1 1 
       1934 1 . . . 1 1 
       1935 1 . . . 1 1 
       1936 1 . . . 1 1 
       1937 1 . . . 1 1 
       1938 1 . . . 1 1 
       1939 1 . . . 1 1 
       1940 1 . . . 1 1 
       1941 1 . . . 1 1 
       1942 1 . . . 1 1 
       1943 1 . . . 1 1 
       1944 1 . . . 1 1 
       1945 1 . . . 1 1 
       1946 1 . . . 1 1 
       1947 1 . . . 1 1 
       1948 1 . . . 1 1 
       1949 1 . . . 1 1 
       1950 1 . . . 1 1 
       1951 1 . . . 1 1 
       1952 1 . . . 1 1 
       1953 1 . . . 1 1 
       1954 1 . . . 1 1 
       1955 1 . . . 1 1 
       1956 1 . . . 1 1 
       1957 1 . . . 1 1 
       1958 1 . . . 1 1 
       1959 1 . . . 1 1 
       1960 1 . . . 1 1 
       1961 1 . . . 1 1 
       1962 1 . . . 1 1 
       1963 1 . . . 1 1 
       1964 1 . . . 1 1 
       1965 1 . . . 1 1 
       1966 1 . . . 1 1 
       1967 1 . . . 1 1 
       1968 1 . . . 1 1 
       1969 1 . . . 1 1 
       1970 1 . . . 1 1 
       1971 1 . . . 1 1 
       1972 1 . . . 1 1 
       1973 1 . . . 1 1 
       1974 1 . . . 1 1 
       1975 1 . . . 1 1 
       1976 1 . . . 1 1 
       1977 1 . . . 1 1 
       1978 1 . . . 1 1 
       1979 1 . . . 1 1 
       1980 1 . . . 1 1 
       1981 1 . . . 1 1 
       1982 1 . . . 1 1 
       1983 1 . . . 1 1 
       1984 1 . . . 1 1 
       1985 1 . . . 1 1 
       1986 1 . . . 1 1 
       1987 1 . . . 1 1 
       1988 1 . . . 1 1 
       1989 1 . . . 1 1 
       1990 1 . . . 1 1 
       1991 1 . . . 1 1 
       1992 1 . . . 1 1 
       1993 1 . . . 1 1 
       1994 1 . . . 1 1 
       1995 1 . . . 1 1 
       1996 1 . . . 1 1 
       1997 1 . . . 1 1 
       1998 1 . . . 1 1 
       1999 1 . . . 1 1 
       2000 1 . . . 1 1 
       2001 1 . . . 1 1 
       2002 1 . . . 1 1 
       2003 1 . . . 1 1 
       2004 1 . . . 1 1 
       2005 1 . . . 1 1 
       2006 1 . . . 1 1 
       2007 1 . . . 1 1 
       2008 1 . . . 1 1 
       2009 1 . . . 1 1 
       2010 1 . . . 1 1 
       2011 1 . . . 1 1 
       2012 1 . . . 1 1 
       2013 1 . . . 1 1 
       2014 1 . . . 1 1 
       2015 1 . . . 1 1 
       2016 1 . . . 1 1 
       2017 1 . . . 1 1 
       2018 1 . . . 1 1 
       2019 1 . . . 1 1 
       2020 1 . . . 1 1 
       2021 1 . . . 1 1 
       2022 1 . . . 1 1 
       2023 1 . . . 1 1 
       2024 1 . . . 1 1 
       2025 1 . . . 1 1 
       2026 1 . . . 1 1 
       2027 1 . . . 1 1 
       2028 1 . . . 1 1 
       2029 1 . . . 1 1 
       2030 1 . . . 1 1 
       2031 1 . . . 1 1 
       2032 1 . . . 1 1 
       2033 1 . . . 1 1 
       2034 1 . . . 1 1 
       2035 1 . . . 1 1 
       2036 1 . . . 1 1 
       2037 1 . . . 1 1 
       2038 1 . . . 1 1 
       2039 1 . . . 1 1 
       2040 1 . . . 1 1 
       2041 1 . . . 1 1 
       2042 1 . . . 1 1 
       2043 1 . . . 1 1 
       2044 1 . . . 1 1 
       2045 1 . . . 1 1 
       2046 1 . . . 1 1 
       2047 1 . . . 1 1 
       2048 1 . . . 1 1 
       2049 1 . . . 1 1 
       2050 1 . . . 1 1 
       2051 1 . . . 1 1 
       2052 1 . . . 1 1 
       2053 1 . . . 1 1 
       2054 1 . . . 1 1 
       2055 1 . . . 1 1 
       2056 1 . . . 1 1 
       2057 1 . . . 1 1 
       2058 1 . . . 1 1 
       2059 1 . . . 1 1 
       2060 1 . . . 1 1 
       2061 1 . . . 1 1 
       2062 1 . . . 1 1 
       2063 1 . . . 1 1 
       2064 1 . . . 1 1 
       2065 1 . . . 1 1 
       2066 1 . . . 1 1 
       2067 1 . . . 1 1 
       2068 1 . . . 1 1 
       2069 1 . . . 1 1 
       2070 1 . . . 1 1 
       2071 1 . . . 1 1 
       2072 1 . . . 1 1 
       2073 1 . . . 1 1 
       2074 1 . . . 1 1 
       2075 1 . . . 1 1 
       2076 1 . . . 1 1 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

          1 1 1 1 1  4 GLY QA   .  4 GLY  QA   1 1 
          1 1 2 1 1  5 SER HA   .  5 SER  HA   1 1 
          2 1 1 1 1  4 GLY QA   .  4 GLY  QA   1 1 
          2 1 2 1 1  6 SER H    .  6 SER  HN   1 1 
          3 1 1 1 1  6 SER H    .  6 SER  HN   1 1 
          3 1 2 1 1  7 GLY H    .  7 GLY  HN   1 1 
          4 1 1 1 1  6 SER HB3  .  6 SER  HB3  1 1 
          4 1 2 1 1  7 GLY H    .  7 GLY  HN   1 1 
          5 1 1 1 1  7 GLY H    .  7 GLY  HN   1 1 
          5 1 2 1 1  8 PRO HD2  .  8 PRO  HD2  1 1 
          6 1 1 1 1  7 GLY H    .  7 GLY  HN   1 1 
          6 1 2 1 1  8 PRO HD3  .  8 PRO  HD3  1 1 
          7 1 1 1 1  7 GLY H    .  7 GLY  HN   1 1 
          7 1 2 1 1 74 TRP HE1  . 74 TRP  HE1  1 1 
          8 1 1 1 1  7 GLY QA   .  7 GLY  QA   1 1 
          8 1 2 1 1 74 TRP HD1  . 74 TRP  HD1  1 1 
          9 1 1 1 1  7 GLY QA   .  7 GLY  QA   1 1 
          9 1 2 1 1 74 TRP HE1  . 74 TRP  HE1  1 1 
         10 1 1 1 1  8 PRO HA   .  8 PRO  HA   1 1 
         10 1 2 1 1  9 LYS H    .  9 LYS+ HN   1 1 
         11 1 1 1 1  8 PRO HA   .  8 PRO  HA   1 1 
         11 1 2 1 1  9 LYS QB   .  9 LYS+ QB   1 1 
         12 1 1 1 1  8 PRO HA   .  8 PRO  HA   1 1 
         12 1 2 1 1  9 LYS QG   .  9 LYS+ QG   1 1 
         13 1 1 1 1  8 PRO HB2  .  8 PRO  HB3  1 1 
         13 1 2 1 1  9 LYS H    .  9 LYS+ HN   1 1 
         14 1 1 1 1  8 PRO HB2  .  8 PRO  HB3  1 1 
         14 1 2 1 1 67 TYR HA   . 67 TYR  HA   1 1 
         15 1 1 1 1  8 PRO HB2  .  8 PRO  HB3  1 1 
         15 1 2 1 1 67 TYR QD   . 67 TYR  QD   1 1 
         16 1 1 1 1  8 PRO HB2  .  8 PRO  HB3  1 1 
         16 1 2 1 1 67 TYR QE   . 67 TYR  QE   1 1 
         17 1 1 1 1  8 PRO HB2  .  8 PRO  HB3  1 1 
         17 1 2 1 1 70 HIS HB2  . 70 HIS  HB2  1 1 
         18 1 1 1 1  8 PRO HB2  .  8 PRO  HB3  1 1 
         18 1 2 1 1 70 HIS HB3  . 70 HIS  HB3  1 1 
         19 1 1 1 1  8 PRO HB2  .  8 PRO  HB3  1 1 
         19 1 2 1 1 71 LEU QD   . 71 LEU  QD1  1 1 
         20 1 1 1 1  8 PRO HB3  .  8 PRO  HB2  1 1 
         20 1 2 1 1  9 LYS H    .  9 LYS+ HN   1 1 
         21 1 1 1 1  8 PRO HB3  .  8 PRO  HB2  1 1 
         21 1 2 1 1 67 TYR QD   . 67 TYR  QD   1 1 
         22 1 1 1 1  8 PRO HB3  .  8 PRO  HB2  1 1 
         22 1 2 1 1 67 TYR QE   . 67 TYR  QE   1 1 
         23 1 1 1 1  8 PRO HB3  .  8 PRO  HB2  1 1 
         23 1 2 1 1 70 HIS HB2  . 70 HIS  HB2  1 1 
         24 1 1 1 1  8 PRO HB3  .  8 PRO  HB2  1 1 
         24 1 2 1 1 70 HIS HB3  . 70 HIS  HB3  1 1 
         25 1 1 1 1  8 PRO HD2  .  8 PRO  HD2  1 1 
         25 1 2 1 1 71 LEU HA   . 71 LEU  HA   1 1 
         26 1 1 1 1  8 PRO HD2  .  8 PRO  HD2  1 1 
         26 1 2 1 1 71 LEU QD   . 71 LEU  QD1  1 1 
         27 1 1 1 1  8 PRO HD2  .  8 PRO  HD2  1 1 
         27 1 2 1 1 74 TRP HB2  . 74 TRP  HB3  1 1 
         28 1 1 1 1  8 PRO HD2  .  8 PRO  HD2  1 1 
         28 1 2 1 1 74 TRP HB3  . 74 TRP  HB2  1 1 
         29 1 1 1 1  8 PRO HD3  .  8 PRO  HD3  1 1 
         29 1 2 1 1 71 LEU QD   . 71 LEU  QD1  1 1 
         30 1 1 1 1  8 PRO HD3  .  8 PRO  HD3  1 1 
         30 1 2 1 1 74 TRP HB2  . 74 TRP  HB3  1 1 
         31 1 1 1 1  8 PRO HD3  .  8 PRO  HD3  1 1 
         31 1 2 1 1 74 TRP HB3  . 74 TRP  HB2  1 1 
         32 1 1 1 1  8 PRO HD3  .  8 PRO  HD3  1 1 
         32 1 2 1 1 74 TRP HD1  . 74 TRP  HD1  1 1 
         33 1 1 1 1  8 PRO HG2  .  8 PRO  HG2  1 1 
         33 1 2 1 1 67 TYR QE   . 67 TYR  QE   1 1 
         34 1 1 1 1  8 PRO HG2  .  8 PRO  HG2  1 1 
         34 1 2 1 1 70 HIS HB2  . 70 HIS  HB2  1 1 
         35 1 1 1 1  8 PRO HG2  .  8 PRO  HG2  1 1 
         35 1 2 1 1 70 HIS HB3  . 70 HIS  HB3  1 1 
         36 1 1 1 1  8 PRO HG2  .  8 PRO  HG2  1 1 
         36 1 2 1 1 71 LEU QD   . 71 LEU  QD1  1 1 
         37 1 1 1 1  8 PRO HG3  .  8 PRO  HG3  1 1 
         37 1 2 1 1 67 TYR QE   . 67 TYR  QE   1 1 
         38 1 1 1 1  8 PRO HG3  .  8 PRO  HG3  1 1 
         38 1 2 1 1 70 HIS HB2  . 70 HIS  HB2  1 1 
         39 1 1 1 1  8 PRO HG3  .  8 PRO  HG3  1 1 
         39 1 2 1 1 70 HIS HB3  . 70 HIS  HB3  1 1 
         40 1 1 1 1  8 PRO HG3  .  8 PRO  HG3  1 1 
         40 1 2 1 1 71 LEU HA   . 71 LEU  HA   1 1 
         41 1 1 1 1  8 PRO HG3  .  8 PRO  HG3  1 1 
         41 1 2 1 1 74 TRP HB2  . 74 TRP  HB3  1 1 
         42 1 1 1 1  8 PRO HG3  .  8 PRO  HG3  1 1 
         42 1 2 1 1 74 TRP HB3  . 74 TRP  HB2  1 1 
         43 1 1 1 1  9 LYS H    .  9 LYS+ HN   1 1 
         43 1 2 1 1  9 LYS QB   .  9 LYS+ QB   1 1 
         44 1 1 1 1  9 LYS H    .  9 LYS+ HN   1 1 
         44 1 2 1 1  9 LYS QD   .  9 LYS+ QD   1 1 
         45 1 1 1 1  9 LYS H    .  9 LYS+ HN   1 1 
         45 1 2 1 1  9 LYS QG   .  9 LYS+ QG   1 1 
         46 1 1 1 1  9 LYS H    .  9 LYS+ HN   1 1 
         46 1 2 1 1 67 TYR QD   . 67 TYR  QD   1 1 
         47 1 1 1 1  9 LYS H    .  9 LYS+ HN   1 1 
         47 1 2 1 1 67 TYR QE   . 67 TYR  QE   1 1 
         48 1 1 1 1  9 LYS HA   .  9 LYS+ HA   1 1 
         48 1 2 1 1  9 LYS QD   .  9 LYS+ QD   1 1 
         49 1 1 1 1  9 LYS HA   .  9 LYS+ HA   1 1 
         49 1 2 1 1  9 LYS QG   .  9 LYS+ QG   1 1 
         50 1 1 1 1  9 LYS HA   .  9 LYS+ HA   1 1 
         50 1 2 1 1 10 LYS H    . 10 LYS+ HN   1 1 
         51 1 1 1 1  9 LYS HA   .  9 LYS+ HA   1 1 
         51 1 2 1 1 10 LYS HB2  . 10 LYS+ HB2  1 1 
         52 1 1 1 1  9 LYS HA   .  9 LYS+ HA   1 1 
         52 1 2 1 1 10 LYS HB3  . 10 LYS+ HB3  1 1 
         53 1 1 1 1  9 LYS HA   .  9 LYS+ HA   1 1 
         53 1 2 1 1 67 TYR QE   . 67 TYR  QE   1 1 
         54 1 1 1 1  9 LYS QB   .  9 LYS+ QB   1 1 
         54 1 2 1 1 10 LYS H    . 10 LYS+ HN   1 1 
         55 1 1 1 1  9 LYS QD   .  9 LYS+ QD   1 1 
         55 1 2 1 1  9 LYS QG   .  9 LYS+ QG   1 1 
         56 1 1 1 1  9 LYS QE   .  9 LYS+ QE   1 1 
         56 1 2 1 1  9 LYS QG   .  9 LYS+ QG   1 1 
         57 1 1 1 1  9 LYS QG   .  9 LYS+ QG   1 1 
         57 1 2 1 1 10 LYS H    . 10 LYS+ HN   1 1 
         58 1 1 1 1 10 LYS H    . 10 LYS+ HN   1 1 
         58 1 2 1 1 10 LYS HB2  . 10 LYS+ HB2  1 1 
         59 1 1 1 1 10 LYS H    . 10 LYS+ HN   1 1 
         59 1 2 1 1 10 LYS HB3  . 10 LYS+ HB3  1 1 
         60 1 1 1 1 10 LYS H    . 10 LYS+ HN   1 1 
         60 1 2 1 1 10 LYS QD   . 10 LYS+ QD   1 1 
         61 1 1 1 1 10 LYS H    . 10 LYS+ HN   1 1 
         61 1 2 1 1 10 LYS QE   . 10 LYS+ QE   1 1 
         62 1 1 1 1 10 LYS H    . 10 LYS+ HN   1 1 
         62 1 2 1 1 10 LYS HG3  . 10 LYS+ HG3  1 1 
         63 1 1 1 1 10 LYS H    . 10 LYS+ HN   1 1 
         63 1 2 1 1 67 TYR QE   . 67 TYR  QE   1 1 
         64 1 1 1 1 10 LYS HA   . 10 LYS+ HA   1 1 
         64 1 2 1 1 10 LYS QD   . 10 LYS+ QD   1 1 
         65 1 1 1 1 10 LYS HA   . 10 LYS+ HA   1 1 
         65 1 2 1 1 10 LYS HG2  . 10 LYS+ HG2  1 1 
         66 1 1 1 1 10 LYS HA   . 10 LYS+ HA   1 1 
         66 1 2 1 1 67 TYR QE   . 67 TYR  QE   1 1 
         67 1 1 1 1 10 LYS HB2  . 10 LYS+ HB2  1 1 
         67 1 2 1 1 10 LYS QE   . 10 LYS+ QE   1 1 
         68 1 1 1 1 10 LYS HB3  . 10 LYS+ HB3  1 1 
         68 1 2 1 1 10 LYS QE   . 10 LYS+ QE   1 1 
         69 1 1 1 1 10 LYS QD   . 10 LYS+ QD   1 1 
         69 1 2 1 1 67 TYR QE   . 67 TYR  QE   1 1 
         70 1 1 1 1 10 LYS QE   . 10 LYS+ QE   1 1 
         70 1 2 1 1 10 LYS HG3  . 10 LYS+ HG3  1 1 
         71 1 1 1 1 10 LYS QE   . 10 LYS+ QE   1 1 
         71 1 2 1 1 67 TYR QE   . 67 TYR  QE   1 1 
         72 1 1 1 1 10 LYS HG3  . 10 LYS+ HG3  1 1 
         72 1 2 1 1 67 TYR QE   . 67 TYR  QE   1 1 
         73 1 1 1 1 11 PRO HA   . 11 PRO  HA   1 1 
         73 1 2 1 1 12 PRO HD2  . 12 PRO  HD3  1 1 
         74 1 1 1 1 11 PRO HA   . 11 PRO  HA   1 1 
         74 1 2 1 1 12 PRO HD3  . 12 PRO  HD2  1 1 
         75 1 1 1 1 11 PRO HB2  . 11 PRO  HB2  1 1 
         75 1 2 1 1 12 PRO HD3  . 12 PRO  HD2  1 1 
         76 1 1 1 1 11 PRO HB2  . 11 PRO  HB2  1 1 
         76 1 2 1 1 63 GLN HE21 . 63 GLN  HE22 1 1 
         77 1 1 1 1 11 PRO HB2  . 11 PRO  HB2  1 1 
         77 1 2 1 1 63 GLN HE22 . 63 GLN  HE21 1 1 
         78 1 1 1 1 11 PRO HB2  . 11 PRO  HB2  1 1 
         78 1 2 1 1 64 GLN HA   . 64 GLN  HA   1 1 
         79 1 1 1 1 11 PRO HB2  . 11 PRO  HB2  1 1 
         79 1 2 1 1 64 GLN HG2  . 64 GLN  HG3  1 1 
         80 1 1 1 1 11 PRO HB2  . 11 PRO  HB2  1 1 
         80 1 2 1 1 64 GLN HG3  . 64 GLN  HG2  1 1 
         81 1 1 1 1 11 PRO HB2  . 11 PRO  HB2  1 1 
         81 1 2 1 1 67 TYR QB   . 67 TYR  QB   1 1 
         82 1 1 1 1 11 PRO HB3  . 11 PRO  HB3  1 1 
         82 1 2 1 1 12 PRO HD2  . 12 PRO  HD3  1 1 
         83 1 1 1 1 11 PRO HB3  . 11 PRO  HB3  1 1 
         83 1 2 1 1 12 PRO HD3  . 12 PRO  HD2  1 1 
         84 1 1 1 1 11 PRO HB3  . 11 PRO  HB3  1 1 
         84 1 2 1 1 63 GLN HG2  . 63 GLN  HG2  1 1 
         85 1 1 1 1 11 PRO HB3  . 11 PRO  HB3  1 1 
         85 1 2 1 1 63 GLN HG3  . 63 GLN  HG3  1 1 
         86 1 1 1 1 11 PRO HB3  . 11 PRO  HB3  1 1 
         86 1 2 1 1 64 GLN HA   . 64 GLN  HA   1 1 
         87 1 1 1 1 11 PRO HB3  . 11 PRO  HB3  1 1 
         87 1 2 1 1 64 GLN HG2  . 64 GLN  HG3  1 1 
         88 1 1 1 1 11 PRO HB3  . 11 PRO  HB3  1 1 
         88 1 2 1 1 64 GLN HG3  . 64 GLN  HG2  1 1 
         89 1 1 1 1 11 PRO HD2  . 11 PRO  HD2  1 1 
         89 1 2 1 1 67 TYR QD   . 67 TYR  QD   1 1 
         90 1 1 1 1 11 PRO HD3  . 11 PRO  HD3  1 1 
         90 1 2 1 1 67 TYR QD   . 67 TYR  QD   1 1 
         91 1 1 1 1 11 PRO HG2  . 11 PRO  HG3  1 1 
         91 1 2 1 1 12 PRO HD2  . 12 PRO  HD3  1 1 
         92 1 1 1 1 11 PRO HG2  . 11 PRO  HG3  1 1 
         92 1 2 1 1 64 GLN HA   . 64 GLN  HA   1 1 
         93 1 1 1 1 11 PRO HG2  . 11 PRO  HG3  1 1 
         93 1 2 1 1 64 GLN HG2  . 64 GLN  HG3  1 1 
         94 1 1 1 1 11 PRO HG2  . 11 PRO  HG3  1 1 
         94 1 2 1 1 64 GLN HG3  . 64 GLN  HG2  1 1 
         95 1 1 1 1 11 PRO HG2  . 11 PRO  HG3  1 1 
         95 1 2 1 1 67 TYR QB   . 67 TYR  QB   1 1 
         96 1 1 1 1 11 PRO HG2  . 11 PRO  HG3  1 1 
         96 1 2 1 1 67 TYR QD   . 67 TYR  QD   1 1 
         97 1 1 1 1 11 PRO HG3  . 11 PRO  HG2  1 1 
         97 1 2 1 1 12 PRO HD2  . 12 PRO  HD3  1 1 
         98 1 1 1 1 11 PRO HG3  . 11 PRO  HG2  1 1 
         98 1 2 1 1 64 GLN HA   . 64 GLN  HA   1 1 
         99 1 1 1 1 11 PRO HG3  . 11 PRO  HG2  1 1 
         99 1 2 1 1 64 GLN HG2  . 64 GLN  HG3  1 1 
        100 1 1 1 1 11 PRO HG3  . 11 PRO  HG2  1 1 
        100 1 2 1 1 64 GLN HG3  . 64 GLN  HG2  1 1 
        101 1 1 1 1 11 PRO HG3  . 11 PRO  HG2  1 1 
        101 1 2 1 1 67 TYR H    . 67 TYR  HN   1 1 
        102 1 1 1 1 11 PRO HG3  . 11 PRO  HG2  1 1 
        102 1 2 1 1 67 TYR QB   . 67 TYR  QB   1 1 
        103 1 1 1 1 11 PRO HG3  . 11 PRO  HG2  1 1 
        103 1 2 1 1 67 TYR QD   . 67 TYR  QD   1 1 
        104 1 1 1 1 12 PRO HA   . 12 PRO  HA   1 1 
        104 1 2 1 1 13 MET H    . 13 MET  HN   1 1 
        105 1 1 1 1 12 PRO HA   . 12 PRO  HA   1 1 
        105 1 2 1 1 13 MET QB   . 13 MET  HB2  1 1 
        106 1 1 1 1 12 PRO HA   . 12 PRO  HA   1 1 
        106 1 2 1 1 13 MET HG2  . 13 MET  HG2  1 1 
        107 1 1 1 1 12 PRO HA   . 12 PRO  HA   1 1 
        107 1 2 1 1 13 MET HG3  . 13 MET  HG3  1 1 
        108 1 1 1 1 12 PRO HA   . 12 PRO  HA   1 1 
        108 1 2 1 1 17 GLN HB3  . 17 GLN  HB3  1 1 
        109 1 1 1 1 12 PRO HA   . 12 PRO  HA   1 1 
        109 1 2 1 1 17 GLN HE21 . 17 GLN  HE21 1 1 
        110 1 1 1 1 12 PRO HA   . 12 PRO  HA   1 1 
        110 1 2 1 1 60 ALA MB   . 60 ALA  QB   1 1 
        111 1 1 1 1 12 PRO HB2  . 12 PRO  HB2  1 1 
        111 1 2 1 1 13 MET H    . 13 MET  HN   1 1 
        112 1 1 1 1 12 PRO HB2  . 12 PRO  HB2  1 1 
        112 1 2 1 1 18 LYS H    . 18 LYS+ HN   1 1 
        113 1 1 1 1 12 PRO HB2  . 12 PRO  HB2  1 1 
        113 1 2 1 1 60 ALA MB   . 60 ALA  QB   1 1 
        114 1 1 1 1 12 PRO HB3  . 12 PRO  HB3  1 1 
        114 1 2 1 1 13 MET H    . 13 MET  HN   1 1 
        115 1 1 1 1 12 PRO HB3  . 12 PRO  HB3  1 1 
        115 1 2 1 1 17 GLN HE21 . 17 GLN  HE21 1 1 
        116 1 1 1 1 12 PRO HB3  . 12 PRO  HB3  1 1 
        116 1 2 1 1 18 LYS H    . 18 LYS+ HN   1 1 
        117 1 1 1 1 12 PRO HB3  . 12 PRO  HB3  1 1 
        117 1 2 1 1 18 LYS HA   . 18 LYS+ HA   1 1 
        118 1 1 1 1 12 PRO HB3  . 12 PRO  HB3  1 1 
        118 1 2 1 1 60 ALA MB   . 60 ALA  QB   1 1 
        119 1 1 1 1 12 PRO HD2  . 12 PRO  HD3  1 1 
        119 1 2 1 1 60 ALA MB   . 60 ALA  QB   1 1 
        120 1 1 1 1 12 PRO HD2  . 12 PRO  HD3  1 1 
        120 1 2 1 1 63 GLN HB2  . 63 GLN  HB2  1 1 
        121 1 1 1 1 12 PRO HD2  . 12 PRO  HD3  1 1 
        121 1 2 1 1 63 GLN HB3  . 63 GLN  HB3  1 1 
        122 1 1 1 1 12 PRO HD2  . 12 PRO  HD3  1 1 
        122 1 2 1 1 63 GLN HE21 . 63 GLN  HE22 1 1 
        123 1 1 1 1 12 PRO HD2  . 12 PRO  HD3  1 1 
        123 1 2 1 1 63 GLN HE22 . 63 GLN  HE21 1 1 
        124 1 1 1 1 12 PRO HD2  . 12 PRO  HD3  1 1 
        124 1 2 1 1 64 GLN HG3  . 64 GLN  HG2  1 1 
        125 1 1 1 1 12 PRO HD3  . 12 PRO  HD2  1 1 
        125 1 2 1 1 63 GLN HB2  . 63 GLN  HB2  1 1 
        126 1 1 1 1 12 PRO HD3  . 12 PRO  HD2  1 1 
        126 1 2 1 1 63 GLN HB3  . 63 GLN  HB3  1 1 
        127 1 1 1 1 12 PRO HD3  . 12 PRO  HD2  1 1 
        127 1 2 1 1 63 GLN HE21 . 63 GLN  HE22 1 1 
        128 1 1 1 1 12 PRO HD3  . 12 PRO  HD2  1 1 
        128 1 2 1 1 63 GLN HE22 . 63 GLN  HE21 1 1 
        129 1 1 1 1 12 PRO HD3  . 12 PRO  HD2  1 1 
        129 1 2 1 1 63 GLN HG3  . 63 GLN  HG3  1 1 
        130 1 1 1 1 12 PRO QG   . 12 PRO  HG3  1 1 
        130 1 2 1 1 18 LYS H    . 18 LYS+ HN   1 1 
        131 1 1 1 1 12 PRO QG   . 12 PRO  HG3  1 1 
        131 1 2 1 1 18 LYS HA   . 18 LYS+ HA   1 1 
        132 1 1 1 1 12 PRO QG   . 12 PRO  HG2  1 1 
        132 1 2 1 1 18 LYS HB2  . 18 LYS+ HB3  1 1 
        133 1 1 1 1 12 PRO QG   . 12 PRO  HG3  1 1 
        133 1 2 1 1 18 LYS HG2  . 18 LYS+ HG3  1 1 
        134 1 1 1 1 12 PRO QG   . 12 PRO  HG3  1 1 
        134 1 2 1 1 60 ALA H    . 60 ALA  HN   1 1 
        135 1 1 1 1 12 PRO QG   . 12 PRO  HG3  1 1 
        135 1 2 1 1 60 ALA HA   . 60 ALA  HA   1 1 
        136 1 1 1 1 12 PRO QG   . 12 PRO  HG2  1 1 
        136 1 2 1 1 60 ALA MB   . 60 ALA  QB   1 1 
        137 1 1 1 1 12 PRO QG   . 12 PRO  HG2  1 1 
        137 1 2 1 1 63 GLN HE21 . 63 GLN  HE22 1 1 
        138 1 1 1 1 13 MET H    . 13 MET  HN   1 1 
        138 1 2 1 1 13 MET QB   . 13 MET  HB2  1 1 
        139 1 1 1 1 13 MET H    . 13 MET  HN   1 1 
        139 1 2 1 1 13 MET HG2  . 13 MET  HG2  1 1 
        140 1 1 1 1 13 MET H    . 13 MET  HN   1 1 
        140 1 2 1 1 13 MET HG3  . 13 MET  HG3  1 1 
        141 1 1 1 1 13 MET H    . 13 MET  HN   1 1 
        141 1 2 1 1 17 GLN HB2  . 17 GLN  HB2  1 1 
        142 1 1 1 1 13 MET H    . 13 MET  HN   1 1 
        142 1 2 1 1 17 GLN HB3  . 17 GLN  HB3  1 1 
        143 1 1 1 1 13 MET H    . 13 MET  HN   1 1 
        143 1 2 1 1 17 GLN HE21 . 17 GLN  HE21 1 1 
        144 1 1 1 1 13 MET H    . 13 MET  HN   1 1 
        144 1 2 1 1 17 GLN HE22 . 17 GLN  HE22 1 1 
        145 1 1 1 1 13 MET H    . 13 MET  HN   1 1 
        145 1 2 1 1 17 GLN HG2  . 17 GLN  HG3  1 1 
        146 1 1 1 1 13 MET H    . 13 MET  HN   1 1 
        146 1 2 1 1 17 GLN HG3  . 17 GLN  HG2  1 1 
        147 1 1 1 1 13 MET HA   . 13 MET  HA   1 1 
        147 1 2 1 1 13 MET ME   . 13 MET  QE   1 1 
        148 1 1 1 1 13 MET HA   . 13 MET  HA   1 1 
        148 1 2 1 1 13 MET HG3  . 13 MET  HG3  1 1 
        149 1 1 1 1 13 MET HA   . 13 MET  HA   1 1 
        149 1 2 1 1 17 GLN HE21 . 17 GLN  HE21 1 1 
        150 1 1 1 1 13 MET HA   . 13 MET  HA   1 1 
        150 1 2 1 1 64 GLN HE21 . 64 GLN  HE21 1 1 
        151 1 1 1 1 13 MET HA   . 13 MET  HA   1 1 
        151 1 2 1 1 64 GLN HE22 . 64 GLN  HE22 1 1 
        152 1 1 1 1 13 MET HA   . 13 MET  HA   1 1 
        152 1 2 1 1 64 GLN HG2  . 64 GLN  HG3  1 1 
        153 1 1 1 1 13 MET QB   . 13 MET  HB3  1 1 
        153 1 2 1 1 14 ASN HD22 . 14 ASN  HD21 1 1 
        154 1 1 1 1 13 MET QB   . 13 MET  HB2  1 1 
        154 1 2 1 1 17 GLN HE21 . 17 GLN  HE21 1 1 
        155 1 1 1 1 13 MET QB   . 13 MET  HB2  1 1 
        155 1 2 1 1 17 GLN HE22 . 17 GLN  HE22 1 1 
        156 1 1 1 1 13 MET ME   . 13 MET  QE   1 1 
        156 1 2 1 1 13 MET HG2  . 13 MET  HG2  1 1 
        157 1 1 1 1 13 MET ME   . 13 MET  QE   1 1 
        157 1 2 1 1 14 ASN HD21 . 14 ASN  HD22 1 1 
        158 1 1 1 1 13 MET ME   . 13 MET  QE   1 1 
        158 1 2 1 1 14 ASN HD22 . 14 ASN  HD21 1 1 
        159 1 1 1 1 13 MET HG2  . 13 MET  HG2  1 1 
        159 1 2 1 1 17 GLN HE21 . 17 GLN  HE21 1 1 
        160 1 1 1 1 13 MET HG3  . 13 MET  HG3  1 1 
        160 1 2 1 1 17 GLN HE21 . 17 GLN  HE21 1 1 
        161 1 1 1 1 13 MET HG3  . 13 MET  HG3  1 1 
        161 1 2 1 1 17 GLN HE22 . 17 GLN  HE22 1 1 
        162 1 1 1 1 14 ASN HA   . 14 ASN  HA   1 1 
        162 1 2 1 1 14 ASN HD22 . 14 ASN  HD21 1 1 
        163 1 1 1 1 14 ASN HA   . 14 ASN  HA   1 1 
        163 1 2 1 1 16 TYR H    . 16 TYR  HN   1 1 
        164 1 1 1 1 14 ASN HA   . 14 ASN  HA   1 1 
        164 1 2 1 1 60 ALA MB   . 60 ALA  QB   1 1 
        165 1 1 1 1 14 ASN HB2  . 14 ASN  HB2  1 1 
        165 1 2 1 1 15 GLY H    . 15 GLY  HN   1 1 
        166 1 1 1 1 14 ASN HB2  . 14 ASN  HB2  1 1 
        166 1 2 1 1 16 TYR H    . 16 TYR  HN   1 1 
        167 1 1 1 1 14 ASN HB3  . 14 ASN  HB3  1 1 
        167 1 2 1 1 15 GLY H    . 15 GLY  HN   1 1 
        168 1 1 1 1 14 ASN HB3  . 14 ASN  HB3  1 1 
        168 1 2 1 1 16 TYR H    . 16 TYR  HN   1 1 
        169 1 1 1 1 14 ASN HD21 . 14 ASN  HD22 1 1 
        169 1 2 1 1 16 TYR QD   . 16 TYR  QD   1 1 
        170 1 1 1 1 14 ASN HD21 . 14 ASN  HD22 1 1 
        170 1 2 1 1 17 GLN H    . 17 GLN  HN   1 1 
        171 1 1 1 1 14 ASN HD21 . 14 ASN  HD22 1 1 
        171 1 2 1 1 17 GLN HG3  . 17 GLN  HG2  1 1 
        172 1 1 1 1 15 GLY H    . 15 GLY  HN   1 1 
        172 1 2 1 1 16 TYR H    . 16 TYR  HN   1 1 
        173 1 1 1 1 15 GLY H    . 15 GLY  HN   1 1 
        173 1 2 1 1 57 LYS HA   . 57 LYS+ HA   1 1 
        174 1 1 1 1 15 GLY H    . 15 GLY  HN   1 1 
        174 1 2 1 1 60 ALA MB   . 60 ALA  QB   1 1 
        175 1 1 1 1 15 GLY QA   . 15 GLY  QA   1 1 
        175 1 2 1 1 17 GLN H    . 17 GLN  HN   1 1 
        176 1 1 1 1 15 GLY QA   . 15 GLY  QA   1 1 
        176 1 2 1 1 18 LYS H    . 18 LYS+ HN   1 1 
        177 1 1 1 1 15 GLY QA   . 15 GLY  QA   1 1 
        177 1 2 1 1 18 LYS HB2  . 18 LYS+ HB3  1 1 
        178 1 1 1 1 15 GLY QA   . 15 GLY  QA   1 1 
        178 1 2 1 1 18 LYS HB3  . 18 LYS+ HB2  1 1 
        179 1 1 1 1 15 GLY QA   . 15 GLY  QA   1 1 
        179 1 2 1 1 45 TRP HH2  . 45 TRP  HH2  1 1 
        180 1 1 1 1 15 GLY QA   . 15 GLY  QA   1 1 
        180 1 2 1 1 45 TRP HZ2  . 45 TRP  HZ2  1 1 
        181 1 1 1 1 15 GLY QA   . 15 GLY  QA   1 1 
        181 1 2 1 1 45 TRP HZ3  . 45 TRP  HZ3  1 1 
        182 1 1 1 1 15 GLY QA   . 15 GLY  QA   1 1 
        182 1 2 1 1 56 TYR H    . 56 TYR  HN   1 1 
        183 1 1 1 1 15 GLY QA   . 15 GLY  QA   1 1 
        183 1 2 1 1 56 TYR HB2  . 56 TYR  HB2  1 1 
        184 1 1 1 1 15 GLY QA   . 15 GLY  QA   1 1 
        184 1 2 1 1 56 TYR HB3  . 56 TYR  HB3  1 1 
        185 1 1 1 1 15 GLY QA   . 15 GLY  QA   1 1 
        185 1 2 1 1 56 TYR QD   . 56 TYR  QD   1 1 
        186 1 1 1 1 15 GLY QA   . 15 GLY  QA   1 1 
        186 1 2 1 1 57 LYS H    . 57 LYS+ HN   1 1 
        187 1 1 1 1 15 GLY QA   . 15 GLY  QA   1 1 
        187 1 2 1 1 57 LYS HB3  . 57 LYS+ HB3  1 1 
        188 1 1 1 1 15 GLY QA   . 15 GLY  QA   1 1 
        188 1 2 1 1 57 LYS QD   . 57 LYS+ QD   1 1 
        189 1 1 1 1 15 GLY QA   . 15 GLY  QA   1 1 
        189 1 2 1 1 57 LYS HG2  . 57 LYS+ HG2  1 1 
        190 1 1 1 1 15 GLY QA   . 15 GLY  QA   1 1 
        190 1 2 1 1 57 LYS HG3  . 57 LYS+ HG3  1 1 
        191 1 1 1 1 15 GLY QA   . 15 GLY  QA   1 1 
        191 1 2 1 1 60 ALA H    . 60 ALA  HN   1 1 
        192 1 1 1 1 15 GLY QA   . 15 GLY  QA   1 1 
        192 1 2 1 1 60 ALA MB   . 60 ALA  QB   1 1 
        193 1 1 1 1 16 TYR H    . 16 TYR  HN   1 1 
        193 1 2 1 1 16 TYR HB2  . 16 TYR  HB3  1 1 
        194 1 1 1 1 16 TYR H    . 16 TYR  HN   1 1 
        194 1 2 1 1 16 TYR HB3  . 16 TYR  HB2  1 1 
        195 1 1 1 1 16 TYR H    . 16 TYR  HN   1 1 
        195 1 2 1 1 16 TYR QD   . 16 TYR  QD   1 1 
        196 1 1 1 1 16 TYR H    . 16 TYR  HN   1 1 
        196 1 2 1 1 17 GLN H    . 17 GLN  HN   1 1 
        197 1 1 1 1 16 TYR H    . 16 TYR  HN   1 1 
        197 1 2 1 1 17 GLN HG3  . 17 GLN  HG2  1 1 
        198 1 1 1 1 16 TYR H    . 16 TYR  HN   1 1 
        198 1 2 1 1 18 LYS H    . 18 LYS+ HN   1 1 
        199 1 1 1 1 16 TYR H    . 16 TYR  HN   1 1 
        199 1 2 1 1 45 TRP HE1  . 45 TRP  HE1  1 1 
        200 1 1 1 1 16 TYR H    . 16 TYR  HN   1 1 
        200 1 2 1 1 45 TRP HH2  . 45 TRP  HH2  1 1 
        201 1 1 1 1 16 TYR H    . 16 TYR  HN   1 1 
        201 1 2 1 1 45 TRP HZ2  . 45 TRP  HZ2  1 1 
        202 1 1 1 1 16 TYR HA   . 16 TYR  HA   1 1 
        202 1 2 1 1 16 TYR QD   . 16 TYR  QD   1 1 
        203 1 1 1 1 16 TYR HA   . 16 TYR  HA   1 1 
        203 1 2 1 1 19 PHE H    . 19 PHE  HN   1 1 
        204 1 1 1 1 16 TYR HA   . 16 TYR  HA   1 1 
        204 1 2 1 1 19 PHE HB2  . 19 PHE  HB3  1 1 
        205 1 1 1 1 16 TYR HA   . 16 TYR  HA   1 1 
        205 1 2 1 1 19 PHE HB3  . 19 PHE  HB2  1 1 
        206 1 1 1 1 16 TYR HA   . 16 TYR  HA   1 1 
        206 1 2 1 1 19 PHE QD   . 19 PHE  QD   1 1 
        207 1 1 1 1 16 TYR HA   . 16 TYR  HA   1 1 
        207 1 2 1 1 20 SER H    . 20 SER  HN   1 1 
        208 1 1 1 1 16 TYR HA   . 16 TYR  HA   1 1 
        208 1 2 1 1 45 TRP HH2  . 45 TRP  HH2  1 1 
        209 1 1 1 1 16 TYR HA   . 16 TYR  HA   1 1 
        209 1 2 1 1 45 TRP HZ2  . 45 TRP  HZ2  1 1 
        210 1 1 1 1 16 TYR HA   . 16 TYR  HA   1 1 
        210 1 2 1 1 45 TRP HZ3  . 45 TRP  HZ3  1 1 
        211 1 1 1 1 16 TYR HB2  . 16 TYR  HB3  1 1 
        211 1 2 1 1 17 GLN H    . 17 GLN  HN   1 1 
        212 1 1 1 1 16 TYR HB2  . 16 TYR  HB3  1 1 
        212 1 2 1 1 45 TRP HE1  . 45 TRP  HE1  1 1 
        213 1 1 1 1 16 TYR HB2  . 16 TYR  HB3  1 1 
        213 1 2 1 1 45 TRP HH2  . 45 TRP  HH2  1 1 
        214 1 1 1 1 16 TYR HB2  . 16 TYR  HB3  1 1 
        214 1 2 1 1 45 TRP HZ2  . 45 TRP  HZ2  1 1 
        215 1 1 1 1 16 TYR HB3  . 16 TYR  HB2  1 1 
        215 1 2 1 1 17 GLN H    . 17 GLN  HN   1 1 
        216 1 1 1 1 16 TYR HB3  . 16 TYR  HB2  1 1 
        216 1 2 1 1 45 TRP HE1  . 45 TRP  HE1  1 1 
        217 1 1 1 1 16 TYR HB3  . 16 TYR  HB2  1 1 
        217 1 2 1 1 45 TRP HZ2  . 45 TRP  HZ2  1 1 
        218 1 1 1 1 16 TYR QD   . 16 TYR  QD   1 1 
        218 1 2 1 1 17 GLN H    . 17 GLN  HN   1 1 
        219 1 1 1 1 16 TYR QD   . 16 TYR  QD   1 1 
        219 1 2 1 1 17 GLN HA   . 17 GLN  HA   1 1 
        220 1 1 1 1 16 TYR QD   . 16 TYR  QD   1 1 
        220 1 2 1 1 17 GLN HG2  . 17 GLN  HG3  1 1 
        221 1 1 1 1 16 TYR QD   . 16 TYR  QD   1 1 
        221 1 2 1 1 17 GLN HG3  . 17 GLN  HG2  1 1 
        222 1 1 1 1 16 TYR QD   . 16 TYR  QD   1 1 
        222 1 2 1 1 41 ILE MG   . 41 ILE  QG2  1 1 
        223 1 1 1 1 16 TYR QD   . 16 TYR  QD   1 1 
        223 1 2 1 1 42 GLY HA2  . 42 GLY  HA1  1 1 
        224 1 1 1 1 16 TYR QD   . 16 TYR  QD   1 1 
        224 1 2 1 1 45 TRP HA   . 45 TRP  HA   1 1 
        225 1 1 1 1 16 TYR QD   . 16 TYR  QD   1 1 
        225 1 2 1 1 45 TRP HB2  . 45 TRP  HB3  1 1 
        226 1 1 1 1 16 TYR QD   . 16 TYR  QD   1 1 
        226 1 2 1 1 45 TRP HB3  . 45 TRP  HB2  1 1 
        227 1 1 1 1 16 TYR QD   . 16 TYR  QD   1 1 
        227 1 2 1 1 45 TRP HD1  . 45 TRP  HD1  1 1 
        228 1 1 1 1 16 TYR QD   . 16 TYR  QD   1 1 
        228 1 2 1 1 45 TRP HE1  . 45 TRP  HE1  1 1 
        229 1 1 1 1 16 TYR QD   . 16 TYR  QD   1 1 
        229 1 2 1 1 45 TRP HE3  . 45 TRP  HE3  1 1 
        230 1 1 1 1 16 TYR QD   . 16 TYR  QD   1 1 
        230 1 2 1 1 45 TRP HZ2  . 45 TRP  HZ2  1 1 
        231 1 1 1 1 16 TYR QE   . 16 TYR  QE   1 1 
        231 1 2 1 1 17 GLN HA   . 17 GLN  HA   1 1 
        232 1 1 1 1 16 TYR QE   . 16 TYR  QE   1 1 
        232 1 2 1 1 17 GLN HG2  . 17 GLN  HG3  1 1 
        233 1 1 1 1 16 TYR QE   . 16 TYR  QE   1 1 
        233 1 2 1 1 19 PHE QE   . 19 PHE  QE   1 1 
        234 1 1 1 1 16 TYR QE   . 16 TYR  QE   1 1 
        234 1 2 1 1 20 SER QB   . 20 SER  HB3  1 1 
        235 1 1 1 1 16 TYR QE   . 16 TYR  QE   1 1 
        235 1 2 1 1 41 ILE HB   . 41 ILE  HB   1 1 
        236 1 1 1 1 16 TYR QE   . 16 TYR  QE   1 1 
        236 1 2 1 1 41 ILE MD   . 41 ILE  QD1  1 1 
        237 1 1 1 1 16 TYR QE   . 16 TYR  QE   1 1 
        237 1 2 1 1 41 ILE MG   . 41 ILE  QG2  1 1 
        238 1 1 1 1 16 TYR QE   . 16 TYR  QE   1 1 
        238 1 2 1 1 42 GLY H    . 42 GLY  HN   1 1 
        239 1 1 1 1 16 TYR QE   . 16 TYR  QE   1 1 
        239 1 2 1 1 42 GLY HA2  . 42 GLY  HA1  1 1 
        240 1 1 1 1 16 TYR QE   . 16 TYR  QE   1 1 
        240 1 2 1 1 43 SER H    . 43 SER  HN   1 1 
        241 1 1 1 1 16 TYR QE   . 16 TYR  QE   1 1 
        241 1 2 1 1 45 TRP H    . 45 TRP  HN   1 1 
        242 1 1 1 1 16 TYR QE   . 16 TYR  QE   1 1 
        242 1 2 1 1 45 TRP HA   . 45 TRP  HA   1 1 
        243 1 1 1 1 16 TYR QE   . 16 TYR  QE   1 1 
        243 1 2 1 1 45 TRP HB2  . 45 TRP  HB3  1 1 
        244 1 1 1 1 16 TYR QE   . 16 TYR  QE   1 1 
        244 1 2 1 1 45 TRP HB3  . 45 TRP  HB2  1 1 
        245 1 1 1 1 16 TYR QE   . 16 TYR  QE   1 1 
        245 1 2 1 1 45 TRP HD1  . 45 TRP  HD1  1 1 
        246 1 1 1 1 16 TYR QE   . 16 TYR  QE   1 1 
        246 1 2 1 1 45 TRP HE1  . 45 TRP  HE1  1 1 
        247 1 1 1 1 16 TYR QE   . 16 TYR  QE   1 1 
        247 1 2 1 1 46 GLN H    . 46 GLN  HN   1 1 
        248 1 1 1 1 17 GLN H    . 17 GLN  HN   1 1 
        248 1 2 1 1 17 GLN HB2  . 17 GLN  HB2  1 1 
        249 1 1 1 1 17 GLN H    . 17 GLN  HN   1 1 
        249 1 2 1 1 17 GLN HB3  . 17 GLN  HB3  1 1 
        250 1 1 1 1 17 GLN H    . 17 GLN  HN   1 1 
        250 1 2 1 1 17 GLN HE21 . 17 GLN  HE21 1 1 
        251 1 1 1 1 17 GLN H    . 17 GLN  HN   1 1 
        251 1 2 1 1 17 GLN HG2  . 17 GLN  HG3  1 1 
        252 1 1 1 1 17 GLN H    . 17 GLN  HN   1 1 
        252 1 2 1 1 17 GLN HG3  . 17 GLN  HG2  1 1 
        253 1 1 1 1 17 GLN H    . 17 GLN  HN   1 1 
        253 1 2 1 1 18 LYS H    . 18 LYS+ HN   1 1 
        254 1 1 1 1 17 GLN H    . 17 GLN  HN   1 1 
        254 1 2 1 1 19 PHE H    . 19 PHE  HN   1 1 
        255 1 1 1 1 17 GLN HA   . 17 GLN  HA   1 1 
        255 1 2 1 1 17 GLN HG2  . 17 GLN  HG3  1 1 
        256 1 1 1 1 17 GLN HA   . 17 GLN  HA   1 1 
        256 1 2 1 1 20 SER H    . 20 SER  HN   1 1 
        257 1 1 1 1 17 GLN HA   . 17 GLN  HA   1 1 
        257 1 2 1 1 20 SER QB   . 20 SER  HB2  1 1 
        258 1 1 1 1 17 GLN HA   . 17 GLN  HA   1 1 
        258 1 2 1 1 21 GLN H    . 21 GLN  HN   1 1 
        259 1 1 1 1 17 GLN HB2  . 17 GLN  HB2  1 1 
        259 1 2 1 1 17 GLN HE21 . 17 GLN  HE21 1 1 
        260 1 1 1 1 17 GLN HB2  . 17 GLN  HB2  1 1 
        260 1 2 1 1 18 LYS H    . 18 LYS+ HN   1 1 
        261 1 1 1 1 17 GLN HB3  . 17 GLN  HB3  1 1 
        261 1 2 1 1 17 GLN HE21 . 17 GLN  HE21 1 1 
        262 1 1 1 1 17 GLN HB3  . 17 GLN  HB3  1 1 
        262 1 2 1 1 17 GLN HE22 . 17 GLN  HE22 1 1 
        263 1 1 1 1 17 GLN HB3  . 17 GLN  HB3  1 1 
        263 1 2 1 1 18 LYS H    . 18 LYS+ HN   1 1 
        264 1 1 1 1 17 GLN HB3  . 17 GLN  HB3  1 1 
        264 1 2 1 1 21 GLN H    . 21 GLN  HN   1 1 
        265 1 1 1 1 17 GLN HE21 . 17 GLN  HE21 1 1 
        265 1 2 1 1 18 LYS H    . 18 LYS+ HN   1 1 
        266 1 1 1 1 17 GLN HG3  . 17 GLN  HG2  1 1 
        266 1 2 1 1 18 LYS H    . 18 LYS+ HN   1 1 
        267 1 1 1 1 18 LYS H    . 18 LYS+ HN   1 1 
        267 1 2 1 1 18 LYS HB2  . 18 LYS+ HB3  1 1 
        268 1 1 1 1 18 LYS H    . 18 LYS+ HN   1 1 
        268 1 2 1 1 18 LYS HB3  . 18 LYS+ HB2  1 1 
        269 1 1 1 1 18 LYS H    . 18 LYS+ HN   1 1 
        269 1 2 1 1 18 LYS HG2  . 18 LYS+ HG3  1 1 
        270 1 1 1 1 18 LYS H    . 18 LYS+ HN   1 1 
        270 1 2 1 1 19 PHE H    . 19 PHE  HN   1 1 
        271 1 1 1 1 18 LYS H    . 18 LYS+ HN   1 1 
        271 1 2 1 1 19 PHE HA   . 19 PHE  HA   1 1 
        272 1 1 1 1 18 LYS H    . 18 LYS+ HN   1 1 
        272 1 2 1 1 19 PHE HB3  . 19 PHE  HB2  1 1 
        273 1 1 1 1 18 LYS H    . 18 LYS+ HN   1 1 
        273 1 2 1 1 20 SER H    . 20 SER  HN   1 1 
        274 1 1 1 1 18 LYS H    . 18 LYS+ HN   1 1 
        274 1 2 1 1 56 TYR QD   . 56 TYR  QD   1 1 
        275 1 1 1 1 18 LYS H    . 18 LYS+ HN   1 1 
        275 1 2 1 1 60 ALA MB   . 60 ALA  QB   1 1 
        276 1 1 1 1 18 LYS HA   . 18 LYS+ HA   1 1 
        276 1 2 1 1 18 LYS QE   . 18 LYS+ HE2  1 1 
        277 1 1 1 1 18 LYS HA   . 18 LYS+ HA   1 1 
        277 1 2 1 1 18 LYS HG2  . 18 LYS+ HG3  1 1 
        278 1 1 1 1 18 LYS HA   . 18 LYS+ HA   1 1 
        278 1 2 1 1 19 PHE HA   . 19 PHE  HA   1 1 
        279 1 1 1 1 18 LYS HA   . 18 LYS+ HA   1 1 
        279 1 2 1 1 20 SER H    . 20 SER  HN   1 1 
        280 1 1 1 1 18 LYS HA   . 18 LYS+ HA   1 1 
        280 1 2 1 1 21 GLN H    . 21 GLN  HN   1 1 
        281 1 1 1 1 18 LYS HB2  . 18 LYS+ HB3  1 1 
        281 1 2 1 1 19 PHE H    . 19 PHE  HN   1 1 
        282 1 1 1 1 18 LYS HB2  . 18 LYS+ HB3  1 1 
        282 1 2 1 1 60 ALA HA   . 60 ALA  HA   1 1 
        283 1 1 1 1 18 LYS HB2  . 18 LYS+ HB3  1 1 
        283 1 2 1 1 60 ALA MB   . 60 ALA  QB   1 1 
        284 1 1 1 1 18 LYS HB3  . 18 LYS+ HB2  1 1 
        284 1 2 1 1 19 PHE H    . 19 PHE  HN   1 1 
        285 1 1 1 1 18 LYS HB3  . 18 LYS+ HB2  1 1 
        285 1 2 1 1 19 PHE HA   . 19 PHE  HA   1 1 
        286 1 1 1 1 18 LYS HB3  . 18 LYS+ HB2  1 1 
        286 1 2 1 1 20 SER H    . 20 SER  HN   1 1 
        287 1 1 1 1 18 LYS HB3  . 18 LYS+ HB2  1 1 
        287 1 2 1 1 56 TYR QD   . 56 TYR  QD   1 1 
        288 1 1 1 1 18 LYS HB3  . 18 LYS+ HB2  1 1 
        288 1 2 1 1 60 ALA H    . 60 ALA  HN   1 1 
        289 1 1 1 1 18 LYS HB3  . 18 LYS+ HB2  1 1 
        289 1 2 1 1 60 ALA MB   . 60 ALA  QB   1 1 
        290 1 1 1 1 18 LYS HD2  . 18 LYS+ HD2  1 1 
        290 1 2 1 1 56 TYR QD   . 56 TYR  QD   1 1 
        291 1 1 1 1 18 LYS QE   . 18 LYS+ HE2  1 1 
        291 1 2 1 1 56 TYR QD   . 56 TYR  QD   1 1 
        292 1 1 1 1 18 LYS QE   . 18 LYS+ HE2  1 1 
        292 1 2 1 1 56 TYR QE   . 56 TYR  QE   1 1 
        293 1 1 1 1 18 LYS QE   . 18 LYS+ HE2  1 1 
        293 1 2 1 1 59 LEU QD   . 59 LEU  QD2  1 1 
        294 1 1 1 1 18 LYS QE   . 18 LYS+ HE2  1 1 
        294 1 2 1 1 60 ALA H    . 60 ALA  HN   1 1 
        295 1 1 1 1 18 LYS QE   . 18 LYS+ HE2  1 1 
        295 1 2 1 1 60 ALA HA   . 60 ALA  HA   1 1 
        296 1 1 1 1 18 LYS QE   . 18 LYS+ HE2  1 1 
        296 1 2 1 1 60 ALA MB   . 60 ALA  QB   1 1 
        297 1 1 1 1 18 LYS HG2  . 18 LYS+ HG3  1 1 
        297 1 2 1 1 19 PHE H    . 19 PHE  HN   1 1 
        298 1 1 1 1 18 LYS HG2  . 18 LYS+ HG3  1 1 
        298 1 2 1 1 56 TYR QD   . 56 TYR  QD   1 1 
        299 1 1 1 1 18 LYS HG2  . 18 LYS+ HG3  1 1 
        299 1 2 1 1 56 TYR QE   . 56 TYR  QE   1 1 
        300 1 1 1 1 18 LYS HG2  . 18 LYS+ HG3  1 1 
        300 1 2 1 1 59 LEU QD   . 59 LEU  QD2  1 1 
        301 1 1 1 1 18 LYS HG2  . 18 LYS+ HG3  1 1 
        301 1 2 1 1 60 ALA H    . 60 ALA  HN   1 1 
        302 1 1 1 1 18 LYS HG2  . 18 LYS+ HG3  1 1 
        302 1 2 1 1 60 ALA MB   . 60 ALA  QB   1 1 
        303 1 1 1 1 18 LYS HG3  . 18 LYS+ HG2  1 1 
        303 1 2 1 1 19 PHE H    . 19 PHE  HN   1 1 
        304 1 1 1 1 18 LYS HG3  . 18 LYS+ HG2  1 1 
        304 1 2 1 1 56 TYR QD   . 56 TYR  QD   1 1 
        305 1 1 1 1 18 LYS HG3  . 18 LYS+ HG2  1 1 
        305 1 2 1 1 56 TYR QE   . 56 TYR  QE   1 1 
        306 1 1 1 1 19 PHE H    . 19 PHE  HN   1 1 
        306 1 2 1 1 19 PHE HB2  . 19 PHE  HB3  1 1 
        307 1 1 1 1 19 PHE H    . 19 PHE  HN   1 1 
        307 1 2 1 1 19 PHE HB3  . 19 PHE  HB2  1 1 
        308 1 1 1 1 19 PHE H    . 19 PHE  HN   1 1 
        308 1 2 1 1 19 PHE QD   . 19 PHE  QD   1 1 
        309 1 1 1 1 19 PHE H    . 19 PHE  HN   1 1 
        309 1 2 1 1 20 SER H    . 20 SER  HN   1 1 
        310 1 1 1 1 19 PHE H    . 19 PHE  HN   1 1 
        310 1 2 1 1 20 SER QB   . 20 SER  HB2  1 1 
        311 1 1 1 1 19 PHE H    . 19 PHE  HN   1 1 
        311 1 2 1 1 21 GLN H    . 21 GLN  HN   1 1 
        312 1 1 1 1 19 PHE H    . 19 PHE  HN   1 1 
        312 1 2 1 1 56 TYR HB3  . 56 TYR  HB3  1 1 
        313 1 1 1 1 19 PHE H    . 19 PHE  HN   1 1 
        313 1 2 1 1 56 TYR QD   . 56 TYR  QD   1 1 
        314 1 1 1 1 19 PHE H    . 19 PHE  HN   1 1 
        314 1 2 1 1 56 TYR QE   . 56 TYR  QE   1 1 
        315 1 1 1 1 19 PHE HA   . 19 PHE  HA   1 1 
        315 1 2 1 1 19 PHE QD   . 19 PHE  QD   1 1 
        316 1 1 1 1 19 PHE HA   . 19 PHE  HA   1 1 
        316 1 2 1 1 22 GLU H    . 22 GLU- HN   1 1 
        317 1 1 1 1 19 PHE HA   . 19 PHE  HA   1 1 
        317 1 2 1 1 22 GLU HB2  . 22 GLU- HB2  1 1 
        318 1 1 1 1 19 PHE HA   . 19 PHE  HA   1 1 
        318 1 2 1 1 22 GLU HB3  . 22 GLU- HB3  1 1 
        319 1 1 1 1 19 PHE HA   . 19 PHE  HA   1 1 
        319 1 2 1 1 56 TYR QD   . 56 TYR  QD   1 1 
        320 1 1 1 1 19 PHE HA   . 19 PHE  HA   1 1 
        320 1 2 1 1 56 TYR QE   . 56 TYR  QE   1 1 
        321 1 1 1 1 19 PHE HB2  . 19 PHE  HB3  1 1 
        321 1 2 1 1 20 SER H    . 20 SER  HN   1 1 
        322 1 1 1 1 19 PHE HB2  . 19 PHE  HB3  1 1 
        322 1 2 1 1 45 TRP HE3  . 45 TRP  HE3  1 1 
        323 1 1 1 1 19 PHE HB2  . 19 PHE  HB3  1 1 
        323 1 2 1 1 45 TRP HZ3  . 45 TRP  HZ3  1 1 
        324 1 1 1 1 19 PHE HB2  . 19 PHE  HB3  1 1 
        324 1 2 1 1 56 TYR QD   . 56 TYR  QD   1 1 
        325 1 1 1 1 19 PHE HB2  . 19 PHE  HB3  1 1 
        325 1 2 1 1 56 TYR QE   . 56 TYR  QE   1 1 
        326 1 1 1 1 19 PHE HB3  . 19 PHE  HB2  1 1 
        326 1 2 1 1 20 SER H    . 20 SER  HN   1 1 
        327 1 1 1 1 19 PHE HB3  . 19 PHE  HB2  1 1 
        327 1 2 1 1 45 TRP HE3  . 45 TRP  HE3  1 1 
        328 1 1 1 1 19 PHE HB3  . 19 PHE  HB2  1 1 
        328 1 2 1 1 45 TRP HZ3  . 45 TRP  HZ3  1 1 
        329 1 1 1 1 19 PHE QD   . 19 PHE  QD   1 1 
        329 1 2 1 1 20 SER H    . 20 SER  HN   1 1 
        330 1 1 1 1 19 PHE QD   . 19 PHE  QD   1 1 
        330 1 2 1 1 20 SER QB   . 20 SER  HB2  1 1 
        331 1 1 1 1 19 PHE QD   . 19 PHE  QD   1 1 
        331 1 2 1 1 22 GLU HB2  . 22 GLU- HB2  1 1 
        332 1 1 1 1 19 PHE QD   . 19 PHE  QD   1 1 
        332 1 2 1 1 23 LEU MD1  . 23 LEU  QD2  1 1 
        333 1 1 1 1 19 PHE QD   . 19 PHE  QD   1 1 
        333 1 2 1 1 23 LEU MD2  . 23 LEU  QD1  1 1 
        334 1 1 1 1 19 PHE QD   . 19 PHE  QD   1 1 
        334 1 2 1 1 41 ILE MG   . 41 ILE  QG2  1 1 
        335 1 1 1 1 19 PHE QD   . 19 PHE  QD   1 1 
        335 1 2 1 1 44 ARG HB3  . 44 ARG+ HB3  1 1 
        336 1 1 1 1 19 PHE QD   . 19 PHE  QD   1 1 
        336 1 2 1 1 45 TRP H    . 45 TRP  HN   1 1 
        337 1 1 1 1 19 PHE QD   . 19 PHE  QD   1 1 
        337 1 2 1 1 45 TRP HA   . 45 TRP  HA   1 1 
        338 1 1 1 1 19 PHE QD   . 19 PHE  QD   1 1 
        338 1 2 1 1 45 TRP HB2  . 45 TRP  HB3  1 1 
        339 1 1 1 1 19 PHE QD   . 19 PHE  QD   1 1 
        339 1 2 1 1 45 TRP HB3  . 45 TRP  HB2  1 1 
        340 1 1 1 1 19 PHE QD   . 19 PHE  QD   1 1 
        340 1 2 1 1 45 TRP HE3  . 45 TRP  HE3  1 1 
        341 1 1 1 1 19 PHE QD   . 19 PHE  QD   1 1 
        341 1 2 1 1 45 TRP HZ3  . 45 TRP  HZ3  1 1 
        342 1 1 1 1 19 PHE QD   . 19 PHE  QD   1 1 
        342 1 2 1 1 48 ILE MD   . 48 ILE  QD1  1 1 
        343 1 1 1 1 19 PHE QD   . 19 PHE  QD   1 1 
        343 1 2 1 1 56 TYR QD   . 56 TYR  QD   1 1 
        344 1 1 1 1 19 PHE QD   . 19 PHE  QD   1 1 
        344 1 2 1 1 56 TYR QE   . 56 TYR  QE   1 1 
        345 1 1 1 1 19 PHE QE   . 19 PHE  QE   1 1 
        345 1 2 1 1 23 LEU MD1  . 23 LEU  QD2  1 1 
        346 1 1 1 1 19 PHE QE   . 19 PHE  QE   1 1 
        346 1 2 1 1 23 LEU MD2  . 23 LEU  QD1  1 1 
        347 1 1 1 1 19 PHE QE   . 19 PHE  QE   1 1 
        347 1 2 1 1 41 ILE HA   . 41 ILE  HA   1 1 
        348 1 1 1 1 19 PHE QE   . 19 PHE  QE   1 1 
        348 1 2 1 1 41 ILE MG   . 41 ILE  QG2  1 1 
        349 1 1 1 1 19 PHE QE   . 19 PHE  QE   1 1 
        349 1 2 1 1 44 ARG H    . 44 ARG+ HN   1 1 
        350 1 1 1 1 19 PHE QE   . 19 PHE  QE   1 1 
        350 1 2 1 1 44 ARG HA   . 44 ARG+ HA   1 1 
        351 1 1 1 1 19 PHE QE   . 19 PHE  QE   1 1 
        351 1 2 1 1 44 ARG HB2  . 44 ARG+ HB2  1 1 
        352 1 1 1 1 19 PHE QE   . 19 PHE  QE   1 1 
        352 1 2 1 1 44 ARG HB3  . 44 ARG+ HB3  1 1 
        353 1 1 1 1 19 PHE QE   . 19 PHE  QE   1 1 
        353 1 2 1 1 45 TRP H    . 45 TRP  HN   1 1 
        354 1 1 1 1 19 PHE QE   . 19 PHE  QE   1 1 
        354 1 2 1 1 45 TRP HA   . 45 TRP  HA   1 1 
        355 1 1 1 1 19 PHE QE   . 19 PHE  QE   1 1 
        355 1 2 1 1 45 TRP HB2  . 45 TRP  HB3  1 1 
        356 1 1 1 1 19 PHE QE   . 19 PHE  QE   1 1 
        356 1 2 1 1 45 TRP HB3  . 45 TRP  HB2  1 1 
        357 1 1 1 1 19 PHE QE   . 19 PHE  QE   1 1 
        357 1 2 1 1 45 TRP HE3  . 45 TRP  HE3  1 1 
        358 1 1 1 1 19 PHE QE   . 19 PHE  QE   1 1 
        358 1 2 1 1 46 GLN H    . 46 GLN  HN   1 1 
        359 1 1 1 1 19 PHE QE   . 19 PHE  QE   1 1 
        359 1 2 1 1 48 ILE MD   . 48 ILE  QD1  1 1 
        360 1 1 1 1 19 PHE QE   . 19 PHE  QE   1 1 
        360 1 2 1 1 56 TYR QE   . 56 TYR  QE   1 1 
        361 1 1 1 1 19 PHE HZ   . 19 PHE  HZ   1 1 
        361 1 2 1 1 23 LEU MD1  . 23 LEU  QD2  1 1 
        362 1 1 1 1 19 PHE HZ   . 19 PHE  HZ   1 1 
        362 1 2 1 1 23 LEU MD2  . 23 LEU  QD1  1 1 
        363 1 1 1 1 19 PHE HZ   . 19 PHE  HZ   1 1 
        363 1 2 1 1 41 ILE HA   . 41 ILE  HA   1 1 
        364 1 1 1 1 19 PHE HZ   . 19 PHE  HZ   1 1 
        364 1 2 1 1 41 ILE MG   . 41 ILE  QG2  1 1 
        365 1 1 1 1 19 PHE HZ   . 19 PHE  HZ   1 1 
        365 1 2 1 1 44 ARG H    . 44 ARG+ HN   1 1 
        366 1 1 1 1 19 PHE HZ   . 19 PHE  HZ   1 1 
        366 1 2 1 1 44 ARG HA   . 44 ARG+ HA   1 1 
        367 1 1 1 1 19 PHE HZ   . 19 PHE  HZ   1 1 
        367 1 2 1 1 44 ARG HB2  . 44 ARG+ HB2  1 1 
        368 1 1 1 1 19 PHE HZ   . 19 PHE  HZ   1 1 
        368 1 2 1 1 44 ARG HB3  . 44 ARG+ HB3  1 1 
        369 1 1 1 1 19 PHE HZ   . 19 PHE  HZ   1 1 
        369 1 2 1 1 44 ARG HD2  . 44 ARG+ HD2  1 1 
        370 1 1 1 1 19 PHE HZ   . 19 PHE  HZ   1 1 
        370 1 2 1 1 44 ARG HD3  . 44 ARG+ HD3  1 1 
        371 1 1 1 1 19 PHE HZ   . 19 PHE  HZ   1 1 
        371 1 2 1 1 44 ARG QG   . 44 ARG+ HG2  1 1 
        372 1 1 1 1 19 PHE HZ   . 19 PHE  HZ   1 1 
        372 1 2 1 1 45 TRP H    . 45 TRP  HN   1 1 
        373 1 1 1 1 19 PHE HZ   . 19 PHE  HZ   1 1 
        373 1 2 1 1 45 TRP HA   . 45 TRP  HA   1 1 
        374 1 1 1 1 19 PHE HZ   . 19 PHE  HZ   1 1 
        374 1 2 1 1 45 TRP HB2  . 45 TRP  HB3  1 1 
        375 1 1 1 1 19 PHE HZ   . 19 PHE  HZ   1 1 
        375 1 2 1 1 48 ILE MD   . 48 ILE  QD1  1 1 
        376 1 1 1 1 20 SER H    . 20 SER  HN   1 1 
        376 1 2 1 1 20 SER QB   . 20 SER  HB2  1 1 
        377 1 1 1 1 20 SER H    . 20 SER  HN   1 1 
        377 1 2 1 1 21 GLN H    . 21 GLN  HN   1 1 
        378 1 1 1 1 20 SER H    . 20 SER  HN   1 1 
        378 1 2 1 1 21 GLN QB   . 21 GLN  QB   1 1 
        379 1 1 1 1 20 SER H    . 20 SER  HN   1 1 
        379 1 2 1 1 41 ILE MG   . 41 ILE  QG2  1 1 
        380 1 1 1 1 20 SER HA   . 20 SER  HA   1 1 
        380 1 2 1 1 23 LEU H    . 23 LEU  HN   1 1 
        381 1 1 1 1 20 SER HA   . 20 SER  HA   1 1 
        381 1 2 1 1 23 LEU HB2  . 23 LEU  HB2  1 1 
        382 1 1 1 1 20 SER HA   . 20 SER  HA   1 1 
        382 1 2 1 1 23 LEU HB3  . 23 LEU  HB3  1 1 
        383 1 1 1 1 20 SER HA   . 20 SER  HA   1 1 
        383 1 2 1 1 23 LEU MD1  . 23 LEU  QD2  1 1 
        384 1 1 1 1 20 SER HA   . 20 SER  HA   1 1 
        384 1 2 1 1 23 LEU MD2  . 23 LEU  QD1  1 1 
        385 1 1 1 1 20 SER HA   . 20 SER  HA   1 1 
        385 1 2 1 1 23 LEU HG   . 23 LEU  HG   1 1 
        386 1 1 1 1 20 SER HA   . 20 SER  HA   1 1 
        386 1 2 1 1 24 LEU H    . 24 LEU  HN   1 1 
        387 1 1 1 1 20 SER HA   . 20 SER  HA   1 1 
        387 1 2 1 1 24 LEU MD2  . 24 LEU  QD2  1 1 
        388 1 1 1 1 20 SER HA   . 20 SER  HA   1 1 
        388 1 2 1 1 41 ILE HB   . 41 ILE  HB   1 1 
        389 1 1 1 1 20 SER HA   . 20 SER  HA   1 1 
        389 1 2 1 1 41 ILE MD   . 41 ILE  QD1  1 1 
        390 1 1 1 1 20 SER HA   . 20 SER  HA   1 1 
        390 1 2 1 1 41 ILE MG   . 41 ILE  QG2  1 1 
        391 1 1 1 1 20 SER QB   . 20 SER  HB2  1 1 
        391 1 2 1 1 21 GLN H    . 21 GLN  HN   1 1 
        392 1 1 1 1 20 SER QB   . 20 SER  HB3  1 1 
        392 1 2 1 1 21 GLN HA   . 21 GLN  HA   1 1 
        393 1 1 1 1 20 SER QB   . 20 SER  HB2  1 1 
        393 1 2 1 1 21 GLN QB   . 21 GLN  QB   1 1 
        394 1 1 1 1 20 SER QB   . 20 SER  HB3  1 1 
        394 1 2 1 1 24 LEU MD1  . 24 LEU  QD1  1 1 
        395 1 1 1 1 20 SER QB   . 20 SER  HB3  1 1 
        395 1 2 1 1 24 LEU HG   . 24 LEU  HG   1 1 
        396 1 1 1 1 20 SER QB   . 20 SER  HB2  1 1 
        396 1 2 1 1 38 MET ME   . 38 MET  QE   1 1 
        397 1 1 1 1 20 SER QB   . 20 SER  HB2  1 1 
        397 1 2 1 1 41 ILE MD   . 41 ILE  QD1  1 1 
        398 1 1 1 1 20 SER QB   . 20 SER  HB2  1 1 
        398 1 2 1 1 41 ILE MG   . 41 ILE  QG2  1 1 
        399 1 1 1 1 21 GLN H    . 21 GLN  HN   1 1 
        399 1 2 1 1 21 GLN QB   . 21 GLN  QB   1 1 
        400 1 1 1 1 21 GLN H    . 21 GLN  HN   1 1 
        400 1 2 1 1 21 GLN HG2  . 21 GLN  HG2  1 1 
        401 1 1 1 1 21 GLN H    . 21 GLN  HN   1 1 
        401 1 2 1 1 21 GLN HG3  . 21 GLN  HG3  1 1 
        402 1 1 1 1 21 GLN H    . 21 GLN  HN   1 1 
        402 1 2 1 1 22 GLU HA   . 22 GLU- HA   1 1 
        403 1 1 1 1 21 GLN H    . 21 GLN  HN   1 1 
        403 1 2 1 1 23 LEU H    . 23 LEU  HN   1 1 
        404 1 1 1 1 21 GLN H    . 21 GLN  HN   1 1 
        404 1 2 1 1 24 LEU MD1  . 24 LEU  QD1  1 1 
        405 1 1 1 1 21 GLN H    . 21 GLN  HN   1 1 
        405 1 2 1 1 24 LEU HG   . 24 LEU  HG   1 1 
        406 1 1 1 1 21 GLN H    . 21 GLN  HN   1 1 
        406 1 2 1 1 41 ILE MD   . 41 ILE  QD1  1 1 
        407 1 1 1 1 21 GLN H    . 21 GLN  HN   1 1 
        407 1 2 1 1 41 ILE MG   . 41 ILE  QG2  1 1 
        408 1 1 1 1 21 GLN HA   . 21 GLN  HA   1 1 
        408 1 2 1 1 21 GLN HG2  . 21 GLN  HG2  1 1 
        409 1 1 1 1 21 GLN HA   . 21 GLN  HA   1 1 
        409 1 2 1 1 21 GLN HG3  . 21 GLN  HG3  1 1 
        410 1 1 1 1 21 GLN HA   . 21 GLN  HA   1 1 
        410 1 2 1 1 23 LEU H    . 23 LEU  HN   1 1 
        411 1 1 1 1 21 GLN HA   . 21 GLN  HA   1 1 
        411 1 2 1 1 24 LEU H    . 24 LEU  HN   1 1 
        412 1 1 1 1 21 GLN HA   . 21 GLN  HA   1 1 
        412 1 2 1 1 24 LEU HB2  . 24 LEU  HB2  1 1 
        413 1 1 1 1 21 GLN HA   . 21 GLN  HA   1 1 
        413 1 2 1 1 24 LEU HB3  . 24 LEU  HB3  1 1 
        414 1 1 1 1 21 GLN HA   . 21 GLN  HA   1 1 
        414 1 2 1 1 24 LEU MD1  . 24 LEU  QD1  1 1 
        415 1 1 1 1 21 GLN HA   . 21 GLN  HA   1 1 
        415 1 2 1 1 24 LEU MD2  . 24 LEU  QD2  1 1 
        416 1 1 1 1 21 GLN HA   . 21 GLN  HA   1 1 
        416 1 2 1 1 24 LEU HG   . 24 LEU  HG   1 1 
        417 1 1 1 1 21 GLN HA   . 21 GLN  HA   1 1 
        417 1 2 1 1 25 SER H    . 25 SER  HN   1 1 
        418 1 1 1 1 21 GLN QB   . 21 GLN  QB   1 1 
        418 1 2 1 1 23 LEU H    . 23 LEU  HN   1 1 
        419 1 1 1 1 21 GLN QB   . 21 GLN  QB   1 1 
        419 1 2 1 1 24 LEU H    . 24 LEU  HN   1 1 
        420 1 1 1 1 21 GLN QB   . 21 GLN  QB   1 1 
        420 1 2 1 1 24 LEU MD1  . 24 LEU  QD1  1 1 
        421 1 1 1 1 21 GLN QB   . 21 GLN  QB   1 1 
        421 1 2 1 1 25 SER H    . 25 SER  HN   1 1 
        422 1 1 1 1 21 GLN HG2  . 21 GLN  HG2  1 1 
        422 1 2 1 1 24 LEU MD1  . 24 LEU  QD1  1 1 
        423 1 1 1 1 22 GLU H    . 22 GLU- HN   1 1 
        423 1 2 1 1 22 GLU HB2  . 22 GLU- HB2  1 1 
        424 1 1 1 1 22 GLU H    . 22 GLU- HN   1 1 
        424 1 2 1 1 22 GLU HB3  . 22 GLU- HB3  1 1 
        425 1 1 1 1 22 GLU H    . 22 GLU- HN   1 1 
        425 1 2 1 1 22 GLU HG3  . 22 GLU- HG3  1 1 
        426 1 1 1 1 22 GLU H    . 22 GLU- HN   1 1 
        426 1 2 1 1 23 LEU H    . 23 LEU  HN   1 1 
        427 1 1 1 1 22 GLU H    . 22 GLU- HN   1 1 
        427 1 2 1 1 23 LEU HG   . 23 LEU  HG   1 1 
        428 1 1 1 1 22 GLU HA   . 22 GLU- HA   1 1 
        428 1 2 1 1 22 GLU HG2  . 22 GLU- HG2  1 1 
        429 1 1 1 1 22 GLU HA   . 22 GLU- HA   1 1 
        429 1 2 1 1 22 GLU HG3  . 22 GLU- HG3  1 1 
        430 1 1 1 1 22 GLU HB2  . 22 GLU- HB2  1 1 
        430 1 2 1 1 23 LEU H    . 23 LEU  HN   1 1 
        431 1 1 1 1 22 GLU HB3  . 22 GLU- HB3  1 1 
        431 1 2 1 1 23 LEU H    . 23 LEU  HN   1 1 
        432 1 1 1 1 22 GLU HB3  . 22 GLU- HB3  1 1 
        432 1 2 1 1 23 LEU HB2  . 23 LEU  HB2  1 1 
        433 1 1 1 1 22 GLU HB3  . 22 GLU- HB3  1 1 
        433 1 2 1 1 23 LEU MD1  . 23 LEU  QD2  1 1 
        434 1 1 1 1 22 GLU HB3  . 22 GLU- HB3  1 1 
        434 1 2 1 1 23 LEU HG   . 23 LEU  HG   1 1 
        435 1 1 1 1 22 GLU HB3  . 22 GLU- HB3  1 1 
        435 1 2 1 1 26 ASN HD21 . 26 ASN  HD21 1 1 
        436 1 1 1 1 22 GLU HB3  . 22 GLU- HB3  1 1 
        436 1 2 1 1 26 ASN HD22 . 26 ASN  HD22 1 1 
        437 1 1 1 1 22 GLU HB3  . 22 GLU- HB3  1 1 
        437 1 2 1 1 56 TYR QE   . 56 TYR  QE   1 1 
        438 1 1 1 1 22 GLU HG2  . 22 GLU- HG2  1 1 
        438 1 2 1 1 23 LEU H    . 23 LEU  HN   1 1 
        439 1 1 1 1 22 GLU HG2  . 22 GLU- HG2  1 1 
        439 1 2 1 1 26 ASN HD21 . 26 ASN  HD21 1 1 
        440 1 1 1 1 22 GLU HG2  . 22 GLU- HG2  1 1 
        440 1 2 1 1 26 ASN HD22 . 26 ASN  HD22 1 1 
        441 1 1 1 1 22 GLU HG2  . 22 GLU- HG2  1 1 
        441 1 2 1 1 56 TYR QE   . 56 TYR  QE   1 1 
        442 1 1 1 1 22 GLU HG3  . 22 GLU- HG3  1 1 
        442 1 2 1 1 23 LEU H    . 23 LEU  HN   1 1 
        443 1 1 1 1 23 LEU H    . 23 LEU  HN   1 1 
        443 1 2 1 1 23 LEU HB2  . 23 LEU  HB2  1 1 
        444 1 1 1 1 23 LEU H    . 23 LEU  HN   1 1 
        444 1 2 1 1 23 LEU HB3  . 23 LEU  HB3  1 1 
        445 1 1 1 1 23 LEU H    . 23 LEU  HN   1 1 
        445 1 2 1 1 23 LEU MD1  . 23 LEU  QD2  1 1 
        446 1 1 1 1 23 LEU H    . 23 LEU  HN   1 1 
        446 1 2 1 1 23 LEU MD2  . 23 LEU  QD1  1 1 
        447 1 1 1 1 23 LEU H    . 23 LEU  HN   1 1 
        447 1 2 1 1 23 LEU HG   . 23 LEU  HG   1 1 
        448 1 1 1 1 23 LEU H    . 23 LEU  HN   1 1 
        448 1 2 1 1 24 LEU H    . 24 LEU  HN   1 1 
        449 1 1 1 1 23 LEU H    . 23 LEU  HN   1 1 
        449 1 2 1 1 24 LEU HB2  . 24 LEU  HB2  1 1 
        450 1 1 1 1 23 LEU H    . 23 LEU  HN   1 1 
        450 1 2 1 1 24 LEU HG   . 24 LEU  HG   1 1 
        451 1 1 1 1 23 LEU H    . 23 LEU  HN   1 1 
        451 1 2 1 1 25 SER H    . 25 SER  HN   1 1 
        452 1 1 1 1 23 LEU H    . 23 LEU  HN   1 1 
        452 1 2 1 1 41 ILE MD   . 41 ILE  QD1  1 1 
        453 1 1 1 1 23 LEU H    . 23 LEU  HN   1 1 
        453 1 2 1 1 41 ILE MG   . 41 ILE  QG2  1 1 
        454 1 1 1 1 23 LEU HA   . 23 LEU  HA   1 1 
        454 1 2 1 1 23 LEU MD1  . 23 LEU  QD2  1 1 
        455 1 1 1 1 23 LEU HA   . 23 LEU  HA   1 1 
        455 1 2 1 1 23 LEU MD2  . 23 LEU  QD1  1 1 
        456 1 1 1 1 23 LEU HA   . 23 LEU  HA   1 1 
        456 1 2 1 1 23 LEU HG   . 23 LEU  HG   1 1 
        457 1 1 1 1 23 LEU HA   . 23 LEU  HA   1 1 
        457 1 2 1 1 25 SER H    . 25 SER  HN   1 1 
        458 1 1 1 1 23 LEU HA   . 23 LEU  HA   1 1 
        458 1 2 1 1 26 ASN H    . 26 ASN  HN   1 1 
        459 1 1 1 1 23 LEU HA   . 23 LEU  HA   1 1 
        459 1 2 1 1 26 ASN HB2  . 26 ASN  HB2  1 1 
        460 1 1 1 1 23 LEU HA   . 23 LEU  HA   1 1 
        460 1 2 1 1 26 ASN HB3  . 26 ASN  HB3  1 1 
        461 1 1 1 1 23 LEU HA   . 23 LEU  HA   1 1 
        461 1 2 1 1 26 ASN HD21 . 26 ASN  HD21 1 1 
        462 1 1 1 1 23 LEU HA   . 23 LEU  HA   1 1 
        462 1 2 1 1 26 ASN HD22 . 26 ASN  HD22 1 1 
        463 1 1 1 1 23 LEU HA   . 23 LEU  HA   1 1 
        463 1 2 1 1 27 GLY H    . 27 GLY  HN   1 1 
        464 1 1 1 1 23 LEU HA   . 23 LEU  HA   1 1 
        464 1 2 1 1 28 GLU H    . 28 GLU- HN   1 1 
        465 1 1 1 1 23 LEU HA   . 23 LEU  HA   1 1 
        465 1 2 1 1 29 LEU MD1  . 29 LEU  QD2  1 1 
        466 1 1 1 1 23 LEU HB2  . 23 LEU  HB2  1 1 
        466 1 2 1 1 23 LEU MD1  . 23 LEU  QD2  1 1 
        467 1 1 1 1 23 LEU HB2  . 23 LEU  HB2  1 1 
        467 1 2 1 1 24 LEU H    . 24 LEU  HN   1 1 
        468 1 1 1 1 23 LEU HB2  . 23 LEU  HB2  1 1 
        468 1 2 1 1 29 LEU MD1  . 29 LEU  QD2  1 1 
        469 1 1 1 1 23 LEU HB2  . 23 LEU  HB2  1 1 
        469 1 2 1 1 29 LEU HG   . 29 LEU  HG   1 1 
        470 1 1 1 1 23 LEU HB2  . 23 LEU  HB2  1 1 
        470 1 2 1 1 41 ILE MD   . 41 ILE  QD1  1 1 
        471 1 1 1 1 23 LEU HB2  . 23 LEU  HB2  1 1 
        471 1 2 1 1 41 ILE HG12 . 41 ILE  HG13 1 1 
        472 1 1 1 1 23 LEU HB2  . 23 LEU  HB2  1 1 
        472 1 2 1 1 41 ILE HG13 . 41 ILE  HG12 1 1 
        473 1 1 1 1 23 LEU HB2  . 23 LEU  HB2  1 1 
        473 1 2 1 1 41 ILE MG   . 41 ILE  QG2  1 1 
        474 1 1 1 1 23 LEU HB3  . 23 LEU  HB3  1 1 
        474 1 2 1 1 23 LEU MD2  . 23 LEU  QD1  1 1 
        475 1 1 1 1 23 LEU HB3  . 23 LEU  HB3  1 1 
        475 1 2 1 1 24 LEU H    . 24 LEU  HN   1 1 
        476 1 1 1 1 23 LEU HB3  . 23 LEU  HB3  1 1 
        476 1 2 1 1 24 LEU MD2  . 24 LEU  QD2  1 1 
        477 1 1 1 1 23 LEU HB3  . 23 LEU  HB3  1 1 
        477 1 2 1 1 29 LEU MD1  . 29 LEU  QD2  1 1 
        478 1 1 1 1 23 LEU HB3  . 23 LEU  HB3  1 1 
        478 1 2 1 1 29 LEU MD2  . 29 LEU  QD1  1 1 
        479 1 1 1 1 23 LEU HB3  . 23 LEU  HB3  1 1 
        479 1 2 1 1 41 ILE HA   . 41 ILE  HA   1 1 
        480 1 1 1 1 23 LEU HB3  . 23 LEU  HB3  1 1 
        480 1 2 1 1 41 ILE MD   . 41 ILE  QD1  1 1 
        481 1 1 1 1 23 LEU HB3  . 23 LEU  HB3  1 1 
        481 1 2 1 1 41 ILE HG12 . 41 ILE  HG13 1 1 
        482 1 1 1 1 23 LEU HB3  . 23 LEU  HB3  1 1 
        482 1 2 1 1 41 ILE MG   . 41 ILE  QG2  1 1 
        483 1 1 1 1 23 LEU MD1  . 23 LEU  QD2  1 1 
        483 1 2 1 1 24 LEU H    . 24 LEU  HN   1 1 
        484 1 1 1 1 23 LEU MD1  . 23 LEU  QD2  1 1 
        484 1 2 1 1 26 ASN HD21 . 26 ASN  HD21 1 1 
        485 1 1 1 1 23 LEU MD1  . 23 LEU  QD2  1 1 
        485 1 2 1 1 26 ASN HD22 . 26 ASN  HD22 1 1 
        486 1 1 1 1 23 LEU MD1  . 23 LEU  QD2  1 1 
        486 1 2 1 1 28 GLU QG   . 28 GLU- QG   1 1 
        487 1 1 1 1 23 LEU MD1  . 23 LEU  QD2  1 1 
        487 1 2 1 1 29 LEU MD1  . 29 LEU  QD2  1 1 
        488 1 1 1 1 23 LEU MD1  . 23 LEU  QD2  1 1 
        488 1 2 1 1 29 LEU MD2  . 29 LEU  QD1  1 1 
        489 1 1 1 1 23 LEU MD1  . 23 LEU  QD2  1 1 
        489 1 2 1 1 29 LEU HG   . 29 LEU  HG   1 1 
        490 1 1 1 1 23 LEU MD1  . 23 LEU  QD2  1 1 
        490 1 2 1 1 41 ILE H    . 41 ILE  HN   1 1 
        491 1 1 1 1 23 LEU MD1  . 23 LEU  QD2  1 1 
        491 1 2 1 1 41 ILE HA   . 41 ILE  HA   1 1 
        492 1 1 1 1 23 LEU MD1  . 23 LEU  QD2  1 1 
        492 1 2 1 1 41 ILE MD   . 41 ILE  QD1  1 1 
        493 1 1 1 1 23 LEU MD1  . 23 LEU  QD2  1 1 
        493 1 2 1 1 41 ILE HG12 . 41 ILE  HG13 1 1 
        494 1 1 1 1 23 LEU MD1  . 23 LEU  QD2  1 1 
        494 1 2 1 1 41 ILE HG13 . 41 ILE  HG12 1 1 
        495 1 1 1 1 23 LEU MD1  . 23 LEU  QD2  1 1 
        495 1 2 1 1 41 ILE MG   . 41 ILE  QG2  1 1 
        496 1 1 1 1 23 LEU MD1  . 23 LEU  QD2  1 1 
        496 1 2 1 1 44 ARG H    . 44 ARG+ HN   1 1 
        497 1 1 1 1 23 LEU MD1  . 23 LEU  QD2  1 1 
        497 1 2 1 1 44 ARG HB2  . 44 ARG+ HB2  1 1 
        498 1 1 1 1 23 LEU MD1  . 23 LEU  QD2  1 1 
        498 1 2 1 1 44 ARG HB3  . 44 ARG+ HB3  1 1 
        499 1 1 1 1 23 LEU MD1  . 23 LEU  QD2  1 1 
        499 1 2 1 1 44 ARG HD2  . 44 ARG+ HD2  1 1 
        500 1 1 1 1 23 LEU MD1  . 23 LEU  QD2  1 1 
        500 1 2 1 1 44 ARG HD3  . 44 ARG+ HD3  1 1 
        501 1 1 1 1 23 LEU MD1  . 23 LEU  QD2  1 1 
        501 1 2 1 1 44 ARG QG   . 44 ARG+ HG3  1 1 
        502 1 1 1 1 23 LEU MD1  . 23 LEU  QD2  1 1 
        502 1 2 1 1 45 TRP H    . 45 TRP  HN   1 1 
        503 1 1 1 1 23 LEU MD2  . 23 LEU  QD1  1 1 
        503 1 2 1 1 24 LEU H    . 24 LEU  HN   1 1 
        504 1 1 1 1 23 LEU MD2  . 23 LEU  QD1  1 1 
        504 1 2 1 1 26 ASN H    . 26 ASN  HN   1 1 
        505 1 1 1 1 23 LEU MD2  . 23 LEU  QD1  1 1 
        505 1 2 1 1 26 ASN HD21 . 26 ASN  HD21 1 1 
        506 1 1 1 1 23 LEU MD2  . 23 LEU  QD1  1 1 
        506 1 2 1 1 26 ASN HD22 . 26 ASN  HD22 1 1 
        507 1 1 1 1 23 LEU MD2  . 23 LEU  QD1  1 1 
        507 1 2 1 1 28 GLU H    . 28 GLU- HN   1 1 
        508 1 1 1 1 23 LEU MD2  . 23 LEU  QD1  1 1 
        508 1 2 1 1 28 GLU HB2  . 28 GLU- HB2  1 1 
        509 1 1 1 1 23 LEU MD2  . 23 LEU  QD1  1 1 
        509 1 2 1 1 28 GLU HB3  . 28 GLU- HB3  1 1 
        510 1 1 1 1 23 LEU MD2  . 23 LEU  QD1  1 1 
        510 1 2 1 1 28 GLU QG   . 28 GLU- QG   1 1 
        511 1 1 1 1 23 LEU MD2  . 23 LEU  QD1  1 1 
        511 1 2 1 1 29 LEU H    . 29 LEU  HN   1 1 
        512 1 1 1 1 23 LEU MD2  . 23 LEU  QD1  1 1 
        512 1 2 1 1 29 LEU QB   . 29 LEU  QB   1 1 
        513 1 1 1 1 23 LEU MD2  . 23 LEU  QD1  1 1 
        513 1 2 1 1 29 LEU MD1  . 29 LEU  QD2  1 1 
        514 1 1 1 1 23 LEU MD2  . 23 LEU  QD1  1 1 
        514 1 2 1 1 29 LEU MD2  . 29 LEU  QD1  1 1 
        515 1 1 1 1 23 LEU MD2  . 23 LEU  QD1  1 1 
        515 1 2 1 1 29 LEU HG   . 29 LEU  HG   1 1 
        516 1 1 1 1 23 LEU MD2  . 23 LEU  QD1  1 1 
        516 1 2 1 1 41 ILE HA   . 41 ILE  HA   1 1 
        517 1 1 1 1 23 LEU MD2  . 23 LEU  QD1  1 1 
        517 1 2 1 1 41 ILE HG12 . 41 ILE  HG13 1 1 
        518 1 1 1 1 23 LEU MD2  . 23 LEU  QD1  1 1 
        518 1 2 1 1 41 ILE HG13 . 41 ILE  HG12 1 1 
        519 1 1 1 1 23 LEU MD2  . 23 LEU  QD1  1 1 
        519 1 2 1 1 41 ILE MG   . 41 ILE  QG2  1 1 
        520 1 1 1 1 23 LEU MD2  . 23 LEU  QD1  1 1 
        520 1 2 1 1 44 ARG HD2  . 44 ARG+ HD2  1 1 
        521 1 1 1 1 23 LEU MD2  . 23 LEU  QD1  1 1 
        521 1 2 1 1 44 ARG HD3  . 44 ARG+ HD3  1 1 
        522 1 1 1 1 23 LEU MD2  . 23 LEU  QD1  1 1 
        522 1 2 1 1 44 ARG QG   . 44 ARG+ HG3  1 1 
        523 1 1 1 1 23 LEU HG   . 23 LEU  HG   1 1 
        523 1 2 1 1 24 LEU H    . 24 LEU  HN   1 1 
        524 1 1 1 1 23 LEU HG   . 23 LEU  HG   1 1 
        524 1 2 1 1 26 ASN HD21 . 26 ASN  HD21 1 1 
        525 1 1 1 1 23 LEU HG   . 23 LEU  HG   1 1 
        525 1 2 1 1 41 ILE HG12 . 41 ILE  HG13 1 1 
        526 1 1 1 1 23 LEU HG   . 23 LEU  HG   1 1 
        526 1 2 1 1 41 ILE MG   . 41 ILE  QG2  1 1 
        527 1 1 1 1 24 LEU H    . 24 LEU  HN   1 1 
        527 1 2 1 1 24 LEU HB2  . 24 LEU  HB2  1 1 
        528 1 1 1 1 24 LEU H    . 24 LEU  HN   1 1 
        528 1 2 1 1 24 LEU MD1  . 24 LEU  QD1  1 1 
        529 1 1 1 1 24 LEU H    . 24 LEU  HN   1 1 
        529 1 2 1 1 24 LEU MD2  . 24 LEU  QD2  1 1 
        530 1 1 1 1 24 LEU H    . 24 LEU  HN   1 1 
        530 1 2 1 1 24 LEU HG   . 24 LEU  HG   1 1 
        531 1 1 1 1 24 LEU H    . 24 LEU  HN   1 1 
        531 1 2 1 1 25 SER H    . 25 SER  HN   1 1 
        532 1 1 1 1 24 LEU H    . 24 LEU  HN   1 1 
        532 1 2 1 1 26 ASN H    . 26 ASN  HN   1 1 
        533 1 1 1 1 24 LEU H    . 24 LEU  HN   1 1 
        533 1 2 1 1 41 ILE MD   . 41 ILE  QD1  1 1 
        534 1 1 1 1 24 LEU H    . 24 LEU  HN   1 1 
        534 1 2 1 1 41 ILE MG   . 41 ILE  QG2  1 1 
        535 1 1 1 1 24 LEU HA   . 24 LEU  HA   1 1 
        535 1 2 1 1 24 LEU MD1  . 24 LEU  QD1  1 1 
        536 1 1 1 1 24 LEU HA   . 24 LEU  HA   1 1 
        536 1 2 1 1 24 LEU MD2  . 24 LEU  QD2  1 1 
        537 1 1 1 1 24 LEU HA   . 24 LEU  HA   1 1 
        537 1 2 1 1 24 LEU HG   . 24 LEU  HG   1 1 
        538 1 1 1 1 24 LEU HA   . 24 LEU  HA   1 1 
        538 1 2 1 1 27 GLY H    . 27 GLY  HN   1 1 
        539 1 1 1 1 24 LEU HA   . 24 LEU  HA   1 1 
        539 1 2 1 1 27 GLY HA2  . 27 GLY  HA1  1 1 
        540 1 1 1 1 24 LEU HA   . 24 LEU  HA   1 1 
        540 1 2 1 1 37 ARG QD   . 37 ARG+ HD3  1 1 
        541 1 1 1 1 24 LEU HA   . 24 LEU  HA   1 1 
        541 1 2 1 1 41 ILE MD   . 41 ILE  QD1  1 1 
        542 1 1 1 1 24 LEU HB2  . 24 LEU  HB2  1 1 
        542 1 2 1 1 25 SER H    . 25 SER  HN   1 1 
        543 1 1 1 1 24 LEU HB2  . 24 LEU  HB2  1 1 
        543 1 2 1 1 25 SER HA   . 25 SER  HA   1 1 
        544 1 1 1 1 24 LEU HB3  . 24 LEU  HB3  1 1 
        544 1 2 1 1 25 SER H    . 25 SER  HN   1 1 
        545 1 1 1 1 24 LEU MD1  . 24 LEU  QD1  1 1 
        545 1 2 1 1 25 SER H    . 25 SER  HN   1 1 
        546 1 1 1 1 24 LEU MD1  . 24 LEU  QD1  1 1 
        546 1 2 1 1 37 ARG QD   . 37 ARG+ HD2  1 1 
        547 1 1 1 1 24 LEU MD1  . 24 LEU  QD1  1 1 
        547 1 2 1 1 38 MET ME   . 38 MET  QE   1 1 
        548 1 1 1 1 24 LEU MD2  . 24 LEU  QD2  1 1 
        548 1 2 1 1 25 SER H    . 25 SER  HN   1 1 
        549 1 1 1 1 24 LEU MD2  . 24 LEU  QD2  1 1 
        549 1 2 1 1 37 ARG H    . 37 ARG+ HN   1 1 
        550 1 1 1 1 24 LEU MD2  . 24 LEU  QD2  1 1 
        550 1 2 1 1 37 ARG QB   . 37 ARG+ HB2  1 1 
        551 1 1 1 1 24 LEU MD2  . 24 LEU  QD2  1 1 
        551 1 2 1 1 37 ARG QD   . 37 ARG+ HD2  1 1 
        552 1 1 1 1 24 LEU MD2  . 24 LEU  QD2  1 1 
        552 1 2 1 1 37 ARG HE   . 37 ARG+ HE   1 1 
        553 1 1 1 1 24 LEU MD2  . 24 LEU  QD2  1 1 
        553 1 2 1 1 38 MET HA   . 38 MET  HA   1 1 
        554 1 1 1 1 24 LEU MD2  . 24 LEU  QD2  1 1 
        554 1 2 1 1 38 MET QG   . 38 MET  QG   1 1 
        555 1 1 1 1 24 LEU HG   . 24 LEU  HG   1 1 
        555 1 2 1 1 41 ILE MD   . 41 ILE  QD1  1 1 
        556 1 1 1 1 24 LEU HG   . 24 LEU  HG   1 1 
        556 1 2 1 1 41 ILE HG12 . 41 ILE  HG13 1 1 
        557 1 1 1 1 25 SER H    . 25 SER  HN   1 1 
        557 1 2 1 1 25 SER QB   . 25 SER  QB   1 1 
        558 1 1 1 1 25 SER H    . 25 SER  HN   1 1 
        558 1 2 1 1 26 ASN H    . 26 ASN  HN   1 1 
        559 1 1 1 1 25 SER H    . 25 SER  HN   1 1 
        559 1 2 1 1 26 ASN HA   . 26 ASN  HA   1 1 
        560 1 1 1 1 25 SER H    . 25 SER  HN   1 1 
        560 1 2 1 1 26 ASN HB2  . 26 ASN  HB2  1 1 
        561 1 1 1 1 25 SER H    . 25 SER  HN   1 1 
        561 1 2 1 1 26 ASN HB3  . 26 ASN  HB3  1 1 
        562 1 1 1 1 25 SER H    . 25 SER  HN   1 1 
        562 1 2 1 1 27 GLY H    . 27 GLY  HN   1 1 
        563 1 1 1 1 25 SER HA   . 25 SER  HA   1 1 
        563 1 2 1 1 26 ASN HA   . 26 ASN  HA   1 1 
        564 1 1 1 1 25 SER HA   . 25 SER  HA   1 1 
        564 1 2 1 1 27 GLY H    . 27 GLY  HN   1 1 
        565 1 1 1 1 25 SER QB   . 25 SER  QB   1 1 
        565 1 2 1 1 26 ASN H    . 26 ASN  HN   1 1 
        566 1 1 1 1 26 ASN H    . 26 ASN  HN   1 1 
        566 1 2 1 1 26 ASN HB2  . 26 ASN  HB2  1 1 
        567 1 1 1 1 26 ASN H    . 26 ASN  HN   1 1 
        567 1 2 1 1 26 ASN HB3  . 26 ASN  HB3  1 1 
        568 1 1 1 1 26 ASN H    . 26 ASN  HN   1 1 
        568 1 2 1 1 26 ASN HD21 . 26 ASN  HD21 1 1 
        569 1 1 1 1 26 ASN H    . 26 ASN  HN   1 1 
        569 1 2 1 1 26 ASN HD22 . 26 ASN  HD22 1 1 
        570 1 1 1 1 26 ASN H    . 26 ASN  HN   1 1 
        570 1 2 1 1 27 GLY H    . 27 GLY  HN   1 1 
        571 1 1 1 1 26 ASN H    . 26 ASN  HN   1 1 
        571 1 2 1 1 27 GLY HA2  . 27 GLY  HA1  1 1 
        572 1 1 1 1 26 ASN H    . 26 ASN  HN   1 1 
        572 1 2 1 1 27 GLY HA3  . 27 GLY  HA2  1 1 
        573 1 1 1 1 26 ASN H    . 26 ASN  HN   1 1 
        573 1 2 1 1 28 GLU H    . 28 GLU- HN   1 1 
        574 1 1 1 1 26 ASN HA   . 26 ASN  HA   1 1 
        574 1 2 1 1 26 ASN HD22 . 26 ASN  HD22 1 1 
        575 1 1 1 1 26 ASN HA   . 26 ASN  HA   1 1 
        575 1 2 1 1 28 GLU H    . 28 GLU- HN   1 1 
        576 1 1 1 1 26 ASN HB2  . 26 ASN  HB2  1 1 
        576 1 2 1 1 27 GLY H    . 27 GLY  HN   1 1 
        577 1 1 1 1 26 ASN HB2  . 26 ASN  HB2  1 1 
        577 1 2 1 1 28 GLU H    . 28 GLU- HN   1 1 
        578 1 1 1 1 26 ASN HB2  . 26 ASN  HB2  1 1 
        578 1 2 1 1 28 GLU QG   . 28 GLU- QG   1 1 
        579 1 1 1 1 26 ASN HB2  . 26 ASN  HB2  1 1 
        579 1 2 1 1 29 LEU H    . 29 LEU  HN   1 1 
        580 1 1 1 1 26 ASN HB3  . 26 ASN  HB3  1 1 
        580 1 2 1 1 27 GLY H    . 27 GLY  HN   1 1 
        581 1 1 1 1 26 ASN HB3  . 26 ASN  HB3  1 1 
        581 1 2 1 1 28 GLU H    . 28 GLU- HN   1 1 
        582 1 1 1 1 26 ASN HB3  . 26 ASN  HB3  1 1 
        582 1 2 1 1 28 GLU QG   . 28 GLU- QG   1 1 
        583 1 1 1 1 26 ASN HD21 . 26 ASN  HD21 1 1 
        583 1 2 1 1 28 GLU HB3  . 28 GLU- HB3  1 1 
        584 1 1 1 1 26 ASN HD21 . 26 ASN  HD21 1 1 
        584 1 2 1 1 28 GLU QG   . 28 GLU- QG   1 1 
        585 1 1 1 1 26 ASN HD22 . 26 ASN  HD22 1 1 
        585 1 2 1 1 28 GLU QG   . 28 GLU- QG   1 1 
        586 1 1 1 1 27 GLY H    . 27 GLY  HN   1 1 
        586 1 2 1 1 28 GLU H    . 28 GLU- HN   1 1 
        587 1 1 1 1 27 GLY H    . 27 GLY  HN   1 1 
        587 1 2 1 1 28 GLU HB2  . 28 GLU- HB2  1 1 
        588 1 1 1 1 27 GLY H    . 27 GLY  HN   1 1 
        588 1 2 1 1 28 GLU QG   . 28 GLU- QG   1 1 
        589 1 1 1 1 27 GLY H    . 27 GLY  HN   1 1 
        589 1 2 1 1 29 LEU H    . 29 LEU  HN   1 1 
        590 1 1 1 1 27 GLY H    . 27 GLY  HN   1 1 
        590 1 2 1 1 30 ASN QD   . 30 ASN  HD22 1 1 
        591 1 1 1 1 27 GLY HA2  . 27 GLY  HA1  1 1 
        591 1 2 1 1 29 LEU H    . 29 LEU  HN   1 1 
        592 1 1 1 1 27 GLY HA2  . 27 GLY  HA1  1 1 
        592 1 2 1 1 30 ASN H    . 30 ASN  HN   1 1 
        593 1 1 1 1 27 GLY HA2  . 27 GLY  HA1  1 1 
        593 1 2 1 1 30 ASN QB   . 30 ASN  QB   1 1 
        594 1 1 1 1 27 GLY HA2  . 27 GLY  HA1  1 1 
        594 1 2 1 1 30 ASN QD   . 30 ASN  HD21 1 1 
        595 1 1 1 1 27 GLY HA3  . 27 GLY  HA2  1 1 
        595 1 2 1 1 29 LEU H    . 29 LEU  HN   1 1 
        596 1 1 1 1 27 GLY HA3  . 27 GLY  HA2  1 1 
        596 1 2 1 1 30 ASN H    . 30 ASN  HN   1 1 
        597 1 1 1 1 27 GLY HA3  . 27 GLY  HA2  1 1 
        597 1 2 1 1 30 ASN QB   . 30 ASN  QB   1 1 
        598 1 1 1 1 27 GLY HA3  . 27 GLY  HA2  1 1 
        598 1 2 1 1 30 ASN QD   . 30 ASN  HD21 1 1 
        599 1 1 1 1 28 GLU H    . 28 GLU- HN   1 1 
        599 1 2 1 1 28 GLU HB2  . 28 GLU- HB2  1 1 
        600 1 1 1 1 28 GLU H    . 28 GLU- HN   1 1 
        600 1 2 1 1 28 GLU HB3  . 28 GLU- HB3  1 1 
        601 1 1 1 1 28 GLU H    . 28 GLU- HN   1 1 
        601 1 2 1 1 28 GLU QG   . 28 GLU- QG   1 1 
        602 1 1 1 1 28 GLU H    . 28 GLU- HN   1 1 
        602 1 2 1 1 29 LEU H    . 29 LEU  HN   1 1 
        603 1 1 1 1 28 GLU H    . 28 GLU- HN   1 1 
        603 1 2 1 1 29 LEU MD1  . 29 LEU  QD2  1 1 
        604 1 1 1 1 28 GLU H    . 28 GLU- HN   1 1 
        604 1 2 1 1 29 LEU MD2  . 29 LEU  QD1  1 1 
        605 1 1 1 1 28 GLU H    . 28 GLU- HN   1 1 
        605 1 2 1 1 29 LEU HG   . 29 LEU  HG   1 1 
        606 1 1 1 1 28 GLU H    . 28 GLU- HN   1 1 
        606 1 2 1 1 30 ASN H    . 30 ASN  HN   1 1 
        607 1 1 1 1 28 GLU HA   . 28 GLU- HA   1 1 
        607 1 2 1 1 28 GLU HB2  . 28 GLU- HB2  1 1 
        608 1 1 1 1 28 GLU HA   . 28 GLU- HA   1 1 
        608 1 2 1 1 28 GLU QG   . 28 GLU- QG   1 1 
        609 1 1 1 1 28 GLU HA   . 28 GLU- HA   1 1 
        609 1 2 1 1 30 ASN H    . 30 ASN  HN   1 1 
        610 1 1 1 1 28 GLU HB2  . 28 GLU- HB2  1 1 
        610 1 2 1 1 29 LEU H    . 29 LEU  HN   1 1 
        611 1 1 1 1 28 GLU HB2  . 28 GLU- HB2  1 1 
        611 1 2 1 1 29 LEU MD2  . 29 LEU  QD1  1 1 
        612 1 1 1 1 28 GLU HB2  . 28 GLU- HB2  1 1 
        612 1 2 1 1 29 LEU HG   . 29 LEU  HG   1 1 
        613 1 1 1 1 28 GLU HB3  . 28 GLU- HB3  1 1 
        613 1 2 1 1 29 LEU H    . 29 LEU  HN   1 1 
        614 1 1 1 1 28 GLU HB3  . 28 GLU- HB3  1 1 
        614 1 2 1 1 29 LEU MD2  . 29 LEU  QD1  1 1 
        615 1 1 1 1 28 GLU HB3  . 28 GLU- HB3  1 1 
        615 1 2 1 1 29 LEU HG   . 29 LEU  HG   1 1 
        616 1 1 1 1 28 GLU QG   . 28 GLU- QG   1 1 
        616 1 2 1 1 29 LEU H    . 29 LEU  HN   1 1 
        617 1 1 1 1 28 GLU QG   . 28 GLU- QG   1 1 
        617 1 2 1 1 29 LEU MD1  . 29 LEU  QD2  1 1 
        618 1 1 1 1 28 GLU QG   . 28 GLU- QG   1 1 
        618 1 2 1 1 29 LEU MD2  . 29 LEU  QD1  1 1 
        619 1 1 1 1 28 GLU QG   . 28 GLU- QG   1 1 
        619 1 2 1 1 29 LEU HG   . 29 LEU  HG   1 1 
        620 1 1 1 1 29 LEU H    . 29 LEU  HN   1 1 
        620 1 2 1 1 29 LEU QB   . 29 LEU  QB   1 1 
        621 1 1 1 1 29 LEU H    . 29 LEU  HN   1 1 
        621 1 2 1 1 29 LEU MD1  . 29 LEU  QD2  1 1 
        622 1 1 1 1 29 LEU H    . 29 LEU  HN   1 1 
        622 1 2 1 1 29 LEU MD2  . 29 LEU  QD1  1 1 
        623 1 1 1 1 29 LEU H    . 29 LEU  HN   1 1 
        623 1 2 1 1 29 LEU HG   . 29 LEU  HG   1 1 
        624 1 1 1 1 29 LEU H    . 29 LEU  HN   1 1 
        624 1 2 1 1 30 ASN H    . 30 ASN  HN   1 1 
        625 1 1 1 1 29 LEU H    . 29 LEU  HN   1 1 
        625 1 2 1 1 30 ASN HA   . 30 ASN  HA   1 1 
        626 1 1 1 1 29 LEU H    . 29 LEU  HN   1 1 
        626 1 2 1 1 30 ASN QB   . 30 ASN  QB   1 1 
        627 1 1 1 1 29 LEU H    . 29 LEU  HN   1 1 
        627 1 2 1 1 31 HIS HE1  . 31 HIS  HE1  1 1 
        628 1 1 1 1 29 LEU H    . 29 LEU  HN   1 1 
        628 1 2 1 1 37 ARG QD   . 37 ARG+ HD3  1 1 
        629 1 1 1 1 29 LEU H    . 29 LEU  HN   1 1 
        629 1 2 1 1 37 ARG QG   . 37 ARG+ HG2  1 1 
        630 1 1 1 1 29 LEU HA   . 29 LEU  HA   1 1 
        630 1 2 1 1 29 LEU MD1  . 29 LEU  QD2  1 1 
        631 1 1 1 1 29 LEU HA   . 29 LEU  HA   1 1 
        631 1 2 1 1 29 LEU MD2  . 29 LEU  QD1  1 1 
        632 1 1 1 1 29 LEU HA   . 29 LEU  HA   1 1 
        632 1 2 1 1 31 HIS HE1  . 31 HIS  HE1  1 1 
        633 1 1 1 1 29 LEU QB   . 29 LEU  QB   1 1 
        633 1 2 1 1 29 LEU MD1  . 29 LEU  QD2  1 1 
        634 1 1 1 1 29 LEU QB   . 29 LEU  QB   1 1 
        634 1 2 1 1 29 LEU MD2  . 29 LEU  QD1  1 1 
        635 1 1 1 1 29 LEU QB   . 29 LEU  QB   1 1 
        635 1 2 1 1 30 ASN H    . 30 ASN  HN   1 1 
        636 1 1 1 1 29 LEU QB   . 29 LEU  QB   1 1 
        636 1 2 1 1 31 HIS HE1  . 31 HIS  HE1  1 1 
        637 1 1 1 1 29 LEU QB   . 29 LEU  QB   1 1 
        637 1 2 1 1 37 ARG HA   . 37 ARG+ HA   1 1 
        638 1 1 1 1 29 LEU QB   . 29 LEU  QB   1 1 
        638 1 2 1 1 37 ARG QD   . 37 ARG+ HD2  1 1 
        639 1 1 1 1 29 LEU MD1  . 29 LEU  QD2  1 1 
        639 1 2 1 1 30 ASN H    . 30 ASN  HN   1 1 
        640 1 1 1 1 29 LEU MD1  . 29 LEU  QD2  1 1 
        640 1 2 1 1 31 HIS HE1  . 31 HIS  HE1  1 1 
        641 1 1 1 1 29 LEU MD1  . 29 LEU  QD2  1 1 
        641 1 2 1 1 37 ARG HA   . 37 ARG+ HA   1 1 
        642 1 1 1 1 29 LEU MD1  . 29 LEU  QD2  1 1 
        642 1 2 1 1 37 ARG QD   . 37 ARG+ HD2  1 1 
        643 1 1 1 1 29 LEU MD1  . 29 LEU  QD2  1 1 
        643 1 2 1 1 40 GLU HA   . 40 GLU- HA   1 1 
        644 1 1 1 1 29 LEU MD1  . 29 LEU  QD2  1 1 
        644 1 2 1 1 40 GLU HB2  . 40 GLU- HB3  1 1 
        645 1 1 1 1 29 LEU MD1  . 29 LEU  QD2  1 1 
        645 1 2 1 1 40 GLU HB3  . 40 GLU- HB2  1 1 
        646 1 1 1 1 29 LEU MD1  . 29 LEU  QD2  1 1 
        646 1 2 1 1 40 GLU HG2  . 40 GLU- HG2  1 1 
        647 1 1 1 1 29 LEU MD1  . 29 LEU  QD2  1 1 
        647 1 2 1 1 40 GLU HG3  . 40 GLU- HG3  1 1 
        648 1 1 1 1 29 LEU MD1  . 29 LEU  QD2  1 1 
        648 1 2 1 1 41 ILE H    . 41 ILE  HN   1 1 
        649 1 1 1 1 29 LEU MD1  . 29 LEU  QD2  1 1 
        649 1 2 1 1 41 ILE HA   . 41 ILE  HA   1 1 
        650 1 1 1 1 29 LEU MD1  . 29 LEU  QD2  1 1 
        650 1 2 1 1 41 ILE HG13 . 41 ILE  HG12 1 1 
        651 1 1 1 1 29 LEU MD1  . 29 LEU  QD2  1 1 
        651 1 2 1 1 41 ILE MG   . 41 ILE  QG2  1 1 
        652 1 1 1 1 29 LEU MD1  . 29 LEU  QD2  1 1 
        652 1 2 1 1 44 ARG HD2  . 44 ARG+ HD2  1 1 
        653 1 1 1 1 29 LEU MD1  . 29 LEU  QD2  1 1 
        653 1 2 1 1 44 ARG HD3  . 44 ARG+ HD3  1 1 
        654 1 1 1 1 29 LEU MD2  . 29 LEU  QD1  1 1 
        654 1 2 1 1 30 ASN H    . 30 ASN  HN   1 1 
        655 1 1 1 1 29 LEU MD2  . 29 LEU  QD1  1 1 
        655 1 2 1 1 31 HIS HE1  . 31 HIS  HE1  1 1 
        656 1 1 1 1 29 LEU MD2  . 29 LEU  QD1  1 1 
        656 1 2 1 1 37 ARG HA   . 37 ARG+ HA   1 1 
        657 1 1 1 1 29 LEU MD2  . 29 LEU  QD1  1 1 
        657 1 2 1 1 40 GLU HG2  . 40 GLU- HG2  1 1 
        658 1 1 1 1 29 LEU MD2  . 29 LEU  QD1  1 1 
        658 1 2 1 1 40 GLU HG3  . 40 GLU- HG3  1 1 
        659 1 1 1 1 29 LEU MD2  . 29 LEU  QD1  1 1 
        659 1 2 1 1 41 ILE H    . 41 ILE  HN   1 1 
        660 1 1 1 1 29 LEU MD2  . 29 LEU  QD1  1 1 
        660 1 2 1 1 41 ILE HA   . 41 ILE  HA   1 1 
        661 1 1 1 1 29 LEU MD2  . 29 LEU  QD1  1 1 
        661 1 2 1 1 41 ILE HG13 . 41 ILE  HG12 1 1 
        662 1 1 1 1 29 LEU MD2  . 29 LEU  QD1  1 1 
        662 1 2 1 1 44 ARG HD2  . 44 ARG+ HD2  1 1 
        663 1 1 1 1 29 LEU MD2  . 29 LEU  QD1  1 1 
        663 1 2 1 1 44 ARG HD3  . 44 ARG+ HD3  1 1 
        664 1 1 1 1 29 LEU HG   . 29 LEU  HG   1 1 
        664 1 2 1 1 30 ASN H    . 30 ASN  HN   1 1 
        665 1 1 1 1 29 LEU HG   . 29 LEU  HG   1 1 
        665 1 2 1 1 31 HIS HE1  . 31 HIS  HE1  1 1 
        666 1 1 1 1 29 LEU HG   . 29 LEU  HG   1 1 
        666 1 2 1 1 41 ILE MD   . 41 ILE  QD1  1 1 
        667 1 1 1 1 30 ASN H    . 30 ASN  HN   1 1 
        667 1 2 1 1 30 ASN QB   . 30 ASN  QB   1 1 
        668 1 1 1 1 30 ASN H    . 30 ASN  HN   1 1 
        668 1 2 1 1 30 ASN QD   . 30 ASN  HD22 1 1 
        669 1 1 1 1 30 ASN H    . 30 ASN  HN   1 1 
        669 1 2 1 1 31 HIS HE1  . 31 HIS  HE1  1 1 
        670 1 1 1 1 30 ASN HA   . 30 ASN  HA   1 1 
        670 1 2 1 1 32 LEU H    . 32 LEU  HN   1 1 
        671 1 1 1 1 30 ASN HA   . 30 ASN  HA   1 1 
        671 1 2 1 1 32 LEU MD1  . 32 LEU  QD1  1 1 
        672 1 1 1 1 30 ASN HA   . 30 ASN  HA   1 1 
        672 1 2 1 1 37 ARG QD   . 37 ARG+ HD2  1 1 
        673 1 1 1 1 30 ASN HA   . 30 ASN  HA   1 1 
        673 1 2 1 1 37 ARG HE   . 37 ARG+ HE   1 1 
        674 1 1 1 1 30 ASN HA   . 30 ASN  HA   1 1 
        674 1 2 1 1 37 ARG QG   . 37 ARG+ HG2  1 1 
        675 1 1 1 1 30 ASN QB   . 30 ASN  QB   1 1 
        675 1 2 1 1 31 HIS HA   . 31 HIS  HA   1 1 
        676 1 1 1 1 31 HIS HB2  . 31 HIS  HB2  1 1 
        676 1 2 1 1 31 HIS HD2  . 31 HIS  HD2  1 1 
        677 1 1 1 1 31 HIS HB2  . 31 HIS  HB2  1 1 
        677 1 2 1 1 32 LEU H    . 32 LEU  HN   1 1 
        678 1 1 1 1 31 HIS HB2  . 31 HIS  HB2  1 1 
        678 1 2 1 1 32 LEU HA   . 32 LEU  HA   1 1 
        679 1 1 1 1 31 HIS HB3  . 31 HIS  HB3  1 1 
        679 1 2 1 1 32 LEU H    . 32 LEU  HN   1 1 
        680 1 1 1 1 31 HIS HD2  . 31 HIS  HD2  1 1 
        680 1 2 1 1 32 LEU H    . 32 LEU  HN   1 1 
        681 1 1 1 1 31 HIS HD2  . 31 HIS  HD2  1 1 
        681 1 2 1 1 32 LEU MD1  . 32 LEU  QD1  1 1 
        682 1 1 1 1 31 HIS HD2  . 31 HIS  HD2  1 1 
        682 1 2 1 1 32 LEU MD2  . 32 LEU  QD2  1 1 
        683 1 1 1 1 31 HIS HD2  . 31 HIS  HD2  1 1 
        683 1 2 1 1 32 LEU HG   . 32 LEU  HG   1 1 
        684 1 1 1 1 31 HIS HE1  . 31 HIS  HE1  1 1 
        684 1 2 1 1 32 LEU MD1  . 32 LEU  QD1  1 1 
        685 1 1 1 1 31 HIS HE1  . 31 HIS  HE1  1 1 
        685 1 2 1 1 32 LEU MD2  . 32 LEU  QD2  1 1 
        686 1 1 1 1 31 HIS HE1  . 31 HIS  HE1  1 1 
        686 1 2 1 1 32 LEU HG   . 32 LEU  HG   1 1 
        687 1 1 1 1 32 LEU H    . 32 LEU  HN   1 1 
        687 1 2 1 1 32 LEU QB   . 32 LEU  HB2  1 1 
        688 1 1 1 1 32 LEU H    . 32 LEU  HN   1 1 
        688 1 2 1 1 32 LEU MD1  . 32 LEU  QD1  1 1 
        689 1 1 1 1 32 LEU H    . 32 LEU  HN   1 1 
        689 1 2 1 1 32 LEU MD2  . 32 LEU  QD2  1 1 
        690 1 1 1 1 32 LEU H    . 32 LEU  HN   1 1 
        690 1 2 1 1 32 LEU HG   . 32 LEU  HG   1 1 
        691 1 1 1 1 32 LEU H    . 32 LEU  HN   1 1 
        691 1 2 1 1 33 PRO HD2  . 33 PRO  HD3  1 1 
        692 1 1 1 1 32 LEU H    . 32 LEU  HN   1 1 
        692 1 2 1 1 33 PRO HD3  . 33 PRO  HD2  1 1 
        693 1 1 1 1 32 LEU H    . 32 LEU  HN   1 1 
        693 1 2 1 1 36 GLU HB3  . 36 GLU- HB3  1 1 
        694 1 1 1 1 32 LEU H    . 32 LEU  HN   1 1 
        694 1 2 1 1 37 ARG HE   . 37 ARG+ HE   1 1 
        695 1 1 1 1 32 LEU H    . 32 LEU  HN   1 1 
        695 1 2 1 1 37 ARG QG   . 37 ARG+ HG2  1 1 
        696 1 1 1 1 32 LEU HA   . 32 LEU  HA   1 1 
        696 1 2 1 1 32 LEU MD1  . 32 LEU  QD1  1 1 
        697 1 1 1 1 32 LEU HA   . 32 LEU  HA   1 1 
        697 1 2 1 1 33 PRO HD2  . 33 PRO  HD3  1 1 
        698 1 1 1 1 32 LEU HA   . 32 LEU  HA   1 1 
        698 1 2 1 1 33 PRO HD3  . 33 PRO  HD2  1 1 
        699 1 1 1 1 32 LEU HA   . 32 LEU  HA   1 1 
        699 1 2 1 1 33 PRO QG   . 33 PRO  QG   1 1 
        700 1 1 1 1 32 LEU HA   . 32 LEU  HA   1 1 
        700 1 2 1 1 36 GLU HB2  . 36 GLU- HB2  1 1 
        701 1 1 1 1 32 LEU QB   . 32 LEU  HB3  1 1 
        701 1 2 1 1 32 LEU MD1  . 32 LEU  QD1  1 1 
        702 1 1 1 1 32 LEU QB   . 32 LEU  HB2  1 1 
        702 1 2 1 1 33 PRO HD2  . 33 PRO  HD3  1 1 
        703 1 1 1 1 32 LEU QB   . 32 LEU  HB2  1 1 
        703 1 2 1 1 33 PRO HD3  . 33 PRO  HD2  1 1 
        704 1 1 1 1 32 LEU QB   . 32 LEU  HB2  1 1 
        704 1 2 1 1 36 GLU HB2  . 36 GLU- HB2  1 1 
        705 1 1 1 1 32 LEU QB   . 32 LEU  HB3  1 1 
        705 1 2 1 1 36 GLU HB3  . 36 GLU- HB3  1 1 
        706 1 1 1 1 32 LEU QB   . 32 LEU  HB3  1 1 
        706 1 2 1 1 36 GLU HG3  . 36 GLU- HG3  1 1 
        707 1 1 1 1 32 LEU QB   . 32 LEU  HB3  1 1 
        707 1 2 1 1 37 ARG H    . 37 ARG+ HN   1 1 
        708 1 1 1 1 32 LEU QB   . 32 LEU  HB3  1 1 
        708 1 2 1 1 37 ARG HA   . 37 ARG+ HA   1 1 
        709 1 1 1 1 32 LEU QB   . 32 LEU  HB3  1 1 
        709 1 2 1 1 37 ARG HE   . 37 ARG+ HE   1 1 
        710 1 1 1 1 32 LEU QB   . 32 LEU  HB3  1 1 
        710 1 2 1 1 37 ARG QG   . 37 ARG+ HG2  1 1 
        711 1 1 1 1 32 LEU MD1  . 32 LEU  QD1  1 1 
        711 1 2 1 1 33 PRO HD2  . 33 PRO  HD3  1 1 
        712 1 1 1 1 32 LEU MD1  . 32 LEU  QD1  1 1 
        712 1 2 1 1 33 PRO HD3  . 33 PRO  HD2  1 1 
        713 1 1 1 1 32 LEU MD1  . 32 LEU  QD1  1 1 
        713 1 2 1 1 36 GLU H    . 36 GLU- HN   1 1 
        714 1 1 1 1 32 LEU MD1  . 32 LEU  QD1  1 1 
        714 1 2 1 1 36 GLU HA   . 36 GLU- HA   1 1 
        715 1 1 1 1 32 LEU MD1  . 32 LEU  QD1  1 1 
        715 1 2 1 1 36 GLU HB2  . 36 GLU- HB2  1 1 
        716 1 1 1 1 32 LEU MD1  . 32 LEU  QD1  1 1 
        716 1 2 1 1 36 GLU HB3  . 36 GLU- HB3  1 1 
        717 1 1 1 1 32 LEU MD1  . 32 LEU  QD1  1 1 
        717 1 2 1 1 36 GLU HG3  . 36 GLU- HG3  1 1 
        718 1 1 1 1 32 LEU MD1  . 32 LEU  QD1  1 1 
        718 1 2 1 1 37 ARG H    . 37 ARG+ HN   1 1 
        719 1 1 1 1 32 LEU MD1  . 32 LEU  QD1  1 1 
        719 1 2 1 1 37 ARG HA   . 37 ARG+ HA   1 1 
        720 1 1 1 1 32 LEU MD1  . 32 LEU  QD1  1 1 
        720 1 2 1 1 37 ARG HE   . 37 ARG+ HE   1 1 
        721 1 1 1 1 32 LEU MD1  . 32 LEU  QD1  1 1 
        721 1 2 1 1 37 ARG QG   . 37 ARG+ HG2  1 1 
        722 1 1 1 1 32 LEU MD1  . 32 LEU  QD1  1 1 
        722 1 2 1 1 40 GLU H    . 40 GLU- HN   1 1 
        723 1 1 1 1 32 LEU MD1  . 32 LEU  QD1  1 1 
        723 1 2 1 1 40 GLU HG2  . 40 GLU- HG2  1 1 
        724 1 1 1 1 32 LEU MD2  . 32 LEU  QD2  1 1 
        724 1 2 1 1 36 GLU HB2  . 36 GLU- HB2  1 1 
        725 1 1 1 1 32 LEU MD2  . 32 LEU  QD2  1 1 
        725 1 2 1 1 36 GLU HB3  . 36 GLU- HB3  1 1 
        726 1 1 1 1 32 LEU MD2  . 32 LEU  QD2  1 1 
        726 1 2 1 1 36 GLU HG2  . 36 GLU- HG2  1 1 
        727 1 1 1 1 32 LEU MD2  . 32 LEU  QD2  1 1 
        727 1 2 1 1 36 GLU HG3  . 36 GLU- HG3  1 1 
        728 1 1 1 1 32 LEU MD2  . 32 LEU  QD2  1 1 
        728 1 2 1 1 37 ARG H    . 37 ARG+ HN   1 1 
        729 1 1 1 1 32 LEU MD2  . 32 LEU  QD2  1 1 
        729 1 2 1 1 37 ARG HA   . 37 ARG+ HA   1 1 
        730 1 1 1 1 32 LEU MD2  . 32 LEU  QD2  1 1 
        730 1 2 1 1 40 GLU HG2  . 40 GLU- HG2  1 1 
        731 1 1 1 1 32 LEU HG   . 32 LEU  HG   1 1 
        731 1 2 1 1 36 GLU HB3  . 36 GLU- HB3  1 1 
        732 1 1 1 1 33 PRO HA   . 33 PRO  HA   1 1 
        732 1 2 1 1 34 LEU H    . 34 LEU  HN   1 1 
        733 1 1 1 1 33 PRO HA   . 33 PRO  HA   1 1 
        733 1 2 1 1 34 LEU HA   . 34 LEU  HA   1 1 
        734 1 1 1 1 33 PRO HA   . 33 PRO  HA   1 1 
        734 1 2 1 1 34 LEU HB2  . 34 LEU  HB2  1 1 
        735 1 1 1 1 33 PRO HA   . 33 PRO  HA   1 1 
        735 1 2 1 1 35 LYS H    . 35 LYS+ HN   1 1 
        736 1 1 1 1 33 PRO HB2  . 33 PRO  HB2  1 1 
        736 1 2 1 1 34 LEU H    . 34 LEU  HN   1 1 
        737 1 1 1 1 33 PRO HB2  . 33 PRO  HB2  1 1 
        737 1 2 1 1 35 LYS H    . 35 LYS+ HN   1 1 
        738 1 1 1 1 33 PRO HB2  . 33 PRO  HB2  1 1 
        738 1 2 1 1 36 GLU H    . 36 GLU- HN   1 1 
        739 1 1 1 1 33 PRO HB3  . 33 PRO  HB3  1 1 
        739 1 2 1 1 34 LEU H    . 34 LEU  HN   1 1 
        740 1 1 1 1 33 PRO HD2  . 33 PRO  HD3  1 1 
        740 1 2 1 1 36 GLU H    . 36 GLU- HN   1 1 
        741 1 1 1 1 33 PRO HD2  . 33 PRO  HD3  1 1 
        741 1 2 1 1 36 GLU HB2  . 36 GLU- HB2  1 1 
        742 1 1 1 1 33 PRO HD2  . 33 PRO  HD3  1 1 
        742 1 2 1 1 36 GLU HB3  . 36 GLU- HB3  1 1 
        743 1 1 1 1 33 PRO HD2  . 33 PRO  HD3  1 1 
        743 1 2 1 1 36 GLU HG2  . 36 GLU- HG2  1 1 
        744 1 1 1 1 33 PRO HD2  . 33 PRO  HD3  1 1 
        744 1 2 1 1 36 GLU HG3  . 36 GLU- HG3  1 1 
        745 1 1 1 1 33 PRO HD2  . 33 PRO  HD3  1 1 
        745 1 2 1 1 37 ARG H    . 37 ARG+ HN   1 1 
        746 1 1 1 1 33 PRO QG   . 33 PRO  QG   1 1 
        746 1 2 1 1 35 LYS H    . 35 LYS+ HN   1 1 
        747 1 1 1 1 33 PRO QG   . 33 PRO  QG   1 1 
        747 1 2 1 1 35 LYS HG2  . 35 LYS+ HG3  1 1 
        748 1 1 1 1 33 PRO QG   . 33 PRO  QG   1 1 
        748 1 2 1 1 36 GLU H    . 36 GLU- HN   1 1 
        749 1 1 1 1 33 PRO QG   . 33 PRO  QG   1 1 
        749 1 2 1 1 36 GLU HG3  . 36 GLU- HG3  1 1 
        750 1 1 1 1 34 LEU H    . 34 LEU  HN   1 1 
        750 1 2 1 1 34 LEU HB2  . 34 LEU  HB2  1 1 
        751 1 1 1 1 34 LEU H    . 34 LEU  HN   1 1 
        751 1 2 1 1 34 LEU HB3  . 34 LEU  HB3  1 1 
        752 1 1 1 1 34 LEU H    . 34 LEU  HN   1 1 
        752 1 2 1 1 34 LEU QD   . 34 LEU  QD1  1 1 
        753 1 1 1 1 34 LEU H    . 34 LEU  HN   1 1 
        753 1 2 1 1 35 LYS H    . 35 LYS+ HN   1 1 
        754 1 1 1 1 34 LEU H    . 34 LEU  HN   1 1 
        754 1 2 1 1 36 GLU H    . 36 GLU- HN   1 1 
        755 1 1 1 1 34 LEU H    . 34 LEU  HN   1 1 
        755 1 2 1 1 37 ARG H    . 37 ARG+ HN   1 1 
        756 1 1 1 1 34 LEU H    . 34 LEU  HN   1 1 
        756 1 2 1 1 37 ARG HE   . 37 ARG+ HE   1 1 
        757 1 1 1 1 34 LEU H    . 34 LEU  HN   1 1 
        757 1 2 1 1 37 ARG QG   . 37 ARG+ HG2  1 1 
        758 1 1 1 1 34 LEU HA   . 34 LEU  HA   1 1 
        758 1 2 1 1 34 LEU QD   . 34 LEU  QD1  1 1 
        759 1 1 1 1 34 LEU HA   . 34 LEU  HA   1 1 
        759 1 2 1 1 34 LEU HG   . 34 LEU  HG   1 1 
        760 1 1 1 1 34 LEU HA   . 34 LEU  HA   1 1 
        760 1 2 1 1 36 GLU H    . 36 GLU- HN   1 1 
        761 1 1 1 1 34 LEU HA   . 34 LEU  HA   1 1 
        761 1 2 1 1 37 ARG H    . 37 ARG+ HN   1 1 
        762 1 1 1 1 34 LEU HA   . 34 LEU  HA   1 1 
        762 1 2 1 1 37 ARG QB   . 37 ARG+ HB3  1 1 
        763 1 1 1 1 34 LEU HA   . 34 LEU  HA   1 1 
        763 1 2 1 1 37 ARG QD   . 37 ARG+ HD2  1 1 
        764 1 1 1 1 34 LEU HA   . 34 LEU  HA   1 1 
        764 1 2 1 1 37 ARG HE   . 37 ARG+ HE   1 1 
        765 1 1 1 1 34 LEU HA   . 34 LEU  HA   1 1 
        765 1 2 1 1 37 ARG QG   . 37 ARG+ HG2  1 1 
        766 1 1 1 1 34 LEU HA   . 34 LEU  HA   1 1 
        766 1 2 1 1 38 MET H    . 38 MET  HN   1 1 
        767 1 1 1 1 34 LEU HB2  . 34 LEU  HB2  1 1 
        767 1 2 1 1 34 LEU QD   . 34 LEU  QD2  1 1 
        768 1 1 1 1 34 LEU HB2  . 34 LEU  HB2  1 1 
        768 1 2 1 1 35 LYS H    . 35 LYS+ HN   1 1 
        769 1 1 1 1 34 LEU HB3  . 34 LEU  HB3  1 1 
        769 1 2 1 1 35 LYS H    . 35 LYS+ HN   1 1 
        770 1 1 1 1 34 LEU HB3  . 34 LEU  HB3  1 1 
        770 1 2 1 1 35 LYS HA   . 35 LYS+ HA   1 1 
        771 1 1 1 1 34 LEU QD   . 34 LEU  QD1  1 1 
        771 1 2 1 1 35 LYS H    . 35 LYS+ HN   1 1 
        772 1 1 1 1 34 LEU QD   . 34 LEU  QD1  1 1 
        772 1 2 1 1 35 LYS HA   . 35 LYS+ HA   1 1 
        773 1 1 1 1 34 LEU QD   . 34 LEU  QD1  1 1 
        773 1 2 1 1 37 ARG H    . 37 ARG+ HN   1 1 
        774 1 1 1 1 34 LEU QD   . 34 LEU  QD2  1 1 
        774 1 2 1 1 37 ARG QB   . 37 ARG+ HB3  1 1 
        775 1 1 1 1 34 LEU QD   . 34 LEU  QD1  1 1 
        775 1 2 1 1 37 ARG QD   . 37 ARG+ HD2  1 1 
        776 1 1 1 1 34 LEU QD   . 34 LEU  QD1  1 1 
        776 1 2 1 1 38 MET H    . 38 MET  HN   1 1 
        777 1 1 1 1 34 LEU QD   . 34 LEU  QD2  1 1 
        777 1 2 1 1 38 MET ME   . 38 MET  QE   1 1 
        778 1 1 1 1 34 LEU QD   . 34 LEU  QD1  1 1 
        778 1 2 1 1 38 MET QG   . 38 MET  QG   1 1 
        779 1 1 1 1 34 LEU HG   . 34 LEU  HG   1 1 
        779 1 2 1 1 35 LYS H    . 35 LYS+ HN   1 1 
        780 1 1 1 1 34 LEU HG   . 34 LEU  HG   1 1 
        780 1 2 1 1 38 MET H    . 38 MET  HN   1 1 
        781 1 1 1 1 34 LEU HG   . 34 LEU  HG   1 1 
        781 1 2 1 1 38 MET QG   . 38 MET  QG   1 1 
        782 1 1 1 1 35 LYS H    . 35 LYS+ HN   1 1 
        782 1 2 1 1 35 LYS HB2  . 35 LYS+ HB2  1 1 
        783 1 1 1 1 35 LYS H    . 35 LYS+ HN   1 1 
        783 1 2 1 1 35 LYS HB3  . 35 LYS+ HB3  1 1 
        784 1 1 1 1 35 LYS H    . 35 LYS+ HN   1 1 
        784 1 2 1 1 35 LYS QD   . 35 LYS+ QD   1 1 
        785 1 1 1 1 35 LYS H    . 35 LYS+ HN   1 1 
        785 1 2 1 1 35 LYS HG2  . 35 LYS+ HG3  1 1 
        786 1 1 1 1 35 LYS H    . 35 LYS+ HN   1 1 
        786 1 2 1 1 35 LYS HG3  . 35 LYS+ HG2  1 1 
        787 1 1 1 1 35 LYS H    . 35 LYS+ HN   1 1 
        787 1 2 1 1 36 GLU H    . 36 GLU- HN   1 1 
        788 1 1 1 1 35 LYS H    . 35 LYS+ HN   1 1 
        788 1 2 1 1 37 ARG H    . 37 ARG+ HN   1 1 
        789 1 1 1 1 35 LYS H    . 35 LYS+ HN   1 1 
        789 1 2 1 1 38 MET H    . 38 MET  HN   1 1 
        790 1 1 1 1 35 LYS HA   . 35 LYS+ HA   1 1 
        790 1 2 1 1 35 LYS QD   . 35 LYS+ QD   1 1 
        791 1 1 1 1 35 LYS HA   . 35 LYS+ HA   1 1 
        791 1 2 1 1 35 LYS HG2  . 35 LYS+ HG3  1 1 
        792 1 1 1 1 35 LYS HA   . 35 LYS+ HA   1 1 
        792 1 2 1 1 35 LYS HG3  . 35 LYS+ HG2  1 1 
        793 1 1 1 1 35 LYS HA   . 35 LYS+ HA   1 1 
        793 1 2 1 1 37 ARG H    . 37 ARG+ HN   1 1 
        794 1 1 1 1 35 LYS HA   . 35 LYS+ HA   1 1 
        794 1 2 1 1 38 MET H    . 38 MET  HN   1 1 
        795 1 1 1 1 35 LYS HA   . 35 LYS+ HA   1 1 
        795 1 2 1 1 38 MET HB2  . 38 MET  HB2  1 1 
        796 1 1 1 1 35 LYS HA   . 35 LYS+ HA   1 1 
        796 1 2 1 1 38 MET HB3  . 38 MET  HB3  1 1 
        797 1 1 1 1 35 LYS HA   . 35 LYS+ HA   1 1 
        797 1 2 1 1 38 MET QG   . 38 MET  QG   1 1 
        798 1 1 1 1 35 LYS HA   . 35 LYS+ HA   1 1 
        798 1 2 1 1 39 VAL H    . 39 VAL  HN   1 1 
        799 1 1 1 1 35 LYS HA   . 35 LYS+ HA   1 1 
        799 1 2 1 1 39 VAL QG   . 39 VAL  QG1  1 1 
        800 1 1 1 1 35 LYS HB2  . 35 LYS+ HB2  1 1 
        800 1 2 1 1 36 GLU H    . 36 GLU- HN   1 1 
        801 1 1 1 1 35 LYS HB3  . 35 LYS+ HB3  1 1 
        801 1 2 1 1 35 LYS QE   . 35 LYS+ QE   1 1 
        802 1 1 1 1 35 LYS HB3  . 35 LYS+ HB3  1 1 
        802 1 2 1 1 36 GLU H    . 36 GLU- HN   1 1 
        803 1 1 1 1 35 LYS HB3  . 35 LYS+ HB3  1 1 
        803 1 2 1 1 36 GLU HG2  . 36 GLU- HG2  1 1 
        804 1 1 1 1 35 LYS HB3  . 35 LYS+ HB3  1 1 
        804 1 2 1 1 36 GLU HG3  . 36 GLU- HG3  1 1 
        805 1 1 1 1 35 LYS HB3  . 35 LYS+ HB3  1 1 
        805 1 2 1 1 39 VAL QG   . 39 VAL  QG1  1 1 
        806 1 1 1 1 35 LYS QD   . 35 LYS+ QD   1 1 
        806 1 2 1 1 35 LYS HG3  . 35 LYS+ HG2  1 1 
        807 1 1 1 1 35 LYS QD   . 35 LYS+ QD   1 1 
        807 1 2 1 1 39 VAL QG   . 39 VAL  QG1  1 1 
        808 1 1 1 1 35 LYS QE   . 35 LYS+ QE   1 1 
        808 1 2 1 1 35 LYS HG2  . 35 LYS+ HG3  1 1 
        809 1 1 1 1 35 LYS QE   . 35 LYS+ QE   1 1 
        809 1 2 1 1 39 VAL QG   . 39 VAL  QG1  1 1 
        810 1 1 1 1 35 LYS HG2  . 35 LYS+ HG3  1 1 
        810 1 2 1 1 36 GLU H    . 36 GLU- HN   1 1 
        811 1 1 1 1 35 LYS HG2  . 35 LYS+ HG3  1 1 
        811 1 2 1 1 36 GLU HA   . 36 GLU- HA   1 1 
        812 1 1 1 1 35 LYS HG2  . 35 LYS+ HG3  1 1 
        812 1 2 1 1 36 GLU HG3  . 36 GLU- HG3  1 1 
        813 1 1 1 1 35 LYS HG3  . 35 LYS+ HG2  1 1 
        813 1 2 1 1 39 VAL QG   . 39 VAL  QG1  1 1 
        814 1 1 1 1 36 GLU H    . 36 GLU- HN   1 1 
        814 1 2 1 1 36 GLU HB2  . 36 GLU- HB2  1 1 
        815 1 1 1 1 36 GLU H    . 36 GLU- HN   1 1 
        815 1 2 1 1 36 GLU HB3  . 36 GLU- HB3  1 1 
        816 1 1 1 1 36 GLU H    . 36 GLU- HN   1 1 
        816 1 2 1 1 36 GLU HG2  . 36 GLU- HG2  1 1 
        817 1 1 1 1 36 GLU H    . 36 GLU- HN   1 1 
        817 1 2 1 1 36 GLU HG3  . 36 GLU- HG3  1 1 
        818 1 1 1 1 36 GLU H    . 36 GLU- HN   1 1 
        818 1 2 1 1 37 ARG H    . 37 ARG+ HN   1 1 
        819 1 1 1 1 36 GLU H    . 36 GLU- HN   1 1 
        819 1 2 1 1 37 ARG QB   . 37 ARG+ HB3  1 1 
        820 1 1 1 1 36 GLU H    . 36 GLU- HN   1 1 
        820 1 2 1 1 38 MET H    . 38 MET  HN   1 1 
        821 1 1 1 1 36 GLU H    . 36 GLU- HN   1 1 
        821 1 2 1 1 39 VAL H    . 39 VAL  HN   1 1 
        822 1 1 1 1 36 GLU H    . 36 GLU- HN   1 1 
        822 1 2 1 1 39 VAL QG   . 39 VAL  QG1  1 1 
        823 1 1 1 1 36 GLU HA   . 36 GLU- HA   1 1 
        823 1 2 1 1 36 GLU HG2  . 36 GLU- HG2  1 1 
        824 1 1 1 1 36 GLU HA   . 36 GLU- HA   1 1 
        824 1 2 1 1 36 GLU HG3  . 36 GLU- HG3  1 1 
        825 1 1 1 1 36 GLU HA   . 36 GLU- HA   1 1 
        825 1 2 1 1 38 MET H    . 38 MET  HN   1 1 
        826 1 1 1 1 36 GLU HA   . 36 GLU- HA   1 1 
        826 1 2 1 1 39 VAL H    . 39 VAL  HN   1 1 
        827 1 1 1 1 36 GLU HA   . 36 GLU- HA   1 1 
        827 1 2 1 1 39 VAL QG   . 39 VAL  QG1  1 1 
        828 1 1 1 1 36 GLU HA   . 36 GLU- HA   1 1 
        828 1 2 1 1 40 GLU H    . 40 GLU- HN   1 1 
        829 1 1 1 1 36 GLU HB2  . 36 GLU- HB2  1 1 
        829 1 2 1 1 37 ARG H    . 37 ARG+ HN   1 1 
        830 1 1 1 1 36 GLU HB3  . 36 GLU- HB3  1 1 
        830 1 2 1 1 37 ARG H    . 37 ARG+ HN   1 1 
        831 1 1 1 1 36 GLU HB3  . 36 GLU- HB3  1 1 
        831 1 2 1 1 39 VAL QG   . 39 VAL  QG1  1 1 
        832 1 1 1 1 36 GLU HG2  . 36 GLU- HG2  1 1 
        832 1 2 1 1 37 ARG H    . 37 ARG+ HN   1 1 
        833 1 1 1 1 36 GLU HG2  . 36 GLU- HG2  1 1 
        833 1 2 1 1 39 VAL QG   . 39 VAL  QG1  1 1 
        834 1 1 1 1 36 GLU HG3  . 36 GLU- HG3  1 1 
        834 1 2 1 1 37 ARG H    . 37 ARG+ HN   1 1 
        835 1 1 1 1 36 GLU HG3  . 36 GLU- HG3  1 1 
        835 1 2 1 1 39 VAL QG   . 39 VAL  QG1  1 1 
        836 1 1 1 1 37 ARG H    . 37 ARG+ HN   1 1 
        836 1 2 1 1 37 ARG QB   . 37 ARG+ HB3  1 1 
        837 1 1 1 1 37 ARG H    . 37 ARG+ HN   1 1 
        837 1 2 1 1 37 ARG QD   . 37 ARG+ HD3  1 1 
        838 1 1 1 1 37 ARG H    . 37 ARG+ HN   1 1 
        838 1 2 1 1 37 ARG QG   . 37 ARG+ HG2  1 1 
        839 1 1 1 1 37 ARG H    . 37 ARG+ HN   1 1 
        839 1 2 1 1 38 MET H    . 38 MET  HN   1 1 
        840 1 1 1 1 37 ARG H    . 37 ARG+ HN   1 1 
        840 1 2 1 1 38 MET QG   . 38 MET  QG   1 1 
        841 1 1 1 1 37 ARG H    . 37 ARG+ HN   1 1 
        841 1 2 1 1 39 VAL H    . 39 VAL  HN   1 1 
        842 1 1 1 1 37 ARG HA   . 37 ARG+ HA   1 1 
        842 1 2 1 1 37 ARG QG   . 37 ARG+ HG2  1 1 
        843 1 1 1 1 37 ARG HA   . 37 ARG+ HA   1 1 
        843 1 2 1 1 40 GLU H    . 40 GLU- HN   1 1 
        844 1 1 1 1 37 ARG HA   . 37 ARG+ HA   1 1 
        844 1 2 1 1 40 GLU HB2  . 40 GLU- HB3  1 1 
        845 1 1 1 1 37 ARG HA   . 37 ARG+ HA   1 1 
        845 1 2 1 1 40 GLU HB3  . 40 GLU- HB2  1 1 
        846 1 1 1 1 37 ARG HA   . 37 ARG+ HA   1 1 
        846 1 2 1 1 40 GLU HG2  . 40 GLU- HG2  1 1 
        847 1 1 1 1 37 ARG HA   . 37 ARG+ HA   1 1 
        847 1 2 1 1 41 ILE H    . 41 ILE  HN   1 1 
        848 1 1 1 1 37 ARG HA   . 37 ARG+ HA   1 1 
        848 1 2 1 1 41 ILE MD   . 41 ILE  QD1  1 1 
        849 1 1 1 1 37 ARG HA   . 37 ARG+ HA   1 1 
        849 1 2 1 1 41 ILE HG13 . 41 ILE  HG12 1 1 
        850 1 1 1 1 37 ARG QB   . 37 ARG+ HB2  1 1 
        850 1 2 1 1 37 ARG HE   . 37 ARG+ HE   1 1 
        851 1 1 1 1 37 ARG QB   . 37 ARG+ HB2  1 1 
        851 1 2 1 1 38 MET H    . 38 MET  HN   1 1 
        852 1 1 1 1 37 ARG QB   . 37 ARG+ HB2  1 1 
        852 1 2 1 1 38 MET QG   . 38 MET  QG   1 1 
        853 1 1 1 1 37 ARG QB   . 37 ARG+ HB2  1 1 
        853 1 2 1 1 41 ILE MD   . 41 ILE  QD1  1 1 
        854 1 1 1 1 37 ARG QD   . 37 ARG+ HD2  1 1 
        854 1 2 1 1 41 ILE MD   . 41 ILE  QD1  1 1 
        855 1 1 1 1 37 ARG QG   . 37 ARG+ HG2  1 1 
        855 1 2 1 1 38 MET H    . 38 MET  HN   1 1 
        856 1 1 1 1 38 MET H    . 38 MET  HN   1 1 
        856 1 2 1 1 38 MET HB2  . 38 MET  HB2  1 1 
        857 1 1 1 1 38 MET H    . 38 MET  HN   1 1 
        857 1 2 1 1 38 MET HB3  . 38 MET  HB3  1 1 
        858 1 1 1 1 38 MET H    . 38 MET  HN   1 1 
        858 1 2 1 1 38 MET ME   . 38 MET  QE   1 1 
        859 1 1 1 1 38 MET H    . 38 MET  HN   1 1 
        859 1 2 1 1 38 MET QG   . 38 MET  QG   1 1 
        860 1 1 1 1 38 MET H    . 38 MET  HN   1 1 
        860 1 2 1 1 39 VAL H    . 39 VAL  HN   1 1 
        861 1 1 1 1 38 MET H    . 38 MET  HN   1 1 
        861 1 2 1 1 39 VAL QG   . 39 VAL  QG1  1 1 
        862 1 1 1 1 38 MET H    . 38 MET  HN   1 1 
        862 1 2 1 1 40 GLU H    . 40 GLU- HN   1 1 
        863 1 1 1 1 38 MET H    . 38 MET  HN   1 1 
        863 1 2 1 1 41 ILE H    . 41 ILE  HN   1 1 
        864 1 1 1 1 38 MET H    . 38 MET  HN   1 1 
        864 1 2 1 1 41 ILE MD   . 41 ILE  QD1  1 1 
        865 1 1 1 1 38 MET HA   . 38 MET  HA   1 1 
        865 1 2 1 1 38 MET ME   . 38 MET  QE   1 1 
        866 1 1 1 1 38 MET HA   . 38 MET  HA   1 1 
        866 1 2 1 1 38 MET QG   . 38 MET  QG   1 1 
        867 1 1 1 1 38 MET HA   . 38 MET  HA   1 1 
        867 1 2 1 1 41 ILE H    . 41 ILE  HN   1 1 
        868 1 1 1 1 38 MET HA   . 38 MET  HA   1 1 
        868 1 2 1 1 41 ILE MD   . 41 ILE  QD1  1 1 
        869 1 1 1 1 38 MET HA   . 38 MET  HA   1 1 
        869 1 2 1 1 41 ILE HG12 . 41 ILE  HG13 1 1 
        870 1 1 1 1 38 MET HA   . 38 MET  HA   1 1 
        870 1 2 1 1 41 ILE MG   . 41 ILE  QG2  1 1 
        871 1 1 1 1 38 MET HA   . 38 MET  HA   1 1 
        871 1 2 1 1 42 GLY H    . 42 GLY  HN   1 1 
        872 1 1 1 1 38 MET HB2  . 38 MET  HB2  1 1 
        872 1 2 1 1 39 VAL H    . 39 VAL  HN   1 1 
        873 1 1 1 1 38 MET HB2  . 38 MET  HB2  1 1 
        873 1 2 1 1 41 ILE MD   . 41 ILE  QD1  1 1 
        874 1 1 1 1 38 MET ME   . 38 MET  QE   1 1 
        874 1 2 1 1 38 MET QG   . 38 MET  QG   1 1 
        875 1 1 1 1 38 MET ME   . 38 MET  QE   1 1 
        875 1 2 1 1 39 VAL H    . 39 VAL  HN   1 1 
        876 1 1 1 1 38 MET ME   . 38 MET  QE   1 1 
        876 1 2 1 1 41 ILE H    . 41 ILE  HN   1 1 
        877 1 1 1 1 38 MET ME   . 38 MET  QE   1 1 
        877 1 2 1 1 41 ILE MD   . 41 ILE  QD1  1 1 
        878 1 1 1 1 38 MET ME   . 38 MET  QE   1 1 
        878 1 2 1 1 41 ILE MG   . 41 ILE  QG2  1 1 
        879 1 1 1 1 38 MET QG   . 38 MET  QG   1 1 
        879 1 2 1 1 39 VAL H    . 39 VAL  HN   1 1 
        880 1 1 1 1 38 MET QG   . 38 MET  QG   1 1 
        880 1 2 1 1 39 VAL QG   . 39 VAL  QG1  1 1 
        881 1 1 1 1 38 MET QG   . 38 MET  QG   1 1 
        881 1 2 1 1 41 ILE MD   . 41 ILE  QD1  1 1 
        882 1 1 1 1 39 VAL H    . 39 VAL  HN   1 1 
        882 1 2 1 1 39 VAL HB   . 39 VAL  HB   1 1 
        883 1 1 1 1 39 VAL H    . 39 VAL  HN   1 1 
        883 1 2 1 1 39 VAL QG   . 39 VAL  QG1  1 1 
        884 1 1 1 1 39 VAL H    . 39 VAL  HN   1 1 
        884 1 2 1 1 40 GLU H    . 40 GLU- HN   1 1 
        885 1 1 1 1 39 VAL H    . 39 VAL  HN   1 1 
        885 1 2 1 1 41 ILE H    . 41 ILE  HN   1 1 
        886 1 1 1 1 39 VAL H    . 39 VAL  HN   1 1 
        886 1 2 1 1 41 ILE HB   . 41 ILE  HB   1 1 
        887 1 1 1 1 39 VAL H    . 39 VAL  HN   1 1 
        887 1 2 1 1 41 ILE MD   . 41 ILE  QD1  1 1 
        888 1 1 1 1 39 VAL H    . 39 VAL  HN   1 1 
        888 1 2 1 1 42 GLY H    . 42 GLY  HN   1 1 
        889 1 1 1 1 39 VAL HA   . 39 VAL  HA   1 1 
        889 1 2 1 1 39 VAL QG   . 39 VAL  QG2  1 1 
        890 1 1 1 1 39 VAL HA   . 39 VAL  HA   1 1 
        890 1 2 1 1 40 GLU HA   . 40 GLU- HA   1 1 
        891 1 1 1 1 39 VAL HA   . 39 VAL  HA   1 1 
        891 1 2 1 1 41 ILE H    . 41 ILE  HN   1 1 
        892 1 1 1 1 39 VAL HA   . 39 VAL  HA   1 1 
        892 1 2 1 1 41 ILE HB   . 41 ILE  HB   1 1 
        893 1 1 1 1 39 VAL HA   . 39 VAL  HA   1 1 
        893 1 2 1 1 42 GLY H    . 42 GLY  HN   1 1 
        894 1 1 1 1 39 VAL HA   . 39 VAL  HA   1 1 
        894 1 2 1 1 42 GLY HA3  . 42 GLY  HA2  1 1 
        895 1 1 1 1 39 VAL HA   . 39 VAL  HA   1 1 
        895 1 2 1 1 43 SER H    . 43 SER  HN   1 1 
        896 1 1 1 1 39 VAL QG   . 39 VAL  QG1  1 1 
        896 1 2 1 1 40 GLU H    . 40 GLU- HN   1 1 
        897 1 1 1 1 39 VAL QG   . 39 VAL  QG1  1 1 
        897 1 2 1 1 40 GLU HA   . 40 GLU- HA   1 1 
        898 1 1 1 1 39 VAL QG   . 39 VAL  QG2  1 1 
        898 1 2 1 1 43 SER H    . 43 SER  HN   1 1 
        899 1 1 1 1 39 VAL QG   . 39 VAL  QG2  1 1 
        899 1 2 1 1 43 SER QB   . 43 SER  QB   1 1 
        900 1 1 1 1 40 GLU H    . 40 GLU- HN   1 1 
        900 1 2 1 1 40 GLU HB2  . 40 GLU- HB3  1 1 
        901 1 1 1 1 40 GLU H    . 40 GLU- HN   1 1 
        901 1 2 1 1 40 GLU HB3  . 40 GLU- HB2  1 1 
        902 1 1 1 1 40 GLU H    . 40 GLU- HN   1 1 
        902 1 2 1 1 40 GLU HG2  . 40 GLU- HG2  1 1 
        903 1 1 1 1 40 GLU H    . 40 GLU- HN   1 1 
        903 1 2 1 1 40 GLU HG3  . 40 GLU- HG3  1 1 
        904 1 1 1 1 40 GLU H    . 40 GLU- HN   1 1 
        904 1 2 1 1 41 ILE H    . 41 ILE  HN   1 1 
        905 1 1 1 1 40 GLU H    . 40 GLU- HN   1 1 
        905 1 2 1 1 41 ILE HA   . 41 ILE  HA   1 1 
        906 1 1 1 1 40 GLU H    . 40 GLU- HN   1 1 
        906 1 2 1 1 41 ILE HB   . 41 ILE  HB   1 1 
        907 1 1 1 1 40 GLU H    . 40 GLU- HN   1 1 
        907 1 2 1 1 41 ILE MD   . 41 ILE  QD1  1 1 
        908 1 1 1 1 40 GLU H    . 40 GLU- HN   1 1 
        908 1 2 1 1 42 GLY H    . 42 GLY  HN   1 1 
        909 1 1 1 1 40 GLU H    . 40 GLU- HN   1 1 
        909 1 2 1 1 43 SER H    . 43 SER  HN   1 1 
        910 1 1 1 1 40 GLU HA   . 40 GLU- HA   1 1 
        910 1 2 1 1 40 GLU HG2  . 40 GLU- HG2  1 1 
        911 1 1 1 1 40 GLU HA   . 40 GLU- HA   1 1 
        911 1 2 1 1 40 GLU HG3  . 40 GLU- HG3  1 1 
        912 1 1 1 1 40 GLU HA   . 40 GLU- HA   1 1 
        912 1 2 1 1 41 ILE HA   . 41 ILE  HA   1 1 
        913 1 1 1 1 40 GLU HA   . 40 GLU- HA   1 1 
        913 1 2 1 1 42 GLY H    . 42 GLY  HN   1 1 
        914 1 1 1 1 40 GLU HA   . 40 GLU- HA   1 1 
        914 1 2 1 1 43 SER H    . 43 SER  HN   1 1 
        915 1 1 1 1 40 GLU HA   . 40 GLU- HA   1 1 
        915 1 2 1 1 43 SER QB   . 43 SER  QB   1 1 
        916 1 1 1 1 40 GLU HB2  . 40 GLU- HB3  1 1 
        916 1 2 1 1 41 ILE H    . 41 ILE  HN   1 1 
        917 1 1 1 1 40 GLU HB2  . 40 GLU- HB3  1 1 
        917 1 2 1 1 41 ILE HA   . 41 ILE  HA   1 1 
        918 1 1 1 1 40 GLU HB3  . 40 GLU- HB2  1 1 
        918 1 2 1 1 41 ILE H    . 41 ILE  HN   1 1 
        919 1 1 1 1 40 GLU HB3  . 40 GLU- HB2  1 1 
        919 1 2 1 1 41 ILE MD   . 41 ILE  QD1  1 1 
        920 1 1 1 1 40 GLU HB3  . 40 GLU- HB2  1 1 
        920 1 2 1 1 42 GLY H    . 42 GLY  HN   1 1 
        921 1 1 1 1 40 GLU HG3  . 40 GLU- HG3  1 1 
        921 1 2 1 1 41 ILE H    . 41 ILE  HN   1 1 
        922 1 1 1 1 40 GLU HG3  . 40 GLU- HG3  1 1 
        922 1 2 1 1 43 SER QB   . 43 SER  QB   1 1 
        923 1 1 1 1 40 GLU HG3  . 40 GLU- HG3  1 1 
        923 1 2 1 1 44 ARG HD2  . 44 ARG+ HD2  1 1 
        924 1 1 1 1 41 ILE H    . 41 ILE  HN   1 1 
        924 1 2 1 1 41 ILE HB   . 41 ILE  HB   1 1 
        925 1 1 1 1 41 ILE H    . 41 ILE  HN   1 1 
        925 1 2 1 1 41 ILE MD   . 41 ILE  QD1  1 1 
        926 1 1 1 1 41 ILE H    . 41 ILE  HN   1 1 
        926 1 2 1 1 41 ILE HG12 . 41 ILE  HG13 1 1 
        927 1 1 1 1 41 ILE H    . 41 ILE  HN   1 1 
        927 1 2 1 1 41 ILE HG13 . 41 ILE  HG12 1 1 
        928 1 1 1 1 41 ILE H    . 41 ILE  HN   1 1 
        928 1 2 1 1 41 ILE MG   . 41 ILE  QG2  1 1 
        929 1 1 1 1 41 ILE H    . 41 ILE  HN   1 1 
        929 1 2 1 1 42 GLY H    . 42 GLY  HN   1 1 
        930 1 1 1 1 41 ILE H    . 41 ILE  HN   1 1 
        930 1 2 1 1 42 GLY HA3  . 42 GLY  HA2  1 1 
        931 1 1 1 1 41 ILE H    . 41 ILE  HN   1 1 
        931 1 2 1 1 43 SER H    . 43 SER  HN   1 1 
        932 1 1 1 1 41 ILE H    . 41 ILE  HN   1 1 
        932 1 2 1 1 44 ARG H    . 44 ARG+ HN   1 1 
        933 1 1 1 1 41 ILE HA   . 41 ILE  HA   1 1 
        933 1 2 1 1 41 ILE MD   . 41 ILE  QD1  1 1 
        934 1 1 1 1 41 ILE HA   . 41 ILE  HA   1 1 
        934 1 2 1 1 41 ILE HG12 . 41 ILE  HG13 1 1 
        935 1 1 1 1 41 ILE HA   . 41 ILE  HA   1 1 
        935 1 2 1 1 41 ILE HG13 . 41 ILE  HG12 1 1 
        936 1 1 1 1 41 ILE HA   . 41 ILE  HA   1 1 
        936 1 2 1 1 41 ILE MG   . 41 ILE  QG2  1 1 
        937 1 1 1 1 41 ILE HA   . 41 ILE  HA   1 1 
        937 1 2 1 1 43 SER H    . 43 SER  HN   1 1 
        938 1 1 1 1 41 ILE HA   . 41 ILE  HA   1 1 
        938 1 2 1 1 44 ARG H    . 44 ARG+ HN   1 1 
        939 1 1 1 1 41 ILE HA   . 41 ILE  HA   1 1 
        939 1 2 1 1 44 ARG HB2  . 44 ARG+ HB2  1 1 
        940 1 1 1 1 41 ILE HA   . 41 ILE  HA   1 1 
        940 1 2 1 1 44 ARG HB3  . 44 ARG+ HB3  1 1 
        941 1 1 1 1 41 ILE HA   . 41 ILE  HA   1 1 
        941 1 2 1 1 44 ARG HD2  . 44 ARG+ HD2  1 1 
        942 1 1 1 1 41 ILE HA   . 41 ILE  HA   1 1 
        942 1 2 1 1 44 ARG HD3  . 44 ARG+ HD3  1 1 
        943 1 1 1 1 41 ILE HA   . 41 ILE  HA   1 1 
        943 1 2 1 1 45 TRP H    . 45 TRP  HN   1 1 
        944 1 1 1 1 41 ILE HB   . 41 ILE  HB   1 1 
        944 1 2 1 1 41 ILE MD   . 41 ILE  QD1  1 1 
        945 1 1 1 1 41 ILE HB   . 41 ILE  HB   1 1 
        945 1 2 1 1 42 GLY H    . 42 GLY  HN   1 1 
        946 1 1 1 1 41 ILE HB   . 41 ILE  HB   1 1 
        946 1 2 1 1 42 GLY HA2  . 42 GLY  HA1  1 1 
        947 1 1 1 1 41 ILE HB   . 41 ILE  HB   1 1 
        947 1 2 1 1 43 SER H    . 43 SER  HN   1 1 
        948 1 1 1 1 41 ILE MD   . 41 ILE  QD1  1 1 
        948 1 2 1 1 41 ILE MG   . 41 ILE  QG2  1 1 
        949 1 1 1 1 41 ILE MD   . 41 ILE  QD1  1 1 
        949 1 2 1 1 42 GLY H    . 42 GLY  HN   1 1 
        950 1 1 1 1 41 ILE MG   . 41 ILE  QG2  1 1 
        950 1 2 1 1 42 GLY H    . 42 GLY  HN   1 1 
        951 1 1 1 1 41 ILE MG   . 41 ILE  QG2  1 1 
        951 1 2 1 1 42 GLY HA2  . 42 GLY  HA1  1 1 
        952 1 1 1 1 41 ILE MG   . 41 ILE  QG2  1 1 
        952 1 2 1 1 43 SER H    . 43 SER  HN   1 1 
        953 1 1 1 1 41 ILE MG   . 41 ILE  QG2  1 1 
        953 1 2 1 1 44 ARG H    . 44 ARG+ HN   1 1 
        954 1 1 1 1 41 ILE MG   . 41 ILE  QG2  1 1 
        954 1 2 1 1 44 ARG HD3  . 44 ARG+ HD3  1 1 
        955 1 1 1 1 41 ILE MG   . 41 ILE  QG2  1 1 
        955 1 2 1 1 45 TRP H    . 45 TRP  HN   1 1 
        956 1 1 1 1 41 ILE MG   . 41 ILE  QG2  1 1 
        956 1 2 1 1 45 TRP HB2  . 45 TRP  HB3  1 1 
        957 1 1 1 1 41 ILE MG   . 41 ILE  QG2  1 1 
        957 1 2 1 1 45 TRP HB3  . 45 TRP  HB2  1 1 
        958 1 1 1 1 41 ILE MG   . 41 ILE  QG2  1 1 
        958 1 2 1 1 45 TRP HE3  . 45 TRP  HE3  1 1 
        959 1 1 1 1 42 GLY H    . 42 GLY  HN   1 1 
        959 1 2 1 1 43 SER H    . 43 SER  HN   1 1 
        960 1 1 1 1 42 GLY H    . 42 GLY  HN   1 1 
        960 1 2 1 1 43 SER QB   . 43 SER  QB   1 1 
        961 1 1 1 1 42 GLY H    . 42 GLY  HN   1 1 
        961 1 2 1 1 44 ARG H    . 44 ARG+ HN   1 1 
        962 1 1 1 1 42 GLY HA2  . 42 GLY  HA1  1 1 
        962 1 2 1 1 45 TRP H    . 45 TRP  HN   1 1 
        963 1 1 1 1 42 GLY HA2  . 42 GLY  HA1  1 1 
        963 1 2 1 1 45 TRP HB2  . 45 TRP  HB3  1 1 
        964 1 1 1 1 42 GLY HA2  . 42 GLY  HA1  1 1 
        964 1 2 1 1 45 TRP HB3  . 45 TRP  HB2  1 1 
        965 1 1 1 1 42 GLY HA2  . 42 GLY  HA1  1 1 
        965 1 2 1 1 45 TRP HD1  . 45 TRP  HD1  1 1 
        966 1 1 1 1 43 SER H    . 43 SER  HN   1 1 
        966 1 2 1 1 43 SER QB   . 43 SER  QB   1 1 
        967 1 1 1 1 43 SER H    . 43 SER  HN   1 1 
        967 1 2 1 1 44 ARG H    . 44 ARG+ HN   1 1 
        968 1 1 1 1 43 SER HA   . 43 SER  HA   1 1 
        968 1 2 1 1 45 TRP H    . 45 TRP  HN   1 1 
        969 1 1 1 1 43 SER HA   . 43 SER  HA   1 1 
        969 1 2 1 1 46 GLN H    . 46 GLN  HN   1 1 
        970 1 1 1 1 43 SER HA   . 43 SER  HA   1 1 
        970 1 2 1 1 46 GLN HA   . 46 GLN  HA   1 1 
        971 1 1 1 1 43 SER HA   . 43 SER  HA   1 1 
        971 1 2 1 1 46 GLN QB   . 46 GLN  QB   1 1 
        972 1 1 1 1 43 SER HA   . 43 SER  HA   1 1 
        972 1 2 1 1 46 GLN HG3  . 46 GLN  HG2  1 1 
        973 1 1 1 1 43 SER QB   . 43 SER  QB   1 1 
        973 1 2 1 1 44 ARG H    . 44 ARG+ HN   1 1 
        974 1 1 1 1 43 SER QB   . 43 SER  QB   1 1 
        974 1 2 1 1 44 ARG HB2  . 44 ARG+ HB2  1 1 
        975 1 1 1 1 43 SER QB   . 43 SER  QB   1 1 
        975 1 2 1 1 44 ARG QG   . 44 ARG+ HG2  1 1 
        976 1 1 1 1 44 ARG H    . 44 ARG+ HN   1 1 
        976 1 2 1 1 44 ARG HB2  . 44 ARG+ HB2  1 1 
        977 1 1 1 1 44 ARG H    . 44 ARG+ HN   1 1 
        977 1 2 1 1 44 ARG HB3  . 44 ARG+ HB3  1 1 
        978 1 1 1 1 44 ARG H    . 44 ARG+ HN   1 1 
        978 1 2 1 1 44 ARG HD2  . 44 ARG+ HD2  1 1 
        979 1 1 1 1 44 ARG H    . 44 ARG+ HN   1 1 
        979 1 2 1 1 44 ARG HD3  . 44 ARG+ HD3  1 1 
        980 1 1 1 1 44 ARG H    . 44 ARG+ HN   1 1 
        980 1 2 1 1 44 ARG QG   . 44 ARG+ HG2  1 1 
        981 1 1 1 1 44 ARG H    . 44 ARG+ HN   1 1 
        981 1 2 1 1 45 TRP HA   . 45 TRP  HA   1 1 
        982 1 1 1 1 44 ARG HA   . 44 ARG+ HA   1 1 
        982 1 2 1 1 44 ARG HD2  . 44 ARG+ HD2  1 1 
        983 1 1 1 1 44 ARG HA   . 44 ARG+ HA   1 1 
        983 1 2 1 1 44 ARG HD3  . 44 ARG+ HD3  1 1 
        984 1 1 1 1 44 ARG HA   . 44 ARG+ HA   1 1 
        984 1 2 1 1 44 ARG QG   . 44 ARG+ HG3  1 1 
        985 1 1 1 1 44 ARG HA   . 44 ARG+ HA   1 1 
        985 1 2 1 1 46 GLN H    . 46 GLN  HN   1 1 
        986 1 1 1 1 44 ARG HA   . 44 ARG+ HA   1 1 
        986 1 2 1 1 47 ARG H    . 47 ARG+ HN   1 1 
        987 1 1 1 1 44 ARG HA   . 44 ARG+ HA   1 1 
        987 1 2 1 1 47 ARG HD2  . 47 ARG+ HD2  1 1 
        988 1 1 1 1 44 ARG HA   . 44 ARG+ HA   1 1 
        988 1 2 1 1 47 ARG HD3  . 47 ARG+ HD3  1 1 
        989 1 1 1 1 44 ARG HB2  . 44 ARG+ HB2  1 1 
        989 1 2 1 1 44 ARG HD2  . 44 ARG+ HD2  1 1 
        990 1 1 1 1 44 ARG HB2  . 44 ARG+ HB2  1 1 
        990 1 2 1 1 44 ARG HD3  . 44 ARG+ HD3  1 1 
        991 1 1 1 1 44 ARG HB2  . 44 ARG+ HB2  1 1 
        991 1 2 1 1 45 TRP H    . 45 TRP  HN   1 1 
        992 1 1 1 1 44 ARG HB3  . 44 ARG+ HB3  1 1 
        992 1 2 1 1 44 ARG HD3  . 44 ARG+ HD3  1 1 
        993 1 1 1 1 44 ARG HB3  . 44 ARG+ HB3  1 1 
        993 1 2 1 1 45 TRP H    . 45 TRP  HN   1 1 
        994 1 1 1 1 44 ARG QG   . 44 ARG+ HG2  1 1 
        994 1 2 1 1 47 ARG HD3  . 47 ARG+ HD3  1 1 
        995 1 1 1 1 45 TRP H    . 45 TRP  HN   1 1 
        995 1 2 1 1 45 TRP HB2  . 45 TRP  HB3  1 1 
        996 1 1 1 1 45 TRP H    . 45 TRP  HN   1 1 
        996 1 2 1 1 45 TRP HB3  . 45 TRP  HB2  1 1 
        997 1 1 1 1 45 TRP H    . 45 TRP  HN   1 1 
        997 1 2 1 1 45 TRP HD1  . 45 TRP  HD1  1 1 
        998 1 1 1 1 45 TRP H    . 45 TRP  HN   1 1 
        998 1 2 1 1 45 TRP HE3  . 45 TRP  HE3  1 1 
        999 1 1 1 1 45 TRP H    . 45 TRP  HN   1 1 
        999 1 2 1 1 46 GLN H    . 46 GLN  HN   1 1 
       1000 1 1 1 1 45 TRP H    . 45 TRP  HN   1 1 
       1000 1 2 1 1 46 GLN QB   . 46 GLN  QB   1 1 
       1001 1 1 1 1 45 TRP H    . 45 TRP  HN   1 1 
       1001 1 2 1 1 47 ARG H    . 47 ARG+ HN   1 1 
       1002 1 1 1 1 45 TRP HA   . 45 TRP  HA   1 1 
       1002 1 2 1 1 45 TRP HE3  . 45 TRP  HE3  1 1 
       1003 1 1 1 1 45 TRP HA   . 45 TRP  HA   1 1 
       1003 1 2 1 1 48 ILE H    . 48 ILE  HN   1 1 
       1004 1 1 1 1 45 TRP HA   . 45 TRP  HA   1 1 
       1004 1 2 1 1 48 ILE MD   . 48 ILE  QD1  1 1 
       1005 1 1 1 1 45 TRP HA   . 45 TRP  HA   1 1 
       1005 1 2 1 1 48 ILE HG12 . 48 ILE  HG12 1 1 
       1006 1 1 1 1 45 TRP HA   . 45 TRP  HA   1 1 
       1006 1 2 1 1 48 ILE MG   . 48 ILE  QG2  1 1 
       1007 1 1 1 1 45 TRP HB2  . 45 TRP  HB3  1 1 
       1007 1 2 1 1 45 TRP HD1  . 45 TRP  HD1  1 1 
       1008 1 1 1 1 45 TRP HB2  . 45 TRP  HB3  1 1 
       1008 1 2 1 1 46 GLN H    . 46 GLN  HN   1 1 
       1009 1 1 1 1 45 TRP HB2  . 45 TRP  HB3  1 1 
       1009 1 2 1 1 48 ILE MD   . 48 ILE  QD1  1 1 
       1010 1 1 1 1 45 TRP HB3  . 45 TRP  HB2  1 1 
       1010 1 2 1 1 45 TRP HD1  . 45 TRP  HD1  1 1 
       1011 1 1 1 1 45 TRP HB3  . 45 TRP  HB2  1 1 
       1011 1 2 1 1 45 TRP HE1  . 45 TRP  HE1  1 1 
       1012 1 1 1 1 45 TRP HB3  . 45 TRP  HB2  1 1 
       1012 1 2 1 1 46 GLN H    . 46 GLN  HN   1 1 
       1013 1 1 1 1 45 TRP HB3  . 45 TRP  HB2  1 1 
       1013 1 2 1 1 46 GLN QB   . 46 GLN  QB   1 1 
       1014 1 1 1 1 45 TRP HD1  . 45 TRP  HD1  1 1 
       1014 1 2 1 1 46 GLN H    . 46 GLN  HN   1 1 
       1015 1 1 1 1 45 TRP HD1  . 45 TRP  HD1  1 1 
       1015 1 2 1 1 46 GLN HA   . 46 GLN  HA   1 1 
       1016 1 1 1 1 45 TRP HD1  . 45 TRP  HD1  1 1 
       1016 1 2 1 1 46 GLN QB   . 46 GLN  QB   1 1 
       1017 1 1 1 1 45 TRP HD1  . 45 TRP  HD1  1 1 
       1017 1 2 1 1 46 GLN HG2  . 46 GLN  HG3  1 1 
       1018 1 1 1 1 45 TRP HD1  . 45 TRP  HD1  1 1 
       1018 1 2 1 1 46 GLN HG3  . 46 GLN  HG2  1 1 
       1019 1 1 1 1 45 TRP HD1  . 45 TRP  HD1  1 1 
       1019 1 2 1 1 53 LYS QE   . 53 LYS+ HE2  1 1 
       1020 1 1 1 1 45 TRP HE1  . 45 TRP  HE1  1 1 
       1020 1 2 1 1 46 GLN HA   . 46 GLN  HA   1 1 
       1021 1 1 1 1 45 TRP HE1  . 45 TRP  HE1  1 1 
       1021 1 2 1 1 53 LYS HB3  . 53 LYS+ HB3  1 1 
       1022 1 1 1 1 45 TRP HE1  . 45 TRP  HE1  1 1 
       1022 1 2 1 1 53 LYS QD   . 53 LYS+ QD   1 1 
       1023 1 1 1 1 45 TRP HE1  . 45 TRP  HE1  1 1 
       1023 1 2 1 1 53 LYS QE   . 53 LYS+ HE2  1 1 
       1024 1 1 1 1 45 TRP HE1  . 45 TRP  HE1  1 1 
       1024 1 2 1 1 53 LYS HG2  . 53 LYS+ HG2  1 1 
       1025 1 1 1 1 45 TRP HE3  . 45 TRP  HE3  1 1 
       1025 1 2 1 1 48 ILE MD   . 48 ILE  QD1  1 1 
       1026 1 1 1 1 45 TRP HE3  . 45 TRP  HE3  1 1 
       1026 1 2 1 1 48 ILE MG   . 48 ILE  QG2  1 1 
       1027 1 1 1 1 45 TRP HH2  . 45 TRP  HH2  1 1 
       1027 1 2 1 1 48 ILE MD   . 48 ILE  QD1  1 1 
       1028 1 1 1 1 45 TRP HH2  . 45 TRP  HH2  1 1 
       1028 1 2 1 1 53 LYS H    . 53 LYS+ HN   1 1 
       1029 1 1 1 1 45 TRP HH2  . 45 TRP  HH2  1 1 
       1029 1 2 1 1 53 LYS HA   . 53 LYS+ HA   1 1 
       1030 1 1 1 1 45 TRP HH2  . 45 TRP  HH2  1 1 
       1030 1 2 1 1 53 LYS HB2  . 53 LYS+ HB2  1 1 
       1031 1 1 1 1 45 TRP HH2  . 45 TRP  HH2  1 1 
       1031 1 2 1 1 53 LYS HB3  . 53 LYS+ HB3  1 1 
       1032 1 1 1 1 45 TRP HH2  . 45 TRP  HH2  1 1 
       1032 1 2 1 1 53 LYS QD   . 53 LYS+ QD   1 1 
       1033 1 1 1 1 45 TRP HH2  . 45 TRP  HH2  1 1 
       1033 1 2 1 1 53 LYS QE   . 53 LYS+ HE2  1 1 
       1034 1 1 1 1 45 TRP HH2  . 45 TRP  HH2  1 1 
       1034 1 2 1 1 53 LYS HG2  . 53 LYS+ HG2  1 1 
       1035 1 1 1 1 45 TRP HH2  . 45 TRP  HH2  1 1 
       1035 1 2 1 1 53 LYS HG3  . 53 LYS+ HG3  1 1 
       1036 1 1 1 1 45 TRP HH2  . 45 TRP  HH2  1 1 
       1036 1 2 1 1 56 TYR H    . 56 TYR  HN   1 1 
       1037 1 1 1 1 45 TRP HH2  . 45 TRP  HH2  1 1 
       1037 1 2 1 1 56 TYR HB2  . 56 TYR  HB2  1 1 
       1038 1 1 1 1 45 TRP HH2  . 45 TRP  HH2  1 1 
       1038 1 2 1 1 56 TYR HB3  . 56 TYR  HB3  1 1 
       1039 1 1 1 1 45 TRP HH2  . 45 TRP  HH2  1 1 
       1039 1 2 1 1 56 TYR QD   . 56 TYR  QD   1 1 
       1040 1 1 1 1 45 TRP HH2  . 45 TRP  HH2  1 1 
       1040 1 2 1 1 57 LYS H    . 57 LYS+ HN   1 1 
       1041 1 1 1 1 45 TRP HZ2  . 45 TRP  HZ2  1 1 
       1041 1 2 1 1 53 LYS HA   . 53 LYS+ HA   1 1 
       1042 1 1 1 1 45 TRP HZ2  . 45 TRP  HZ2  1 1 
       1042 1 2 1 1 53 LYS HB2  . 53 LYS+ HB2  1 1 
       1043 1 1 1 1 45 TRP HZ2  . 45 TRP  HZ2  1 1 
       1043 1 2 1 1 53 LYS HB3  . 53 LYS+ HB3  1 1 
       1044 1 1 1 1 45 TRP HZ2  . 45 TRP  HZ2  1 1 
       1044 1 2 1 1 53 LYS QD   . 53 LYS+ QD   1 1 
       1045 1 1 1 1 45 TRP HZ2  . 45 TRP  HZ2  1 1 
       1045 1 2 1 1 53 LYS QE   . 53 LYS+ HE2  1 1 
       1046 1 1 1 1 45 TRP HZ2  . 45 TRP  HZ2  1 1 
       1046 1 2 1 1 53 LYS HG2  . 53 LYS+ HG2  1 1 
       1047 1 1 1 1 45 TRP HZ2  . 45 TRP  HZ2  1 1 
       1047 1 2 1 1 53 LYS HG3  . 53 LYS+ HG3  1 1 
       1048 1 1 1 1 45 TRP HZ3  . 45 TRP  HZ3  1 1 
       1048 1 2 1 1 48 ILE MD   . 48 ILE  QD1  1 1 
       1049 1 1 1 1 45 TRP HZ3  . 45 TRP  HZ3  1 1 
       1049 1 2 1 1 53 LYS HA   . 53 LYS+ HA   1 1 
       1050 1 1 1 1 45 TRP HZ3  . 45 TRP  HZ3  1 1 
       1050 1 2 1 1 56 TYR HB2  . 56 TYR  HB2  1 1 
       1051 1 1 1 1 45 TRP HZ3  . 45 TRP  HZ3  1 1 
       1051 1 2 1 1 56 TYR HB3  . 56 TYR  HB3  1 1 
       1052 1 1 1 1 45 TRP HZ3  . 45 TRP  HZ3  1 1 
       1052 1 2 1 1 56 TYR QD   . 56 TYR  QD   1 1 
       1053 1 1 1 1 45 TRP HZ3  . 45 TRP  HZ3  1 1 
       1053 1 2 1 1 56 TYR QE   . 56 TYR  QE   1 1 
       1054 1 1 1 1 46 GLN H    . 46 GLN  HN   1 1 
       1054 1 2 1 1 46 GLN QB   . 46 GLN  QB   1 1 
       1055 1 1 1 1 46 GLN H    . 46 GLN  HN   1 1 
       1055 1 2 1 1 46 GLN HG2  . 46 GLN  HG3  1 1 
       1056 1 1 1 1 46 GLN H    . 46 GLN  HN   1 1 
       1056 1 2 1 1 46 GLN HG3  . 46 GLN  HG2  1 1 
       1057 1 1 1 1 46 GLN H    . 46 GLN  HN   1 1 
       1057 1 2 1 1 47 ARG H    . 47 ARG+ HN   1 1 
       1058 1 1 1 1 46 GLN H    . 46 GLN  HN   1 1 
       1058 1 2 1 1 47 ARG HA   . 47 ARG+ HA   1 1 
       1059 1 1 1 1 46 GLN H    . 46 GLN  HN   1 1 
       1059 1 2 1 1 47 ARG HG3  . 47 ARG+ HG2  1 1 
       1060 1 1 1 1 46 GLN H    . 46 GLN  HN   1 1 
       1060 1 2 1 1 48 ILE H    . 48 ILE  HN   1 1 
       1061 1 1 1 1 46 GLN HA   . 46 GLN  HA   1 1 
       1061 1 2 1 1 46 GLN HG2  . 46 GLN  HG3  1 1 
       1062 1 1 1 1 46 GLN HA   . 46 GLN  HA   1 1 
       1062 1 2 1 1 46 GLN HG3  . 46 GLN  HG2  1 1 
       1063 1 1 1 1 46 GLN HA   . 46 GLN  HA   1 1 
       1063 1 2 1 1 53 LYS QE   . 53 LYS+ HE2  1 1 
       1064 1 1 1 1 46 GLN QB   . 46 GLN  QB   1 1 
       1064 1 2 1 1 47 ARG H    . 47 ARG+ HN   1 1 
       1065 1 1 1 1 46 GLN QB   . 46 GLN  QB   1 1 
       1065 1 2 1 1 47 ARG HA   . 47 ARG+ HA   1 1 
       1066 1 1 1 1 46 GLN QB   . 46 GLN  QB   1 1 
       1066 1 2 1 1 47 ARG HG3  . 47 ARG+ HG2  1 1 
       1067 1 1 1 1 46 GLN HG2  . 46 GLN  HG3  1 1 
       1067 1 2 1 1 47 ARG H    . 47 ARG+ HN   1 1 
       1068 1 1 1 1 47 ARG H    . 47 ARG+ HN   1 1 
       1068 1 2 1 1 47 ARG HB2  . 47 ARG+ HB2  1 1 
       1069 1 1 1 1 47 ARG H    . 47 ARG+ HN   1 1 
       1069 1 2 1 1 47 ARG HB3  . 47 ARG+ HB3  1 1 
       1070 1 1 1 1 47 ARG H    . 47 ARG+ HN   1 1 
       1070 1 2 1 1 47 ARG HD2  . 47 ARG+ HD2  1 1 
       1071 1 1 1 1 47 ARG H    . 47 ARG+ HN   1 1 
       1071 1 2 1 1 47 ARG HD3  . 47 ARG+ HD3  1 1 
       1072 1 1 1 1 47 ARG H    . 47 ARG+ HN   1 1 
       1072 1 2 1 1 47 ARG HG2  . 47 ARG+ HG3  1 1 
       1073 1 1 1 1 47 ARG H    . 47 ARG+ HN   1 1 
       1073 1 2 1 1 47 ARG HG3  . 47 ARG+ HG2  1 1 
       1074 1 1 1 1 47 ARG H    . 47 ARG+ HN   1 1 
       1074 1 2 1 1 48 ILE H    . 48 ILE  HN   1 1 
       1075 1 1 1 1 47 ARG H    . 47 ARG+ HN   1 1 
       1075 1 2 1 1 48 ILE HA   . 48 ILE  HA   1 1 
       1076 1 1 1 1 47 ARG H    . 47 ARG+ HN   1 1 
       1076 1 2 1 1 48 ILE HG12 . 48 ILE  HG12 1 1 
       1077 1 1 1 1 47 ARG H    . 47 ARG+ HN   1 1 
       1077 1 2 1 1 48 ILE MG   . 48 ILE  QG2  1 1 
       1078 1 1 1 1 47 ARG HA   . 47 ARG+ HA   1 1 
       1078 1 2 1 1 47 ARG HD3  . 47 ARG+ HD3  1 1 
       1079 1 1 1 1 47 ARG HA   . 47 ARG+ HA   1 1 
       1079 1 2 1 1 47 ARG HG2  . 47 ARG+ HG3  1 1 
       1080 1 1 1 1 47 ARG HA   . 47 ARG+ HA   1 1 
       1080 1 2 1 1 47 ARG HG3  . 47 ARG+ HG2  1 1 
       1081 1 1 1 1 47 ARG HB2  . 47 ARG+ HB2  1 1 
       1081 1 2 1 1 47 ARG HD3  . 47 ARG+ HD3  1 1 
       1082 1 1 1 1 47 ARG HB2  . 47 ARG+ HB2  1 1 
       1082 1 2 1 1 48 ILE H    . 48 ILE  HN   1 1 
       1083 1 1 1 1 47 ARG HB2  . 47 ARG+ HB2  1 1 
       1083 1 2 1 1 48 ILE MG   . 48 ILE  QG2  1 1 
       1084 1 1 1 1 47 ARG HB3  . 47 ARG+ HB3  1 1 
       1084 1 2 1 1 47 ARG HD3  . 47 ARG+ HD3  1 1 
       1085 1 1 1 1 47 ARG HB3  . 47 ARG+ HB3  1 1 
       1085 1 2 1 1 48 ILE H    . 48 ILE  HN   1 1 
       1086 1 1 1 1 47 ARG HD3  . 47 ARG+ HD3  1 1 
       1086 1 2 1 1 47 ARG HG3  . 47 ARG+ HG2  1 1 
       1087 1 1 1 1 47 ARG HG2  . 47 ARG+ HG3  1 1 
       1087 1 2 1 1 48 ILE H    . 48 ILE  HN   1 1 
       1088 1 1 1 1 48 ILE H    . 48 ILE  HN   1 1 
       1088 1 2 1 1 48 ILE HB   . 48 ILE  HB   1 1 
       1089 1 1 1 1 48 ILE H    . 48 ILE  HN   1 1 
       1089 1 2 1 1 48 ILE MD   . 48 ILE  QD1  1 1 
       1090 1 1 1 1 48 ILE H    . 48 ILE  HN   1 1 
       1090 1 2 1 1 48 ILE HG12 . 48 ILE  HG12 1 1 
       1091 1 1 1 1 48 ILE H    . 48 ILE  HN   1 1 
       1091 1 2 1 1 48 ILE HG13 . 48 ILE  HG13 1 1 
       1092 1 1 1 1 48 ILE H    . 48 ILE  HN   1 1 
       1092 1 2 1 1 48 ILE MG   . 48 ILE  QG2  1 1 
       1093 1 1 1 1 48 ILE H    . 48 ILE  HN   1 1 
       1093 1 2 1 1 49 SER H    . 49 SER  HN   1 1 
       1094 1 1 1 1 48 ILE HA   . 48 ILE  HA   1 1 
       1094 1 2 1 1 48 ILE MD   . 48 ILE  QD1  1 1 
       1095 1 1 1 1 48 ILE HA   . 48 ILE  HA   1 1 
       1095 1 2 1 1 48 ILE HG13 . 48 ILE  HG13 1 1 
       1096 1 1 1 1 48 ILE HA   . 48 ILE  HA   1 1 
       1096 1 2 1 1 48 ILE MG   . 48 ILE  QG2  1 1 
       1097 1 1 1 1 48 ILE HA   . 48 ILE  HA   1 1 
       1097 1 2 1 1 49 SER H    . 49 SER  HN   1 1 
       1098 1 1 1 1 48 ILE HB   . 48 ILE  HB   1 1 
       1098 1 2 1 1 48 ILE MD   . 48 ILE  QD1  1 1 
       1099 1 1 1 1 48 ILE HB   . 48 ILE  HB   1 1 
       1099 1 2 1 1 49 SER H    . 49 SER  HN   1 1 
       1100 1 1 1 1 48 ILE HB   . 48 ILE  HB   1 1 
       1100 1 2 1 1 52 GLN H    . 52 GLN  HN   1 1 
       1101 1 1 1 1 48 ILE HB   . 48 ILE  HB   1 1 
       1101 1 2 1 1 52 GLN HB2  . 52 GLN  HB3  1 1 
       1102 1 1 1 1 48 ILE HB   . 48 ILE  HB   1 1 
       1102 1 2 1 1 52 GLN HB3  . 52 GLN  HB2  1 1 
       1103 1 1 1 1 48 ILE HB   . 48 ILE  HB   1 1 
       1103 1 2 1 1 52 GLN QG   . 52 GLN  HG2  1 1 
       1104 1 1 1 1 48 ILE MD   . 48 ILE  QD1  1 1 
       1104 1 2 1 1 48 ILE MG   . 48 ILE  QG2  1 1 
       1105 1 1 1 1 48 ILE MD   . 48 ILE  QD1  1 1 
       1105 1 2 1 1 49 SER H    . 49 SER  HN   1 1 
       1106 1 1 1 1 48 ILE MD   . 48 ILE  QD1  1 1 
       1106 1 2 1 1 52 GLN H    . 52 GLN  HN   1 1 
       1107 1 1 1 1 48 ILE MD   . 48 ILE  QD1  1 1 
       1107 1 2 1 1 52 GLN HB2  . 52 GLN  HB3  1 1 
       1108 1 1 1 1 48 ILE MD   . 48 ILE  QD1  1 1 
       1108 1 2 1 1 52 GLN HB3  . 52 GLN  HB2  1 1 
       1109 1 1 1 1 48 ILE MD   . 48 ILE  QD1  1 1 
       1109 1 2 1 1 52 GLN HE21 . 52 GLN  HE21 1 1 
       1110 1 1 1 1 48 ILE MD   . 48 ILE  QD1  1 1 
       1110 1 2 1 1 52 GLN QG   . 52 GLN  HG3  1 1 
       1111 1 1 1 1 48 ILE MD   . 48 ILE  QD1  1 1 
       1111 1 2 1 1 53 LYS H    . 53 LYS+ HN   1 1 
       1112 1 1 1 1 48 ILE MD   . 48 ILE  QD1  1 1 
       1112 1 2 1 1 53 LYS HA   . 53 LYS+ HA   1 1 
       1113 1 1 1 1 48 ILE MD   . 48 ILE  QD1  1 1 
       1113 1 2 1 1 53 LYS HB3  . 53 LYS+ HB3  1 1 
       1114 1 1 1 1 48 ILE MD   . 48 ILE  QD1  1 1 
       1114 1 2 1 1 53 LYS QE   . 53 LYS+ HE3  1 1 
       1115 1 1 1 1 48 ILE MD   . 48 ILE  QD1  1 1 
       1115 1 2 1 1 53 LYS HG3  . 53 LYS+ HG3  1 1 
       1116 1 1 1 1 48 ILE MD   . 48 ILE  QD1  1 1 
       1116 1 2 1 1 56 TYR QD   . 56 TYR  QD   1 1 
       1117 1 1 1 1 48 ILE MD   . 48 ILE  QD1  1 1 
       1117 1 2 1 1 56 TYR QE   . 56 TYR  QE   1 1 
       1118 1 1 1 1 48 ILE HG12 . 48 ILE  HG12 1 1 
       1118 1 2 1 1 48 ILE MG   . 48 ILE  QG2  1 1 
       1119 1 1 1 1 48 ILE HG12 . 48 ILE  HG12 1 1 
       1119 1 2 1 1 49 SER H    . 49 SER  HN   1 1 
       1120 1 1 1 1 48 ILE HG12 . 48 ILE  HG12 1 1 
       1120 1 2 1 1 53 LYS H    . 53 LYS+ HN   1 1 
       1121 1 1 1 1 48 ILE MG   . 48 ILE  QG2  1 1 
       1121 1 2 1 1 49 SER H    . 49 SER  HN   1 1 
       1122 1 1 1 1 48 ILE MG   . 48 ILE  QG2  1 1 
       1122 1 2 1 1 52 GLN H    . 52 GLN  HN   1 1 
       1123 1 1 1 1 48 ILE MG   . 48 ILE  QG2  1 1 
       1123 1 2 1 1 52 GLN HB2  . 52 GLN  HB3  1 1 
       1124 1 1 1 1 48 ILE MG   . 48 ILE  QG2  1 1 
       1124 1 2 1 1 52 GLN HB3  . 52 GLN  HB2  1 1 
       1125 1 1 1 1 48 ILE MG   . 48 ILE  QG2  1 1 
       1125 1 2 1 1 52 GLN HE21 . 52 GLN  HE21 1 1 
       1126 1 1 1 1 48 ILE MG   . 48 ILE  QG2  1 1 
       1126 1 2 1 1 52 GLN HE22 . 52 GLN  HE22 1 1 
       1127 1 1 1 1 48 ILE MG   . 48 ILE  QG2  1 1 
       1127 1 2 1 1 52 GLN QG   . 52 GLN  HG3  1 1 
       1128 1 1 1 1 48 ILE MG   . 48 ILE  QG2  1 1 
       1128 1 2 1 1 56 TYR QD   . 56 TYR  QD   1 1 
       1129 1 1 1 1 48 ILE MG   . 48 ILE  QG2  1 1 
       1129 1 2 1 1 56 TYR QE   . 56 TYR  QE   1 1 
       1130 1 1 1 1 49 SER H    . 49 SER  HN   1 1 
       1130 1 2 1 1 49 SER HB2  . 49 SER  HB2  1 1 
       1131 1 1 1 1 49 SER H    . 49 SER  HN   1 1 
       1131 1 2 1 1 49 SER HB3  . 49 SER  HB3  1 1 
       1132 1 1 1 1 49 SER H    . 49 SER  HN   1 1 
       1132 1 2 1 1 50 GLN H    . 50 GLN  HN   1 1 
       1133 1 1 1 1 49 SER H    . 49 SER  HN   1 1 
       1133 1 2 1 1 52 GLN H    . 52 GLN  HN   1 1 
       1134 1 1 1 1 49 SER H    . 49 SER  HN   1 1 
       1134 1 2 1 1 52 GLN HB2  . 52 GLN  HB3  1 1 
       1135 1 1 1 1 49 SER H    . 49 SER  HN   1 1 
       1135 1 2 1 1 52 GLN HB3  . 52 GLN  HB2  1 1 
       1136 1 1 1 1 49 SER H    . 49 SER  HN   1 1 
       1136 1 2 1 1 52 GLN QG   . 52 GLN  HG2  1 1 
       1137 1 1 1 1 49 SER HA   . 49 SER  HA   1 1 
       1137 1 2 1 1 50 GLN H    . 50 GLN  HN   1 1 
       1138 1 1 1 1 49 SER HA   . 49 SER  HA   1 1 
       1138 1 2 1 1 52 GLN H    . 52 GLN  HN   1 1 
       1139 1 1 1 1 49 SER HB2  . 49 SER  HB2  1 1 
       1139 1 2 1 1 50 GLN H    . 50 GLN  HN   1 1 
       1140 1 1 1 1 49 SER HB2  . 49 SER  HB2  1 1 
       1140 1 2 1 1 51 SER H    . 51 SER  HN   1 1 
       1141 1 1 1 1 49 SER HB3  . 49 SER  HB3  1 1 
       1141 1 2 1 1 50 GLN H    . 50 GLN  HN   1 1 
       1142 1 1 1 1 49 SER HB3  . 49 SER  HB3  1 1 
       1142 1 2 1 1 51 SER H    . 51 SER  HN   1 1 
       1143 1 1 1 1 49 SER HB3  . 49 SER  HB3  1 1 
       1143 1 2 1 1 52 GLN H    . 52 GLN  HN   1 1 
       1144 1 1 1 1 50 GLN H    . 50 GLN  HN   1 1 
       1144 1 2 1 1 50 GLN HB2  . 50 GLN  HB2  1 1 
       1145 1 1 1 1 50 GLN H    . 50 GLN  HN   1 1 
       1145 1 2 1 1 50 GLN HB3  . 50 GLN  HB3  1 1 
       1146 1 1 1 1 50 GLN H    . 50 GLN  HN   1 1 
       1146 1 2 1 1 50 GLN QG   . 50 GLN  QG   1 1 
       1147 1 1 1 1 50 GLN H    . 50 GLN  HN   1 1 
       1147 1 2 1 1 51 SER H    . 51 SER  HN   1 1 
       1148 1 1 1 1 50 GLN H    . 50 GLN  HN   1 1 
       1148 1 2 1 1 52 GLN H    . 52 GLN  HN   1 1 
       1149 1 1 1 1 50 GLN HA   . 50 GLN  HA   1 1 
       1149 1 2 1 1 50 GLN HE21 . 50 GLN  HE21 1 1 
       1150 1 1 1 1 50 GLN HA   . 50 GLN  HA   1 1 
       1150 1 2 1 1 50 GLN HE22 . 50 GLN  HE22 1 1 
       1151 1 1 1 1 50 GLN HA   . 50 GLN  HA   1 1 
       1151 1 2 1 1 50 GLN QG   . 50 GLN  QG   1 1 
       1152 1 1 1 1 50 GLN HA   . 50 GLN  HA   1 1 
       1152 1 2 1 1 53 LYS H    . 53 LYS+ HN   1 1 
       1153 1 1 1 1 50 GLN HA   . 50 GLN  HA   1 1 
       1153 1 2 1 1 53 LYS HB3  . 53 LYS+ HB3  1 1 
       1154 1 1 1 1 50 GLN HA   . 50 GLN  HA   1 1 
       1154 1 2 1 1 53 LYS QD   . 53 LYS+ QD   1 1 
       1155 1 1 1 1 50 GLN HA   . 50 GLN  HA   1 1 
       1155 1 2 1 1 54 GLU H    . 54 GLU- HN   1 1 
       1156 1 1 1 1 50 GLN HB2  . 50 GLN  HB2  1 1 
       1156 1 2 1 1 50 GLN HE22 . 50 GLN  HE22 1 1 
       1157 1 1 1 1 50 GLN HB2  . 50 GLN  HB2  1 1 
       1157 1 2 1 1 51 SER H    . 51 SER  HN   1 1 
       1158 1 1 1 1 50 GLN HB3  . 50 GLN  HB3  1 1 
       1158 1 2 1 1 51 SER H    . 51 SER  HN   1 1 
       1159 1 1 1 1 50 GLN HB3  . 50 GLN  HB3  1 1 
       1159 1 2 1 1 54 GLU H    . 54 GLU- HN   1 1 
       1160 1 1 1 1 50 GLN HE21 . 50 GLN  HE21 1 1 
       1160 1 2 1 1 52 GLN H    . 52 GLN  HN   1 1 
       1161 1 1 1 1 50 GLN HE21 . 50 GLN  HE21 1 1 
       1161 1 2 1 1 54 GLU HG2  . 54 GLU- HG2  1 1 
       1162 1 1 1 1 50 GLN HE21 . 50 GLN  HE21 1 1 
       1162 1 2 1 1 54 GLU HG3  . 54 GLU- HG3  1 1 
       1163 1 1 1 1 50 GLN HE22 . 50 GLN  HE22 1 1 
       1163 1 2 1 1 53 LYS HB2  . 53 LYS+ HB2  1 1 
       1164 1 1 1 1 50 GLN HE22 . 50 GLN  HE22 1 1 
       1164 1 2 1 1 53 LYS QD   . 53 LYS+ QD   1 1 
       1165 1 1 1 1 50 GLN QG   . 50 GLN  QG   1 1 
       1165 1 2 1 1 51 SER H    . 51 SER  HN   1 1 
       1166 1 1 1 1 50 GLN QG   . 50 GLN  QG   1 1 
       1166 1 2 1 1 51 SER HA   . 51 SER  HA   1 1 
       1167 1 1 1 1 50 GLN QG   . 50 GLN  QG   1 1 
       1167 1 2 1 1 51 SER QB   . 51 SER  QB   1 1 
       1168 1 1 1 1 50 GLN QG   . 50 GLN  QG   1 1 
       1168 1 2 1 1 54 GLU H    . 54 GLU- HN   1 1 
       1169 1 1 1 1 51 SER H    . 51 SER  HN   1 1 
       1169 1 2 1 1 51 SER QB   . 51 SER  QB   1 1 
       1170 1 1 1 1 51 SER H    . 51 SER  HN   1 1 
       1170 1 2 1 1 52 GLN H    . 52 GLN  HN   1 1 
       1171 1 1 1 1 51 SER HA   . 51 SER  HA   1 1 
       1171 1 2 1 1 54 GLU H    . 54 GLU- HN   1 1 
       1172 1 1 1 1 51 SER HA   . 51 SER  HA   1 1 
       1172 1 2 1 1 54 GLU HB2  . 54 GLU- HB2  1 1 
       1173 1 1 1 1 51 SER HA   . 51 SER  HA   1 1 
       1173 1 2 1 1 54 GLU HB3  . 54 GLU- HB3  1 1 
       1174 1 1 1 1 51 SER HA   . 51 SER  HA   1 1 
       1174 1 2 1 1 54 GLU HG3  . 54 GLU- HG3  1 1 
       1175 1 1 1 1 51 SER QB   . 51 SER  QB   1 1 
       1175 1 2 1 1 52 GLN H    . 52 GLN  HN   1 1 
       1176 1 1 1 1 51 SER QB   . 51 SER  QB   1 1 
       1176 1 2 1 1 52 GLN HB2  . 52 GLN  HB3  1 1 
       1177 1 1 1 1 52 GLN H    . 52 GLN  HN   1 1 
       1177 1 2 1 1 52 GLN HB2  . 52 GLN  HB3  1 1 
       1178 1 1 1 1 52 GLN H    . 52 GLN  HN   1 1 
       1178 1 2 1 1 52 GLN HB3  . 52 GLN  HB2  1 1 
       1179 1 1 1 1 52 GLN H    . 52 GLN  HN   1 1 
       1179 1 2 1 1 52 GLN QG   . 52 GLN  HG2  1 1 
       1180 1 1 1 1 52 GLN H    . 52 GLN  HN   1 1 
       1180 1 2 1 1 53 LYS H    . 53 LYS+ HN   1 1 
       1181 1 1 1 1 52 GLN H    . 52 GLN  HN   1 1 
       1181 1 2 1 1 54 GLU H    . 54 GLU- HN   1 1 
       1182 1 1 1 1 52 GLN H    . 52 GLN  HN   1 1 
       1182 1 2 1 1 55 HIS HB2  . 55 HIS  HB2  1 1 
       1183 1 1 1 1 52 GLN H    . 52 GLN  HN   1 1 
       1183 1 2 1 1 55 HIS HB3  . 55 HIS  HB3  1 1 
       1184 1 1 1 1 52 GLN HA   . 52 GLN  HA   1 1 
       1184 1 2 1 1 52 GLN HE21 . 52 GLN  HE21 1 1 
       1185 1 1 1 1 52 GLN HA   . 52 GLN  HA   1 1 
       1185 1 2 1 1 52 GLN QG   . 52 GLN  HG2  1 1 
       1186 1 1 1 1 52 GLN HA   . 52 GLN  HA   1 1 
       1186 1 2 1 1 55 HIS H    . 55 HIS  HN   1 1 
       1187 1 1 1 1 52 GLN HA   . 52 GLN  HA   1 1 
       1187 1 2 1 1 55 HIS HB2  . 55 HIS  HB2  1 1 
       1188 1 1 1 1 52 GLN HA   . 52 GLN  HA   1 1 
       1188 1 2 1 1 55 HIS HB3  . 55 HIS  HB3  1 1 
       1189 1 1 1 1 52 GLN HA   . 52 GLN  HA   1 1 
       1189 1 2 1 1 56 TYR H    . 56 TYR  HN   1 1 
       1190 1 1 1 1 52 GLN HB2  . 52 GLN  HB3  1 1 
       1190 1 2 1 1 53 LYS H    . 53 LYS+ HN   1 1 
       1191 1 1 1 1 52 GLN HB2  . 52 GLN  HB3  1 1 
       1191 1 2 1 1 56 TYR QD   . 56 TYR  QD   1 1 
       1192 1 1 1 1 52 GLN HB2  . 52 GLN  HB3  1 1 
       1192 1 2 1 1 56 TYR QE   . 56 TYR  QE   1 1 
       1193 1 1 1 1 52 GLN HB3  . 52 GLN  HB2  1 1 
       1193 1 2 1 1 53 LYS H    . 53 LYS+ HN   1 1 
       1194 1 1 1 1 52 GLN HE21 . 52 GLN  HE21 1 1 
       1194 1 2 1 1 56 TYR QE   . 56 TYR  QE   1 1 
       1195 1 1 1 1 52 GLN QG   . 52 GLN  HG2  1 1 
       1195 1 2 1 1 53 LYS H    . 53 LYS+ HN   1 1 
       1196 1 1 1 1 52 GLN QG   . 52 GLN  HG3  1 1 
       1196 1 2 1 1 56 TYR QD   . 56 TYR  QD   1 1 
       1197 1 1 1 1 52 GLN QG   . 52 GLN  HG3  1 1 
       1197 1 2 1 1 56 TYR QE   . 56 TYR  QE   1 1 
       1198 1 1 1 1 53 LYS H    . 53 LYS+ HN   1 1 
       1198 1 2 1 1 53 LYS HB2  . 53 LYS+ HB2  1 1 
       1199 1 1 1 1 53 LYS H    . 53 LYS+ HN   1 1 
       1199 1 2 1 1 53 LYS HB3  . 53 LYS+ HB3  1 1 
       1200 1 1 1 1 53 LYS H    . 53 LYS+ HN   1 1 
       1200 1 2 1 1 53 LYS QD   . 53 LYS+ QD   1 1 
       1201 1 1 1 1 53 LYS H    . 53 LYS+ HN   1 1 
       1201 1 2 1 1 53 LYS HG2  . 53 LYS+ HG2  1 1 
       1202 1 1 1 1 53 LYS H    . 53 LYS+ HN   1 1 
       1202 1 2 1 1 53 LYS HG3  . 53 LYS+ HG3  1 1 
       1203 1 1 1 1 53 LYS H    . 53 LYS+ HN   1 1 
       1203 1 2 1 1 54 GLU H    . 54 GLU- HN   1 1 
       1204 1 1 1 1 53 LYS H    . 53 LYS+ HN   1 1 
       1204 1 2 1 1 54 GLU HB2  . 54 GLU- HB2  1 1 
       1205 1 1 1 1 53 LYS H    . 53 LYS+ HN   1 1 
       1205 1 2 1 1 55 HIS H    . 55 HIS  HN   1 1 
       1206 1 1 1 1 53 LYS HA   . 53 LYS+ HA   1 1 
       1206 1 2 1 1 53 LYS QD   . 53 LYS+ QD   1 1 
       1207 1 1 1 1 53 LYS HA   . 53 LYS+ HA   1 1 
       1207 1 2 1 1 53 LYS QE   . 53 LYS+ HE2  1 1 
       1208 1 1 1 1 53 LYS HA   . 53 LYS+ HA   1 1 
       1208 1 2 1 1 53 LYS HG2  . 53 LYS+ HG2  1 1 
       1209 1 1 1 1 53 LYS HA   . 53 LYS+ HA   1 1 
       1209 1 2 1 1 53 LYS HG3  . 53 LYS+ HG3  1 1 
       1210 1 1 1 1 53 LYS HA   . 53 LYS+ HA   1 1 
       1210 1 2 1 1 56 TYR H    . 56 TYR  HN   1 1 
       1211 1 1 1 1 53 LYS HA   . 53 LYS+ HA   1 1 
       1211 1 2 1 1 56 TYR HB2  . 56 TYR  HB2  1 1 
       1212 1 1 1 1 53 LYS HA   . 53 LYS+ HA   1 1 
       1212 1 2 1 1 56 TYR HB3  . 56 TYR  HB3  1 1 
       1213 1 1 1 1 53 LYS HA   . 53 LYS+ HA   1 1 
       1213 1 2 1 1 56 TYR QD   . 56 TYR  QD   1 1 
       1214 1 1 1 1 53 LYS HB2  . 53 LYS+ HB2  1 1 
       1214 1 2 1 1 53 LYS QD   . 53 LYS+ QD   1 1 
       1215 1 1 1 1 53 LYS HB2  . 53 LYS+ HB2  1 1 
       1215 1 2 1 1 53 LYS QE   . 53 LYS+ HE2  1 1 
       1216 1 1 1 1 53 LYS HB2  . 53 LYS+ HB2  1 1 
       1216 1 2 1 1 54 GLU H    . 54 GLU- HN   1 1 
       1217 1 1 1 1 53 LYS HB2  . 53 LYS+ HB2  1 1 
       1217 1 2 1 1 54 GLU HG2  . 54 GLU- HG2  1 1 
       1218 1 1 1 1 53 LYS HB3  . 53 LYS+ HB3  1 1 
       1218 1 2 1 1 53 LYS QD   . 53 LYS+ QD   1 1 
       1219 1 1 1 1 53 LYS HB3  . 53 LYS+ HB3  1 1 
       1219 1 2 1 1 54 GLU H    . 54 GLU- HN   1 1 
       1220 1 1 1 1 53 LYS HB3  . 53 LYS+ HB3  1 1 
       1220 1 2 1 1 54 GLU HG2  . 54 GLU- HG2  1 1 
       1221 1 1 1 1 53 LYS QD   . 53 LYS+ QD   1 1 
       1221 1 2 1 1 54 GLU H    . 54 GLU- HN   1 1 
       1222 1 1 1 1 53 LYS HG2  . 53 LYS+ HG2  1 1 
       1222 1 2 1 1 54 GLU H    . 54 GLU- HN   1 1 
       1223 1 1 1 1 53 LYS HG3  . 53 LYS+ HG3  1 1 
       1223 1 2 1 1 54 GLU H    . 54 GLU- HN   1 1 
       1224 1 1 1 1 54 GLU H    . 54 GLU- HN   1 1 
       1224 1 2 1 1 54 GLU HB2  . 54 GLU- HB2  1 1 
       1225 1 1 1 1 54 GLU H    . 54 GLU- HN   1 1 
       1225 1 2 1 1 54 GLU HB3  . 54 GLU- HB3  1 1 
       1226 1 1 1 1 54 GLU H    . 54 GLU- HN   1 1 
       1226 1 2 1 1 54 GLU HG2  . 54 GLU- HG2  1 1 
       1227 1 1 1 1 54 GLU H    . 54 GLU- HN   1 1 
       1227 1 2 1 1 54 GLU HG3  . 54 GLU- HG3  1 1 
       1228 1 1 1 1 54 GLU H    . 54 GLU- HN   1 1 
       1228 1 2 1 1 55 HIS H    . 55 HIS  HN   1 1 
       1229 1 1 1 1 54 GLU H    . 54 GLU- HN   1 1 
       1229 1 2 1 1 55 HIS HA   . 55 HIS  HA   1 1 
       1230 1 1 1 1 54 GLU H    . 54 GLU- HN   1 1 
       1230 1 2 1 1 55 HIS HB2  . 55 HIS  HB2  1 1 
       1231 1 1 1 1 54 GLU H    . 54 GLU- HN   1 1 
       1231 1 2 1 1 55 HIS HB3  . 55 HIS  HB3  1 1 
       1232 1 1 1 1 54 GLU H    . 54 GLU- HN   1 1 
       1232 1 2 1 1 56 TYR H    . 56 TYR  HN   1 1 
       1233 1 1 1 1 54 GLU HA   . 54 GLU- HA   1 1 
       1233 1 2 1 1 54 GLU HG2  . 54 GLU- HG2  1 1 
       1234 1 1 1 1 54 GLU HA   . 54 GLU- HA   1 1 
       1234 1 2 1 1 56 TYR H    . 56 TYR  HN   1 1 
       1235 1 1 1 1 54 GLU HA   . 54 GLU- HA   1 1 
       1235 1 2 1 1 57 LYS H    . 57 LYS+ HN   1 1 
       1236 1 1 1 1 54 GLU HA   . 54 GLU- HA   1 1 
       1236 1 2 1 1 57 LYS HB3  . 57 LYS+ HB3  1 1 
       1237 1 1 1 1 54 GLU HA   . 54 GLU- HA   1 1 
       1237 1 2 1 1 57 LYS QE   . 57 LYS+ QE   1 1 
       1238 1 1 1 1 54 GLU HB2  . 54 GLU- HB2  1 1 
       1238 1 2 1 1 55 HIS H    . 55 HIS  HN   1 1 
       1239 1 1 1 1 55 HIS H    . 55 HIS  HN   1 1 
       1239 1 2 1 1 55 HIS HB2  . 55 HIS  HB2  1 1 
       1240 1 1 1 1 55 HIS H    . 55 HIS  HN   1 1 
       1240 1 2 1 1 55 HIS HB3  . 55 HIS  HB3  1 1 
       1241 1 1 1 1 55 HIS H    . 55 HIS  HN   1 1 
       1241 1 2 1 1 55 HIS HD2  . 55 HIS  HD2  1 1 
       1242 1 1 1 1 55 HIS H    . 55 HIS  HN   1 1 
       1242 1 2 1 1 56 TYR H    . 56 TYR  HN   1 1 
       1243 1 1 1 1 55 HIS H    . 55 HIS  HN   1 1 
       1243 1 2 1 1 56 TYR QD   . 56 TYR  QD   1 1 
       1244 1 1 1 1 55 HIS H    . 55 HIS  HN   1 1 
       1244 1 2 1 1 57 LYS H    . 57 LYS+ HN   1 1 
       1245 1 1 1 1 55 HIS HA   . 55 HIS  HA   1 1 
       1245 1 2 1 1 57 LYS H    . 57 LYS+ HN   1 1 
       1246 1 1 1 1 55 HIS HA   . 55 HIS  HA   1 1 
       1246 1 2 1 1 58 LYS H    . 58 LYS+ HN   1 1 
       1247 1 1 1 1 55 HIS HA   . 55 HIS  HA   1 1 
       1247 1 2 1 1 58 LYS HB2  . 58 LYS+ HB2  1 1 
       1248 1 1 1 1 55 HIS HA   . 55 HIS  HA   1 1 
       1248 1 2 1 1 58 LYS HB3  . 58 LYS+ HB3  1 1 
       1249 1 1 1 1 55 HIS HA   . 55 HIS  HA   1 1 
       1249 1 2 1 1 58 LYS QD   . 58 LYS+ HD3  1 1 
       1250 1 1 1 1 55 HIS HA   . 55 HIS  HA   1 1 
       1250 1 2 1 1 58 LYS HG2  . 58 LYS+ HG2  1 1 
       1251 1 1 1 1 55 HIS HB2  . 55 HIS  HB2  1 1 
       1251 1 2 1 1 56 TYR H    . 56 TYR  HN   1 1 
       1252 1 1 1 1 55 HIS HB3  . 55 HIS  HB3  1 1 
       1252 1 2 1 1 56 TYR H    . 56 TYR  HN   1 1 
       1253 1 1 1 1 55 HIS HD2  . 55 HIS  HD2  1 1 
       1253 1 2 1 1 56 TYR H    . 56 TYR  HN   1 1 
       1254 1 1 1 1 55 HIS HD2  . 55 HIS  HD2  1 1 
       1254 1 2 1 1 56 TYR HA   . 56 TYR  HA   1 1 
       1255 1 1 1 1 55 HIS HD2  . 55 HIS  HD2  1 1 
       1255 1 2 1 1 56 TYR QD   . 56 TYR  QD   1 1 
       1256 1 1 1 1 55 HIS HD2  . 55 HIS  HD2  1 1 
       1256 1 2 1 1 56 TYR QE   . 56 TYR  QE   1 1 
       1257 1 1 1 1 55 HIS HD2  . 55 HIS  HD2  1 1 
       1257 1 2 1 1 59 LEU QD   . 59 LEU  QD2  1 1 
       1258 1 1 1 1 55 HIS HD2  . 55 HIS  HD2  1 1 
       1258 1 2 1 1 59 LEU HG   . 59 LEU  HG   1 1 
       1259 1 1 1 1 55 HIS HE1  . 55 HIS  HE1  1 1 
       1259 1 2 1 1 59 LEU QD   . 59 LEU  QD1  1 1 
       1260 1 1 1 1 55 HIS HE1  . 55 HIS  HE1  1 1 
       1260 1 2 1 1 59 LEU HG   . 59 LEU  HG   1 1 
       1261 1 1 1 1 56 TYR H    . 56 TYR  HN   1 1 
       1261 1 2 1 1 56 TYR HB2  . 56 TYR  HB2  1 1 
       1262 1 1 1 1 56 TYR H    . 56 TYR  HN   1 1 
       1262 1 2 1 1 56 TYR HB3  . 56 TYR  HB3  1 1 
       1263 1 1 1 1 56 TYR H    . 56 TYR  HN   1 1 
       1263 1 2 1 1 56 TYR QD   . 56 TYR  QD   1 1 
       1264 1 1 1 1 56 TYR H    . 56 TYR  HN   1 1 
       1264 1 2 1 1 56 TYR QE   . 56 TYR  QE   1 1 
       1265 1 1 1 1 56 TYR H    . 56 TYR  HN   1 1 
       1265 1 2 1 1 57 LYS H    . 57 LYS+ HN   1 1 
       1266 1 1 1 1 56 TYR H    . 56 TYR  HN   1 1 
       1266 1 2 1 1 57 LYS HB3  . 57 LYS+ HB3  1 1 
       1267 1 1 1 1 56 TYR H    . 56 TYR  HN   1 1 
       1267 1 2 1 1 59 LEU HB2  . 59 LEU  HB2  1 1 
       1268 1 1 1 1 56 TYR H    . 56 TYR  HN   1 1 
       1268 1 2 1 1 59 LEU QD   . 59 LEU  QD2  1 1 
       1269 1 1 1 1 56 TYR H    . 56 TYR  HN   1 1 
       1269 1 2 1 1 59 LEU HG   . 59 LEU  HG   1 1 
       1270 1 1 1 1 56 TYR HA   . 56 TYR  HA   1 1 
       1270 1 2 1 1 56 TYR QD   . 56 TYR  QD   1 1 
       1271 1 1 1 1 56 TYR HA   . 56 TYR  HA   1 1 
       1271 1 2 1 1 56 TYR QE   . 56 TYR  QE   1 1 
       1272 1 1 1 1 56 TYR HA   . 56 TYR  HA   1 1 
       1272 1 2 1 1 59 LEU H    . 59 LEU  HN   1 1 
       1273 1 1 1 1 56 TYR HA   . 56 TYR  HA   1 1 
       1273 1 2 1 1 59 LEU HB2  . 59 LEU  HB2  1 1 
       1274 1 1 1 1 56 TYR HA   . 56 TYR  HA   1 1 
       1274 1 2 1 1 59 LEU HB3  . 59 LEU  HB3  1 1 
       1275 1 1 1 1 56 TYR HA   . 56 TYR  HA   1 1 
       1275 1 2 1 1 59 LEU QD   . 59 LEU  QD1  1 1 
       1276 1 1 1 1 56 TYR HA   . 56 TYR  HA   1 1 
       1276 1 2 1 1 59 LEU HG   . 59 LEU  HG   1 1 
       1277 1 1 1 1 56 TYR HB2  . 56 TYR  HB2  1 1 
       1277 1 2 1 1 57 LYS H    . 57 LYS+ HN   1 1 
       1278 1 1 1 1 56 TYR HB2  . 56 TYR  HB2  1 1 
       1278 1 2 1 1 58 LYS H    . 58 LYS+ HN   1 1 
       1279 1 1 1 1 56 TYR HB3  . 56 TYR  HB3  1 1 
       1279 1 2 1 1 57 LYS H    . 57 LYS+ HN   1 1 
       1280 1 1 1 1 56 TYR HB3  . 56 TYR  HB3  1 1 
       1280 1 2 1 1 60 ALA H    . 60 ALA  HN   1 1 
       1281 1 1 1 1 56 TYR HB3  . 56 TYR  HB3  1 1 
       1281 1 2 1 1 60 ALA MB   . 60 ALA  QB   1 1 
       1282 1 1 1 1 56 TYR QD   . 56 TYR  QD   1 1 
       1282 1 2 1 1 57 LYS H    . 57 LYS+ HN   1 1 
       1283 1 1 1 1 56 TYR QD   . 56 TYR  QD   1 1 
       1283 1 2 1 1 59 LEU QD   . 59 LEU  QD2  1 1 
       1284 1 1 1 1 56 TYR QD   . 56 TYR  QD   1 1 
       1284 1 2 1 1 59 LEU HG   . 59 LEU  HG   1 1 
       1285 1 1 1 1 56 TYR QE   . 56 TYR  QE   1 1 
       1285 1 2 1 1 59 LEU QD   . 59 LEU  QD2  1 1 
       1286 1 1 1 1 57 LYS H    . 57 LYS+ HN   1 1 
       1286 1 2 1 1 57 LYS HB2  . 57 LYS+ HB2  1 1 
       1287 1 1 1 1 57 LYS H    . 57 LYS+ HN   1 1 
       1287 1 2 1 1 57 LYS HB3  . 57 LYS+ HB3  1 1 
       1288 1 1 1 1 57 LYS H    . 57 LYS+ HN   1 1 
       1288 1 2 1 1 57 LYS QE   . 57 LYS+ QE   1 1 
       1289 1 1 1 1 57 LYS H    . 57 LYS+ HN   1 1 
       1289 1 2 1 1 57 LYS HG2  . 57 LYS+ HG2  1 1 
       1290 1 1 1 1 57 LYS H    . 57 LYS+ HN   1 1 
       1290 1 2 1 1 57 LYS HG3  . 57 LYS+ HG3  1 1 
       1291 1 1 1 1 57 LYS HA   . 57 LYS+ HA   1 1 
       1291 1 2 1 1 57 LYS QE   . 57 LYS+ QE   1 1 
       1292 1 1 1 1 57 LYS HA   . 57 LYS+ HA   1 1 
       1292 1 2 1 1 57 LYS HG2  . 57 LYS+ HG2  1 1 
       1293 1 1 1 1 57 LYS HA   . 57 LYS+ HA   1 1 
       1293 1 2 1 1 57 LYS HG3  . 57 LYS+ HG3  1 1 
       1294 1 1 1 1 57 LYS HA   . 57 LYS+ HA   1 1 
       1294 1 2 1 1 60 ALA H    . 60 ALA  HN   1 1 
       1295 1 1 1 1 57 LYS HA   . 57 LYS+ HA   1 1 
       1295 1 2 1 1 60 ALA MB   . 60 ALA  QB   1 1 
       1296 1 1 1 1 57 LYS HB2  . 57 LYS+ HB2  1 1 
       1296 1 2 1 1 57 LYS QE   . 57 LYS+ QE   1 1 
       1297 1 1 1 1 57 LYS HB2  . 57 LYS+ HB2  1 1 
       1297 1 2 1 1 58 LYS H    . 58 LYS+ HN   1 1 
       1298 1 1 1 1 57 LYS HB3  . 57 LYS+ HB3  1 1 
       1298 1 2 1 1 57 LYS QE   . 57 LYS+ QE   1 1 
       1299 1 1 1 1 57 LYS HB3  . 57 LYS+ HB3  1 1 
       1299 1 2 1 1 58 LYS H    . 58 LYS+ HN   1 1 
       1300 1 1 1 1 57 LYS QE   . 57 LYS+ QE   1 1 
       1300 1 2 1 1 57 LYS HG3  . 57 LYS+ HG3  1 1 
       1301 1 1 1 1 57 LYS HG2  . 57 LYS+ HG2  1 1 
       1301 1 2 1 1 61 GLU QG   . 61 GLU- HG2  1 1 
       1302 1 1 1 1 57 LYS HG3  . 57 LYS+ HG3  1 1 
       1302 1 2 1 1 61 GLU QG   . 61 GLU- HG2  1 1 
       1303 1 1 1 1 58 LYS H    . 58 LYS+ HN   1 1 
       1303 1 2 1 1 58 LYS HB2  . 58 LYS+ HB2  1 1 
       1304 1 1 1 1 58 LYS H    . 58 LYS+ HN   1 1 
       1304 1 2 1 1 58 LYS HB3  . 58 LYS+ HB3  1 1 
       1305 1 1 1 1 58 LYS H    . 58 LYS+ HN   1 1 
       1305 1 2 1 1 58 LYS HG2  . 58 LYS+ HG2  1 1 
       1306 1 1 1 1 58 LYS H    . 58 LYS+ HN   1 1 
       1306 1 2 1 1 58 LYS HG3  . 58 LYS+ HG3  1 1 
       1307 1 1 1 1 58 LYS HA   . 58 LYS+ HA   1 1 
       1307 1 2 1 1 58 LYS HB2  . 58 LYS+ HB2  1 1 
       1308 1 1 1 1 58 LYS HA   . 58 LYS+ HA   1 1 
       1308 1 2 1 1 58 LYS QD   . 58 LYS+ HD3  1 1 
       1309 1 1 1 1 58 LYS HA   . 58 LYS+ HA   1 1 
       1309 1 2 1 1 58 LYS HG2  . 58 LYS+ HG2  1 1 
       1310 1 1 1 1 58 LYS HA   . 58 LYS+ HA   1 1 
       1310 1 2 1 1 58 LYS HG3  . 58 LYS+ HG3  1 1 
       1311 1 1 1 1 58 LYS HA   . 58 LYS+ HA   1 1 
       1311 1 2 1 1 60 ALA MB   . 60 ALA  QB   1 1 
       1312 1 1 1 1 58 LYS HA   . 58 LYS+ HA   1 1 
       1312 1 2 1 1 61 GLU H    . 61 GLU- HN   1 1 
       1313 1 1 1 1 58 LYS HA   . 58 LYS+ HA   1 1 
       1313 1 2 1 1 61 GLU HB2  . 61 GLU- HB2  1 1 
       1314 1 1 1 1 58 LYS HA   . 58 LYS+ HA   1 1 
       1314 1 2 1 1 61 GLU QG   . 61 GLU- HG2  1 1 
       1315 1 1 1 1 58 LYS QD   . 58 LYS+ HD3  1 1 
       1315 1 2 1 1 59 LEU H    . 59 LEU  HN   1 1 
       1316 1 1 1 1 58 LYS QD   . 58 LYS+ HD2  1 1 
       1316 1 2 1 1 59 LEU HA   . 59 LEU  HA   1 1 
       1317 1 1 1 1 58 LYS QD   . 58 LYS+ HD2  1 1 
       1317 1 2 1 1 59 LEU HG   . 59 LEU  HG   1 1 
       1318 1 1 1 1 58 LYS QD   . 58 LYS+ HD3  1 1 
       1318 1 2 1 1 61 GLU QG   . 61 GLU- HG2  1 1 
       1319 1 1 1 1 58 LYS QE   . 58 LYS+ QE   1 1 
       1319 1 2 1 1 58 LYS HG3  . 58 LYS+ HG3  1 1 
       1320 1 1 1 1 58 LYS QE   . 58 LYS+ QE   1 1 
       1320 1 2 1 1 59 LEU H    . 59 LEU  HN   1 1 
       1321 1 1 1 1 58 LYS QE   . 58 LYS+ QE   1 1 
       1321 1 2 1 1 59 LEU HA   . 59 LEU  HA   1 1 
       1322 1 1 1 1 58 LYS QE   . 58 LYS+ QE   1 1 
       1322 1 2 1 1 59 LEU QD   . 59 LEU  QD2  1 1 
       1323 1 1 1 1 58 LYS QE   . 58 LYS+ QE   1 1 
       1323 1 2 1 1 59 LEU HG   . 59 LEU  HG   1 1 
       1324 1 1 1 1 58 LYS HG2  . 58 LYS+ HG2  1 1 
       1324 1 2 1 1 59 LEU H    . 59 LEU  HN   1 1 
       1325 1 1 1 1 58 LYS HG3  . 58 LYS+ HG3  1 1 
       1325 1 2 1 1 59 LEU H    . 59 LEU  HN   1 1 
       1326 1 1 1 1 59 LEU H    . 59 LEU  HN   1 1 
       1326 1 2 1 1 59 LEU HB2  . 59 LEU  HB2  1 1 
       1327 1 1 1 1 59 LEU H    . 59 LEU  HN   1 1 
       1327 1 2 1 1 59 LEU QD   . 59 LEU  QD2  1 1 
       1328 1 1 1 1 59 LEU H    . 59 LEU  HN   1 1 
       1328 1 2 1 1 59 LEU HG   . 59 LEU  HG   1 1 
       1329 1 1 1 1 59 LEU HA   . 59 LEU  HA   1 1 
       1329 1 2 1 1 59 LEU QD   . 59 LEU  QD2  1 1 
       1330 1 1 1 1 59 LEU HA   . 59 LEU  HA   1 1 
       1330 1 2 1 1 59 LEU HG   . 59 LEU  HG   1 1 
       1331 1 1 1 1 59 LEU HA   . 59 LEU  HA   1 1 
       1331 1 2 1 1 62 GLU H    . 62 GLU- HN   1 1 
       1332 1 1 1 1 59 LEU HA   . 59 LEU  HA   1 1 
       1332 1 2 1 1 62 GLU HB2  . 62 GLU- HB2  1 1 
       1333 1 1 1 1 59 LEU HA   . 59 LEU  HA   1 1 
       1333 1 2 1 1 62 GLU HB3  . 62 GLU- HB3  1 1 
       1334 1 1 1 1 59 LEU HA   . 59 LEU  HA   1 1 
       1334 1 2 1 1 62 GLU QG   . 62 GLU- QG   1 1 
       1335 1 1 1 1 59 LEU HA   . 59 LEU  HA   1 1 
       1335 1 2 1 1 63 GLN H    . 63 GLN  HN   1 1 
       1336 1 1 1 1 59 LEU HB2  . 59 LEU  HB2  1 1 
       1336 1 2 1 1 60 ALA H    . 60 ALA  HN   1 1 
       1337 1 1 1 1 59 LEU HB2  . 59 LEU  HB2  1 1 
       1337 1 2 1 1 60 ALA HA   . 60 ALA  HA   1 1 
       1338 1 1 1 1 59 LEU HB3  . 59 LEU  HB3  1 1 
       1338 1 2 1 1 60 ALA H    . 60 ALA  HN   1 1 
       1339 1 1 1 1 59 LEU HB3  . 59 LEU  HB3  1 1 
       1339 1 2 1 1 62 GLU HB3  . 62 GLU- HB3  1 1 
       1340 1 1 1 1 59 LEU QD   . 59 LEU  QD1  1 1 
       1340 1 2 1 1 60 ALA H    . 60 ALA  HN   1 1 
       1341 1 1 1 1 59 LEU QD   . 59 LEU  QD1  1 1 
       1341 1 2 1 1 62 GLU H    . 62 GLU- HN   1 1 
       1342 1 1 1 1 59 LEU QD   . 59 LEU  QD1  1 1 
       1342 1 2 1 1 62 GLU HB2  . 62 GLU- HB2  1 1 
       1343 1 1 1 1 59 LEU QD   . 59 LEU  QD1  1 1 
       1343 1 2 1 1 62 GLU HB3  . 62 GLU- HB3  1 1 
       1344 1 1 1 1 59 LEU QD   . 59 LEU  QD1  1 1 
       1344 1 2 1 1 62 GLU QG   . 62 GLU- QG   1 1 
       1345 1 1 1 1 60 ALA H    . 60 ALA  HN   1 1 
       1345 1 2 1 1 60 ALA MB   . 60 ALA  QB   1 1 
       1346 1 1 1 1 60 ALA H    . 60 ALA  HN   1 1 
       1346 1 2 1 1 61 GLU QG   . 61 GLU- HG2  1 1 
       1347 1 1 1 1 60 ALA H    . 60 ALA  HN   1 1 
       1347 1 2 1 1 63 GLN HB2  . 63 GLN  HB2  1 1 
       1348 1 1 1 1 60 ALA HA   . 60 ALA  HA   1 1 
       1348 1 2 1 1 63 GLN H    . 63 GLN  HN   1 1 
       1349 1 1 1 1 60 ALA HA   . 60 ALA  HA   1 1 
       1349 1 2 1 1 63 GLN HB2  . 63 GLN  HB2  1 1 
       1350 1 1 1 1 60 ALA HA   . 60 ALA  HA   1 1 
       1350 1 2 1 1 63 GLN HB3  . 63 GLN  HB3  1 1 
       1351 1 1 1 1 60 ALA HA   . 60 ALA  HA   1 1 
       1351 1 2 1 1 63 GLN HG2  . 63 GLN  HG2  1 1 
       1352 1 1 1 1 60 ALA HA   . 60 ALA  HA   1 1 
       1352 1 2 1 1 63 GLN HG3  . 63 GLN  HG3  1 1 
       1353 1 1 1 1 60 ALA HA   . 60 ALA  HA   1 1 
       1353 1 2 1 1 64 GLN HG3  . 64 GLN  HG2  1 1 
       1354 1 1 1 1 60 ALA MB   . 60 ALA  QB   1 1 
       1354 1 2 1 1 61 GLU H    . 61 GLU- HN   1 1 
       1355 1 1 1 1 60 ALA MB   . 60 ALA  QB   1 1 
       1355 1 2 1 1 61 GLU QG   . 61 GLU- HG2  1 1 
       1356 1 1 1 1 60 ALA MB   . 60 ALA  QB   1 1 
       1356 1 2 1 1 62 GLU H    . 62 GLU- HN   1 1 
       1357 1 1 1 1 60 ALA MB   . 60 ALA  QB   1 1 
       1357 1 2 1 1 63 GLN H    . 63 GLN  HN   1 1 
       1358 1 1 1 1 60 ALA MB   . 60 ALA  QB   1 1 
       1358 1 2 1 1 63 GLN HB2  . 63 GLN  HB2  1 1 
       1359 1 1 1 1 60 ALA MB   . 60 ALA  QB   1 1 
       1359 1 2 1 1 63 GLN HB3  . 63 GLN  HB3  1 1 
       1360 1 1 1 1 60 ALA MB   . 60 ALA  QB   1 1 
       1360 1 2 1 1 64 GLN HE21 . 64 GLN  HE21 1 1 
       1361 1 1 1 1 60 ALA MB   . 60 ALA  QB   1 1 
       1361 1 2 1 1 64 GLN HE22 . 64 GLN  HE22 1 1 
       1362 1 1 1 1 60 ALA MB   . 60 ALA  QB   1 1 
       1362 1 2 1 1 64 GLN HG3  . 64 GLN  HG2  1 1 
       1363 1 1 1 1 61 GLU H    . 61 GLU- HN   1 1 
       1363 1 2 1 1 61 GLU HB2  . 61 GLU- HB2  1 1 
       1364 1 1 1 1 61 GLU H    . 61 GLU- HN   1 1 
       1364 1 2 1 1 61 GLU HB3  . 61 GLU- HB3  1 1 
       1365 1 1 1 1 61 GLU H    . 61 GLU- HN   1 1 
       1365 1 2 1 1 61 GLU QG   . 61 GLU- HG2  1 1 
       1366 1 1 1 1 61 GLU H    . 61 GLU- HN   1 1 
       1366 1 2 1 1 62 GLU H    . 62 GLU- HN   1 1 
       1367 1 1 1 1 61 GLU HA   . 61 GLU- HA   1 1 
       1367 1 2 1 1 61 GLU QG   . 61 GLU- HG3  1 1 
       1368 1 1 1 1 61 GLU HA   . 61 GLU- HA   1 1 
       1368 1 2 1 1 64 GLN H    . 64 GLN  HN   1 1 
       1369 1 1 1 1 61 GLU HA   . 61 GLU- HA   1 1 
       1369 1 2 1 1 64 GLN HB2  . 64 GLN  HB2  1 1 
       1370 1 1 1 1 61 GLU HA   . 61 GLU- HA   1 1 
       1370 1 2 1 1 64 GLN HE21 . 64 GLN  HE21 1 1 
       1371 1 1 1 1 61 GLU HA   . 61 GLU- HA   1 1 
       1371 1 2 1 1 64 GLN HE22 . 64 GLN  HE22 1 1 
       1372 1 1 1 1 61 GLU HA   . 61 GLU- HA   1 1 
       1372 1 2 1 1 64 GLN HG3  . 64 GLN  HG2  1 1 
       1373 1 1 1 1 61 GLU HA   . 61 GLU- HA   1 1 
       1373 1 2 1 1 65 ARG H    . 65 ARG+ HN   1 1 
       1374 1 1 1 1 61 GLU HB2  . 61 GLU- HB2  1 1 
       1374 1 2 1 1 62 GLU H    . 62 GLU- HN   1 1 
       1375 1 1 1 1 61 GLU HB3  . 61 GLU- HB3  1 1 
       1375 1 2 1 1 61 GLU QG   . 61 GLU- HG3  1 1 
       1376 1 1 1 1 61 GLU QG   . 61 GLU- HG3  1 1 
       1376 1 2 1 1 62 GLU H    . 62 GLU- HN   1 1 
       1377 1 1 1 1 62 GLU H    . 62 GLU- HN   1 1 
       1377 1 2 1 1 62 GLU HB2  . 62 GLU- HB2  1 1 
       1378 1 1 1 1 62 GLU H    . 62 GLU- HN   1 1 
       1378 1 2 1 1 62 GLU HB3  . 62 GLU- HB3  1 1 
       1379 1 1 1 1 62 GLU H    . 62 GLU- HN   1 1 
       1379 1 2 1 1 62 GLU QG   . 62 GLU- QG   1 1 
       1380 1 1 1 1 62 GLU H    . 62 GLU- HN   1 1 
       1380 1 2 1 1 63 GLN H    . 63 GLN  HN   1 1 
       1381 1 1 1 1 62 GLU H    . 62 GLU- HN   1 1 
       1381 1 2 1 1 64 GLN H    . 64 GLN  HN   1 1 
       1382 1 1 1 1 62 GLU HA   . 62 GLU- HA   1 1 
       1382 1 2 1 1 62 GLU QG   . 62 GLU- QG   1 1 
       1383 1 1 1 1 62 GLU HA   . 62 GLU- HA   1 1 
       1383 1 2 1 1 65 ARG H    . 65 ARG+ HN   1 1 
       1384 1 1 1 1 62 GLU HA   . 62 GLU- HA   1 1 
       1384 1 2 1 1 65 ARG HB2  . 65 ARG+ HB2  1 1 
       1385 1 1 1 1 62 GLU HA   . 62 GLU- HA   1 1 
       1385 1 2 1 1 65 ARG HB3  . 65 ARG+ HB3  1 1 
       1386 1 1 1 1 62 GLU HA   . 62 GLU- HA   1 1 
       1386 1 2 1 1 65 ARG QD   . 65 ARG+ QD   1 1 
       1387 1 1 1 1 62 GLU HA   . 62 GLU- HA   1 1 
       1387 1 2 1 1 65 ARG HG2  . 65 ARG+ HG2  1 1 
       1388 1 1 1 1 62 GLU HA   . 62 GLU- HA   1 1 
       1388 1 2 1 1 65 ARG HG3  . 65 ARG+ HG3  1 1 
       1389 1 1 1 1 62 GLU HA   . 62 GLU- HA   1 1 
       1389 1 2 1 1 66 GLN H    . 66 GLN  HN   1 1 
       1390 1 1 1 1 62 GLU HB2  . 62 GLU- HB2  1 1 
       1390 1 2 1 1 62 GLU QG   . 62 GLU- QG   1 1 
       1391 1 1 1 1 62 GLU HB2  . 62 GLU- HB2  1 1 
       1391 1 2 1 1 63 GLN H    . 63 GLN  HN   1 1 
       1392 1 1 1 1 62 GLU HB2  . 62 GLU- HB2  1 1 
       1392 1 2 1 1 65 ARG QD   . 65 ARG+ QD   1 1 
       1393 1 1 1 1 62 GLU HB3  . 62 GLU- HB3  1 1 
       1393 1 2 1 1 63 GLN H    . 63 GLN  HN   1 1 
       1394 1 1 1 1 62 GLU QG   . 62 GLU- QG   1 1 
       1394 1 2 1 1 63 GLN H    . 63 GLN  HN   1 1 
       1395 1 1 1 1 62 GLU QG   . 62 GLU- QG   1 1 
       1395 1 2 1 1 66 GLN HE21 . 66 GLN  HE21 1 1 
       1396 1 1 1 1 62 GLU QG   . 62 GLU- QG   1 1 
       1396 1 2 1 1 66 GLN HE22 . 66 GLN  HE22 1 1 
       1397 1 1 1 1 63 GLN H    . 63 GLN  HN   1 1 
       1397 1 2 1 1 63 GLN HB2  . 63 GLN  HB2  1 1 
       1398 1 1 1 1 63 GLN H    . 63 GLN  HN   1 1 
       1398 1 2 1 1 63 GLN HB3  . 63 GLN  HB3  1 1 
       1399 1 1 1 1 63 GLN H    . 63 GLN  HN   1 1 
       1399 1 2 1 1 63 GLN HG2  . 63 GLN  HG2  1 1 
       1400 1 1 1 1 63 GLN H    . 63 GLN  HN   1 1 
       1400 1 2 1 1 63 GLN HG3  . 63 GLN  HG3  1 1 
       1401 1 1 1 1 63 GLN H    . 63 GLN  HN   1 1 
       1401 1 2 1 1 64 GLN H    . 64 GLN  HN   1 1 
       1402 1 1 1 1 63 GLN HA   . 63 GLN  HA   1 1 
       1402 1 2 1 1 63 GLN HG2  . 63 GLN  HG2  1 1 
       1403 1 1 1 1 63 GLN HA   . 63 GLN  HA   1 1 
       1403 1 2 1 1 63 GLN HG3  . 63 GLN  HG3  1 1 
       1404 1 1 1 1 63 GLN HA   . 63 GLN  HA   1 1 
       1404 1 2 1 1 67 TYR H    . 67 TYR  HN   1 1 
       1405 1 1 1 1 63 GLN HB2  . 63 GLN  HB2  1 1 
       1405 1 2 1 1 64 GLN H    . 64 GLN  HN   1 1 
       1406 1 1 1 1 63 GLN HB3  . 63 GLN  HB3  1 1 
       1406 1 2 1 1 63 GLN HE22 . 63 GLN  HE21 1 1 
       1407 1 1 1 1 64 GLN H    . 64 GLN  HN   1 1 
       1407 1 2 1 1 64 GLN HB3  . 64 GLN  HB3  1 1 
       1408 1 1 1 1 64 GLN H    . 64 GLN  HN   1 1 
       1408 1 2 1 1 64 GLN HG2  . 64 GLN  HG3  1 1 
       1409 1 1 1 1 64 GLN H    . 64 GLN  HN   1 1 
       1409 1 2 1 1 64 GLN HG3  . 64 GLN  HG2  1 1 
       1410 1 1 1 1 64 GLN H    . 64 GLN  HN   1 1 
       1410 1 2 1 1 65 ARG H    . 65 ARG+ HN   1 1 
       1411 1 1 1 1 64 GLN H    . 64 GLN  HN   1 1 
       1411 1 2 1 1 66 GLN H    . 66 GLN  HN   1 1 
       1412 1 1 1 1 64 GLN HA   . 64 GLN  HA   1 1 
       1412 1 2 1 1 64 GLN HG2  . 64 GLN  HG3  1 1 
       1413 1 1 1 1 64 GLN HA   . 64 GLN  HA   1 1 
       1413 1 2 1 1 64 GLN HG3  . 64 GLN  HG2  1 1 
       1414 1 1 1 1 64 GLN HA   . 64 GLN  HA   1 1 
       1414 1 2 1 1 67 TYR H    . 67 TYR  HN   1 1 
       1415 1 1 1 1 64 GLN HA   . 64 GLN  HA   1 1 
       1415 1 2 1 1 67 TYR QB   . 67 TYR  QB   1 1 
       1416 1 1 1 1 64 GLN HA   . 64 GLN  HA   1 1 
       1416 1 2 1 1 67 TYR QD   . 67 TYR  QD   1 1 
       1417 1 1 1 1 64 GLN HB2  . 64 GLN  HB2  1 1 
       1417 1 2 1 1 65 ARG H    . 65 ARG+ HN   1 1 
       1418 1 1 1 1 64 GLN HB2  . 64 GLN  HB2  1 1 
       1418 1 2 1 1 65 ARG HA   . 65 ARG+ HA   1 1 
       1419 1 1 1 1 64 GLN HB2  . 64 GLN  HB2  1 1 
       1419 1 2 1 1 65 ARG HB2  . 65 ARG+ HB2  1 1 
       1420 1 1 1 1 64 GLN HB3  . 64 GLN  HB3  1 1 
       1420 1 2 1 1 65 ARG H    . 65 ARG+ HN   1 1 
       1421 1 1 1 1 64 GLN HG3  . 64 GLN  HG2  1 1 
       1421 1 2 1 1 65 ARG H    . 65 ARG+ HN   1 1 
       1422 1 1 1 1 64 GLN HG3  . 64 GLN  HG2  1 1 
       1422 1 2 1 1 67 TYR QB   . 67 TYR  QB   1 1 
       1423 1 1 1 1 65 ARG H    . 65 ARG+ HN   1 1 
       1423 1 2 1 1 65 ARG HB2  . 65 ARG+ HB2  1 1 
       1424 1 1 1 1 65 ARG H    . 65 ARG+ HN   1 1 
       1424 1 2 1 1 65 ARG HB3  . 65 ARG+ HB3  1 1 
       1425 1 1 1 1 65 ARG H    . 65 ARG+ HN   1 1 
       1425 1 2 1 1 65 ARG QD   . 65 ARG+ QD   1 1 
       1426 1 1 1 1 65 ARG H    . 65 ARG+ HN   1 1 
       1426 1 2 1 1 65 ARG HG2  . 65 ARG+ HG2  1 1 
       1427 1 1 1 1 65 ARG HA   . 65 ARG+ HA   1 1 
       1427 1 2 1 1 65 ARG HB3  . 65 ARG+ HB3  1 1 
       1428 1 1 1 1 65 ARG HA   . 65 ARG+ HA   1 1 
       1428 1 2 1 1 65 ARG QD   . 65 ARG+ QD   1 1 
       1429 1 1 1 1 65 ARG HA   . 65 ARG+ HA   1 1 
       1429 1 2 1 1 65 ARG HG2  . 65 ARG+ HG2  1 1 
       1430 1 1 1 1 65 ARG HA   . 65 ARG+ HA   1 1 
       1430 1 2 1 1 65 ARG HG3  . 65 ARG+ HG3  1 1 
       1431 1 1 1 1 65 ARG HA   . 65 ARG+ HA   1 1 
       1431 1 2 1 1 67 TYR H    . 67 TYR  HN   1 1 
       1432 1 1 1 1 65 ARG HA   . 65 ARG+ HA   1 1 
       1432 1 2 1 1 68 LYS H    . 68 LYS+ HN   1 1 
       1433 1 1 1 1 65 ARG HA   . 65 ARG+ HA   1 1 
       1433 1 2 1 1 69 VAL QG   . 69 VAL  QG1  1 1 
       1434 1 1 1 1 65 ARG HB2  . 65 ARG+ HB2  1 1 
       1434 1 2 1 1 65 ARG QD   . 65 ARG+ QD   1 1 
       1435 1 1 1 1 65 ARG HB3  . 65 ARG+ HB3  1 1 
       1435 1 2 1 1 65 ARG QD   . 65 ARG+ QD   1 1 
       1436 1 1 1 1 65 ARG HB3  . 65 ARG+ HB3  1 1 
       1436 1 2 1 1 65 ARG HG2  . 65 ARG+ HG2  1 1 
       1437 1 1 1 1 65 ARG HB3  . 65 ARG+ HB3  1 1 
       1437 1 2 1 1 66 GLN H    . 66 GLN  HN   1 1 
       1438 1 1 1 1 65 ARG QD   . 65 ARG+ QD   1 1 
       1438 1 2 1 1 66 GLN H    . 66 GLN  HN   1 1 
       1439 1 1 1 1 65 ARG QD   . 65 ARG+ QD   1 1 
       1439 1 2 1 1 66 GLN QG   . 66 GLN  HG3  1 1 
       1440 1 1 1 1 65 ARG QD   . 65 ARG+ QD   1 1 
       1440 1 2 1 1 69 VAL QG   . 69 VAL  QG1  1 1 
       1441 1 1 1 1 65 ARG HG2  . 65 ARG+ HG2  1 1 
       1441 1 2 1 1 66 GLN H    . 66 GLN  HN   1 1 
       1442 1 1 1 1 65 ARG HG2  . 65 ARG+ HG2  1 1 
       1442 1 2 1 1 69 VAL QG   . 69 VAL  QG1  1 1 
       1443 1 1 1 1 65 ARG HG3  . 65 ARG+ HG3  1 1 
       1443 1 2 1 1 66 GLN H    . 66 GLN  HN   1 1 
       1444 1 1 1 1 65 ARG HG3  . 65 ARG+ HG3  1 1 
       1444 1 2 1 1 66 GLN QG   . 66 GLN  HG3  1 1 
       1445 1 1 1 1 65 ARG HG3  . 65 ARG+ HG3  1 1 
       1445 1 2 1 1 69 VAL QG   . 69 VAL  QG1  1 1 
       1446 1 1 1 1 66 GLN H    . 66 GLN  HN   1 1 
       1446 1 2 1 1 66 GLN QB   . 66 GLN  QB   1 1 
       1447 1 1 1 1 66 GLN H    . 66 GLN  HN   1 1 
       1447 1 2 1 1 66 GLN HE21 . 66 GLN  HE21 1 1 
       1448 1 1 1 1 66 GLN H    . 66 GLN  HN   1 1 
       1448 1 2 1 1 66 GLN HE22 . 66 GLN  HE22 1 1 
       1449 1 1 1 1 66 GLN H    . 66 GLN  HN   1 1 
       1449 1 2 1 1 66 GLN QG   . 66 GLN  HG2  1 1 
       1450 1 1 1 1 66 GLN H    . 66 GLN  HN   1 1 
       1450 1 2 1 1 67 TYR H    . 67 TYR  HN   1 1 
       1451 1 1 1 1 66 GLN H    . 66 GLN  HN   1 1 
       1451 1 2 1 1 67 TYR HA   . 67 TYR  HA   1 1 
       1452 1 1 1 1 66 GLN H    . 66 GLN  HN   1 1 
       1452 1 2 1 1 67 TYR QB   . 67 TYR  QB   1 1 
       1453 1 1 1 1 66 GLN H    . 66 GLN  HN   1 1 
       1453 1 2 1 1 68 LYS H    . 68 LYS+ HN   1 1 
       1454 1 1 1 1 66 GLN HA   . 66 GLN  HA   1 1 
       1454 1 2 1 1 66 GLN HE21 . 66 GLN  HE21 1 1 
       1455 1 1 1 1 66 GLN HA   . 66 GLN  HA   1 1 
       1455 1 2 1 1 66 GLN QG   . 66 GLN  HG2  1 1 
       1456 1 1 1 1 66 GLN HA   . 66 GLN  HA   1 1 
       1456 1 2 1 1 69 VAL H    . 69 VAL  HN   1 1 
       1457 1 1 1 1 66 GLN HA   . 66 GLN  HA   1 1 
       1457 1 2 1 1 69 VAL QG   . 69 VAL  QG2  1 1 
       1458 1 1 1 1 66 GLN HA   . 66 GLN  HA   1 1 
       1458 1 2 1 1 70 HIS H    . 70 HIS  HN   1 1 
       1459 1 1 1 1 66 GLN HA   . 66 GLN  HA   1 1 
       1459 1 2 1 1 70 HIS HD2  . 70 HIS  HD2  1 1 
       1460 1 1 1 1 66 GLN QB   . 66 GLN  QB   1 1 
       1460 1 2 1 1 67 TYR H    . 67 TYR  HN   1 1 
       1461 1 1 1 1 66 GLN QB   . 66 GLN  QB   1 1 
       1461 1 2 1 1 67 TYR QB   . 67 TYR  QB   1 1 
       1462 1 1 1 1 66 GLN QB   . 66 GLN  QB   1 1 
       1462 1 2 1 1 70 HIS HE1  . 70 HIS  HE1  1 1 
       1463 1 1 1 1 66 GLN QG   . 66 GLN  HG3  1 1 
       1463 1 2 1 1 67 TYR H    . 67 TYR  HN   1 1 
       1464 1 1 1 1 66 GLN QG   . 66 GLN  HG3  1 1 
       1464 1 2 1 1 69 VAL QG   . 69 VAL  QG1  1 1 
       1465 1 1 1 1 66 GLN QG   . 66 GLN  HG2  1 1 
       1465 1 2 1 1 70 HIS HE1  . 70 HIS  HE1  1 1 
       1466 1 1 1 1 67 TYR H    . 67 TYR  HN   1 1 
       1466 1 2 1 1 67 TYR QB   . 67 TYR  QB   1 1 
       1467 1 1 1 1 67 TYR H    . 67 TYR  HN   1 1 
       1467 1 2 1 1 67 TYR QD   . 67 TYR  QD   1 1 
       1468 1 1 1 1 67 TYR H    . 67 TYR  HN   1 1 
       1468 1 2 1 1 68 LYS H    . 68 LYS+ HN   1 1 
       1469 1 1 1 1 67 TYR H    . 67 TYR  HN   1 1 
       1469 1 2 1 1 68 LYS HA   . 68 LYS+ HA   1 1 
       1470 1 1 1 1 67 TYR HA   . 67 TYR  HA   1 1 
       1470 1 2 1 1 67 TYR QD   . 67 TYR  QD   1 1 
       1471 1 1 1 1 67 TYR HA   . 67 TYR  HA   1 1 
       1471 1 2 1 1 68 LYS HA   . 68 LYS+ HA   1 1 
       1472 1 1 1 1 67 TYR HA   . 67 TYR  HA   1 1 
       1472 1 2 1 1 69 VAL H    . 69 VAL  HN   1 1 
       1473 1 1 1 1 67 TYR HA   . 67 TYR  HA   1 1 
       1473 1 2 1 1 70 HIS H    . 70 HIS  HN   1 1 
       1474 1 1 1 1 67 TYR HA   . 67 TYR  HA   1 1 
       1474 1 2 1 1 70 HIS HB2  . 70 HIS  HB2  1 1 
       1475 1 1 1 1 67 TYR HA   . 67 TYR  HA   1 1 
       1475 1 2 1 1 70 HIS HB3  . 70 HIS  HB3  1 1 
       1476 1 1 1 1 67 TYR HA   . 67 TYR  HA   1 1 
       1476 1 2 1 1 70 HIS HD2  . 70 HIS  HD2  1 1 
       1477 1 1 1 1 67 TYR QB   . 67 TYR  QB   1 1 
       1477 1 2 1 1 68 LYS H    . 68 LYS+ HN   1 1 
       1478 1 1 1 1 67 TYR QB   . 67 TYR  QB   1 1 
       1478 1 2 1 1 68 LYS HA   . 68 LYS+ HA   1 1 
       1479 1 1 1 1 67 TYR QD   . 67 TYR  QD   1 1 
       1479 1 2 1 1 68 LYS H    . 68 LYS+ HN   1 1 
       1480 1 1 1 1 67 TYR QD   . 67 TYR  QD   1 1 
       1480 1 2 1 1 68 LYS HA   . 68 LYS+ HA   1 1 
       1481 1 1 1 1 67 TYR QD   . 67 TYR  QD   1 1 
       1481 1 2 1 1 68 LYS QB   . 68 LYS+ QB   1 1 
       1482 1 1 1 1 67 TYR QD   . 67 TYR  QD   1 1 
       1482 1 2 1 1 68 LYS HG2  . 68 LYS+ HG2  1 1 
       1483 1 1 1 1 67 TYR QD   . 67 TYR  QD   1 1 
       1483 1 2 1 1 68 LYS HG3  . 68 LYS+ HG3  1 1 
       1484 1 1 1 1 67 TYR QD   . 67 TYR  QD   1 1 
       1484 1 2 1 1 71 LEU QD   . 71 LEU  QD1  1 1 
       1485 1 1 1 1 67 TYR QE   . 67 TYR  QE   1 1 
       1485 1 2 1 1 71 LEU QD   . 71 LEU  QD1  1 1 
       1486 1 1 1 1 67 TYR QE   . 67 TYR  QE   1 1 
       1486 1 2 1 1 71 LEU HG   . 71 LEU  HG   1 1 
       1487 1 1 1 1 68 LYS H    . 68 LYS+ HN   1 1 
       1487 1 2 1 1 68 LYS QB   . 68 LYS+ QB   1 1 
       1488 1 1 1 1 68 LYS H    . 68 LYS+ HN   1 1 
       1488 1 2 1 1 68 LYS QD   . 68 LYS+ QD   1 1 
       1489 1 1 1 1 68 LYS H    . 68 LYS+ HN   1 1 
       1489 1 2 1 1 68 LYS HG2  . 68 LYS+ HG2  1 1 
       1490 1 1 1 1 68 LYS H    . 68 LYS+ HN   1 1 
       1490 1 2 1 1 68 LYS HG3  . 68 LYS+ HG3  1 1 
       1491 1 1 1 1 68 LYS H    . 68 LYS+ HN   1 1 
       1491 1 2 1 1 69 VAL H    . 69 VAL  HN   1 1 
       1492 1 1 1 1 68 LYS H    . 68 LYS+ HN   1 1 
       1492 1 2 1 1 69 VAL QG   . 69 VAL  QG1  1 1 
       1493 1 1 1 1 68 LYS H    . 68 LYS+ HN   1 1 
       1493 1 2 1 1 70 HIS H    . 70 HIS  HN   1 1 
       1494 1 1 1 1 68 LYS H    . 68 LYS+ HN   1 1 
       1494 1 2 1 1 71 LEU H    . 71 LEU  HN   1 1 
       1495 1 1 1 1 68 LYS HA   . 68 LYS+ HA   1 1 
       1495 1 2 1 1 68 LYS QD   . 68 LYS+ QD   1 1 
       1496 1 1 1 1 68 LYS HA   . 68 LYS+ HA   1 1 
       1496 1 2 1 1 68 LYS QE   . 68 LYS+ QE   1 1 
       1497 1 1 1 1 68 LYS HA   . 68 LYS+ HA   1 1 
       1497 1 2 1 1 68 LYS HG2  . 68 LYS+ HG2  1 1 
       1498 1 1 1 1 68 LYS HA   . 68 LYS+ HA   1 1 
       1498 1 2 1 1 68 LYS HG3  . 68 LYS+ HG3  1 1 
       1499 1 1 1 1 68 LYS HA   . 68 LYS+ HA   1 1 
       1499 1 2 1 1 71 LEU H    . 71 LEU  HN   1 1 
       1500 1 1 1 1 68 LYS HA   . 68 LYS+ HA   1 1 
       1500 1 2 1 1 71 LEU HB2  . 71 LEU  HB3  1 1 
       1501 1 1 1 1 68 LYS HA   . 68 LYS+ HA   1 1 
       1501 1 2 1 1 71 LEU QD   . 71 LEU  QD2  1 1 
       1502 1 1 1 1 68 LYS QB   . 68 LYS+ QB   1 1 
       1502 1 2 1 1 68 LYS QE   . 68 LYS+ QE   1 1 
       1503 1 1 1 1 68 LYS QB   . 68 LYS+ QB   1 1 
       1503 1 2 1 1 69 VAL H    . 69 VAL  HN   1 1 
       1504 1 1 1 1 68 LYS QB   . 68 LYS+ QB   1 1 
       1504 1 2 1 1 69 VAL HA   . 69 VAL  HA   1 1 
       1505 1 1 1 1 68 LYS QB   . 68 LYS+ QB   1 1 
       1505 1 2 1 1 69 VAL QG   . 69 VAL  QG1  1 1 
       1506 1 1 1 1 68 LYS QD   . 68 LYS+ QD   1 1 
       1506 1 2 1 1 71 LEU QD   . 71 LEU  QD2  1 1 
       1507 1 1 1 1 68 LYS QE   . 68 LYS+ QE   1 1 
       1507 1 2 1 1 71 LEU QD   . 71 LEU  QD2  1 1 
       1508 1 1 1 1 68 LYS HG3  . 68 LYS+ HG3  1 1 
       1508 1 2 1 1 69 VAL QG   . 69 VAL  QG1  1 1 
       1509 1 1 1 1 69 VAL H    . 69 VAL  HN   1 1 
       1509 1 2 1 1 69 VAL HB   . 69 VAL  HB   1 1 
       1510 1 1 1 1 69 VAL H    . 69 VAL  HN   1 1 
       1510 1 2 1 1 69 VAL QG   . 69 VAL  QG1  1 1 
       1511 1 1 1 1 69 VAL H    . 69 VAL  HN   1 1 
       1511 1 2 1 1 70 HIS H    . 70 HIS  HN   1 1 
       1512 1 1 1 1 69 VAL H    . 69 VAL  HN   1 1 
       1512 1 2 1 1 70 HIS HB2  . 70 HIS  HB2  1 1 
       1513 1 1 1 1 69 VAL HA   . 69 VAL  HA   1 1 
       1513 1 2 1 1 69 VAL QG   . 69 VAL  QG1  1 1 
       1514 1 1 1 1 69 VAL HA   . 69 VAL  HA   1 1 
       1514 1 2 1 1 70 HIS HA   . 70 HIS  HA   1 1 
       1515 1 1 1 1 69 VAL HA   . 69 VAL  HA   1 1 
       1515 1 2 1 1 72 ASP H    . 72 ASP- HN   1 1 
       1516 1 1 1 1 69 VAL HA   . 69 VAL  HA   1 1 
       1516 1 2 1 1 72 ASP HB2  . 72 ASP- HB2  1 1 
       1517 1 1 1 1 69 VAL HA   . 69 VAL  HA   1 1 
       1517 1 2 1 1 72 ASP HB3  . 72 ASP- HB3  1 1 
       1518 1 1 1 1 69 VAL HA   . 69 VAL  HA   1 1 
       1518 1 2 1 1 73 LEU H    . 73 LEU  HN   1 1 
       1519 1 1 1 1 69 VAL HB   . 69 VAL  HB   1 1 
       1519 1 2 1 1 70 HIS H    . 70 HIS  HN   1 1 
       1520 1 1 1 1 69 VAL HB   . 69 VAL  HB   1 1 
       1520 1 2 1 1 70 HIS HA   . 70 HIS  HA   1 1 
       1521 1 1 1 1 69 VAL HB   . 69 VAL  HB   1 1 
       1521 1 2 1 1 70 HIS HD2  . 70 HIS  HD2  1 1 
       1522 1 1 1 1 69 VAL QG   . 69 VAL  QG1  1 1 
       1522 1 2 1 1 70 HIS H    . 70 HIS  HN   1 1 
       1523 1 1 1 1 69 VAL QG   . 69 VAL  QG2  1 1 
       1523 1 2 1 1 70 HIS HA   . 70 HIS  HA   1 1 
       1524 1 1 1 1 69 VAL QG   . 69 VAL  QG2  1 1 
       1524 1 2 1 1 70 HIS HB2  . 70 HIS  HB2  1 1 
       1525 1 1 1 1 69 VAL QG   . 69 VAL  QG2  1 1 
       1525 1 2 1 1 70 HIS HB3  . 70 HIS  HB3  1 1 
       1526 1 1 1 1 69 VAL QG   . 69 VAL  QG1  1 1 
       1526 1 2 1 1 70 HIS HD2  . 70 HIS  HD2  1 1 
       1527 1 1 1 1 69 VAL QG   . 69 VAL  QG2  1 1 
       1527 1 2 1 1 72 ASP H    . 72 ASP- HN   1 1 
       1528 1 1 1 1 69 VAL QG   . 69 VAL  QG2  1 1 
       1528 1 2 1 1 72 ASP HB2  . 72 ASP- HB2  1 1 
       1529 1 1 1 1 69 VAL QG   . 69 VAL  QG2  1 1 
       1529 1 2 1 1 72 ASP HB3  . 72 ASP- HB3  1 1 
       1530 1 1 1 1 69 VAL QG   . 69 VAL  QG2  1 1 
       1530 1 2 1 1 73 LEU H    . 73 LEU  HN   1 1 
       1531 1 1 1 1 69 VAL QG   . 69 VAL  QG1  1 1 
       1531 1 2 1 1 73 LEU MD2  . 73 LEU  QD2  1 1 
       1532 1 1 1 1 69 VAL QG   . 69 VAL  QG2  1 1 
       1532 1 2 1 1 73 LEU HG   . 73 LEU  HG   1 1 
       1533 1 1 1 1 70 HIS H    . 70 HIS  HN   1 1 
       1533 1 2 1 1 70 HIS HB2  . 70 HIS  HB2  1 1 
       1534 1 1 1 1 70 HIS H    . 70 HIS  HN   1 1 
       1534 1 2 1 1 70 HIS HB3  . 70 HIS  HB3  1 1 
       1535 1 1 1 1 70 HIS H    . 70 HIS  HN   1 1 
       1535 1 2 1 1 70 HIS HD2  . 70 HIS  HD2  1 1 
       1536 1 1 1 1 70 HIS H    . 70 HIS  HN   1 1 
       1536 1 2 1 1 71 LEU H    . 71 LEU  HN   1 1 
       1537 1 1 1 1 70 HIS H    . 70 HIS  HN   1 1 
       1537 1 2 1 1 72 ASP H    . 72 ASP- HN   1 1 
       1538 1 1 1 1 70 HIS H    . 70 HIS  HN   1 1 
       1538 1 2 1 1 73 LEU MD1  . 73 LEU  QD1  1 1 
       1539 1 1 1 1 70 HIS HA   . 70 HIS  HA   1 1 
       1539 1 2 1 1 70 HIS HD2  . 70 HIS  HD2  1 1 
       1540 1 1 1 1 70 HIS HA   . 70 HIS  HA   1 1 
       1540 1 2 1 1 73 LEU H    . 73 LEU  HN   1 1 
       1541 1 1 1 1 70 HIS HA   . 70 HIS  HA   1 1 
       1541 1 2 1 1 73 LEU HB2  . 73 LEU  HB2  1 1 
       1542 1 1 1 1 70 HIS HA   . 70 HIS  HA   1 1 
       1542 1 2 1 1 73 LEU HB3  . 73 LEU  HB3  1 1 
       1543 1 1 1 1 70 HIS HA   . 70 HIS  HA   1 1 
       1543 1 2 1 1 73 LEU MD1  . 73 LEU  QD1  1 1 
       1544 1 1 1 1 70 HIS HA   . 70 HIS  HA   1 1 
       1544 1 2 1 1 73 LEU MD2  . 73 LEU  QD2  1 1 
       1545 1 1 1 1 70 HIS HA   . 70 HIS  HA   1 1 
       1545 1 2 1 1 73 LEU HG   . 73 LEU  HG   1 1 
       1546 1 1 1 1 70 HIS HA   . 70 HIS  HA   1 1 
       1546 1 2 1 1 74 TRP H    . 74 TRP  HN   1 1 
       1547 1 1 1 1 70 HIS HB2  . 70 HIS  HB2  1 1 
       1547 1 2 1 1 71 LEU H    . 71 LEU  HN   1 1 
       1548 1 1 1 1 70 HIS HB3  . 70 HIS  HB3  1 1 
       1548 1 2 1 1 71 LEU H    . 71 LEU  HN   1 1 
       1549 1 1 1 1 70 HIS HB3  . 70 HIS  HB3  1 1 
       1549 1 2 1 1 73 LEU HG   . 73 LEU  HG   1 1 
       1550 1 1 1 1 70 HIS HD2  . 70 HIS  HD2  1 1 
       1550 1 2 1 1 73 LEU HB2  . 73 LEU  HB2  1 1 
       1551 1 1 1 1 70 HIS HD2  . 70 HIS  HD2  1 1 
       1551 1 2 1 1 73 LEU MD1  . 73 LEU  QD1  1 1 
       1552 1 1 1 1 71 LEU H    . 71 LEU  HN   1 1 
       1552 1 2 1 1 71 LEU HB3  . 71 LEU  HB2  1 1 
       1553 1 1 1 1 71 LEU H    . 71 LEU  HN   1 1 
       1553 1 2 1 1 71 LEU QD   . 71 LEU  QD1  1 1 
       1554 1 1 1 1 71 LEU H    . 71 LEU  HN   1 1 
       1554 1 2 1 1 71 LEU HG   . 71 LEU  HG   1 1 
       1555 1 1 1 1 71 LEU H    . 71 LEU  HN   1 1 
       1555 1 2 1 1 72 ASP H    . 72 ASP- HN   1 1 
       1556 1 1 1 1 71 LEU HA   . 71 LEU  HA   1 1 
       1556 1 2 1 1 71 LEU QD   . 71 LEU  QD1  1 1 
       1557 1 1 1 1 71 LEU HA   . 71 LEU  HA   1 1 
       1557 1 2 1 1 71 LEU HG   . 71 LEU  HG   1 1 
       1558 1 1 1 1 71 LEU HA   . 71 LEU  HA   1 1 
       1558 1 2 1 1 74 TRP H    . 74 TRP  HN   1 1 
       1559 1 1 1 1 71 LEU HA   . 71 LEU  HA   1 1 
       1559 1 2 1 1 74 TRP HB2  . 74 TRP  HB3  1 1 
       1560 1 1 1 1 71 LEU HA   . 71 LEU  HA   1 1 
       1560 1 2 1 1 74 TRP HB3  . 74 TRP  HB2  1 1 
       1561 1 1 1 1 71 LEU HA   . 71 LEU  HA   1 1 
       1561 1 2 1 1 74 TRP HE3  . 74 TRP  HE3  1 1 
       1562 1 1 1 1 71 LEU HA   . 71 LEU  HA   1 1 
       1562 1 2 1 1 75 VAL H    . 75 VAL  HN   1 1 
       1563 1 1 1 1 71 LEU HA   . 71 LEU  HA   1 1 
       1563 1 2 1 1 75 VAL MG2  . 75 VAL  QG1  1 1 
       1564 1 1 1 1 71 LEU HB2  . 71 LEU  HB3  1 1 
       1564 1 2 1 1 72 ASP H    . 72 ASP- HN   1 1 
       1565 1 1 1 1 71 LEU HB3  . 71 LEU  HB2  1 1 
       1565 1 2 1 1 71 LEU QD   . 71 LEU  QD2  1 1 
       1566 1 1 1 1 71 LEU HB3  . 71 LEU  HB2  1 1 
       1566 1 2 1 1 72 ASP H    . 72 ASP- HN   1 1 
       1567 1 1 1 1 71 LEU HB3  . 71 LEU  HB2  1 1 
       1567 1 2 1 1 74 TRP HE3  . 74 TRP  HE3  1 1 
       1568 1 1 1 1 71 LEU QD   . 71 LEU  QD2  1 1 
       1568 1 2 1 1 72 ASP H    . 72 ASP- HN   1 1 
       1569 1 1 1 1 71 LEU QD   . 71 LEU  QD1  1 1 
       1569 1 2 1 1 74 TRP HB2  . 74 TRP  HB3  1 1 
       1570 1 1 1 1 71 LEU QD   . 71 LEU  QD1  1 1 
       1570 1 2 1 1 74 TRP HB3  . 74 TRP  HB2  1 1 
       1571 1 1 1 1 71 LEU QD   . 71 LEU  QD2  1 1 
       1571 1 2 1 1 74 TRP HE3  . 74 TRP  HE3  1 1 
       1572 1 1 1 1 71 LEU QD   . 71 LEU  QD1  1 1 
       1572 1 2 1 1 74 TRP HZ3  . 74 TRP  HZ3  1 1 
       1573 1 1 1 1 71 LEU QD   . 71 LEU  QD2  1 1 
       1573 1 2 1 1 86 TYR QE   . 86 TYR  QE   1 1 
       1574 1 1 1 1 71 LEU HG   . 71 LEU  HG   1 1 
       1574 1 2 1 1 72 ASP H    . 72 ASP- HN   1 1 
       1575 1 1 1 1 71 LEU HG   . 71 LEU  HG   1 1 
       1575 1 2 1 1 74 TRP HE3  . 74 TRP  HE3  1 1 
       1576 1 1 1 1 72 ASP H    . 72 ASP- HN   1 1 
       1576 1 2 1 1 72 ASP HB2  . 72 ASP- HB2  1 1 
       1577 1 1 1 1 72 ASP H    . 72 ASP- HN   1 1 
       1577 1 2 1 1 72 ASP HB3  . 72 ASP- HB3  1 1 
       1578 1 1 1 1 72 ASP H    . 72 ASP- HN   1 1 
       1578 1 2 1 1 73 LEU H    . 73 LEU  HN   1 1 
       1579 1 1 1 1 72 ASP H    . 72 ASP- HN   1 1 
       1579 1 2 1 1 74 TRP H    . 74 TRP  HN   1 1 
       1580 1 1 1 1 72 ASP HA   . 72 ASP- HA   1 1 
       1580 1 2 1 1 75 VAL H    . 75 VAL  HN   1 1 
       1581 1 1 1 1 72 ASP HA   . 72 ASP- HA   1 1 
       1581 1 2 1 1 75 VAL HB   . 75 VAL  HB   1 1 
       1582 1 1 1 1 72 ASP HA   . 72 ASP- HA   1 1 
       1582 1 2 1 1 75 VAL MG1  . 75 VAL  QG2  1 1 
       1583 1 1 1 1 72 ASP HA   . 72 ASP- HA   1 1 
       1583 1 2 1 1 75 VAL MG2  . 75 VAL  QG1  1 1 
       1584 1 1 1 1 72 ASP HA   . 72 ASP- HA   1 1 
       1584 1 2 1 1 76 LYS H    . 76 LYS+ HN   1 1 
       1585 1 1 1 1 72 ASP HB2  . 72 ASP- HB2  1 1 
       1585 1 2 1 1 73 LEU H    . 73 LEU  HN   1 1 
       1586 1 1 1 1 72 ASP HB2  . 72 ASP- HB2  1 1 
       1586 1 2 1 1 73 LEU HA   . 73 LEU  HA   1 1 
       1587 1 1 1 1 72 ASP HB2  . 72 ASP- HB2  1 1 
       1587 1 2 1 1 73 LEU MD2  . 73 LEU  QD2  1 1 
       1588 1 1 1 1 72 ASP HB2  . 72 ASP- HB2  1 1 
       1588 1 2 1 1 73 LEU HG   . 73 LEU  HG   1 1 
       1589 1 1 1 1 72 ASP HB3  . 72 ASP- HB3  1 1 
       1589 1 2 1 1 73 LEU H    . 73 LEU  HN   1 1 
       1590 1 1 1 1 72 ASP HB3  . 72 ASP- HB3  1 1 
       1590 1 2 1 1 73 LEU HA   . 73 LEU  HA   1 1 
       1591 1 1 1 1 72 ASP HB3  . 72 ASP- HB3  1 1 
       1591 1 2 1 1 73 LEU MD2  . 73 LEU  QD2  1 1 
       1592 1 1 1 1 72 ASP HB3  . 72 ASP- HB3  1 1 
       1592 1 2 1 1 73 LEU HG   . 73 LEU  HG   1 1 
       1593 1 1 1 1 72 ASP HB3  . 72 ASP- HB3  1 1 
       1593 1 2 1 1 75 VAL MG2  . 75 VAL  QG1  1 1 
       1594 1 1 1 1 72 ASP HB3  . 72 ASP- HB3  1 1 
       1594 1 2 1 1 76 LYS QD   . 76 LYS+ QD   1 1 
       1595 1 1 1 1 73 LEU H    . 73 LEU  HN   1 1 
       1595 1 2 1 1 73 LEU HB2  . 73 LEU  HB2  1 1 
       1596 1 1 1 1 73 LEU H    . 73 LEU  HN   1 1 
       1596 1 2 1 1 73 LEU HB3  . 73 LEU  HB3  1 1 
       1597 1 1 1 1 73 LEU H    . 73 LEU  HN   1 1 
       1597 1 2 1 1 73 LEU MD1  . 73 LEU  QD1  1 1 
       1598 1 1 1 1 73 LEU H    . 73 LEU  HN   1 1 
       1598 1 2 1 1 73 LEU MD2  . 73 LEU  QD2  1 1 
       1599 1 1 1 1 73 LEU H    . 73 LEU  HN   1 1 
       1599 1 2 1 1 73 LEU HG   . 73 LEU  HG   1 1 
       1600 1 1 1 1 73 LEU H    . 73 LEU  HN   1 1 
       1600 1 2 1 1 74 TRP H    . 74 TRP  HN   1 1 
       1601 1 1 1 1 73 LEU H    . 73 LEU  HN   1 1 
       1601 1 2 1 1 74 TRP HA   . 74 TRP  HA   1 1 
       1602 1 1 1 1 73 LEU HA   . 73 LEU  HA   1 1 
       1602 1 2 1 1 73 LEU MD1  . 73 LEU  QD1  1 1 
       1603 1 1 1 1 73 LEU HA   . 73 LEU  HA   1 1 
       1603 1 2 1 1 73 LEU MD2  . 73 LEU  QD2  1 1 
       1604 1 1 1 1 73 LEU HA   . 73 LEU  HA   1 1 
       1604 1 2 1 1 73 LEU HG   . 73 LEU  HG   1 1 
       1605 1 1 1 1 73 LEU HA   . 73 LEU  HA   1 1 
       1605 1 2 1 1 76 LYS H    . 76 LYS+ HN   1 1 
       1606 1 1 1 1 73 LEU HA   . 73 LEU  HA   1 1 
       1606 1 2 1 1 76 LYS QB   . 76 LYS+ QB   1 1 
       1607 1 1 1 1 73 LEU HA   . 73 LEU  HA   1 1 
       1607 1 2 1 1 76 LYS QD   . 76 LYS+ QD   1 1 
       1608 1 1 1 1 73 LEU HA   . 73 LEU  HA   1 1 
       1608 1 2 1 1 76 LYS QE   . 76 LYS+ QE   1 1 
       1609 1 1 1 1 73 LEU HA   . 73 LEU  HA   1 1 
       1609 1 2 1 1 76 LYS HG2  . 76 LYS+ HG3  1 1 
       1610 1 1 1 1 73 LEU HA   . 73 LEU  HA   1 1 
       1610 1 2 1 1 77 SER H    . 77 SER  HN   1 1 
       1611 1 1 1 1 73 LEU HB2  . 73 LEU  HB2  1 1 
       1611 1 2 1 1 73 LEU MD1  . 73 LEU  QD1  1 1 
       1612 1 1 1 1 73 LEU HB2  . 73 LEU  HB2  1 1 
       1612 1 2 1 1 74 TRP H    . 74 TRP  HN   1 1 
       1613 1 1 1 1 73 LEU HB2  . 73 LEU  HB2  1 1 
       1613 1 2 1 1 74 TRP HA   . 74 TRP  HA   1 1 
       1614 1 1 1 1 73 LEU HB3  . 73 LEU  HB3  1 1 
       1614 1 2 1 1 73 LEU MD1  . 73 LEU  QD1  1 1 
       1615 1 1 1 1 73 LEU HB3  . 73 LEU  HB3  1 1 
       1615 1 2 1 1 74 TRP H    . 74 TRP  HN   1 1 
       1616 1 1 1 1 73 LEU HB3  . 73 LEU  HB3  1 1 
       1616 1 2 1 1 74 TRP HA   . 74 TRP  HA   1 1 
       1617 1 1 1 1 73 LEU MD1  . 73 LEU  QD1  1 1 
       1617 1 2 1 1 74 TRP H    . 74 TRP  HN   1 1 
       1618 1 1 1 1 73 LEU MD2  . 73 LEU  QD2  1 1 
       1618 1 2 1 1 74 TRP H    . 74 TRP  HN   1 1 
       1619 1 1 1 1 73 LEU MD2  . 73 LEU  QD2  1 1 
       1619 1 2 1 1 76 LYS QB   . 76 LYS+ QB   1 1 
       1620 1 1 1 1 73 LEU MD2  . 73 LEU  QD2  1 1 
       1620 1 2 1 1 76 LYS QD   . 76 LYS+ QD   1 1 
       1621 1 1 1 1 73 LEU MD2  . 73 LEU  QD2  1 1 
       1621 1 2 1 1 76 LYS QE   . 76 LYS+ QE   1 1 
       1622 1 1 1 1 73 LEU HG   . 73 LEU  HG   1 1 
       1622 1 2 1 1 74 TRP H    . 74 TRP  HN   1 1 
       1623 1 1 1 1 74 TRP H    . 74 TRP  HN   1 1 
       1623 1 2 1 1 74 TRP HB2  . 74 TRP  HB3  1 1 
       1624 1 1 1 1 74 TRP H    . 74 TRP  HN   1 1 
       1624 1 2 1 1 74 TRP HB3  . 74 TRP  HB2  1 1 
       1625 1 1 1 1 74 TRP H    . 74 TRP  HN   1 1 
       1625 1 2 1 1 74 TRP HD1  . 74 TRP  HD1  1 1 
       1626 1 1 1 1 74 TRP H    . 74 TRP  HN   1 1 
       1626 1 2 1 1 74 TRP HE3  . 74 TRP  HE3  1 1 
       1627 1 1 1 1 74 TRP H    . 74 TRP  HN   1 1 
       1627 1 2 1 1 75 VAL H    . 75 VAL  HN   1 1 
       1628 1 1 1 1 74 TRP H    . 74 TRP  HN   1 1 
       1628 1 2 1 1 75 VAL HA   . 75 VAL  HA   1 1 
       1629 1 1 1 1 74 TRP H    . 74 TRP  HN   1 1 
       1629 1 2 1 1 75 VAL HB   . 75 VAL  HB   1 1 
       1630 1 1 1 1 74 TRP H    . 74 TRP  HN   1 1 
       1630 1 2 1 1 75 VAL MG2  . 75 VAL  QG1  1 1 
       1631 1 1 1 1 74 TRP H    . 74 TRP  HN   1 1 
       1631 1 2 1 1 76 LYS H    . 76 LYS+ HN   1 1 
       1632 1 1 1 1 74 TRP HA   . 74 TRP  HA   1 1 
       1632 1 2 1 1 74 TRP HD1  . 74 TRP  HD1  1 1 
       1633 1 1 1 1 74 TRP HA   . 74 TRP  HA   1 1 
       1633 1 2 1 1 74 TRP HE1  . 74 TRP  HE1  1 1 
       1634 1 1 1 1 74 TRP HA   . 74 TRP  HA   1 1 
       1634 1 2 1 1 74 TRP HE3  . 74 TRP  HE3  1 1 
       1635 1 1 1 1 74 TRP HA   . 74 TRP  HA   1 1 
       1635 1 2 1 1 76 LYS H    . 76 LYS+ HN   1 1 
       1636 1 1 1 1 74 TRP HA   . 74 TRP  HA   1 1 
       1636 1 2 1 1 77 SER H    . 77 SER  HN   1 1 
       1637 1 1 1 1 74 TRP HB2  . 74 TRP  HB3  1 1 
       1637 1 2 1 1 74 TRP HD1  . 74 TRP  HD1  1 1 
       1638 1 1 1 1 74 TRP HB2  . 74 TRP  HB3  1 1 
       1638 1 2 1 1 74 TRP HE1  . 74 TRP  HE1  1 1 
       1639 1 1 1 1 74 TRP HB2  . 74 TRP  HB3  1 1 
       1639 1 2 1 1 74 TRP HE3  . 74 TRP  HE3  1 1 
       1640 1 1 1 1 74 TRP HB2  . 74 TRP  HB3  1 1 
       1640 1 2 1 1 75 VAL H    . 75 VAL  HN   1 1 
       1641 1 1 1 1 74 TRP HB3  . 74 TRP  HB2  1 1 
       1641 1 2 1 1 74 TRP HE3  . 74 TRP  HE3  1 1 
       1642 1 1 1 1 74 TRP HB3  . 74 TRP  HB2  1 1 
       1642 1 2 1 1 75 VAL H    . 75 VAL  HN   1 1 
       1643 1 1 1 1 74 TRP HB3  . 74 TRP  HB2  1 1 
       1643 1 2 1 1 75 VAL MG2  . 75 VAL  QG1  1 1 
       1644 1 1 1 1 74 TRP HB3  . 74 TRP  HB2  1 1 
       1644 1 2 1 1 76 LYS H    . 76 LYS+ HN   1 1 
       1645 1 1 1 1 74 TRP HD1  . 74 TRP  HD1  1 1 
       1645 1 2 1 1 77 SER QB   . 77 SER  QB   1 1 
       1646 1 1 1 1 74 TRP HD1  . 74 TRP  HD1  1 1 
       1646 1 2 1 1 78 LEU MD2  . 78 LEU  QD1  1 1 
       1647 1 1 1 1 74 TRP HE1  . 74 TRP  HE1  1 1 
       1647 1 2 1 1 78 LEU MD1  . 78 LEU  QD2  1 1 
       1648 1 1 1 1 74 TRP HE1  . 74 TRP  HE1  1 1 
       1648 1 2 1 1 78 LEU MD2  . 78 LEU  QD1  1 1 
       1649 1 1 1 1 74 TRP HE1  . 74 TRP  HE1  1 1 
       1649 1 2 1 1 78 LEU HG   . 78 LEU  HG   1 1 
       1650 1 1 1 1 74 TRP HE3  . 74 TRP  HE3  1 1 
       1650 1 2 1 1 75 VAL H    . 75 VAL  HN   1 1 
       1651 1 1 1 1 74 TRP HE3  . 74 TRP  HE3  1 1 
       1651 1 2 1 1 75 VAL HA   . 75 VAL  HA   1 1 
       1652 1 1 1 1 74 TRP HE3  . 74 TRP  HE3  1 1 
       1652 1 2 1 1 75 VAL HB   . 75 VAL  HB   1 1 
       1653 1 1 1 1 74 TRP HE3  . 74 TRP  HE3  1 1 
       1653 1 2 1 1 75 VAL MG1  . 75 VAL  QG2  1 1 
       1654 1 1 1 1 74 TRP HE3  . 74 TRP  HE3  1 1 
       1654 1 2 1 1 75 VAL MG2  . 75 VAL  QG1  1 1 
       1655 1 1 1 1 74 TRP HE3  . 74 TRP  HE3  1 1 
       1655 1 2 1 1 78 LEU MD1  . 78 LEU  QD2  1 1 
       1656 1 1 1 1 74 TRP HE3  . 74 TRP  HE3  1 1 
       1656 1 2 1 1 86 TYR QE   . 86 TYR  QE   1 1 
       1657 1 1 1 1 74 TRP HH2  . 74 TRP  HH2  1 1 
       1657 1 2 1 1 75 VAL MG2  . 75 VAL  QG1  1 1 
       1658 1 1 1 1 74 TRP HH2  . 74 TRP  HH2  1 1 
       1658 1 2 1 1 78 LEU MD1  . 78 LEU  QD2  1 1 
       1659 1 1 1 1 74 TRP HH2  . 74 TRP  HH2  1 1 
       1659 1 2 1 1 78 LEU MD2  . 78 LEU  QD1  1 1 
       1660 1 1 1 1 74 TRP HH2  . 74 TRP  HH2  1 1 
       1660 1 2 1 1 86 TYR HB2  . 86 TYR  HB2  1 1 
       1661 1 1 1 1 74 TRP HH2  . 74 TRP  HH2  1 1 
       1661 1 2 1 1 86 TYR HB3  . 86 TYR  HB3  1 1 
       1662 1 1 1 1 74 TRP HH2  . 74 TRP  HH2  1 1 
       1662 1 2 1 1 86 TYR QD   . 86 TYR  QD   1 1 
       1663 1 1 1 1 74 TRP HZ2  . 74 TRP  HZ2  1 1 
       1663 1 2 1 1 78 LEU MD1  . 78 LEU  QD2  1 1 
       1664 1 1 1 1 74 TRP HZ2  . 74 TRP  HZ2  1 1 
       1664 1 2 1 1 78 LEU MD2  . 78 LEU  QD1  1 1 
       1665 1 1 1 1 74 TRP HZ3  . 74 TRP  HZ3  1 1 
       1665 1 2 1 1 75 VAL MG2  . 75 VAL  QG1  1 1 
       1666 1 1 1 1 74 TRP HZ3  . 74 TRP  HZ3  1 1 
       1666 1 2 1 1 78 LEU MD1  . 78 LEU  QD2  1 1 
       1667 1 1 1 1 74 TRP HZ3  . 74 TRP  HZ3  1 1 
       1667 1 2 1 1 86 TYR QD   . 86 TYR  QD   1 1 
       1668 1 1 1 1 74 TRP HZ3  . 74 TRP  HZ3  1 1 
       1668 1 2 1 1 86 TYR QE   . 86 TYR  QE   1 1 
       1669 1 1 1 1 75 VAL H    . 75 VAL  HN   1 1 
       1669 1 2 1 1 75 VAL HB   . 75 VAL  HB   1 1 
       1670 1 1 1 1 75 VAL H    . 75 VAL  HN   1 1 
       1670 1 2 1 1 75 VAL MG1  . 75 VAL  QG2  1 1 
       1671 1 1 1 1 75 VAL H    . 75 VAL  HN   1 1 
       1671 1 2 1 1 75 VAL MG2  . 75 VAL  QG1  1 1 
       1672 1 1 1 1 75 VAL H    . 75 VAL  HN   1 1 
       1672 1 2 1 1 76 LYS H    . 76 LYS+ HN   1 1 
       1673 1 1 1 1 75 VAL H    . 75 VAL  HN   1 1 
       1673 1 2 1 1 77 SER H    . 77 SER  HN   1 1 
       1674 1 1 1 1 75 VAL HA   . 75 VAL  HA   1 1 
       1674 1 2 1 1 75 VAL MG1  . 75 VAL  QG2  1 1 
       1675 1 1 1 1 75 VAL HA   . 75 VAL  HA   1 1 
       1675 1 2 1 1 75 VAL MG2  . 75 VAL  QG1  1 1 
       1676 1 1 1 1 75 VAL HA   . 75 VAL  HA   1 1 
       1676 1 2 1 1 76 LYS HA   . 76 LYS+ HA   1 1 
       1677 1 1 1 1 75 VAL HA   . 75 VAL  HA   1 1 
       1677 1 2 1 1 77 SER H    . 77 SER  HN   1 1 
       1678 1 1 1 1 75 VAL HA   . 75 VAL  HA   1 1 
       1678 1 2 1 1 78 LEU H    . 78 LEU  HN   1 1 
       1679 1 1 1 1 75 VAL HA   . 75 VAL  HA   1 1 
       1679 1 2 1 1 78 LEU HB2  . 78 LEU  HB2  1 1 
       1680 1 1 1 1 75 VAL HA   . 75 VAL  HA   1 1 
       1680 1 2 1 1 78 LEU HB3  . 78 LEU  HB3  1 1 
       1681 1 1 1 1 75 VAL HA   . 75 VAL  HA   1 1 
       1681 1 2 1 1 78 LEU MD1  . 78 LEU  QD2  1 1 
       1682 1 1 1 1 75 VAL HA   . 75 VAL  HA   1 1 
       1682 1 2 1 1 78 LEU MD2  . 78 LEU  QD1  1 1 
       1683 1 1 1 1 75 VAL HA   . 75 VAL  HA   1 1 
       1683 1 2 1 1 78 LEU HG   . 78 LEU  HG   1 1 
       1684 1 1 1 1 75 VAL HA   . 75 VAL  HA   1 1 
       1684 1 2 1 1 83 ARG HA   . 83 ARG+ HA   1 1 
       1685 1 1 1 1 75 VAL HA   . 75 VAL  HA   1 1 
       1685 1 2 1 1 83 ARG QG   . 83 ARG+ QG   1 1 
       1686 1 1 1 1 75 VAL HA   . 75 VAL  HA   1 1 
       1686 1 2 1 1 86 TYR QD   . 86 TYR  QD   1 1 
       1687 1 1 1 1 75 VAL HB   . 75 VAL  HB   1 1 
       1687 1 2 1 1 76 LYS H    . 76 LYS+ HN   1 1 
       1688 1 1 1 1 75 VAL HB   . 75 VAL  HB   1 1 
       1688 1 2 1 1 76 LYS HG3  . 76 LYS+ HG2  1 1 
       1689 1 1 1 1 75 VAL HB   . 75 VAL  HB   1 1 
       1689 1 2 1 1 77 SER H    . 77 SER  HN   1 1 
       1690 1 1 1 1 75 VAL HB   . 75 VAL  HB   1 1 
       1690 1 2 1 1 78 LEU MD1  . 78 LEU  QD2  1 1 
       1691 1 1 1 1 75 VAL HB   . 75 VAL  HB   1 1 
       1691 1 2 1 1 86 TYR QE   . 86 TYR  QE   1 1 
       1692 1 1 1 1 75 VAL MG1  . 75 VAL  QG2  1 1 
       1692 1 2 1 1 76 LYS H    . 76 LYS+ HN   1 1 
       1693 1 1 1 1 75 VAL MG1  . 75 VAL  QG2  1 1 
       1693 1 2 1 1 76 LYS HA   . 76 LYS+ HA   1 1 
       1694 1 1 1 1 75 VAL MG1  . 75 VAL  QG2  1 1 
       1694 1 2 1 1 76 LYS HG2  . 76 LYS+ HG3  1 1 
       1695 1 1 1 1 75 VAL MG1  . 75 VAL  QG2  1 1 
       1695 1 2 1 1 77 SER H    . 77 SER  HN   1 1 
       1696 1 1 1 1 75 VAL MG1  . 75 VAL  QG2  1 1 
       1696 1 2 1 1 78 LEU H    . 78 LEU  HN   1 1 
       1697 1 1 1 1 75 VAL MG1  . 75 VAL  QG2  1 1 
       1697 1 2 1 1 78 LEU MD1  . 78 LEU  QD2  1 1 
       1698 1 1 1 1 75 VAL MG1  . 75 VAL  QG2  1 1 
       1698 1 2 1 1 78 LEU MD2  . 78 LEU  QD1  1 1 
       1699 1 1 1 1 75 VAL MG1  . 75 VAL  QG2  1 1 
       1699 1 2 1 1 78 LEU HG   . 78 LEU  HG   1 1 
       1700 1 1 1 1 75 VAL MG1  . 75 VAL  QG2  1 1 
       1700 1 2 1 1 83 ARG HA   . 83 ARG+ HA   1 1 
       1701 1 1 1 1 75 VAL MG1  . 75 VAL  QG2  1 1 
       1701 1 2 1 1 83 ARG HB2  . 83 ARG+ HB3  1 1 
       1702 1 1 1 1 75 VAL MG1  . 75 VAL  QG2  1 1 
       1702 1 2 1 1 83 ARG HB3  . 83 ARG+ HB2  1 1 
       1703 1 1 1 1 75 VAL MG1  . 75 VAL  QG2  1 1 
       1703 1 2 1 1 83 ARG QD   . 83 ARG+ QD   1 1 
       1704 1 1 1 1 75 VAL MG1  . 75 VAL  QG2  1 1 
       1704 1 2 1 1 83 ARG QG   . 83 ARG+ QG   1 1 
       1705 1 1 1 1 75 VAL MG1  . 75 VAL  QG2  1 1 
       1705 1 2 1 1 86 TYR QD   . 86 TYR  QD   1 1 
       1706 1 1 1 1 75 VAL MG1  . 75 VAL  QG2  1 1 
       1706 1 2 1 1 86 TYR QE   . 86 TYR  QE   1 1 
       1707 1 1 1 1 75 VAL MG2  . 75 VAL  QG1  1 1 
       1707 1 2 1 1 76 LYS H    . 76 LYS+ HN   1 1 
       1708 1 1 1 1 75 VAL MG2  . 75 VAL  QG1  1 1 
       1708 1 2 1 1 77 SER H    . 77 SER  HN   1 1 
       1709 1 1 1 1 75 VAL MG2  . 75 VAL  QG1  1 1 
       1709 1 2 1 1 78 LEU H    . 78 LEU  HN   1 1 
       1710 1 1 1 1 75 VAL MG2  . 75 VAL  QG1  1 1 
       1710 1 2 1 1 78 LEU MD1  . 78 LEU  QD2  1 1 
       1711 1 1 1 1 75 VAL MG2  . 75 VAL  QG1  1 1 
       1711 1 2 1 1 78 LEU MD2  . 78 LEU  QD1  1 1 
       1712 1 1 1 1 75 VAL MG2  . 75 VAL  QG1  1 1 
       1712 1 2 1 1 78 LEU HG   . 78 LEU  HG   1 1 
       1713 1 1 1 1 75 VAL MG2  . 75 VAL  QG1  1 1 
       1713 1 2 1 1 83 ARG QD   . 83 ARG+ QD   1 1 
       1714 1 1 1 1 75 VAL MG2  . 75 VAL  QG1  1 1 
       1714 1 2 1 1 83 ARG QG   . 83 ARG+ QG   1 1 
       1715 1 1 1 1 75 VAL MG2  . 75 VAL  QG1  1 1 
       1715 1 2 1 1 86 TYR QD   . 86 TYR  QD   1 1 
       1716 1 1 1 1 75 VAL MG2  . 75 VAL  QG1  1 1 
       1716 1 2 1 1 86 TYR QE   . 86 TYR  QE   1 1 
       1717 1 1 1 1 76 LYS H    . 76 LYS+ HN   1 1 
       1717 1 2 1 1 76 LYS QB   . 76 LYS+ QB   1 1 
       1718 1 1 1 1 76 LYS H    . 76 LYS+ HN   1 1 
       1718 1 2 1 1 76 LYS QD   . 76 LYS+ QD   1 1 
       1719 1 1 1 1 76 LYS H    . 76 LYS+ HN   1 1 
       1719 1 2 1 1 76 LYS QE   . 76 LYS+ QE   1 1 
       1720 1 1 1 1 76 LYS H    . 76 LYS+ HN   1 1 
       1720 1 2 1 1 76 LYS HG2  . 76 LYS+ HG3  1 1 
       1721 1 1 1 1 76 LYS H    . 76 LYS+ HN   1 1 
       1721 1 2 1 1 76 LYS HG3  . 76 LYS+ HG2  1 1 
       1722 1 1 1 1 76 LYS H    . 76 LYS+ HN   1 1 
       1722 1 2 1 1 77 SER H    . 77 SER  HN   1 1 
       1723 1 1 1 1 76 LYS H    . 76 LYS+ HN   1 1 
       1723 1 2 1 1 78 LEU H    . 78 LEU  HN   1 1 
       1724 1 1 1 1 76 LYS HA   . 76 LYS+ HA   1 1 
       1724 1 2 1 1 76 LYS QD   . 76 LYS+ QD   1 1 
       1725 1 1 1 1 76 LYS HA   . 76 LYS+ HA   1 1 
       1725 1 2 1 1 76 LYS QE   . 76 LYS+ QE   1 1 
       1726 1 1 1 1 76 LYS HA   . 76 LYS+ HA   1 1 
       1726 1 2 1 1 76 LYS HG2  . 76 LYS+ HG3  1 1 
       1727 1 1 1 1 76 LYS HA   . 76 LYS+ HA   1 1 
       1727 1 2 1 1 76 LYS HG3  . 76 LYS+ HG2  1 1 
       1728 1 1 1 1 76 LYS HA   . 76 LYS+ HA   1 1 
       1728 1 2 1 1 78 LEU H    . 78 LEU  HN   1 1 
       1729 1 1 1 1 76 LYS QB   . 76 LYS+ QB   1 1 
       1729 1 2 1 1 76 LYS QD   . 76 LYS+ QD   1 1 
       1730 1 1 1 1 76 LYS QB   . 76 LYS+ QB   1 1 
       1730 1 2 1 1 76 LYS QE   . 76 LYS+ QE   1 1 
       1731 1 1 1 1 76 LYS QB   . 76 LYS+ QB   1 1 
       1731 1 2 1 1 77 SER H    . 77 SER  HN   1 1 
       1732 1 1 1 1 76 LYS QB   . 76 LYS+ QB   1 1 
       1732 1 2 1 1 77 SER HA   . 77 SER  HA   1 1 
       1733 1 1 1 1 76 LYS QB   . 76 LYS+ QB   1 1 
       1733 1 2 1 1 78 LEU H    . 78 LEU  HN   1 1 
       1734 1 1 1 1 76 LYS QE   . 76 LYS+ QE   1 1 
       1734 1 2 1 1 76 LYS HG2  . 76 LYS+ HG3  1 1 
       1735 1 1 1 1 76 LYS HG2  . 76 LYS+ HG3  1 1 
       1735 1 2 1 1 77 SER H    . 77 SER  HN   1 1 
       1736 1 1 1 1 77 SER H    . 77 SER  HN   1 1 
       1736 1 2 1 1 77 SER QB   . 77 SER  QB   1 1 
       1737 1 1 1 1 77 SER H    . 77 SER  HN   1 1 
       1737 1 2 1 1 78 LEU H    . 78 LEU  HN   1 1 
       1738 1 1 1 1 77 SER H    . 77 SER  HN   1 1 
       1738 1 2 1 1 78 LEU HB2  . 78 LEU  HB2  1 1 
       1739 1 1 1 1 77 SER H    . 77 SER  HN   1 1 
       1739 1 2 1 1 78 LEU MD2  . 78 LEU  QD1  1 1 
       1740 1 1 1 1 77 SER H    . 77 SER  HN   1 1 
       1740 1 2 1 1 78 LEU HG   . 78 LEU  HG   1 1 
       1741 1 1 1 1 77 SER H    . 77 SER  HN   1 1 
       1741 1 2 1 1 83 ARG QD   . 83 ARG+ QD   1 1 
       1742 1 1 1 1 77 SER QB   . 77 SER  QB   1 1 
       1742 1 2 1 1 78 LEU H    . 78 LEU  HN   1 1 
       1743 1 1 1 1 77 SER QB   . 77 SER  QB   1 1 
       1743 1 2 1 1 78 LEU HA   . 78 LEU  HA   1 1 
       1744 1 1 1 1 77 SER QB   . 77 SER  QB   1 1 
       1744 1 2 1 1 78 LEU HG   . 78 LEU  HG   1 1 
       1745 1 1 1 1 78 LEU H    . 78 LEU  HN   1 1 
       1745 1 2 1 1 78 LEU HB2  . 78 LEU  HB2  1 1 
       1746 1 1 1 1 78 LEU H    . 78 LEU  HN   1 1 
       1746 1 2 1 1 78 LEU HB3  . 78 LEU  HB3  1 1 
       1747 1 1 1 1 78 LEU H    . 78 LEU  HN   1 1 
       1747 1 2 1 1 78 LEU MD1  . 78 LEU  QD2  1 1 
       1748 1 1 1 1 78 LEU H    . 78 LEU  HN   1 1 
       1748 1 2 1 1 78 LEU MD2  . 78 LEU  QD1  1 1 
       1749 1 1 1 1 78 LEU H    . 78 LEU  HN   1 1 
       1749 1 2 1 1 78 LEU HG   . 78 LEU  HG   1 1 
       1750 1 1 1 1 78 LEU H    . 78 LEU  HN   1 1 
       1750 1 2 1 1 79 SER H    . 79 SER  HN   1 1 
       1751 1 1 1 1 78 LEU H    . 78 LEU  HN   1 1 
       1751 1 2 1 1 83 ARG HB2  . 83 ARG+ HB3  1 1 
       1752 1 1 1 1 78 LEU H    . 78 LEU  HN   1 1 
       1752 1 2 1 1 83 ARG QD   . 83 ARG+ QD   1 1 
       1753 1 1 1 1 78 LEU HA   . 78 LEU  HA   1 1 
       1753 1 2 1 1 78 LEU MD1  . 78 LEU  QD2  1 1 
       1754 1 1 1 1 78 LEU HA   . 78 LEU  HA   1 1 
       1754 1 2 1 1 78 LEU MD2  . 78 LEU  QD1  1 1 
       1755 1 1 1 1 78 LEU HA   . 78 LEU  HA   1 1 
       1755 1 2 1 1 79 SER H    . 79 SER  HN   1 1 
       1756 1 1 1 1 78 LEU HA   . 78 LEU  HA   1 1 
       1756 1 2 1 1 82 ASP HB2  . 82 ASP- HB2  1 1 
       1757 1 1 1 1 78 LEU HA   . 78 LEU  HA   1 1 
       1757 1 2 1 1 82 ASP HB3  . 82 ASP- HB3  1 1 
       1758 1 1 1 1 78 LEU HB2  . 78 LEU  HB2  1 1 
       1758 1 2 1 1 78 LEU MD1  . 78 LEU  QD2  1 1 
       1759 1 1 1 1 78 LEU HB2  . 78 LEU  HB2  1 1 
       1759 1 2 1 1 79 SER H    . 79 SER  HN   1 1 
       1760 1 1 1 1 78 LEU HB2  . 78 LEU  HB2  1 1 
       1760 1 2 1 1 82 ASP HB2  . 82 ASP- HB2  1 1 
       1761 1 1 1 1 78 LEU HB2  . 78 LEU  HB2  1 1 
       1761 1 2 1 1 82 ASP HB3  . 82 ASP- HB3  1 1 
       1762 1 1 1 1 78 LEU HB2  . 78 LEU  HB2  1 1 
       1762 1 2 1 1 83 ARG H    . 83 ARG+ HN   1 1 
       1763 1 1 1 1 78 LEU HB2  . 78 LEU  HB2  1 1 
       1763 1 2 1 1 83 ARG HA   . 83 ARG+ HA   1 1 
       1764 1 1 1 1 78 LEU HB2  . 78 LEU  HB2  1 1 
       1764 1 2 1 1 83 ARG HB2  . 83 ARG+ HB3  1 1 
       1765 1 1 1 1 78 LEU HB2  . 78 LEU  HB2  1 1 
       1765 1 2 1 1 83 ARG QD   . 83 ARG+ QD   1 1 
       1766 1 1 1 1 78 LEU HB3  . 78 LEU  HB3  1 1 
       1766 1 2 1 1 79 SER H    . 79 SER  HN   1 1 
       1767 1 1 1 1 78 LEU HB3  . 78 LEU  HB3  1 1 
       1767 1 2 1 1 82 ASP H    . 82 ASP- HN   1 1 
       1768 1 1 1 1 78 LEU HB3  . 78 LEU  HB3  1 1 
       1768 1 2 1 1 82 ASP HB2  . 82 ASP- HB2  1 1 
       1769 1 1 1 1 78 LEU HB3  . 78 LEU  HB3  1 1 
       1769 1 2 1 1 82 ASP HB3  . 82 ASP- HB3  1 1 
       1770 1 1 1 1 78 LEU HB3  . 78 LEU  HB3  1 1 
       1770 1 2 1 1 83 ARG H    . 83 ARG+ HN   1 1 
       1771 1 1 1 1 78 LEU HB3  . 78 LEU  HB3  1 1 
       1771 1 2 1 1 83 ARG HA   . 83 ARG+ HA   1 1 
       1772 1 1 1 1 78 LEU HB3  . 78 LEU  HB3  1 1 
       1772 1 2 1 1 83 ARG HB2  . 83 ARG+ HB3  1 1 
       1773 1 1 1 1 78 LEU HB3  . 78 LEU  HB3  1 1 
       1773 1 2 1 1 83 ARG HB3  . 83 ARG+ HB2  1 1 
       1774 1 1 1 1 78 LEU HB3  . 78 LEU  HB3  1 1 
       1774 1 2 1 1 83 ARG QD   . 83 ARG+ QD   1 1 
       1775 1 1 1 1 78 LEU HB3  . 78 LEU  HB3  1 1 
       1775 1 2 1 1 83 ARG QG   . 83 ARG+ QG   1 1 
       1776 1 1 1 1 78 LEU MD1  . 78 LEU  QD2  1 1 
       1776 1 2 1 1 79 SER H    . 79 SER  HN   1 1 
       1777 1 1 1 1 78 LEU MD1  . 78 LEU  QD2  1 1 
       1777 1 2 1 1 82 ASP H    . 82 ASP- HN   1 1 
       1778 1 1 1 1 78 LEU MD1  . 78 LEU  QD2  1 1 
       1778 1 2 1 1 82 ASP HA   . 82 ASP- HA   1 1 
       1779 1 1 1 1 78 LEU MD1  . 78 LEU  QD2  1 1 
       1779 1 2 1 1 82 ASP HB2  . 82 ASP- HB2  1 1 
       1780 1 1 1 1 78 LEU MD1  . 78 LEU  QD2  1 1 
       1780 1 2 1 1 82 ASP HB3  . 82 ASP- HB3  1 1 
       1781 1 1 1 1 78 LEU MD1  . 78 LEU  QD2  1 1 
       1781 1 2 1 1 83 ARG H    . 83 ARG+ HN   1 1 
       1782 1 1 1 1 78 LEU MD1  . 78 LEU  QD2  1 1 
       1782 1 2 1 1 83 ARG HA   . 83 ARG+ HA   1 1 
       1783 1 1 1 1 78 LEU MD1  . 78 LEU  QD2  1 1 
       1783 1 2 1 1 83 ARG HB2  . 83 ARG+ HB3  1 1 
       1784 1 1 1 1 78 LEU MD1  . 78 LEU  QD2  1 1 
       1784 1 2 1 1 83 ARG HB3  . 83 ARG+ HB2  1 1 
       1785 1 1 1 1 78 LEU MD1  . 78 LEU  QD2  1 1 
       1785 1 2 1 1 83 ARG QD   . 83 ARG+ QD   1 1 
       1786 1 1 1 1 78 LEU MD1  . 78 LEU  QD2  1 1 
       1786 1 2 1 1 83 ARG QG   . 83 ARG+ QG   1 1 
       1787 1 1 1 1 78 LEU MD1  . 78 LEU  QD2  1 1 
       1787 1 2 1 1 84 ALA H    . 84 ALA  HN   1 1 
       1788 1 1 1 1 78 LEU MD1  . 78 LEU  QD2  1 1 
       1788 1 2 1 1 86 TYR HB3  . 86 TYR  HB3  1 1 
       1789 1 1 1 1 78 LEU MD1  . 78 LEU  QD2  1 1 
       1789 1 2 1 1 86 TYR QD   . 86 TYR  QD   1 1 
       1790 1 1 1 1 78 LEU MD1  . 78 LEU  QD2  1 1 
       1790 1 2 1 1 86 TYR QE   . 86 TYR  QE   1 1 
       1791 1 1 1 1 78 LEU MD2  . 78 LEU  QD1  1 1 
       1791 1 2 1 1 79 SER H    . 79 SER  HN   1 1 
       1792 1 1 1 1 78 LEU MD2  . 78 LEU  QD1  1 1 
       1792 1 2 1 1 82 ASP H    . 82 ASP- HN   1 1 
       1793 1 1 1 1 78 LEU MD2  . 78 LEU  QD1  1 1 
       1793 1 2 1 1 82 ASP HA   . 82 ASP- HA   1 1 
       1794 1 1 1 1 78 LEU MD2  . 78 LEU  QD1  1 1 
       1794 1 2 1 1 82 ASP HB2  . 82 ASP- HB2  1 1 
       1795 1 1 1 1 78 LEU MD2  . 78 LEU  QD1  1 1 
       1795 1 2 1 1 82 ASP HB3  . 82 ASP- HB3  1 1 
       1796 1 1 1 1 78 LEU MD2  . 78 LEU  QD1  1 1 
       1796 1 2 1 1 83 ARG H    . 83 ARG+ HN   1 1 
       1797 1 1 1 1 78 LEU MD2  . 78 LEU  QD1  1 1 
       1797 1 2 1 1 83 ARG HA   . 83 ARG+ HA   1 1 
       1798 1 1 1 1 78 LEU HG   . 78 LEU  HG   1 1 
       1798 1 2 1 1 79 SER H    . 79 SER  HN   1 1 
       1799 1 1 1 1 78 LEU HG   . 78 LEU  HG   1 1 
       1799 1 2 1 1 82 ASP HB2  . 82 ASP- HB2  1 1 
       1800 1 1 1 1 79 SER H    . 79 SER  HN   1 1 
       1800 1 2 1 1 79 SER QB   . 79 SER  HB3  1 1 
       1801 1 1 1 1 79 SER H    . 79 SER  HN   1 1 
       1801 1 2 1 1 80 PRO HD2  . 80 PRO  HD2  1 1 
       1802 1 1 1 1 79 SER H    . 79 SER  HN   1 1 
       1802 1 2 1 1 80 PRO HD3  . 80 PRO  HD3  1 1 
       1803 1 1 1 1 79 SER H    . 79 SER  HN   1 1 
       1803 1 2 1 1 81 GLN H    . 81 GLN  HN   1 1 
       1804 1 1 1 1 79 SER H    . 79 SER  HN   1 1 
       1804 1 2 1 1 82 ASP H    . 82 ASP- HN   1 1 
       1805 1 1 1 1 79 SER H    . 79 SER  HN   1 1 
       1805 1 2 1 1 82 ASP HB2  . 82 ASP- HB2  1 1 
       1806 1 1 1 1 79 SER H    . 79 SER  HN   1 1 
       1806 1 2 1 1 82 ASP HB3  . 82 ASP- HB3  1 1 
       1807 1 1 1 1 79 SER H    . 79 SER  HN   1 1 
       1807 1 2 1 1 83 ARG H    . 83 ARG+ HN   1 1 
       1808 1 1 1 1 79 SER HA   . 79 SER  HA   1 1 
       1808 1 2 1 1 80 PRO HD2  . 80 PRO  HD2  1 1 
       1809 1 1 1 1 79 SER HA   . 79 SER  HA   1 1 
       1809 1 2 1 1 80 PRO HD3  . 80 PRO  HD3  1 1 
       1810 1 1 1 1 79 SER HA   . 79 SER  HA   1 1 
       1810 1 2 1 1 81 GLN H    . 81 GLN  HN   1 1 
       1811 1 1 1 1 79 SER QB   . 79 SER  HB3  1 1 
       1811 1 2 1 1 80 PRO HD2  . 80 PRO  HD2  1 1 
       1812 1 1 1 1 79 SER QB   . 79 SER  HB2  1 1 
       1812 1 2 1 1 80 PRO HD3  . 80 PRO  HD3  1 1 
       1813 1 1 1 1 79 SER QB   . 79 SER  HB2  1 1 
       1813 1 2 1 1 81 GLN H    . 81 GLN  HN   1 1 
       1814 1 1 1 1 79 SER QB   . 79 SER  HB2  1 1 
       1814 1 2 1 1 81 GLN HB2  . 81 GLN  HB3  1 1 
       1815 1 1 1 1 79 SER QB   . 79 SER  HB2  1 1 
       1815 1 2 1 1 82 ASP H    . 82 ASP- HN   1 1 
       1816 1 1 1 1 80 PRO HA   . 80 PRO  HA   1 1 
       1816 1 2 1 1 82 ASP H    . 82 ASP- HN   1 1 
       1817 1 1 1 1 80 PRO HA   . 80 PRO  HA   1 1 
       1817 1 2 1 1 83 ARG H    . 83 ARG+ HN   1 1 
       1818 1 1 1 1 80 PRO HA   . 80 PRO  HA   1 1 
       1818 1 2 1 1 83 ARG HB2  . 83 ARG+ HB3  1 1 
       1819 1 1 1 1 80 PRO HA   . 80 PRO  HA   1 1 
       1819 1 2 1 1 83 ARG HB3  . 83 ARG+ HB2  1 1 
       1820 1 1 1 1 80 PRO HA   . 80 PRO  HA   1 1 
       1820 1 2 1 1 83 ARG QD   . 83 ARG+ QD   1 1 
       1821 1 1 1 1 80 PRO HA   . 80 PRO  HA   1 1 
       1821 1 2 1 1 84 ALA H    . 84 ALA  HN   1 1 
       1822 1 1 1 1 80 PRO HA   . 80 PRO  HA   1 1 
       1822 1 2 1 1 84 ALA MB   . 84 ALA  QB   1 1 
       1823 1 1 1 1 80 PRO HB2  . 80 PRO  HB3  1 1 
       1823 1 2 1 1 81 GLN H    . 81 GLN  HN   1 1 
       1824 1 1 1 1 80 PRO HB2  . 80 PRO  HB3  1 1 
       1824 1 2 1 1 84 ALA MB   . 84 ALA  QB   1 1 
       1825 1 1 1 1 80 PRO HB3  . 80 PRO  HB2  1 1 
       1825 1 2 1 1 81 GLN H    . 81 GLN  HN   1 1 
       1826 1 1 1 1 80 PRO HD2  . 80 PRO  HD2  1 1 
       1826 1 2 1 1 81 GLN H    . 81 GLN  HN   1 1 
       1827 1 1 1 1 80 PRO HD3  . 80 PRO  HD3  1 1 
       1827 1 2 1 1 81 GLN H    . 81 GLN  HN   1 1 
       1828 1 1 1 1 80 PRO HG2  . 80 PRO  HG2  1 1 
       1828 1 2 1 1 81 GLN H    . 81 GLN  HN   1 1 
       1829 1 1 1 1 81 GLN H    . 81 GLN  HN   1 1 
       1829 1 2 1 1 81 GLN HB2  . 81 GLN  HB3  1 1 
       1830 1 1 1 1 81 GLN H    . 81 GLN  HN   1 1 
       1830 1 2 1 1 81 GLN HB3  . 81 GLN  HB2  1 1 
       1831 1 1 1 1 81 GLN H    . 81 GLN  HN   1 1 
       1831 1 2 1 1 81 GLN HG2  . 81 GLN  HG2  1 1 
       1832 1 1 1 1 81 GLN H    . 81 GLN  HN   1 1 
       1832 1 2 1 1 81 GLN HG3  . 81 GLN  HG3  1 1 
       1833 1 1 1 1 81 GLN H    . 81 GLN  HN   1 1 
       1833 1 2 1 1 82 ASP H    . 82 ASP- HN   1 1 
       1834 1 1 1 1 81 GLN H    . 81 GLN  HN   1 1 
       1834 1 2 1 1 82 ASP HB2  . 82 ASP- HB2  1 1 
       1835 1 1 1 1 81 GLN H    . 81 GLN  HN   1 1 
       1835 1 2 1 1 83 ARG H    . 83 ARG+ HN   1 1 
       1836 1 1 1 1 81 GLN H    . 81 GLN  HN   1 1 
       1836 1 2 1 1 84 ALA MB   . 84 ALA  QB   1 1 
       1837 1 1 1 1 81 GLN HA   . 81 GLN  HA   1 1 
       1837 1 2 1 1 81 GLN HG2  . 81 GLN  HG2  1 1 
       1838 1 1 1 1 81 GLN HA   . 81 GLN  HA   1 1 
       1838 1 2 1 1 81 GLN HG3  . 81 GLN  HG3  1 1 
       1839 1 1 1 1 81 GLN HA   . 81 GLN  HA   1 1 
       1839 1 2 1 1 83 ARG H    . 83 ARG+ HN   1 1 
       1840 1 1 1 1 81 GLN HA   . 81 GLN  HA   1 1 
       1840 1 2 1 1 84 ALA MB   . 84 ALA  QB   1 1 
       1841 1 1 1 1 81 GLN HB2  . 81 GLN  HB3  1 1 
       1841 1 2 1 1 82 ASP H    . 82 ASP- HN   1 1 
       1842 1 1 1 1 81 GLN HB2  . 81 GLN  HB3  1 1 
       1842 1 2 1 1 83 ARG H    . 83 ARG+ HN   1 1 
       1843 1 1 1 1 81 GLN HB2  . 81 GLN  HB3  1 1 
       1843 1 2 1 1 84 ALA MB   . 84 ALA  QB   1 1 
       1844 1 1 1 1 81 GLN HB3  . 81 GLN  HB2  1 1 
       1844 1 2 1 1 82 ASP H    . 82 ASP- HN   1 1 
       1845 1 1 1 1 81 GLN HB3  . 81 GLN  HB2  1 1 
       1845 1 2 1 1 84 ALA MB   . 84 ALA  QB   1 1 
       1846 1 1 1 1 81 GLN HG2  . 81 GLN  HG2  1 1 
       1846 1 2 1 1 84 ALA MB   . 84 ALA  QB   1 1 
       1847 1 1 1 1 81 GLN HG3  . 81 GLN  HG3  1 1 
       1847 1 2 1 1 82 ASP H    . 82 ASP- HN   1 1 
       1848 1 1 1 1 81 GLN HG3  . 81 GLN  HG3  1 1 
       1848 1 2 1 1 84 ALA MB   . 84 ALA  QB   1 1 
       1849 1 1 1 1 82 ASP H    . 82 ASP- HN   1 1 
       1849 1 2 1 1 82 ASP HB2  . 82 ASP- HB2  1 1 
       1850 1 1 1 1 82 ASP H    . 82 ASP- HN   1 1 
       1850 1 2 1 1 82 ASP HB3  . 82 ASP- HB3  1 1 
       1851 1 1 1 1 82 ASP H    . 82 ASP- HN   1 1 
       1851 1 2 1 1 83 ARG H    . 83 ARG+ HN   1 1 
       1852 1 1 1 1 82 ASP H    . 82 ASP- HN   1 1 
       1852 1 2 1 1 84 ALA H    . 84 ALA  HN   1 1 
       1853 1 1 1 1 82 ASP H    . 82 ASP- HN   1 1 
       1853 1 2 1 1 84 ALA MB   . 84 ALA  QB   1 1 
       1854 1 1 1 1 82 ASP HA   . 82 ASP- HA   1 1 
       1854 1 2 1 1 84 ALA H    . 84 ALA  HN   1 1 
       1855 1 1 1 1 82 ASP HA   . 82 ASP- HA   1 1 
       1855 1 2 1 1 85 ALA H    . 85 ALA  HN   1 1 
       1856 1 1 1 1 82 ASP HA   . 82 ASP- HA   1 1 
       1856 1 2 1 1 85 ALA MB   . 85 ALA  QB   1 1 
       1857 1 1 1 1 82 ASP HA   . 82 ASP- HA   1 1 
       1857 1 2 1 1 86 TYR H    . 86 TYR  HN   1 1 
       1858 1 1 1 1 82 ASP HB2  . 82 ASP- HB2  1 1 
       1858 1 2 1 1 83 ARG H    . 83 ARG+ HN   1 1 
       1859 1 1 1 1 82 ASP HB3  . 82 ASP- HB3  1 1 
       1859 1 2 1 1 83 ARG H    . 83 ARG+ HN   1 1 
       1860 1 1 1 1 82 ASP HB3  . 82 ASP- HB3  1 1 
       1860 1 2 1 1 85 ALA MB   . 85 ALA  QB   1 1 
       1861 1 1 1 1 82 ASP HB3  . 82 ASP- HB3  1 1 
       1861 1 2 1 1 86 TYR HB3  . 86 TYR  HB3  1 1 
       1862 1 1 1 1 83 ARG H    . 83 ARG+ HN   1 1 
       1862 1 2 1 1 83 ARG HB2  . 83 ARG+ HB3  1 1 
       1863 1 1 1 1 83 ARG H    . 83 ARG+ HN   1 1 
       1863 1 2 1 1 83 ARG HB3  . 83 ARG+ HB2  1 1 
       1864 1 1 1 1 83 ARG H    . 83 ARG+ HN   1 1 
       1864 1 2 1 1 83 ARG QD   . 83 ARG+ QD   1 1 
       1865 1 1 1 1 83 ARG H    . 83 ARG+ HN   1 1 
       1865 1 2 1 1 83 ARG QG   . 83 ARG+ QG   1 1 
       1866 1 1 1 1 83 ARG H    . 83 ARG+ HN   1 1 
       1866 1 2 1 1 84 ALA H    . 84 ALA  HN   1 1 
       1867 1 1 1 1 83 ARG H    . 83 ARG+ HN   1 1 
       1867 1 2 1 1 84 ALA HA   . 84 ALA  HA   1 1 
       1868 1 1 1 1 83 ARG H    . 83 ARG+ HN   1 1 
       1868 1 2 1 1 84 ALA MB   . 84 ALA  QB   1 1 
       1869 1 1 1 1 83 ARG H    . 83 ARG+ HN   1 1 
       1869 1 2 1 1 85 ALA H    . 85 ALA  HN   1 1 
       1870 1 1 1 1 83 ARG HA   . 83 ARG+ HA   1 1 
       1870 1 2 1 1 83 ARG QD   . 83 ARG+ QD   1 1 
       1871 1 1 1 1 83 ARG HA   . 83 ARG+ HA   1 1 
       1871 1 2 1 1 83 ARG QG   . 83 ARG+ QG   1 1 
       1872 1 1 1 1 83 ARG HA   . 83 ARG+ HA   1 1 
       1872 1 2 1 1 84 ALA MB   . 84 ALA  QB   1 1 
       1873 1 1 1 1 83 ARG HA   . 83 ARG+ HA   1 1 
       1873 1 2 1 1 85 ALA H    . 85 ALA  HN   1 1 
       1874 1 1 1 1 83 ARG HA   . 83 ARG+ HA   1 1 
       1874 1 2 1 1 85 ALA MB   . 85 ALA  QB   1 1 
       1875 1 1 1 1 83 ARG HA   . 83 ARG+ HA   1 1 
       1875 1 2 1 1 86 TYR HB3  . 86 TYR  HB3  1 1 
       1876 1 1 1 1 83 ARG HA   . 83 ARG+ HA   1 1 
       1876 1 2 1 1 86 TYR QD   . 86 TYR  QD   1 1 
       1877 1 1 1 1 83 ARG HB2  . 83 ARG+ HB3  1 1 
       1877 1 2 1 1 84 ALA H    . 84 ALA  HN   1 1 
       1878 1 1 1 1 83 ARG HB3  . 83 ARG+ HB2  1 1 
       1878 1 2 1 1 84 ALA H    . 84 ALA  HN   1 1 
       1879 1 1 1 1 83 ARG QG   . 83 ARG+ QG   1 1 
       1879 1 2 1 1 84 ALA H    . 84 ALA  HN   1 1 
       1880 1 1 1 1 83 ARG QG   . 83 ARG+ QG   1 1 
       1880 1 2 1 1 86 TYR HB3  . 86 TYR  HB3  1 1 
       1881 1 1 1 1 84 ALA H    . 84 ALA  HN   1 1 
       1881 1 2 1 1 84 ALA MB   . 84 ALA  QB   1 1 
       1882 1 1 1 1 84 ALA H    . 84 ALA  HN   1 1 
       1882 1 2 1 1 85 ALA H    . 85 ALA  HN   1 1 
       1883 1 1 1 1 84 ALA H    . 84 ALA  HN   1 1 
       1883 1 2 1 1 86 TYR H    . 86 TYR  HN   1 1 
       1884 1 1 1 1 84 ALA H    . 84 ALA  HN   1 1 
       1884 1 2 1 1 86 TYR HB3  . 86 TYR  HB3  1 1 
       1885 1 1 1 1 84 ALA H    . 84 ALA  HN   1 1 
       1885 1 2 1 1 87 LYS QB   . 87 LYS+ QB   1 1 
       1886 1 1 1 1 84 ALA HA   . 84 ALA  HA   1 1 
       1886 1 2 1 1 87 LYS H    . 87 LYS+ HN   1 1 
       1887 1 1 1 1 84 ALA HA   . 84 ALA  HA   1 1 
       1887 1 2 1 1 87 LYS QB   . 87 LYS+ QB   1 1 
       1888 1 1 1 1 84 ALA HA   . 84 ALA  HA   1 1 
       1888 1 2 1 1 88 GLU H    . 88 GLU- HN   1 1 
       1889 1 1 1 1 84 ALA MB   . 84 ALA  QB   1 1 
       1889 1 2 1 1 85 ALA H    . 85 ALA  HN   1 1 
       1890 1 1 1 1 85 ALA H    . 85 ALA  HN   1 1 
       1890 1 2 1 1 85 ALA MB   . 85 ALA  QB   1 1 
       1891 1 1 1 1 85 ALA H    . 85 ALA  HN   1 1 
       1891 1 2 1 1 86 TYR H    . 86 TYR  HN   1 1 
       1892 1 1 1 1 85 ALA H    . 85 ALA  HN   1 1 
       1892 1 2 1 1 86 TYR HA   . 86 TYR  HA   1 1 
       1893 1 1 1 1 85 ALA H    . 85 ALA  HN   1 1 
       1893 1 2 1 1 86 TYR HB3  . 86 TYR  HB3  1 1 
       1894 1 1 1 1 85 ALA H    . 85 ALA  HN   1 1 
       1894 1 2 1 1 87 LYS QB   . 87 LYS+ QB   1 1 
       1895 1 1 1 1 85 ALA H    . 85 ALA  HN   1 1 
       1895 1 2 1 1 88 GLU QB   . 88 GLU- QB   1 1 
       1896 1 1 1 1 85 ALA HA   . 85 ALA  HA   1 1 
       1896 1 2 1 1 87 LYS H    . 87 LYS+ HN   1 1 
       1897 1 1 1 1 85 ALA HA   . 85 ALA  HA   1 1 
       1897 1 2 1 1 88 GLU H    . 88 GLU- HN   1 1 
       1898 1 1 1 1 85 ALA HA   . 85 ALA  HA   1 1 
       1898 1 2 1 1 88 GLU HA   . 88 GLU- HA   1 1 
       1899 1 1 1 1 85 ALA HA   . 85 ALA  HA   1 1 
       1899 1 2 1 1 88 GLU QB   . 88 GLU- QB   1 1 
       1900 1 1 1 1 85 ALA HA   . 85 ALA  HA   1 1 
       1900 1 2 1 1 88 GLU HG2  . 88 GLU- HG2  1 1 
       1901 1 1 1 1 85 ALA HA   . 85 ALA  HA   1 1 
       1901 1 2 1 1 88 GLU HG3  . 88 GLU- HG3  1 1 
       1902 1 1 1 1 85 ALA MB   . 85 ALA  QB   1 1 
       1902 1 2 1 1 86 TYR H    . 86 TYR  HN   1 1 
       1903 1 1 1 1 85 ALA MB   . 85 ALA  QB   1 1 
       1903 1 2 1 1 86 TYR HA   . 86 TYR  HA   1 1 
       1904 1 1 1 1 85 ALA MB   . 85 ALA  QB   1 1 
       1904 1 2 1 1 86 TYR HB3  . 86 TYR  HB3  1 1 
       1905 1 1 1 1 85 ALA MB   . 85 ALA  QB   1 1 
       1905 1 2 1 1 88 GLU QB   . 88 GLU- QB   1 1 
       1906 1 1 1 1 85 ALA MB   . 85 ALA  QB   1 1 
       1906 1 2 1 1 89 TYR H    . 89 TYR  HN   1 1 
       1907 1 1 1 1 86 TYR H    . 86 TYR  HN   1 1 
       1907 1 2 1 1 86 TYR HB2  . 86 TYR  HB2  1 1 
       1908 1 1 1 1 86 TYR H    . 86 TYR  HN   1 1 
       1908 1 2 1 1 86 TYR HB3  . 86 TYR  HB3  1 1 
       1909 1 1 1 1 86 TYR H    . 86 TYR  HN   1 1 
       1909 1 2 1 1 86 TYR QD   . 86 TYR  QD   1 1 
       1910 1 1 1 1 86 TYR HA   . 86 TYR  HA   1 1 
       1910 1 2 1 1 86 TYR QD   . 86 TYR  QD   1 1 
       1911 1 1 1 1 86 TYR HA   . 86 TYR  HA   1 1 
       1911 1 2 1 1 88 GLU H    . 88 GLU- HN   1 1 
       1912 1 1 1 1 86 TYR HA   . 86 TYR  HA   1 1 
       1912 1 2 1 1 89 TYR H    . 89 TYR  HN   1 1 
       1913 1 1 1 1 86 TYR HA   . 86 TYR  HA   1 1 
       1913 1 2 1 1 89 TYR QD   . 89 TYR  QD   1 1 
       1914 1 1 1 1 86 TYR HA   . 86 TYR  HA   1 1 
       1914 1 2 1 1 90 ILE H    . 90 ILE  HN   1 1 
       1915 1 1 1 1 86 TYR HB3  . 86 TYR  HB3  1 1 
       1915 1 2 1 1 87 LYS H    . 87 LYS+ HN   1 1 
       1916 1 1 1 1 86 TYR QD   . 86 TYR  QD   1 1 
       1916 1 2 1 1 87 LYS H    . 87 LYS+ HN   1 1 
       1917 1 1 1 1 86 TYR QD   . 86 TYR  QD   1 1 
       1917 1 2 1 1 87 LYS HA   . 87 LYS+ HA   1 1 
       1918 1 1 1 1 86 TYR QD   . 86 TYR  QD   1 1 
       1918 1 2 1 1 87 LYS QB   . 87 LYS+ QB   1 1 
       1919 1 1 1 1 86 TYR QD   . 86 TYR  QD   1 1 
       1919 1 2 1 1 87 LYS HG2  . 87 LYS+ HG2  1 1 
       1920 1 1 1 1 86 TYR QD   . 86 TYR  QD   1 1 
       1920 1 2 1 1 87 LYS HG3  . 87 LYS+ HG3  1 1 
       1921 1 1 1 1 86 TYR QD   . 86 TYR  QD   1 1 
       1921 1 2 1 1 90 ILE H    . 90 ILE  HN   1 1 
       1922 1 1 1 1 86 TYR QD   . 86 TYR  QD   1 1 
       1922 1 2 1 1 90 ILE MD   . 90 ILE  QD1  1 1 
       1923 1 1 1 1 86 TYR QD   . 86 TYR  QD   1 1 
       1923 1 2 1 1 90 ILE HG12 . 90 ILE  HG12 1 1 
       1924 1 1 1 1 86 TYR QD   . 86 TYR  QD   1 1 
       1924 1 2 1 1 90 ILE HG13 . 90 ILE  HG13 1 1 
       1925 1 1 1 1 86 TYR QD   . 86 TYR  QD   1 1 
       1925 1 2 1 1 90 ILE MG   . 90 ILE  QG2  1 1 
       1926 1 1 1 1 86 TYR QE   . 86 TYR  QE   1 1 
       1926 1 2 1 1 87 LYS H    . 87 LYS+ HN   1 1 
       1927 1 1 1 1 86 TYR QE   . 86 TYR  QE   1 1 
       1927 1 2 1 1 87 LYS HA   . 87 LYS+ HA   1 1 
       1928 1 1 1 1 86 TYR QE   . 86 TYR  QE   1 1 
       1928 1 2 1 1 87 LYS HG2  . 87 LYS+ HG2  1 1 
       1929 1 1 1 1 86 TYR QE   . 86 TYR  QE   1 1 
       1929 1 2 1 1 90 ILE HB   . 90 ILE  HB   1 1 
       1930 1 1 1 1 86 TYR QE   . 86 TYR  QE   1 1 
       1930 1 2 1 1 90 ILE MD   . 90 ILE  QD1  1 1 
       1931 1 1 1 1 86 TYR QE   . 86 TYR  QE   1 1 
       1931 1 2 1 1 90 ILE HG12 . 90 ILE  HG12 1 1 
       1932 1 1 1 1 86 TYR QE   . 86 TYR  QE   1 1 
       1932 1 2 1 1 90 ILE HG13 . 90 ILE  HG13 1 1 
       1933 1 1 1 1 86 TYR QE   . 86 TYR  QE   1 1 
       1933 1 2 1 1 90 ILE MG   . 90 ILE  QG2  1 1 
       1934 1 1 1 1 87 LYS H    . 87 LYS+ HN   1 1 
       1934 1 2 1 1 87 LYS QB   . 87 LYS+ QB   1 1 
       1935 1 1 1 1 87 LYS H    . 87 LYS+ HN   1 1 
       1935 1 2 1 1 87 LYS QD   . 87 LYS+ HD3  1 1 
       1936 1 1 1 1 87 LYS H    . 87 LYS+ HN   1 1 
       1936 1 2 1 1 87 LYS HG2  . 87 LYS+ HG2  1 1 
       1937 1 1 1 1 87 LYS H    . 87 LYS+ HN   1 1 
       1937 1 2 1 1 87 LYS HG3  . 87 LYS+ HG3  1 1 
       1938 1 1 1 1 87 LYS H    . 87 LYS+ HN   1 1 
       1938 1 2 1 1 88 GLU H    . 88 GLU- HN   1 1 
       1939 1 1 1 1 87 LYS H    . 87 LYS+ HN   1 1 
       1939 1 2 1 1 90 ILE MD   . 90 ILE  QD1  1 1 
       1940 1 1 1 1 87 LYS H    . 87 LYS+ HN   1 1 
       1940 1 2 1 1 90 ILE HG13 . 90 ILE  HG13 1 1 
       1941 1 1 1 1 87 LYS HA   . 87 LYS+ HA   1 1 
       1941 1 2 1 1 87 LYS QD   . 87 LYS+ HD3  1 1 
       1942 1 1 1 1 87 LYS HA   . 87 LYS+ HA   1 1 
       1942 1 2 1 1 87 LYS HG2  . 87 LYS+ HG2  1 1 
       1943 1 1 1 1 87 LYS HA   . 87 LYS+ HA   1 1 
       1943 1 2 1 1 87 LYS HG3  . 87 LYS+ HG3  1 1 
       1944 1 1 1 1 87 LYS HA   . 87 LYS+ HA   1 1 
       1944 1 2 1 1 89 TYR H    . 89 TYR  HN   1 1 
       1945 1 1 1 1 87 LYS HA   . 87 LYS+ HA   1 1 
       1945 1 2 1 1 90 ILE H    . 90 ILE  HN   1 1 
       1946 1 1 1 1 87 LYS HA   . 87 LYS+ HA   1 1 
       1946 1 2 1 1 90 ILE HB   . 90 ILE  HB   1 1 
       1947 1 1 1 1 87 LYS HA   . 87 LYS+ HA   1 1 
       1947 1 2 1 1 90 ILE MD   . 90 ILE  QD1  1 1 
       1948 1 1 1 1 87 LYS HA   . 87 LYS+ HA   1 1 
       1948 1 2 1 1 90 ILE HG12 . 90 ILE  HG12 1 1 
       1949 1 1 1 1 87 LYS HA   . 87 LYS+ HA   1 1 
       1949 1 2 1 1 90 ILE HG13 . 90 ILE  HG13 1 1 
       1950 1 1 1 1 87 LYS HA   . 87 LYS+ HA   1 1 
       1950 1 2 1 1 90 ILE MG   . 90 ILE  QG2  1 1 
       1951 1 1 1 1 87 LYS QB   . 87 LYS+ QB   1 1 
       1951 1 2 1 1 88 GLU H    . 88 GLU- HN   1 1 
       1952 1 1 1 1 87 LYS QD   . 87 LYS+ HD3  1 1 
       1952 1 2 1 1 88 GLU H    . 88 GLU- HN   1 1 
       1953 1 1 1 1 87 LYS QD   . 87 LYS+ HD3  1 1 
       1953 1 2 1 1 90 ILE HB   . 90 ILE  HB   1 1 
       1954 1 1 1 1 87 LYS HG2  . 87 LYS+ HG2  1 1 
       1954 1 2 1 1 88 GLU H    . 88 GLU- HN   1 1 
       1955 1 1 1 1 87 LYS HG3  . 87 LYS+ HG3  1 1 
       1955 1 2 1 1 90 ILE HG13 . 90 ILE  HG13 1 1 
       1956 1 1 1 1 88 GLU H    . 88 GLU- HN   1 1 
       1956 1 2 1 1 88 GLU QB   . 88 GLU- QB   1 1 
       1957 1 1 1 1 88 GLU H    . 88 GLU- HN   1 1 
       1957 1 2 1 1 88 GLU HG2  . 88 GLU- HG2  1 1 
       1958 1 1 1 1 88 GLU H    . 88 GLU- HN   1 1 
       1958 1 2 1 1 88 GLU HG3  . 88 GLU- HG3  1 1 
       1959 1 1 1 1 88 GLU H    . 88 GLU- HN   1 1 
       1959 1 2 1 1 89 TYR QB   . 89 TYR  QB   1 1 
       1960 1 1 1 1 88 GLU HA   . 88 GLU- HA   1 1 
       1960 1 2 1 1 88 GLU HG2  . 88 GLU- HG2  1 1 
       1961 1 1 1 1 88 GLU HA   . 88 GLU- HA   1 1 
       1961 1 2 1 1 88 GLU HG3  . 88 GLU- HG3  1 1 
       1962 1 1 1 1 88 GLU HA   . 88 GLU- HA   1 1 
       1962 1 2 1 1 90 ILE H    . 90 ILE  HN   1 1 
       1963 1 1 1 1 88 GLU HA   . 88 GLU- HA   1 1 
       1963 1 2 1 1 91 SER H    . 91 SER  HN   1 1 
       1964 1 1 1 1 88 GLU QB   . 88 GLU- QB   1 1 
       1964 1 2 1 1 88 GLU HG3  . 88 GLU- HG3  1 1 
       1965 1 1 1 1 88 GLU QB   . 88 GLU- QB   1 1 
       1965 1 2 1 1 89 TYR H    . 89 TYR  HN   1 1 
       1966 1 1 1 1 88 GLU QB   . 88 GLU- QB   1 1 
       1966 1 2 1 1 89 TYR HA   . 89 TYR  HA   1 1 
       1967 1 1 1 1 88 GLU QB   . 88 GLU- QB   1 1 
       1967 1 2 1 1 92 ASN HD21 . 92 ASN  HD21 1 1 
       1968 1 1 1 1 88 GLU QB   . 88 GLU- QB   1 1 
       1968 1 2 1 1 92 ASN HD22 . 92 ASN  HD22 1 1 
       1969 1 1 1 1 88 GLU HG2  . 88 GLU- HG2  1 1 
       1969 1 2 1 1 89 TYR H    . 89 TYR  HN   1 1 
       1970 1 1 1 1 88 GLU HG2  . 88 GLU- HG2  1 1 
       1970 1 2 1 1 92 ASN HD21 . 92 ASN  HD21 1 1 
       1971 1 1 1 1 88 GLU HG3  . 88 GLU- HG3  1 1 
       1971 1 2 1 1 89 TYR H    . 89 TYR  HN   1 1 
       1972 1 1 1 1 88 GLU HG3  . 88 GLU- HG3  1 1 
       1972 1 2 1 1 92 ASN HD21 . 92 ASN  HD21 1 1 
       1973 1 1 1 1 88 GLU HG3  . 88 GLU- HG3  1 1 
       1973 1 2 1 1 92 ASN HD22 . 92 ASN  HD22 1 1 
       1974 1 1 1 1 89 TYR H    . 89 TYR  HN   1 1 
       1974 1 2 1 1 89 TYR QB   . 89 TYR  QB   1 1 
       1975 1 1 1 1 89 TYR H    . 89 TYR  HN   1 1 
       1975 1 2 1 1 89 TYR QD   . 89 TYR  QD   1 1 
       1976 1 1 1 1 89 TYR H    . 89 TYR  HN   1 1 
       1976 1 2 1 1 90 ILE HA   . 90 ILE  HA   1 1 
       1977 1 1 1 1 89 TYR H    . 89 TYR  HN   1 1 
       1977 1 2 1 1 90 ILE MD   . 90 ILE  QD1  1 1 
       1978 1 1 1 1 89 TYR H    . 89 TYR  HN   1 1 
       1978 1 2 1 1 90 ILE HG13 . 90 ILE  HG13 1 1 
       1979 1 1 1 1 89 TYR H    . 89 TYR  HN   1 1 
       1979 1 2 1 1 91 SER H    . 91 SER  HN   1 1 
       1980 1 1 1 1 89 TYR HA   . 89 TYR  HA   1 1 
       1980 1 2 1 1 89 TYR QD   . 89 TYR  QD   1 1 
       1981 1 1 1 1 89 TYR HA   . 89 TYR  HA   1 1 
       1981 1 2 1 1 92 ASN QB   . 92 ASN  QB   1 1 
       1982 1 1 1 1 89 TYR HA   . 89 TYR  HA   1 1 
       1982 1 2 1 1 92 ASN HD21 . 92 ASN  HD21 1 1 
       1983 1 1 1 1 89 TYR QB   . 89 TYR  QB   1 1 
       1983 1 2 1 1 90 ILE H    . 90 ILE  HN   1 1 
       1984 1 1 1 1 89 TYR QB   . 89 TYR  QB   1 1 
       1984 1 2 1 1 90 ILE HB   . 90 ILE  HB   1 1 
       1985 1 1 1 1 89 TYR QB   . 89 TYR  QB   1 1 
       1985 1 2 1 1 90 ILE MD   . 90 ILE  QD1  1 1 
       1986 1 1 1 1 89 TYR QB   . 89 TYR  QB   1 1 
       1986 1 2 1 1 90 ILE HG12 . 90 ILE  HG12 1 1 
       1987 1 1 1 1 89 TYR QB   . 89 TYR  QB   1 1 
       1987 1 2 1 1 90 ILE HG13 . 90 ILE  HG13 1 1 
       1988 1 1 1 1 89 TYR QB   . 89 TYR  QB   1 1 
       1988 1 2 1 1 91 SER H    . 91 SER  HN   1 1 
       1989 1 1 1 1 89 TYR QD   . 89 TYR  QD   1 1 
       1989 1 2 1 1 90 ILE H    . 90 ILE  HN   1 1 
       1990 1 1 1 1 89 TYR QD   . 89 TYR  QD   1 1 
       1990 1 2 1 1 90 ILE HA   . 90 ILE  HA   1 1 
       1991 1 1 1 1 89 TYR QD   . 89 TYR  QD   1 1 
       1991 1 2 1 1 90 ILE HB   . 90 ILE  HB   1 1 
       1992 1 1 1 1 89 TYR QD   . 89 TYR  QD   1 1 
       1992 1 2 1 1 90 ILE MD   . 90 ILE  QD1  1 1 
       1993 1 1 1 1 89 TYR QD   . 89 TYR  QD   1 1 
       1993 1 2 1 1 90 ILE HG12 . 90 ILE  HG12 1 1 
       1994 1 1 1 1 89 TYR QD   . 89 TYR  QD   1 1 
       1994 1 2 1 1 90 ILE HG13 . 90 ILE  HG13 1 1 
       1995 1 1 1 1 89 TYR QD   . 89 TYR  QD   1 1 
       1995 1 2 1 1 93 LYS QD   . 93 LYS+ QD   1 1 
       1996 1 1 1 1 89 TYR QE   . 89 TYR  QE   1 1 
       1996 1 2 1 1 90 ILE H    . 90 ILE  HN   1 1 
       1997 1 1 1 1 89 TYR QE   . 89 TYR  QE   1 1 
       1997 1 2 1 1 90 ILE HA   . 90 ILE  HA   1 1 
       1998 1 1 1 1 89 TYR QE   . 89 TYR  QE   1 1 
       1998 1 2 1 1 90 ILE MD   . 90 ILE  QD1  1 1 
       1999 1 1 1 1 89 TYR QE   . 89 TYR  QE   1 1 
       1999 1 2 1 1 93 LYS QD   . 93 LYS+ QD   1 1 
       2000 1 1 1 1 89 TYR QE   . 89 TYR  QE   1 1 
       2000 1 2 1 1 93 LYS HE2  . 93 LYS+ HE2  1 1 
       2001 1 1 1 1 89 TYR QE   . 89 TYR  QE   1 1 
       2001 1 2 1 1 93 LYS QG   . 93 LYS+ QG   1 1 
       2002 1 1 1 1 90 ILE H    . 90 ILE  HN   1 1 
       2002 1 2 1 1 90 ILE HB   . 90 ILE  HB   1 1 
       2003 1 1 1 1 90 ILE H    . 90 ILE  HN   1 1 
       2003 1 2 1 1 90 ILE MD   . 90 ILE  QD1  1 1 
       2004 1 1 1 1 90 ILE H    . 90 ILE  HN   1 1 
       2004 1 2 1 1 90 ILE HG12 . 90 ILE  HG12 1 1 
       2005 1 1 1 1 90 ILE H    . 90 ILE  HN   1 1 
       2005 1 2 1 1 90 ILE HG13 . 90 ILE  HG13 1 1 
       2006 1 1 1 1 90 ILE H    . 90 ILE  HN   1 1 
       2006 1 2 1 1 90 ILE MG   . 90 ILE  QG2  1 1 
       2007 1 1 1 1 90 ILE H    . 90 ILE  HN   1 1 
       2007 1 2 1 1 91 SER H    . 91 SER  HN   1 1 
       2008 1 1 1 1 90 ILE H    . 90 ILE  HN   1 1 
       2008 1 2 1 1 91 SER QB   . 91 SER  QB   1 1 
       2009 1 1 1 1 90 ILE HA   . 90 ILE  HA   1 1 
       2009 1 2 1 1 90 ILE MD   . 90 ILE  QD1  1 1 
       2010 1 1 1 1 90 ILE HA   . 90 ILE  HA   1 1 
       2010 1 2 1 1 90 ILE HG13 . 90 ILE  HG13 1 1 
       2011 1 1 1 1 90 ILE HA   . 90 ILE  HA   1 1 
       2011 1 2 1 1 90 ILE MG   . 90 ILE  QG2  1 1 
       2012 1 1 1 1 90 ILE HA   . 90 ILE  HA   1 1 
       2012 1 2 1 1 93 LYS H    . 93 LYS+ HN   1 1 
       2013 1 1 1 1 90 ILE HA   . 90 ILE  HA   1 1 
       2013 1 2 1 1 93 LYS HB2  . 93 LYS+ HB2  1 1 
       2014 1 1 1 1 90 ILE HA   . 90 ILE  HA   1 1 
       2014 1 2 1 1 93 LYS HB3  . 93 LYS+ HB3  1 1 
       2015 1 1 1 1 90 ILE HA   . 90 ILE  HA   1 1 
       2015 1 2 1 1 93 LYS QD   . 93 LYS+ QD   1 1 
       2016 1 1 1 1 90 ILE HB   . 90 ILE  HB   1 1 
       2016 1 2 1 1 90 ILE MD   . 90 ILE  QD1  1 1 
       2017 1 1 1 1 90 ILE HB   . 90 ILE  HB   1 1 
       2017 1 2 1 1 91 SER H    . 91 SER  HN   1 1 
       2018 1 1 1 1 90 ILE HB   . 90 ILE  HB   1 1 
       2018 1 2 1 1 91 SER HA   . 91 SER  HA   1 1 
       2019 1 1 1 1 90 ILE HG12 . 90 ILE  HG12 1 1 
       2019 1 2 1 1 90 ILE MG   . 90 ILE  QG2  1 1 
       2020 1 1 1 1 90 ILE HG12 . 90 ILE  HG12 1 1 
       2020 1 2 1 1 91 SER H    . 91 SER  HN   1 1 
       2021 1 1 1 1 90 ILE HG13 . 90 ILE  HG13 1 1 
       2021 1 2 1 1 90 ILE MG   . 90 ILE  QG2  1 1 
       2022 1 1 1 1 90 ILE HG13 . 90 ILE  HG13 1 1 
       2022 1 2 1 1 91 SER H    . 91 SER  HN   1 1 
       2023 1 1 1 1 90 ILE MG   . 90 ILE  QG2  1 1 
       2023 1 2 1 1 91 SER H    . 91 SER  HN   1 1 
       2024 1 1 1 1 90 ILE MG   . 90 ILE  QG2  1 1 
       2024 1 2 1 1 91 SER HA   . 91 SER  HA   1 1 
       2025 1 1 1 1 90 ILE MG   . 90 ILE  QG2  1 1 
       2025 1 2 1 1 91 SER QB   . 91 SER  QB   1 1 
       2026 1 1 1 1 90 ILE MG   . 90 ILE  QG2  1 1 
       2026 1 2 1 1 93 LYS H    . 93 LYS+ HN   1 1 
       2027 1 1 1 1 90 ILE MG   . 90 ILE  QG2  1 1 
       2027 1 2 1 1 94 ARG HD2  . 94 ARG+ HD2  1 1 
       2028 1 1 1 1 90 ILE MG   . 90 ILE  QG2  1 1 
       2028 1 2 1 1 94 ARG HG2  . 94 ARG+ HG2  1 1 
       2029 1 1 1 1 90 ILE MG   . 90 ILE  QG2  1 1 
       2029 1 2 1 1 94 ARG HG3  . 94 ARG+ HG3  1 1 
       2030 1 1 1 1 91 SER H    . 91 SER  HN   1 1 
       2030 1 2 1 1 91 SER QB   . 91 SER  QB   1 1 
       2031 1 1 1 1 91 SER H    . 91 SER  HN   1 1 
       2031 1 2 1 1 92 ASN H    . 92 ASN  HN   1 1 
       2032 1 1 1 1 91 SER H    . 91 SER  HN   1 1 
       2032 1 2 1 1 92 ASN HA   . 92 ASN  HA   1 1 
       2033 1 1 1 1 91 SER HA   . 91 SER  HA   1 1 
       2033 1 2 1 1 93 LYS H    . 93 LYS+ HN   1 1 
       2034 1 1 1 1 91 SER QB   . 91 SER  QB   1 1 
       2034 1 2 1 1 92 ASN H    . 92 ASN  HN   1 1 
       2035 1 1 1 1 91 SER QB   . 91 SER  QB   1 1 
       2035 1 2 1 1 92 ASN QB   . 92 ASN  QB   1 1 
       2036 1 1 1 1 92 ASN H    . 92 ASN  HN   1 1 
       2036 1 2 1 1 92 ASN QB   . 92 ASN  QB   1 1 
       2037 1 1 1 1 92 ASN H    . 92 ASN  HN   1 1 
       2037 1 2 1 1 92 ASN HD21 . 92 ASN  HD21 1 1 
       2038 1 1 1 1 92 ASN H    . 92 ASN  HN   1 1 
       2038 1 2 1 1 92 ASN HD22 . 92 ASN  HD22 1 1 
       2039 1 1 1 1 92 ASN H    . 92 ASN  HN   1 1 
       2039 1 2 1 1 93 LYS HB2  . 93 LYS+ HB2  1 1 
       2040 1 1 1 1 92 ASN QB   . 92 ASN  QB   1 1 
       2040 1 2 1 1 93 LYS H    . 93 LYS+ HN   1 1 
       2041 1 1 1 1 92 ASN QB   . 92 ASN  QB   1 1 
       2041 1 2 1 1 93 LYS HA   . 93 LYS+ HA   1 1 
       2042 1 1 1 1 93 LYS H    . 93 LYS+ HN   1 1 
       2042 1 2 1 1 93 LYS HB2  . 93 LYS+ HB2  1 1 
       2043 1 1 1 1 93 LYS H    . 93 LYS+ HN   1 1 
       2043 1 2 1 1 93 LYS HB3  . 93 LYS+ HB3  1 1 
       2044 1 1 1 1 93 LYS H    . 93 LYS+ HN   1 1 
       2044 1 2 1 1 93 LYS QG   . 93 LYS+ QG   1 1 
       2045 1 1 1 1 93 LYS HA   . 93 LYS+ HA   1 1 
       2045 1 2 1 1 93 LYS QD   . 93 LYS+ QD   1 1 
       2046 1 1 1 1 93 LYS HA   . 93 LYS+ HA   1 1 
       2046 1 2 1 1 93 LYS HE2  . 93 LYS+ HE2  1 1 
       2047 1 1 1 1 93 LYS HA   . 93 LYS+ HA   1 1 
       2047 1 2 1 1 93 LYS QG   . 93 LYS+ QG   1 1 
       2048 1 1 1 1 93 LYS HB2  . 93 LYS+ HB2  1 1 
       2048 1 2 1 1 93 LYS HE2  . 93 LYS+ HE2  1 1 
       2049 1 1 1 1 93 LYS HB3  . 93 LYS+ HB3  1 1 
       2049 1 2 1 1 94 ARG H    . 94 ARG+ HN   1 1 
       2050 1 1 1 1 93 LYS QD   . 93 LYS+ QD   1 1 
       2050 1 2 1 1 94 ARG H    . 94 ARG+ HN   1 1 
       2051 1 1 1 1 93 LYS QG   . 93 LYS+ QG   1 1 
       2051 1 2 1 1 94 ARG H    . 94 ARG+ HN   1 1 
       2052 1 1 1 1 94 ARG H    . 94 ARG+ HN   1 1 
       2052 1 2 1 1 94 ARG HB2  . 94 ARG+ HB2  1 1 
       2053 1 1 1 1 94 ARG H    . 94 ARG+ HN   1 1 
       2053 1 2 1 1 94 ARG HB3  . 94 ARG+ HB3  1 1 
       2054 1 1 1 1 94 ARG H    . 94 ARG+ HN   1 1 
       2054 1 2 1 1 94 ARG HG2  . 94 ARG+ HG2  1 1 
       2055 1 1 1 1 94 ARG H    . 94 ARG+ HN   1 1 
       2055 1 2 1 1 94 ARG HG3  . 94 ARG+ HG3  1 1 
       2056 1 1 1 1 94 ARG HA   . 94 ARG+ HA   1 1 
       2056 1 2 1 1 94 ARG HD2  . 94 ARG+ HD2  1 1 
       2057 1 1 1 1 94 ARG HA   . 94 ARG+ HA   1 1 
       2057 1 2 1 1 94 ARG HG2  . 94 ARG+ HG2  1 1 
       2058 1 1 1 1 94 ARG HA   . 94 ARG+ HA   1 1 
       2058 1 2 1 1 94 ARG HG3  . 94 ARG+ HG3  1 1 
       2059 1 1 1 1 94 ARG HA   . 94 ARG+ HA   1 1 
       2059 1 2 1 1 95 LYS H    . 95 LYS+ HN   1 1 
       2060 1 1 1 1 94 ARG HB2  . 94 ARG+ HB2  1 1 
       2060 1 2 1 1 94 ARG HD2  . 94 ARG+ HD2  1 1 
       2061 1 1 1 1 94 ARG HB2  . 94 ARG+ HB2  1 1 
       2061 1 2 1 1 94 ARG HG2  . 94 ARG+ HG2  1 1 
       2062 1 1 1 1 94 ARG HB3  . 94 ARG+ HB3  1 1 
       2062 1 2 1 1 94 ARG HD2  . 94 ARG+ HD2  1 1 
       2063 1 1 1 1 94 ARG HB3  . 94 ARG+ HB3  1 1 
       2063 1 2 1 1 94 ARG HG3  . 94 ARG+ HG3  1 1 
       2064 1 1 1 1 94 ARG HB3  . 94 ARG+ HB3  1 1 
       2064 1 2 1 1 95 LYS H    . 95 LYS+ HN   1 1 
       2065 1 1 1 1 94 ARG HG2  . 94 ARG+ HG2  1 1 
       2065 1 2 1 1 95 LYS H    . 95 LYS+ HN   1 1 
       2066 1 1 1 1 95 LYS H    . 95 LYS+ HN   1 1 
       2066 1 2 1 1 95 LYS HB2  . 95 LYS+ HB2  1 1 
       2067 1 1 1 1 95 LYS H    . 95 LYS+ HN   1 1 
       2067 1 2 1 1 95 LYS HB3  . 95 LYS+ HB3  1 1 
       2068 1 1 1 1 95 LYS H    . 95 LYS+ HN   1 1 
       2068 1 2 1 1 95 LYS HG2  . 95 LYS+ HG2  1 1 
       2069 1 1 1 1 95 LYS HA   . 95 LYS+ HA   1 1 
       2069 1 2 1 1 95 LYS QD   . 95 LYS+ QD   1 1 
       2070 1 1 1 1 95 LYS HA   . 95 LYS+ HA   1 1 
       2070 1 2 1 1 95 LYS HG3  . 95 LYS+ HG3  1 1 
       2071 1 1 1 1 95 LYS HA   . 95 LYS+ HA   1 1 
       2071 1 2 1 1 96 SER HA   . 96 SER  HA   1 1 
       2072 1 1 1 1 95 LYS HB2  . 95 LYS+ HB2  1 1 
       2072 1 2 1 1 96 SER H    . 96 SER  HN   1 1 
       2073 1 1 1 1 95 LYS HB3  . 95 LYS+ HB3  1 1 
       2073 1 2 1 1 96 SER H    . 96 SER  HN   1 1 
       2074 1 1 1 1 96 SER HA   . 96 SER  HA   1 1 
       2074 1 2 1 1 96 SER HB3  . 96 SER  HB3  1 1 
       2075 1 1 1 1 96 SER HB3  . 96 SER  HB3  1 1 
       2075 1 2 1 1 97 GLY H    . 97 GLY  HN   1 1 
       2076 1 1 1 1 97 GLY QA   . 97 GLY  QA   1 1 
       2076 1 2 1 1 98 PRO HD3  . 98 PRO  HD3  1 1 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

          1 1 . . . . . . . 5.06 1 1 
          2 1 . . . . . . .  5.5 1 1 
          3 1 . . . . . . . 5.04 1 1 
          4 1 . . . . . . . 4.95 1 1 
          5 1 . . . . . . . 5.09 1 1 
          6 1 . . . . . . . 4.47 1 1 
          7 1 . . . . . . .  5.5 1 1 
          8 1 . . . . . . . 5.19 1 1 
          9 1 . . . . . . . 5.34 1 1 
         10 1 . . . . . . . 2.88 1 1 
         11 1 . . . . . . . 4.28 1 1 
         12 1 . . . . . . . 4.95 1 1 
         13 1 . . . . . . . 4.04 1 1 
         14 1 . . . . . . . 4.95 1 1 
         15 1 . . . . . . . 3.67 1 1 
         16 1 . . . . . . . 3.62 1 1 
         17 1 . . . . . . . 4.41 1 1 
         18 1 . . . . . . . 4.32 1 1 
         19 1 . . . . . . . 4.69 1 1 
         20 1 . . . . . . . 3.98 1 1 
         21 1 . . . . . . . 4.23 1 1 
         22 1 . . . . . . . 4.42 1 1 
         23 1 . . . . . . . 4.41 1 1 
         24 1 . . . . . . . 4.18 1 1 
         25 1 . . . . . . . 5.35 1 1 
         26 1 . . . . . . . 4.04 1 1 
         27 1 . . . . . . . 4.56 1 1 
         28 1 . . . . . . . 5.06 1 1 
         29 1 . . . . . . .  5.5 1 1 
         30 1 . . . . . . . 5.06 1 1 
         31 1 . . . . . . . 5.19 1 1 
         32 1 . . . . . . . 5.03 1 1 
         33 1 . . . . . . . 4.15 1 1 
         34 1 . . . . . . . 5.19 1 1 
         35 1 . . . . . . . 5.35 1 1 
         36 1 . . . . . . . 3.99 1 1 
         37 1 . . . . . . . 5.35 1 1 
         38 1 . . . . . . . 4.95 1 1 
         39 1 . . . . . . . 4.69 1 1 
         40 1 . . . . . . . 4.25 1 1 
         41 1 . . . . . . . 5.19 1 1 
         42 1 . . . . . . . 5.19 1 1 
         43 1 . . . . . . . 3.07 1 1 
         44 1 . . . . . . . 4.77 1 1 
         45 1 . . . . . . . 3.83 1 1 
         46 1 . . . . . . . 5.19 1 1 
         47 1 . . . . . . .  5.5 1 1 
         48 1 . . . . . . . 3.77 1 1 
         49 1 . . . . . . . 3.67 1 1 
         50 1 . . . . . . . 2.88 1 1 
         51 1 . . . . . . . 5.06 1 1 
         52 1 . . . . . . . 4.85 1 1 
         53 1 . . . . . . . 5.03 1 1 
         54 1 . . . . . . . 3.72 1 1 
         55 1 . . . . . . . 2.44 1 1 
         56 1 . . . . . . . 3.01 1 1 
         57 1 . . . . . . . 3.55 1 1 
         58 1 . . . . . . .  3.8 1 1 
         59 1 . . . . . . . 3.25 1 1 
         60 1 . . . . . . . 4.41 1 1 
         61 1 . . . . . . . 5.04 1 1 
         62 1 . . . . . . . 4.23 1 1 
         63 1 . . . . . . .  4.8 1 1 
         64 1 . . . . . . . 4.69 1 1 
         65 1 . . . . . . . 4.25 1 1 
         66 1 . . . . . . . 3.99 1 1 
         67 1 . . . . . . . 4.32 1 1 
         68 1 . . . . . . . 4.18 1 1 
         69 1 . . . . . . . 4.85 1 1 
         70 1 . . . . . . . 3.38 1 1 
         71 1 . . . . . . . 4.27 1 1 
         72 1 . . . . . . . 4.55 1 1 
         73 1 . . . . . . . 3.45 1 1 
         74 1 . . . . . . . 3.32 1 1 
         75 1 . . . . . . .  3.3 1 1 
         76 1 . . . . . . . 5.42 1 1 
         77 1 . . . . . . .  5.5 1 1 
         78 1 . . . . . . . 4.41 1 1 
         79 1 . . . . . . . 4.45 1 1 
         80 1 . . . . . . . 4.45 1 1 
         81 1 . . . . . . . 4.45 1 1 
         82 1 . . . . . . . 3.48 1 1 
         83 1 . . . . . . . 3.89 1 1 
         84 1 . . . . . . . 4.95 1 1 
         85 1 . . . . . . . 5.19 1 1 
         86 1 . . . . . . . 4.41 1 1 
         87 1 . . . . . . . 4.36 1 1 
         88 1 . . . . . . . 4.09 1 1 
         89 1 . . . . . . . 4.15 1 1 
         90 1 . . . . . . . 5.19 1 1 
         91 1 . . . . . . . 5.35 1 1 
         92 1 . . . . . . . 4.36 1 1 
         93 1 . . . . . . . 4.12 1 1 
         94 1 . . . . . . . 4.85 1 1 
         95 1 . . . . . . . 4.62 1 1 
         96 1 . . . . . . . 3.94 1 1 
         97 1 . . . . . . . 5.47 1 1 
         98 1 . . . . . . .  3.8 1 1 
         99 1 . . . . . . . 4.45 1 1 
        100 1 . . . . . . . 4.51 1 1 
        101 1 . . . . . . . 5.04 1 1 
        102 1 . . . . . . . 4.15 1 1 
        103 1 . . . . . . . 3.62 1 1 
        104 1 . . . . . . . 3.16 1 1 
        105 1 . . . . . . . 4.85 1 1 
        106 1 . . . . . . . 5.06 1 1 
        107 1 . . . . . . . 4.69 1 1 
        108 1 . . . . . . . 4.62 1 1 
        109 1 . . . . . . . 5.06 1 1 
        110 1 . . . . . . . 5.06 1 1 
        111 1 . . . . . . . 4.62 1 1 
        112 1 . . . . . . . 4.05 1 1 
        113 1 . . . . . . . 3.68 1 1 
        114 1 . . . . . . . 4.32 1 1 
        115 1 . . . . . . . 4.77 1 1 
        116 1 . . . . . . . 4.51 1 1 
        117 1 . . . . . . . 3.99 1 1 
        118 1 . . . . . . . 5.06 1 1 
        119 1 . . . . . . . 4.85 1 1 
        120 1 . . . . . . . 4.77 1 1 
        121 1 . . . . . . . 4.04 1 1 
        122 1 . . . . . . .  5.5 1 1 
        123 1 . . . . . . .  5.5 1 1 
        124 1 . . . . . . . 4.95 1 1 
        125 1 . . . . . . . 4.85 1 1 
        126 1 . . . . . . . 4.25 1 1 
        127 1 . . . . . . . 5.19 1 1 
        128 1 . . . . . . . 5.19 1 1 
        129 1 . . . . . . . 4.95 1 1 
        130 1 . . . . . . . 5.06 1 1 
        131 1 . . . . . . . 3.99 1 1 
        132 1 . . . . . . . 3.95 1 1 
        133 1 . . . . . . . 4.62 1 1 
        134 1 . . . . . . . 4.87 1 1 
        135 1 . . . . . . . 4.21 1 1 
        136 1 . . . . . . . 4.18 1 1 
        137 1 . . . . . . . 5.21 1 1 
        138 1 . . . . . . .  3.7 1 1 
        139 1 . . . . . . . 4.21 1 1 
        140 1 . . . . . . . 4.04 1 1 
        141 1 . . . . . . . 4.32 1 1 
        142 1 . . . . . . . 3.38 1 1 
        143 1 . . . . . . .  4.0 1 1 
        144 1 . . . . . . .  5.5 1 1 
        145 1 . . . . . . . 5.21 1 1 
        146 1 . . . . . . . 5.34 1 1 
        147 1 . . . . . . . 4.32 1 1 
        148 1 . . . . . . . 4.25 1 1 
        149 1 . . . . . . . 4.41 1 1 
        150 1 . . . . . . . 3.97 1 1 
        151 1 . . . . . . . 4.62 1 1 
        152 1 . . . . . . . 5.19 1 1 
        153 1 . . . . . . . 5.27 1 1 
        154 1 . . . . . . . 4.64 1 1 
        155 1 . . . . . . . 5.06 1 1 
        156 1 . . . . . . . 3.87 1 1 
        157 1 . . . . . . . 5.06 1 1 
        158 1 . . . . . . . 4.95 1 1 
        159 1 . . . . . . . 5.35 1 1 
        160 1 . . . . . . . 4.79 1 1 
        161 1 . . . . . . .  5.5 1 1 
        162 1 . . . . . . .  5.5 1 1 
        163 1 . . . . . . .  5.5 1 1 
        164 1 . . . . . . . 4.25 1 1 
        165 1 . . . . . . . 4.54 1 1 
        166 1 . . . . . . .  4.7 1 1 
        167 1 . . . . . . . 4.62 1 1 
        168 1 . . . . . . . 5.15 1 1 
        169 1 . . . . . . .  5.5 1 1 
        170 1 . . . . . . .  5.5 1 1 
        171 1 . . . . . . . 5.21 1 1 
        172 1 . . . . . . .  4.2 1 1 
        173 1 . . . . . . . 4.51 1 1 
        174 1 . . . . . . . 5.35 1 1 
        175 1 . . . . . . . 5.27 1 1 
        176 1 . . . . . . . 4.73 1 1 
        177 1 . . . . . . . 4.62 1 1 
        178 1 . . . . . . . 4.62 1 1 
        179 1 . . . . . . . 3.87 1 1 
        180 1 . . . . . . . 4.62 1 1 
        181 1 . . . . . . . 5.03 1 1 
        182 1 . . . . . . . 4.95 1 1 
        183 1 . . . . . . . 4.25 1 1 
        184 1 . . . . . . . 4.32 1 1 
        185 1 . . . . . . . 5.03 1 1 
        186 1 . . . . . . . 3.96 1 1 
        187 1 . . . . . . . 4.77 1 1 
        188 1 . . . . . . . 4.62 1 1 
        189 1 . . . . . . . 4.95 1 1 
        190 1 . . . . . . . 5.06 1 1 
        191 1 . . . . . . . 4.87 1 1 
        192 1 . . . . . . . 4.04 1 1 
        193 1 . . . . . . .  3.6 1 1 
        194 1 . . . . . . . 3.56 1 1 
        195 1 . . . . . . . 4.87 1 1 
        196 1 . . . . . . . 3.79 1 1 
        197 1 . . . . . . .  5.5 1 1 
        198 1 . . . . . . . 4.91 1 1 
        199 1 . . . . . . .  5.5 1 1 
        200 1 . . . . . . . 4.99 1 1 
        201 1 . . . . . . . 4.51 1 1 
        202 1 . . . . . . . 3.73 1 1 
        203 1 . . . . . . . 5.19 1 1 
        204 1 . . . . . . . 4.45 1 1 
        205 1 . . . . . . . 4.12 1 1 
        206 1 . . . . . . . 5.03 1 1 
        207 1 . . . . . . .  5.5 1 1 
        208 1 . . . . . . .  4.9 1 1 
        209 1 . . . . . . .  4.9 1 1 
        210 1 . . . . . . . 5.35 1 1 
        211 1 . . . . . . . 4.69 1 1 
        212 1 . . . . . . . 4.56 1 1 
        213 1 . . . . . . . 5.38 1 1 
        214 1 . . . . . . . 4.55 1 1 
        215 1 . . . . . . .  3.9 1 1 
        216 1 . . . . . . . 4.99 1 1 
        217 1 . . . . . . .  4.9 1 1 
        218 1 . . . . . . . 4.62 1 1 
        219 1 . . . . . . .  4.7 1 1 
        220 1 . . . . . . . 5.06 1 1 
        221 1 . . . . . . .  4.7 1 1 
        222 1 . . . . . . .  4.9 1 1 
        223 1 . . . . . . . 5.19 1 1 
        224 1 . . . . . . . 4.85 1 1 
        225 1 . . . . . . . 4.27 1 1 
        226 1 . . . . . . . 4.37 1 1 
        227 1 . . . . . . . 4.55 1 1 
        228 1 . . . . . . . 4.91 1 1 
        229 1 . . . . . . . 3.32 1 1 
        230 1 . . . . . . . 4.73 1 1 
        231 1 . . . . . . .  4.9 1 1 
        232 1 . . . . . . . 4.55 1 1 
        233 1 . . . . . . . 4.37 1 1 
        234 1 . . . . . . . 5.19 1 1 
        235 1 . . . . . . .  4.9 1 1 
        236 1 . . . . . . . 5.19 1 1 
        237 1 . . . . . . . 3.39 1 1 
        238 1 . . . . . . .  4.7 1 1 
        239 1 . . . . . . . 3.47 1 1 
        240 1 . . . . . . .  5.5 1 1 
        241 1 . . . . . . . 4.55 1 1 
        242 1 . . . . . . .  4.9 1 1 
        243 1 . . . . . . . 3.73 1 1 
        244 1 . . . . . . . 3.68 1 1 
        245 1 . . . . . . . 4.42 1 1 
        246 1 . . . . . . .  5.5 1 1 
        247 1 . . . . . . . 5.38 1 1 
        248 1 . . . . . . . 3.97 1 1 
        249 1 . . . . . . . 3.59 1 1 
        250 1 . . . . . . . 4.79 1 1 
        251 1 . . . . . . . 4.36 1 1 
        252 1 . . . . . . . 4.01 1 1 
        253 1 . . . . . . . 4.01 1 1 
        254 1 . . . . . . . 5.21 1 1 
        255 1 . . . . . . .  3.7 1 1 
        256 1 . . . . . . . 4.45 1 1 
        257 1 . . . . . . . 3.32 1 1 
        258 1 . . . . . . . 4.85 1 1 
        259 1 . . . . . . . 4.56 1 1 
        260 1 . . . . . . . 4.36 1 1 
        261 1 . . . . . . . 4.32 1 1 
        262 1 . . . . . . . 5.09 1 1 
        263 1 . . . . . . . 3.95 1 1 
        264 1 . . . . . . .  5.5 1 1 
        265 1 . . . . . . . 4.83 1 1 
        266 1 . . . . . . . 5.19 1 1 
        267 1 . . . . . . . 3.79 1 1 
        268 1 . . . . . . . 3.85 1 1 
        269 1 . . . . . . . 4.79 1 1 
        270 1 . . . . . . . 3.89 1 1 
        271 1 . . . . . . . 5.21 1 1 
        272 1 . . . . . . . 5.04 1 1 
        273 1 . . . . . . . 4.91 1 1 
        274 1 . . . . . . .  5.5 1 1 
        275 1 . . . . . . . 4.69 1 1 
        276 1 . . . . . . . 4.69 1 1 
        277 1 . . . . . . . 3.97 1 1 
        278 1 . . . . . . . 4.95 1 1 
        279 1 . . . . . . .  5.5 1 1 
        280 1 . . . . . . . 4.06 1 1 
        281 1 . . . . . . . 4.32 1 1 
        282 1 . . . . . . . 4.25 1 1 
        283 1 . . . . . . . 3.66 1 1 
        284 1 . . . . . . . 4.05 1 1 
        285 1 . . . . . . . 4.77 1 1 
        286 1 . . . . . . . 4.87 1 1 
        287 1 . . . . . . . 4.48 1 1 
        288 1 . . . . . . .  5.5 1 1 
        289 1 . . . . . . . 4.15 1 1 
        290 1 . . . . . . . 4.48 1 1 
        291 1 . . . . . . . 4.77 1 1 
        292 1 . . . . . . .  4.7 1 1 
        293 1 . . . . . . . 4.69 1 1 
        294 1 . . . . . . . 5.42 1 1 
        295 1 . . . . . . . 5.19 1 1 
        296 1 . . . . . . . 5.19 1 1 
        297 1 . . . . . . . 4.85 1 1 
        298 1 . . . . . . . 4.19 1 1 
        299 1 . . . . . . . 4.27 1 1 
        300 1 . . . . . . . 4.56 1 1 
        301 1 . . . . . . . 5.04 1 1 
        302 1 . . . . . . . 4.36 1 1 
        303 1 . . . . . . . 4.85 1 1 
        304 1 . . . . . . . 4.08 1 1 
        305 1 . . . . . . . 4.32 1 1 
        306 1 . . . . . . . 3.77 1 1 
        307 1 . . . . . . . 3.76 1 1 
        308 1 . . . . . . . 4.59 1 1 
        309 1 . . . . . . . 3.95 1 1 
        310 1 . . . . . . . 5.04 1 1 
        311 1 . . . . . . . 5.42 1 1 
        312 1 . . . . . . . 4.99 1 1 
        313 1 . . . . . . . 4.99 1 1 
        314 1 . . . . . . .  5.5 1 1 
        315 1 . . . . . . . 3.97 1 1 
        316 1 . . . . . . . 4.56 1 1 
        317 1 . . . . . . . 4.15 1 1 
        318 1 . . . . . . . 4.36 1 1 
        319 1 . . . . . . . 4.77 1 1 
        320 1 . . . . . . . 3.92 1 1 
        321 1 . . . . . . . 4.24 1 1 
        322 1 . . . . . . . 5.19 1 1 
        323 1 . . . . . . . 4.55 1 1 
        324 1 . . . . . . .  4.8 1 1 
        325 1 . . . . . . . 4.48 1 1 
        326 1 . . . . . . . 3.89 1 1 
        327 1 . . . . . . . 5.19 1 1 
        328 1 . . . . . . .  4.9 1 1 
        329 1 . . . . . . . 4.26 1 1 
        330 1 . . . . . . . 5.19 1 1 
        331 1 . . . . . . .  5.5 1 1 
        332 1 . . . . . . . 4.51 1 1 
        333 1 . . . . . . . 4.85 1 1 
        334 1 . . . . . . . 4.19 1 1 
        335 1 . . . . . . . 5.19 1 1 
        336 1 . . . . . . . 4.95 1 1 
        337 1 . . . . . . . 5.06 1 1 
        338 1 . . . . . . . 4.32 1 1 
        339 1 . . . . . . . 5.19 1 1 
        340 1 . . . . . . .  4.9 1 1 
        341 1 . . . . . . .  4.9 1 1 
        342 1 . . . . . . . 4.56 1 1 
        343 1 . . . . . . . 5.38 1 1 
        344 1 . . . . . . . 4.08 1 1 
        345 1 . . . . . . . 3.93 1 1 
        346 1 . . . . . . . 4.06 1 1 
        347 1 . . . . . . . 4.56 1 1 
        348 1 . . . . . . . 3.47 1 1 
        349 1 . . . . . . . 5.04 1 1 
        350 1 . . . . . . . 5.38 1 1 
        351 1 . . . . . . . 4.23 1 1 
        352 1 . . . . . . . 4.37 1 1 
        353 1 . . . . . . . 4.18 1 1 
        354 1 . . . . . . . 4.62 1 1 
        355 1 . . . . . . . 4.45 1 1 
        356 1 . . . . . . . 4.69 1 1 
        357 1 . . . . . . .  5.5 1 1 
        358 1 . . . . . . . 4.91 1 1 
        359 1 . . . . . . . 3.99 1 1 
        360 1 . . . . . . . 4.42 1 1 
        361 1 . . . . . . . 4.05 1 1 
        362 1 . . . . . . . 4.18 1 1 
        363 1 . . . . . . . 5.19 1 1 
        364 1 . . . . . . . 3.91 1 1 
        365 1 . . . . . . . 5.21 1 1 
        366 1 . . . . . . . 4.69 1 1 
        367 1 . . . . . . . 3.81 1 1 
        368 1 . . . . . . . 3.57 1 1 
        369 1 . . . . . . . 4.69 1 1 
        370 1 . . . . . . . 4.69 1 1 
        371 1 . . . . . . .  4.8 1 1 
        372 1 . . . . . . . 4.62 1 1 
        373 1 . . . . . . . 4.62 1 1 
        374 1 . . . . . . . 5.19 1 1 
        375 1 . . . . . . . 4.48 1 1 
        376 1 . . . . . . . 3.85 1 1 
        377 1 . . . . . . . 3.92 1 1 
        378 1 . . . . . . . 4.83 1 1 
        379 1 . . . . . . . 4.83 1 1 
        380 1 . . . . . . . 4.67 1 1 
        381 1 . . . . . . . 4.32 1 1 
        382 1 . . . . . . . 4.95 1 1 
        383 1 . . . . . . . 4.56 1 1 
        384 1 . . . . . . . 4.95 1 1 
        385 1 . . . . . . . 4.51 1 1 
        386 1 . . . . . . . 4.99 1 1 
        387 1 . . . . . . . 5.06 1 1 
        388 1 . . . . . . . 4.95 1 1 
        389 1 . . . . . . . 3.85 1 1 
        390 1 . . . . . . . 3.26 1 1 
        391 1 . . . . . . . 4.06 1 1 
        392 1 . . . . . . . 4.85 1 1 
        393 1 . . . . . . . 5.06 1 1 
        394 1 . . . . . . . 4.95 1 1 
        395 1 . . . . . . .  5.5 1 1 
        396 1 . . . . . . . 4.45 1 1 
        397 1 . . . . . . . 4.32 1 1 
        398 1 . . . . . . . 3.63 1 1 
        399 1 . . . . . . . 3.06 1 1 
        400 1 . . . . . . . 3.95 1 1 
        401 1 . . . . . . . 4.34 1 1 
        402 1 . . . . . . . 5.34 1 1 
        403 1 . . . . . . . 5.27 1 1 
        404 1 . . . . . . .  5.5 1 1 
        405 1 . . . . . . . 5.15 1 1 
        406 1 . . . . . . .  5.5 1 1 
        407 1 . . . . . . . 5.06 1 1 
        408 1 . . . . . . . 4.18 1 1 
        409 1 . . . . . . .  3.8 1 1 
        410 1 . . . . . . . 5.34 1 1 
        411 1 . . . . . . . 4.06 1 1 
        412 1 . . . . . . . 3.83 1 1 
        413 1 . . . . . . . 4.69 1 1 
        414 1 . . . . . . . 4.04 1 1 
        415 1 . . . . . . . 4.85 1 1 
        416 1 . . . . . . . 3.91 1 1 
        417 1 . . . . . . . 4.83 1 1 
        418 1 . . . . . . . 4.77 1 1 
        419 1 . . . . . . . 4.99 1 1 
        420 1 . . . . . . . 4.95 1 1 
        421 1 . . . . . . . 5.21 1 1 
        422 1 . . . . . . . 5.35 1 1 
        423 1 . . . . . . . 2.99 1 1 
        424 1 . . . . . . . 3.42 1 1 
        425 1 . . . . . . . 4.01 1 1 
        426 1 . . . . . . . 3.62 1 1 
        427 1 . . . . . . . 4.64 1 1 
        428 1 . . . . . . . 3.83 1 1 
        429 1 . . . . . . . 3.15 1 1 
        430 1 . . . . . . . 3.93 1 1 
        431 1 . . . . . . . 3.67 1 1 
        432 1 . . . . . . . 4.85 1 1 
        433 1 . . . . . . . 3.99 1 1 
        434 1 . . . . . . . 4.25 1 1 
        435 1 . . . . . . . 4.91 1 1 
        436 1 . . . . . . . 4.91 1 1 
        437 1 . . . . . . . 4.85 1 1 
        438 1 . . . . . . . 5.34 1 1 
        439 1 . . . . . . . 5.35 1 1 
        440 1 . . . . . . . 5.35 1 1 
        441 1 . . . . . . . 5.35 1 1 
        442 1 . . . . . . . 4.69 1 1 
        443 1 . . . . . . . 3.31 1 1 
        444 1 . . . . . . .  3.9 1 1 
        445 1 . . . . . . . 4.09 1 1 
        446 1 . . . . . . . 4.15 1 1 
        447 1 . . . . . . . 3.77 1 1 
        448 1 . . . . . . . 3.75 1 1 
        449 1 . . . . . . .  5.5 1 1 
        450 1 . . . . . . . 5.09 1 1 
        451 1 . . . . . . . 4.99 1 1 
        452 1 . . . . . . . 4.76 1 1 
        453 1 . . . . . . . 4.41 1 1 
        454 1 . . . . . . . 4.15 1 1 
        455 1 . . . . . . . 3.19 1 1 
        456 1 . . . . . . . 3.33 1 1 
        457 1 . . . . . . . 4.21 1 1 
        458 1 . . . . . . . 3.88 1 1 
        459 1 . . . . . . . 4.09 1 1 
        460 1 . . . . . . . 4.45 1 1 
        461 1 . . . . . . . 4.45 1 1 
        462 1 . . . . . . . 4.62 1 1 
        463 1 . . . . . . . 5.09 1 1 
        464 1 . . . . . . . 5.15 1 1 
        465 1 . . . . . . . 4.56 1 1 
        466 1 . . . . . . . 3.45 1 1 
        467 1 . . . . . . . 3.72 1 1 
        468 1 . . . . . . . 4.25 1 1 
        469 1 . . . . . . . 4.77 1 1 
        470 1 . . . . . . .  3.8 1 1 
        471 1 . . . . . . . 3.67 1 1 
        472 1 . . . . . . . 4.77 1 1 
        473 1 . . . . . . . 4.04 1 1 
        474 1 . . . . . . . 3.58 1 1 
        475 1 . . . . . . . 4.35 1 1 
        476 1 . . . . . . . 3.95 1 1 
        477 1 . . . . . . . 3.95 1 1 
        478 1 . . . . . . . 4.28 1 1 
        479 1 . . . . . . . 5.35 1 1 
        480 1 . . . . . . . 3.95 1 1 
        481 1 . . . . . . . 4.85 1 1 
        482 1 . . . . . . . 4.09 1 1 
        483 1 . . . . . . . 5.06 1 1 
        484 1 . . . . . . .  5.5 1 1 
        485 1 . . . . . . . 5.19 1 1 
        486 1 . . . . . . .  5.5 1 1 
        487 1 . . . . . . . 4.12 1 1 
        488 1 . . . . . . . 4.12 1 1 
        489 1 . . . . . . . 4.85 1 1 
        490 1 . . . . . . . 5.19 1 1 
        491 1 . . . . . . . 4.09 1 1 
        492 1 . . . . . . . 3.91 1 1 
        493 1 . . . . . . . 3.31 1 1 
        494 1 . . . . . . . 4.12 1 1 
        495 1 . . . . . . . 3.38 1 1 
        496 1 . . . . . . .  5.5 1 1 
        497 1 . . . . . . . 4.32 1 1 
        498 1 . . . . . . . 3.97 1 1 
        499 1 . . . . . . . 4.18 1 1 
        500 1 . . . . . . . 3.97 1 1 
        501 1 . . . . . . . 3.91 1 1 
        502 1 . . . . . . . 5.19 1 1 
        503 1 . . . . . . . 5.06 1 1 
        504 1 . . . . . . .  5.5 1 1 
        505 1 . . . . . . . 3.99 1 1 
        506 1 . . . . . . . 4.21 1 1 
        507 1 . . . . . . . 4.85 1 1 
        508 1 . . . . . . .  3.7 1 1 
        509 1 . . . . . . . 4.18 1 1 
        510 1 . . . . . . . 3.95 1 1 
        511 1 . . . . . . . 5.19 1 1 
        512 1 . . . . . . . 4.45 1 1 
        513 1 . . . . . . . 3.15 1 1 
        514 1 . . . . . . . 3.97 1 1 
        515 1 . . . . . . . 4.28 1 1 
        516 1 . . . . . . . 4.25 1 1 
        517 1 . . . . . . . 4.51 1 1 
        518 1 . . . . . . . 4.36 1 1 
        519 1 . . . . . . . 4.25 1 1 
        520 1 . . . . . . . 4.12 1 1 
        521 1 . . . . . . . 3.97 1 1 
        522 1 . . . . . . . 4.85 1 1 
        523 1 . . . . . . . 4.95 1 1 
        524 1 . . . . . . . 4.85 1 1 
        525 1 . . . . . . .  5.4 1 1 
        526 1 . . . . . . . 5.06 1 1 
        527 1 . . . . . . . 3.66 1 1 
        528 1 . . . . . . . 4.12 1 1 
        529 1 . . . . . . . 3.92 1 1 
        530 1 . . . . . . . 3.46 1 1 
        531 1 . . . . . . . 3.61 1 1 
        532 1 . . . . . . . 4.87 1 1 
        533 1 . . . . . . . 4.28 1 1 
        534 1 . . . . . . .  5.5 1 1 
        535 1 . . . . . . . 3.78 1 1 
        536 1 . . . . . . . 3.15 1 1 
        537 1 . . . . . . . 3.82 1 1 
        538 1 . . . . . . . 5.19 1 1 
        539 1 . . . . . . . 4.51 1 1 
        540 1 . . . . . . . 5.06 1 1 
        541 1 . . . . . . . 4.45 1 1 
        542 1 . . . . . . . 4.03 1 1 
        543 1 . . . . . . . 4.95 1 1 
        544 1 . . . . . . . 4.49 1 1 
        545 1 . . . . . . . 5.35 1 1 
        546 1 . . . . . . . 4.62 1 1 
        547 1 . . . . . . . 3.62 1 1 
        548 1 . . . . . . . 4.79 1 1 
        549 1 . . . . . . .  5.5 1 1 
        550 1 . . . . . . . 3.97 1 1 
        551 1 . . . . . . .  3.7 1 1 
        552 1 . . . . . . . 5.06 1 1 
        553 1 . . . . . . . 4.95 1 1 
        554 1 . . . . . . . 5.06 1 1 
        555 1 . . . . . . .  3.3 1 1 
        556 1 . . . . . . . 5.19 1 1 
        557 1 . . . . . . . 3.26 1 1 
        558 1 . . . . . . . 3.39 1 1 
        559 1 . . . . . . .  5.5 1 1 
        560 1 . . . . . . . 5.06 1 1 
        561 1 . . . . . . .  5.5 1 1 
        562 1 . . . . . . . 5.21 1 1 
        563 1 . . . . . . . 4.95 1 1 
        564 1 . . . . . . . 5.09 1 1 
        565 1 . . . . . . . 3.67 1 1 
        566 1 . . . . . . . 3.66 1 1 
        567 1 . . . . . . . 3.76 1 1 
        568 1 . . . . . . . 5.09 1 1 
        569 1 . . . . . . . 5.34 1 1 
        570 1 . . . . . . . 3.58 1 1 
        571 1 . . . . . . . 5.34 1 1 
        572 1 . . . . . . . 4.99 1 1 
        573 1 . . . . . . . 4.91 1 1 
        574 1 . . . . . . .  5.5 1 1 
        575 1 . . . . . . .  5.5 1 1 
        576 1 . . . . . . . 5.15 1 1 
        577 1 . . . . . . . 5.06 1 1 
        578 1 . . . . . . . 4.69 1 1 
        579 1 . . . . . . .  5.5 1 1 
        580 1 . . . . . . . 5.04 1 1 
        581 1 . . . . . . . 5.06 1 1 
        582 1 . . . . . . . 4.56 1 1 
        583 1 . . . . . . .  5.5 1 1 
        584 1 . . . . . . . 4.85 1 1 
        585 1 . . . . . . . 4.62 1 1 
        586 1 . . . . . . . 3.76 1 1 
        587 1 . . . . . . .  5.5 1 1 
        588 1 . . . . . . .  5.5 1 1 
        589 1 . . . . . . . 5.21 1 1 
        590 1 . . . . . . . 5.42 1 1 
        591 1 . . . . . . . 5.27 1 1 
        592 1 . . . . . . . 4.95 1 1 
        593 1 . . . . . . . 4.28 1 1 
        594 1 . . . . . . . 4.64 1 1 
        595 1 . . . . . . . 5.27 1 1 
        596 1 . . . . . . .  4.7 1 1 
        597 1 . . . . . . . 4.77 1 1 
        598 1 . . . . . . . 4.45 1 1 
        599 1 . . . . . . . 3.42 1 1 
        600 1 . . . . . . . 3.58 1 1 
        601 1 . . . . . . . 3.63 1 1 
        602 1 . . . . . . . 3.74 1 1 
        603 1 . . . . . . . 5.19 1 1 
        604 1 . . . . . . . 4.85 1 1 
        605 1 . . . . . . . 5.42 1 1 
        606 1 . . . . . . . 4.99 1 1 
        607 1 . . . . . . . 2.76 1 1 
        608 1 . . . . . . .  2.8 1 1 
        609 1 . . . . . . .  4.7 1 1 
        610 1 . . . . . . . 4.67 1 1 
        611 1 . . . . . . . 3.87 1 1 
        612 1 . . . . . . . 4.62 1 1 
        613 1 . . . . . . .  4.7 1 1 
        614 1 . . . . . . .  3.5 1 1 
        615 1 . . . . . . . 4.41 1 1 
        616 1 . . . . . . . 4.56 1 1 
        617 1 . . . . . . . 4.45 1 1 
        618 1 . . . . . . . 3.85 1 1 
        619 1 . . . . . . . 4.18 1 1 
        620 1 . . . . . . . 3.73 1 1 
        621 1 . . . . . . . 4.21 1 1 
        622 1 . . . . . . . 4.18 1 1 
        623 1 . . . . . . . 3.95 1 1 
        624 1 . . . . . . . 3.47 1 1 
        625 1 . . . . . . . 5.06 1 1 
        626 1 . . . . . . . 5.35 1 1 
        627 1 . . . . . . . 5.19 1 1 
        628 1 . . . . . . . 5.34 1 1 
        629 1 . . . . . . .  5.5 1 1 
        630 1 . . . . . . . 4.41 1 1 
        631 1 . . . . . . .  3.2 1 1 
        632 1 . . . . . . . 3.44 1 1 
        633 1 . . . . . . .  3.0 1 1 
        634 1 . . . . . . .  3.1 1 1 
        635 1 . . . . . . .  4.7 1 1 
        636 1 . . . . . . .  4.7 1 1 
        637 1 . . . . . . . 3.87 1 1 
        638 1 . . . . . . . 4.85 1 1 
        639 1 . . . . . . .  5.5 1 1 
        640 1 . . . . . . .  5.5 1 1 
        641 1 . . . . . . . 4.28 1 1 
        642 1 . . . . . . . 5.06 1 1 
        643 1 . . . . . . . 4.85 1 1 
        644 1 . . . . . . . 3.58 1 1 
        645 1 . . . . . . . 3.89 1 1 
        646 1 . . . . . . . 4.18 1 1 
        647 1 . . . . . . . 4.68 1 1 
        648 1 . . . . . . . 3.51 1 1 
        649 1 . . . . . . . 4.56 1 1 
        650 1 . . . . . . . 3.62 1 1 
        651 1 . . . . . . . 4.28 1 1 
        652 1 . . . . . . . 5.06 1 1 
        653 1 . . . . . . . 4.51 1 1 
        654 1 . . . . . . . 5.19 1 1 
        655 1 . . . . . . . 3.56 1 1 
        656 1 . . . . . . . 4.62 1 1 
        657 1 . . . . . . . 3.58 1 1 
        658 1 . . . . . . . 4.18 1 1 
        659 1 . . . . . . . 5.15 1 1 
        660 1 . . . . . . . 4.36 1 1 
        661 1 . . . . . . . 4.21 1 1 
        662 1 . . . . . . . 5.19 1 1 
        663 1 . . . . . . . 4.69 1 1 
        664 1 . . . . . . . 5.34 1 1 
        665 1 . . . . . . . 5.03 1 1 
        666 1 . . . . . . . 4.77 1 1 
        667 1 . . . . . . . 3.41 1 1 
        668 1 . . . . . . . 5.04 1 1 
        669 1 . . . . . . . 5.27 1 1 
        670 1 . . . . . . . 4.41 1 1 
        671 1 . . . . . . . 4.95 1 1 
        672 1 . . . . . . .  3.8 1 1 
        673 1 . . . . . . . 4.21 1 1 
        674 1 . . . . . . . 5.19 1 1 
        675 1 . . . . . . . 4.77 1 1 
        676 1 . . . . . . . 3.62 1 1 
        677 1 . . . . . . . 5.09 1 1 
        678 1 . . . . . . . 5.06 1 1 
        679 1 . . . . . . . 5.21 1 1 
        680 1 . . . . . . .  5.5 1 1 
        681 1 . . . . . . . 4.85 1 1 
        682 1 . . . . . . . 3.41 1 1 
        683 1 . . . . . . . 4.42 1 1 
        684 1 . . . . . . . 3.92 1 1 
        685 1 . . . . . . . 4.77 1 1 
        686 1 . . . . . . . 4.62 1 1 
        687 1 . . . . . . . 3.57 1 1 
        688 1 . . . . . . . 3.62 1 1 
        689 1 . . . . . . . 4.04 1 1 
        690 1 . . . . . . . 4.62 1 1 
        691 1 . . . . . . .  5.5 1 1 
        692 1 . . . . . . . 5.15 1 1 
        693 1 . . . . . . . 5.16 1 1 
        694 1 . . . . . . . 4.47 1 1 
        695 1 . . . . . . . 5.04 1 1 
        696 1 . . . . . . . 3.83 1 1 
        697 1 . . . . . . . 3.25 1 1 
        698 1 . . . . . . . 3.06 1 1 
        699 1 . . . . . . . 4.15 1 1 
        700 1 . . . . . . . 5.06 1 1 
        701 1 . . . . . . .  3.2 1 1 
        702 1 . . . . . . . 3.89 1 1 
        703 1 . . . . . . . 4.21 1 1 
        704 1 . . . . . . . 4.04 1 1 
        705 1 . . . . . . . 3.91 1 1 
        706 1 . . . . . . . 4.85 1 1 
        707 1 . . . . . . . 4.56 1 1 
        708 1 . . . . . . . 4.62 1 1 
        709 1 . . . . . . . 5.19 1 1 
        710 1 . . . . . . . 4.45 1 1 
        711 1 . . . . . . .  3.7 1 1 
        712 1 . . . . . . . 4.85 1 1 
        713 1 . . . . . . . 4.95 1 1 
        714 1 . . . . . . . 4.85 1 1 
        715 1 . . . . . . . 3.74 1 1 
        716 1 . . . . . . . 3.54 1 1 
        717 1 . . . . . . . 4.85 1 1 
        718 1 . . . . . . . 4.35 1 1 
        719 1 . . . . . . . 3.34 1 1 
        720 1 . . . . . . .  5.5 1 1 
        721 1 . . . . . . . 3.61 1 1 
        722 1 . . . . . . . 5.19 1 1 
        723 1 . . . . . . . 3.97 1 1 
        724 1 . . . . . . .  3.6 1 1 
        725 1 . . . . . . . 3.65 1 1 
        726 1 . . . . . . . 4.51 1 1 
        727 1 . . . . . . . 4.51 1 1 
        728 1 . . . . . . . 4.95 1 1 
        729 1 . . . . . . . 4.69 1 1 
        730 1 . . . . . . .  3.7 1 1 
        731 1 . . . . . . . 4.95 1 1 
        732 1 . . . . . . . 3.11 1 1 
        733 1 . . . . . . . 4.85 1 1 
        734 1 . . . . . . . 4.85 1 1 
        735 1 . . . . . . . 4.95 1 1 
        736 1 . . . . . . . 4.04 1 1 
        737 1 . . . . . . . 4.85 1 1 
        738 1 . . . . . . . 4.95 1 1 
        739 1 . . . . . . . 3.96 1 1 
        740 1 . . . . . . . 4.95 1 1 
        741 1 . . . . . . . 4.06 1 1 
        742 1 . . . . . . . 4.01 1 1 
        743 1 . . . . . . . 4.85 1 1 
        744 1 . . . . . . . 4.25 1 1 
        745 1 . . . . . . .  5.5 1 1 
        746 1 . . . . . . . 4.42 1 1 
        747 1 . . . . . . . 4.85 1 1 
        748 1 . . . . . . . 4.41 1 1 
        749 1 . . . . . . .  3.2 1 1 
        750 1 . . . . . . . 3.48 1 1 
        751 1 . . . . . . . 3.21 1 1 
        752 1 . . . . . . . 4.12 1 1 
        753 1 . . . . . . . 4.17 1 1 
        754 1 . . . . . . . 5.42 1 1 
        755 1 . . . . . . . 4.95 1 1 
        756 1 . . . . . . . 5.27 1 1 
        757 1 . . . . . . . 5.42 1 1 
        758 1 . . . . . . . 3.12 1 1 
        759 1 . . . . . . . 3.97 1 1 
        760 1 . . . . . . . 5.06 1 1 
        761 1 . . . . . . . 4.36 1 1 
        762 1 . . . . . . . 3.45 1 1 
        763 1 . . . . . . . 4.28 1 1 
        764 1 . . . . . . . 5.06 1 1 
        765 1 . . . . . . . 4.09 1 1 
        766 1 . . . . . . . 4.85 1 1 
        767 1 . . . . . . . 3.12 1 1 
        768 1 . . . . . . . 3.71 1 1 
        769 1 . . . . . . . 3.83 1 1 
        770 1 . . . . . . . 4.45 1 1 
        771 1 . . . . . . . 4.47 1 1 
        772 1 . . . . . . . 4.62 1 1 
        773 1 . . . . . . . 4.95 1 1 
        774 1 . . . . . . . 3.75 1 1 
        775 1 . . . . . . . 3.93 1 1 
        776 1 . . . . . . . 4.56 1 1 
        777 1 . . . . . . . 3.59 1 1 
        778 1 . . . . . . . 3.77 1 1 
        779 1 . . . . . . . 4.41 1 1 
        780 1 . . . . . . .  5.5 1 1 
        781 1 . . . . . . . 4.36 1 1 
        782 1 . . . . . . .  3.4 1 1 
        783 1 . . . . . . . 3.32 1 1 
        784 1 . . . . . . . 4.69 1 1 
        785 1 . . . . . . . 4.77 1 1 
        786 1 . . . . . . . 4.56 1 1 
        787 1 . . . . . . . 3.72 1 1 
        788 1 . . . . . . . 4.43 1 1 
        789 1 . . . . . . .  5.5 1 1 
        790 1 . . . . . . . 4.32 1 1 
        791 1 . . . . . . . 4.15 1 1 
        792 1 . . . . . . . 4.04 1 1 
        793 1 . . . . . . . 5.15 1 1 
        794 1 . . . . . . . 4.67 1 1 
        795 1 . . . . . . . 4.32 1 1 
        796 1 . . . . . . . 5.36 1 1 
        797 1 . . . . . . . 4.36 1 1 
        798 1 . . . . . . . 5.34 1 1 
        799 1 . . . . . . . 5.06 1 1 
        800 1 . . . . . . . 4.26 1 1 
        801 1 . . . . . . . 4.95 1 1 
        802 1 . . . . . . . 3.72 1 1 
        803 1 . . . . . . . 4.85 1 1 
        804 1 . . . . . . . 4.85 1 1 
        805 1 . . . . . . . 5.41 1 1 
        806 1 . . . . . . .  2.5 1 1 
        807 1 . . . . . . . 4.62 1 1 
        808 1 . . . . . . . 3.26 1 1 
        809 1 . . . . . . . 4.85 1 1 
        810 1 . . . . . . . 5.06 1 1 
        811 1 . . . . . . . 5.35 1 1 
        812 1 . . . . . . . 5.06 1 1 
        813 1 . . . . . . . 4.45 1 1 
        814 1 . . . . . . . 3.68 1 1 
        815 1 . . . . . . . 3.22 1 1 
        816 1 . . . . . . . 3.99 1 1 
        817 1 . . . . . . . 3.89 1 1 
        818 1 . . . . . . . 3.44 1 1 
        819 1 . . . . . . . 5.35 1 1 
        820 1 . . . . . . . 5.04 1 1 
        821 1 . . . . . . . 5.27 1 1 
        822 1 . . . . . . . 4.99 1 1 
        823 1 . . . . . . . 3.59 1 1 
        824 1 . . . . . . . 3.54 1 1 
        825 1 . . . . . . . 5.27 1 1 
        826 1 . . . . . . . 3.93 1 1 
        827 1 . . . . . . . 3.46 1 1 
        828 1 . . . . . . . 4.54 1 1 
        829 1 . . . . . . . 4.04 1 1 
        830 1 . . . . . . .  3.3 1 1 
        831 1 . . . . . . . 4.51 1 1 
        832 1 . . . . . . . 5.06 1 1 
        833 1 . . . . . . . 4.85 1 1 
        834 1 . . . . . . . 5.21 1 1 
        835 1 . . . . . . . 4.51 1 1 
        836 1 . . . . . . . 3.58 1 1 
        837 1 . . . . . . . 5.19 1 1 
        838 1 . . . . . . . 3.84 1 1 
        839 1 . . . . . . . 3.75 1 1 
        840 1 . . . . . . . 5.21 1 1 
        841 1 . . . . . . . 5.15 1 1 
        842 1 . . . . . . . 3.93 1 1 
        843 1 . . . . . . . 4.36 1 1 
        844 1 . . . . . . . 4.21 1 1 
        845 1 . . . . . . . 4.09 1 1 
        846 1 . . . . . . . 4.95 1 1 
        847 1 . . . . . . . 4.79 1 1 
        848 1 . . . . . . . 4.62 1 1 
        849 1 . . . . . . . 5.35 1 1 
        850 1 . . . . . . . 4.41 1 1 
        851 1 . . . . . . . 3.89 1 1 
        852 1 . . . . . . . 4.69 1 1 
        853 1 . . . . . . . 3.78 1 1 
        854 1 . . . . . . . 5.19 1 1 
        855 1 . . . . . . . 4.99 1 1 
        856 1 . . . . . . . 3.65 1 1 
        857 1 . . . . . . . 3.93 1 1 
        858 1 . . . . . . . 4.62 1 1 
        859 1 . . . . . . . 3.43 1 1 
        860 1 . . . . . . . 3.62 1 1 
        861 1 . . . . . . . 4.56 1 1 
        862 1 . . . . . . . 4.87 1 1 
        863 1 . . . . . . .  5.5 1 1 
        864 1 . . . . . . . 4.76 1 1 
        865 1 . . . . . . . 3.56 1 1 
        866 1 . . . . . . . 3.99 1 1 
        867 1 . . . . . . . 3.99 1 1 
        868 1 . . . . . . . 3.66 1 1 
        869 1 . . . . . . . 5.19 1 1 
        870 1 . . . . . . . 4.56 1 1 
        871 1 . . . . . . . 4.26 1 1 
        872 1 . . . . . . . 4.06 1 1 
        873 1 . . . . . . . 5.06 1 1 
        874 1 . . . . . . . 3.58 1 1 
        875 1 . . . . . . . 5.06 1 1 
        876 1 . . . . . . . 5.06 1 1 
        877 1 . . . . . . . 3.38 1 1 
        878 1 . . . . . . . 3.83 1 1 
        879 1 . . . . . . .  4.7 1 1 
        880 1 . . . . . . . 4.95 1 1 
        881 1 . . . . . . . 5.06 1 1 
        882 1 . . . . . . . 3.08 1 1 
        883 1 . . . . . . . 3.06 1 1 
        884 1 . . . . . . . 3.53 1 1 
        885 1 . . . . . . . 4.99 1 1 
        886 1 . . . . . . . 5.21 1 1 
        887 1 . . . . . . . 5.15 1 1 
        888 1 . . . . . . .  5.5 1 1 
        889 1 . . . . . . . 3.03 1 1 
        890 1 . . . . . . . 4.85 1 1 
        891 1 . . . . . . . 5.35 1 1 
        892 1 . . . . . . . 4.95 1 1 
        893 1 . . . . . . . 4.41 1 1 
        894 1 . . . . . . . 4.36 1 1 
        895 1 . . . . . . . 4.76 1 1 
        896 1 . . . . . . . 3.91 1 1 
        897 1 . . . . . . . 4.04 1 1 
        898 1 . . . . . . . 4.79 1 1 
        899 1 . . . . . . . 4.45 1 1 
        900 1 . . . . . . . 3.44 1 1 
        901 1 . . . . . . . 3.21 1 1 
        902 1 . . . . . . . 4.41 1 1 
        903 1 . . . . . . . 4.56 1 1 
        904 1 . . . . . . . 3.73 1 1 
        905 1 . . . . . . .  5.5 1 1 
        906 1 . . . . . . . 4.95 1 1 
        907 1 . . . . . . . 5.06 1 1 
        908 1 . . . . . . . 5.21 1 1 
        909 1 . . . . . . . 5.27 1 1 
        910 1 . . . . . . . 4.06 1 1 
        911 1 . . . . . . . 4.28 1 1 
        912 1 . . . . . . . 4.85 1 1 
        913 1 . . . . . . . 5.06 1 1 
        914 1 . . . . . . . 4.18 1 1 
        915 1 . . . . . . . 2.85 1 1 
        916 1 . . . . . . . 3.72 1 1 
        917 1 . . . . . . .  5.5 1 1 
        918 1 . . . . . . . 3.91 1 1 
        919 1 . . . . . . . 5.15 1 1 
        920 1 . . . . . . .  5.5 1 1 
        921 1 . . . . . . . 4.95 1 1 
        922 1 . . . . . . . 4.95 1 1 
        923 1 . . . . . . . 4.51 1 1 
        924 1 . . . . . . .  3.2 1 1 
        925 1 . . . . . . . 3.45 1 1 
        926 1 . . . . . . . 4.28 1 1 
        927 1 . . . . . . . 3.04 1 1 
        928 1 . . . . . . . 3.78 1 1 
        929 1 . . . . . . . 3.84 1 1 
        930 1 . . . . . . . 5.22 1 1 
        931 1 . . . . . . . 4.56 1 1 
        932 1 . . . . . . . 4.87 1 1 
        933 1 . . . . . . . 3.88 1 1 
        934 1 . . . . . . . 3.38 1 1 
        935 1 . . . . . . . 3.54 1 1 
        936 1 . . . . . . . 3.16 1 1 
        937 1 . . . . . . . 5.27 1 1 
        938 1 . . . . . . . 4.36 1 1 
        939 1 . . . . . . . 4.32 1 1 
        940 1 . . . . . . . 4.36 1 1 
        941 1 . . . . . . . 4.56 1 1 
        942 1 . . . . . . . 4.28 1 1 
        943 1 . . . . . . . 4.83 1 1 
        944 1 . . . . . . . 3.34 1 1 
        945 1 . . . . . . . 3.66 1 1 
        946 1 . . . . . . . 4.95 1 1 
        947 1 . . . . . . . 4.95 1 1 
        948 1 . . . . . . . 2.85 1 1 
        949 1 . . . . . . . 4.61 1 1 
        950 1 . . . . . . . 4.01 1 1 
        951 1 . . . . . . . 4.21 1 1 
        952 1 . . . . . . . 5.06 1 1 
        953 1 . . . . . . . 5.21 1 1 
        954 1 . . . . . . . 4.95 1 1 
        955 1 . . . . . . . 4.56 1 1 
        956 1 . . . . . . . 4.69 1 1 
        957 1 . . . . . . . 5.35 1 1 
        958 1 . . . . . . . 5.03 1 1 
        959 1 . . . . . . . 3.44 1 1 
        960 1 . . . . . . . 4.85 1 1 
        961 1 . . . . . . . 4.99 1 1 
        962 1 . . . . . . . 4.37 1 1 
        963 1 . . . . . . . 5.06 1 1 
        964 1 . . . . . . . 4.69 1 1 
        965 1 . . . . . . . 5.03 1 1 
        966 1 . . . . . . . 2.85 1 1 
        967 1 . . . . . . . 3.44 1 1 
        968 1 . . . . . . .  5.5 1 1 
        969 1 . . . . . . . 4.12 1 1 
        970 1 . . . . . . .  5.5 1 1 
        971 1 . . . . . . . 3.61 1 1 
        972 1 . . . . . . . 4.41 1 1 
        973 1 . . . . . . . 3.25 1 1 
        974 1 . . . . . . . 4.51 1 1 
        975 1 . . . . . . . 4.41 1 1 
        976 1 . . . . . . . 3.64 1 1 
        977 1 . . . . . . . 4.06 1 1 
        978 1 . . . . . . . 4.61 1 1 
        979 1 . . . . . . . 4.56 1 1 
        980 1 . . . . . . .  3.5 1 1 
        981 1 . . . . . . . 5.31 1 1 
        982 1 . . . . . . . 4.69 1 1 
        983 1 . . . . . . . 4.36 1 1 
        984 1 . . . . . . . 3.44 1 1 
        985 1 . . . . . . . 4.64 1 1 
        986 1 . . . . . . . 4.56 1 1 
        987 1 . . . . . . . 4.28 1 1 
        988 1 . . . . . . . 4.04 1 1 
        989 1 . . . . . . . 4.06 1 1 
        990 1 . . . . . . . 3.89 1 1 
        991 1 . . . . . . . 4.11 1 1 
        992 1 . . . . . . . 3.58 1 1 
        993 1 . . . . . . . 4.47 1 1 
        994 1 . . . . . . . 4.95 1 1 
        995 1 . . . . . . . 3.61 1 1 
        996 1 . . . . . . . 3.58 1 1 
        997 1 . . . . . . .  4.7 1 1 
        998 1 . . . . . . .  5.5 1 1 
        999 1 . . . . . . . 3.86 1 1 
       1000 1 . . . . . . . 5.06 1 1 
       1001 1 . . . . . . . 5.34 1 1 
       1002 1 . . . . . . . 3.99 1 1 
       1003 1 . . . . . . . 4.51 1 1 
       1004 1 . . . . . . . 4.06 1 1 
       1005 1 . . . . . . . 4.12 1 1 
       1006 1 . . . . . . . 3.91 1 1 
       1007 1 . . . . . . . 3.92 1 1 
       1008 1 . . . . . . . 4.16 1 1 
       1009 1 . . . . . . . 5.35 1 1 
       1010 1 . . . . . . . 3.61 1 1 
       1011 1 . . . . . . . 5.21 1 1 
       1012 1 . . . . . . . 3.89 1 1 
       1013 1 . . . . . . . 4.85 1 1 
       1014 1 . . . . . . . 4.32 1 1 
       1015 1 . . . . . . . 4.12 1 1 
       1016 1 . . . . . . . 4.85 1 1 
       1017 1 . . . . . . . 4.42 1 1 
       1018 1 . . . . . . . 4.42 1 1 
       1019 1 . . . . . . . 4.23 1 1 
       1020 1 . . . . . . . 5.21 1 1 
       1021 1 . . . . . . .  5.5 1 1 
       1022 1 . . . . . . . 4.39 1 1 
       1023 1 . . . . . . . 4.23 1 1 
       1024 1 . . . . . . .  5.5 1 1 
       1025 1 . . . . . . . 4.15 1 1 
       1026 1 . . . . . . . 4.95 1 1 
       1027 1 . . . . . . . 5.19 1 1 
       1028 1 . . . . . . .  5.5 1 1 
       1029 1 . . . . . . . 3.75 1 1 
       1030 1 . . . . . . . 5.38 1 1 
       1031 1 . . . . . . . 4.48 1 1 
       1032 1 . . . . . . . 5.19 1 1 
       1033 1 . . . . . . .  5.5 1 1 
       1034 1 . . . . . . . 5.19 1 1 
       1035 1 . . . . . . . 5.38 1 1 
       1036 1 . . . . . . . 5.03 1 1 
       1037 1 . . . . . . . 4.37 1 1 
       1038 1 . . . . . . . 3.42 1 1 
       1039 1 . . . . . . .  4.8 1 1 
       1040 1 . . . . . . . 5.15 1 1 
       1041 1 . . . . . . .  4.7 1 1 
       1042 1 . . . . . . .  4.7 1 1 
       1043 1 . . . . . . . 4.37 1 1 
       1044 1 . . . . . . . 3.92 1 1 
       1045 1 . . . . . . .  4.9 1 1 
       1046 1 . . . . . . . 5.03 1 1 
       1047 1 . . . . . . . 5.03 1 1 
       1048 1 . . . . . . . 4.18 1 1 
       1049 1 . . . . . . . 4.77 1 1 
       1050 1 . . . . . . . 4.95 1 1 
       1051 1 . . . . . . .  4.8 1 1 
       1052 1 . . . . . . .  4.7 1 1 
       1053 1 . . . . . . .  4.9 1 1 
       1054 1 . . . . . . . 3.14 1 1 
       1055 1 . . . . . . . 4.03 1 1 
       1056 1 . . . . . . . 4.04 1 1 
       1057 1 . . . . . . . 3.75 1 1 
       1058 1 . . . . . . . 5.42 1 1 
       1059 1 . . . . . . . 4.91 1 1 
       1060 1 . . . . . . . 5.21 1 1 
       1061 1 . . . . . . . 3.83 1 1 
       1062 1 . . . . . . . 4.04 1 1 
       1063 1 . . . . . . . 4.69 1 1 
       1064 1 . . . . . . . 3.72 1 1 
       1065 1 . . . . . . . 4.36 1 1 
       1066 1 . . . . . . . 3.99 1 1 
       1067 1 . . . . . . . 5.27 1 1 
       1068 1 . . . . . . . 3.91 1 1 
       1069 1 . . . . . . . 3.68 1 1 
       1070 1 . . . . . . . 4.85 1 1 
       1071 1 . . . . . . . 4.85 1 1 
       1072 1 . . . . . . . 3.97 1 1 
       1073 1 . . . . . . . 3.35 1 1 
       1074 1 . . . . . . . 3.66 1 1 
       1075 1 . . . . . . . 5.09 1 1 
       1076 1 . . . . . . . 5.34 1 1 
       1077 1 . . . . . . . 4.62 1 1 
       1078 1 . . . . . . . 4.56 1 1 
       1079 1 . . . . . . . 3.41 1 1 
       1080 1 . . . . . . . 3.22 1 1 
       1081 1 . . . . . . . 3.72 1 1 
       1082 1 . . . . . . . 4.77 1 1 
       1083 1 . . . . . . . 4.69 1 1 
       1084 1 . . . . . . . 4.15 1 1 
       1085 1 . . . . . . . 4.39 1 1 
       1086 1 . . . . . . . 3.03 1 1 
       1087 1 . . . . . . .  5.5 1 1 
       1088 1 . . . . . . . 4.05 1 1 
       1089 1 . . . . . . . 4.41 1 1 
       1090 1 . . . . . . . 3.59 1 1 
       1091 1 . . . . . . . 4.85 1 1 
       1092 1 . . . . . . . 3.34 1 1 
       1093 1 . . . . . . . 4.87 1 1 
       1094 1 . . . . . . . 4.12 1 1 
       1095 1 . . . . . . . 4.01 1 1 
       1096 1 . . . . . . . 3.17 1 1 
       1097 1 . . . . . . . 3.05 1 1 
       1098 1 . . . . . . . 3.48 1 1 
       1099 1 . . . . . . . 3.48 1 1 
       1100 1 . . . . . . . 5.21 1 1 
       1101 1 . . . . . . . 3.95 1 1 
       1102 1 . . . . . . . 4.04 1 1 
       1103 1 . . . . . . . 4.62 1 1 
       1104 1 . . . . . . . 2.96 1 1 
       1105 1 . . . . . . . 4.59 1 1 
       1106 1 . . . . . . . 5.27 1 1 
       1107 1 . . . . . . . 3.61 1 1 
       1108 1 . . . . . . . 3.89 1 1 
       1109 1 . . . . . . .  5.5 1 1 
       1110 1 . . . . . . . 4.62 1 1 
       1111 1 . . . . . . . 4.18 1 1 
       1112 1 . . . . . . . 3.87 1 1 
       1113 1 . . . . . . . 4.95 1 1 
       1114 1 . . . . . . . 4.95 1 1 
       1115 1 . . . . . . . 4.32 1 1 
       1116 1 . . . . . . . 4.04 1 1 
       1117 1 . . . . . . . 3.57 1 1 
       1118 1 . . . . . . . 3.47 1 1 
       1119 1 . . . . . . . 4.83 1 1 
       1120 1 . . . . . . . 5.34 1 1 
       1121 1 . . . . . . . 3.63 1 1 
       1122 1 . . . . . . . 5.06 1 1 
       1123 1 . . . . . . . 3.75 1 1 
       1124 1 . . . . . . . 3.89 1 1 
       1125 1 . . . . . . . 5.34 1 1 
       1126 1 . . . . . . . 4.99 1 1 
       1127 1 . . . . . . . 4.69 1 1 
       1128 1 . . . . . . . 4.85 1 1 
       1129 1 . . . . . . . 4.55 1 1 
       1130 1 . . . . . . . 4.09 1 1 
       1131 1 . . . . . . . 3.56 1 1 
       1132 1 . . . . . . . 5.09 1 1 
       1133 1 . . . . . . . 4.95 1 1 
       1134 1 . . . . . . . 3.87 1 1 
       1135 1 . . . . . . . 4.04 1 1 
       1136 1 . . . . . . . 4.45 1 1 
       1137 1 . . . . . . . 3.51 1 1 
       1138 1 . . . . . . . 5.35 1 1 
       1139 1 . . . . . . . 4.12 1 1 
       1140 1 . . . . . . . 4.37 1 1 
       1141 1 . . . . . . . 4.51 1 1 
       1142 1 . . . . . . . 5.04 1 1 
       1143 1 . . . . . . . 5.04 1 1 
       1144 1 . . . . . . . 3.84 1 1 
       1145 1 . . . . . . . 3.96 1 1 
       1146 1 . . . . . . . 4.51 1 1 
       1147 1 . . . . . . . 4.32 1 1 
       1148 1 . . . . . . .  5.5 1 1 
       1149 1 . . . . . . . 5.42 1 1 
       1150 1 . . . . . . .  5.5 1 1 
       1151 1 . . . . . . . 3.67 1 1 
       1152 1 . . . . . . . 4.15 1 1 
       1153 1 . . . . . . . 4.32 1 1 
       1154 1 . . . . . . . 3.91 1 1 
       1155 1 . . . . . . . 4.54 1 1 
       1156 1 . . . . . . .  5.5 1 1 
       1157 1 . . . . . . . 4.47 1 1 
       1158 1 . . . . . . . 4.21 1 1 
       1159 1 . . . . . . . 5.27 1 1 
       1160 1 . . . . . . . 5.34 1 1 
       1161 1 . . . . . . . 4.95 1 1 
       1162 1 . . . . . . . 4.95 1 1 
       1163 1 . . . . . . . 5.15 1 1 
       1164 1 . . . . . . .  5.5 1 1 
       1165 1 . . . . . . . 4.62 1 1 
       1166 1 . . . . . . . 4.04 1 1 
       1167 1 . . . . . . . 4.69 1 1 
       1168 1 . . . . . . . 5.06 1 1 
       1169 1 . . . . . . . 3.64 1 1 
       1170 1 . . . . . . . 4.07 1 1 
       1171 1 . . . . . . .  4.1 1 1 
       1172 1 . . . . . . . 3.63 1 1 
       1173 1 . . . . . . . 3.91 1 1 
       1174 1 . . . . . . . 4.51 1 1 
       1175 1 . . . . . . . 3.88 1 1 
       1176 1 . . . . . . . 4.62 1 1 
       1177 1 . . . . . . . 3.89 1 1 
       1178 1 . . . . . . . 3.52 1 1 
       1179 1 . . . . . . . 3.95 1 1 
       1180 1 . . . . . . . 3.29 1 1 
       1181 1 . . . . . . . 4.79 1 1 
       1182 1 . . . . . . .  5.5 1 1 
       1183 1 . . . . . . .  5.5 1 1 
       1184 1 . . . . . . . 5.34 1 1 
       1185 1 . . . . . . .  3.6 1 1 
       1186 1 . . . . . . . 3.83 1 1 
       1187 1 . . . . . . . 3.58 1 1 
       1188 1 . . . . . . . 3.72 1 1 
       1189 1 . . . . . . . 4.73 1 1 
       1190 1 . . . . . . . 4.18 1 1 
       1191 1 . . . . . . .  4.8 1 1 
       1192 1 . . . . . . . 5.25 1 1 
       1193 1 . . . . . . . 3.89 1 1 
       1194 1 . . . . . . . 5.42 1 1 
       1195 1 . . . . . . . 4.36 1 1 
       1196 1 . . . . . . .  4.8 1 1 
       1197 1 . . . . . . . 4.32 1 1 
       1198 1 . . . . . . . 3.78 1 1 
       1199 1 . . . . . . . 4.16 1 1 
       1200 1 . . . . . . . 4.39 1 1 
       1201 1 . . . . . . . 3.83 1 1 
       1202 1 . . . . . . . 4.47 1 1 
       1203 1 . . . . . . . 3.61 1 1 
       1204 1 . . . . . . . 4.95 1 1 
       1205 1 . . . . . . . 4.79 1 1 
       1206 1 . . . . . . . 4.36 1 1 
       1207 1 . . . . . . . 4.85 1 1 
       1208 1 . . . . . . . 4.06 1 1 
       1209 1 . . . . . . . 3.99 1 1 
       1210 1 . . . . . . . 4.45 1 1 
       1211 1 . . . . . . . 3.91 1 1 
       1212 1 . . . . . . . 4.41 1 1 
       1213 1 . . . . . . . 4.18 1 1 
       1214 1 . . . . . . . 3.82 1 1 
       1215 1 . . . . . . . 4.95 1 1 
       1216 1 . . . . . . . 3.87 1 1 
       1217 1 . . . . . . . 4.95 1 1 
       1218 1 . . . . . . . 3.83 1 1 
       1219 1 . . . . . . . 4.29 1 1 
       1220 1 . . . . . . . 4.85 1 1 
       1221 1 . . . . . . . 5.09 1 1 
       1222 1 . . . . . . . 5.21 1 1 
       1223 1 . . . . . . .  5.5 1 1 
       1224 1 . . . . . . . 3.35 1 1 
       1225 1 . . . . . . . 3.49 1 1 
       1226 1 . . . . . . . 3.77 1 1 
       1227 1 . . . . . . . 3.63 1 1 
       1228 1 . . . . . . . 3.61 1 1 
       1229 1 . . . . . . . 5.34 1 1 
       1230 1 . . . . . . . 5.42 1 1 
       1231 1 . . . . . . . 5.19 1 1 
       1232 1 . . . . . . . 4.59 1 1 
       1233 1 . . . . . . . 3.85 1 1 
       1234 1 . . . . . . . 5.21 1 1 
       1235 1 . . . . . . . 3.99 1 1 
       1236 1 . . . . . . . 3.63 1 1 
       1237 1 . . . . . . . 4.25 1 1 
       1238 1 . . . . . . . 4.18 1 1 
       1239 1 . . . . . . . 3.43 1 1 
       1240 1 . . . . . . .  3.4 1 1 
       1241 1 . . . . . . . 5.19 1 1 
       1242 1 . . . . . . .  3.6 1 1 
       1243 1 . . . . . . . 5.42 1 1 
       1244 1 . . . . . . . 5.09 1 1 
       1245 1 . . . . . . .  5.5 1 1 
       1246 1 . . . . . . . 4.21 1 1 
       1247 1 . . . . . . . 4.18 1 1 
       1248 1 . . . . . . . 3.85 1 1 
       1249 1 . . . . . . . 4.56 1 1 
       1250 1 . . . . . . .  5.5 1 1 
       1251 1 . . . . . . .  3.7 1 1 
       1252 1 . . . . . . . 4.09 1 1 
       1253 1 . . . . . . .  4.7 1 1 
       1254 1 . . . . . . .  4.9 1 1 
       1255 1 . . . . . . . 4.62 1 1 
       1256 1 . . . . . . . 4.62 1 1 
       1257 1 . . . . . . . 4.15 1 1 
       1258 1 . . . . . . .  4.9 1 1 
       1259 1 . . . . . . . 3.77 1 1 
       1260 1 . . . . . . .  4.8 1 1 
       1261 1 . . . . . . . 3.67 1 1 
       1262 1 . . . . . . . 3.53 1 1 
       1263 1 . . . . . . . 3.83 1 1 
       1264 1 . . . . . . . 4.55 1 1 
       1265 1 . . . . . . . 3.42 1 1 
       1266 1 . . . . . . .  5.5 1 1 
       1267 1 . . . . . . . 5.21 1 1 
       1268 1 . . . . . . .  5.5 1 1 
       1269 1 . . . . . . .  5.5 1 1 
       1270 1 . . . . . . . 3.64 1 1 
       1271 1 . . . . . . . 4.32 1 1 
       1272 1 . . . . . . . 4.45 1 1 
       1273 1 . . . . . . . 3.78 1 1 
       1274 1 . . . . . . . 4.21 1 1 
       1275 1 . . . . . . . 3.89 1 1 
       1276 1 . . . . . . . 3.78 1 1 
       1277 1 . . . . . . . 4.54 1 1 
       1278 1 . . . . . . .  5.5 1 1 
       1279 1 . . . . . . . 3.87 1 1 
       1280 1 . . . . . . .  5.5 1 1 
       1281 1 . . . . . . . 4.95 1 1 
       1282 1 . . . . . . . 5.27 1 1 
       1283 1 . . . . . . . 4.41 1 1 
       1284 1 . . . . . . .  4.9 1 1 
       1285 1 . . . . . . . 4.23 1 1 
       1286 1 . . . . . . .  3.7 1 1 
       1287 1 . . . . . . . 3.28 1 1 
       1288 1 . . . . . . . 4.85 1 1 
       1289 1 . . . . . . . 4.45 1 1 
       1290 1 . . . . . . . 4.67 1 1 
       1291 1 . . . . . . . 4.69 1 1 
       1292 1 . . . . . . . 3.87 1 1 
       1293 1 . . . . . . . 3.93 1 1 
       1294 1 . . . . . . .  4.2 1 1 
       1295 1 . . . . . . . 3.57 1 1 
       1296 1 . . . . . . . 3.99 1 1 
       1297 1 . . . . . . . 4.09 1 1 
       1298 1 . . . . . . . 3.93 1 1 
       1299 1 . . . . . . . 3.91 1 1 
       1300 1 . . . . . . . 3.62 1 1 
       1301 1 . . . . . . . 4.95 1 1 
       1302 1 . . . . . . . 4.51 1 1 
       1303 1 . . . . . . . 3.37 1 1 
       1304 1 . . . . . . . 3.29 1 1 
       1305 1 . . . . . . . 4.17 1 1 
       1306 1 . . . . . . . 4.56 1 1 
       1307 1 . . . . . . . 2.75 1 1 
       1308 1 . . . . . . .  3.8 1 1 
       1309 1 . . . . . . . 3.68 1 1 
       1310 1 . . . . . . . 3.74 1 1 
       1311 1 . . . . . . . 4.77 1 1 
       1312 1 . . . . . . .  4.0 1 1 
       1313 1 . . . . . . . 3.95 1 1 
       1314 1 . . . . . . . 3.87 1 1 
       1315 1 . . . . . . . 4.28 1 1 
       1316 1 . . . . . . . 3.74 1 1 
       1317 1 . . . . . . . 4.36 1 1 
       1318 1 . . . . . . . 5.06 1 1 
       1319 1 . . . . . . . 3.78 1 1 
       1320 1 . . . . . . . 4.62 1 1 
       1321 1 . . . . . . . 4.15 1 1 
       1322 1 . . . . . . . 3.62 1 1 
       1323 1 . . . . . . . 4.62 1 1 
       1324 1 . . . . . . . 3.89 1 1 
       1325 1 . . . . . . . 5.42 1 1 
       1326 1 . . . . . . . 3.62 1 1 
       1327 1 . . . . . . . 3.78 1 1 
       1328 1 . . . . . . . 3.47 1 1 
       1329 1 . . . . . . . 2.95 1 1 
       1330 1 . . . . . . . 3.97 1 1 
       1331 1 . . . . . . . 4.21 1 1 
       1332 1 . . . . . . . 3.83 1 1 
       1333 1 . . . . . . . 3.56 1 1 
       1334 1 . . . . . . . 4.12 1 1 
       1335 1 . . . . . . . 4.56 1 1 
       1336 1 . . . . . . .  3.8 1 1 
       1337 1 . . . . . . . 4.69 1 1 
       1338 1 . . . . . . . 3.74 1 1 
       1339 1 . . . . . . . 4.85 1 1 
       1340 1 . . . . . . . 4.99 1 1 
       1341 1 . . . . . . .  5.5 1 1 
       1342 1 . . . . . . . 4.36 1 1 
       1343 1 . . . . . . . 4.77 1 1 
       1344 1 . . . . . . . 4.51 1 1 
       1345 1 . . . . . . . 3.07 1 1 
       1346 1 . . . . . . . 5.27 1 1 
       1347 1 . . . . . . . 5.19 1 1 
       1348 1 . . . . . . . 4.09 1 1 
       1349 1 . . . . . . . 3.97 1 1 
       1350 1 . . . . . . . 4.21 1 1 
       1351 1 . . . . . . . 4.85 1 1 
       1352 1 . . . . . . . 4.62 1 1 
       1353 1 . . . . . . . 4.69 1 1 
       1354 1 . . . . . . . 3.86 1 1 
       1355 1 . . . . . . . 4.32 1 1 
       1356 1 . . . . . . . 4.83 1 1 
       1357 1 . . . . . . . 4.95 1 1 
       1358 1 . . . . . . . 5.19 1 1 
       1359 1 . . . . . . . 4.95 1 1 
       1360 1 . . . . . . . 4.21 1 1 
       1361 1 . . . . . . . 4.69 1 1 
       1362 1 . . . . . . . 5.35 1 1 
       1363 1 . . . . . . . 3.47 1 1 
       1364 1 . . . . . . . 3.71 1 1 
       1365 1 . . . . . . . 3.66 1 1 
       1366 1 . . . . . . . 3.46 1 1 
       1367 1 . . . . . . . 3.62 1 1 
       1368 1 . . . . . . . 4.69 1 1 
       1369 1 . . . . . . . 3.56 1 1 
       1370 1 . . . . . . . 5.06 1 1 
       1371 1 . . . . . . . 5.19 1 1 
       1372 1 . . . . . . . 4.85 1 1 
       1373 1 . . . . . . . 4.76 1 1 
       1374 1 . . . . . . . 3.72 1 1 
       1375 1 . . . . . . . 2.78 1 1 
       1376 1 . . . . . . . 4.62 1 1 
       1377 1 . . . . . . . 3.45 1 1 
       1378 1 . . . . . . . 3.32 1 1 
       1379 1 . . . . . . . 3.78 1 1 
       1380 1 . . . . . . .  3.6 1 1 
       1381 1 . . . . . . . 4.64 1 1 
       1382 1 . . . . . . . 3.46 1 1 
       1383 1 . . . . . . . 3.82 1 1 
       1384 1 . . . . . . . 3.58 1 1 
       1385 1 . . . . . . . 3.91 1 1 
       1386 1 . . . . . . . 4.21 1 1 
       1387 1 . . . . . . . 4.56 1 1 
       1388 1 . . . . . . . 4.85 1 1 
       1389 1 . . . . . . . 4.91 1 1 
       1390 1 . . . . . . . 2.76 1 1 
       1391 1 . . . . . . . 4.04 1 1 
       1392 1 . . . . . . . 4.95 1 1 
       1393 1 . . . . . . . 3.54 1 1 
       1394 1 . . . . . . . 4.18 1 1 
       1395 1 . . . . . . . 4.21 1 1 
       1396 1 . . . . . . . 4.69 1 1 
       1397 1 . . . . . . . 3.55 1 1 
       1398 1 . . . . . . . 3.68 1 1 
       1399 1 . . . . . . . 3.96 1 1 
       1400 1 . . . . . . . 4.09 1 1 
       1401 1 . . . . . . . 3.73 1 1 
       1402 1 . . . . . . . 4.06 1 1 
       1403 1 . . . . . . . 3.91 1 1 
       1404 1 . . . . . . . 4.79 1 1 
       1405 1 . . . . . . . 4.45 1 1 
       1406 1 . . . . . . . 5.21 1 1 
       1407 1 . . . . . . . 4.12 1 1 
       1408 1 . . . . . . . 4.36 1 1 
       1409 1 . . . . . . . 4.06 1 1 
       1410 1 . . . . . . . 3.64 1 1 
       1411 1 . . . . . . . 4.41 1 1 
       1412 1 . . . . . . . 3.54 1 1 
       1413 1 . . . . . . . 3.91 1 1 
       1414 1 . . . . . . . 4.28 1 1 
       1415 1 . . . . . . . 3.78 1 1 
       1416 1 . . . . . . . 4.12 1 1 
       1417 1 . . . . . . . 3.98 1 1 
       1418 1 . . . . . . . 4.36 1 1 
       1419 1 . . . . . . . 5.19 1 1 
       1420 1 . . . . . . .  4.2 1 1 
       1421 1 . . . . . . . 4.95 1 1 
       1422 1 . . . . . . . 5.19 1 1 
       1423 1 . . . . . . . 3.43 1 1 
       1424 1 . . . . . . . 3.49 1 1 
       1425 1 . . . . . . . 4.51 1 1 
       1426 1 . . . . . . . 3.86 1 1 
       1427 1 . . . . . . . 3.06 1 1 
       1428 1 . . . . . . . 4.18 1 1 
       1429 1 . . . . . . . 3.71 1 1 
       1430 1 . . . . . . . 3.56 1 1 
       1431 1 . . . . . . .  4.7 1 1 
       1432 1 . . . . . . . 4.32 1 1 
       1433 1 . . . . . . . 4.85 1 1 
       1434 1 . . . . . . . 3.91 1 1 
       1435 1 . . . . . . . 3.34 1 1 
       1436 1 . . . . . . . 2.91 1 1 
       1437 1 . . . . . . . 3.65 1 1 
       1438 1 . . . . . . . 4.91 1 1 
       1439 1 . . . . . . . 5.06 1 1 
       1440 1 . . . . . . . 5.19 1 1 
       1441 1 . . . . . . . 4.18 1 1 
       1442 1 . . . . . . . 4.56 1 1 
       1443 1 . . . . . . . 4.21 1 1 
       1444 1 . . . . . . . 4.85 1 1 
       1445 1 . . . . . . . 4.28 1 1 
       1446 1 . . . . . . .  3.2 1 1 
       1447 1 . . . . . . . 5.27 1 1 
       1448 1 . . . . . . .  5.5 1 1 
       1449 1 . . . . . . . 3.75 1 1 
       1450 1 . . . . . . . 3.63 1 1 
       1451 1 . . . . . . .  5.5 1 1 
       1452 1 . . . . . . . 5.04 1 1 
       1453 1 . . . . . . . 4.76 1 1 
       1454 1 . . . . . . .  5.5 1 1 
       1455 1 . . . . . . . 3.66 1 1 
       1456 1 . . . . . . . 4.56 1 1 
       1457 1 . . . . . . . 3.53 1 1 
       1458 1 . . . . . . . 4.67 1 1 
       1459 1 . . . . . . . 5.03 1 1 
       1460 1 . . . . . . . 3.75 1 1 
       1461 1 . . . . . . . 4.95 1 1 
       1462 1 . . . . . . . 4.48 1 1 
       1463 1 . . . . . . . 4.76 1 1 
       1464 1 . . . . . . . 4.95 1 1 
       1465 1 . . . . . . . 5.38 1 1 
       1466 1 . . . . . . .  3.3 1 1 
       1467 1 . . . . . . . 4.05 1 1 
       1468 1 . . . . . . . 3.75 1 1 
       1469 1 . . . . . . . 5.42 1 1 
       1470 1 . . . . . . . 3.37 1 1 
       1471 1 . . . . . . . 4.85 1 1 
       1472 1 . . . . . . .  5.5 1 1 
       1473 1 . . . . . . . 4.51 1 1 
       1474 1 . . . . . . . 4.06 1 1 
       1475 1 . . . . . . . 3.95 1 1 
       1476 1 . . . . . . . 4.56 1 1 
       1477 1 . . . . . . . 3.89 1 1 
       1478 1 . . . . . . . 4.85 1 1 
       1479 1 . . . . . . . 4.05 1 1 
       1480 1 . . . . . . . 3.97 1 1 
       1481 1 . . . . . . . 4.12 1 1 
       1482 1 . . . . . . . 4.85 1 1 
       1483 1 . . . . . . . 4.48 1 1 
       1484 1 . . . . . . . 4.12 1 1 
       1485 1 . . . . . . . 3.22 1 1 
       1486 1 . . . . . . . 5.35 1 1 
       1487 1 . . . . . . . 3.15 1 1 
       1488 1 . . . . . . .  5.5 1 1 
       1489 1 . . . . . . . 4.41 1 1 
       1490 1 . . . . . . . 4.51 1 1 
       1491 1 . . . . . . . 3.95 1 1 
       1492 1 . . . . . . . 4.56 1 1 
       1493 1 . . . . . . . 4.95 1 1 
       1494 1 . . . . . . .  5.5 1 1 
       1495 1 . . . . . . . 4.85 1 1 
       1496 1 . . . . . . . 4.85 1 1 
       1497 1 . . . . . . . 3.46 1 1 
       1498 1 . . . . . . . 4.04 1 1 
       1499 1 . . . . . . . 5.06 1 1 
       1500 1 . . . . . . . 4.77 1 1 
       1501 1 . . . . . . . 3.77 1 1 
       1502 1 . . . . . . . 4.56 1 1 
       1503 1 . . . . . . . 3.77 1 1 
       1504 1 . . . . . . . 4.77 1 1 
       1505 1 . . . . . . . 3.82 1 1 
       1506 1 . . . . . . . 5.06 1 1 
       1507 1 . . . . . . . 4.95 1 1 
       1508 1 . . . . . . . 4.95 1 1 
       1509 1 . . . . . . . 3.45 1 1 
       1510 1 . . . . . . . 3.18 1 1 
       1511 1 . . . . . . . 3.89 1 1 
       1512 1 . . . . . . . 5.34 1 1 
       1513 1 . . . . . . . 3.01 1 1 
       1514 1 . . . . . . . 4.85 1 1 
       1515 1 . . . . . . . 4.56 1 1 
       1516 1 . . . . . . . 3.91 1 1 
       1517 1 . . . . . . . 3.97 1 1 
       1518 1 . . . . . . . 4.95 1 1 
       1519 1 . . . . . . .  4.9 1 1 
       1520 1 . . . . . . . 5.19 1 1 
       1521 1 . . . . . . . 4.27 1 1 
       1522 1 . . . . . . . 4.06 1 1 
       1523 1 . . . . . . . 4.18 1 1 
       1524 1 . . . . . . . 4.77 1 1 
       1525 1 . . . . . . . 4.95 1 1 
       1526 1 . . . . . . . 3.49 1 1 
       1527 1 . . . . . . .  5.5 1 1 
       1528 1 . . . . . . . 4.56 1 1 
       1529 1 . . . . . . . 5.19 1 1 
       1530 1 . . . . . . . 4.77 1 1 
       1531 1 . . . . . . . 4.28 1 1 
       1532 1 . . . . . . . 3.95 1 1 
       1533 1 . . . . . . . 3.72 1 1 
       1534 1 . . . . . . . 3.78 1 1 
       1535 1 . . . . . . . 4.48 1 1 
       1536 1 . . . . . . . 4.27 1 1 
       1537 1 . . . . . . . 5.04 1 1 
       1538 1 . . . . . . . 5.19 1 1 
       1539 1 . . . . . . . 3.61 1 1 
       1540 1 . . . . . . . 3.91 1 1 
       1541 1 . . . . . . . 3.93 1 1 
       1542 1 . . . . . . . 4.32 1 1 
       1543 1 . . . . . . .  3.7 1 1 
       1544 1 . . . . . . . 4.56 1 1 
       1545 1 . . . . . . . 4.32 1 1 
       1546 1 . . . . . . .  4.7 1 1 
       1547 1 . . . . . . . 4.62 1 1 
       1548 1 . . . . . . . 4.62 1 1 
       1549 1 . . . . . . . 5.06 1 1 
       1550 1 . . . . . . . 5.19 1 1 
       1551 1 . . . . . . . 4.28 1 1 
       1552 1 . . . . . . . 4.09 1 1 
       1553 1 . . . . . . . 4.73 1 1 
       1554 1 . . . . . . . 5.19 1 1 
       1555 1 . . . . . . . 4.87 1 1 
       1556 1 . . . . . . . 3.13 1 1 
       1557 1 . . . . . . . 4.12 1 1 
       1558 1 . . . . . . . 4.09 1 1 
       1559 1 . . . . . . . 4.06 1 1 
       1560 1 . . . . . . . 3.95 1 1 
       1561 1 . . . . . . . 4.04 1 1 
       1562 1 . . . . . . .  5.5 1 1 
       1563 1 . . . . . . . 4.56 1 1 
       1564 1 . . . . . . . 4.95 1 1 
       1565 1 . . . . . . . 3.07 1 1 
       1566 1 . . . . . . . 4.06 1 1 
       1567 1 . . . . . . . 5.19 1 1 
       1568 1 . . . . . . . 4.79 1 1 
       1569 1 . . . . . . . 4.45 1 1 
       1570 1 . . . . . . . 4.25 1 1 
       1571 1 . . . . . . . 3.41 1 1 
       1572 1 . . . . . . . 4.28 1 1 
       1573 1 . . . . . . . 4.45 1 1 
       1574 1 . . . . . . . 5.19 1 1 
       1575 1 . . . . . . . 5.19 1 1 
       1576 1 . . . . . . . 3.45 1 1 
       1577 1 . . . . . . .  3.6 1 1 
       1578 1 . . . . . . . 3.86 1 1 
       1579 1 . . . . . . .  5.5 1 1 
       1580 1 . . . . . . . 5.42 1 1 
       1581 1 . . . . . . . 3.57 1 1 
       1582 1 . . . . . . . 4.41 1 1 
       1583 1 . . . . . . . 4.04 1 1 
       1584 1 . . . . . . . 4.99 1 1 
       1585 1 . . . . . . . 3.89 1 1 
       1586 1 . . . . . . . 5.28 1 1 
       1587 1 . . . . . . . 4.95 1 1 
       1588 1 . . . . . . . 4.85 1 1 
       1589 1 . . . . . . . 3.85 1 1 
       1590 1 . . . . . . . 4.95 1 1 
       1591 1 . . . . . . . 4.51 1 1 
       1592 1 . . . . . . . 4.77 1 1 
       1593 1 . . . . . . . 4.95 1 1 
       1594 1 . . . . . . . 4.77 1 1 
       1595 1 . . . . . . .  3.6 1 1 
       1596 1 . . . . . . . 3.78 1 1 
       1597 1 . . . . . . . 4.15 1 1 
       1598 1 . . . . . . . 3.91 1 1 
       1599 1 . . . . . . .  3.3 1 1 
       1600 1 . . . . . . . 3.67 1 1 
       1601 1 . . . . . . .  5.5 1 1 
       1602 1 . . . . . . . 3.97 1 1 
       1603 1 . . . . . . . 3.06 1 1 
       1604 1 . . . . . . . 3.99 1 1 
       1605 1 . . . . . . . 3.97 1 1 
       1606 1 . . . . . . . 3.05 1 1 
       1607 1 . . . . . . . 4.01 1 1 
       1608 1 . . . . . . . 4.62 1 1 
       1609 1 . . . . . . . 4.95 1 1 
       1610 1 . . . . . . . 4.91 1 1 
       1611 1 . . . . . . . 3.36 1 1 
       1612 1 . . . . . . .  4.0 1 1 
       1613 1 . . . . . . . 4.77 1 1 
       1614 1 . . . . . . . 2.86 1 1 
       1615 1 . . . . . . . 4.23 1 1 
       1616 1 . . . . . . . 4.95 1 1 
       1617 1 . . . . . . . 5.06 1 1 
       1618 1 . . . . . . . 4.76 1 1 
       1619 1 . . . . . . . 4.18 1 1 
       1620 1 . . . . . . . 3.95 1 1 
       1621 1 . . . . . . . 3.99 1 1 
       1622 1 . . . . . . . 4.95 1 1 
       1623 1 . . . . . . . 3.62 1 1 
       1624 1 . . . . . . . 3.62 1 1 
       1625 1 . . . . . . . 5.21 1 1 
       1626 1 . . . . . . .  4.8 1 1 
       1627 1 . . . . . . . 4.02 1 1 
       1628 1 . . . . . . .  5.5 1 1 
       1629 1 . . . . . . . 5.34 1 1 
       1630 1 . . . . . . . 4.79 1 1 
       1631 1 . . . . . . . 4.95 1 1 
       1632 1 . . . . . . . 3.64 1 1 
       1633 1 . . . . . . . 5.47 1 1 
       1634 1 . . . . . . . 4.62 1 1 
       1635 1 . . . . . . . 5.19 1 1 
       1636 1 . . . . . . . 4.23 1 1 
       1637 1 . . . . . . . 3.72 1 1 
       1638 1 . . . . . . . 5.42 1 1 
       1639 1 . . . . . . . 4.12 1 1 
       1640 1 . . . . . . . 4.62 1 1 
       1641 1 . . . . . . . 3.79 1 1 
       1642 1 . . . . . . . 4.36 1 1 
       1643 1 . . . . . . . 4.45 1 1 
       1644 1 . . . . . . .  5.5 1 1 
       1645 1 . . . . . . . 4.85 1 1 
       1646 1 . . . . . . .  4.7 1 1 
       1647 1 . . . . . . . 5.15 1 1 
       1648 1 . . . . . . . 3.97 1 1 
       1649 1 . . . . . . .  5.5 1 1 
       1650 1 . . . . . . . 4.48 1 1 
       1651 1 . . . . . . . 4.32 1 1 
       1652 1 . . . . . . . 5.03 1 1 
       1653 1 . . . . . . . 4.62 1 1 
       1654 1 . . . . . . . 3.27 1 1 
       1655 1 . . . . . . . 5.38 1 1 
       1656 1 . . . . . . . 5.03 1 1 
       1657 1 . . . . . . .  4.8 1 1 
       1658 1 . . . . . . . 4.48 1 1 
       1659 1 . . . . . . .  4.7 1 1 
       1660 1 . . . . . . . 5.06 1 1 
       1661 1 . . . . . . .  4.8 1 1 
       1662 1 . . . . . . . 4.02 1 1 
       1663 1 . . . . . . . 4.48 1 1 
       1664 1 . . . . . . . 3.83 1 1 
       1665 1 . . . . . . . 4.12 1 1 
       1666 1 . . . . . . . 4.85 1 1 
       1667 1 . . . . . . .  4.7 1 1 
       1668 1 . . . . . . . 4.32 1 1 
       1669 1 . . . . . . . 3.62 1 1 
       1670 1 . . . . . . . 4.18 1 1 
       1671 1 . . . . . . . 3.49 1 1 
       1672 1 . . . . . . . 3.83 1 1 
       1673 1 . . . . . . . 5.21 1 1 
       1674 1 . . . . . . .  3.4 1 1 
       1675 1 . . . . . . . 3.38 1 1 
       1676 1 . . . . . . . 5.35 1 1 
       1677 1 . . . . . . . 4.87 1 1 
       1678 1 . . . . . . . 4.51 1 1 
       1679 1 . . . . . . . 4.51 1 1 
       1680 1 . . . . . . . 4.45 1 1 
       1681 1 . . . . . . . 3.54 1 1 
       1682 1 . . . . . . . 4.45 1 1 
       1683 1 . . . . . . .  3.6 1 1 
       1684 1 . . . . . . . 5.19 1 1 
       1685 1 . . . . . . . 4.62 1 1 
       1686 1 . . . . . . . 5.03 1 1 
       1687 1 . . . . . . . 3.68 1 1 
       1688 1 . . . . . . . 4.45 1 1 
       1689 1 . . . . . . .  5.5 1 1 
       1690 1 . . . . . . . 5.35 1 1 
       1691 1 . . . . . . . 5.38 1 1 
       1692 1 . . . . . . . 4.09 1 1 
       1693 1 . . . . . . . 3.95 1 1 
       1694 1 . . . . . . . 4.95 1 1 
       1695 1 . . . . . . . 4.99 1 1 
       1696 1 . . . . . . . 4.95 1 1 
       1697 1 . . . . . . . 3.93 1 1 
       1698 1 . . . . . . . 4.85 1 1 
       1699 1 . . . . . . . 4.51 1 1 
       1700 1 . . . . . . . 4.85 1 1 
       1701 1 . . . . . . . 5.35 1 1 
       1702 1 . . . . . . . 4.95 1 1 
       1703 1 . . . . . . . 3.41 1 1 
       1704 1 . . . . . . . 3.45 1 1 
       1705 1 . . . . . . . 4.02 1 1 
       1706 1 . . . . . . . 4.51 1 1 
       1707 1 . . . . . . . 4.37 1 1 
       1708 1 . . . . . . .  5.5 1 1 
       1709 1 . . . . . . .  5.5 1 1 
       1710 1 . . . . . . . 4.01 1 1 
       1711 1 . . . . . . . 4.69 1 1 
       1712 1 . . . . . . . 3.83 1 1 
       1713 1 . . . . . . . 4.41 1 1 
       1714 1 . . . . . . . 3.61 1 1 
       1715 1 . . . . . . . 4.08 1 1 
       1716 1 . . . . . . . 3.57 1 1 
       1717 1 . . . . . . . 3.11 1 1 
       1718 1 . . . . . . . 4.45 1 1 
       1719 1 . . . . . . . 4.95 1 1 
       1720 1 . . . . . . . 4.41 1 1 
       1721 1 . . . . . . . 3.63 1 1 
       1722 1 . . . . . . . 3.51 1 1 
       1723 1 . . . . . . . 5.09 1 1 
       1724 1 . . . . . . . 4.28 1 1 
       1725 1 . . . . . . . 4.09 1 1 
       1726 1 . . . . . . . 3.61 1 1 
       1727 1 . . . . . . . 4.12 1 1 
       1728 1 . . . . . . . 4.95 1 1 
       1729 1 . . . . . . .  3.3 1 1 
       1730 1 . . . . . . . 3.75 1 1 
       1731 1 . . . . . . . 3.76 1 1 
       1732 1 . . . . . . . 4.56 1 1 
       1733 1 . . . . . . . 5.04 1 1 
       1734 1 . . . . . . .  3.8 1 1 
       1735 1 . . . . . . .  5.5 1 1 
       1736 1 . . . . . . . 3.26 1 1 
       1737 1 . . . . . . . 3.42 1 1 
       1738 1 . . . . . . . 4.45 1 1 
       1739 1 . . . . . . . 5.42 1 1 
       1740 1 . . . . . . . 4.45 1 1 
       1741 1 . . . . . . .  5.5 1 1 
       1742 1 . . . . . . . 4.35 1 1 
       1743 1 . . . . . . . 4.95 1 1 
       1744 1 . . . . . . . 4.85 1 1 
       1745 1 . . . . . . . 3.62 1 1 
       1746 1 . . . . . . . 4.12 1 1 
       1747 1 . . . . . . . 3.97 1 1 
       1748 1 . . . . . . . 4.18 1 1 
       1749 1 . . . . . . . 3.37 1 1 
       1750 1 . . . . . . . 4.79 1 1 
       1751 1 . . . . . . .  5.5 1 1 
       1752 1 . . . . . . . 4.77 1 1 
       1753 1 . . . . . . . 4.28 1 1 
       1754 1 . . . . . . . 3.15 1 1 
       1755 1 . . . . . . . 3.15 1 1 
       1756 1 . . . . . . . 4.69 1 1 
       1757 1 . . . . . . . 4.95 1 1 
       1758 1 . . . . . . . 3.39 1 1 
       1759 1 . . . . . . . 4.43 1 1 
       1760 1 . . . . . . . 4.45 1 1 
       1761 1 . . . . . . . 4.62 1 1 
       1762 1 . . . . . . . 3.98 1 1 
       1763 1 . . . . . . . 4.85 1 1 
       1764 1 . . . . . . . 4.28 1 1 
       1765 1 . . . . . . . 5.19 1 1 
       1766 1 . . . . . . . 3.85 1 1 
       1767 1 . . . . . . . 5.21 1 1 
       1768 1 . . . . . . . 4.09 1 1 
       1769 1 . . . . . . . 4.25 1 1 
       1770 1 . . . . . . . 4.37 1 1 
       1771 1 . . . . . . . 4.41 1 1 
       1772 1 . . . . . . . 4.51 1 1 
       1773 1 . . . . . . . 4.56 1 1 
       1774 1 . . . . . . .  5.5 1 1 
       1775 1 . . . . . . . 4.85 1 1 
       1776 1 . . . . . . . 4.95 1 1 
       1777 1 . . . . . . .  5.5 1 1 
       1778 1 . . . . . . .  5.5 1 1 
       1779 1 . . . . . . . 4.56 1 1 
       1780 1 . . . . . . . 4.41 1 1 
       1781 1 . . . . . . . 4.76 1 1 
       1782 1 . . . . . . . 3.55 1 1 
       1783 1 . . . . . . . 4.62 1 1 
       1784 1 . . . . . . . 4.85 1 1 
       1785 1 . . . . . . . 4.85 1 1 
       1786 1 . . . . . . . 4.45 1 1 
       1787 1 . . . . . . .  5.5 1 1 
       1788 1 . . . . . . . 4.15 1 1 
       1789 1 . . . . . . . 4.42 1 1 
       1790 1 . . . . . . .  4.9 1 1 
       1791 1 . . . . . . . 3.99 1 1 
       1792 1 . . . . . . .  5.5 1 1 
       1793 1 . . . . . . . 4.95 1 1 
       1794 1 . . . . . . . 4.01 1 1 
       1795 1 . . . . . . . 3.85 1 1 
       1796 1 . . . . . . . 5.34 1 1 
       1797 1 . . . . . . . 4.56 1 1 
       1798 1 . . . . . . . 5.35 1 1 
       1799 1 . . . . . . . 5.19 1 1 
       1800 1 . . . . . . . 3.59 1 1 
       1801 1 . . . . . . . 4.73 1 1 
       1802 1 . . . . . . . 4.73 1 1 
       1803 1 . . . . . . .  5.5 1 1 
       1804 1 . . . . . . . 4.91 1 1 
       1805 1 . . . . . . . 4.09 1 1 
       1806 1 . . . . . . . 4.47 1 1 
       1807 1 . . . . . . . 5.21 1 1 
       1808 1 . . . . . . . 3.27 1 1 
       1809 1 . . . . . . . 3.34 1 1 
       1810 1 . . . . . . . 4.83 1 1 
       1811 1 . . . . . . . 3.85 1 1 
       1812 1 . . . . . . .  3.7 1 1 
       1813 1 . . . . . . . 4.35 1 1 
       1814 1 . . . . . . . 4.77 1 1 
       1815 1 . . . . . . . 5.06 1 1 
       1816 1 . . . . . . . 5.19 1 1 
       1817 1 . . . . . . . 4.29 1 1 
       1818 1 . . . . . . .  3.8 1 1 
       1819 1 . . . . . . . 3.62 1 1 
       1820 1 . . . . . . . 4.45 1 1 
       1821 1 . . . . . . . 4.77 1 1 
       1822 1 . . . . . . . 5.06 1 1 
       1823 1 . . . . . . . 4.01 1 1 
       1824 1 . . . . . . . 4.62 1 1 
       1825 1 . . . . . . . 4.51 1 1 
       1826 1 . . . . . . . 4.41 1 1 
       1827 1 . . . . . . . 4.06 1 1 
       1828 1 . . . . . . . 4.54 1 1 
       1829 1 . . . . . . . 3.33 1 1 
       1830 1 . . . . . . . 3.67 1 1 
       1831 1 . . . . . . . 4.56 1 1 
       1832 1 . . . . . . . 4.51 1 1 
       1833 1 . . . . . . . 3.47 1 1 
       1834 1 . . . . . . . 5.15 1 1 
       1835 1 . . . . . . .  4.7 1 1 
       1836 1 . . . . . . .  5.5 1 1 
       1837 1 . . . . . . . 3.63 1 1 
       1838 1 . . . . . . .  3.2 1 1 
       1839 1 . . . . . . . 5.06 1 1 
       1840 1 . . . . . . . 3.25 1 1 
       1841 1 . . . . . . . 3.89 1 1 
       1842 1 . . . . . . . 5.34 1 1 
       1843 1 . . . . . . . 5.34 1 1 
       1844 1 . . . . . . . 3.93 1 1 
       1845 1 . . . . . . . 4.32 1 1 
       1846 1 . . . . . . . 4.95 1 1 
       1847 1 . . . . . . . 4.69 1 1 
       1848 1 . . . . . . . 4.95 1 1 
       1849 1 . . . . . . . 3.72 1 1 
       1850 1 . . . . . . . 3.97 1 1 
       1851 1 . . . . . . .  3.6 1 1 
       1852 1 . . . . . . . 5.27 1 1 
       1853 1 . . . . . . . 5.09 1 1 
       1854 1 . . . . . . . 5.09 1 1 
       1855 1 . . . . . . . 4.05 1 1 
       1856 1 . . . . . . . 3.42 1 1 
       1857 1 . . . . . . .  5.5 1 1 
       1858 1 . . . . . . . 4.23 1 1 
       1859 1 . . . . . . . 4.56 1 1 
       1860 1 . . . . . . . 4.95 1 1 
       1861 1 . . . . . . . 5.35 1 1 
       1862 1 . . . . . . . 3.64 1 1 
       1863 1 . . . . . . . 3.65 1 1 
       1864 1 . . . . . . . 5.04 1 1 
       1865 1 . . . . . . . 4.28 1 1 
       1866 1 . . . . . . . 3.57 1 1 
       1867 1 . . . . . . .  5.5 1 1 
       1868 1 . . . . . . . 4.77 1 1 
       1869 1 . . . . . . . 5.09 1 1 
       1870 1 . . . . . . . 3.72 1 1 
       1871 1 . . . . . . . 3.46 1 1 
       1872 1 . . . . . . . 4.95 1 1 
       1873 1 . . . . . . . 5.04 1 1 
       1874 1 . . . . . . . 4.95 1 1 
       1875 1 . . . . . . . 3.54 1 1 
       1876 1 . . . . . . . 4.23 1 1 
       1877 1 . . . . . . . 4.18 1 1 
       1878 1 . . . . . . . 3.69 1 1 
       1879 1 . . . . . . . 4.26 1 1 
       1880 1 . . . . . . . 4.69 1 1 
       1881 1 . . . . . . . 2.89 1 1 
       1882 1 . . . . . . . 3.49 1 1 
       1883 1 . . . . . . . 4.76 1 1 
       1884 1 . . . . . . . 4.99 1 1 
       1885 1 . . . . . . . 4.95 1 1 
       1886 1 . . . . . . . 4.18 1 1 
       1887 1 . . . . . . . 3.56 1 1 
       1888 1 . . . . . . . 4.77 1 1 
       1889 1 . . . . . . . 3.23 1 1 
       1890 1 . . . . . . . 2.87 1 1 
       1891 1 . . . . . . . 3.52 1 1 
       1892 1 . . . . . . .  5.5 1 1 
       1893 1 . . . . . . . 4.79 1 1 
       1894 1 . . . . . . . 5.15 1 1 
       1895 1 . . . . . . . 5.09 1 1 
       1896 1 . . . . . . . 4.95 1 1 
       1897 1 . . . . . . . 4.15 1 1 
       1898 1 . . . . . . . 5.06 1 1 
       1899 1 . . . . . . . 3.47 1 1 
       1900 1 . . . . . . . 4.85 1 1 
       1901 1 . . . . . . . 4.69 1 1 
       1902 1 . . . . . . . 3.67 1 1 
       1903 1 . . . . . . . 4.62 1 1 
       1904 1 . . . . . . . 4.51 1 1 
       1905 1 . . . . . . . 4.28 1 1 
       1906 1 . . . . . . . 5.42 1 1 
       1907 1 . . . . . . . 3.89 1 1 
       1908 1 . . . . . . . 3.62 1 1 
       1909 1 . . . . . . . 4.27 1 1 
       1910 1 . . . . . . . 3.48 1 1 
       1911 1 . . . . . . . 5.15 1 1 
       1912 1 . . . . . . .  4.3 1 1 
       1913 1 . . . . . . . 4.23 1 1 
       1914 1 . . . . . . . 5.34 1 1 
       1915 1 . . . . . . . 3.76 1 1 
       1916 1 . . . . . . . 4.15 1 1 
       1917 1 . . . . . . . 4.42 1 1 
       1918 1 . . . . . . . 5.19 1 1 
       1919 1 . . . . . . . 4.19 1 1 
       1920 1 . . . . . . . 4.85 1 1 
       1921 1 . . . . . . .  4.7 1 1 
       1922 1 . . . . . . . 4.62 1 1 
       1923 1 . . . . . . . 5.19 1 1 
       1924 1 . . . . . . . 5.03 1 1 
       1925 1 . . . . . . . 4.69 1 1 
       1926 1 . . . . . . .  5.5 1 1 
       1927 1 . . . . . . .  4.9 1 1 
       1928 1 . . . . . . . 4.62 1 1 
       1929 1 . . . . . . . 5.19 1 1 
       1930 1 . . . . . . . 3.47 1 1 
       1931 1 . . . . . . . 4.55 1 1 
       1932 1 . . . . . . .  4.7 1 1 
       1933 1 . . . . . . . 4.12 1 1 
       1934 1 . . . . . . . 3.26 1 1 
       1935 1 . . . . . . .  5.5 1 1 
       1936 1 . . . . . . . 3.99 1 1 
       1937 1 . . . . . . . 4.25 1 1 
       1938 1 . . . . . . . 3.59 1 1 
       1939 1 . . . . . . .  5.5 1 1 
       1940 1 . . . . . . .  5.5 1 1 
       1941 1 . . . . . . . 4.18 1 1 
       1942 1 . . . . . . .  3.8 1 1 
       1943 1 . . . . . . . 3.75 1 1 
       1944 1 . . . . . . . 5.04 1 1 
       1945 1 . . . . . . . 3.87 1 1 
       1946 1 . . . . . . . 4.09 1 1 
       1947 1 . . . . . . . 3.95 1 1 
       1948 1 . . . . . . . 4.09 1 1 
       1949 1 . . . . . . . 3.71 1 1 
       1950 1 . . . . . . . 3.78 1 1 
       1951 1 . . . . . . . 3.68 1 1 
       1952 1 . . . . . . . 4.95 1 1 
       1953 1 . . . . . . . 4.95 1 1 
       1954 1 . . . . . . . 5.09 1 1 
       1955 1 . . . . . . . 4.69 1 1 
       1956 1 . . . . . . . 2.96 1 1 
       1957 1 . . . . . . . 4.23 1 1 
       1958 1 . . . . . . . 4.09 1 1 
       1959 1 . . . . . . . 4.73 1 1 
       1960 1 . . . . . . . 3.87 1 1 
       1961 1 . . . . . . . 3.85 1 1 
       1962 1 . . . . . . . 5.34 1 1 
       1963 1 . . . . . . . 4.32 1 1 
       1964 1 . . . . . . . 2.79 1 1 
       1965 1 . . . . . . . 3.39 1 1 
       1966 1 . . . . . . . 4.77 1 1 
       1967 1 . . . . . . . 5.34 1 1 
       1968 1 . . . . . . .  5.5 1 1 
       1969 1 . . . . . . . 3.95 1 1 
       1970 1 . . . . . . . 5.42 1 1 
       1971 1 . . . . . . . 3.99 1 1 
       1972 1 . . . . . . . 5.34 1 1 
       1973 1 . . . . . . . 5.42 1 1 
       1974 1 . . . . . . .  3.1 1 1 
       1975 1 . . . . . . . 4.23 1 1 
       1976 1 . . . . . . .  5.5 1 1 
       1977 1 . . . . . . . 5.15 1 1 
       1978 1 . . . . . . . 5.27 1 1 
       1979 1 . . . . . . . 5.15 1 1 
       1980 1 . . . . . . . 3.29 1 1 
       1981 1 . . . . . . . 4.28 1 1 
       1982 1 . . . . . . .  5.5 1 1 
       1983 1 . . . . . . . 3.69 1 1 
       1984 1 . . . . . . . 5.06 1 1 
       1985 1 . . . . . . . 4.62 1 1 
       1986 1 . . . . . . . 5.35 1 1 
       1987 1 . . . . . . . 4.95 1 1 
       1988 1 . . . . . . . 5.42 1 1 
       1989 1 . . . . . . . 3.61 1 1 
       1990 1 . . . . . . . 4.56 1 1 
       1991 1 . . . . . . . 5.06 1 1 
       1992 1 . . . . . . . 3.51 1 1 
       1993 1 . . . . . . . 4.62 1 1 
       1994 1 . . . . . . . 4.37 1 1 
       1995 1 . . . . . . .  4.7 1 1 
       1996 1 . . . . . . . 5.08 1 1 
       1997 1 . . . . . . .  4.9 1 1 
       1998 1 . . . . . . . 3.77 1 1 
       1999 1 . . . . . . . 4.27 1 1 
       2000 1 . . . . . . . 4.62 1 1 
       2001 1 . . . . . . .  4.9 1 1 
       2002 1 . . . . . . . 3.51 1 1 
       2003 1 . . . . . . . 3.64 1 1 
       2004 1 . . . . . . .  3.8 1 1 
       2005 1 . . . . . . . 3.62 1 1 
       2006 1 . . . . . . . 3.51 1 1 
       2007 1 . . . . . . . 3.34 1 1 
       2008 1 . . . . . . . 4.79 1 1 
       2009 1 . . . . . . . 3.48 1 1 
       2010 1 . . . . . . . 4.18 1 1 
       2011 1 . . . . . . . 3.17 1 1 
       2012 1 . . . . . . . 4.83 1 1 
       2013 1 . . . . . . . 4.51 1 1 
       2014 1 . . . . . . . 4.45 1 1 
       2015 1 . . . . . . . 4.69 1 1 
       2016 1 . . . . . . . 3.45 1 1 
       2017 1 . . . . . . . 3.89 1 1 
       2018 1 . . . . . . . 4.62 1 1 
       2019 1 . . . . . . . 3.52 1 1 
       2020 1 . . . . . . . 4.45 1 1 
       2021 1 . . . . . . . 3.39 1 1 
       2022 1 . . . . . . . 4.54 1 1 
       2023 1 . . . . . . . 4.09 1 1 
       2024 1 . . . . . . . 4.41 1 1 
       2025 1 . . . . . . . 4.36 1 1 
       2026 1 . . . . . . .  5.5 1 1 
       2027 1 . . . . . . . 4.28 1 1 
       2028 1 . . . . . . . 4.45 1 1 
       2029 1 . . . . . . . 4.62 1 1 
       2030 1 . . . . . . . 3.31 1 1 
       2031 1 . . . . . . . 4.02 1 1 
       2032 1 . . . . . . .  5.5 1 1 
       2033 1 . . . . . . . 4.67 1 1 
       2034 1 . . . . . . . 4.13 1 1 
       2035 1 . . . . . . . 4.85 1 1 
       2036 1 . . . . . . . 3.62 1 1 
       2037 1 . . . . . . . 5.15 1 1 
       2038 1 . . . . . . .  5.5 1 1 
       2039 1 . . . . . . . 5.42 1 1 
       2040 1 . . . . . . . 4.12 1 1 
       2041 1 . . . . . . . 4.95 1 1 
       2042 1 . . . . . . . 3.81 1 1 
       2043 1 . . . . . . . 3.53 1 1 
       2044 1 . . . . . . . 4.04 1 1 
       2045 1 . . . . . . . 3.91 1 1 
       2046 1 . . . . . . .  5.5 1 1 
       2047 1 . . . . . . . 3.82 1 1 
       2048 1 . . . . . . . 4.95 1 1 
       2049 1 . . . . . . . 3.87 1 1 
       2050 1 . . . . . . .  5.5 1 1 
       2051 1 . . . . . . . 5.15 1 1 
       2052 1 . . . . . . . 3.93 1 1 
       2053 1 . . . . . . . 3.45 1 1 
       2054 1 . . . . . . . 4.56 1 1 
       2055 1 . . . . . . . 4.09 1 1 
       2056 1 . . . . . . . 4.45 1 1 
       2057 1 . . . . . . . 4.01 1 1 
       2058 1 . . . . . . . 3.82 1 1 
       2059 1 . . . . . . . 3.64 1 1 
       2060 1 . . . . . . . 3.93 1 1 
       2061 1 . . . . . . . 2.99 1 1 
       2062 1 . . . . . . . 3.77 1 1 
       2063 1 . . . . . . . 2.86 1 1 
       2064 1 . . . . . . . 5.06 1 1 
       2065 1 . . . . . . . 4.99 1 1 
       2066 1 . . . . . . .  4.2 1 1 
       2067 1 . . . . . . . 3.75 1 1 
       2068 1 . . . . . . . 4.67 1 1 
       2069 1 . . . . . . . 4.56 1 1 
       2070 1 . . . . . . . 4.01 1 1 
       2071 1 . . . . . . . 4.69 1 1 
       2072 1 . . . . . . . 4.87 1 1 
       2073 1 . . . . . . . 4.99 1 1 
       2074 1 . . . . . . . 2.96 1 1 
       2075 1 . . . . . . .  4.7 1 1 
       2076 1 . . . . . . . 3.18 1 1 
    stop_

save_


save_conformer_family_coord_set_1
    _Conformer_family_coord_set.Sf_category  conformer_family_coord_set
    _Conformer_family_coord_set.Entry_ID     1
    _Conformer_family_coord_set.ID           1

    loop_
       _Atom_site.Model_ID
       _Atom_site.ID
       _Atom_site.Label_entity_assembly_ID
       _Atom_site.Label_entity_ID
       _Atom_site.Label_comp_index_ID
       _Atom_site.Label_comp_ID
       _Atom_site.Label_atom_ID
       _Atom_site.Type_symbol
       _Atom_site.Cartn_x
       _Atom_site.Cartn_y
       _Atom_site.Cartn_z
       _Atom_site.Occupancy
       _Atom_site.Uncertainty
       _Atom_site.PDBX_label_asym_ID
       _Atom_site.PDB_strand_ID
       _Atom_site.PDB_ins_code
       _Atom_site.PDB_residue_no
       _Atom_site.PDB_residue_name
       _Atom_site.PDB_atom_name
       _Atom_site.Entry_ID
       _Atom_site.Conformer_family_coord_set_ID

        1     1 1 1   1 GLY C    C -18.869   4.503   3.469 1.00 . A A .   1 GLY C    1 1 
        1     2 1 1   1 GLY CA   C -19.017   5.062   4.885 1.00 . A A .   1 GLY CA   1 1 
        1     3 1 1   1 GLY H1   H -18.822   6.950   4.027 1.00 . A A .   1 GLY H1   1 1 
        1     4 1 1   1 GLY HA2  H -18.330   4.548   5.557 1.00 . A A .   1 GLY HA2  1 1 
        1     5 1 1   1 GLY HA3  H -20.025   4.869   5.253 1.00 . A A .   1 GLY HA3  1 1 
        1     6 1 1   1 GLY N    N -18.752   6.490   4.912 1.00 . A A .   1 GLY N    1 1 
        1     7 1 1   1 GLY O    O -18.846   5.259   2.499 1.00 . A A .   1 GLY O    1 1 
        1     8 1 1   2 SER C    C -18.508   1.004   2.321 1.00 . A A .   2 SER C    1 1 
        1     9 1 1   2 SER CA   C -18.627   2.515   2.113 1.00 . A A .   2 SER CA   1 1 
        1    10 1 1   2 SER CB   C -17.409   3.043   1.351 1.00 . A A .   2 SER CB   1 1 
        1    11 1 1   2 SER H    H -18.792   2.576   4.188 1.00 . A A .   2 SER H    1 1 
        1    12 1 1   2 SER HA   H -19.534   2.755   1.558 1.00 . A A .   2 SER HA   1 1 
        1    13 1 1   2 SER HB2  H -16.831   3.699   2.002 1.00 . A A .   2 SER HB2  1 1 
        1    14 1 1   2 SER HB3  H -16.761   2.209   1.081 1.00 . A A .   2 SER HB3  1 1 
        1    15 1 1   2 SER HG   H -18.707   4.121   0.275 1.00 . A A .   2 SER HG   1 1 
        1    16 1 1   2 SER N    N -18.772   3.184   3.394 1.00 . A A .   2 SER N    1 1 
        1    17 1 1   2 SER O    O -18.231   0.547   3.429 1.00 . A A .   2 SER O    1 1 
        1    18 1 1   2 SER OG   O -17.783   3.754   0.174 1.00 . A A .   2 SER OG   1 1 
        1    19 1 1   3 SER C    C -18.182  -1.725  -0.063 1.00 . A A .   3 SER C    1 1 
        1    20 1 1   3 SER CA   C -18.645  -1.179   1.289 1.00 . A A .   3 SER CA   1 1 
        1    21 1 1   3 SER CB   C -19.993  -1.791   1.676 1.00 . A A .   3 SER CB   1 1 
        1    22 1 1   3 SER H    H -18.950   0.651   0.342 1.00 . A A .   3 SER H    1 1 
        1    23 1 1   3 SER HA   H -17.911  -1.401   2.064 1.00 . A A .   3 SER HA   1 1 
        1    24 1 1   3 SER HB2  H -20.759  -1.015   1.670 1.00 . A A .   3 SER HB2  1 1 
        1    25 1 1   3 SER HB3  H -20.283  -2.531   0.929 1.00 . A A .   3 SER HB3  1 1 
        1    26 1 1   3 SER HG   H -19.661  -3.359   2.874 1.00 . A A .   3 SER HG   1 1 
        1    27 1 1   3 SER N    N -18.724   0.271   1.239 1.00 . A A .   3 SER N    1 1 
        1    28 1 1   3 SER O    O -18.860  -1.548  -1.073 1.00 . A A .   3 SER O    1 1 
        1    29 1 1   3 SER OG   O -19.952  -2.406   2.960 1.00 . A A .   3 SER OG   1 1 
        1    30 1 1   4 GLY C    C -16.136  -1.861  -2.269 1.00 . A A .   4 GLY C    1 1 
        1    31 1 1   4 GLY CA   C -16.468  -2.952  -1.249 1.00 . A A .   4 GLY CA   1 1 
        1    32 1 1   4 GLY H    H -16.484  -2.519   0.789 1.00 . A A .   4 GLY H    1 1 
        1    33 1 1   4 GLY HA2  H -15.566  -3.514  -1.005 1.00 . A A .   4 GLY HA2  1 1 
        1    34 1 1   4 GLY HA3  H -17.175  -3.658  -1.683 1.00 . A A .   4 GLY HA3  1 1 
        1    35 1 1   4 GLY N    N -17.030  -2.379  -0.037 1.00 . A A .   4 GLY N    1 1 
        1    36 1 1   4 GLY O    O -16.798  -0.825  -2.313 1.00 . A A .   4 GLY O    1 1 
        1    37 1 1   5 SER C    C -14.178  -1.936  -5.314 1.00 . A A .   5 SER C    1 1 
        1    38 1 1   5 SER CA   C -14.683  -1.185  -4.080 1.00 . A A .   5 SER CA   1 1 
        1    39 1 1   5 SER CB   C -13.595  -0.253  -3.543 1.00 . A A .   5 SER CB   1 1 
        1    40 1 1   5 SER H    H -14.577  -2.975  -3.021 1.00 . A A .   5 SER H    1 1 
        1    41 1 1   5 SER HA   H -15.571  -0.602  -4.324 1.00 . A A .   5 SER HA   1 1 
        1    42 1 1   5 SER HB2  H -13.314  -0.566  -2.537 1.00 . A A .   5 SER HB2  1 1 
        1    43 1 1   5 SER HB3  H -12.704  -0.340  -4.165 1.00 . A A .   5 SER HB3  1 1 
        1    44 1 1   5 SER HG   H -15.010   1.151  -3.368 1.00 . A A .   5 SER HG   1 1 
        1    45 1 1   5 SER N    N -15.111  -2.131  -3.064 1.00 . A A .   5 SER N    1 1 
        1    46 1 1   5 SER O    O -14.646  -1.696  -6.426 1.00 . A A .   5 SER O    1 1 
        1    47 1 1   5 SER OG   O -14.022   1.106  -3.515 1.00 . A A .   5 SER OG   1 1 
        1    48 1 1   6 SER C    C -11.906  -4.821  -5.580 1.00 . A A .   6 SER C    1 1 
        1    49 1 1   6 SER CA   C -12.654  -3.616  -6.154 1.00 . A A .   6 SER CA   1 1 
        1    50 1 1   6 SER CB   C -11.716  -2.769  -7.015 1.00 . A A .   6 SER CB   1 1 
        1    51 1 1   6 SER H    H -12.853  -3.018  -4.168 1.00 . A A .   6 SER H    1 1 
        1    52 1 1   6 SER HA   H -13.502  -3.943  -6.755 1.00 . A A .   6 SER HA   1 1 
        1    53 1 1   6 SER HB2  H -11.315  -1.950  -6.417 1.00 . A A .   6 SER HB2  1 1 
        1    54 1 1   6 SER HB3  H -10.868  -3.376  -7.333 1.00 . A A .   6 SER HB3  1 1 
        1    55 1 1   6 SER HG   H -13.356  -2.431  -8.111 1.00 . A A .   6 SER HG   1 1 
        1    56 1 1   6 SER N    N -13.228  -2.829  -5.076 1.00 . A A .   6 SER N    1 1 
        1    57 1 1   6 SER O    O -11.620  -4.867  -4.385 1.00 . A A .   6 SER O    1 1 
        1    58 1 1   6 SER OG   O -12.376  -2.239  -8.162 1.00 . A A .   6 SER OG   1 1 
        1    59 1 1   7 GLY C    C  -9.611  -6.619  -5.308 1.00 . A A .   7 GLY C    1 1 
        1    60 1 1   7 GLY CA   C -10.899  -6.968  -6.056 1.00 . A A .   7 GLY CA   1 1 
        1    61 1 1   7 GLY H    H -11.845  -5.721  -7.431 1.00 . A A .   7 GLY H    1 1 
        1    62 1 1   7 GLY HA2  H -11.540  -7.577  -5.418 1.00 . A A .   7 GLY HA2  1 1 
        1    63 1 1   7 GLY HA3  H -10.663  -7.568  -6.935 1.00 . A A .   7 GLY HA3  1 1 
        1    64 1 1   7 GLY N    N -11.609  -5.767  -6.460 1.00 . A A .   7 GLY N    1 1 
        1    65 1 1   7 GLY O    O  -9.606  -6.524  -4.082 1.00 . A A .   7 GLY O    1 1 
        1    66 1 1   8 PRO C    C  -7.193  -4.634  -5.073 1.00 . A A .   8 PRO C    1 1 
        1    67 1 1   8 PRO CA   C  -7.228  -6.095  -5.526 1.00 . A A .   8 PRO CA   1 1 
        1    68 1 1   8 PRO CB   C  -6.219  -6.402  -6.620 1.00 . A A .   8 PRO CB   1 1 
        1    69 1 1   8 PRO CD   C  -8.488  -6.536  -7.555 1.00 . A A .   8 PRO CD   1 1 
        1    70 1 1   8 PRO CG   C  -7.013  -6.457  -7.915 1.00 . A A .   8 PRO CG   1 1 
        1    71 1 1   8 PRO HA   H  -7.061  -6.640  -4.704 1.00 . A A .   8 PRO HA   1 1 
        1    72 1 1   8 PRO HB2  H  -5.448  -5.634  -6.667 1.00 . A A .   8 PRO HB2  1 1 
        1    73 1 1   8 PRO HB3  H  -5.714  -7.350  -6.431 1.00 . A A .   8 PRO HB3  1 1 
        1    74 1 1   8 PRO HD2  H  -9.054  -5.730  -8.023 1.00 . A A .   8 PRO HD2  1 1 
        1    75 1 1   8 PRO HD3  H  -8.929  -7.473  -7.895 1.00 . A A .   8 PRO HD3  1 1 
        1    76 1 1   8 PRO HG2  H  -6.815  -5.573  -8.522 1.00 . A A .   8 PRO HG2  1 1 
        1    77 1 1   8 PRO HG3  H  -6.718  -7.323  -8.508 1.00 . A A .   8 PRO HG3  1 1 
        1    78 1 1   8 PRO N    N  -8.520  -6.432  -6.099 1.00 . A A .   8 PRO N    1 1 
        1    79 1 1   8 PRO O    O  -7.887  -3.789  -5.638 1.00 . A A .   8 PRO O    1 1 
        1    80 1 1   9 LYS C    C  -4.815  -2.543  -3.752 1.00 . A A .   9 LYS C    1 1 
        1    81 1 1   9 LYS CA   C  -6.245  -3.037  -3.525 1.00 . A A .   9 LYS CA   1 1 
        1    82 1 1   9 LYS CB   C  -6.684  -2.996  -2.060 1.00 . A A .   9 LYS CB   1 1 
        1    83 1 1   9 LYS CD   C  -8.893  -2.893  -0.848 1.00 . A A .   9 LYS CD   1 1 
        1    84 1 1   9 LYS CE   C  -8.851  -2.114   0.469 1.00 . A A .   9 LYS CE   1 1 
        1    85 1 1   9 LYS CG   C  -8.002  -2.235  -1.903 1.00 . A A .   9 LYS CG   1 1 
        1    86 1 1   9 LYS H    H  -5.819  -5.074  -3.606 1.00 . A A .   9 LYS H    1 1 
        1    87 1 1   9 LYS HA   H  -6.925  -2.394  -4.083 1.00 . A A .   9 LYS HA   1 1 
        1    88 1 1   9 LYS HB2  H  -6.800  -4.012  -1.682 1.00 . A A .   9 LYS HB2  1 1 
        1    89 1 1   9 LYS HB3  H  -5.911  -2.519  -1.457 1.00 . A A .   9 LYS HB3  1 1 
        1    90 1 1   9 LYS HD2  H  -9.919  -2.942  -1.213 1.00 . A A .   9 LYS HD2  1 1 
        1    91 1 1   9 LYS HD3  H  -8.566  -3.919  -0.679 1.00 . A A .   9 LYS HD3  1 1 
        1    92 1 1   9 LYS HE2  H  -7.922  -2.332   0.997 1.00 . A A .   9 LYS HE2  1 1 
        1    93 1 1   9 LYS HE3  H  -8.858  -1.043   0.265 1.00 . A A .   9 LYS HE3  1 1 
        1    94 1 1   9 LYS HG2  H  -7.798  -1.202  -1.620 1.00 . A A .   9 LYS HG2  1 1 
        1    95 1 1   9 LYS HG3  H  -8.525  -2.205  -2.859 1.00 . A A .   9 LYS HG3  1 1 
        1    96 1 1   9 LYS HZ1  H -10.847  -2.120   0.905 1.00 . A A .   9 LYS HZ1  1 1 
        1    97 1 1   9 LYS HZ2  H -10.067  -3.466   1.401 1.00 . A A .   9 LYS HZ2  1 1 
        1    98 1 1   9 LYS HZ3  H  -9.891  -2.068   2.227 1.00 . A A .   9 LYS HZ3  1 1 
        1    99 1 1   9 LYS N    N  -6.379  -4.381  -4.059 1.00 . A A .   9 LYS N    1 1 
        1   100 1 1   9 LYS NZ   N -10.008  -2.471   1.319 1.00 . A A .   9 LYS NZ   1 1 
        1   101 1 1   9 LYS O    O  -3.855  -3.249  -3.449 1.00 . A A .   9 LYS O    1 1 
        1   102 1 1  10 LYS C    C  -2.478  -1.023  -3.384 1.00 . A A .  10 LYS C    1 1 
        1   103 1 1  10 LYS CA   C  -3.421  -0.736  -4.554 1.00 . A A .  10 LYS CA   1 1 
        1   104 1 1  10 LYS CB   C  -3.572   0.753  -4.870 1.00 . A A .  10 LYS CB   1 1 
        1   105 1 1  10 LYS CD   C  -3.120   1.866  -7.088 1.00 . A A .  10 LYS CD   1 1 
        1   106 1 1  10 LYS CE   C  -2.414   1.405  -8.365 1.00 . A A .  10 LYS CE   1 1 
        1   107 1 1  10 LYS CG   C  -2.494   1.218  -5.851 1.00 . A A .  10 LYS CG   1 1 
        1   108 1 1  10 LYS H    H  -5.504  -0.764  -4.526 1.00 . A A .  10 LYS H    1 1 
        1   109 1 1  10 LYS HA   H  -3.021  -1.216  -5.447 1.00 . A A .  10 LYS HA   1 1 
        1   110 1 1  10 LYS HB2  H  -4.559   0.941  -5.294 1.00 . A A .  10 LYS HB2  1 1 
        1   111 1 1  10 LYS HB3  H  -3.506   1.333  -3.950 1.00 . A A .  10 LYS HB3  1 1 
        1   112 1 1  10 LYS HD2  H  -4.178   1.610  -7.141 1.00 . A A .  10 LYS HD2  1 1 
        1   113 1 1  10 LYS HD3  H  -3.057   2.951  -7.005 1.00 . A A .  10 LYS HD3  1 1 
        1   114 1 1  10 LYS HE2  H  -1.345   1.298  -8.179 1.00 . A A .  10 LYS HE2  1 1 
        1   115 1 1  10 LYS HE3  H  -2.786   0.423  -8.659 1.00 . A A .  10 LYS HE3  1 1 
        1   116 1 1  10 LYS HG2  H  -1.832   1.930  -5.359 1.00 . A A .  10 LYS HG2  1 1 
        1   117 1 1  10 LYS HG3  H  -1.881   0.368  -6.152 1.00 . A A .  10 LYS HG3  1 1 
        1   118 1 1  10 LYS HZ1  H  -2.494   3.303  -9.118 1.00 . A A .  10 LYS HZ1  1 1 
        1   119 1 1  10 LYS HZ2  H  -1.998   2.190 -10.205 1.00 . A A .  10 LYS HZ2  1 1 
        1   120 1 1  10 LYS HZ3  H  -3.576   2.286  -9.797 1.00 . A A .  10 LYS HZ3  1 1 
        1   121 1 1  10 LYS N    N  -4.718  -1.333  -4.283 1.00 . A A .  10 LYS N    1 1 
        1   122 1 1  10 LYS NZ   N  -2.639   2.374  -9.460 1.00 . A A .  10 LYS NZ   1 1 
        1   123 1 1  10 LYS O    O  -2.554  -0.369  -2.345 1.00 . A A .  10 LYS O    1 1 
        1   124 1 1  11 PRO C    C   0.500  -1.384  -2.469 1.00 . A A .  11 PRO C    1 1 
        1   125 1 1  11 PRO CA   C  -0.629  -2.410  -2.574 1.00 . A A .  11 PRO CA   1 1 
        1   126 1 1  11 PRO CB   C  -0.142  -3.790  -2.985 1.00 . A A .  11 PRO CB   1 1 
        1   127 1 1  11 PRO CD   C  -1.467  -2.825  -4.816 1.00 . A A .  11 PRO CD   1 1 
        1   128 1 1  11 PRO CG   C  -0.490  -3.932  -4.458 1.00 . A A .  11 PRO CG   1 1 
        1   129 1 1  11 PRO HA   H  -1.069  -2.425  -1.676 1.00 . A A .  11 PRO HA   1 1 
        1   130 1 1  11 PRO HB2  H   0.931  -3.889  -2.826 1.00 . A A .  11 PRO HB2  1 1 
        1   131 1 1  11 PRO HB3  H  -0.625  -4.567  -2.393 1.00 . A A .  11 PRO HB3  1 1 
        1   132 1 1  11 PRO HD2  H  -1.098  -2.224  -5.647 1.00 . A A .  11 PRO HD2  1 1 
        1   133 1 1  11 PRO HD3  H  -2.432  -3.230  -5.120 1.00 . A A .  11 PRO HD3  1 1 
        1   134 1 1  11 PRO HG2  H   0.409  -3.861  -5.071 1.00 . A A .  11 PRO HG2  1 1 
        1   135 1 1  11 PRO HG3  H  -0.932  -4.909  -4.653 1.00 . A A .  11 PRO HG3  1 1 
        1   136 1 1  11 PRO N    N  -1.587  -2.028  -3.598 1.00 . A A .  11 PRO N    1 1 
        1   137 1 1  11 PRO O    O   0.581  -0.459  -3.276 1.00 . A A .  11 PRO O    1 1 
        1   138 1 1  12 PRO C    C   3.597  -0.934  -2.249 1.00 . A A .  12 PRO C    1 1 
        1   139 1 1  12 PRO CA   C   2.490  -0.690  -1.221 1.00 . A A .  12 PRO CA   1 1 
        1   140 1 1  12 PRO CB   C   2.936  -0.962   0.206 1.00 . A A .  12 PRO CB   1 1 
        1   141 1 1  12 PRO CD   C   1.304  -2.672  -0.467 1.00 . A A .  12 PRO CD   1 1 
        1   142 1 1  12 PRO CG   C   2.354  -2.317   0.574 1.00 . A A .  12 PRO CG   1 1 
        1   143 1 1  12 PRO HA   H   2.205   0.260  -1.346 1.00 . A A .  12 PRO HA   1 1 
        1   144 1 1  12 PRO HB2  H   4.023  -0.970   0.281 1.00 . A A .  12 PRO HB2  1 1 
        1   145 1 1  12 PRO HB3  H   2.576  -0.186   0.882 1.00 . A A .  12 PRO HB3  1 1 
        1   146 1 1  12 PRO HD2  H   1.517  -3.635  -0.931 1.00 . A A .  12 PRO HD2  1 1 
        1   147 1 1  12 PRO HD3  H   0.313  -2.745  -0.020 1.00 . A A .  12 PRO HD3  1 1 
        1   148 1 1  12 PRO HG2  H   3.137  -3.075   0.600 1.00 . A A .  12 PRO HG2  1 1 
        1   149 1 1  12 PRO HG3  H   1.909  -2.284   1.569 1.00 . A A .  12 PRO HG3  1 1 
        1   150 1 1  12 PRO N    N   1.368  -1.587  -1.442 1.00 . A A .  12 PRO N    1 1 
        1   151 1 1  12 PRO O    O   3.423  -1.720  -3.179 1.00 . A A .  12 PRO O    1 1 
        1   152 1 1  13 MET C    C   7.107  -0.772  -2.179 1.00 . A A .  13 MET C    1 1 
        1   153 1 1  13 MET CA   C   5.844  -0.374  -2.946 1.00 . A A .  13 MET CA   1 1 
        1   154 1 1  13 MET CB   C   6.081   0.955  -3.666 1.00 . A A .  13 MET CB   1 1 
        1   155 1 1  13 MET CE   C   6.803   2.577  -6.276 1.00 . A A .  13 MET CE   1 1 
        1   156 1 1  13 MET CG   C   5.014   1.196  -4.736 1.00 . A A .  13 MET CG   1 1 
        1   157 1 1  13 MET H    H   4.842   0.395  -1.289 1.00 . A A .  13 MET H    1 1 
        1   158 1 1  13 MET HA   H   5.573  -1.163  -3.647 1.00 . A A .  13 MET HA   1 1 
        1   159 1 1  13 MET HB2  H   6.069   1.771  -2.944 1.00 . A A .  13 MET HB2  1 1 
        1   160 1 1  13 MET HB3  H   7.069   0.951  -4.127 1.00 . A A .  13 MET HB3  1 1 
        1   161 1 1  13 MET HE1  H   7.717   2.393  -6.841 1.00 . A A .  13 MET HE1  1 1 
        1   162 1 1  13 MET HE2  H   6.280   3.433  -6.700 1.00 . A A .  13 MET HE2  1 1 
        1   163 1 1  13 MET HE3  H   7.055   2.783  -5.236 1.00 . A A .  13 MET HE3  1 1 
        1   164 1 1  13 MET HG2  H   4.230   0.443  -4.656 1.00 . A A .  13 MET HG2  1 1 
        1   165 1 1  13 MET HG3  H   4.542   2.166  -4.578 1.00 . A A .  13 MET HG3  1 1 
        1   166 1 1  13 MET N    N   4.709  -0.243  -2.048 1.00 . A A .  13 MET N    1 1 
        1   167 1 1  13 MET O    O   7.655  -1.852  -2.396 1.00 . A A .  13 MET O    1 1 
        1   168 1 1  13 MET SD   S   5.753   1.136  -6.360 1.00 . A A .  13 MET SD   1 1 
        1   169 1 1  14 ASN C    C   8.321  -0.832   0.796 1.00 . A A .  14 ASN C    1 1 
        1   170 1 1  14 ASN CA   C   8.721  -0.122  -0.499 1.00 . A A .  14 ASN CA   1 1 
        1   171 1 1  14 ASN CB   C   9.412   1.191  -0.125 1.00 . A A .  14 ASN CB   1 1 
        1   172 1 1  14 ASN CG   C   9.818   1.973  -1.376 1.00 . A A .  14 ASN CG   1 1 
        1   173 1 1  14 ASN H    H   7.081   0.998  -1.129 1.00 . A A .  14 ASN H    1 1 
        1   174 1 1  14 ASN HA   H   9.368  -0.733  -1.127 1.00 . A A .  14 ASN HA   1 1 
        1   175 1 1  14 ASN HB2  H   8.743   1.797   0.486 1.00 . A A .  14 ASN HB2  1 1 
        1   176 1 1  14 ASN HB3  H  10.295   0.982   0.480 1.00 . A A .  14 ASN HB3  1 1 
        1   177 1 1  14 ASN HD21 H   8.818   3.573  -0.642 1.00 . A A .  14 ASN HD21 1 1 
        1   178 1 1  14 ASN HD22 H   9.581   3.817  -2.178 1.00 . A A .  14 ASN HD22 1 1 
        1   179 1 1  14 ASN N    N   7.533   0.122  -1.299 1.00 . A A .  14 ASN N    1 1 
        1   180 1 1  14 ASN ND2  N   9.368   3.224  -1.400 1.00 . A A .  14 ASN ND2  1 1 
        1   181 1 1  14 ASN O    O   8.693  -1.983   1.017 1.00 . A A .  14 ASN O    1 1 
        1   182 1 1  14 ASN OD1  O  10.494   1.473  -2.260 1.00 . A A .  14 ASN OD1  1 1 
        1   183 1 1  15 GLY C    C   6.531   0.435   3.779 1.00 . A A .  15 GLY C    1 1 
        1   184 1 1  15 GLY CA   C   7.115  -0.662   2.886 1.00 . A A .  15 GLY CA   1 1 
        1   185 1 1  15 GLY H    H   7.271   0.821   1.431 1.00 . A A .  15 GLY H    1 1 
        1   186 1 1  15 GLY HA2  H   6.362  -1.429   2.706 1.00 . A A .  15 GLY HA2  1 1 
        1   187 1 1  15 GLY HA3  H   7.948  -1.146   3.396 1.00 . A A .  15 GLY HA3  1 1 
        1   188 1 1  15 GLY N    N   7.569  -0.115   1.619 1.00 . A A .  15 GLY N    1 1 
        1   189 1 1  15 GLY O    O   5.640   0.174   4.585 1.00 . A A .  15 GLY O    1 1 
        1   190 1 1  16 TYR C    C   5.123   3.066   4.114 1.00 . A A .  16 TYR C    1 1 
        1   191 1 1  16 TYR CA   C   6.600   2.775   4.384 1.00 . A A .  16 TYR CA   1 1 
        1   192 1 1  16 TYR CB   C   7.436   3.969   3.920 1.00 . A A .  16 TYR CB   1 1 
        1   193 1 1  16 TYR CD1  C   6.560   5.557   5.671 1.00 . A A .  16 TYR CD1  1 1 
        1   194 1 1  16 TYR CD2  C   6.683   6.321   3.410 1.00 . A A .  16 TYR CD2  1 1 
        1   195 1 1  16 TYR CE1  C   6.031   6.834   6.074 1.00 . A A .  16 TYR CE1  1 1 
        1   196 1 1  16 TYR CE2  C   6.154   7.598   3.812 1.00 . A A .  16 TYR CE2  1 1 
        1   197 1 1  16 TYR CG   C   6.874   5.327   4.347 1.00 . A A .  16 TYR CG   1 1 
        1   198 1 1  16 TYR CZ   C   5.854   7.792   5.124 1.00 . A A .  16 TYR CZ   1 1 
        1   199 1 1  16 TYR H    H   7.783   1.841   2.946 1.00 . A A .  16 TYR H    1 1 
        1   200 1 1  16 TYR HA   H   6.728   2.533   5.439 1.00 . A A .  16 TYR HA   1 1 
        1   201 1 1  16 TYR HB2  H   8.448   3.866   4.312 1.00 . A A .  16 TYR HB2  1 1 
        1   202 1 1  16 TYR HB3  H   7.513   3.945   2.833 1.00 . A A .  16 TYR HB3  1 1 
        1   203 1 1  16 TYR HD1  H   6.711   4.772   6.412 1.00 . A A .  16 TYR HD1  1 1 
        1   204 1 1  16 TYR HD2  H   6.932   6.139   2.364 1.00 . A A .  16 TYR HD2  1 1 
        1   205 1 1  16 TYR HE1  H   5.778   7.029   7.116 1.00 . A A .  16 TYR HE1  1 1 
        1   206 1 1  16 TYR HE2  H   5.998   8.392   3.082 1.00 . A A .  16 TYR HE2  1 1 
        1   207 1 1  16 TYR HH   H   4.371   8.925   5.669 1.00 . A A .  16 TYR HH   1 1 
        1   208 1 1  16 TYR N    N   7.058   1.638   3.604 1.00 . A A .  16 TYR N    1 1 
        1   209 1 1  16 TYR O    O   4.403   3.520   5.002 1.00 . A A .  16 TYR O    1 1 
        1   210 1 1  16 TYR OH   O   5.355   8.998   5.505 1.00 . A A .  16 TYR OH   1 1 
        1   211 1 1  17 GLN C    C   2.418   1.983   3.134 1.00 . A A .  17 GLN C    1 1 
        1   212 1 1  17 GLN CA   C   3.336   3.020   2.485 1.00 . A A .  17 GLN CA   1 1 
        1   213 1 1  17 GLN CB   C   3.195   3.000   0.961 1.00 . A A .  17 GLN CB   1 1 
        1   214 1 1  17 GLN CD   C   3.818   4.151  -1.194 1.00 . A A .  17 GLN CD   1 1 
        1   215 1 1  17 GLN CG   C   4.050   4.093   0.317 1.00 . A A .  17 GLN CG   1 1 
        1   216 1 1  17 GLN H    H   5.306   2.424   2.167 1.00 . A A .  17 GLN H    1 1 
        1   217 1 1  17 GLN HA   H   3.088   4.016   2.853 1.00 . A A .  17 GLN HA   1 1 
        1   218 1 1  17 GLN HB2  H   3.495   2.025   0.578 1.00 . A A .  17 GLN HB2  1 1 
        1   219 1 1  17 GLN HB3  H   2.149   3.142   0.687 1.00 . A A .  17 GLN HB3  1 1 
        1   220 1 1  17 GLN HE21 H   4.092   2.146  -1.266 1.00 . A A .  17 GLN HE21 1 1 
        1   221 1 1  17 GLN HE22 H   3.759   2.904  -2.788 1.00 . A A .  17 GLN HE22 1 1 
        1   222 1 1  17 GLN HG2  H   3.809   5.058   0.763 1.00 . A A .  17 GLN HG2  1 1 
        1   223 1 1  17 GLN HG3  H   5.104   3.902   0.520 1.00 . A A .  17 GLN HG3  1 1 
        1   224 1 1  17 GLN N    N   4.714   2.793   2.883 1.00 . A A .  17 GLN N    1 1 
        1   225 1 1  17 GLN NE2  N   3.896   2.969  -1.799 1.00 . A A .  17 GLN NE2  1 1 
        1   226 1 1  17 GLN O    O   1.223   2.224   3.301 1.00 . A A .  17 GLN O    1 1 
        1   227 1 1  17 GLN OE1  O   3.584   5.200  -1.772 1.00 . A A .  17 GLN OE1  1 1 
        1   228 1 1  18 LYS C    C   1.839   0.207   5.516 1.00 . A A .  18 LYS C    1 1 
        1   229 1 1  18 LYS CA   C   2.261  -0.225   4.110 1.00 . A A .  18 LYS CA   1 1 
        1   230 1 1  18 LYS CB   C   3.065  -1.526   4.081 1.00 . A A .  18 LYS CB   1 1 
        1   231 1 1  18 LYS CD   C   0.947  -2.877   4.297 1.00 . A A .  18 LYS CD   1 1 
        1   232 1 1  18 LYS CE   C   0.595  -4.366   4.336 1.00 . A A .  18 LYS CE   1 1 
        1   233 1 1  18 LYS CG   C   2.348  -2.631   4.860 1.00 . A A .  18 LYS CG   1 1 
        1   234 1 1  18 LYS H    H   3.983   0.662   3.343 1.00 . A A .  18 LYS H    1 1 
        1   235 1 1  18 LYS HA   H   1.363  -0.388   3.514 1.00 . A A .  18 LYS HA   1 1 
        1   236 1 1  18 LYS HB2  H   3.216  -1.843   3.049 1.00 . A A .  18 LYS HB2  1 1 
        1   237 1 1  18 LYS HB3  H   4.053  -1.357   4.509 1.00 . A A .  18 LYS HB3  1 1 
        1   238 1 1  18 LYS HD2  H   0.215  -2.311   4.873 1.00 . A A .  18 LYS HD2  1 1 
        1   239 1 1  18 LYS HD3  H   0.894  -2.514   3.271 1.00 . A A .  18 LYS HD3  1 1 
        1   240 1 1  18 LYS HE2  H   0.449  -4.738   3.322 1.00 . A A .  18 LYS HE2  1 1 
        1   241 1 1  18 LYS HE3  H   1.421  -4.930   4.767 1.00 . A A .  18 LYS HE3  1 1 
        1   242 1 1  18 LYS HG2  H   2.930  -3.551   4.812 1.00 . A A .  18 LYS HG2  1 1 
        1   243 1 1  18 LYS HG3  H   2.278  -2.353   5.911 1.00 . A A .  18 LYS HG3  1 1 
        1   244 1 1  18 LYS HZ1  H  -0.495  -4.242   6.061 1.00 . A A .  18 LYS HZ1  1 1 
        1   245 1 1  18 LYS HZ2  H  -1.398  -4.103   4.707 1.00 . A A .  18 LYS HZ2  1 1 
        1   246 1 1  18 LYS HZ3  H  -0.836  -5.566   5.168 1.00 . A A .  18 LYS HZ3  1 1 
        1   247 1 1  18 LYS N    N   3.011   0.850   3.483 1.00 . A A .  18 LYS N    1 1 
        1   248 1 1  18 LYS NZ   N  -0.633  -4.587   5.133 1.00 . A A .  18 LYS NZ   1 1 
        1   249 1 1  18 LYS O    O   0.650   0.233   5.830 1.00 . A A .  18 LYS O    1 1 
        1   250 1 1  19 PHE C    C   1.593   2.129   7.723 1.00 . A A .  19 PHE C    1 1 
        1   251 1 1  19 PHE CA   C   2.583   0.963   7.689 1.00 . A A .  19 PHE CA   1 1 
        1   252 1 1  19 PHE CB   C   3.921   1.428   8.267 1.00 . A A .  19 PHE CB   1 1 
        1   253 1 1  19 PHE CD1  C   3.417   1.897  10.675 1.00 . A A .  19 PHE CD1  1 1 
        1   254 1 1  19 PHE CD2  C   4.038   3.706   9.300 1.00 . A A .  19 PHE CD2  1 1 
        1   255 1 1  19 PHE CE1  C   3.293   2.780  11.780 1.00 . A A .  19 PHE CE1  1 1 
        1   256 1 1  19 PHE CE2  C   3.914   4.589  10.405 1.00 . A A .  19 PHE CE2  1 1 
        1   257 1 1  19 PHE CG   C   3.787   2.379   9.458 1.00 . A A .  19 PHE CG   1 1 
        1   258 1 1  19 PHE CZ   C   3.544   4.107  11.622 1.00 . A A .  19 PHE CZ   1 1 
        1   259 1 1  19 PHE H    H   3.800   0.510   6.061 1.00 . A A .  19 PHE H    1 1 
        1   260 1 1  19 PHE HA   H   2.158   0.112   8.222 1.00 . A A .  19 PHE HA   1 1 
        1   261 1 1  19 PHE HB2  H   4.495   0.554   8.576 1.00 . A A .  19 PHE HB2  1 1 
        1   262 1 1  19 PHE HB3  H   4.492   1.923   7.482 1.00 . A A .  19 PHE HB3  1 1 
        1   263 1 1  19 PHE HD1  H   3.216   0.833  10.802 1.00 . A A .  19 PHE HD1  1 1 
        1   264 1 1  19 PHE HD2  H   4.334   4.092   8.325 1.00 . A A .  19 PHE HD2  1 1 
        1   265 1 1  19 PHE HE1  H   2.997   2.394  12.756 1.00 . A A .  19 PHE HE1  1 1 
        1   266 1 1  19 PHE HE2  H   4.115   5.653  10.279 1.00 . A A .  19 PHE HE2  1 1 
        1   267 1 1  19 PHE HZ   H   3.448   4.785  12.471 1.00 . A A .  19 PHE HZ   1 1 
        1   268 1 1  19 PHE N    N   2.836   0.534   6.324 1.00 . A A .  19 PHE N    1 1 
        1   269 1 1  19 PHE O    O   0.711   2.175   8.579 1.00 . A A .  19 PHE O    1 1 
        1   270 1 1  20 SER C    C  -0.540   3.765   6.457 1.00 . A A .  20 SER C    1 1 
        1   271 1 1  20 SER CA   C   0.906   4.206   6.692 1.00 . A A .  20 SER CA   1 1 
        1   272 1 1  20 SER CB   C   1.361   5.148   5.575 1.00 . A A .  20 SER CB   1 1 
        1   273 1 1  20 SER H    H   2.492   2.998   6.088 1.00 . A A .  20 SER H    1 1 
        1   274 1 1  20 SER HA   H   1.001   4.711   7.653 1.00 . A A .  20 SER HA   1 1 
        1   275 1 1  20 SER HB2  H   1.256   4.646   4.613 1.00 . A A .  20 SER HB2  1 1 
        1   276 1 1  20 SER HB3  H   0.711   6.022   5.551 1.00 . A A .  20 SER HB3  1 1 
        1   277 1 1  20 SER HG   H   2.950   6.247   5.055 1.00 . A A .  20 SER HG   1 1 
        1   278 1 1  20 SER N    N   1.772   3.043   6.781 1.00 . A A .  20 SER N    1 1 
        1   279 1 1  20 SER O    O  -1.422   4.065   7.260 1.00 . A A .  20 SER O    1 1 
        1   280 1 1  20 SER OG   O   2.712   5.566   5.747 1.00 . A A .  20 SER OG   1 1 
        1   281 1 1  21 GLN C    C  -2.774   2.031   6.245 1.00 . A A .  21 GLN C    1 1 
        1   282 1 1  21 GLN CA   C  -2.062   2.573   5.004 1.00 . A A .  21 GLN CA   1 1 
        1   283 1 1  21 GLN CB   C  -1.984   1.509   3.907 1.00 . A A .  21 GLN CB   1 1 
        1   284 1 1  21 GLN CD   C  -3.876   2.520   2.581 1.00 . A A .  21 GLN CD   1 1 
        1   285 1 1  21 GLN CG   C  -2.410   2.083   2.554 1.00 . A A .  21 GLN CG   1 1 
        1   286 1 1  21 GLN H    H  -0.015   2.819   4.706 1.00 . A A .  21 GLN H    1 1 
        1   287 1 1  21 GLN HA   H  -2.598   3.442   4.621 1.00 . A A .  21 GLN HA   1 1 
        1   288 1 1  21 GLN HB2  H  -0.966   1.126   3.839 1.00 . A A .  21 GLN HB2  1 1 
        1   289 1 1  21 GLN HB3  H  -2.625   0.667   4.166 1.00 . A A .  21 GLN HB3  1 1 
        1   290 1 1  21 GLN HE21 H  -3.575   3.476   0.822 1.00 . A A .  21 GLN HE21 1 1 
        1   291 1 1  21 GLN HE22 H  -5.180   3.590   1.462 1.00 . A A .  21 GLN HE22 1 1 
        1   292 1 1  21 GLN HG2  H  -1.778   2.935   2.301 1.00 . A A .  21 GLN HG2  1 1 
        1   293 1 1  21 GLN HG3  H  -2.264   1.335   1.775 1.00 . A A .  21 GLN HG3  1 1 
        1   294 1 1  21 GLN N    N  -0.738   3.059   5.354 1.00 . A A .  21 GLN N    1 1 
        1   295 1 1  21 GLN NE2  N  -4.240   3.256   1.535 1.00 . A A .  21 GLN NE2  1 1 
        1   296 1 1  21 GLN O    O  -3.991   2.157   6.372 1.00 . A A .  21 GLN O    1 1 
        1   297 1 1  21 GLN OE1  O  -4.627   2.209   3.491 1.00 . A A .  21 GLN OE1  1 1 
        1   298 1 1  22 GLU C    C  -3.078   1.986   9.249 1.00 . A A .  22 GLU C    1 1 
        1   299 1 1  22 GLU CA   C  -2.524   0.875   8.355 1.00 . A A .  22 GLU CA   1 1 
        1   300 1 1  22 GLU CB   C  -1.465   0.054   9.093 1.00 . A A .  22 GLU CB   1 1 
        1   301 1 1  22 GLU CD   C  -1.322  -2.464   9.154 1.00 . A A .  22 GLU CD   1 1 
        1   302 1 1  22 GLU CG   C  -2.069  -1.230   9.666 1.00 . A A .  22 GLU CG   1 1 
        1   303 1 1  22 GLU H    H  -0.996   1.339   7.017 1.00 . A A .  22 GLU H    1 1 
        1   304 1 1  22 GLU HA   H  -3.332   0.216   8.040 1.00 . A A .  22 GLU HA   1 1 
        1   305 1 1  22 GLU HB2  H  -0.652  -0.196   8.411 1.00 . A A .  22 GLU HB2  1 1 
        1   306 1 1  22 GLU HB3  H  -1.034   0.648   9.898 1.00 . A A .  22 GLU HB3  1 1 
        1   307 1 1  22 GLU HG2  H  -2.027  -1.201  10.755 1.00 . A A .  22 GLU HG2  1 1 
        1   308 1 1  22 GLU HG3  H  -3.121  -1.297   9.389 1.00 . A A .  22 GLU HG3  1 1 
        1   309 1 1  22 GLU N    N  -1.985   1.438   7.128 1.00 . A A .  22 GLU N    1 1 
        1   310 1 1  22 GLU O    O  -4.172   1.859   9.797 1.00 . A A .  22 GLU O    1 1 
        1   311 1 1  22 GLU OE1  O  -1.584  -2.845   7.994 1.00 . A A .  22 GLU OE1  1 1 
        1   312 1 1  22 GLU OE2  O  -0.505  -2.997   9.936 1.00 . A A .  22 GLU OE2  1 1 
        1   313 1 1  23 LEU C    C  -3.868   4.902   9.520 1.00 . A A .  23 LEU C    1 1 
        1   314 1 1  23 LEU CA   C  -2.696   4.181  10.189 1.00 . A A .  23 LEU CA   1 1 
        1   315 1 1  23 LEU CB   C  -1.496   5.088  10.470 1.00 . A A .  23 LEU CB   1 1 
        1   316 1 1  23 LEU CD1  C   0.988   4.940  10.879 1.00 . A A .  23 LEU CD1  1 1 
        1   317 1 1  23 LEU CD2  C  -0.635   4.825  12.826 1.00 . A A .  23 LEU CD2  1 1 
        1   318 1 1  23 LEU CG   C  -0.397   4.492  11.352 1.00 . A A .  23 LEU CG   1 1 
        1   319 1 1  23 LEU H    H  -1.408   3.145   8.922 1.00 . A A .  23 LEU H    1 1 
        1   320 1 1  23 LEU HA   H  -3.035   3.788  11.148 1.00 . A A .  23 LEU HA   1 1 
        1   321 1 1  23 LEU HB2  H  -1.054   5.378   9.517 1.00 . A A .  23 LEU HB2  1 1 
        1   322 1 1  23 LEU HB3  H  -1.859   6.001  10.944 1.00 . A A .  23 LEU HB3  1 1 
        1   323 1 1  23 LEU HD11 H   0.879   5.721  10.126 1.00 . A A .  23 LEU HD11 1 1 
        1   324 1 1  23 LEU HD12 H   1.553   5.329  11.727 1.00 . A A .  23 LEU HD12 1 1 
        1   325 1 1  23 LEU HD13 H   1.517   4.091  10.448 1.00 . A A .  23 LEU HD13 1 1 
        1   326 1 1  23 LEU HD21 H   0.254   4.572  13.404 1.00 . A A .  23 LEU HD21 1 1 
        1   327 1 1  23 LEU HD22 H  -0.845   5.890  12.929 1.00 . A A .  23 LEU HD22 1 1 
        1   328 1 1  23 LEU HD23 H  -1.484   4.250  13.196 1.00 . A A .  23 LEU HD23 1 1 
        1   329 1 1  23 LEU HG   H  -0.434   3.407  11.257 1.00 . A A .  23 LEU HG   1 1 
        1   330 1 1  23 LEU N    N  -2.297   3.049   9.370 1.00 . A A .  23 LEU N    1 1 
        1   331 1 1  23 LEU O    O  -4.597   5.648  10.172 1.00 . A A .  23 LEU O    1 1 
        1   332 1 1  24 LEU C    C  -6.339   4.400   7.558 1.00 . A A .  24 LEU C    1 1 
        1   333 1 1  24 LEU CA   C  -5.083   5.269   7.461 1.00 . A A .  24 LEU CA   1 1 
        1   334 1 1  24 LEU CB   C  -4.630   5.537   6.025 1.00 . A A .  24 LEU CB   1 1 
        1   335 1 1  24 LEU CD1  C  -3.529   7.114   4.393 1.00 . A A .  24 LEU CD1  1 1 
        1   336 1 1  24 LEU CD2  C  -3.832   7.794   6.818 1.00 . A A .  24 LEU CD2  1 1 
        1   337 1 1  24 LEU CG   C  -3.583   6.639   5.846 1.00 . A A .  24 LEU CG   1 1 
        1   338 1 1  24 LEU H    H  -3.415   4.046   7.703 1.00 . A A .  24 LEU H    1 1 
        1   339 1 1  24 LEU HA   H  -5.297   6.236   7.917 1.00 . A A .  24 LEU HA   1 1 
        1   340 1 1  24 LEU HB2  H  -4.228   4.612   5.612 1.00 . A A .  24 LEU HB2  1 1 
        1   341 1 1  24 LEU HB3  H  -5.506   5.797   5.431 1.00 . A A .  24 LEU HB3  1 1 
        1   342 1 1  24 LEU HD11 H  -4.069   8.056   4.298 1.00 . A A .  24 LEU HD11 1 1 
        1   343 1 1  24 LEU HD12 H  -2.490   7.259   4.096 1.00 . A A .  24 LEU HD12 1 1 
        1   344 1 1  24 LEU HD13 H  -3.989   6.365   3.748 1.00 . A A .  24 LEU HD13 1 1 
        1   345 1 1  24 LEU HD21 H  -3.613   7.467   7.834 1.00 . A A .  24 LEU HD21 1 1 
        1   346 1 1  24 LEU HD22 H  -3.185   8.632   6.559 1.00 . A A .  24 LEU HD22 1 1 
        1   347 1 1  24 LEU HD23 H  -4.874   8.106   6.753 1.00 . A A .  24 LEU HD23 1 1 
        1   348 1 1  24 LEU HG   H  -2.605   6.222   6.085 1.00 . A A .  24 LEU HG   1 1 
        1   349 1 1  24 LEU N    N  -4.013   4.654   8.226 1.00 . A A .  24 LEU N    1 1 
        1   350 1 1  24 LEU O    O  -7.456   4.902   7.447 1.00 . A A .  24 LEU O    1 1 
        1   351 1 1  25 SER C    C  -7.556   1.938   9.349 1.00 . A A .  25 SER C    1 1 
        1   352 1 1  25 SER CA   C  -7.211   2.166   7.876 1.00 . A A .  25 SER CA   1 1 
        1   353 1 1  25 SER CB   C  -6.867   0.838   7.199 1.00 . A A .  25 SER CB   1 1 
        1   354 1 1  25 SER H    H  -5.200   2.710   7.852 1.00 . A A .  25 SER H    1 1 
        1   355 1 1  25 SER HA   H  -8.047   2.633   7.355 1.00 . A A .  25 SER HA   1 1 
        1   356 1 1  25 SER HB2  H  -6.301   1.031   6.288 1.00 . A A .  25 SER HB2  1 1 
        1   357 1 1  25 SER HB3  H  -6.224   0.252   7.856 1.00 . A A .  25 SER HB3  1 1 
        1   358 1 1  25 SER HG   H  -8.121  -0.691   7.508 1.00 . A A .  25 SER HG   1 1 
        1   359 1 1  25 SER N    N  -6.112   3.111   7.763 1.00 . A A .  25 SER N    1 1 
        1   360 1 1  25 SER O    O  -8.660   1.502   9.671 1.00 . A A .  25 SER O    1 1 
        1   361 1 1  25 SER OG   O  -8.033   0.083   6.881 1.00 . A A .  25 SER OG   1 1 
        1   362 1 1  26 ASN C    C  -7.647   3.218  12.167 1.00 . A A .  26 ASN C    1 1 
        1   363 1 1  26 ASN CA   C  -6.778   2.077  11.635 1.00 . A A .  26 ASN CA   1 1 
        1   364 1 1  26 ASN CB   C  -5.439   2.118  12.374 1.00 . A A .  26 ASN CB   1 1 
        1   365 1 1  26 ASN CG   C  -4.631   0.845  12.116 1.00 . A A .  26 ASN CG   1 1 
        1   366 1 1  26 ASN H    H  -5.695   2.598   9.933 1.00 . A A .  26 ASN H    1 1 
        1   367 1 1  26 ASN HA   H  -7.253   1.102  11.750 1.00 . A A .  26 ASN HA   1 1 
        1   368 1 1  26 ASN HB2  H  -4.868   2.988  12.051 1.00 . A A .  26 ASN HB2  1 1 
        1   369 1 1  26 ASN HB3  H  -5.614   2.231  13.444 1.00 . A A .  26 ASN HB3  1 1 
        1   370 1 1  26 ASN HD21 H  -2.952   1.975  12.077 1.00 . A A .  26 ASN HD21 1 1 
        1   371 1 1  26 ASN HD22 H  -2.709   0.278  11.827 1.00 . A A .  26 ASN HD22 1 1 
        1   372 1 1  26 ASN N    N  -6.590   2.243  10.204 1.00 . A A .  26 ASN N    1 1 
        1   373 1 1  26 ASN ND2  N  -3.322   1.050  11.997 1.00 . A A .  26 ASN ND2  1 1 
        1   374 1 1  26 ASN O    O  -8.728   2.981  12.705 1.00 . A A .  26 ASN O    1 1 
        1   375 1 1  26 ASN OD1  O  -5.161  -0.251  12.031 1.00 . A A .  26 ASN OD1  1 1 
        1   376 1 1  27 GLY C    C  -7.281   6.128  13.773 1.00 . A A .  27 GLY C    1 1 
        1   377 1 1  27 GLY CA   C  -7.860   5.610  12.455 1.00 . A A .  27 GLY CA   1 1 
        1   378 1 1  27 GLY H    H  -6.264   4.616  11.559 1.00 . A A .  27 GLY H    1 1 
        1   379 1 1  27 GLY HA2  H  -7.803   6.391  11.696 1.00 . A A .  27 GLY HA2  1 1 
        1   380 1 1  27 GLY HA3  H  -8.915   5.370  12.586 1.00 . A A .  27 GLY HA3  1 1 
        1   381 1 1  27 GLY N    N  -7.143   4.431  11.998 1.00 . A A .  27 GLY N    1 1 
        1   382 1 1  27 GLY O    O  -7.994   6.727  14.576 1.00 . A A .  27 GLY O    1 1 
        1   383 1 1  28 GLU C    C  -5.085   7.825  15.130 1.00 . A A .  28 GLU C    1 1 
        1   384 1 1  28 GLU CA   C  -5.309   6.312  15.161 1.00 . A A .  28 GLU CA   1 1 
        1   385 1 1  28 GLU CB   C  -3.985   5.566  15.340 1.00 . A A .  28 GLU CB   1 1 
        1   386 1 1  28 GLU CD   C  -3.249   3.159  15.501 1.00 . A A .  28 GLU CD   1 1 
        1   387 1 1  28 GLU CG   C  -4.043   4.183  14.687 1.00 . A A .  28 GLU CG   1 1 
        1   388 1 1  28 GLU H    H  -5.419   5.390  13.296 1.00 . A A .  28 GLU H    1 1 
        1   389 1 1  28 GLU HA   H  -5.978   6.053  15.982 1.00 . A A .  28 GLU HA   1 1 
        1   390 1 1  28 GLU HB2  H  -3.174   6.146  14.899 1.00 . A A .  28 GLU HB2  1 1 
        1   391 1 1  28 GLU HB3  H  -3.763   5.462  16.401 1.00 . A A .  28 GLU HB3  1 1 
        1   392 1 1  28 GLU HG2  H  -5.080   3.860  14.602 1.00 . A A .  28 GLU HG2  1 1 
        1   393 1 1  28 GLU HG3  H  -3.642   4.238  13.675 1.00 . A A .  28 GLU HG3  1 1 
        1   394 1 1  28 GLU N    N  -5.992   5.878  13.954 1.00 . A A .  28 GLU N    1 1 
        1   395 1 1  28 GLU O    O  -5.051   8.473  16.175 1.00 . A A .  28 GLU O    1 1 
        1   396 1 1  28 GLU OE1  O  -2.003   3.211  15.418 1.00 . A A .  28 GLU OE1  1 1 
        1   397 1 1  28 GLU OE2  O  -3.907   2.348  16.189 1.00 . A A .  28 GLU OE2  1 1 
        1   398 1 1  29 LEU C    C  -5.899  10.369  12.970 1.00 . A A .  29 LEU C    1 1 
        1   399 1 1  29 LEU CA   C  -4.720   9.770  13.739 1.00 . A A .  29 LEU CA   1 1 
        1   400 1 1  29 LEU CB   C  -3.363  10.024  13.079 1.00 . A A .  29 LEU CB   1 1 
        1   401 1 1  29 LEU CD1  C  -1.452   8.947  11.835 1.00 . A A .  29 LEU CD1  1 1 
        1   402 1 1  29 LEU CD2  C  -1.666   8.655  14.346 1.00 . A A .  29 LEU CD2  1 1 
        1   403 1 1  29 LEU CG   C  -2.411   8.827  13.021 1.00 . A A .  29 LEU CG   1 1 
        1   404 1 1  29 LEU H    H  -4.968   7.811  13.075 1.00 . A A .  29 LEU H    1 1 
        1   405 1 1  29 LEU HA   H  -4.686  10.223  14.729 1.00 . A A .  29 LEU HA   1 1 
        1   406 1 1  29 LEU HB2  H  -3.536  10.374  12.061 1.00 . A A .  29 LEU HB2  1 1 
        1   407 1 1  29 LEU HB3  H  -2.866  10.832  13.615 1.00 . A A .  29 LEU HB3  1 1 
        1   408 1 1  29 LEU HD11 H  -0.870   9.864  11.929 1.00 . A A .  29 LEU HD11 1 1 
        1   409 1 1  29 LEU HD12 H  -0.779   8.089  11.824 1.00 . A A .  29 LEU HD12 1 1 
        1   410 1 1  29 LEU HD13 H  -2.023   8.972  10.907 1.00 . A A .  29 LEU HD13 1 1 
        1   411 1 1  29 LEU HD21 H  -0.597   8.559  14.152 1.00 . A A .  29 LEU HD21 1 1 
        1   412 1 1  29 LEU HD22 H  -1.844   9.524  14.978 1.00 . A A .  29 LEU HD22 1 1 
        1   413 1 1  29 LEU HD23 H  -2.025   7.758  14.851 1.00 . A A .  29 LEU HD23 1 1 
        1   414 1 1  29 LEU HG   H  -3.004   7.926  12.865 1.00 . A A .  29 LEU HG   1 1 
        1   415 1 1  29 LEU N    N  -4.939   8.345  13.920 1.00 . A A .  29 LEU N    1 1 
        1   416 1 1  29 LEU O    O  -5.711  11.223  12.105 1.00 . A A .  29 LEU O    1 1 
        1   417 1 1  30 ASN C    C  -8.802  11.625  13.398 1.00 . A A .  30 ASN C    1 1 
        1   418 1 1  30 ASN CA   C  -8.299  10.378  12.668 1.00 . A A .  30 ASN CA   1 1 
        1   419 1 1  30 ASN CB   C  -9.405   9.322  12.718 1.00 . A A .  30 ASN CB   1 1 
        1   420 1 1  30 ASN CG   C  -9.322   8.384  11.513 1.00 . A A .  30 ASN CG   1 1 
        1   421 1 1  30 ASN H    H  -7.233   9.205  14.020 1.00 . A A .  30 ASN H    1 1 
        1   422 1 1  30 ASN HA   H  -8.010  10.585  11.638 1.00 . A A .  30 ASN HA   1 1 
        1   423 1 1  30 ASN HB2  H  -9.321   8.745  13.639 1.00 . A A .  30 ASN HB2  1 1 
        1   424 1 1  30 ASN HB3  H -10.379   9.811  12.736 1.00 . A A .  30 ASN HB3  1 1 
        1   425 1 1  30 ASN HD21 H -10.613   7.139  12.453 1.00 . A A .  30 ASN HD21 1 1 
        1   426 1 1  30 ASN HD22 H -10.079   6.611  10.891 1.00 . A A .  30 ASN HD22 1 1 
        1   427 1 1  30 ASN N    N  -7.089   9.899  13.315 1.00 . A A .  30 ASN N    1 1 
        1   428 1 1  30 ASN ND2  N -10.066   7.287  11.628 1.00 . A A .  30 ASN ND2  1 1 
        1   429 1 1  30 ASN O    O  -9.889  12.123  13.106 1.00 . A A .  30 ASN O    1 1 
        1   430 1 1  30 ASN OD1  O  -8.629   8.638  10.541 1.00 . A A .  30 ASN OD1  1 1 
        1   431 1 1  31 HIS C    C  -7.859  14.528  14.373 1.00 . A A .  31 HIS C    1 1 
        1   432 1 1  31 HIS CA   C  -8.338  13.273  15.105 1.00 . A A .  31 HIS CA   1 1 
        1   433 1 1  31 HIS CB   C  -7.788  13.172  16.529 1.00 . A A .  31 HIS CB   1 1 
        1   434 1 1  31 HIS CD2  C  -5.270  13.829  16.779 1.00 . A A .  31 HIS CD2  1 1 
        1   435 1 1  31 HIS CE1  C  -4.404  11.831  16.571 1.00 . A A .  31 HIS CE1  1 1 
        1   436 1 1  31 HIS CG   C  -6.296  12.949  16.597 1.00 . A A .  31 HIS CG   1 1 
        1   437 1 1  31 HIS H    H  -7.107  11.683  14.563 1.00 . A A .  31 HIS H    1 1 
        1   438 1 1  31 HIS HA   H  -9.426  13.294  15.171 1.00 . A A .  31 HIS HA   1 1 
        1   439 1 1  31 HIS HB2  H  -8.032  14.087  17.069 1.00 . A A .  31 HIS HB2  1 1 
        1   440 1 1  31 HIS HB3  H  -8.291  12.354  17.045 1.00 . A A .  31 HIS HB3  1 1 
        1   441 1 1  31 HIS HD1  H  -6.210  10.839  16.322 1.00 . A A .  31 HIS HD1  1 1 
        1   442 1 1  31 HIS HD2  H  -5.371  14.906  16.914 1.00 . A A .  31 HIS HD2  1 1 
        1   443 1 1  31 HIS HE1  H  -3.672  11.025  16.512 1.00 . A A .  31 HIS HE1  1 1 
        1   444 1 1  31 HIS N    N  -7.989  12.094  14.332 1.00 . A A .  31 HIS N    1 1 
        1   445 1 1  31 HIS ND1  N  -5.718  11.698  16.468 1.00 . A A .  31 HIS ND1  1 1 
        1   446 1 1  31 HIS NE2  N  -4.128  13.152  16.764 1.00 . A A .  31 HIS NE2  1 1 
        1   447 1 1  31 HIS O    O  -8.373  15.621  14.605 1.00 . A A .  31 HIS O    1 1 
        1   448 1 1  32 LEU C    C  -6.651  15.227  11.252 1.00 . A A .  32 LEU C    1 1 
        1   449 1 1  32 LEU CA   C  -6.326  15.430  12.734 1.00 . A A .  32 LEU CA   1 1 
        1   450 1 1  32 LEU CB   C  -4.832  15.585  13.020 1.00 . A A .  32 LEU CB   1 1 
        1   451 1 1  32 LEU CD1  C  -3.828  13.300  12.658 1.00 . A A .  32 LEU CD1  1 1 
        1   452 1 1  32 LEU CD2  C  -2.905  14.828  14.461 1.00 . A A .  32 LEU CD2  1 1 
        1   453 1 1  32 LEU CG   C  -4.148  14.388  13.685 1.00 . A A .  32 LEU CG   1 1 
        1   454 1 1  32 LEU H    H  -6.468  13.436  13.319 1.00 . A A .  32 LEU H    1 1 
        1   455 1 1  32 LEU HA   H  -6.816  16.343  13.072 1.00 . A A .  32 LEU HA   1 1 
        1   456 1 1  32 LEU HB2  H  -4.321  15.794  12.080 1.00 . A A .  32 LEU HB2  1 1 
        1   457 1 1  32 LEU HB3  H  -4.693  16.458  13.658 1.00 . A A .  32 LEU HB3  1 1 
        1   458 1 1  32 LEU HD11 H  -4.080  12.324  13.073 1.00 . A A .  32 LEU HD11 1 1 
        1   459 1 1  32 LEU HD12 H  -4.411  13.472  11.753 1.00 . A A .  32 LEU HD12 1 1 
        1   460 1 1  32 LEU HD13 H  -2.766  13.329  12.417 1.00 . A A .  32 LEU HD13 1 1 
        1   461 1 1  32 LEU HD21 H  -2.459  13.963  14.951 1.00 . A A .  32 LEU HD21 1 1 
        1   462 1 1  32 LEU HD22 H  -2.184  15.268  13.772 1.00 . A A .  32 LEU HD22 1 1 
        1   463 1 1  32 LEU HD23 H  -3.188  15.565  15.212 1.00 . A A .  32 LEU HD23 1 1 
        1   464 1 1  32 LEU HG   H  -4.842  13.956  14.406 1.00 . A A .  32 LEU HG   1 1 
        1   465 1 1  32 LEU N    N  -6.880  14.329  13.502 1.00 . A A .  32 LEU N    1 1 
        1   466 1 1  32 LEU O    O  -7.111  14.158  10.855 1.00 . A A .  32 LEU O    1 1 
        1   467 1 1  33 PRO C    C  -5.591  15.410   8.306 1.00 . A A .  33 PRO C    1 1 
        1   468 1 1  33 PRO CA   C  -6.650  16.247   9.026 1.00 . A A .  33 PRO CA   1 1 
        1   469 1 1  33 PRO CB   C  -6.665  17.699   8.577 1.00 . A A .  33 PRO CB   1 1 
        1   470 1 1  33 PRO CD   C  -5.845  17.580  10.891 1.00 . A A .  33 PRO CD   1 1 
        1   471 1 1  33 PRO CG   C  -5.957  18.481   9.672 1.00 . A A .  33 PRO CG   1 1 
        1   472 1 1  33 PRO HA   H  -7.524  15.794   8.848 1.00 . A A .  33 PRO HA   1 1 
        1   473 1 1  33 PRO HB2  H  -6.156  17.818   7.621 1.00 . A A .  33 PRO HB2  1 1 
        1   474 1 1  33 PRO HB3  H  -7.686  18.055   8.441 1.00 . A A .  33 PRO HB3  1 1 
        1   475 1 1  33 PRO HD2  H  -4.810  17.480  11.215 1.00 . A A .  33 PRO HD2  1 1 
        1   476 1 1  33 PRO HD3  H  -6.406  17.983  11.734 1.00 . A A .  33 PRO HD3  1 1 
        1   477 1 1  33 PRO HG2  H  -4.969  18.796   9.337 1.00 . A A .  33 PRO HG2  1 1 
        1   478 1 1  33 PRO HG3  H  -6.514  19.386   9.916 1.00 . A A .  33 PRO HG3  1 1 
        1   479 1 1  33 PRO N    N  -6.391  16.298  10.455 1.00 . A A .  33 PRO N    1 1 
        1   480 1 1  33 PRO O    O  -4.493  15.212   8.824 1.00 . A A .  33 PRO O    1 1 
        1   481 1 1  34 LEU C    C  -3.638  14.703   6.425 1.00 . A A .  34 LEU C    1 1 
        1   482 1 1  34 LEU CA   C  -5.053  14.129   6.326 1.00 . A A .  34 LEU CA   1 1 
        1   483 1 1  34 LEU CB   C  -5.567  14.005   4.890 1.00 . A A .  34 LEU CB   1 1 
        1   484 1 1  34 LEU CD1  C  -3.320  13.146   4.133 1.00 . A A .  34 LEU CD1  1 1 
        1   485 1 1  34 LEU CD2  C  -5.300  11.568   4.298 1.00 . A A .  34 LEU CD2  1 1 
        1   486 1 1  34 LEU CG   C  -4.837  12.996   4.001 1.00 . A A .  34 LEU CG   1 1 
        1   487 1 1  34 LEU H    H  -6.853  15.106   6.708 1.00 . A A .  34 LEU H    1 1 
        1   488 1 1  34 LEU HA   H  -5.050  13.127   6.755 1.00 . A A .  34 LEU HA   1 1 
        1   489 1 1  34 LEU HB2  H  -6.622  13.732   4.926 1.00 . A A .  34 LEU HB2  1 1 
        1   490 1 1  34 LEU HB3  H  -5.507  14.986   4.418 1.00 . A A .  34 LEU HB3  1 1 
        1   491 1 1  34 LEU HD11 H  -2.833  12.669   3.282 1.00 . A A .  34 LEU HD11 1 1 
        1   492 1 1  34 LEU HD12 H  -3.060  14.204   4.153 1.00 . A A .  34 LEU HD12 1 1 
        1   493 1 1  34 LEU HD13 H  -2.987  12.672   5.056 1.00 . A A .  34 LEU HD13 1 1 
        1   494 1 1  34 LEU HD21 H  -5.345  11.418   5.377 1.00 . A A .  34 LEU HD21 1 1 
        1   495 1 1  34 LEU HD22 H  -6.289  11.410   3.868 1.00 . A A .  34 LEU HD22 1 1 
        1   496 1 1  34 LEU HD23 H  -4.596  10.860   3.861 1.00 . A A .  34 LEU HD23 1 1 
        1   497 1 1  34 LEU HG   H  -5.093  13.208   2.963 1.00 . A A .  34 LEU HG   1 1 
        1   498 1 1  34 LEU N    N  -5.958  14.940   7.123 1.00 . A A .  34 LEU N    1 1 
        1   499 1 1  34 LEU O    O  -2.702  13.996   6.793 1.00 . A A .  34 LEU O    1 1 
        1   500 1 1  35 LYS C    C  -1.446  16.148   7.340 1.00 . A A .  35 LYS C    1 1 
        1   501 1 1  35 LYS CA   C  -2.243  16.658   6.138 1.00 . A A .  35 LYS CA   1 1 
        1   502 1 1  35 LYS CB   C  -2.438  18.176   6.128 1.00 . A A .  35 LYS CB   1 1 
        1   503 1 1  35 LYS CD   C  -0.264  18.849   5.040 1.00 . A A .  35 LYS CD   1 1 
        1   504 1 1  35 LYS CE   C   0.326  20.223   4.717 1.00 . A A .  35 LYS CE   1 1 
        1   505 1 1  35 LYS CG   C  -1.104  18.900   6.319 1.00 . A A .  35 LYS CG   1 1 
        1   506 1 1  35 LYS H    H  -4.295  16.549   5.793 1.00 . A A .  35 LYS H    1 1 
        1   507 1 1  35 LYS HA   H  -1.703  16.397   5.228 1.00 . A A .  35 LYS HA   1 1 
        1   508 1 1  35 LYS HB2  H  -2.891  18.483   5.186 1.00 . A A .  35 LYS HB2  1 1 
        1   509 1 1  35 LYS HB3  H  -3.128  18.463   6.922 1.00 . A A .  35 LYS HB3  1 1 
        1   510 1 1  35 LYS HD2  H   0.540  18.122   5.158 1.00 . A A .  35 LYS HD2  1 1 
        1   511 1 1  35 LYS HD3  H  -0.882  18.510   4.209 1.00 . A A .  35 LYS HD3  1 1 
        1   512 1 1  35 LYS HE2  H   0.843  20.619   5.591 1.00 . A A .  35 LYS HE2  1 1 
        1   513 1 1  35 LYS HE3  H   1.068  20.129   3.924 1.00 . A A .  35 LYS HE3  1 1 
        1   514 1 1  35 LYS HG2  H  -1.286  19.938   6.597 1.00 . A A .  35 LYS HG2  1 1 
        1   515 1 1  35 LYS HG3  H  -0.551  18.443   7.139 1.00 . A A .  35 LYS HG3  1 1 
        1   516 1 1  35 LYS HZ1  H  -0.924  21.808   5.036 1.00 . A A .  35 LYS HZ1  1 1 
        1   517 1 1  35 LYS HZ2  H  -0.445  21.658   3.483 1.00 . A A .  35 LYS HZ2  1 1 
        1   518 1 1  35 LYS HZ3  H  -1.573  20.646   4.090 1.00 . A A .  35 LYS HZ3  1 1 
        1   519 1 1  35 LYS N    N  -3.528  15.981   6.091 1.00 . A A .  35 LYS N    1 1 
        1   520 1 1  35 LYS NZ   N  -0.740  21.160   4.297 1.00 . A A .  35 LYS NZ   1 1 
        1   521 1 1  35 LYS O    O  -0.443  15.456   7.175 1.00 . A A .  35 LYS O    1 1 
        1   522 1 1  36 GLU C    C  -1.039  14.583   9.749 1.00 . A A .  36 GLU C    1 1 
        1   523 1 1  36 GLU CA   C  -1.266  16.096   9.751 1.00 . A A .  36 GLU CA   1 1 
        1   524 1 1  36 GLU CB   C  -2.075  16.528  10.976 1.00 . A A .  36 GLU CB   1 1 
        1   525 1 1  36 GLU CD   C  -1.544  17.960  12.982 1.00 . A A .  36 GLU CD   1 1 
        1   526 1 1  36 GLU CG   C  -1.645  17.915  11.456 1.00 . A A .  36 GLU CG   1 1 
        1   527 1 1  36 GLU H    H  -2.739  17.072   8.648 1.00 . A A .  36 GLU H    1 1 
        1   528 1 1  36 GLU HA   H  -0.307  16.615   9.756 1.00 . A A .  36 GLU HA   1 1 
        1   529 1 1  36 GLU HB2  H  -3.137  16.537  10.730 1.00 . A A .  36 GLU HB2  1 1 
        1   530 1 1  36 GLU HB3  H  -1.940  15.803  11.779 1.00 . A A .  36 GLU HB3  1 1 
        1   531 1 1  36 GLU HG2  H  -0.682  18.174  11.017 1.00 . A A .  36 GLU HG2  1 1 
        1   532 1 1  36 GLU HG3  H  -2.362  18.661  11.113 1.00 . A A .  36 GLU HG3  1 1 
        1   533 1 1  36 GLU N    N  -1.922  16.509   8.522 1.00 . A A .  36 GLU N    1 1 
        1   534 1 1  36 GLU O    O   0.070  14.118  10.007 1.00 . A A .  36 GLU O    1 1 
        1   535 1 1  36 GLU OE1  O  -2.480  17.441  13.628 1.00 . A A .  36 GLU OE1  1 1 
        1   536 1 1  36 GLU OE2  O  -0.534  18.514  13.468 1.00 . A A .  36 GLU OE2  1 1 
        1   537 1 1  37 ARG C    C  -0.743  11.954   8.740 1.00 . A A .  37 ARG C    1 1 
        1   538 1 1  37 ARG CA   C  -2.039  12.406   9.417 1.00 . A A .  37 ARG CA   1 1 
        1   539 1 1  37 ARG CB   C  -3.232  11.818   8.662 1.00 . A A .  37 ARG CB   1 1 
        1   540 1 1  37 ARG CD   C  -5.541  10.832   8.907 1.00 . A A .  37 ARG CD   1 1 
        1   541 1 1  37 ARG CG   C  -4.246  11.205   9.631 1.00 . A A .  37 ARG CG   1 1 
        1   542 1 1  37 ARG CZ   C  -7.953  11.381   9.207 1.00 . A A .  37 ARG CZ   1 1 
        1   543 1 1  37 ARG H    H  -3.006  14.243   9.248 1.00 . A A .  37 ARG H    1 1 
        1   544 1 1  37 ARG HA   H  -2.063  12.098  10.462 1.00 . A A .  37 ARG HA   1 1 
        1   545 1 1  37 ARG HB2  H  -3.714  12.597   8.072 1.00 . A A .  37 ARG HB2  1 1 
        1   546 1 1  37 ARG HB3  H  -2.886  11.056   7.963 1.00 . A A .  37 ARG HB3  1 1 
        1   547 1 1  37 ARG HD2  H  -5.422  10.979   7.833 1.00 . A A .  37 ARG HD2  1 1 
        1   548 1 1  37 ARG HD3  H  -5.763   9.777   9.062 1.00 . A A .  37 ARG HD3  1 1 
        1   549 1 1  37 ARG HE   H  -6.434  12.485   9.931 1.00 . A A .  37 ARG HE   1 1 
        1   550 1 1  37 ARG HG2  H  -3.818  10.318  10.098 1.00 . A A .  37 ARG HG2  1 1 
        1   551 1 1  37 ARG HG3  H  -4.463  11.913  10.431 1.00 . A A .  37 ARG HG3  1 1 
        1   552 1 1  37 ARG HH11 H  -7.594   9.684   8.145 1.00 . A A .  37 ARG HH11 1 1 
        1   553 1 1  37 ARG HH12 H  -9.267  10.079   8.363 1.00 . A A .  37 ARG HH12 1 1 
        1   554 1 1  37 ARG HH21 H  -8.640  13.006  10.218 1.00 . A A .  37 ARG HH21 1 1 
        1   555 1 1  37 ARG HH22 H  -9.866  11.981   9.549 1.00 . A A .  37 ARG HH22 1 1 
        1   556 1 1  37 ARG N    N  -2.107  13.857   9.456 1.00 . A A .  37 ARG N    1 1 
        1   557 1 1  37 ARG NE   N  -6.659  11.663   9.409 1.00 . A A .  37 ARG NE   1 1 
        1   558 1 1  37 ARG NH1  N  -8.301  10.289   8.513 1.00 . A A .  37 ARG NH1  1 1 
        1   559 1 1  37 ARG NH2  N  -8.900  12.191   9.700 1.00 . A A .  37 ARG NH2  1 1 
        1   560 1 1  37 ARG O    O   0.088  11.293   9.360 1.00 . A A .  37 ARG O    1 1 
        1   561 1 1  38 MET C    C   1.846  12.277   7.491 1.00 . A A .  38 MET C    1 1 
        1   562 1 1  38 MET CA   C   0.568  11.971   6.707 1.00 . A A .  38 MET CA   1 1 
        1   563 1 1  38 MET CB   C   0.577  12.750   5.391 1.00 . A A .  38 MET CB   1 1 
        1   564 1 1  38 MET CE   C   0.112   9.486   4.025 1.00 . A A .  38 MET CE   1 1 
        1   565 1 1  38 MET CG   C  -0.410  12.145   4.390 1.00 . A A .  38 MET CG   1 1 
        1   566 1 1  38 MET H    H  -1.293  12.867   6.978 1.00 . A A .  38 MET H    1 1 
        1   567 1 1  38 MET HA   H   0.489  10.897   6.533 1.00 . A A .  38 MET HA   1 1 
        1   568 1 1  38 MET HB2  H   0.317  13.792   5.579 1.00 . A A .  38 MET HB2  1 1 
        1   569 1 1  38 MET HB3  H   1.581  12.743   4.967 1.00 . A A .  38 MET HB3  1 1 
        1   570 1 1  38 MET HE1  H   0.768   9.350   4.885 1.00 . A A .  38 MET HE1  1 1 
        1   571 1 1  38 MET HE2  H  -0.927   9.457   4.352 1.00 . A A .  38 MET HE2  1 1 
        1   572 1 1  38 MET HE3  H   0.289   8.687   3.304 1.00 . A A .  38 MET HE3  1 1 
        1   573 1 1  38 MET HG2  H  -1.184  11.590   4.919 1.00 . A A .  38 MET HG2  1 1 
        1   574 1 1  38 MET HG3  H  -0.910  12.939   3.835 1.00 . A A .  38 MET HG3  1 1 
        1   575 1 1  38 MET N    N  -0.612  12.329   7.476 1.00 . A A .  38 MET N    1 1 
        1   576 1 1  38 MET O    O   2.559  11.364   7.904 1.00 . A A .  38 MET O    1 1 
        1   577 1 1  38 MET SD   S   0.452  11.063   3.261 1.00 . A A .  38 MET SD   1 1 
        1   578 1 1  39 VAL C    C   3.414  13.183   9.681 1.00 . A A .  39 VAL C    1 1 
        1   579 1 1  39 VAL CA   C   3.276  14.004   8.397 1.00 . A A .  39 VAL CA   1 1 
        1   580 1 1  39 VAL CB   C   3.202  15.510   8.656 1.00 . A A .  39 VAL CB   1 1 
        1   581 1 1  39 VAL CG1  C   1.881  15.886   9.331 1.00 . A A .  39 VAL CG1  1 1 
        1   582 1 1  39 VAL CG2  C   4.396  15.984   9.487 1.00 . A A .  39 VAL CG2  1 1 
        1   583 1 1  39 VAL H    H   1.512  14.302   7.332 1.00 . A A .  39 VAL H    1 1 
        1   584 1 1  39 VAL HA   H   4.143  13.813   7.764 1.00 . A A .  39 VAL HA   1 1 
        1   585 1 1  39 VAL HB   H   3.242  16.018   7.693 1.00 . A A .  39 VAL HB   1 1 
        1   586 1 1  39 VAL HG11 H   1.824  15.408  10.309 1.00 . A A .  39 VAL HG11 1 1 
        1   587 1 1  39 VAL HG12 H   1.830  16.968   9.452 1.00 . A A .  39 VAL HG12 1 1 
        1   588 1 1  39 VAL HG13 H   1.049  15.549   8.713 1.00 . A A .  39 VAL HG13 1 1 
        1   589 1 1  39 VAL HG21 H   5.068  16.567   8.858 1.00 . A A .  39 VAL HG21 1 1 
        1   590 1 1  39 VAL HG22 H   4.042  16.602  10.312 1.00 . A A .  39 VAL HG22 1 1 
        1   591 1 1  39 VAL HG23 H   4.929  15.119   9.883 1.00 . A A .  39 VAL HG23 1 1 
        1   592 1 1  39 VAL N    N   2.097  13.566   7.671 1.00 . A A .  39 VAL N    1 1 
        1   593 1 1  39 VAL O    O   4.487  12.659   9.975 1.00 . A A .  39 VAL O    1 1 
        1   594 1 1  40 GLU C    C   2.772  10.914  11.420 1.00 . A A .  40 GLU C    1 1 
        1   595 1 1  40 GLU CA   C   2.297  12.349  11.657 1.00 . A A .  40 GLU CA   1 1 
        1   596 1 1  40 GLU CB   C   0.904  12.367  12.290 1.00 . A A .  40 GLU CB   1 1 
        1   597 1 1  40 GLU CD   C   0.676  10.601  14.076 1.00 . A A .  40 GLU CD   1 1 
        1   598 1 1  40 GLU CG   C   0.980  12.073  13.790 1.00 . A A .  40 GLU CG   1 1 
        1   599 1 1  40 GLU H    H   1.443  13.527  10.166 1.00 . A A .  40 GLU H    1 1 
        1   600 1 1  40 GLU HA   H   2.995  12.867  12.315 1.00 . A A .  40 GLU HA   1 1 
        1   601 1 1  40 GLU HB2  H   0.440  13.341  12.130 1.00 . A A .  40 GLU HB2  1 1 
        1   602 1 1  40 GLU HB3  H   0.269  11.628  11.803 1.00 . A A .  40 GLU HB3  1 1 
        1   603 1 1  40 GLU HG2  H   1.973  12.323  14.163 1.00 . A A .  40 GLU HG2  1 1 
        1   604 1 1  40 GLU HG3  H   0.270  12.705  14.324 1.00 . A A .  40 GLU HG3  1 1 
        1   605 1 1  40 GLU N    N   2.312  13.097  10.412 1.00 . A A .  40 GLU N    1 1 
        1   606 1 1  40 GLU O    O   3.519  10.363  12.228 1.00 . A A .  40 GLU O    1 1 
        1   607 1 1  40 GLU OE1  O   0.939   9.781  13.170 1.00 . A A .  40 GLU OE1  1 1 
        1   608 1 1  40 GLU OE2  O   0.187  10.330  15.194 1.00 . A A .  40 GLU OE2  1 1 
        1   609 1 1  41 ILE C    C   4.205   8.916   9.749 1.00 . A A .  41 ILE C    1 1 
        1   610 1 1  41 ILE CA   C   2.691   8.991   9.956 1.00 . A A .  41 ILE CA   1 1 
        1   611 1 1  41 ILE CB   C   1.881   8.511   8.751 1.00 . A A .  41 ILE CB   1 1 
        1   612 1 1  41 ILE CD1  C  -0.462   8.740   7.846 1.00 . A A .  41 ILE CD1  1 1 
        1   613 1 1  41 ILE CG1  C   0.389   8.446   9.083 1.00 . A A .  41 ILE CG1  1 1 
        1   614 1 1  41 ILE CG2  C   2.411   7.173   8.231 1.00 . A A .  41 ILE CG2  1 1 
        1   615 1 1  41 ILE H    H   1.714  10.806   9.658 1.00 . A A .  41 ILE H    1 1 
        1   616 1 1  41 ILE HA   H   2.426   8.351  10.798 1.00 . A A .  41 ILE HA   1 1 
        1   617 1 1  41 ILE HB   H   2.000   9.238   7.948 1.00 . A A .  41 ILE HB   1 1 
        1   618 1 1  41 ILE HD11 H  -1.204   7.951   7.720 1.00 . A A .  41 ILE HD11 1 1 
        1   619 1 1  41 ILE HD12 H  -0.968   9.697   7.972 1.00 . A A .  41 ILE HD12 1 1 
        1   620 1 1  41 ILE HD13 H   0.179   8.780   6.966 1.00 . A A .  41 ILE HD13 1 1 
        1   621 1 1  41 ILE HG12 H   0.142   7.458   9.472 1.00 . A A .  41 ILE HG12 1 1 
        1   622 1 1  41 ILE HG13 H   0.156   9.165   9.868 1.00 . A A .  41 ILE HG13 1 1 
        1   623 1 1  41 ILE HG21 H   2.582   7.243   7.157 1.00 . A A .  41 ILE HG21 1 1 
        1   624 1 1  41 ILE HG22 H   3.348   6.934   8.733 1.00 . A A .  41 ILE HG22 1 1 
        1   625 1 1  41 ILE HG23 H   1.680   6.390   8.433 1.00 . A A .  41 ILE HG23 1 1 
        1   626 1 1  41 ILE N    N   2.321  10.351  10.310 1.00 . A A .  41 ILE N    1 1 
        1   627 1 1  41 ILE O    O   4.902   8.217  10.482 1.00 . A A .  41 ILE O    1 1 
        1   628 1 1  42 GLY C    C   6.931   9.664   9.709 1.00 . A A .  42 GLY C    1 1 
        1   629 1 1  42 GLY CA   C   6.088   9.673   8.433 1.00 . A A .  42 GLY CA   1 1 
        1   630 1 1  42 GLY H    H   4.095  10.213   8.154 1.00 . A A .  42 GLY H    1 1 
        1   631 1 1  42 GLY HA2  H   6.344   8.810   7.818 1.00 . A A .  42 GLY HA2  1 1 
        1   632 1 1  42 GLY HA3  H   6.318  10.562   7.846 1.00 . A A .  42 GLY HA3  1 1 
        1   633 1 1  42 GLY N    N   4.669   9.647   8.746 1.00 . A A .  42 GLY N    1 1 
        1   634 1 1  42 GLY O    O   7.998   9.053   9.748 1.00 . A A .  42 GLY O    1 1 
        1   635 1 1  43 SER C    C   7.081   9.067  12.695 1.00 . A A .  43 SER C    1 1 
        1   636 1 1  43 SER CA   C   7.114  10.428  11.997 1.00 . A A .  43 SER CA   1 1 
        1   637 1 1  43 SER CB   C   6.495  11.501  12.895 1.00 . A A .  43 SER CB   1 1 
        1   638 1 1  43 SER H    H   5.553  10.843  10.682 1.00 . A A .  43 SER H    1 1 
        1   639 1 1  43 SER HA   H   8.139  10.707  11.751 1.00 . A A .  43 SER HA   1 1 
        1   640 1 1  43 SER HB2  H   5.965  12.227  12.279 1.00 . A A .  43 SER HB2  1 1 
        1   641 1 1  43 SER HB3  H   5.757  11.042  13.553 1.00 . A A .  43 SER HB3  1 1 
        1   642 1 1  43 SER HG   H   7.262  12.076  14.651 1.00 . A A .  43 SER HG   1 1 
        1   643 1 1  43 SER N    N   6.421  10.349  10.722 1.00 . A A .  43 SER N    1 1 
        1   644 1 1  43 SER O    O   8.126   8.515  13.036 1.00 . A A .  43 SER O    1 1 
        1   645 1 1  43 SER OG   O   7.477  12.172  13.679 1.00 . A A .  43 SER OG   1 1 
        1   646 1 1  44 ARG C    C   6.549   6.214  12.862 1.00 . A A .  44 ARG C    1 1 
        1   647 1 1  44 ARG CA   C   5.688   7.281  13.541 1.00 . A A .  44 ARG CA   1 1 
        1   648 1 1  44 ARG CB   C   4.222   6.845  13.498 1.00 . A A .  44 ARG CB   1 1 
        1   649 1 1  44 ARG CD   C   2.077   7.160  14.788 1.00 . A A .  44 ARG CD   1 1 
        1   650 1 1  44 ARG CG   C   3.331   7.844  14.239 1.00 . A A .  44 ARG CG   1 1 
        1   651 1 1  44 ARG CZ   C   2.623   7.346  17.212 1.00 . A A .  44 ARG CZ   1 1 
        1   652 1 1  44 ARG H    H   5.025   9.022  12.609 1.00 . A A .  44 ARG H    1 1 
        1   653 1 1  44 ARG HA   H   6.004   7.443  14.571 1.00 . A A .  44 ARG HA   1 1 
        1   654 1 1  44 ARG HB2  H   3.894   6.759  12.462 1.00 . A A .  44 ARG HB2  1 1 
        1   655 1 1  44 ARG HB3  H   4.119   5.857  13.948 1.00 . A A .  44 ARG HB3  1 1 
        1   656 1 1  44 ARG HD2  H   1.257   7.875  14.842 1.00 . A A .  44 ARG HD2  1 1 
        1   657 1 1  44 ARG HD3  H   1.762   6.364  14.112 1.00 . A A .  44 ARG HD3  1 1 
        1   658 1 1  44 ARG HE   H   2.333   5.608  16.239 1.00 . A A .  44 ARG HE   1 1 
        1   659 1 1  44 ARG HG2  H   3.890   8.298  15.058 1.00 . A A .  44 ARG HG2  1 1 
        1   660 1 1  44 ARG HG3  H   3.043   8.651  13.564 1.00 . A A .  44 ARG HG3  1 1 
        1   661 1 1  44 ARG HH11 H   2.482   9.124  16.234 1.00 . A A .  44 ARG HH11 1 1 
        1   662 1 1  44 ARG HH12 H   2.861   9.238  17.921 1.00 . A A .  44 ARG HH12 1 1 
        1   663 1 1  44 ARG HH21 H   2.833   5.757  18.464 1.00 . A A .  44 ARG HH21 1 1 
        1   664 1 1  44 ARG HH22 H   3.062   7.310  19.197 1.00 . A A .  44 ARG HH22 1 1 
        1   665 1 1  44 ARG N    N   5.870   8.566  12.889 1.00 . A A .  44 ARG N    1 1 
        1   666 1 1  44 ARG NE   N   2.352   6.602  16.131 1.00 . A A .  44 ARG NE   1 1 
        1   667 1 1  44 ARG NH1  N   2.659   8.682  17.114 1.00 . A A .  44 ARG NH1  1 1 
        1   668 1 1  44 ARG NH2  N   2.860   6.754  18.391 1.00 . A A .  44 ARG NH2  1 1 
        1   669 1 1  44 ARG O    O   7.118   5.352  13.530 1.00 . A A .  44 ARG O    1 1 
        1   670 1 1  45 TRP C    C   8.877   5.566  11.117 1.00 . A A .  45 TRP C    1 1 
        1   671 1 1  45 TRP CA   C   7.402   5.361  10.765 1.00 . A A .  45 TRP CA   1 1 
        1   672 1 1  45 TRP CB   C   7.117   5.511   9.270 1.00 . A A .  45 TRP CB   1 1 
        1   673 1 1  45 TRP CD1  C   9.256   5.192   7.860 1.00 . A A .  45 TRP CD1  1 1 
        1   674 1 1  45 TRP CD2  C   7.954   3.399   7.894 1.00 . A A .  45 TRP CD2  1 1 
        1   675 1 1  45 TRP CE2  C   9.052   3.098   7.113 1.00 . A A .  45 TRP CE2  1 1 
        1   676 1 1  45 TRP CE3  C   6.932   2.460   8.114 1.00 . A A .  45 TRP CE3  1 1 
        1   677 1 1  45 TRP CG   C   8.097   4.754   8.371 1.00 . A A .  45 TRP CG   1 1 
        1   678 1 1  45 TRP CH2  C   8.226   0.905   6.697 1.00 . A A .  45 TRP CH2  1 1 
        1   679 1 1  45 TRP CZ2  C   9.232   1.857   6.491 1.00 . A A .  45 TRP CZ2  1 1 
        1   680 1 1  45 TRP CZ3  C   7.127   1.224   7.485 1.00 . A A .  45 TRP CZ3  1 1 
        1   681 1 1  45 TRP H    H   6.154   7.011  11.006 1.00 . A A .  45 TRP H    1 1 
        1   682 1 1  45 TRP HA   H   7.088   4.357  11.049 1.00 . A A .  45 TRP HA   1 1 
        1   683 1 1  45 TRP HB2  H   6.106   5.159   9.065 1.00 . A A .  45 TRP HB2  1 1 
        1   684 1 1  45 TRP HB3  H   7.145   6.569   9.010 1.00 . A A .  45 TRP HB3  1 1 
        1   685 1 1  45 TRP HD1  H   9.664   6.188   8.030 1.00 . A A .  45 TRP HD1  1 1 
        1   686 1 1  45 TRP HE1  H  10.818   4.321   6.566 1.00 . A A .  45 TRP HE1  1 1 
        1   687 1 1  45 TRP HE3  H   6.056   2.673   8.726 1.00 . A A .  45 TRP HE3  1 1 
        1   688 1 1  45 TRP HH2  H   8.305  -0.082   6.240 1.00 . A A .  45 TRP HH2  1 1 
        1   689 1 1  45 TRP HZ2  H  10.109   1.643   5.879 1.00 . A A .  45 TRP HZ2  1 1 
        1   690 1 1  45 TRP HZ3  H   6.364   0.459   7.624 1.00 . A A .  45 TRP HZ3  1 1 
        1   691 1 1  45 TRP N    N   6.619   6.307  11.542 1.00 . A A .  45 TRP N    1 1 
        1   692 1 1  45 TRP NE1  N   9.869   4.222   7.092 1.00 . A A .  45 TRP NE1  1 1 
        1   693 1 1  45 TRP O    O   9.665   4.623  11.080 1.00 . A A .  45 TRP O    1 1 
        1   694 1 1  46 GLN C    C  10.861   6.735  13.253 1.00 . A A .  46 GLN C    1 1 
        1   695 1 1  46 GLN CA   C  10.572   7.147  11.808 1.00 . A A .  46 GLN CA   1 1 
        1   696 1 1  46 GLN CB   C  10.836   8.640  11.601 1.00 . A A .  46 GLN CB   1 1 
        1   697 1 1  46 GLN CD   C  12.973   9.277  10.422 1.00 . A A .  46 GLN CD   1 1 
        1   698 1 1  46 GLN CG   C  11.502   8.895  10.247 1.00 . A A .  46 GLN CG   1 1 
        1   699 1 1  46 GLN H    H   8.559   7.568  11.478 1.00 . A A .  46 GLN H    1 1 
        1   700 1 1  46 GLN HA   H  11.201   6.575  11.127 1.00 . A A .  46 GLN HA   1 1 
        1   701 1 1  46 GLN HB2  H   9.898   9.191  11.659 1.00 . A A .  46 GLN HB2  1 1 
        1   702 1 1  46 GLN HB3  H  11.476   9.014  12.400 1.00 . A A .  46 GLN HB3  1 1 
        1   703 1 1  46 GLN HE21 H  12.800  10.494   8.814 1.00 . A A .  46 GLN HE21 1 1 
        1   704 1 1  46 GLN HE22 H  14.366  10.461   9.553 1.00 . A A .  46 GLN HE22 1 1 
        1   705 1 1  46 GLN HG2  H  11.425   8.003   9.626 1.00 . A A .  46 GLN HG2  1 1 
        1   706 1 1  46 GLN HG3  H  10.975   9.694   9.724 1.00 . A A .  46 GLN HG3  1 1 
        1   707 1 1  46 GLN N    N   9.206   6.806  11.450 1.00 . A A .  46 GLN N    1 1 
        1   708 1 1  46 GLN NE2  N  13.416  10.150   9.522 1.00 . A A .  46 GLN NE2  1 1 
        1   709 1 1  46 GLN O    O  11.977   6.907  13.740 1.00 . A A .  46 GLN O    1 1 
        1   710 1 1  46 GLN OE1  O  13.660   8.810  11.316 1.00 . A A .  46 GLN OE1  1 1 
        1   711 1 1  47 ARG C    C  10.261   4.260  15.332 1.00 . A A .  47 ARG C    1 1 
        1   712 1 1  47 ARG CA   C   9.965   5.760  15.277 1.00 . A A .  47 ARG CA   1 1 
        1   713 1 1  47 ARG CB   C   8.689   6.050  16.070 1.00 . A A .  47 ARG CB   1 1 
        1   714 1 1  47 ARG CD   C   7.065   7.838  16.795 1.00 . A A .  47 ARG CD   1 1 
        1   715 1 1  47 ARG CG   C   8.423   7.555  16.151 1.00 . A A .  47 ARG CG   1 1 
        1   716 1 1  47 ARG CZ   C   7.830   9.363  18.611 1.00 . A A .  47 ARG CZ   1 1 
        1   717 1 1  47 ARG H    H   8.930   6.062  13.495 1.00 . A A .  47 ARG H    1 1 
        1   718 1 1  47 ARG HA   H  10.797   6.339  15.677 1.00 . A A .  47 ARG HA   1 1 
        1   719 1 1  47 ARG HB2  H   7.842   5.553  15.597 1.00 . A A .  47 ARG HB2  1 1 
        1   720 1 1  47 ARG HB3  H   8.779   5.638  17.075 1.00 . A A .  47 ARG HB3  1 1 
        1   721 1 1  47 ARG HD2  H   6.556   8.636  16.254 1.00 . A A .  47 ARG HD2  1 1 
        1   722 1 1  47 ARG HD3  H   6.430   6.954  16.729 1.00 . A A .  47 ARG HD3  1 1 
        1   723 1 1  47 ARG HE   H   6.913   7.597  18.915 1.00 . A A .  47 ARG HE   1 1 
        1   724 1 1  47 ARG HG2  H   9.212   8.036  16.730 1.00 . A A .  47 ARG HG2  1 1 
        1   725 1 1  47 ARG HG3  H   8.453   7.987  15.151 1.00 . A A .  47 ARG HG3  1 1 
        1   726 1 1  47 ARG HH11 H   8.200  10.034  16.727 1.00 . A A .  47 ARG HH11 1 1 
        1   727 1 1  47 ARG HH12 H   8.727  11.083  18.000 1.00 . A A .  47 ARG HH12 1 1 
        1   728 1 1  47 ARG HH21 H   7.607   8.981  20.596 1.00 . A A .  47 ARG HH21 1 1 
        1   729 1 1  47 ARG HH22 H   8.387  10.481  20.216 1.00 . A A .  47 ARG HH22 1 1 
        1   730 1 1  47 ARG N    N   9.835   6.198  13.898 1.00 . A A .  47 ARG N    1 1 
        1   731 1 1  47 ARG NE   N   7.246   8.225  18.212 1.00 . A A .  47 ARG NE   1 1 
        1   732 1 1  47 ARG NH1  N   8.291  10.234  17.702 1.00 . A A .  47 ARG NH1  1 1 
        1   733 1 1  47 ARG NH2  N   7.952   9.631  19.918 1.00 . A A .  47 ARG NH2  1 1 
        1   734 1 1  47 ARG O    O  11.210   3.835  15.990 1.00 . A A .  47 ARG O    1 1 
        1   735 1 1  48 ILE C    C  11.063   1.718  14.332 1.00 . A A .  48 ILE C    1 1 
        1   736 1 1  48 ILE CA   C   9.594   2.056  14.593 1.00 . A A .  48 ILE CA   1 1 
        1   737 1 1  48 ILE CB   C   8.631   1.437  13.578 1.00 . A A .  48 ILE CB   1 1 
        1   738 1 1  48 ILE CD1  C   7.819   1.476  11.191 1.00 . A A .  48 ILE CD1  1 1 
        1   739 1 1  48 ILE CG1  C   8.776   2.102  12.208 1.00 . A A .  48 ILE CG1  1 1 
        1   740 1 1  48 ILE CG2  C   7.189   1.486  14.089 1.00 . A A .  48 ILE CG2  1 1 
        1   741 1 1  48 ILE H    H   8.663   3.853  14.100 1.00 . A A .  48 ILE H    1 1 
        1   742 1 1  48 ILE HA   H   9.319   1.670  15.575 1.00 . A A .  48 ILE HA   1 1 
        1   743 1 1  48 ILE HB   H   8.893   0.386  13.456 1.00 . A A .  48 ILE HB   1 1 
        1   744 1 1  48 ILE HD11 H   8.390   0.904  10.460 1.00 . A A .  48 ILE HD11 1 1 
        1   745 1 1  48 ILE HD12 H   7.122   0.816  11.706 1.00 . A A .  48 ILE HD12 1 1 
        1   746 1 1  48 ILE HD13 H   7.264   2.264  10.682 1.00 . A A .  48 ILE HD13 1 1 
        1   747 1 1  48 ILE HG12 H   8.573   3.169  12.295 1.00 . A A .  48 ILE HG12 1 1 
        1   748 1 1  48 ILE HG13 H   9.803   2.000  11.857 1.00 . A A .  48 ILE HG13 1 1 
        1   749 1 1  48 ILE HG21 H   7.139   2.121  14.974 1.00 . A A .  48 ILE HG21 1 1 
        1   750 1 1  48 ILE HG22 H   6.542   1.893  13.312 1.00 . A A .  48 ILE HG22 1 1 
        1   751 1 1  48 ILE HG23 H   6.860   0.479  14.346 1.00 . A A .  48 ILE HG23 1 1 
        1   752 1 1  48 ILE N    N   9.432   3.500  14.632 1.00 . A A .  48 ILE N    1 1 
        1   753 1 1  48 ILE O    O  11.865   2.605  14.044 1.00 . A A .  48 ILE O    1 1 
        1   754 1 1  49 SER C    C  12.837  -0.698  12.850 1.00 . A A .  49 SER C    1 1 
        1   755 1 1  49 SER CA   C  12.729  -0.031  14.222 1.00 . A A .  49 SER CA   1 1 
        1   756 1 1  49 SER CB   C  13.163  -1.004  15.321 1.00 . A A .  49 SER CB   1 1 
        1   757 1 1  49 SER H    H  10.712  -0.280  14.678 1.00 . A A .  49 SER H    1 1 
        1   758 1 1  49 SER HA   H  13.351   0.863  14.263 1.00 . A A .  49 SER HA   1 1 
        1   759 1 1  49 SER HB2  H  12.280  -1.433  15.795 1.00 . A A .  49 SER HB2  1 1 
        1   760 1 1  49 SER HB3  H  13.718  -1.829  14.876 1.00 . A A .  49 SER HB3  1 1 
        1   761 1 1  49 SER HG   H  13.939  -0.888  17.162 1.00 . A A .  49 SER HG   1 1 
        1   762 1 1  49 SER N    N  11.371   0.435  14.443 1.00 . A A .  49 SER N    1 1 
        1   763 1 1  49 SER O    O  11.833  -0.882  12.164 1.00 . A A .  49 SER O    1 1 
        1   764 1 1  49 SER OG   O  13.970  -0.368  16.309 1.00 . A A .  49 SER OG   1 1 
        1   765 1 1  50 GLN C    C  13.341  -2.843  10.997 1.00 . A A .  50 GLN C    1 1 
        1   766 1 1  50 GLN CA   C  14.318  -1.685  11.211 1.00 . A A .  50 GLN CA   1 1 
        1   767 1 1  50 GLN CB   C  15.767  -2.166  11.116 1.00 . A A .  50 GLN CB   1 1 
        1   768 1 1  50 GLN CD   C  15.709  -1.751   8.629 1.00 . A A .  50 GLN CD   1 1 
        1   769 1 1  50 GLN CG   C  16.061  -2.750   9.733 1.00 . A A .  50 GLN CG   1 1 
        1   770 1 1  50 GLN H    H  14.877  -0.889  13.053 1.00 . A A .  50 GLN H    1 1 
        1   771 1 1  50 GLN HA   H  14.147  -0.914  10.460 1.00 . A A .  50 GLN HA   1 1 
        1   772 1 1  50 GLN HB2  H  16.444  -1.335  11.315 1.00 . A A .  50 GLN HB2  1 1 
        1   773 1 1  50 GLN HB3  H  15.955  -2.920  11.881 1.00 . A A .  50 GLN HB3  1 1 
        1   774 1 1  50 GLN HE21 H  13.795  -2.407   8.711 1.00 . A A .  50 GLN HE21 1 1 
        1   775 1 1  50 GLN HE22 H  14.101  -1.156   7.553 1.00 . A A .  50 GLN HE22 1 1 
        1   776 1 1  50 GLN HG2  H  17.116  -3.017   9.664 1.00 . A A .  50 GLN HG2  1 1 
        1   777 1 1  50 GLN HG3  H  15.490  -3.668   9.593 1.00 . A A .  50 GLN HG3  1 1 
        1   778 1 1  50 GLN N    N  14.065  -1.042  12.490 1.00 . A A .  50 GLN N    1 1 
        1   779 1 1  50 GLN NE2  N  14.429  -1.773   8.268 1.00 . A A .  50 GLN NE2  1 1 
        1   780 1 1  50 GLN O    O  12.699  -2.933   9.951 1.00 . A A .  50 GLN O    1 1 
        1   781 1 1  50 GLN OE1  O  16.544  -1.009   8.139 1.00 . A A .  50 GLN OE1  1 1 
        1   782 1 1  51 SER C    C  11.058  -4.457  11.257 1.00 . A A .  51 SER C    1 1 
        1   783 1 1  51 SER CA   C  12.370  -4.848  11.939 1.00 . A A .  51 SER CA   1 1 
        1   784 1 1  51 SER CB   C  12.095  -5.411  13.335 1.00 . A A .  51 SER CB   1 1 
        1   785 1 1  51 SER H    H  13.783  -3.619  12.851 1.00 . A A .  51 SER H    1 1 
        1   786 1 1  51 SER HA   H  12.903  -5.592  11.347 1.00 . A A .  51 SER HA   1 1 
        1   787 1 1  51 SER HB2  H  12.970  -5.959  13.684 1.00 . A A .  51 SER HB2  1 1 
        1   788 1 1  51 SER HB3  H  11.935  -4.589  14.032 1.00 . A A .  51 SER HB3  1 1 
        1   789 1 1  51 SER HG   H  11.099  -7.032  12.713 1.00 . A A .  51 SER HG   1 1 
        1   790 1 1  51 SER N    N  13.258  -3.700  12.004 1.00 . A A .  51 SER N    1 1 
        1   791 1 1  51 SER O    O  10.756  -4.934  10.164 1.00 . A A .  51 SER O    1 1 
        1   792 1 1  51 SER OG   O  10.960  -6.273  13.349 1.00 . A A .  51 SER OG   1 1 
        1   793 1 1  52 GLN C    C   9.156  -2.855   9.901 1.00 . A A .  52 GLN C    1 1 
        1   794 1 1  52 GLN CA   C   9.040  -3.131  11.401 1.00 . A A .  52 GLN CA   1 1 
        1   795 1 1  52 GLN CB   C   8.553  -1.889  12.151 1.00 . A A .  52 GLN CB   1 1 
        1   796 1 1  52 GLN CD   C   7.343  -3.496  13.672 1.00 . A A .  52 GLN CD   1 1 
        1   797 1 1  52 GLN CG   C   7.251  -2.177  12.901 1.00 . A A .  52 GLN CG   1 1 
        1   798 1 1  52 GLN H    H  10.566  -3.208  12.818 1.00 . A A .  52 GLN H    1 1 
        1   799 1 1  52 GLN HA   H   8.341  -3.949  11.574 1.00 . A A .  52 GLN HA   1 1 
        1   800 1 1  52 GLN HB2  H   9.318  -1.562  12.855 1.00 . A A .  52 GLN HB2  1 1 
        1   801 1 1  52 GLN HB3  H   8.398  -1.072  11.446 1.00 . A A .  52 GLN HB3  1 1 
        1   802 1 1  52 GLN HE21 H   8.607  -2.593  14.971 1.00 . A A .  52 GLN HE21 1 1 
        1   803 1 1  52 GLN HE22 H   8.261  -4.256  15.308 1.00 . A A .  52 GLN HE22 1 1 
        1   804 1 1  52 GLN HG2  H   7.037  -1.362  13.592 1.00 . A A .  52 GLN HG2  1 1 
        1   805 1 1  52 GLN HG3  H   6.422  -2.222  12.194 1.00 . A A .  52 GLN HG3  1 1 
        1   806 1 1  52 GLN N    N  10.313  -3.592  11.929 1.00 . A A .  52 GLN N    1 1 
        1   807 1 1  52 GLN NE2  N   8.136  -3.444  14.739 1.00 . A A .  52 GLN NE2  1 1 
        1   808 1 1  52 GLN O    O   8.629  -3.609   9.085 1.00 . A A .  52 GLN O    1 1 
        1   809 1 1  52 GLN OE1  O   6.734  -4.493  13.322 1.00 . A A .  52 GLN OE1  1 1 
        1   810 1 1  53 LYS C    C  10.321  -2.639   7.357 1.00 . A A .  53 LYS C    1 1 
        1   811 1 1  53 LYS CA   C  10.043  -1.388   8.194 1.00 . A A .  53 LYS CA   1 1 
        1   812 1 1  53 LYS CB   C  11.131  -0.318   8.081 1.00 . A A .  53 LYS CB   1 1 
        1   813 1 1  53 LYS CD   C  11.685   2.097   8.548 1.00 . A A .  53 LYS CD   1 1 
        1   814 1 1  53 LYS CE   C  11.239   3.374   9.261 1.00 . A A .  53 LYS CE   1 1 
        1   815 1 1  53 LYS CG   C  10.763   0.926   8.892 1.00 . A A .  53 LYS CG   1 1 
        1   816 1 1  53 LYS H    H  10.277  -1.165  10.252 1.00 . A A .  53 LYS H    1 1 
        1   817 1 1  53 LYS HA   H   9.112  -0.940   7.848 1.00 . A A .  53 LYS HA   1 1 
        1   818 1 1  53 LYS HB2  H  12.081  -0.720   8.434 1.00 . A A .  53 LYS HB2  1 1 
        1   819 1 1  53 LYS HB3  H  11.271  -0.047   7.034 1.00 . A A .  53 LYS HB3  1 1 
        1   820 1 1  53 LYS HD2  H  12.709   1.855   8.834 1.00 . A A .  53 LYS HD2  1 1 
        1   821 1 1  53 LYS HD3  H  11.686   2.259   7.470 1.00 . A A .  53 LYS HD3  1 1 
        1   822 1 1  53 LYS HE2  H  11.554   4.247   8.689 1.00 . A A .  53 LYS HE2  1 1 
        1   823 1 1  53 LYS HE3  H  10.150   3.406   9.317 1.00 . A A .  53 LYS HE3  1 1 
        1   824 1 1  53 LYS HG2  H   9.728   1.202   8.692 1.00 . A A .  53 LYS HG2  1 1 
        1   825 1 1  53 LYS HG3  H  10.834   0.704   9.957 1.00 . A A .  53 LYS HG3  1 1 
        1   826 1 1  53 LYS HZ1  H  12.454   2.678  10.750 1.00 . A A .  53 LYS HZ1  1 1 
        1   827 1 1  53 LYS HZ2  H  12.293   4.303  10.745 1.00 . A A .  53 LYS HZ2  1 1 
        1   828 1 1  53 LYS HZ3  H  11.077   3.364  11.299 1.00 . A A .  53 LYS HZ3  1 1 
        1   829 1 1  53 LYS N    N   9.851  -1.773   9.582 1.00 . A A .  53 LYS N    1 1 
        1   830 1 1  53 LYS NZ   N  11.812   3.435  10.624 1.00 . A A .  53 LYS NZ   1 1 
        1   831 1 1  53 LYS O    O   9.688  -2.851   6.324 1.00 . A A .  53 LYS O    1 1 
        1   832 1 1  54 GLU C    C  10.400  -5.530   6.912 1.00 . A A .  54 GLU C    1 1 
        1   833 1 1  54 GLU CA   C  11.636  -4.657   7.143 1.00 . A A .  54 GLU CA   1 1 
        1   834 1 1  54 GLU CB   C  12.710  -5.423   7.918 1.00 . A A .  54 GLU CB   1 1 
        1   835 1 1  54 GLU CD   C  14.576  -6.132   6.377 1.00 . A A .  54 GLU CD   1 1 
        1   836 1 1  54 GLU CG   C  14.108  -5.088   7.393 1.00 . A A .  54 GLU CG   1 1 
        1   837 1 1  54 GLU H    H  11.777  -3.254   8.676 1.00 . A A .  54 GLU H    1 1 
        1   838 1 1  54 GLU HA   H  12.046  -4.336   6.186 1.00 . A A .  54 GLU HA   1 1 
        1   839 1 1  54 GLU HB2  H  12.647  -5.174   8.977 1.00 . A A .  54 GLU HB2  1 1 
        1   840 1 1  54 GLU HB3  H  12.532  -6.495   7.831 1.00 . A A .  54 GLU HB3  1 1 
        1   841 1 1  54 GLU HG2  H  14.099  -4.102   6.929 1.00 . A A .  54 GLU HG2  1 1 
        1   842 1 1  54 GLU HG3  H  14.811  -5.043   8.224 1.00 . A A .  54 GLU HG3  1 1 
        1   843 1 1  54 GLU N    N  11.267  -3.434   7.835 1.00 . A A .  54 GLU N    1 1 
        1   844 1 1  54 GLU O    O  10.161  -5.992   5.797 1.00 . A A .  54 GLU O    1 1 
        1   845 1 1  54 GLU OE1  O  14.509  -7.331   6.723 1.00 . A A .  54 GLU OE1  1 1 
        1   846 1 1  54 GLU OE2  O  14.991  -5.707   5.277 1.00 . A A .  54 GLU OE2  1 1 
        1   847 1 1  55 HIS C    C   7.509  -5.974   6.839 1.00 . A A .  55 HIS C    1 1 
        1   848 1 1  55 HIS CA   C   8.442  -6.537   7.912 1.00 . A A .  55 HIS CA   1 1 
        1   849 1 1  55 HIS CB   C   7.773  -6.639   9.285 1.00 . A A .  55 HIS CB   1 1 
        1   850 1 1  55 HIS CD2  C   5.277  -7.312   9.671 1.00 . A A .  55 HIS CD2  1 1 
        1   851 1 1  55 HIS CE1  C   5.429  -9.416   9.089 1.00 . A A .  55 HIS CE1  1 1 
        1   852 1 1  55 HIS CG   C   6.572  -7.554   9.317 1.00 . A A .  55 HIS CG   1 1 
        1   853 1 1  55 HIS H    H   9.848  -5.349   8.887 1.00 . A A .  55 HIS H    1 1 
        1   854 1 1  55 HIS HA   H   8.755  -7.540   7.620 1.00 . A A .  55 HIS HA   1 1 
        1   855 1 1  55 HIS HB2  H   8.506  -6.993  10.009 1.00 . A A .  55 HIS HB2  1 1 
        1   856 1 1  55 HIS HB3  H   7.467  -5.642   9.603 1.00 . A A .  55 HIS HB3  1 1 
        1   857 1 1  55 HIS HD1  H   7.455  -9.372   8.646 1.00 . A A .  55 HIS HD1  1 1 
        1   858 1 1  55 HIS HD2  H   4.877  -6.357  10.010 1.00 . A A .  55 HIS HD2  1 1 
        1   859 1 1  55 HIS HE1  H   5.155 -10.451   8.882 1.00 . A A .  55 HIS HE1  1 1 
        1   860 1 1  55 HIS N    N   9.647  -5.729   7.984 1.00 . A A .  55 HIS N    1 1 
        1   861 1 1  55 HIS ND1  N   6.636  -8.888   8.955 1.00 . A A .  55 HIS ND1  1 1 
        1   862 1 1  55 HIS NE2  N   4.588  -8.438   9.532 1.00 . A A .  55 HIS NE2  1 1 
        1   863 1 1  55 HIS O    O   7.166  -6.668   5.883 1.00 . A A .  55 HIS O    1 1 
        1   864 1 1  56 TYR C    C   6.802  -4.116   4.671 1.00 . A A .  56 TYR C    1 1 
        1   865 1 1  56 TYR CA   C   6.239  -4.056   6.092 1.00 . A A .  56 TYR CA   1 1 
        1   866 1 1  56 TYR CB   C   6.169  -2.595   6.539 1.00 . A A .  56 TYR CB   1 1 
        1   867 1 1  56 TYR CD1  C   4.011  -2.855   7.817 1.00 . A A .  56 TYR CD1  1 1 
        1   868 1 1  56 TYR CD2  C   5.806  -1.664   8.854 1.00 . A A .  56 TYR CD2  1 1 
        1   869 1 1  56 TYR CE1  C   3.193  -2.638   8.983 1.00 . A A .  56 TYR CE1  1 1 
        1   870 1 1  56 TYR CE2  C   4.988  -1.447  10.019 1.00 . A A .  56 TYR CE2  1 1 
        1   871 1 1  56 TYR CG   C   5.300  -2.364   7.777 1.00 . A A .  56 TYR CG   1 1 
        1   872 1 1  56 TYR CZ   C   3.722  -1.945  10.026 1.00 . A A .  56 TYR CZ   1 1 
        1   873 1 1  56 TYR H    H   7.409  -4.163   7.812 1.00 . A A .  56 TYR H    1 1 
        1   874 1 1  56 TYR HA   H   5.278  -4.570   6.115 1.00 . A A .  56 TYR HA   1 1 
        1   875 1 1  56 TYR HB2  H   7.179  -2.240   6.745 1.00 . A A .  56 TYR HB2  1 1 
        1   876 1 1  56 TYR HB3  H   5.780  -1.992   5.718 1.00 . A A .  56 TYR HB3  1 1 
        1   877 1 1  56 TYR HD1  H   3.612  -3.408   6.967 1.00 . A A .  56 TYR HD1  1 1 
        1   878 1 1  56 TYR HD2  H   6.824  -1.276   8.822 1.00 . A A .  56 TYR HD2  1 1 
        1   879 1 1  56 TYR HE1  H   2.174  -3.021   9.027 1.00 . A A .  56 TYR HE1  1 1 
        1   880 1 1  56 TYR HE2  H   5.375  -0.896  10.877 1.00 . A A .  56 TYR HE2  1 1 
        1   881 1 1  56 TYR HH   H   3.158  -2.427  11.823 1.00 . A A .  56 TYR HH   1 1 
        1   882 1 1  56 TYR N    N   7.125  -4.721   7.032 1.00 . A A .  56 TYR N    1 1 
        1   883 1 1  56 TYR O    O   6.048  -4.196   3.703 1.00 . A A .  56 TYR O    1 1 
        1   884 1 1  56 TYR OH   O   2.950  -1.740  11.127 1.00 . A A .  56 TYR OH   1 1 
        1   885 1 1  57 LYS C    C   8.625  -5.514   2.694 1.00 . A A .  57 LYS C    1 1 
        1   886 1 1  57 LYS CA   C   8.798  -4.122   3.304 1.00 . A A .  57 LYS CA   1 1 
        1   887 1 1  57 LYS CB   C  10.259  -3.690   3.447 1.00 . A A .  57 LYS CB   1 1 
        1   888 1 1  57 LYS CD   C  12.302  -3.033   2.123 1.00 . A A .  57 LYS CD   1 1 
        1   889 1 1  57 LYS CE   C  13.403  -3.737   2.917 1.00 . A A .  57 LYS CE   1 1 
        1   890 1 1  57 LYS CG   C  11.012  -3.855   2.126 1.00 . A A .  57 LYS CG   1 1 
        1   891 1 1  57 LYS H    H   8.731  -4.008   5.383 1.00 . A A .  57 LYS H    1 1 
        1   892 1 1  57 LYS HA   H   8.310  -3.396   2.652 1.00 . A A .  57 LYS HA   1 1 
        1   893 1 1  57 LYS HB2  H  10.305  -2.649   3.768 1.00 . A A .  57 LYS HB2  1 1 
        1   894 1 1  57 LYS HB3  H  10.743  -4.284   4.223 1.00 . A A .  57 LYS HB3  1 1 
        1   895 1 1  57 LYS HD2  H  12.633  -2.873   1.097 1.00 . A A .  57 LYS HD2  1 1 
        1   896 1 1  57 LYS HD3  H  12.111  -2.049   2.552 1.00 . A A .  57 LYS HD3  1 1 
        1   897 1 1  57 LYS HE2  H  13.494  -3.285   3.905 1.00 . A A .  57 LYS HE2  1 1 
        1   898 1 1  57 LYS HE3  H  13.137  -4.784   3.069 1.00 . A A .  57 LYS HE3  1 1 
        1   899 1 1  57 LYS HG2  H  11.247  -4.908   1.966 1.00 . A A .  57 LYS HG2  1 1 
        1   900 1 1  57 LYS HG3  H  10.375  -3.543   1.298 1.00 . A A .  57 LYS HG3  1 1 
        1   901 1 1  57 LYS HZ1  H  15.444  -3.637   2.867 1.00 . A A .  57 LYS HZ1  1 1 
        1   902 1 1  57 LYS HZ2  H  14.798  -4.436   1.597 1.00 . A A .  57 LYS HZ2  1 1 
        1   903 1 1  57 LYS HZ3  H  14.720  -2.806   1.662 1.00 . A A .  57 LYS HZ3  1 1 
        1   904 1 1  57 LYS N    N   8.124  -4.074   4.590 1.00 . A A .  57 LYS N    1 1 
        1   905 1 1  57 LYS NZ   N  14.696  -3.647   2.203 1.00 . A A .  57 LYS NZ   1 1 
        1   906 1 1  57 LYS O    O   8.407  -5.647   1.491 1.00 . A A .  57 LYS O    1 1 
        1   907 1 1  58 LYS C    C   7.147  -8.134   2.653 1.00 . A A .  58 LYS C    1 1 
        1   908 1 1  58 LYS CA   C   8.587  -7.896   3.114 1.00 . A A .  58 LYS CA   1 1 
        1   909 1 1  58 LYS CB   C   9.048  -8.858   4.211 1.00 . A A .  58 LYS CB   1 1 
        1   910 1 1  58 LYS CD   C   7.167 -10.425   4.814 1.00 . A A .  58 LYS CD   1 1 
        1   911 1 1  58 LYS CE   C   7.453 -10.362   6.316 1.00 . A A .  58 LYS CE   1 1 
        1   912 1 1  58 LYS CG   C   8.453 -10.252   4.004 1.00 . A A .  58 LYS CG   1 1 
        1   913 1 1  58 LYS H    H   8.906  -6.402   4.530 1.00 . A A .  58 LYS H    1 1 
        1   914 1 1  58 LYS HA   H   9.250  -8.037   2.261 1.00 . A A .  58 LYS HA   1 1 
        1   915 1 1  58 LYS HB2  H  10.137  -8.920   4.211 1.00 . A A .  58 LYS HB2  1 1 
        1   916 1 1  58 LYS HB3  H   8.751  -8.473   5.186 1.00 . A A .  58 LYS HB3  1 1 
        1   917 1 1  58 LYS HD2  H   6.455  -9.645   4.543 1.00 . A A .  58 LYS HD2  1 1 
        1   918 1 1  58 LYS HD3  H   6.703 -11.380   4.568 1.00 . A A .  58 LYS HD3  1 1 
        1   919 1 1  58 LYS HE2  H   8.460  -9.982   6.485 1.00 . A A .  58 LYS HE2  1 1 
        1   920 1 1  58 LYS HE3  H   6.765  -9.665   6.794 1.00 . A A .  58 LYS HE3  1 1 
        1   921 1 1  58 LYS HG2  H   8.244 -10.408   2.945 1.00 . A A .  58 LYS HG2  1 1 
        1   922 1 1  58 LYS HG3  H   9.179 -11.009   4.300 1.00 . A A .  58 LYS HG3  1 1 
        1   923 1 1  58 LYS HZ1  H   8.011 -12.314   6.551 1.00 . A A .  58 LYS HZ1  1 1 
        1   924 1 1  58 LYS HZ2  H   7.430 -11.632   7.917 1.00 . A A .  58 LYS HZ2  1 1 
        1   925 1 1  58 LYS HZ3  H   6.405 -12.069   6.723 1.00 . A A .  58 LYS HZ3  1 1 
        1   926 1 1  58 LYS N    N   8.729  -6.518   3.553 1.00 . A A .  58 LYS N    1 1 
        1   927 1 1  58 LYS NZ   N   7.313 -11.703   6.926 1.00 . A A .  58 LYS NZ   1 1 
        1   928 1 1  58 LYS O    O   6.919  -8.725   1.599 1.00 . A A .  58 LYS O    1 1 
        1   929 1 1  59 LEU C    C   4.516  -7.196   1.786 1.00 . A A .  59 LEU C    1 1 
        1   930 1 1  59 LEU CA   C   4.803  -7.816   3.155 1.00 . A A .  59 LEU CA   1 1 
        1   931 1 1  59 LEU CB   C   3.940  -7.244   4.282 1.00 . A A .  59 LEU CB   1 1 
        1   932 1 1  59 LEU CD1  C   3.482  -7.038   6.753 1.00 . A A .  59 LEU CD1  1 1 
        1   933 1 1  59 LEU CD2  C   3.556  -9.324   5.655 1.00 . A A .  59 LEU CD2  1 1 
        1   934 1 1  59 LEU CG   C   4.110  -7.898   5.655 1.00 . A A .  59 LEU CG   1 1 
        1   935 1 1  59 LEU H    H   6.408  -7.182   4.322 1.00 . A A .  59 LEU H    1 1 
        1   936 1 1  59 LEU HA   H   4.595  -8.885   3.101 1.00 . A A .  59 LEU HA   1 1 
        1   937 1 1  59 LEU HB2  H   4.161  -6.181   4.378 1.00 . A A .  59 LEU HB2  1 1 
        1   938 1 1  59 LEU HB3  H   2.894  -7.327   3.989 1.00 . A A .  59 LEU HB3  1 1 
        1   939 1 1  59 LEU HD11 H   3.532  -5.988   6.466 1.00 . A A .  59 LEU HD11 1 1 
        1   940 1 1  59 LEU HD12 H   2.441  -7.329   6.891 1.00 . A A .  59 LEU HD12 1 1 
        1   941 1 1  59 LEU HD13 H   4.027  -7.186   7.686 1.00 . A A .  59 LEU HD13 1 1 
        1   942 1 1  59 LEU HD21 H   2.565  -9.328   6.110 1.00 . A A .  59 LEU HD21 1 1 
        1   943 1 1  59 LEU HD22 H   3.486  -9.687   4.630 1.00 . A A .  59 LEU HD22 1 1 
        1   944 1 1  59 LEU HD23 H   4.220  -9.972   6.227 1.00 . A A .  59 LEU HD23 1 1 
        1   945 1 1  59 LEU HG   H   5.176  -7.967   5.871 1.00 . A A .  59 LEU HG   1 1 
        1   946 1 1  59 LEU N    N   6.214  -7.662   3.466 1.00 . A A .  59 LEU N    1 1 
        1   947 1 1  59 LEU O    O   3.880  -7.821   0.939 1.00 . A A .  59 LEU O    1 1 
        1   948 1 1  60 ALA C    C   5.095  -6.206  -0.808 1.00 . A A .  60 ALA C    1 1 
        1   949 1 1  60 ALA CA   C   4.803  -5.263   0.361 1.00 . A A .  60 ALA CA   1 1 
        1   950 1 1  60 ALA CB   C   5.687  -4.015   0.338 1.00 . A A .  60 ALA CB   1 1 
        1   951 1 1  60 ALA H    H   5.516  -5.473   2.307 1.00 . A A .  60 ALA H    1 1 
        1   952 1 1  60 ALA HA   H   3.758  -4.954   0.315 1.00 . A A .  60 ALA HA   1 1 
        1   953 1 1  60 ALA HB1  H   5.475  -3.435  -0.560 1.00 . A A .  60 ALA HB1  1 1 
        1   954 1 1  60 ALA HB2  H   5.481  -3.408   1.220 1.00 . A A .  60 ALA HB2  1 1 
        1   955 1 1  60 ALA HB3  H   6.736  -4.313   0.339 1.00 . A A .  60 ALA HB3  1 1 
        1   956 1 1  60 ALA N    N   4.999  -5.975   1.612 1.00 . A A .  60 ALA N    1 1 
        1   957 1 1  60 ALA O    O   4.401  -6.176  -1.823 1.00 . A A .  60 ALA O    1 1 
        1   958 1 1  61 GLU C    C   5.427  -9.028  -1.844 1.00 . A A .  61 GLU C    1 1 
        1   959 1 1  61 GLU CA   C   6.517  -7.971  -1.653 1.00 . A A .  61 GLU CA   1 1 
        1   960 1 1  61 GLU CB   C   7.859  -8.622  -1.313 1.00 . A A .  61 GLU CB   1 1 
        1   961 1 1  61 GLU CD   C  10.261  -8.009  -0.853 1.00 . A A .  61 GLU CD   1 1 
        1   962 1 1  61 GLU CG   C   8.797  -7.622  -0.634 1.00 . A A .  61 GLU CG   1 1 
        1   963 1 1  61 GLU H    H   6.684  -7.039   0.202 1.00 . A A .  61 GLU H    1 1 
        1   964 1 1  61 GLU HA   H   6.626  -7.383  -2.565 1.00 . A A .  61 GLU HA   1 1 
        1   965 1 1  61 GLU HB2  H   7.696  -9.477  -0.657 1.00 . A A .  61 GLU HB2  1 1 
        1   966 1 1  61 GLU HB3  H   8.324  -9.003  -2.223 1.00 . A A .  61 GLU HB3  1 1 
        1   967 1 1  61 GLU HG2  H   8.618  -6.623  -1.031 1.00 . A A .  61 GLU HG2  1 1 
        1   968 1 1  61 GLU HG3  H   8.583  -7.584   0.434 1.00 . A A .  61 GLU HG3  1 1 
        1   969 1 1  61 GLU N    N   6.124  -7.021  -0.626 1.00 . A A .  61 GLU N    1 1 
        1   970 1 1  61 GLU O    O   5.141  -9.434  -2.969 1.00 . A A .  61 GLU O    1 1 
        1   971 1 1  61 GLU OE1  O  10.595  -9.171  -0.533 1.00 . A A .  61 GLU OE1  1 1 
        1   972 1 1  61 GLU OE2  O  11.014  -7.135  -1.334 1.00 . A A .  61 GLU OE2  1 1 
        1   973 1 1  62 GLU C    C   2.491  -9.829  -1.265 1.00 . A A .  62 GLU C    1 1 
        1   974 1 1  62 GLU CA   C   3.796 -10.444  -0.756 1.00 . A A .  62 GLU CA   1 1 
        1   975 1 1  62 GLU CB   C   3.602 -11.077   0.623 1.00 . A A .  62 GLU CB   1 1 
        1   976 1 1  62 GLU CD   C   2.567 -13.309   1.179 1.00 . A A .  62 GLU CD   1 1 
        1   977 1 1  62 GLU CG   C   2.305 -11.887   0.678 1.00 . A A .  62 GLU CG   1 1 
        1   978 1 1  62 GLU H    H   5.087  -9.107   0.185 1.00 . A A .  62 GLU H    1 1 
        1   979 1 1  62 GLU HA   H   4.142 -11.207  -1.454 1.00 . A A .  62 GLU HA   1 1 
        1   980 1 1  62 GLU HB2  H   4.449 -11.724   0.853 1.00 . A A .  62 GLU HB2  1 1 
        1   981 1 1  62 GLU HB3  H   3.581 -10.298   1.385 1.00 . A A .  62 GLU HB3  1 1 
        1   982 1 1  62 GLU HG2  H   1.591 -11.392   1.335 1.00 . A A .  62 GLU HG2  1 1 
        1   983 1 1  62 GLU HG3  H   1.854 -11.925  -0.313 1.00 . A A .  62 GLU HG3  1 1 
        1   984 1 1  62 GLU N    N   4.848  -9.443  -0.726 1.00 . A A .  62 GLU N    1 1 
        1   985 1 1  62 GLU O    O   1.791 -10.432  -2.077 1.00 . A A .  62 GLU O    1 1 
        1   986 1 1  62 GLU OE1  O   3.166 -14.083   0.402 1.00 . A A .  62 GLU OE1  1 1 
        1   987 1 1  62 GLU OE2  O   2.164 -13.588   2.329 1.00 . A A .  62 GLU OE2  1 1 
        1   988 1 1  63 GLN C    C   0.965  -7.737  -2.678 1.00 . A A .  63 GLN C    1 1 
        1   989 1 1  63 GLN CA   C   0.995  -7.931  -1.161 1.00 . A A .  63 GLN CA   1 1 
        1   990 1 1  63 GLN CB   C   0.880  -6.590  -0.434 1.00 . A A .  63 GLN CB   1 1 
        1   991 1 1  63 GLN CD   C  -1.532  -6.250   0.217 1.00 . A A .  63 GLN CD   1 1 
        1   992 1 1  63 GLN CG   C  -0.142  -6.667   0.702 1.00 . A A .  63 GLN CG   1 1 
        1   993 1 1  63 GLN H    H   2.778  -8.151  -0.107 1.00 . A A .  63 GLN H    1 1 
        1   994 1 1  63 GLN HA   H   0.171  -8.575  -0.854 1.00 . A A .  63 GLN HA   1 1 
        1   995 1 1  63 GLN HB2  H   1.853  -6.305  -0.033 1.00 . A A .  63 GLN HB2  1 1 
        1   996 1 1  63 GLN HB3  H   0.587  -5.813  -1.140 1.00 . A A .  63 GLN HB3  1 1 
        1   997 1 1  63 GLN HE21 H  -1.006  -4.319   0.517 1.00 . A A .  63 GLN HE21 1 1 
        1   998 1 1  63 GLN HE22 H  -2.612  -4.565  -0.083 1.00 . A A .  63 GLN HE22 1 1 
        1   999 1 1  63 GLN HG2  H  -0.179  -7.684   1.094 1.00 . A A .  63 GLN HG2  1 1 
        1  1000 1 1  63 GLN HG3  H   0.170  -6.021   1.522 1.00 . A A .  63 GLN HG3  1 1 
        1  1001 1 1  63 GLN N    N   2.204  -8.635  -0.767 1.00 . A A .  63 GLN N    1 1 
        1  1002 1 1  63 GLN NE2  N  -1.734  -4.936   0.217 1.00 . A A .  63 GLN NE2  1 1 
        1  1003 1 1  63 GLN O    O  -0.036  -8.038  -3.326 1.00 . A A .  63 GLN O    1 1 
        1  1004 1 1  63 GLN OE1  O  -2.367  -7.068  -0.134 1.00 . A A .  63 GLN OE1  1 1 
        1  1005 1 1  64 GLN C    C   2.186  -8.324  -5.391 1.00 . A A .  64 GLN C    1 1 
        1  1006 1 1  64 GLN CA   C   2.187  -6.996  -4.629 1.00 . A A .  64 GLN CA   1 1 
        1  1007 1 1  64 GLN CB   C   3.441  -6.181  -4.952 1.00 . A A .  64 GLN CB   1 1 
        1  1008 1 1  64 GLN CD   C   4.694  -4.042  -4.489 1.00 . A A .  64 GLN CD   1 1 
        1  1009 1 1  64 GLN CG   C   3.376  -4.796  -4.305 1.00 . A A .  64 GLN CG   1 1 
        1  1010 1 1  64 GLN H    H   2.884  -6.992  -2.666 1.00 . A A .  64 GLN H    1 1 
        1  1011 1 1  64 GLN HA   H   1.305  -6.415  -4.897 1.00 . A A .  64 GLN HA   1 1 
        1  1012 1 1  64 GLN HB2  H   4.325  -6.711  -4.597 1.00 . A A .  64 GLN HB2  1 1 
        1  1013 1 1  64 GLN HB3  H   3.544  -6.077  -6.032 1.00 . A A .  64 GLN HB3  1 1 
        1  1014 1 1  64 GLN HE21 H   5.050  -4.276  -2.510 1.00 . A A .  64 GLN HE21 1 1 
        1  1015 1 1  64 GLN HE22 H   6.276  -3.423  -3.387 1.00 . A A .  64 GLN HE22 1 1 
        1  1016 1 1  64 GLN HG2  H   2.560  -4.223  -4.746 1.00 . A A .  64 GLN HG2  1 1 
        1  1017 1 1  64 GLN HG3  H   3.156  -4.897  -3.242 1.00 . A A .  64 GLN HG3  1 1 
        1  1018 1 1  64 GLN N    N   2.074  -7.234  -3.201 1.00 . A A .  64 GLN N    1 1 
        1  1019 1 1  64 GLN NE2  N   5.398  -3.902  -3.369 1.00 . A A .  64 GLN NE2  1 1 
        1  1020 1 1  64 GLN O    O   1.872  -8.361  -6.579 1.00 . A A .  64 GLN O    1 1 
        1  1021 1 1  64 GLN OE1  O   5.049  -3.616  -5.576 1.00 . A A .  64 GLN OE1  1 1 
        1  1022 1 1  65 ARG C    C   1.167 -11.267  -5.418 1.00 . A A .  65 ARG C    1 1 
        1  1023 1 1  65 ARG CA   C   2.583 -10.706  -5.267 1.00 . A A .  65 ARG CA   1 1 
        1  1024 1 1  65 ARG CB   C   3.415 -11.664  -4.413 1.00 . A A .  65 ARG CB   1 1 
        1  1025 1 1  65 ARG CD   C   3.824 -14.081  -3.817 1.00 . A A .  65 ARG CD   1 1 
        1  1026 1 1  65 ARG CG   C   2.894 -13.098  -4.532 1.00 . A A .  65 ARG CG   1 1 
        1  1027 1 1  65 ARG CZ   C   2.893 -16.341  -4.301 1.00 . A A .  65 ARG CZ   1 1 
        1  1028 1 1  65 ARG H    H   2.793  -9.341  -3.707 1.00 . A A .  65 ARG H    1 1 
        1  1029 1 1  65 ARG HA   H   3.053 -10.561  -6.239 1.00 . A A .  65 ARG HA   1 1 
        1  1030 1 1  65 ARG HB2  H   4.458 -11.625  -4.727 1.00 . A A .  65 ARG HB2  1 1 
        1  1031 1 1  65 ARG HB3  H   3.384 -11.348  -3.370 1.00 . A A .  65 ARG HB3  1 1 
        1  1032 1 1  65 ARG HD2  H   4.670 -14.326  -4.459 1.00 . A A .  65 ARG HD2  1 1 
        1  1033 1 1  65 ARG HD3  H   4.231 -13.620  -2.917 1.00 . A A .  65 ARG HD3  1 1 
        1  1034 1 1  65 ARG HE   H   2.703 -15.382  -2.542 1.00 . A A .  65 ARG HE   1 1 
        1  1035 1 1  65 ARG HG2  H   1.894 -13.163  -4.105 1.00 . A A .  65 ARG HG2  1 1 
        1  1036 1 1  65 ARG HG3  H   2.810 -13.372  -5.584 1.00 . A A .  65 ARG HG3  1 1 
        1  1037 1 1  65 ARG HH11 H   3.897 -15.487  -5.850 1.00 . A A .  65 ARG HH11 1 1 
        1  1038 1 1  65 ARG HH12 H   3.243 -17.059  -6.171 1.00 . A A .  65 ARG HH12 1 1 
        1  1039 1 1  65 ARG HH21 H   1.840 -17.455  -2.965 1.00 . A A .  65 ARG HH21 1 1 
        1  1040 1 1  65 ARG HH22 H   2.066 -18.186  -4.519 1.00 . A A .  65 ARG HH22 1 1 
        1  1041 1 1  65 ARG N    N   2.539  -9.380  -4.674 1.00 . A A .  65 ARG N    1 1 
        1  1042 1 1  65 ARG NE   N   3.084 -15.312  -3.464 1.00 . A A .  65 ARG NE   1 1 
        1  1043 1 1  65 ARG NH1  N   3.386 -16.291  -5.546 1.00 . A A .  65 ARG NH1  1 1 
        1  1044 1 1  65 ARG NH2  N   2.208 -17.418  -3.894 1.00 . A A .  65 ARG NH2  1 1 
        1  1045 1 1  65 ARG O    O   0.820 -11.813  -6.464 1.00 . A A .  65 ARG O    1 1 
        1  1046 1 1  66 GLN C    C  -1.840 -10.757  -5.310 1.00 . A A .  66 GLN C    1 1 
        1  1047 1 1  66 GLN CA   C  -0.983 -11.595  -4.359 1.00 . A A .  66 GLN CA   1 1 
        1  1048 1 1  66 GLN CB   C  -1.567 -11.591  -2.945 1.00 . A A .  66 GLN CB   1 1 
        1  1049 1 1  66 GLN CD   C  -1.470 -12.653  -0.660 1.00 . A A .  66 GLN CD   1 1 
        1  1050 1 1  66 GLN CG   C  -0.997 -12.741  -2.113 1.00 . A A .  66 GLN CG   1 1 
        1  1051 1 1  66 GLN H    H   0.677 -10.665  -3.511 1.00 . A A .  66 GLN H    1 1 
        1  1052 1 1  66 GLN HA   H  -0.927 -12.622  -4.719 1.00 . A A .  66 GLN HA   1 1 
        1  1053 1 1  66 GLN HB2  H  -1.346 -10.641  -2.459 1.00 . A A .  66 GLN HB2  1 1 
        1  1054 1 1  66 GLN HB3  H  -2.653 -11.677  -2.996 1.00 . A A .  66 GLN HB3  1 1 
        1  1055 1 1  66 GLN HE21 H  -0.244 -11.063  -0.406 1.00 . A A .  66 GLN HE21 1 1 
        1  1056 1 1  66 GLN HE22 H  -1.155 -11.527   0.992 1.00 . A A .  66 GLN HE22 1 1 
        1  1057 1 1  66 GLN HG2  H  -1.306 -13.694  -2.543 1.00 . A A .  66 GLN HG2  1 1 
        1  1058 1 1  66 GLN HG3  H   0.092 -12.714  -2.146 1.00 . A A .  66 GLN HG3  1 1 
        1  1059 1 1  66 GLN N    N   0.387 -11.111  -4.358 1.00 . A A .  66 GLN N    1 1 
        1  1060 1 1  66 GLN NE2  N  -0.910 -11.666   0.033 1.00 . A A .  66 GLN NE2  1 1 
        1  1061 1 1  66 GLN O    O  -2.604 -11.302  -6.105 1.00 . A A .  66 GLN O    1 1 
        1  1062 1 1  66 GLN OE1  O  -2.290 -13.431  -0.200 1.00 . A A .  66 GLN OE1  1 1 
        1  1063 1 1  67 TYR C    C  -2.312  -8.909  -7.512 1.00 . A A .  67 TYR C    1 1 
        1  1064 1 1  67 TYR CA   C  -2.436  -8.528  -6.035 1.00 . A A .  67 TYR CA   1 1 
        1  1065 1 1  67 TYR CB   C  -1.805  -7.150  -5.822 1.00 . A A .  67 TYR CB   1 1 
        1  1066 1 1  67 TYR CD1  C  -1.696  -6.255  -8.176 1.00 . A A .  67 TYR CD1  1 1 
        1  1067 1 1  67 TYR CD2  C  -3.003  -5.062  -6.570 1.00 . A A .  67 TYR CD2  1 1 
        1  1068 1 1  67 TYR CE1  C  -2.049  -5.287  -9.183 1.00 . A A .  67 TYR CE1  1 1 
        1  1069 1 1  67 TYR CE2  C  -3.356  -4.094  -7.576 1.00 . A A .  67 TYR CE2  1 1 
        1  1070 1 1  67 TYR CG   C  -2.180  -6.122  -6.891 1.00 . A A .  67 TYR CG   1 1 
        1  1071 1 1  67 TYR CZ   C  -2.861  -4.255  -8.833 1.00 . A A .  67 TYR CZ   1 1 
        1  1072 1 1  67 TYR H    H  -1.061  -9.012  -4.546 1.00 . A A .  67 TYR H    1 1 
        1  1073 1 1  67 TYR HA   H  -3.483  -8.583  -5.740 1.00 . A A .  67 TYR HA   1 1 
        1  1074 1 1  67 TYR HB2  H  -2.107  -6.771  -4.846 1.00 . A A .  67 TYR HB2  1 1 
        1  1075 1 1  67 TYR HB3  H  -0.721  -7.258  -5.800 1.00 . A A .  67 TYR HB3  1 1 
        1  1076 1 1  67 TYR HD1  H  -1.046  -7.093  -8.430 1.00 . A A .  67 TYR HD1  1 1 
        1  1077 1 1  67 TYR HD2  H  -3.386  -4.957  -5.555 1.00 . A A .  67 TYR HD2  1 1 
        1  1078 1 1  67 TYR HE1  H  -1.673  -5.381 -10.201 1.00 . A A .  67 TYR HE1  1 1 
        1  1079 1 1  67 TYR HE2  H  -4.005  -3.252  -7.336 1.00 . A A .  67 TYR HE2  1 1 
        1  1080 1 1  67 TYR HH   H  -2.994  -2.418  -9.455 1.00 . A A .  67 TYR HH   1 1 
        1  1081 1 1  67 TYR N    N  -1.685  -9.446  -5.196 1.00 . A A .  67 TYR N    1 1 
        1  1082 1 1  67 TYR O    O  -3.185  -8.585  -8.315 1.00 . A A .  67 TYR O    1 1 
        1  1083 1 1  67 TYR OH   O  -3.195  -3.341  -9.783 1.00 . A A .  67 TYR OH   1 1 
        1  1084 1 1  68 LYS C    C  -2.025 -11.054  -9.596 1.00 . A A .  68 LYS C    1 1 
        1  1085 1 1  68 LYS CA   C  -0.972 -10.021  -9.190 1.00 . A A .  68 LYS CA   1 1 
        1  1086 1 1  68 LYS CB   C   0.467 -10.517  -9.342 1.00 . A A .  68 LYS CB   1 1 
        1  1087 1 1  68 LYS CD   C   0.740 -11.554 -11.625 1.00 . A A .  68 LYS CD   1 1 
        1  1088 1 1  68 LYS CE   C   1.238 -11.340 -13.055 1.00 . A A .  68 LYS CE   1 1 
        1  1089 1 1  68 LYS CG   C   0.972 -10.306 -10.771 1.00 . A A .  68 LYS CG   1 1 
        1  1090 1 1  68 LYS H    H  -0.516  -9.852  -7.165 1.00 . A A .  68 LYS H    1 1 
        1  1091 1 1  68 LYS HA   H  -1.081  -9.147  -9.832 1.00 . A A .  68 LYS HA   1 1 
        1  1092 1 1  68 LYS HB2  H   1.114  -9.989  -8.642 1.00 . A A .  68 LYS HB2  1 1 
        1  1093 1 1  68 LYS HB3  H   0.520 -11.576  -9.087 1.00 . A A .  68 LYS HB3  1 1 
        1  1094 1 1  68 LYS HD2  H   1.256 -12.405 -11.180 1.00 . A A .  68 LYS HD2  1 1 
        1  1095 1 1  68 LYS HD3  H  -0.323 -11.797 -11.638 1.00 . A A .  68 LYS HD3  1 1 
        1  1096 1 1  68 LYS HE2  H   0.812 -12.099 -13.712 1.00 . A A .  68 LYS HE2  1 1 
        1  1097 1 1  68 LYS HE3  H   0.898 -10.372 -13.424 1.00 . A A .  68 LYS HE3  1 1 
        1  1098 1 1  68 LYS HG2  H   0.461  -9.454 -11.219 1.00 . A A .  68 LYS HG2  1 1 
        1  1099 1 1  68 LYS HG3  H   2.035 -10.066 -10.753 1.00 . A A .  68 LYS HG3  1 1 
        1  1100 1 1  68 LYS HZ1  H   3.016 -11.440 -14.058 1.00 . A A .  68 LYS HZ1  1 1 
        1  1101 1 1  68 LYS HZ2  H   3.100 -10.595 -12.663 1.00 . A A .  68 LYS HZ2  1 1 
        1  1102 1 1  68 LYS HZ3  H   3.029 -12.227 -12.627 1.00 . A A .  68 LYS HZ3  1 1 
        1  1103 1 1  68 LYS N    N  -1.221  -9.592  -7.824 1.00 . A A .  68 LYS N    1 1 
        1  1104 1 1  68 LYS NZ   N   2.715 -11.406 -13.105 1.00 . A A .  68 LYS NZ   1 1 
        1  1105 1 1  68 LYS O    O  -2.739 -10.865 -10.579 1.00 . A A .  68 LYS O    1 1 
        1  1106 1 1  69 VAL C    C  -4.461 -12.659  -8.873 1.00 . A A .  69 VAL C    1 1 
        1  1107 1 1  69 VAL CA   C  -3.041 -13.188  -9.083 1.00 . A A .  69 VAL CA   1 1 
        1  1108 1 1  69 VAL CB   C  -2.723 -14.406  -8.213 1.00 . A A .  69 VAL CB   1 1 
        1  1109 1 1  69 VAL CG1  C  -1.212 -14.591  -8.060 1.00 . A A .  69 VAL CG1  1 1 
        1  1110 1 1  69 VAL CG2  C  -3.403 -14.297  -6.847 1.00 . A A .  69 VAL CG2  1 1 
        1  1111 1 1  69 VAL H    H  -1.503 -12.271  -8.019 1.00 . A A .  69 VAL H    1 1 
        1  1112 1 1  69 VAL HA   H  -2.926 -13.480 -10.127 1.00 . A A .  69 VAL HA   1 1 
        1  1113 1 1  69 VAL HB   H  -3.119 -15.289  -8.715 1.00 . A A .  69 VAL HB   1 1 
        1  1114 1 1  69 VAL HG11 H  -0.897 -14.219  -7.085 1.00 . A A .  69 VAL HG11 1 1 
        1  1115 1 1  69 VAL HG12 H  -0.965 -15.649  -8.143 1.00 . A A .  69 VAL HG12 1 1 
        1  1116 1 1  69 VAL HG13 H  -0.697 -14.035  -8.844 1.00 . A A .  69 VAL HG13 1 1 
        1  1117 1 1  69 VAL HG21 H  -4.475 -14.157  -6.985 1.00 . A A .  69 VAL HG21 1 1 
        1  1118 1 1  69 VAL HG22 H  -3.226 -15.211  -6.279 1.00 . A A .  69 VAL HG22 1 1 
        1  1119 1 1  69 VAL HG23 H  -2.992 -13.446  -6.304 1.00 . A A .  69 VAL HG23 1 1 
        1  1120 1 1  69 VAL N    N  -2.088 -12.125  -8.817 1.00 . A A .  69 VAL N    1 1 
        1  1121 1 1  69 VAL O    O  -5.364 -12.968  -9.649 1.00 . A A .  69 VAL O    1 1 
        1  1122 1 1  70 HIS C    C  -6.520 -10.670  -8.755 1.00 . A A .  70 HIS C    1 1 
        1  1123 1 1  70 HIS CA   C  -5.909 -11.294  -7.498 1.00 . A A .  70 HIS CA   1 1 
        1  1124 1 1  70 HIS CB   C  -5.790 -10.300  -6.341 1.00 . A A .  70 HIS CB   1 1 
        1  1125 1 1  70 HIS CD2  C  -5.010 -12.183  -4.704 1.00 . A A .  70 HIS CD2  1 1 
        1  1126 1 1  70 HIS CE1  C  -5.335 -11.114  -2.823 1.00 . A A .  70 HIS CE1  1 1 
        1  1127 1 1  70 HIS CG   C  -5.491 -10.943  -5.008 1.00 . A A .  70 HIS CG   1 1 
        1  1128 1 1  70 HIS H    H  -3.875 -11.623  -7.193 1.00 . A A .  70 HIS H    1 1 
        1  1129 1 1  70 HIS HA   H  -6.543 -12.116  -7.166 1.00 . A A .  70 HIS HA   1 1 
        1  1130 1 1  70 HIS HB2  H  -5.002  -9.583  -6.572 1.00 . A A .  70 HIS HB2  1 1 
        1  1131 1 1  70 HIS HB3  H  -6.720  -9.738  -6.261 1.00 . A A .  70 HIS HB3  1 1 
        1  1132 1 1  70 HIS HD1  H  -6.034  -9.363  -3.688 1.00 . A A .  70 HIS HD1  1 1 
        1  1133 1 1  70 HIS HD2  H  -4.747 -12.958  -5.423 1.00 . A A .  70 HIS HD2  1 1 
        1  1134 1 1  70 HIS HE1  H  -5.374 -10.893  -1.756 1.00 . A A .  70 HIS HE1  1 1 
        1  1135 1 1  70 HIS N    N  -4.614 -11.870  -7.820 1.00 . A A .  70 HIS N    1 1 
        1  1136 1 1  70 HIS ND1  N  -5.686 -10.293  -3.802 1.00 . A A .  70 HIS ND1  1 1 
        1  1137 1 1  70 HIS NE2  N  -4.915 -12.284  -3.384 1.00 . A A .  70 HIS NE2  1 1 
        1  1138 1 1  70 HIS O    O  -7.714 -10.822  -9.010 1.00 . A A .  70 HIS O    1 1 
        1  1139 1 1  71 LEU C    C  -6.704 -10.385 -11.674 1.00 . A A .  71 LEU C    1 1 
        1  1140 1 1  71 LEU CA   C  -6.115  -9.335 -10.730 1.00 . A A .  71 LEU CA   1 1 
        1  1141 1 1  71 LEU CB   C  -4.975  -8.523 -11.348 1.00 . A A .  71 LEU CB   1 1 
        1  1142 1 1  71 LEU CD1  C  -6.131  -6.300 -11.056 1.00 . A A .  71 LEU CD1  1 1 
        1  1143 1 1  71 LEU CD2  C  -4.160  -6.516 -12.639 1.00 . A A .  71 LEU CD2  1 1 
        1  1144 1 1  71 LEU CG   C  -5.377  -7.212 -12.027 1.00 . A A .  71 LEU CG   1 1 
        1  1145 1 1  71 LEU H    H  -4.704  -9.863  -9.291 1.00 . A A .  71 LEU H    1 1 
        1  1146 1 1  71 LEU HA   H  -6.903  -8.631 -10.461 1.00 . A A .  71 LEU HA   1 1 
        1  1147 1 1  71 LEU HB2  H  -4.251  -8.296 -10.565 1.00 . A A .  71 LEU HB2  1 1 
        1  1148 1 1  71 LEU HB3  H  -4.466  -9.148 -12.081 1.00 . A A .  71 LEU HB3  1 1 
        1  1149 1 1  71 LEU HD11 H  -5.756  -6.457 -10.045 1.00 . A A .  71 LEU HD11 1 1 
        1  1150 1 1  71 LEU HD12 H  -5.978  -5.259 -11.343 1.00 . A A .  71 LEU HD12 1 1 
        1  1151 1 1  71 LEU HD13 H  -7.195  -6.534 -11.090 1.00 . A A .  71 LEU HD13 1 1 
        1  1152 1 1  71 LEU HD21 H  -3.250  -7.010 -12.299 1.00 . A A .  71 LEU HD21 1 1 
        1  1153 1 1  71 LEU HD22 H  -4.218  -6.570 -13.726 1.00 . A A .  71 LEU HD22 1 1 
        1  1154 1 1  71 LEU HD23 H  -4.144  -5.471 -12.328 1.00 . A A .  71 LEU HD23 1 1 
        1  1155 1 1  71 LEU HG   H  -6.059  -7.445 -12.844 1.00 . A A .  71 LEU HG   1 1 
        1  1156 1 1  71 LEU N    N  -5.674  -9.982  -9.506 1.00 . A A .  71 LEU N    1 1 
        1  1157 1 1  71 LEU O    O  -7.695 -10.127 -12.354 1.00 . A A .  71 LEU O    1 1 
        1  1158 1 1  72 ASP C    C  -7.786 -13.251 -11.941 1.00 . A A .  72 ASP C    1 1 
        1  1159 1 1  72 ASP CA   C  -6.516 -12.638 -12.533 1.00 . A A .  72 ASP CA   1 1 
        1  1160 1 1  72 ASP CB   C  -5.456 -13.738 -12.622 1.00 . A A .  72 ASP CB   1 1 
        1  1161 1 1  72 ASP CG   C  -4.764 -13.861 -13.981 1.00 . A A .  72 ASP CG   1 1 
        1  1162 1 1  72 ASP H    H  -5.262 -11.749 -11.128 1.00 . A A .  72 ASP H    1 1 
        1  1163 1 1  72 ASP HA   H  -6.687 -12.188 -13.511 1.00 . A A .  72 ASP HA   1 1 
        1  1164 1 1  72 ASP HB2  H  -4.699 -13.555 -11.860 1.00 . A A .  72 ASP HB2  1 1 
        1  1165 1 1  72 ASP HB3  H  -5.925 -14.693 -12.382 1.00 . A A .  72 ASP HB3  1 1 
        1  1166 1 1  72 ASP N    N  -6.068 -11.547 -11.684 1.00 . A A .  72 ASP N    1 1 
        1  1167 1 1  72 ASP O    O  -8.722 -13.576 -12.670 1.00 . A A .  72 ASP O    1 1 
        1  1168 1 1  72 ASP OD1  O  -5.494 -14.067 -14.974 1.00 . A A .  72 ASP OD1  1 1 
        1  1169 1 1  72 ASP OD2  O  -3.519 -13.746 -13.996 1.00 . A A .  72 ASP OD2  1 1 
        1  1170 1 1  73 LEU C    C -10.154 -13.100 -10.190 1.00 . A A .  73 LEU C    1 1 
        1  1171 1 1  73 LEU CA   C  -8.917 -13.960  -9.924 1.00 . A A .  73 LEU CA   1 1 
        1  1172 1 1  73 LEU CB   C  -8.600 -14.138  -8.438 1.00 . A A .  73 LEU CB   1 1 
        1  1173 1 1  73 LEU CD1  C  -7.318 -15.425  -6.689 1.00 . A A .  73 LEU CD1  1 1 
        1  1174 1 1  73 LEU CD2  C  -7.002 -15.955  -9.149 1.00 . A A .  73 LEU CD2  1 1 
        1  1175 1 1  73 LEU CG   C  -7.295 -14.868  -8.113 1.00 . A A .  73 LEU CG   1 1 
        1  1176 1 1  73 LEU H    H  -7.013 -13.125 -10.037 1.00 . A A .  73 LEU H    1 1 
        1  1177 1 1  73 LEU HA   H  -9.092 -14.954 -10.337 1.00 . A A .  73 LEU HA   1 1 
        1  1178 1 1  73 LEU HB2  H  -8.568 -13.153  -7.973 1.00 . A A .  73 LEU HB2  1 1 
        1  1179 1 1  73 LEU HB3  H  -9.423 -14.683  -7.974 1.00 . A A .  73 LEU HB3  1 1 
        1  1180 1 1  73 LEU HD11 H  -6.767 -14.755  -6.028 1.00 . A A .  73 LEU HD11 1 1 
        1  1181 1 1  73 LEU HD12 H  -8.350 -15.506  -6.347 1.00 . A A .  73 LEU HD12 1 1 
        1  1182 1 1  73 LEU HD13 H  -6.852 -16.410  -6.676 1.00 . A A .  73 LEU HD13 1 1 
        1  1183 1 1  73 LEU HD21 H  -7.138 -15.548 -10.151 1.00 . A A .  73 LEU HD21 1 1 
        1  1184 1 1  73 LEU HD22 H  -5.974 -16.299  -9.034 1.00 . A A .  73 LEU HD22 1 1 
        1  1185 1 1  73 LEU HD23 H  -7.685 -16.791  -9.001 1.00 . A A .  73 LEU HD23 1 1 
        1  1186 1 1  73 LEU HG   H  -6.479 -14.147  -8.164 1.00 . A A .  73 LEU HG   1 1 
        1  1187 1 1  73 LEU N    N  -7.778 -13.392 -10.623 1.00 . A A .  73 LEU N    1 1 
        1  1188 1 1  73 LEU O    O -11.267 -13.617 -10.276 1.00 . A A .  73 LEU O    1 1 
        1  1189 1 1  74 TRP C    C -11.452 -11.048 -12.017 1.00 . A A .  74 TRP C    1 1 
        1  1190 1 1  74 TRP CA   C -10.999 -10.865 -10.567 1.00 . A A .  74 TRP CA   1 1 
        1  1191 1 1  74 TRP CB   C -10.568  -9.432 -10.252 1.00 . A A .  74 TRP CB   1 1 
        1  1192 1 1  74 TRP CD1  C -12.571  -7.815 -10.440 1.00 . A A .  74 TRP CD1  1 1 
        1  1193 1 1  74 TRP CD2  C -11.207  -7.724 -12.183 1.00 . A A .  74 TRP CD2  1 1 
        1  1194 1 1  74 TRP CE2  C -12.224  -6.819 -12.408 1.00 . A A .  74 TRP CE2  1 1 
        1  1195 1 1  74 TRP CE3  C -10.169  -7.905 -13.114 1.00 . A A .  74 TRP CE3  1 1 
        1  1196 1 1  74 TRP CG   C -11.441  -8.361 -10.909 1.00 . A A .  74 TRP CG   1 1 
        1  1197 1 1  74 TRP CH2  C -11.282  -6.190 -14.500 1.00 . A A .  74 TRP CH2  1 1 
        1  1198 1 1  74 TRP CZ2  C -12.305  -6.026 -13.558 1.00 . A A .  74 TRP CZ2  1 1 
        1  1199 1 1  74 TRP CZ3  C -10.264  -7.105 -14.259 1.00 . A A .  74 TRP CZ3  1 1 
        1  1200 1 1  74 TRP H    H  -9.010 -11.390 -10.241 1.00 . A A .  74 TRP H    1 1 
        1  1201 1 1  74 TRP HA   H -11.817 -11.108  -9.888 1.00 . A A .  74 TRP HA   1 1 
        1  1202 1 1  74 TRP HB2  H -10.586  -9.287  -9.171 1.00 . A A .  74 TRP HB2  1 1 
        1  1203 1 1  74 TRP HB3  H  -9.536  -9.294 -10.575 1.00 . A A .  74 TRP HB3  1 1 
        1  1204 1 1  74 TRP HD1  H -13.030  -8.079  -9.487 1.00 . A A .  74 TRP HD1  1 1 
        1  1205 1 1  74 TRP HE1  H -13.987  -6.289 -11.173 1.00 . A A .  74 TRP HE1  1 1 
        1  1206 1 1  74 TRP HE3  H  -9.354  -8.613 -12.959 1.00 . A A .  74 TRP HE3  1 1 
        1  1207 1 1  74 TRP HH2  H -11.284  -5.603 -15.419 1.00 . A A .  74 TRP HH2  1 1 
        1  1208 1 1  74 TRP HZ2  H -13.119  -5.319 -13.713 1.00 . A A .  74 TRP HZ2  1 1 
        1  1209 1 1  74 TRP HZ3  H  -9.484  -7.207 -15.014 1.00 . A A .  74 TRP HZ3  1 1 
        1  1210 1 1  74 TRP N    N  -9.918 -11.802 -10.312 1.00 . A A .  74 TRP N    1 1 
        1  1211 1 1  74 TRP NE1  N -13.081  -6.877 -11.314 1.00 . A A .  74 TRP NE1  1 1 
        1  1212 1 1  74 TRP O    O -12.609 -10.791 -12.347 1.00 . A A .  74 TRP O    1 1 
        1  1213 1 1  75 VAL C    C -11.639 -12.985 -14.403 1.00 . A A .  75 VAL C    1 1 
        1  1214 1 1  75 VAL CA   C -10.805 -11.712 -14.251 1.00 . A A .  75 VAL CA   1 1 
        1  1215 1 1  75 VAL CB   C  -9.502 -11.752 -15.052 1.00 . A A .  75 VAL CB   1 1 
        1  1216 1 1  75 VAL CG1  C  -9.725 -12.379 -16.430 1.00 . A A .  75 VAL CG1  1 1 
        1  1217 1 1  75 VAL CG2  C  -8.892 -10.354 -15.178 1.00 . A A .  75 VAL CG2  1 1 
        1  1218 1 1  75 VAL H    H  -9.578 -11.698 -12.567 1.00 . A A .  75 VAL H    1 1 
        1  1219 1 1  75 VAL HA   H -11.392 -10.863 -14.603 1.00 . A A .  75 VAL HA   1 1 
        1  1220 1 1  75 VAL HB   H  -8.794 -12.378 -14.509 1.00 . A A .  75 VAL HB   1 1 
        1  1221 1 1  75 VAL HG11 H -10.651 -11.996 -16.858 1.00 . A A .  75 VAL HG11 1 1 
        1  1222 1 1  75 VAL HG12 H  -8.890 -12.124 -17.084 1.00 . A A .  75 VAL HG12 1 1 
        1  1223 1 1  75 VAL HG13 H  -9.791 -13.462 -16.330 1.00 . A A .  75 VAL HG13 1 1 
        1  1224 1 1  75 VAL HG21 H  -7.901 -10.348 -14.725 1.00 . A A .  75 VAL HG21 1 1 
        1  1225 1 1  75 VAL HG22 H  -8.812 -10.086 -16.231 1.00 . A A .  75 VAL HG22 1 1 
        1  1226 1 1  75 VAL HG23 H  -9.530  -9.632 -14.666 1.00 . A A .  75 VAL HG23 1 1 
        1  1227 1 1  75 VAL N    N -10.517 -11.491 -12.844 1.00 . A A .  75 VAL N    1 1 
        1  1228 1 1  75 VAL O    O -12.628 -13.000 -15.134 1.00 . A A .  75 VAL O    1 1 
        1  1229 1 1  76 LYS C    C -13.388 -15.077 -13.440 1.00 . A A .  76 LYS C    1 1 
        1  1230 1 1  76 LYS CA   C -11.905 -15.298 -13.747 1.00 . A A .  76 LYS CA   1 1 
        1  1231 1 1  76 LYS CB   C -11.230 -16.311 -12.821 1.00 . A A .  76 LYS CB   1 1 
        1  1232 1 1  76 LYS CD   C  -9.092 -17.551 -12.318 1.00 . A A .  76 LYS CD   1 1 
        1  1233 1 1  76 LYS CE   C  -9.547 -19.008 -12.425 1.00 . A A .  76 LYS CE   1 1 
        1  1234 1 1  76 LYS CG   C  -9.832 -16.670 -13.328 1.00 . A A .  76 LYS CG   1 1 
        1  1235 1 1  76 LYS H    H -10.405 -14.002 -13.107 1.00 . A A .  76 LYS H    1 1 
        1  1236 1 1  76 LYS HA   H -11.816 -15.681 -14.764 1.00 . A A .  76 LYS HA   1 1 
        1  1237 1 1  76 LYS HB2  H -11.161 -15.900 -11.814 1.00 . A A .  76 LYS HB2  1 1 
        1  1238 1 1  76 LYS HB3  H -11.840 -17.212 -12.756 1.00 . A A .  76 LYS HB3  1 1 
        1  1239 1 1  76 LYS HD2  H  -8.018 -17.487 -12.494 1.00 . A A .  76 LYS HD2  1 1 
        1  1240 1 1  76 LYS HD3  H  -9.272 -17.182 -11.308 1.00 . A A .  76 LYS HD3  1 1 
        1  1241 1 1  76 LYS HE2  H  -9.356 -19.524 -11.484 1.00 . A A .  76 LYS HE2  1 1 
        1  1242 1 1  76 LYS HE3  H -10.622 -19.047 -12.597 1.00 . A A .  76 LYS HE3  1 1 
        1  1243 1 1  76 LYS HG2  H  -9.909 -17.191 -14.282 1.00 . A A .  76 LYS HG2  1 1 
        1  1244 1 1  76 LYS HG3  H  -9.261 -15.759 -13.508 1.00 . A A .  76 LYS HG3  1 1 
        1  1245 1 1  76 LYS HZ1  H  -8.603 -20.624 -13.246 1.00 . A A .  76 LYS HZ1  1 1 
        1  1246 1 1  76 LYS HZ2  H  -9.426 -19.727 -14.334 1.00 . A A .  76 LYS HZ2  1 1 
        1  1247 1 1  76 LYS HZ3  H  -7.999 -19.191 -13.747 1.00 . A A .  76 LYS HZ3  1 1 
        1  1248 1 1  76 LYS N    N -11.210 -14.023 -13.700 1.00 . A A .  76 LYS N    1 1 
        1  1249 1 1  76 LYS NZ   N  -8.836 -19.693 -13.528 1.00 . A A .  76 LYS NZ   1 1 
        1  1250 1 1  76 LYS O    O -14.230 -15.897 -13.805 1.00 . A A .  76 LYS O    1 1 
        1  1251 1 1  77 SER C    C -15.661 -12.768 -13.511 1.00 . A A .  77 SER C    1 1 
        1  1252 1 1  77 SER CA   C -15.029 -13.627 -12.414 1.00 . A A .  77 SER CA   1 1 
        1  1253 1 1  77 SER CB   C -15.079 -12.895 -11.071 1.00 . A A .  77 SER CB   1 1 
        1  1254 1 1  77 SER H    H -12.972 -13.304 -12.481 1.00 . A A .  77 SER H    1 1 
        1  1255 1 1  77 SER HA   H -15.549 -14.581 -12.326 1.00 . A A .  77 SER HA   1 1 
        1  1256 1 1  77 SER HB2  H -14.687 -11.885 -11.194 1.00 . A A .  77 SER HB2  1 1 
        1  1257 1 1  77 SER HB3  H -16.116 -12.797 -10.750 1.00 . A A .  77 SER HB3  1 1 
        1  1258 1 1  77 SER HG   H -14.881 -14.314  -9.675 1.00 . A A .  77 SER HG   1 1 
        1  1259 1 1  77 SER N    N -13.662 -13.966 -12.774 1.00 . A A .  77 SER N    1 1 
        1  1260 1 1  77 SER O    O -16.861 -12.864 -13.765 1.00 . A A .  77 SER O    1 1 
        1  1261 1 1  77 SER OG   O -14.334 -13.574 -10.064 1.00 . A A .  77 SER OG   1 1 
        1  1262 1 1  78 LEU C    C -16.169 -11.871 -16.159 1.00 . A A .  78 LEU C    1 1 
        1  1263 1 1  78 LEU CA   C -15.288 -11.073 -15.195 1.00 . A A .  78 LEU CA   1 1 
        1  1264 1 1  78 LEU CB   C -14.104 -10.382 -15.873 1.00 . A A .  78 LEU CB   1 1 
        1  1265 1 1  78 LEU CD1  C -12.445  -8.484 -15.964 1.00 . A A .  78 LEU CD1  1 1 
        1  1266 1 1  78 LEU CD2  C -14.553  -8.271 -14.568 1.00 . A A .  78 LEU CD2  1 1 
        1  1267 1 1  78 LEU CG   C -13.477  -9.217 -15.104 1.00 . A A .  78 LEU CG   1 1 
        1  1268 1 1  78 LEU H    H -13.851 -11.876 -13.919 1.00 . A A .  78 LEU H    1 1 
        1  1269 1 1  78 LEU HA   H -15.897 -10.294 -14.736 1.00 . A A .  78 LEU HA   1 1 
        1  1270 1 1  78 LEU HB2  H -13.331 -11.127 -16.058 1.00 . A A .  78 LEU HB2  1 1 
        1  1271 1 1  78 LEU HB3  H -14.431 -10.014 -16.846 1.00 . A A .  78 LEU HB3  1 1 
        1  1272 1 1  78 LEU HD11 H -12.495  -8.856 -16.987 1.00 . A A .  78 LEU HD11 1 1 
        1  1273 1 1  78 LEU HD12 H -12.659  -7.415 -15.955 1.00 . A A .  78 LEU HD12 1 1 
        1  1274 1 1  78 LEU HD13 H -11.447  -8.658 -15.562 1.00 . A A .  78 LEU HD13 1 1 
        1  1275 1 1  78 LEU HD21 H -14.847  -8.585 -13.566 1.00 . A A .  78 LEU HD21 1 1 
        1  1276 1 1  78 LEU HD22 H -14.158  -7.256 -14.530 1.00 . A A .  78 LEU HD22 1 1 
        1  1277 1 1  78 LEU HD23 H -15.421  -8.298 -15.227 1.00 . A A .  78 LEU HD23 1 1 
        1  1278 1 1  78 LEU HG   H -12.947  -9.623 -14.242 1.00 . A A .  78 LEU HG   1 1 
        1  1279 1 1  78 LEU N    N -14.826 -11.948 -14.131 1.00 . A A .  78 LEU N    1 1 
        1  1280 1 1  78 LEU O    O -15.745 -12.898 -16.687 1.00 . A A .  78 LEU O    1 1 
        1  1281 1 1  79 SER C    C -17.671 -12.265 -18.614 1.00 . A A .  79 SER C    1 1 
        1  1282 1 1  79 SER CA   C -18.322 -12.020 -17.251 1.00 . A A .  79 SER CA   1 1 
        1  1283 1 1  79 SER CB   C -19.594 -11.186 -17.413 1.00 . A A .  79 SER CB   1 1 
        1  1284 1 1  79 SER H    H -17.715 -10.532 -15.927 1.00 . A A .  79 SER H    1 1 
        1  1285 1 1  79 SER HA   H -18.567 -12.967 -16.769 1.00 . A A .  79 SER HA   1 1 
        1  1286 1 1  79 SER HB2  H -19.525 -10.295 -16.789 1.00 . A A .  79 SER HB2  1 1 
        1  1287 1 1  79 SER HB3  H -19.677 -10.847 -18.445 1.00 . A A .  79 SER HB3  1 1 
        1  1288 1 1  79 SER HG   H -21.580 -11.434 -17.368 1.00 . A A .  79 SER HG   1 1 
        1  1289 1 1  79 SER N    N -17.378 -11.368 -16.360 1.00 . A A .  79 SER N    1 1 
        1  1290 1 1  79 SER O    O -16.516 -11.901 -18.829 1.00 . A A .  79 SER O    1 1 
        1  1291 1 1  79 SER OG   O -20.763 -11.922 -17.061 1.00 . A A .  79 SER OG   1 1 
        1  1292 1 1  80 PRO C    C -17.933 -11.931 -21.722 1.00 . A A .  80 PRO C    1 1 
        1  1293 1 1  80 PRO CA   C -17.974 -13.195 -20.859 1.00 . A A .  80 PRO CA   1 1 
        1  1294 1 1  80 PRO CB   C -18.925 -14.251 -21.398 1.00 . A A .  80 PRO CB   1 1 
        1  1295 1 1  80 PRO CD   C -19.834 -13.343 -19.304 1.00 . A A .  80 PRO CD   1 1 
        1  1296 1 1  80 PRO CG   C -20.173 -14.169 -20.534 1.00 . A A .  80 PRO CG   1 1 
        1  1297 1 1  80 PRO HA   H -17.032 -13.529 -20.819 1.00 . A A .  80 PRO HA   1 1 
        1  1298 1 1  80 PRO HB2  H -19.162 -14.065 -22.446 1.00 . A A .  80 PRO HB2  1 1 
        1  1299 1 1  80 PRO HB3  H -18.477 -15.243 -21.345 1.00 . A A .  80 PRO HB3  1 1 
        1  1300 1 1  80 PRO HD2  H -20.513 -12.497 -19.195 1.00 . A A .  80 PRO HD2  1 1 
        1  1301 1 1  80 PRO HD3  H -19.916 -13.937 -18.394 1.00 . A A .  80 PRO HD3  1 1 
        1  1302 1 1  80 PRO HG2  H -20.991 -13.709 -21.089 1.00 . A A .  80 PRO HG2  1 1 
        1  1303 1 1  80 PRO HG3  H -20.503 -15.166 -20.246 1.00 . A A .  80 PRO HG3  1 1 
        1  1304 1 1  80 PRO N    N -18.461 -12.897 -19.523 1.00 . A A .  80 PRO N    1 1 
        1  1305 1 1  80 PRO O    O -17.302 -11.917 -22.778 1.00 . A A .  80 PRO O    1 1 
        1  1306 1 1  81 GLN C    C -17.572  -8.694 -21.438 1.00 . A A .  81 GLN C    1 1 
        1  1307 1 1  81 GLN CA   C -18.661  -9.637 -21.953 1.00 . A A .  81 GLN CA   1 1 
        1  1308 1 1  81 GLN CB   C -20.044  -8.993 -21.834 1.00 . A A .  81 GLN CB   1 1 
        1  1309 1 1  81 GLN CD   C -22.473  -9.629 -21.601 1.00 . A A .  81 GLN CD   1 1 
        1  1310 1 1  81 GLN CG   C -21.141  -9.965 -22.274 1.00 . A A .  81 GLN CG   1 1 
        1  1311 1 1  81 GLN H    H -19.122 -10.922 -20.379 1.00 . A A .  81 GLN H    1 1 
        1  1312 1 1  81 GLN HA   H -18.472  -9.886 -22.997 1.00 . A A .  81 GLN HA   1 1 
        1  1313 1 1  81 GLN HB2  H -20.218  -8.685 -20.803 1.00 . A A .  81 GLN HB2  1 1 
        1  1314 1 1  81 GLN HB3  H -20.084  -8.092 -22.446 1.00 . A A .  81 GLN HB3  1 1 
        1  1315 1 1  81 GLN HE21 H -23.215 -11.377 -22.303 1.00 . A A .  81 GLN HE21 1 1 
        1  1316 1 1  81 GLN HE22 H -24.321 -10.424 -21.370 1.00 . A A .  81 GLN HE22 1 1 
        1  1317 1 1  81 GLN HG2  H -21.256  -9.923 -23.357 1.00 . A A .  81 GLN HG2  1 1 
        1  1318 1 1  81 GLN HG3  H -20.850 -10.985 -22.023 1.00 . A A .  81 GLN HG3  1 1 
        1  1319 1 1  81 GLN N    N -18.612 -10.902 -21.239 1.00 . A A .  81 GLN N    1 1 
        1  1320 1 1  81 GLN NE2  N -23.414 -10.553 -21.772 1.00 . A A .  81 GLN NE2  1 1 
        1  1321 1 1  81 GLN O    O -16.925  -8.000 -22.221 1.00 . A A .  81 GLN O    1 1 
        1  1322 1 1  81 GLN OE1  O -22.636  -8.598 -20.968 1.00 . A A .  81 GLN OE1  1 1 
        1  1323 1 1  82 ASP C    C -15.006  -8.381 -19.837 1.00 . A A .  82 ASP C    1 1 
        1  1324 1 1  82 ASP CA   C -16.401  -7.855 -19.495 1.00 . A A .  82 ASP CA   1 1 
        1  1325 1 1  82 ASP CB   C -16.550  -7.864 -17.972 1.00 . A A .  82 ASP CB   1 1 
        1  1326 1 1  82 ASP CG   C -17.728  -7.051 -17.432 1.00 . A A .  82 ASP CG   1 1 
        1  1327 1 1  82 ASP H    H -17.931  -9.268 -19.494 1.00 . A A .  82 ASP H    1 1 
        1  1328 1 1  82 ASP HA   H -16.579  -6.856 -19.893 1.00 . A A .  82 ASP HA   1 1 
        1  1329 1 1  82 ASP HB2  H -16.658  -8.897 -17.640 1.00 . A A .  82 ASP HB2  1 1 
        1  1330 1 1  82 ASP HB3  H -15.630  -7.482 -17.530 1.00 . A A .  82 ASP HB3  1 1 
        1  1331 1 1  82 ASP N    N -17.401  -8.700 -20.124 1.00 . A A .  82 ASP N    1 1 
        1  1332 1 1  82 ASP O    O -14.161  -7.636 -20.330 1.00 . A A .  82 ASP O    1 1 
        1  1333 1 1  82 ASP OD1  O -17.817  -5.863 -17.810 1.00 . A A .  82 ASP OD1  1 1 
        1  1334 1 1  82 ASP OD2  O -18.512  -7.636 -16.654 1.00 . A A .  82 ASP OD2  1 1 
        1  1335 1 1  83 ARG C    C -13.134 -10.088 -21.298 1.00 . A A .  83 ARG C    1 1 
        1  1336 1 1  83 ARG CA   C -13.530 -10.297 -19.834 1.00 . A A .  83 ARG CA   1 1 
        1  1337 1 1  83 ARG CB   C -13.586 -11.797 -19.538 1.00 . A A .  83 ARG CB   1 1 
        1  1338 1 1  83 ARG CD   C -12.364 -13.584 -18.244 1.00 . A A .  83 ARG CD   1 1 
        1  1339 1 1  83 ARG CG   C -12.218 -12.320 -19.093 1.00 . A A .  83 ARG CG   1 1 
        1  1340 1 1  83 ARG CZ   C -11.884 -15.354 -19.930 1.00 . A A .  83 ARG CZ   1 1 
        1  1341 1 1  83 ARG H    H -15.501 -10.262 -19.161 1.00 . A A .  83 ARG H    1 1 
        1  1342 1 1  83 ARG HA   H -12.826  -9.806 -19.164 1.00 . A A .  83 ARG HA   1 1 
        1  1343 1 1  83 ARG HB2  H -14.324 -11.991 -18.760 1.00 . A A .  83 ARG HB2  1 1 
        1  1344 1 1  83 ARG HB3  H -13.913 -12.336 -20.428 1.00 . A A .  83 ARG HB3  1 1 
        1  1345 1 1  83 ARG HD2  H -12.045 -13.384 -17.221 1.00 . A A .  83 ARG HD2  1 1 
        1  1346 1 1  83 ARG HD3  H -13.412 -13.882 -18.198 1.00 . A A .  83 ARG HD3  1 1 
        1  1347 1 1  83 ARG HE   H -10.704 -14.929 -18.356 1.00 . A A .  83 ARG HE   1 1 
        1  1348 1 1  83 ARG HG2  H -11.604 -12.534 -19.968 1.00 . A A .  83 ARG HG2  1 1 
        1  1349 1 1  83 ARG HG3  H -11.700 -11.551 -18.520 1.00 . A A .  83 ARG HG3  1 1 
        1  1350 1 1  83 ARG HH11 H -13.607 -14.323 -20.250 1.00 . A A .  83 ARG HH11 1 1 
        1  1351 1 1  83 ARG HH12 H -13.260 -15.557 -21.415 1.00 . A A .  83 ARG HH12 1 1 
        1  1352 1 1  83 ARG HH21 H -10.245 -16.558 -19.892 1.00 . A A .  83 ARG HH21 1 1 
        1  1353 1 1  83 ARG HH22 H -11.334 -16.837 -21.209 1.00 . A A .  83 ARG HH22 1 1 
        1  1354 1 1  83 ARG N    N -14.808  -9.662 -19.562 1.00 . A A .  83 ARG N    1 1 
        1  1355 1 1  83 ARG NE   N -11.553 -14.679 -18.822 1.00 . A A .  83 ARG NE   1 1 
        1  1356 1 1  83 ARG NH1  N -13.012 -15.052 -20.587 1.00 . A A .  83 ARG NH1  1 1 
        1  1357 1 1  83 ARG NH2  N -11.087 -16.332 -20.382 1.00 . A A .  83 ARG NH2  1 1 
        1  1358 1 1  83 ARG O    O -11.960  -9.886 -21.604 1.00 . A A .  83 ARG O    1 1 
        1  1359 1 1  84 ALA C    C -13.286  -8.587 -23.827 1.00 . A A .  84 ALA C    1 1 
        1  1360 1 1  84 ALA CA   C -13.908  -9.963 -23.586 1.00 . A A .  84 ALA CA   1 1 
        1  1361 1 1  84 ALA CB   C -15.226 -10.148 -24.342 1.00 . A A .  84 ALA CB   1 1 
        1  1362 1 1  84 ALA H    H -15.089 -10.309 -21.905 1.00 . A A .  84 ALA H    1 1 
        1  1363 1 1  84 ALA HA   H -13.207 -10.732 -23.909 1.00 . A A .  84 ALA HA   1 1 
        1  1364 1 1  84 ALA HB1  H -15.425 -11.212 -24.470 1.00 . A A .  84 ALA HB1  1 1 
        1  1365 1 1  84 ALA HB2  H -16.037  -9.692 -23.775 1.00 . A A .  84 ALA HB2  1 1 
        1  1366 1 1  84 ALA HB3  H -15.153  -9.671 -25.319 1.00 . A A .  84 ALA HB3  1 1 
        1  1367 1 1  84 ALA N    N -14.137 -10.144 -22.162 1.00 . A A .  84 ALA N    1 1 
        1  1368 1 1  84 ALA O    O -12.526  -8.403 -24.777 1.00 . A A .  84 ALA O    1 1 
        1  1369 1 1  85 ALA C    C -11.734  -6.232 -22.401 1.00 . A A .  85 ALA C    1 1 
        1  1370 1 1  85 ALA CA   C -13.115  -6.300 -23.057 1.00 . A A .  85 ALA CA   1 1 
        1  1371 1 1  85 ALA CB   C -14.109  -5.324 -22.424 1.00 . A A .  85 ALA CB   1 1 
        1  1372 1 1  85 ALA H    H -14.249  -7.812 -22.181 1.00 . A A .  85 ALA H    1 1 
        1  1373 1 1  85 ALA HA   H -13.017  -6.064 -24.116 1.00 . A A .  85 ALA HA   1 1 
        1  1374 1 1  85 ALA HB1  H -15.025  -5.304 -23.016 1.00 . A A .  85 ALA HB1  1 1 
        1  1375 1 1  85 ALA HB2  H -14.339  -5.647 -21.409 1.00 . A A .  85 ALA HB2  1 1 
        1  1376 1 1  85 ALA HB3  H -13.672  -4.326 -22.398 1.00 . A A .  85 ALA HB3  1 1 
        1  1377 1 1  85 ALA N    N -13.631  -7.655 -22.951 1.00 . A A .  85 ALA N    1 1 
        1  1378 1 1  85 ALA O    O -10.744  -5.925 -23.063 1.00 . A A .  85 ALA O    1 1 
        1  1379 1 1  86 TYR C    C  -9.321  -7.089 -21.178 1.00 . A A .  86 TYR C    1 1 
        1  1380 1 1  86 TYR CA   C -10.470  -6.500 -20.357 1.00 . A A .  86 TYR CA   1 1 
        1  1381 1 1  86 TYR CB   C -10.704  -7.378 -19.126 1.00 . A A .  86 TYR CB   1 1 
        1  1382 1 1  86 TYR CD1  C  -8.707  -8.901 -18.901 1.00 . A A .  86 TYR CD1  1 1 
        1  1383 1 1  86 TYR CD2  C  -8.972  -7.137 -17.310 1.00 . A A .  86 TYR CD2  1 1 
        1  1384 1 1  86 TYR CE1  C  -7.498  -9.316 -18.239 1.00 . A A .  86 TYR CE1  1 1 
        1  1385 1 1  86 TYR CE2  C  -7.763  -7.552 -16.648 1.00 . A A .  86 TYR CE2  1 1 
        1  1386 1 1  86 TYR CG   C  -9.419  -7.819 -18.423 1.00 . A A .  86 TYR CG   1 1 
        1  1387 1 1  86 TYR CZ   C  -7.085  -8.621 -17.145 1.00 . A A .  86 TYR CZ   1 1 
        1  1388 1 1  86 TYR H    H -12.523  -6.773 -20.579 1.00 . A A .  86 TYR H    1 1 
        1  1389 1 1  86 TYR HA   H -10.241  -5.461 -20.119 1.00 . A A .  86 TYR HA   1 1 
        1  1390 1 1  86 TYR HB2  H -11.326  -6.832 -18.416 1.00 . A A .  86 TYR HB2  1 1 
        1  1391 1 1  86 TYR HB3  H -11.265  -8.263 -19.426 1.00 . A A .  86 TYR HB3  1 1 
        1  1392 1 1  86 TYR HD1  H  -9.061  -9.440 -19.780 1.00 . A A .  86 TYR HD1  1 1 
        1  1393 1 1  86 TYR HD2  H  -9.535  -6.283 -16.932 1.00 . A A .  86 TYR HD2  1 1 
        1  1394 1 1  86 TYR HE1  H  -6.926 -10.169 -18.607 1.00 . A A .  86 TYR HE1  1 1 
        1  1395 1 1  86 TYR HE2  H  -7.399  -7.022 -15.768 1.00 . A A .  86 TYR HE2  1 1 
        1  1396 1 1  86 TYR HH   H  -5.552  -8.248 -16.009 1.00 . A A .  86 TYR HH   1 1 
        1  1397 1 1  86 TYR N    N -11.713  -6.524 -21.109 1.00 . A A .  86 TYR N    1 1 
        1  1398 1 1  86 TYR O    O  -8.235  -6.514 -21.235 1.00 . A A .  86 TYR O    1 1 
        1  1399 1 1  86 TYR OH   O  -5.943  -9.014 -16.520 1.00 . A A .  86 TYR OH   1 1 
        1  1400 1 1  87 LYS C    C  -8.172  -7.978 -23.747 1.00 . A A .  87 LYS C    1 1 
        1  1401 1 1  87 LYS CA   C  -8.603  -8.903 -22.608 1.00 . A A .  87 LYS CA   1 1 
        1  1402 1 1  87 LYS CB   C  -9.127 -10.260 -23.082 1.00 . A A .  87 LYS CB   1 1 
        1  1403 1 1  87 LYS CD   C  -7.929 -12.349 -23.833 1.00 . A A .  87 LYS CD   1 1 
        1  1404 1 1  87 LYS CE   C  -6.635 -13.138 -23.625 1.00 . A A .  87 LYS CE   1 1 
        1  1405 1 1  87 LYS CG   C  -8.180 -11.388 -22.669 1.00 . A A .  87 LYS CG   1 1 
        1  1406 1 1  87 LYS H    H -10.485  -8.691 -21.741 1.00 . A A .  87 LYS H    1 1 
        1  1407 1 1  87 LYS HA   H  -7.738  -9.096 -21.973 1.00 . A A .  87 LYS HA   1 1 
        1  1408 1 1  87 LYS HB2  H -10.117 -10.439 -22.663 1.00 . A A .  87 LYS HB2  1 1 
        1  1409 1 1  87 LYS HB3  H  -9.237 -10.252 -24.167 1.00 . A A .  87 LYS HB3  1 1 
        1  1410 1 1  87 LYS HD2  H  -8.769 -13.038 -23.928 1.00 . A A .  87 LYS HD2  1 1 
        1  1411 1 1  87 LYS HD3  H  -7.872 -11.788 -24.766 1.00 . A A .  87 LYS HD3  1 1 
        1  1412 1 1  87 LYS HE2  H  -5.953 -12.954 -24.455 1.00 . A A .  87 LYS HE2  1 1 
        1  1413 1 1  87 LYS HE3  H  -6.135 -12.794 -22.719 1.00 . A A .  87 LYS HE3  1 1 
        1  1414 1 1  87 LYS HG2  H  -7.233 -10.968 -22.330 1.00 . A A .  87 LYS HG2  1 1 
        1  1415 1 1  87 LYS HG3  H  -8.605 -11.935 -21.827 1.00 . A A .  87 LYS HG3  1 1 
        1  1416 1 1  87 LYS HZ1  H  -6.073 -15.102 -23.630 1.00 . A A .  87 LYS HZ1  1 1 
        1  1417 1 1  87 LYS HZ2  H  -7.320 -14.784 -22.626 1.00 . A A .  87 LYS HZ2  1 1 
        1  1418 1 1  87 LYS HZ3  H  -7.567 -14.850 -24.238 1.00 . A A .  87 LYS HZ3  1 1 
        1  1419 1 1  87 LYS N    N  -9.599  -8.229 -21.793 1.00 . A A .  87 LYS N    1 1 
        1  1420 1 1  87 LYS NZ   N  -6.922 -14.586 -23.521 1.00 . A A .  87 LYS NZ   1 1 
        1  1421 1 1  87 LYS O    O  -6.983  -7.859 -24.040 1.00 . A A .  87 LYS O    1 1 
        1  1422 1 1  88 GLU C    C  -7.691  -5.552 -25.144 1.00 . A A .  88 GLU C    1 1 
        1  1423 1 1  88 GLU CA   C  -8.900  -6.434 -25.461 1.00 . A A .  88 GLU CA   1 1 
        1  1424 1 1  88 GLU CB   C -10.132  -5.583 -25.774 1.00 . A A .  88 GLU CB   1 1 
        1  1425 1 1  88 GLU CD   C -11.349  -3.447 -25.213 1.00 . A A .  88 GLU CD   1 1 
        1  1426 1 1  88 GLU CG   C -10.018  -4.197 -25.136 1.00 . A A .  88 GLU CG   1 1 
        1  1427 1 1  88 GLU H    H -10.126  -7.447 -24.116 1.00 . A A .  88 GLU H    1 1 
        1  1428 1 1  88 GLU HA   H  -8.679  -7.071 -26.318 1.00 . A A .  88 GLU HA   1 1 
        1  1429 1 1  88 GLU HB2  H -10.245  -5.482 -26.853 1.00 . A A .  88 GLU HB2  1 1 
        1  1430 1 1  88 GLU HB3  H -11.028  -6.084 -25.405 1.00 . A A .  88 GLU HB3  1 1 
        1  1431 1 1  88 GLU HG2  H  -9.712  -4.297 -24.094 1.00 . A A .  88 GLU HG2  1 1 
        1  1432 1 1  88 GLU HG3  H  -9.243  -3.623 -25.642 1.00 . A A .  88 GLU HG3  1 1 
        1  1433 1 1  88 GLU N    N  -9.162  -7.345 -24.360 1.00 . A A .  88 GLU N    1 1 
        1  1434 1 1  88 GLU O    O  -6.888  -5.252 -26.027 1.00 . A A .  88 GLU O    1 1 
        1  1435 1 1  88 GLU OE1  O -11.906  -3.392 -26.331 1.00 . A A .  88 GLU OE1  1 1 
        1  1436 1 1  88 GLU OE2  O -11.780  -2.945 -24.152 1.00 . A A .  88 GLU OE2  1 1 
        1  1437 1 1  89 TYR C    C  -5.244  -5.151 -23.174 1.00 . A A .  89 TYR C    1 1 
        1  1438 1 1  89 TYR CA   C  -6.501  -4.319 -23.437 1.00 . A A .  89 TYR CA   1 1 
        1  1439 1 1  89 TYR CB   C  -6.961  -3.684 -22.124 1.00 . A A .  89 TYR CB   1 1 
        1  1440 1 1  89 TYR CD1  C  -5.158  -2.096 -21.362 1.00 . A A .  89 TYR CD1  1 1 
        1  1441 1 1  89 TYR CD2  C  -5.445  -4.143 -20.162 1.00 . A A .  89 TYR CD2  1 1 
        1  1442 1 1  89 TYR CE1  C  -4.081  -1.729 -20.479 1.00 . A A .  89 TYR CE1  1 1 
        1  1443 1 1  89 TYR CE2  C  -4.368  -3.777 -19.279 1.00 . A A .  89 TYR CE2  1 1 
        1  1444 1 1  89 TYR CG   C  -5.817  -3.295 -21.185 1.00 . A A .  89 TYR CG   1 1 
        1  1445 1 1  89 TYR CZ   C  -3.739  -2.588 -19.481 1.00 . A A .  89 TYR CZ   1 1 
        1  1446 1 1  89 TYR H    H  -8.255  -5.410 -23.170 1.00 . A A .  89 TYR H    1 1 
        1  1447 1 1  89 TYR HA   H  -6.290  -3.597 -24.225 1.00 . A A .  89 TYR HA   1 1 
        1  1448 1 1  89 TYR HB2  H  -7.551  -2.795 -22.349 1.00 . A A .  89 TYR HB2  1 1 
        1  1449 1 1  89 TYR HB3  H  -7.621  -4.381 -21.606 1.00 . A A .  89 TYR HB3  1 1 
        1  1450 1 1  89 TYR HD1  H  -5.452  -1.426 -22.170 1.00 . A A .  89 TYR HD1  1 1 
        1  1451 1 1  89 TYR HD2  H  -5.966  -5.090 -20.023 1.00 . A A .  89 TYR HD2  1 1 
        1  1452 1 1  89 TYR HE1  H  -3.551  -0.785 -20.607 1.00 . A A .  89 TYR HE1  1 1 
        1  1453 1 1  89 TYR HE2  H  -4.064  -4.438 -18.468 1.00 . A A .  89 TYR HE2  1 1 
        1  1454 1 1  89 TYR HH   H  -2.229  -1.454 -19.017 1.00 . A A .  89 TYR HH   1 1 
        1  1455 1 1  89 TYR N    N  -7.598  -5.161 -23.881 1.00 . A A .  89 TYR N    1 1 
        1  1456 1 1  89 TYR O    O  -4.127  -4.678 -23.380 1.00 . A A .  89 TYR O    1 1 
        1  1457 1 1  89 TYR OH   O  -2.722  -2.242 -18.647 1.00 . A A .  89 TYR OH   1 1 
        1  1458 1 1  90 ILE C    C  -3.547  -7.506 -23.700 1.00 . A A .  90 ILE C    1 1 
        1  1459 1 1  90 ILE CA   C  -4.367  -7.279 -22.429 1.00 . A A .  90 ILE CA   1 1 
        1  1460 1 1  90 ILE CB   C  -4.887  -8.569 -21.793 1.00 . A A .  90 ILE CB   1 1 
        1  1461 1 1  90 ILE CD1  C  -4.703  -8.107 -19.321 1.00 . A A .  90 ILE CD1  1 1 
        1  1462 1 1  90 ILE CG1  C  -5.658  -8.274 -20.504 1.00 . A A .  90 ILE CG1  1 1 
        1  1463 1 1  90 ILE CG2  C  -3.749  -9.566 -21.565 1.00 . A A .  90 ILE CG2  1 1 
        1  1464 1 1  90 ILE H    H  -6.379  -6.754 -22.557 1.00 . A A .  90 ILE H    1 1 
        1  1465 1 1  90 ILE HA   H  -3.731  -6.789 -21.691 1.00 . A A .  90 ILE HA   1 1 
        1  1466 1 1  90 ILE HB   H  -5.587  -9.034 -22.487 1.00 . A A .  90 ILE HB   1 1 
        1  1467 1 1  90 ILE HD11 H  -5.262  -7.770 -18.447 1.00 . A A .  90 ILE HD11 1 1 
        1  1468 1 1  90 ILE HD12 H  -4.226  -9.062 -19.101 1.00 . A A .  90 ILE HD12 1 1 
        1  1469 1 1  90 ILE HD13 H  -3.940  -7.369 -19.570 1.00 . A A .  90 ILE HD13 1 1 
        1  1470 1 1  90 ILE HG12 H  -6.249  -7.367 -20.630 1.00 . A A .  90 ILE HG12 1 1 
        1  1471 1 1  90 ILE HG13 H  -6.357  -9.085 -20.300 1.00 . A A .  90 ILE HG13 1 1 
        1  1472 1 1  90 ILE HG21 H  -2.960  -9.089 -20.983 1.00 . A A .  90 ILE HG21 1 1 
        1  1473 1 1  90 ILE HG22 H  -4.127 -10.432 -21.022 1.00 . A A .  90 ILE HG22 1 1 
        1  1474 1 1  90 ILE HG23 H  -3.348  -9.886 -22.526 1.00 . A A .  90 ILE HG23 1 1 
        1  1475 1 1  90 ILE N    N  -5.468  -6.377 -22.722 1.00 . A A .  90 ILE N    1 1 
        1  1476 1 1  90 ILE O    O  -2.384  -7.112 -23.772 1.00 . A A .  90 ILE O    1 1 
        1  1477 1 1  91 SER C    C  -2.795  -7.182 -26.437 1.00 . A A .  91 SER C    1 1 
        1  1478 1 1  91 SER CA   C  -3.530  -8.427 -25.937 1.00 . A A .  91 SER CA   1 1 
        1  1479 1 1  91 SER CB   C  -4.537  -8.906 -26.984 1.00 . A A .  91 SER CB   1 1 
        1  1480 1 1  91 SER H    H  -5.131  -8.459 -24.605 1.00 . A A .  91 SER H    1 1 
        1  1481 1 1  91 SER HA   H  -2.823  -9.228 -25.721 1.00 . A A .  91 SER HA   1 1 
        1  1482 1 1  91 SER HB2  H  -5.004  -9.829 -26.642 1.00 . A A .  91 SER HB2  1 1 
        1  1483 1 1  91 SER HB3  H  -5.331  -8.166 -27.087 1.00 . A A .  91 SER HB3  1 1 
        1  1484 1 1  91 SER HG   H  -4.579  -8.935 -28.984 1.00 . A A .  91 SER HG   1 1 
        1  1485 1 1  91 SER N    N  -4.185  -8.142 -24.672 1.00 . A A .  91 SER N    1 1 
        1  1486 1 1  91 SER O    O  -1.624  -7.255 -26.809 1.00 . A A .  91 SER O    1 1 
        1  1487 1 1  91 SER OG   O  -3.926  -9.125 -28.252 1.00 . A A .  91 SER OG   1 1 
        1  1488 1 1  92 ASN C    C  -1.605  -4.578 -26.173 1.00 . A A .  92 ASN C    1 1 
        1  1489 1 1  92 ASN CA   C  -2.942  -4.809 -26.880 1.00 . A A .  92 ASN CA   1 1 
        1  1490 1 1  92 ASN CB   C  -3.864  -3.636 -26.542 1.00 . A A .  92 ASN CB   1 1 
        1  1491 1 1  92 ASN CG   C  -5.051  -3.575 -27.506 1.00 . A A .  92 ASN CG   1 1 
        1  1492 1 1  92 ASN H    H  -4.463  -6.017 -26.127 1.00 . A A .  92 ASN H    1 1 
        1  1493 1 1  92 ASN HA   H  -2.831  -4.913 -27.959 1.00 . A A .  92 ASN HA   1 1 
        1  1494 1 1  92 ASN HB2  H  -4.227  -3.737 -25.519 1.00 . A A .  92 ASN HB2  1 1 
        1  1495 1 1  92 ASN HB3  H  -3.304  -2.702 -26.590 1.00 . A A .  92 ASN HB3  1 1 
        1  1496 1 1  92 ASN HD21 H  -6.090  -2.570 -26.089 1.00 . A A .  92 ASN HD21 1 1 
        1  1497 1 1  92 ASN HD22 H  -6.943  -2.857 -27.569 1.00 . A A .  92 ASN HD22 1 1 
        1  1498 1 1  92 ASN N    N  -3.512  -6.068 -26.431 1.00 . A A .  92 ASN N    1 1 
        1  1499 1 1  92 ASN ND2  N  -6.116  -2.949 -27.014 1.00 . A A .  92 ASN ND2  1 1 
        1  1500 1 1  92 ASN O    O  -0.588  -4.343 -26.824 1.00 . A A .  92 ASN O    1 1 
        1  1501 1 1  92 ASN OD1  O  -5.002  -4.064 -28.622 1.00 . A A .  92 ASN OD1  1 1 
        1  1502 1 1  93 LYS C    C   0.390  -5.732 -24.077 1.00 . A A .  93 LYS C    1 1 
        1  1503 1 1  93 LYS CA   C  -0.454  -4.456 -24.050 1.00 . A A .  93 LYS CA   1 1 
        1  1504 1 1  93 LYS CB   C  -0.826  -3.994 -22.639 1.00 . A A .  93 LYS CB   1 1 
        1  1505 1 1  93 LYS CD   C  -0.657  -2.098 -20.984 1.00 . A A .  93 LYS CD   1 1 
        1  1506 1 1  93 LYS CE   C  -0.399  -0.591 -20.922 1.00 . A A .  93 LYS CE   1 1 
        1  1507 1 1  93 LYS CG   C  -0.099  -2.697 -22.277 1.00 . A A .  93 LYS CG   1 1 
        1  1508 1 1  93 LYS H    H  -2.481  -4.845 -24.330 1.00 . A A .  93 LYS H    1 1 
        1  1509 1 1  93 LYS HA   H   0.119  -3.652 -24.511 1.00 . A A .  93 LYS HA   1 1 
        1  1510 1 1  93 LYS HB2  H  -1.903  -3.842 -22.573 1.00 . A A .  93 LYS HB2  1 1 
        1  1511 1 1  93 LYS HB3  H  -0.570  -4.772 -21.919 1.00 . A A .  93 LYS HB3  1 1 
        1  1512 1 1  93 LYS HD2  H  -1.728  -2.291 -20.923 1.00 . A A .  93 LYS HD2  1 1 
        1  1513 1 1  93 LYS HD3  H  -0.195  -2.585 -20.125 1.00 . A A .  93 LYS HD3  1 1 
        1  1514 1 1  93 LYS HE2  H   0.332  -0.310 -21.681 1.00 . A A .  93 LYS HE2  1 1 
        1  1515 1 1  93 LYS HE3  H  -1.318  -0.050 -21.148 1.00 . A A .  93 LYS HE3  1 1 
        1  1516 1 1  93 LYS HG2  H   0.967  -2.893 -22.161 1.00 . A A .  93 LYS HG2  1 1 
        1  1517 1 1  93 LYS HG3  H  -0.204  -1.979 -23.090 1.00 . A A .  93 LYS HG3  1 1 
        1  1518 1 1  93 LYS HZ1  H  -0.391  -0.731 -18.883 1.00 . A A .  93 LYS HZ1  1 1 
        1  1519 1 1  93 LYS HZ2  H   1.075  -0.394 -19.520 1.00 . A A .  93 LYS HZ2  1 1 
        1  1520 1 1  93 LYS HZ3  H  -0.067   0.771 -19.436 1.00 . A A .  93 LYS HZ3  1 1 
        1  1521 1 1  93 LYS N    N  -1.650  -4.654 -24.851 1.00 . A A .  93 LYS N    1 1 
        1  1522 1 1  93 LYS NZ   N   0.094  -0.205 -19.582 1.00 . A A .  93 LYS NZ   1 1 
        1  1523 1 1  93 LYS O    O  -0.024  -6.742 -24.644 1.00 . A A .  93 LYS O    1 1 
        1  1524 1 1  94 ARG C    C   2.566  -7.441 -24.778 1.00 . A A .  94 ARG C    1 1 
        1  1525 1 1  94 ARG CA   C   2.463  -6.779 -23.403 1.00 . A A .  94 ARG CA   1 1 
        1  1526 1 1  94 ARG CB   C   1.989  -7.814 -22.381 1.00 . A A .  94 ARG CB   1 1 
        1  1527 1 1  94 ARG CD   C   0.433  -9.774 -22.070 1.00 . A A .  94 ARG CD   1 1 
        1  1528 1 1  94 ARG CG   C   0.682  -8.470 -22.830 1.00 . A A .  94 ARG CG   1 1 
        1  1529 1 1  94 ARG CZ   C  -0.862 -10.470 -20.058 1.00 . A A .  94 ARG CZ   1 1 
        1  1530 1 1  94 ARG H    H   1.886  -4.819 -22.998 1.00 . A A .  94 ARG H    1 1 
        1  1531 1 1  94 ARG HA   H   3.420  -6.357 -23.098 1.00 . A A .  94 ARG HA   1 1 
        1  1532 1 1  94 ARG HB2  H   2.756  -8.577 -22.248 1.00 . A A .  94 ARG HB2  1 1 
        1  1533 1 1  94 ARG HB3  H   1.846  -7.335 -21.412 1.00 . A A .  94 ARG HB3  1 1 
        1  1534 1 1  94 ARG HD2  H   0.033 -10.529 -22.748 1.00 . A A .  94 ARG HD2  1 1 
        1  1535 1 1  94 ARG HD3  H   1.374 -10.163 -21.681 1.00 . A A .  94 ARG HD3  1 1 
        1  1536 1 1  94 ARG HE   H  -0.923  -8.631 -20.874 1.00 . A A .  94 ARG HE   1 1 
        1  1537 1 1  94 ARG HG2  H  -0.149  -7.784 -22.664 1.00 . A A .  94 ARG HG2  1 1 
        1  1538 1 1  94 ARG HG3  H   0.720  -8.670 -23.901 1.00 . A A .  94 ARG HG3  1 1 
        1  1539 1 1  94 ARG HH11 H   0.307 -11.928 -20.861 1.00 . A A .  94 ARG HH11 1 1 
        1  1540 1 1  94 ARG HH12 H  -0.600 -12.396 -19.461 1.00 . A A .  94 ARG HH12 1 1 
        1  1541 1 1  94 ARG HH21 H  -2.119  -9.248 -19.027 1.00 . A A .  94 ARG HH21 1 1 
        1  1542 1 1  94 ARG HH22 H  -1.989 -10.862 -18.411 1.00 . A A .  94 ARG HH22 1 1 
        1  1543 1 1  94 ARG N    N   1.557  -5.644 -23.457 1.00 . A A .  94 ARG N    1 1 
        1  1544 1 1  94 ARG NE   N  -0.515  -9.540 -20.958 1.00 . A A .  94 ARG NE   1 1 
        1  1545 1 1  94 ARG NH1  N  -0.341 -11.702 -20.133 1.00 . A A .  94 ARG NH1  1 1 
        1  1546 1 1  94 ARG NH2  N  -1.730 -10.168 -19.083 1.00 . A A .  94 ARG NH2  1 1 
        1  1547 1 1  94 ARG O    O   2.087  -6.896 -25.772 1.00 . A A .  94 ARG O    1 1 
        1  1548 1 1  95 LYS C    C   3.419 -10.847 -25.718 1.00 . A A .  95 LYS C    1 1 
        1  1549 1 1  95 LYS CA   C   3.367  -9.350 -26.030 1.00 . A A .  95 LYS CA   1 1 
        1  1550 1 1  95 LYS CB   C   4.589  -8.839 -26.795 1.00 . A A .  95 LYS CB   1 1 
        1  1551 1 1  95 LYS CD   C   5.829  -9.583 -28.862 1.00 . A A .  95 LYS CD   1 1 
        1  1552 1 1  95 LYS CE   C   5.737 -10.960 -29.523 1.00 . A A .  95 LYS CE   1 1 
        1  1553 1 1  95 LYS CG   C   4.476  -9.160 -28.287 1.00 . A A .  95 LYS CG   1 1 
        1  1554 1 1  95 LYS H    H   3.582  -9.044 -23.980 1.00 . A A .  95 LYS H    1 1 
        1  1555 1 1  95 LYS HA   H   2.493  -9.156 -26.652 1.00 . A A .  95 LYS HA   1 1 
        1  1556 1 1  95 LYS HB2  H   4.685  -7.762 -26.658 1.00 . A A .  95 LYS HB2  1 1 
        1  1557 1 1  95 LYS HB3  H   5.493  -9.293 -26.390 1.00 . A A .  95 LYS HB3  1 1 
        1  1558 1 1  95 LYS HD2  H   6.165  -8.847 -29.591 1.00 . A A .  95 LYS HD2  1 1 
        1  1559 1 1  95 LYS HD3  H   6.574  -9.607 -28.067 1.00 . A A .  95 LYS HD3  1 1 
        1  1560 1 1  95 LYS HE2  H   6.025 -11.733 -28.811 1.00 . A A .  95 LYS HE2  1 1 
        1  1561 1 1  95 LYS HE3  H   4.706 -11.162 -29.814 1.00 . A A .  95 LYS HE3  1 1 
        1  1562 1 1  95 LYS HG2  H   3.748  -9.957 -28.436 1.00 . A A .  95 LYS HG2  1 1 
        1  1563 1 1  95 LYS HG3  H   4.106  -8.286 -28.824 1.00 . A A .  95 LYS HG3  1 1 
        1  1564 1 1  95 LYS HZ1  H   7.163 -10.187 -30.768 1.00 . A A .  95 LYS HZ1  1 1 
        1  1565 1 1  95 LYS HZ2  H   7.222 -11.814 -30.638 1.00 . A A .  95 LYS HZ2  1 1 
        1  1566 1 1  95 LYS HZ3  H   6.055 -11.108 -31.537 1.00 . A A .  95 LYS HZ3  1 1 
        1  1567 1 1  95 LYS N    N   3.195  -8.608 -24.793 1.00 . A A .  95 LYS N    1 1 
        1  1568 1 1  95 LYS NZ   N   6.615 -11.022 -30.713 1.00 . A A .  95 LYS NZ   1 1 
        1  1569 1 1  95 LYS O    O   4.465 -11.370 -25.339 1.00 . A A .  95 LYS O    1 1 
        1  1570 1 1  96 SER C    C   3.409 -13.639 -26.187 1.00 . A A .  96 SER C    1 1 
        1  1571 1 1  96 SER CA   C   2.177 -12.921 -25.632 1.00 . A A .  96 SER CA   1 1 
        1  1572 1 1  96 SER CB   C   0.902 -13.504 -26.244 1.00 . A A .  96 SER CB   1 1 
        1  1573 1 1  96 SER H    H   1.429 -11.061 -26.199 1.00 . A A .  96 SER H    1 1 
        1  1574 1 1  96 SER HA   H   2.135 -13.016 -24.547 1.00 . A A .  96 SER HA   1 1 
        1  1575 1 1  96 SER HB2  H   0.810 -13.172 -27.278 1.00 . A A .  96 SER HB2  1 1 
        1  1576 1 1  96 SER HB3  H   0.974 -14.592 -26.264 1.00 . A A .  96 SER HB3  1 1 
        1  1577 1 1  96 SER HG   H  -0.313 -12.124 -25.454 1.00 . A A .  96 SER HG   1 1 
        1  1578 1 1  96 SER N    N   2.275 -11.494 -25.890 1.00 . A A .  96 SER N    1 1 
        1  1579 1 1  96 SER O    O   3.937 -13.257 -27.230 1.00 . A A .  96 SER O    1 1 
        1  1580 1 1  96 SER OG   O  -0.263 -13.120 -25.518 1.00 . A A .  96 SER OG   1 1 
        1  1581 1 1  97 GLY C    C   4.568 -16.779 -26.486 1.00 . A A .  97 GLY C    1 1 
        1  1582 1 1  97 GLY CA   C   4.990 -15.442 -25.872 1.00 . A A .  97 GLY CA   1 1 
        1  1583 1 1  97 GLY H    H   3.395 -14.971 -24.618 1.00 . A A .  97 GLY H    1 1 
        1  1584 1 1  97 GLY HA2  H   5.575 -14.874 -26.595 1.00 . A A .  97 GLY HA2  1 1 
        1  1585 1 1  97 GLY HA3  H   5.633 -15.621 -25.010 1.00 . A A .  97 GLY HA3  1 1 
        1  1586 1 1  97 GLY N    N   3.830 -14.667 -25.465 1.00 . A A .  97 GLY N    1 1 
        1  1587 1 1  97 GLY O    O   3.891 -17.577 -25.839 1.00 . A A .  97 GLY O    1 1 
        1  1588 1 1  98 PRO C    C   5.514 -19.382 -27.956 1.00 . A A .  98 PRO C    1 1 
        1  1589 1 1  98 PRO CA   C   4.670 -18.213 -28.468 1.00 . A A .  98 PRO CA   1 1 
        1  1590 1 1  98 PRO CB   C   4.919 -17.898 -29.934 1.00 . A A .  98 PRO CB   1 1 
        1  1591 1 1  98 PRO CD   C   5.800 -16.064 -28.556 1.00 . A A .  98 PRO CD   1 1 
        1  1592 1 1  98 PRO CG   C   5.813 -16.668 -29.951 1.00 . A A .  98 PRO CG   1 1 
        1  1593 1 1  98 PRO HA   H   3.718 -18.468 -28.300 1.00 . A A .  98 PRO HA   1 1 
        1  1594 1 1  98 PRO HB2  H   5.399 -18.737 -30.438 1.00 . A A .  98 PRO HB2  1 1 
        1  1595 1 1  98 PRO HB3  H   3.982 -17.707 -30.457 1.00 . A A .  98 PRO HB3  1 1 
        1  1596 1 1  98 PRO HD2  H   6.809 -15.970 -28.156 1.00 . A A .  98 PRO HD2  1 1 
        1  1597 1 1  98 PRO HD3  H   5.365 -15.064 -28.562 1.00 . A A .  98 PRO HD3  1 1 
        1  1598 1 1  98 PRO HG2  H   6.828 -16.939 -30.240 1.00 . A A .  98 PRO HG2  1 1 
        1  1599 1 1  98 PRO HG3  H   5.454 -15.946 -30.683 1.00 . A A .  98 PRO HG3  1 1 
        1  1600 1 1  98 PRO N    N   4.996 -16.987 -27.760 1.00 . A A .  98 PRO N    1 1 
        1  1601 1 1  98 PRO O    O   6.248 -19.242 -26.980 1.00 . A A .  98 PRO O    1 1 
        1  1602 1 1  99 SER C    C   6.525 -22.481 -29.520 1.00 . A A .  99 SER C    1 1 
        1  1603 1 1  99 SER CA   C   6.120 -21.703 -28.266 1.00 . A A .  99 SER CA   1 1 
        1  1604 1 1  99 SER CB   C   5.297 -22.593 -27.332 1.00 . A A .  99 SER CB   1 1 
        1  1605 1 1  99 SER H    H   4.780 -20.615 -29.432 1.00 . A A .  99 SER H    1 1 
        1  1606 1 1  99 SER HA   H   7.002 -21.342 -27.738 1.00 . A A .  99 SER HA   1 1 
        1  1607 1 1  99 SER HB2  H   4.719 -21.967 -26.652 1.00 . A A .  99 SER HB2  1 1 
        1  1608 1 1  99 SER HB3  H   4.582 -23.170 -27.919 1.00 . A A .  99 SER HB3  1 1 
        1  1609 1 1  99 SER HG   H   5.573 -24.247 -26.240 1.00 . A A .  99 SER HG   1 1 
        1  1610 1 1  99 SER N    N   5.380 -20.510 -28.639 1.00 . A A .  99 SER N    1 1 
        1  1611 1 1  99 SER O    O   6.090 -22.156 -30.623 1.00 . A A .  99 SER O    1 1 
        1  1612 1 1  99 SER OG   O   6.118 -23.480 -26.578 1.00 . A A .  99 SER OG   1 1 
        1  1613 1 1 100 SER C    C   7.108 -25.673 -30.385 1.00 . A A . 100 SER C    1 1 
        1  1614 1 1 100 SER CA   C   7.822 -24.320 -30.406 1.00 . A A . 100 SER CA   1 1 
        1  1615 1 1 100 SER CB   C   9.337 -24.518 -30.339 1.00 . A A . 100 SER CB   1 1 
        1  1616 1 1 100 SER H    H   7.702 -23.751 -28.406 1.00 . A A . 100 SER H    1 1 
        1  1617 1 1 100 SER HA   H   7.568 -23.768 -31.311 1.00 . A A . 100 SER HA   1 1 
        1  1618 1 1 100 SER HB2  H   9.837 -23.596 -30.634 1.00 . A A . 100 SER HB2  1 1 
        1  1619 1 1 100 SER HB3  H   9.631 -24.725 -29.310 1.00 . A A . 100 SER HB3  1 1 
        1  1620 1 1 100 SER HG   H   9.244 -25.590 -32.027 1.00 . A A . 100 SER HG   1 1 
        1  1621 1 1 100 SER N    N   7.353 -23.493 -29.307 1.00 . A A . 100 SER N    1 1 
        1  1622 1 1 100 SER O    O   6.436 -26.040 -31.348 1.00 . A A . 100 SER O    1 1 
        1  1623 1 1 100 SER OG   O   9.774 -25.583 -31.179 1.00 . A A . 100 SER OG   1 1 
        1  1624 1 1 101 GLY C    C   5.668 -27.680 -27.951 1.00 . A A . 101 GLY C    1 1 
        1  1625 1 1 101 GLY CA   C   6.658 -27.683 -29.116 1.00 . A A . 101 GLY CA   1 1 
        1  1626 1 1 101 GLY H    H   7.826 -26.073 -28.498 1.00 . A A . 101 GLY H    1 1 
        1  1627 1 1 101 GLY HA2  H   6.143 -27.959 -30.036 1.00 . A A . 101 GLY HA2  1 1 
        1  1628 1 1 101 GLY HA3  H   7.427 -28.436 -28.943 1.00 . A A . 101 GLY HA3  1 1 
        1  1629 1 1 101 GLY N    N   7.278 -26.378 -29.276 1.00 . A A . 101 GLY N    1 1 
        1  1630 1 1 101 GLY O    O   4.571 -27.134 -28.064 1.00 . A A . 101 GLY O    1 1 
        2  1631 1 1   1 GLY C    C -19.239   7.748  -0.744 1.00 . A A .   1 GLY C    1 1 
        2  1632 1 1   1 GLY CA   C -19.270   8.914   0.246 1.00 . A A .   1 GLY CA   1 1 
        2  1633 1 1   1 GLY H1   H -17.384   9.657  -0.232 1.00 . A A .   1 GLY H1   1 1 
        2  1634 1 1   1 GLY HA2  H -19.775   8.606   1.161 1.00 . A A .   1 GLY HA2  1 1 
        2  1635 1 1   1 GLY HA3  H -19.848   9.737  -0.175 1.00 . A A .   1 GLY HA3  1 1 
        2  1636 1 1   1 GLY N    N -17.926   9.369   0.557 1.00 . A A .   1 GLY N    1 1 
        2  1637 1 1   1 GLY O    O -19.785   7.846  -1.842 1.00 . A A .   1 GLY O    1 1 
        2  1638 1 1   2 SER C    C -17.709   5.818  -2.433 1.00 . A A .   2 SER C    1 1 
        2  1639 1 1   2 SER CA   C -18.484   5.487  -1.156 1.00 . A A .   2 SER CA   1 1 
        2  1640 1 1   2 SER CB   C -19.865   4.928  -1.503 1.00 . A A .   2 SER CB   1 1 
        2  1641 1 1   2 SER H    H -18.152   6.600   0.574 1.00 . A A .   2 SER H    1 1 
        2  1642 1 1   2 SER HA   H -17.938   4.760  -0.555 1.00 . A A .   2 SER HA   1 1 
        2  1643 1 1   2 SER HB2  H -20.607   5.345  -0.822 1.00 . A A .   2 SER HB2  1 1 
        2  1644 1 1   2 SER HB3  H -20.142   5.245  -2.508 1.00 . A A .   2 SER HB3  1 1 
        2  1645 1 1   2 SER HG   H -19.431   3.196  -0.600 1.00 . A A .   2 SER HG   1 1 
        2  1646 1 1   2 SER N    N -18.594   6.671  -0.320 1.00 . A A .   2 SER N    1 1 
        2  1647 1 1   2 SER O    O -17.566   6.986  -2.792 1.00 . A A .   2 SER O    1 1 
        2  1648 1 1   2 SER OG   O -19.899   3.505  -1.427 1.00 . A A .   2 SER OG   1 1 
        2  1649 1 1   3 SER C    C -16.054   3.566  -4.858 1.00 . A A .   3 SER C    1 1 
        2  1650 1 1   3 SER CA   C -16.472   4.934  -4.313 1.00 . A A .   3 SER CA   1 1 
        2  1651 1 1   3 SER CB   C -15.241   5.814  -4.089 1.00 . A A .   3 SER CB   1 1 
        2  1652 1 1   3 SER H    H -17.349   3.822  -2.785 1.00 . A A .   3 SER H    1 1 
        2  1653 1 1   3 SER HA   H -17.151   5.430  -5.006 1.00 . A A .   3 SER HA   1 1 
        2  1654 1 1   3 SER HB2  H -15.221   6.152  -3.053 1.00 . A A .   3 SER HB2  1 1 
        2  1655 1 1   3 SER HB3  H -14.339   5.223  -4.248 1.00 . A A .   3 SER HB3  1 1 
        2  1656 1 1   3 SER HG   H -16.090   7.443  -4.883 1.00 . A A .   3 SER HG   1 1 
        2  1657 1 1   3 SER N    N -17.228   4.769  -3.084 1.00 . A A .   3 SER N    1 1 
        2  1658 1 1   3 SER O    O -14.925   3.127  -4.644 1.00 . A A .   3 SER O    1 1 
        2  1659 1 1   3 SER OG   O -15.227   6.944  -4.957 1.00 . A A .   3 SER OG   1 1 
        2  1660 1 1   4 GLY C    C -15.935   0.743  -5.160 1.00 . A A .   4 GLY C    1 1 
        2  1661 1 1   4 GLY CA   C -16.730   1.622  -6.128 1.00 . A A .   4 GLY CA   1 1 
        2  1662 1 1   4 GLY H    H -17.903   3.295  -5.720 1.00 . A A .   4 GLY H    1 1 
        2  1663 1 1   4 GLY HA2  H -17.675   1.137  -6.373 1.00 . A A .   4 GLY HA2  1 1 
        2  1664 1 1   4 GLY HA3  H -16.178   1.734  -7.061 1.00 . A A .   4 GLY HA3  1 1 
        2  1665 1 1   4 GLY N    N -16.987   2.931  -5.551 1.00 . A A .   4 GLY N    1 1 
        2  1666 1 1   4 GLY O    O -15.873   1.028  -3.965 1.00 . A A .   4 GLY O    1 1 
        2  1667 1 1   5 SER C    C -13.648  -2.061  -5.819 1.00 . A A .   5 SER C    1 1 
        2  1668 1 1   5 SER CA   C -14.560  -1.231  -4.913 1.00 . A A .   5 SER CA   1 1 
        2  1669 1 1   5 SER CB   C -15.460  -2.148  -4.082 1.00 . A A .   5 SER CB   1 1 
        2  1670 1 1   5 SER H    H -15.404  -0.534  -6.685 1.00 . A A .   5 SER H    1 1 
        2  1671 1 1   5 SER HA   H -13.969  -0.603  -4.247 1.00 . A A .   5 SER HA   1 1 
        2  1672 1 1   5 SER HB2  H -16.498  -2.006  -4.383 1.00 . A A .   5 SER HB2  1 1 
        2  1673 1 1   5 SER HB3  H -15.208  -3.188  -4.289 1.00 . A A .   5 SER HB3  1 1 
        2  1674 1 1   5 SER HG   H -16.224  -1.664  -2.297 1.00 . A A .   5 SER HG   1 1 
        2  1675 1 1   5 SER N    N -15.348  -0.309  -5.712 1.00 . A A .   5 SER N    1 1 
        2  1676 1 1   5 SER O    O -12.435  -2.098  -5.619 1.00 . A A .   5 SER O    1 1 
        2  1677 1 1   5 SER OG   O -15.333  -1.898  -2.685 1.00 . A A .   5 SER OG   1 1 
        2  1678 1 1   6 SER C    C -12.829  -4.674  -6.987 1.00 . A A .   6 SER C    1 1 
        2  1679 1 1   6 SER CA   C -13.527  -3.535  -7.733 1.00 . A A .   6 SER CA   1 1 
        2  1680 1 1   6 SER CB   C -12.504  -2.705  -8.511 1.00 . A A .   6 SER CB   1 1 
        2  1681 1 1   6 SER H    H -15.255  -2.672  -6.952 1.00 . A A .   6 SER H    1 1 
        2  1682 1 1   6 SER HA   H -14.274  -3.929  -8.422 1.00 . A A .   6 SER HA   1 1 
        2  1683 1 1   6 SER HB2  H -12.160  -1.878  -7.890 1.00 . A A .   6 SER HB2  1 1 
        2  1684 1 1   6 SER HB3  H -11.633  -3.320  -8.735 1.00 . A A .   6 SER HB3  1 1 
        2  1685 1 1   6 SER HG   H -12.630  -1.308  -9.939 1.00 . A A .   6 SER HG   1 1 
        2  1686 1 1   6 SER N    N -14.268  -2.707  -6.796 1.00 . A A .   6 SER N    1 1 
        2  1687 1 1   6 SER O    O -12.615  -4.590  -5.779 1.00 . A A .   6 SER O    1 1 
        2  1688 1 1   6 SER OG   O -13.046  -2.192  -9.725 1.00 . A A .   6 SER OG   1 1 
        2  1689 1 1   7 GLY C    C -10.540  -6.453  -6.442 1.00 . A A .   7 GLY C    1 1 
        2  1690 1 1   7 GLY CA   C -11.825  -6.867  -7.164 1.00 . A A .   7 GLY CA   1 1 
        2  1691 1 1   7 GLY H    H -12.672  -5.773  -8.721 1.00 . A A .   7 GLY H    1 1 
        2  1692 1 1   7 GLY HA2  H -12.493  -7.369  -6.464 1.00 . A A .   7 GLY HA2  1 1 
        2  1693 1 1   7 GLY HA3  H -11.589  -7.584  -7.950 1.00 . A A .   7 GLY HA3  1 1 
        2  1694 1 1   7 GLY N    N -12.494  -5.712  -7.739 1.00 . A A .   7 GLY N    1 1 
        2  1695 1 1   7 GLY O    O -10.570  -6.113  -5.261 1.00 . A A .   7 GLY O    1 1 
        2  1696 1 1   8 PRO C    C  -8.000  -4.614  -6.497 1.00 . A A .   8 PRO C    1 1 
        2  1697 1 1   8 PRO CA   C  -8.122  -6.132  -6.649 1.00 . A A .   8 PRO CA   1 1 
        2  1698 1 1   8 PRO CB   C  -7.101  -6.715  -7.613 1.00 . A A .   8 PRO CB   1 1 
        2  1699 1 1   8 PRO CD   C  -9.341  -6.896  -8.606 1.00 . A A .   8 PRO CD   1 1 
        2  1700 1 1   8 PRO CG   C  -7.854  -6.982  -8.906 1.00 . A A .   8 PRO CG   1 1 
        2  1701 1 1   8 PRO HA   H  -8.020  -6.508  -5.728 1.00 . A A .   8 PRO HA   1 1 
        2  1702 1 1   8 PRO HB2  H  -6.277  -6.021  -7.776 1.00 . A A .   8 PRO HB2  1 1 
        2  1703 1 1   8 PRO HB3  H  -6.670  -7.634  -7.215 1.00 . A A .   8 PRO HB3  1 1 
        2  1704 1 1   8 PRO HD2  H  -9.834  -6.168  -9.250 1.00 . A A .   8 PRO HD2  1 1 
        2  1705 1 1   8 PRO HD3  H  -9.834  -7.854  -8.772 1.00 . A A .   8 PRO HD3  1 1 
        2  1706 1 1   8 PRO HG2  H  -7.575  -6.253  -9.667 1.00 . A A .   8 PRO HG2  1 1 
        2  1707 1 1   8 PRO HG3  H  -7.600  -7.966  -9.300 1.00 . A A .   8 PRO HG3  1 1 
        2  1708 1 1   8 PRO N    N  -9.414  -6.498  -7.203 1.00 . A A .   8 PRO N    1 1 
        2  1709 1 1   8 PRO O    O  -8.228  -3.871  -7.450 1.00 . A A .   8 PRO O    1 1 
        2  1710 1 1   9 LYS C    C  -6.013  -2.399  -5.131 1.00 . A A .   9 LYS C    1 1 
        2  1711 1 1   9 LYS CA   C  -7.488  -2.784  -5.001 1.00 . A A .   9 LYS CA   1 1 
        2  1712 1 1   9 LYS CB   C  -8.094  -2.447  -3.637 1.00 . A A .   9 LYS CB   1 1 
        2  1713 1 1   9 LYS CD   C  -6.681  -1.402  -1.828 1.00 . A A .   9 LYS CD   1 1 
        2  1714 1 1   9 LYS CE   C  -7.428  -1.218  -0.506 1.00 . A A .   9 LYS CE   1 1 
        2  1715 1 1   9 LYS CG   C  -7.091  -2.708  -2.512 1.00 . A A .   9 LYS CG   1 1 
        2  1716 1 1   9 LYS H    H  -7.459  -4.811  -4.521 1.00 . A A .   9 LYS H    1 1 
        2  1717 1 1   9 LYS HA   H  -8.056  -2.233  -5.751 1.00 . A A .   9 LYS HA   1 1 
        2  1718 1 1   9 LYS HB2  H  -8.401  -1.401  -3.620 1.00 . A A .   9 LYS HB2  1 1 
        2  1719 1 1   9 LYS HB3  H  -8.991  -3.045  -3.476 1.00 . A A .   9 LYS HB3  1 1 
        2  1720 1 1   9 LYS HD2  H  -5.606  -1.404  -1.646 1.00 . A A .   9 LYS HD2  1 1 
        2  1721 1 1   9 LYS HD3  H  -6.891  -0.560  -2.488 1.00 . A A .   9 LYS HD3  1 1 
        2  1722 1 1   9 LYS HE2  H  -8.265  -0.534  -0.646 1.00 . A A .   9 LYS HE2  1 1 
        2  1723 1 1   9 LYS HE3  H  -7.846  -2.171  -0.181 1.00 . A A .   9 LYS HE3  1 1 
        2  1724 1 1   9 LYS HG2  H  -7.529  -3.384  -1.778 1.00 . A A .   9 LYS HG2  1 1 
        2  1725 1 1   9 LYS HG3  H  -6.208  -3.204  -2.915 1.00 . A A .   9 LYS HG3  1 1 
        2  1726 1 1   9 LYS HZ1  H  -5.570  -0.877   0.275 1.00 . A A .   9 LYS HZ1  1 1 
        2  1727 1 1   9 LYS HZ2  H  -6.649   0.298   0.623 1.00 . A A .   9 LYS HZ2  1 1 
        2  1728 1 1   9 LYS HZ3  H  -6.717  -1.132   1.409 1.00 . A A .   9 LYS HZ3  1 1 
        2  1729 1 1   9 LYS N    N  -7.642  -4.199  -5.291 1.00 . A A .   9 LYS N    1 1 
        2  1730 1 1   9 LYS NZ   N  -6.517  -0.690   0.535 1.00 . A A .   9 LYS NZ   1 1 
        2  1731 1 1   9 LYS O    O  -5.135  -3.259  -5.067 1.00 . A A .   9 LYS O    1 1 
        2  1732 1 1  10 LYS C    C  -3.670  -0.822  -4.142 1.00 . A A .  10 LYS C    1 1 
        2  1733 1 1  10 LYS CA   C  -4.431  -0.597  -5.450 1.00 . A A .  10 LYS CA   1 1 
        2  1734 1 1  10 LYS CB   C  -4.453   0.863  -5.906 1.00 . A A .  10 LYS CB   1 1 
        2  1735 1 1  10 LYS CD   C  -3.348   1.854  -7.945 1.00 . A A .  10 LYS CD   1 1 
        2  1736 1 1  10 LYS CE   C  -2.446   1.183  -8.983 1.00 . A A .  10 LYS CE   1 1 
        2  1737 1 1  10 LYS CG   C  -3.123   1.254  -6.555 1.00 . A A .  10 LYS CG   1 1 
        2  1738 1 1  10 LYS H    H  -6.505  -0.414  -5.361 1.00 . A A .  10 LYS H    1 1 
        2  1739 1 1  10 LYS HA   H  -3.945  -1.173  -6.237 1.00 . A A .  10 LYS HA   1 1 
        2  1740 1 1  10 LYS HB2  H  -5.266   1.015  -6.615 1.00 . A A .  10 LYS HB2  1 1 
        2  1741 1 1  10 LYS HB3  H  -4.649   1.512  -5.052 1.00 . A A .  10 LYS HB3  1 1 
        2  1742 1 1  10 LYS HD2  H  -4.392   1.734  -8.233 1.00 . A A .  10 LYS HD2  1 1 
        2  1743 1 1  10 LYS HD3  H  -3.145   2.925  -7.920 1.00 . A A .  10 LYS HD3  1 1 
        2  1744 1 1  10 LYS HE2  H  -1.515   0.866  -8.515 1.00 . A A .  10 LYS HE2  1 1 
        2  1745 1 1  10 LYS HE3  H  -2.931   0.285  -9.368 1.00 . A A .  10 LYS HE3  1 1 
        2  1746 1 1  10 LYS HG2  H  -2.604   1.975  -5.924 1.00 . A A .  10 LYS HG2  1 1 
        2  1747 1 1  10 LYS HG3  H  -2.481   0.377  -6.633 1.00 . A A .  10 LYS HG3  1 1 
        2  1748 1 1  10 LYS HZ1  H  -2.417   3.042  -9.832 1.00 . A A .  10 LYS HZ1  1 1 
        2  1749 1 1  10 LYS HZ2  H  -1.180   2.088 -10.308 1.00 . A A .  10 LYS HZ2  1 1 
        2  1750 1 1  10 LYS HZ3  H  -2.680   1.839 -10.905 1.00 . A A .  10 LYS HZ3  1 1 
        2  1751 1 1  10 LYS N    N  -5.785  -1.106  -5.311 1.00 . A A .  10 LYS N    1 1 
        2  1752 1 1  10 LYS NZ   N  -2.158   2.113 -10.097 1.00 . A A .  10 LYS NZ   1 1 
        2  1753 1 1  10 LYS O    O  -3.981  -0.205  -3.124 1.00 . A A .  10 LYS O    1 1 
        2  1754 1 1  11 PRO C    C  -0.862  -0.917  -2.748 1.00 . A A .  11 PRO C    1 1 
        2  1755 1 1  11 PRO CA   C  -1.852  -2.044  -3.048 1.00 . A A .  11 PRO CA   1 1 
        2  1756 1 1  11 PRO CB   C  -1.169  -3.360  -3.386 1.00 . A A .  11 PRO CB   1 1 
        2  1757 1 1  11 PRO CD   C  -2.263  -2.480  -5.402 1.00 . A A .  11 PRO CD   1 1 
        2  1758 1 1  11 PRO CG   C  -1.253  -3.498  -4.897 1.00 . A A .  11 PRO CG   1 1 
        2  1759 1 1  11 PRO HA   H  -2.430  -2.124  -2.236 1.00 . A A .  11 PRO HA   1 1 
        2  1760 1 1  11 PRO HB2  H  -0.132  -3.359  -3.051 1.00 . A A .  11 PRO HB2  1 1 
        2  1761 1 1  11 PRO HB3  H  -1.663  -4.195  -2.889 1.00 . A A .  11 PRO HB3  1 1 
        2  1762 1 1  11 PRO HD2  H  -1.824  -1.826  -6.155 1.00 . A A .  11 PRO HD2  1 1 
        2  1763 1 1  11 PRO HD3  H  -3.120  -2.969  -5.866 1.00 . A A .  11 PRO HD3  1 1 
        2  1764 1 1  11 PRO HG2  H  -0.278  -3.325  -5.351 1.00 . A A .  11 PRO HG2  1 1 
        2  1765 1 1  11 PRO HG3  H  -1.559  -4.507  -5.172 1.00 . A A .  11 PRO HG3  1 1 
        2  1766 1 1  11 PRO N    N  -2.660  -1.730  -4.214 1.00 . A A .  11 PRO N    1 1 
        2  1767 1 1  11 PRO O    O  -0.678  -0.014  -3.563 1.00 . A A .  11 PRO O    1 1 
        2  1768 1 1  12 PRO C    C   2.058  -0.181  -1.871 1.00 . A A .  12 PRO C    1 1 
        2  1769 1 1  12 PRO CA   C   0.732  -0.007  -1.127 1.00 . A A .  12 PRO CA   1 1 
        2  1770 1 1  12 PRO CB   C   0.866  -0.193   0.376 1.00 . A A .  12 PRO CB   1 1 
        2  1771 1 1  12 PRO CD   C  -0.427  -2.064  -0.555 1.00 . A A .  12 PRO CD   1 1 
        2  1772 1 1  12 PRO CG   C   0.328  -1.583   0.674 1.00 . A A .  12 PRO CG   1 1 
        2  1773 1 1  12 PRO HA   H   0.406   0.909  -1.360 1.00 . A A .  12 PRO HA   1 1 
        2  1774 1 1  12 PRO HB2  H   1.905  -0.100   0.690 1.00 . A A .  12 PRO HB2  1 1 
        2  1775 1 1  12 PRO HB3  H   0.301   0.568   0.915 1.00 . A A .  12 PRO HB3  1 1 
        2  1776 1 1  12 PRO HD2  H  -0.037  -3.018  -0.911 1.00 . A A .  12 PRO HD2  1 1 
        2  1777 1 1  12 PRO HD3  H  -1.484  -2.213  -0.336 1.00 . A A .  12 PRO HD3  1 1 
        2  1778 1 1  12 PRO HG2  H   1.145  -2.265   0.911 1.00 . A A .  12 PRO HG2  1 1 
        2  1779 1 1  12 PRO HG3  H  -0.330  -1.560   1.542 1.00 . A A .  12 PRO HG3  1 1 
        2  1780 1 1  12 PRO N    N  -0.234  -1.009  -1.545 1.00 . A A .  12 PRO N    1 1 
        2  1781 1 1  12 PRO O    O   2.121  -0.883  -2.878 1.00 . A A .  12 PRO O    1 1 
        2  1782 1 1  13 MET C    C   5.497   0.632  -0.901 1.00 . A A .  13 MET C    1 1 
        2  1783 1 1  13 MET CA   C   4.405   0.399  -1.947 1.00 . A A .  13 MET CA   1 1 
        2  1784 1 1  13 MET CB   C   4.522   1.452  -3.051 1.00 . A A .  13 MET CB   1 1 
        2  1785 1 1  13 MET CE   C   5.039   3.104  -5.618 1.00 . A A .  13 MET CE   1 1 
        2  1786 1 1  13 MET CG   C   3.943   0.932  -4.368 1.00 . A A .  13 MET CG   1 1 
        2  1787 1 1  13 MET H    H   3.024   1.042  -0.526 1.00 . A A .  13 MET H    1 1 
        2  1788 1 1  13 MET HA   H   4.487  -0.610  -2.351 1.00 . A A .  13 MET HA   1 1 
        2  1789 1 1  13 MET HB2  H   3.996   2.358  -2.751 1.00 . A A .  13 MET HB2  1 1 
        2  1790 1 1  13 MET HB3  H   5.569   1.722  -3.191 1.00 . A A .  13 MET HB3  1 1 
        2  1791 1 1  13 MET HE1  H   4.200   3.496  -6.193 1.00 . A A .  13 MET HE1  1 1 
        2  1792 1 1  13 MET HE2  H   4.940   3.410  -4.576 1.00 . A A .  13 MET HE2  1 1 
        2  1793 1 1  13 MET HE3  H   5.972   3.494  -6.024 1.00 . A A .  13 MET HE3  1 1 
        2  1794 1 1  13 MET HG2  H   3.795  -0.146  -4.309 1.00 . A A .  13 MET HG2  1 1 
        2  1795 1 1  13 MET HG3  H   2.965   1.379  -4.547 1.00 . A A .  13 MET HG3  1 1 
        2  1796 1 1  13 MET N    N   3.084   0.472  -1.345 1.00 . A A .  13 MET N    1 1 
        2  1797 1 1  13 MET O    O   5.233   1.185   0.165 1.00 . A A .  13 MET O    1 1 
        2  1798 1 1  13 MET SD   S   5.047   1.322  -5.716 1.00 . A A .  13 MET SD   1 1 
        2  1799 1 1  14 ASN C    C   7.564  -0.416   0.948 1.00 . A A .  14 ASN C    1 1 
        2  1800 1 1  14 ASN CA   C   7.835   0.352  -0.348 1.00 . A A .  14 ASN CA   1 1 
        2  1801 1 1  14 ASN CB   C   8.057   1.822   0.012 1.00 . A A .  14 ASN CB   1 1 
        2  1802 1 1  14 ASN CG   C   8.717   2.576  -1.145 1.00 . A A .  14 ASN CG   1 1 
        2  1803 1 1  14 ASN H    H   6.908  -0.252  -2.113 1.00 . A A .  14 ASN H    1 1 
        2  1804 1 1  14 ASN HA   H   8.689  -0.045  -0.896 1.00 . A A .  14 ASN HA   1 1 
        2  1805 1 1  14 ASN HB2  H   7.103   2.288   0.257 1.00 . A A .  14 ASN HB2  1 1 
        2  1806 1 1  14 ASN HB3  H   8.684   1.892   0.901 1.00 . A A .  14 ASN HB3  1 1 
        2  1807 1 1  14 ASN HD21 H   7.244   3.959  -1.021 1.00 . A A .  14 ASN HD21 1 1 
        2  1808 1 1  14 ASN HD22 H   8.432   4.249  -2.248 1.00 . A A .  14 ASN HD22 1 1 
        2  1809 1 1  14 ASN N    N   6.701   0.198  -1.243 1.00 . A A .  14 ASN N    1 1 
        2  1810 1 1  14 ASN ND2  N   8.078   3.686  -1.501 1.00 . A A .  14 ASN ND2  1 1 
        2  1811 1 1  14 ASN O    O   8.052  -1.531   1.127 1.00 . A A .  14 ASN O    1 1 
        2  1812 1 1  14 ASN OD1  O   9.738   2.175  -1.679 1.00 . A A .  14 ASN OD1  1 1 
        2  1813 1 1  15 GLY C    C   5.916   0.647   4.076 1.00 . A A .  15 GLY C    1 1 
        2  1814 1 1  15 GLY CA   C   6.445  -0.399   3.092 1.00 . A A .  15 GLY CA   1 1 
        2  1815 1 1  15 GLY H    H   6.394   1.118   1.665 1.00 . A A .  15 GLY H    1 1 
        2  1816 1 1  15 GLY HA2  H   5.692  -1.172   2.938 1.00 . A A .  15 GLY HA2  1 1 
        2  1817 1 1  15 GLY HA3  H   7.323  -0.888   3.512 1.00 . A A .  15 GLY HA3  1 1 
        2  1818 1 1  15 GLY N    N   6.787   0.211   1.818 1.00 . A A .  15 GLY N    1 1 
        2  1819 1 1  15 GLY O    O   5.138   0.323   4.972 1.00 . A A .  15 GLY O    1 1 
        2  1820 1 1  16 TYR C    C   4.460   3.293   4.533 1.00 . A A .  16 TYR C    1 1 
        2  1821 1 1  16 TYR CA   C   5.942   2.974   4.736 1.00 . A A .  16 TYR CA   1 1 
        2  1822 1 1  16 TYR CB   C   6.775   4.185   4.311 1.00 . A A .  16 TYR CB   1 1 
        2  1823 1 1  16 TYR CD1  C   6.168   5.673   6.253 1.00 . A A .  16 TYR CD1  1 1 
        2  1824 1 1  16 TYR CD2  C   5.948   6.551   4.041 1.00 . A A .  16 TYR CD2  1 1 
        2  1825 1 1  16 TYR CE1  C   5.703   6.923   6.796 1.00 . A A .  16 TYR CE1  1 1 
        2  1826 1 1  16 TYR CE2  C   5.483   7.801   4.584 1.00 . A A .  16 TYR CE2  1 1 
        2  1827 1 1  16 TYR CG   C   6.281   5.513   4.887 1.00 . A A .  16 TYR CG   1 1 
        2  1828 1 1  16 TYR CZ   C   5.383   7.925   5.934 1.00 . A A .  16 TYR CZ   1 1 
        2  1829 1 1  16 TYR H    H   6.994   2.133   3.146 1.00 . A A .  16 TYR H    1 1 
        2  1830 1 1  16 TYR HA   H   6.103   2.670   5.770 1.00 . A A .  16 TYR HA   1 1 
        2  1831 1 1  16 TYR HB2  H   7.809   4.028   4.620 1.00 . A A .  16 TYR HB2  1 1 
        2  1832 1 1  16 TYR HB3  H   6.775   4.250   3.223 1.00 . A A .  16 TYR HB3  1 1 
        2  1833 1 1  16 TYR HD1  H   6.431   4.853   6.922 1.00 . A A .  16 TYR HD1  1 1 
        2  1834 1 1  16 TYR HD2  H   6.037   6.425   2.962 1.00 . A A .  16 TYR HD2  1 1 
        2  1835 1 1  16 TYR HE1  H   5.609   7.063   7.873 1.00 . A A .  16 TYR HE1  1 1 
        2  1836 1 1  16 TYR HE2  H   5.217   8.629   3.927 1.00 . A A .  16 TYR HE2  1 1 
        2  1837 1 1  16 TYR HH   H   4.489   8.950   7.324 1.00 . A A .  16 TYR HH   1 1 
        2  1838 1 1  16 TYR N    N   6.361   1.879   3.877 1.00 . A A .  16 TYR N    1 1 
        2  1839 1 1  16 TYR O    O   3.727   3.496   5.501 1.00 . A A .  16 TYR O    1 1 
        2  1840 1 1  16 TYR OH   O   4.944   9.106   6.447 1.00 . A A .  16 TYR OH   1 1 
        2  1841 1 1  17 GLN C    C   1.743   2.620   3.609 1.00 . A A .  17 GLN C    1 1 
        2  1842 1 1  17 GLN CA   C   2.680   3.620   2.929 1.00 . A A .  17 GLN CA   1 1 
        2  1843 1 1  17 GLN CB   C   2.477   3.617   1.413 1.00 . A A .  17 GLN CB   1 1 
        2  1844 1 1  17 GLN CD   C   2.417   5.098  -0.628 1.00 . A A .  17 GLN CD   1 1 
        2  1845 1 1  17 GLN CG   C   2.959   4.930   0.793 1.00 . A A .  17 GLN CG   1 1 
        2  1846 1 1  17 GLN H    H   4.664   3.162   2.489 1.00 . A A .  17 GLN H    1 1 
        2  1847 1 1  17 GLN HA   H   2.492   4.623   3.313 1.00 . A A .  17 GLN HA   1 1 
        2  1848 1 1  17 GLN HB2  H   3.020   2.782   0.971 1.00 . A A .  17 GLN HB2  1 1 
        2  1849 1 1  17 GLN HB3  H   1.422   3.469   1.183 1.00 . A A .  17 GLN HB3  1 1 
        2  1850 1 1  17 GLN HE21 H   2.589   3.096  -0.879 1.00 . A A .  17 GLN HE21 1 1 
        2  1851 1 1  17 GLN HE22 H   1.974   3.964  -2.246 1.00 . A A .  17 GLN HE22 1 1 
        2  1852 1 1  17 GLN HG2  H   2.636   5.768   1.410 1.00 . A A .  17 GLN HG2  1 1 
        2  1853 1 1  17 GLN HG3  H   4.049   4.949   0.774 1.00 . A A .  17 GLN HG3  1 1 
        2  1854 1 1  17 GLN N    N   4.062   3.328   3.270 1.00 . A A .  17 GLN N    1 1 
        2  1855 1 1  17 GLN NE2  N   2.318   3.959  -1.307 1.00 . A A .  17 GLN NE2  1 1 
        2  1856 1 1  17 GLN O    O   0.601   2.950   3.927 1.00 . A A .  17 GLN O    1 1 
        2  1857 1 1  17 GLN OE1  O   2.108   6.189  -1.078 1.00 . A A .  17 GLN OE1  1 1 
        2  1858 1 1  18 LYS C    C   1.199   0.757   5.901 1.00 . A A .  18 LYS C    1 1 
        2  1859 1 1  18 LYS CA   C   1.484   0.367   4.449 1.00 . A A .  18 LYS CA   1 1 
        2  1860 1 1  18 LYS CB   C   2.188  -0.984   4.302 1.00 . A A .  18 LYS CB   1 1 
        2  1861 1 1  18 LYS CD   C   0.023  -2.173   4.809 1.00 . A A .  18 LYS CD   1 1 
        2  1862 1 1  18 LYS CE   C  -0.403  -3.640   4.723 1.00 . A A .  18 LYS CE   1 1 
        2  1863 1 1  18 LYS CG   C   1.507  -2.053   5.159 1.00 . A A .  18 LYS CG   1 1 
        2  1864 1 1  18 LYS H    H   3.189   1.156   3.551 1.00 . A A .  18 LYS H    1 1 
        2  1865 1 1  18 LYS HA   H   0.534   0.294   3.918 1.00 . A A .  18 LYS HA   1 1 
        2  1866 1 1  18 LYS HB2  H   2.180  -1.291   3.257 1.00 . A A .  18 LYS HB2  1 1 
        2  1867 1 1  18 LYS HB3  H   3.233  -0.887   4.597 1.00 . A A .  18 LYS HB3  1 1 
        2  1868 1 1  18 LYS HD2  H  -0.575  -1.661   5.562 1.00 . A A .  18 LYS HD2  1 1 
        2  1869 1 1  18 LYS HD3  H  -0.171  -1.679   3.857 1.00 . A A .  18 LYS HD3  1 1 
        2  1870 1 1  18 LYS HE2  H  -0.696  -3.881   3.701 1.00 . A A .  18 LYS HE2  1 1 
        2  1871 1 1  18 LYS HE3  H   0.439  -4.285   4.974 1.00 . A A .  18 LYS HE3  1 1 
        2  1872 1 1  18 LYS HG2  H   1.999  -3.014   5.007 1.00 . A A .  18 LYS HG2  1 1 
        2  1873 1 1  18 LYS HG3  H   1.616  -1.803   6.214 1.00 . A A .  18 LYS HG3  1 1 
        2  1874 1 1  18 LYS HZ1  H  -1.203  -3.882   6.589 1.00 . A A .  18 LYS HZ1  1 1 
        2  1875 1 1  18 LYS HZ2  H  -2.237  -3.210   5.518 1.00 . A A .  18 LYS HZ2  1 1 
        2  1876 1 1  18 LYS HZ3  H  -1.915  -4.810   5.449 1.00 . A A .  18 LYS HZ3  1 1 
        2  1877 1 1  18 LYS N    N   2.260   1.417   3.812 1.00 . A A .  18 LYS N    1 1 
        2  1878 1 1  18 LYS NZ   N  -1.531  -3.907   5.644 1.00 . A A .  18 LYS NZ   1 1 
        2  1879 1 1  18 LYS O    O   0.042   0.892   6.295 1.00 . A A .  18 LYS O    1 1 
        2  1880 1 1  19 PHE C    C   1.339   2.585   8.213 1.00 . A A .  19 PHE C    1 1 
        2  1881 1 1  19 PHE CA   C   2.154   1.300   8.055 1.00 . A A .  19 PHE CA   1 1 
        2  1882 1 1  19 PHE CB   C   3.572   1.543   8.576 1.00 . A A .  19 PHE CB   1 1 
        2  1883 1 1  19 PHE CD1  C   3.156   1.748  11.037 1.00 . A A .  19 PHE CD1  1 1 
        2  1884 1 1  19 PHE CD2  C   4.145   3.574   9.925 1.00 . A A .  19 PHE CD2  1 1 
        2  1885 1 1  19 PHE CE1  C   3.207   2.466  12.261 1.00 . A A .  19 PHE CE1  1 1 
        2  1886 1 1  19 PHE CE2  C   4.195   4.292  11.149 1.00 . A A .  19 PHE CE2  1 1 
        2  1887 1 1  19 PHE CG   C   3.626   2.317   9.895 1.00 . A A .  19 PHE CG   1 1 
        2  1888 1 1  19 PHE CZ   C   3.725   3.723  12.291 1.00 . A A .  19 PHE CZ   1 1 
        2  1889 1 1  19 PHE H    H   3.212   0.816   6.327 1.00 . A A .  19 PHE H    1 1 
        2  1890 1 1  19 PHE HA   H   1.643   0.483   8.565 1.00 . A A .  19 PHE HA   1 1 
        2  1891 1 1  19 PHE HB2  H   4.068   0.582   8.710 1.00 . A A .  19 PHE HB2  1 1 
        2  1892 1 1  19 PHE HB3  H   4.137   2.091   7.822 1.00 . A A .  19 PHE HB3  1 1 
        2  1893 1 1  19 PHE HD1  H   2.741   0.740  11.014 1.00 . A A .  19 PHE HD1  1 1 
        2  1894 1 1  19 PHE HD2  H   4.522   4.030   9.010 1.00 . A A .  19 PHE HD2  1 1 
        2  1895 1 1  19 PHE HE1  H   2.830   2.010  13.177 1.00 . A A .  19 PHE HE1  1 1 
        2  1896 1 1  19 PHE HE2  H   4.611   5.299  11.173 1.00 . A A .  19 PHE HE2  1 1 
        2  1897 1 1  19 PHE HZ   H   3.764   4.274  13.231 1.00 . A A .  19 PHE HZ   1 1 
        2  1898 1 1  19 PHE N    N   2.274   0.928   6.656 1.00 . A A .  19 PHE N    1 1 
        2  1899 1 1  19 PHE O    O   0.470   2.671   9.079 1.00 . A A .  19 PHE O    1 1 
        2  1900 1 1  20 SER C    C  -0.556   4.607   7.296 1.00 . A A .  20 SER C    1 1 
        2  1901 1 1  20 SER CA   C   0.955   4.829   7.395 1.00 . A A .  20 SER CA   1 1 
        2  1902 1 1  20 SER CB   C   1.432   5.745   6.267 1.00 . A A .  20 SER CB   1 1 
        2  1903 1 1  20 SER H    H   2.356   3.475   6.660 1.00 . A A .  20 SER H    1 1 
        2  1904 1 1  20 SER HA   H   1.214   5.273   8.357 1.00 . A A .  20 SER HA   1 1 
        2  1905 1 1  20 SER HB2  H   1.225   5.274   5.305 1.00 . A A .  20 SER HB2  1 1 
        2  1906 1 1  20 SER HB3  H   0.868   6.677   6.293 1.00 . A A .  20 SER HB3  1 1 
        2  1907 1 1  20 SER HG   H   3.131   6.525   5.550 1.00 . A A .  20 SER HG   1 1 
        2  1908 1 1  20 SER N    N   1.648   3.553   7.361 1.00 . A A .  20 SER N    1 1 
        2  1909 1 1  20 SER O    O  -1.304   4.996   8.191 1.00 . A A .  20 SER O    1 1 
        2  1910 1 1  20 SER OG   O   2.825   6.031   6.364 1.00 . A A .  20 SER OG   1 1 
        2  1911 1 1  21 GLN C    C  -3.009   3.141   7.239 1.00 . A A .  21 GLN C    1 1 
        2  1912 1 1  21 GLN CA   C  -2.366   3.705   5.970 1.00 . A A .  21 GLN CA   1 1 
        2  1913 1 1  21 GLN CB   C  -2.552   2.749   4.790 1.00 . A A .  21 GLN CB   1 1 
        2  1914 1 1  21 GLN CD   C  -3.685   2.592   2.543 1.00 . A A .  21 GLN CD   1 1 
        2  1915 1 1  21 GLN CG   C  -2.955   3.510   3.526 1.00 . A A .  21 GLN CG   1 1 
        2  1916 1 1  21 GLN H    H  -0.343   3.670   5.475 1.00 . A A .  21 GLN H    1 1 
        2  1917 1 1  21 GLN HA   H  -2.816   4.667   5.724 1.00 . A A .  21 GLN HA   1 1 
        2  1918 1 1  21 GLN HB2  H  -1.626   2.203   4.611 1.00 . A A .  21 GLN HB2  1 1 
        2  1919 1 1  21 GLN HB3  H  -3.315   2.009   5.033 1.00 . A A .  21 GLN HB3  1 1 
        2  1920 1 1  21 GLN HE21 H  -3.040   3.776   1.032 1.00 . A A .  21 GLN HE21 1 1 
        2  1921 1 1  21 GLN HE22 H  -4.011   2.425   0.552 1.00 . A A .  21 GLN HE22 1 1 
        2  1922 1 1  21 GLN HG2  H  -3.599   4.349   3.792 1.00 . A A .  21 GLN HG2  1 1 
        2  1923 1 1  21 GLN HG3  H  -2.068   3.927   3.050 1.00 . A A .  21 GLN HG3  1 1 
        2  1924 1 1  21 GLN N    N  -0.959   3.983   6.198 1.00 . A A .  21 GLN N    1 1 
        2  1925 1 1  21 GLN NE2  N  -3.569   2.961   1.270 1.00 . A A .  21 GLN NE2  1 1 
        2  1926 1 1  21 GLN O    O  -4.178   3.402   7.516 1.00 . A A .  21 GLN O    1 1 
        2  1927 1 1  21 GLN OE1  O  -4.311   1.613   2.915 1.00 . A A .  21 GLN OE1  1 1 
        2  1928 1 1  22 GLU C    C  -3.024   2.860  10.237 1.00 . A A .  22 GLU C    1 1 
        2  1929 1 1  22 GLU CA   C  -2.691   1.776   9.210 1.00 . A A .  22 GLU CA   1 1 
        2  1930 1 1  22 GLU CB   C  -1.666   0.787   9.769 1.00 . A A .  22 GLU CB   1 1 
        2  1931 1 1  22 GLU CD   C  -1.798  -1.731   9.716 1.00 . A A .  22 GLU CD   1 1 
        2  1932 1 1  22 GLU CG   C  -2.356  -0.452  10.344 1.00 . A A .  22 GLU CG   1 1 
        2  1933 1 1  22 GLU H    H  -1.265   2.171   7.745 1.00 . A A .  22 GLU H    1 1 
        2  1934 1 1  22 GLU HA   H  -3.597   1.235   8.937 1.00 . A A .  22 GLU HA   1 1 
        2  1935 1 1  22 GLU HB2  H  -0.975   0.490   8.980 1.00 . A A .  22 GLU HB2  1 1 
        2  1936 1 1  22 GLU HB3  H  -1.074   1.271  10.546 1.00 . A A .  22 GLU HB3  1 1 
        2  1937 1 1  22 GLU HG2  H  -2.216  -0.482  11.425 1.00 . A A .  22 GLU HG2  1 1 
        2  1938 1 1  22 GLU HG3  H  -3.429  -0.392  10.163 1.00 . A A .  22 GLU HG3  1 1 
        2  1939 1 1  22 GLU N    N  -2.215   2.379   7.977 1.00 . A A .  22 GLU N    1 1 
        2  1940 1 1  22 GLU O    O  -4.057   2.795  10.902 1.00 . A A .  22 GLU O    1 1 
        2  1941 1 1  22 GLU OE1  O  -0.728  -2.174  10.186 1.00 . A A .  22 GLU OE1  1 1 
        2  1942 1 1  22 GLU OE2  O  -2.456  -2.237   8.781 1.00 . A A .  22 GLU OE2  1 1 
        2  1943 1 1  23 LEU C    C  -3.462   5.817  10.786 1.00 . A A .  23 LEU C    1 1 
        2  1944 1 1  23 LEU CA   C  -2.314   4.929  11.270 1.00 . A A .  23 LEU CA   1 1 
        2  1945 1 1  23 LEU CB   C  -0.999   5.682  11.480 1.00 . A A .  23 LEU CB   1 1 
        2  1946 1 1  23 LEU CD1  C   1.481   5.239  11.577 1.00 . A A .  23 LEU CD1  1 1 
        2  1947 1 1  23 LEU CD2  C   0.084   5.138  13.691 1.00 . A A .  23 LEU CD2  1 1 
        2  1948 1 1  23 LEU CG   C   0.116   4.903  12.180 1.00 . A A .  23 LEU CG   1 1 
        2  1949 1 1  23 LEU H    H  -1.291   3.878   9.791 1.00 . A A .  23 LEU H    1 1 
        2  1950 1 1  23 LEU HA   H  -2.594   4.496  12.230 1.00 . A A .  23 LEU HA   1 1 
        2  1951 1 1  23 LEU HB2  H  -0.632   6.009  10.507 1.00 . A A .  23 LEU HB2  1 1 
        2  1952 1 1  23 LEU HB3  H  -1.207   6.581  12.060 1.00 . A A .  23 LEU HB3  1 1 
        2  1953 1 1  23 LEU HD11 H   1.854   4.379  11.021 1.00 . A A .  23 LEU HD11 1 1 
        2  1954 1 1  23 LEU HD12 H   1.382   6.091  10.904 1.00 . A A .  23 LEU HD12 1 1 
        2  1955 1 1  23 LEU HD13 H   2.181   5.486  12.375 1.00 . A A .  23 LEU HD13 1 1 
        2  1956 1 1  23 LEU HD21 H  -0.046   6.202  13.891 1.00 . A A .  23 LEU HD21 1 1 
        2  1957 1 1  23 LEU HD22 H  -0.747   4.583  14.127 1.00 . A A .  23 LEU HD22 1 1 
        2  1958 1 1  23 LEU HD23 H   1.020   4.797  14.132 1.00 . A A .  23 LEU HD23 1 1 
        2  1959 1 1  23 LEU HG   H  -0.055   3.839  12.016 1.00 . A A .  23 LEU HG   1 1 
        2  1960 1 1  23 LEU N    N  -2.129   3.832  10.335 1.00 . A A .  23 LEU N    1 1 
        2  1961 1 1  23 LEU O    O  -4.029   6.583  11.564 1.00 . A A .  23 LEU O    1 1 
        2  1962 1 1  24 LEU C    C  -6.170   5.741   9.109 1.00 . A A .  24 LEU C    1 1 
        2  1963 1 1  24 LEU CA   C  -4.839   6.467   8.907 1.00 . A A .  24 LEU CA   1 1 
        2  1964 1 1  24 LEU CB   C  -4.524   6.776   7.442 1.00 . A A .  24 LEU CB   1 1 
        2  1965 1 1  24 LEU CD1  C  -3.444   8.301   5.748 1.00 . A A .  24 LEU CD1  1 1 
        2  1966 1 1  24 LEU CD2  C  -3.520   8.963   8.195 1.00 . A A .  24 LEU CD2  1 1 
        2  1967 1 1  24 LEU CG   C  -3.422   7.809   7.196 1.00 . A A .  24 LEU CG   1 1 
        2  1968 1 1  24 LEU H    H  -3.303   5.061   8.878 1.00 . A A .  24 LEU H    1 1 
        2  1969 1 1  24 LEU HA   H  -4.881   7.420   9.435 1.00 . A A .  24 LEU HA   1 1 
        2  1970 1 1  24 LEU HB2  H  -4.240   5.847   6.948 1.00 . A A .  24 LEU HB2  1 1 
        2  1971 1 1  24 LEU HB3  H  -5.436   7.127   6.961 1.00 . A A .  24 LEU HB3  1 1 
        2  1972 1 1  24 LEU HD11 H  -2.425   8.342   5.362 1.00 . A A .  24 LEU HD11 1 1 
        2  1973 1 1  24 LEU HD12 H  -4.035   7.615   5.140 1.00 . A A .  24 LEU HD12 1 1 
        2  1974 1 1  24 LEU HD13 H  -3.889   9.295   5.709 1.00 . A A .  24 LEU HD13 1 1 
        2  1975 1 1  24 LEU HD21 H  -2.882   9.784   7.866 1.00 . A A .  24 LEU HD21 1 1 
        2  1976 1 1  24 LEU HD22 H  -4.553   9.307   8.254 1.00 . A A .  24 LEU HD22 1 1 
        2  1977 1 1  24 LEU HD23 H  -3.194   8.622   9.178 1.00 . A A .  24 LEU HD23 1 1 
        2  1978 1 1  24 LEU HG   H  -2.458   7.325   7.357 1.00 . A A .  24 LEU HG   1 1 
        2  1979 1 1  24 LEU N    N  -3.769   5.686   9.504 1.00 . A A .  24 LEU N    1 1 
        2  1980 1 1  24 LEU O    O  -7.224   6.372   9.162 1.00 . A A .  24 LEU O    1 1 
        2  1981 1 1  25 SER C    C  -7.462   3.320  10.904 1.00 . A A .  25 SER C    1 1 
        2  1982 1 1  25 SER CA   C  -7.262   3.604   9.413 1.00 . A A .  25 SER CA   1 1 
        2  1983 1 1  25 SER CB   C  -7.159   2.292   8.633 1.00 . A A .  25 SER CB   1 1 
        2  1984 1 1  25 SER H    H  -5.216   3.917   9.174 1.00 . A A .  25 SER H    1 1 
        2  1985 1 1  25 SER HA   H  -8.090   4.195   9.022 1.00 . A A .  25 SER HA   1 1 
        2  1986 1 1  25 SER HB2  H  -6.111   2.078   8.421 1.00 . A A .  25 SER HB2  1 1 
        2  1987 1 1  25 SER HB3  H  -7.533   1.474   9.248 1.00 . A A .  25 SER HB3  1 1 
        2  1988 1 1  25 SER HG   H  -8.148   3.283   7.203 1.00 . A A .  25 SER HG   1 1 
        2  1989 1 1  25 SER N    N  -6.078   4.423   9.218 1.00 . A A .  25 SER N    1 1 
        2  1990 1 1  25 SER O    O  -8.569   3.007  11.336 1.00 . A A .  25 SER O    1 1 
        2  1991 1 1  25 SER OG   O  -7.890   2.340   7.410 1.00 . A A .  25 SER OG   1 1 
        2  1992 1 1  26 ASN C    C  -7.073   4.395  13.773 1.00 . A A .  26 ASN C    1 1 
        2  1993 1 1  26 ASN CA   C  -6.414   3.201  13.080 1.00 . A A .  26 ASN CA   1 1 
        2  1994 1 1  26 ASN CB   C  -5.004   3.041  13.653 1.00 . A A .  26 ASN CB   1 1 
        2  1995 1 1  26 ASN CG   C  -4.382   1.714  13.216 1.00 . A A .  26 ASN CG   1 1 
        2  1996 1 1  26 ASN H    H  -5.474   3.696  11.288 1.00 . A A .  26 ASN H    1 1 
        2  1997 1 1  26 ASN HA   H  -6.985   2.281  13.200 1.00 . A A .  26 ASN HA   1 1 
        2  1998 1 1  26 ASN HB2  H  -4.376   3.868  13.320 1.00 . A A .  26 ASN HB2  1 1 
        2  1999 1 1  26 ASN HB3  H  -5.042   3.089  14.741 1.00 . A A .  26 ASN HB3  1 1 
        2  2000 1 1  26 ASN HD21 H  -2.587   2.645  13.106 1.00 . A A .  26 ASN HD21 1 1 
        2  2001 1 1  26 ASN HD22 H  -2.575   0.962  12.697 1.00 . A A .  26 ASN HD22 1 1 
        2  2002 1 1  26 ASN N    N  -6.372   3.441  11.647 1.00 . A A .  26 ASN N    1 1 
        2  2003 1 1  26 ASN ND2  N  -3.073   1.779  12.988 1.00 . A A .  26 ASN ND2  1 1 
        2  2004 1 1  26 ASN O    O  -8.105   4.246  14.426 1.00 . A A .  26 ASN O    1 1 
        2  2005 1 1  26 ASN OD1  O  -5.046   0.697  13.095 1.00 . A A .  26 ASN OD1  1 1 
        2  2006 1 1  27 GLY C    C  -6.171   7.140  15.465 1.00 . A A .  27 GLY C    1 1 
        2  2007 1 1  27 GLY CA   C  -6.964   6.771  14.209 1.00 . A A .  27 GLY CA   1 1 
        2  2008 1 1  27 GLY H    H  -5.612   5.666  13.075 1.00 . A A .  27 GLY H    1 1 
        2  2009 1 1  27 GLY HA2  H  -6.911   7.587  13.489 1.00 . A A .  27 GLY HA2  1 1 
        2  2010 1 1  27 GLY HA3  H  -8.016   6.640  14.465 1.00 . A A .  27 GLY HA3  1 1 
        2  2011 1 1  27 GLY N    N  -6.451   5.553  13.608 1.00 . A A .  27 GLY N    1 1 
        2  2012 1 1  27 GLY O    O  -6.704   7.767  16.379 1.00 . A A .  27 GLY O    1 1 
        2  2013 1 1  28 GLU C    C  -3.585   8.475  16.569 1.00 . A A .  28 GLU C    1 1 
        2  2014 1 1  28 GLU CA   C  -4.038   7.014  16.597 1.00 . A A .  28 GLU CA   1 1 
        2  2015 1 1  28 GLU CB   C  -2.835   6.068  16.608 1.00 . A A .  28 GLU CB   1 1 
        2  2016 1 1  28 GLU CD   C  -2.370   3.590  16.530 1.00 . A A .  28 GLU CD   1 1 
        2  2017 1 1  28 GLU CG   C  -3.174   4.742  15.923 1.00 . A A .  28 GLU CG   1 1 
        2  2018 1 1  28 GLU H    H  -4.484   6.224  14.722 1.00 . A A .  28 GLU H    1 1 
        2  2019 1 1  28 GLU HA   H  -4.644   6.831  17.484 1.00 . A A .  28 GLU HA   1 1 
        2  2020 1 1  28 GLU HB2  H  -1.993   6.538  16.101 1.00 . A A .  28 GLU HB2  1 1 
        2  2021 1 1  28 GLU HB3  H  -2.524   5.881  17.636 1.00 . A A .  28 GLU HB3  1 1 
        2  2022 1 1  28 GLU HG2  H  -4.240   4.539  16.023 1.00 . A A .  28 GLU HG2  1 1 
        2  2023 1 1  28 GLU HG3  H  -2.962   4.815  14.856 1.00 . A A .  28 GLU HG3  1 1 
        2  2024 1 1  28 GLU N    N  -4.910   6.734  15.469 1.00 . A A .  28 GLU N    1 1 
        2  2025 1 1  28 GLU O    O  -3.134   9.008  17.581 1.00 . A A .  28 GLU O    1 1 
        2  2026 1 1  28 GLU OE1  O  -2.823   3.070  17.572 1.00 . A A .  28 GLU OE1  1 1 
        2  2027 1 1  28 GLU OE2  O  -1.321   3.257  15.938 1.00 . A A .  28 GLU OE2  1 1 
        2  2028 1 1  29 LEU C    C  -4.516  11.259  14.658 1.00 . A A .  29 LEU C    1 1 
        2  2029 1 1  29 LEU CA   C  -3.334  10.471  15.226 1.00 . A A .  29 LEU CA   1 1 
        2  2030 1 1  29 LEU CB   C  -2.064  10.570  14.379 1.00 . A A .  29 LEU CB   1 1 
        2  2031 1 1  29 LEU CD1  C  -0.514   9.323  12.830 1.00 . A A .  29 LEU CD1  1 1 
        2  2032 1 1  29 LEU CD2  C  -0.448   8.882  15.327 1.00 . A A .  29 LEU CD2  1 1 
        2  2033 1 1  29 LEU CG   C  -1.321   9.257  14.128 1.00 . A A .  29 LEU CG   1 1 
        2  2034 1 1  29 LEU H    H  -4.092   8.641  14.581 1.00 . A A .  29 LEU H    1 1 
        2  2035 1 1  29 LEU HA   H  -3.096  10.869  16.213 1.00 . A A .  29 LEU HA   1 1 
        2  2036 1 1  29 LEU HB2  H  -2.327  11.006  13.415 1.00 . A A .  29 LEU HB2  1 1 
        2  2037 1 1  29 LEU HB3  H  -1.380  11.264  14.867 1.00 . A A .  29 LEU HB3  1 1 
        2  2038 1 1  29 LEU HD11 H   0.403   9.887  13.000 1.00 . A A .  29 LEU HD11 1 1 
        2  2039 1 1  29 LEU HD12 H  -0.264   8.313  12.505 1.00 . A A .  29 LEU HD12 1 1 
        2  2040 1 1  29 LEU HD13 H  -1.106   9.816  12.059 1.00 . A A .  29 LEU HD13 1 1 
        2  2041 1 1  29 LEU HD21 H  -0.748   9.472  16.193 1.00 . A A .  29 LEU HD21 1 1 
        2  2042 1 1  29 LEU HD22 H  -0.570   7.822  15.549 1.00 . A A .  29 LEU HD22 1 1 
        2  2043 1 1  29 LEU HD23 H   0.597   9.086  15.093 1.00 . A A .  29 LEU HD23 1 1 
        2  2044 1 1  29 LEU HG   H  -2.059   8.464  14.007 1.00 . A A .  29 LEU HG   1 1 
        2  2045 1 1  29 LEU N    N  -3.723   9.081  15.399 1.00 . A A .  29 LEU N    1 1 
        2  2046 1 1  29 LEU O    O  -4.336  12.119  13.796 1.00 . A A .  29 LEU O    1 1 
        2  2047 1 1  30 ASN C    C  -7.177  12.819  15.611 1.00 . A A .  30 ASN C    1 1 
        2  2048 1 1  30 ASN CA   C  -6.909  11.607  14.717 1.00 . A A .  30 ASN CA   1 1 
        2  2049 1 1  30 ASN CB   C  -8.118  10.674  14.809 1.00 . A A .  30 ASN CB   1 1 
        2  2050 1 1  30 ASN CG   C  -8.217   9.781  13.571 1.00 . A A .  30 ASN CG   1 1 
        2  2051 1 1  30 ASN H    H  -5.835  10.239  15.864 1.00 . A A .  30 ASN H    1 1 
        2  2052 1 1  30 ASN HA   H  -6.716  11.887  13.681 1.00 . A A .  30 ASN HA   1 1 
        2  2053 1 1  30 ASN HB2  H  -8.038  10.055  15.702 1.00 . A A .  30 ASN HB2  1 1 
        2  2054 1 1  30 ASN HB3  H  -9.029  11.264  14.910 1.00 . A A .  30 ASN HB3  1 1 
        2  2055 1 1  30 ASN HD21 H  -9.636   8.697  14.524 1.00 . A A .  30 ASN HD21 1 1 
        2  2056 1 1  30 ASN HD22 H  -9.244   8.160  12.925 1.00 . A A .  30 ASN HD22 1 1 
        2  2057 1 1  30 ASN N    N  -5.698  10.939  15.163 1.00 . A A .  30 ASN N    1 1 
        2  2058 1 1  30 ASN ND2  N  -9.106   8.798  13.683 1.00 . A A .  30 ASN ND2  1 1 
        2  2059 1 1  30 ASN O    O  -8.235  13.440  15.519 1.00 . A A .  30 ASN O    1 1 
        2  2060 1 1  30 ASN OD1  O  -7.532   9.971  12.579 1.00 . A A .  30 ASN OD1  1 1 
        2  2061 1 1  31 HIS C    C  -5.726  15.496  16.713 1.00 . A A .  31 HIS C    1 1 
        2  2062 1 1  31 HIS CA   C  -6.319  14.245  17.366 1.00 . A A .  31 HIS CA   1 1 
        2  2063 1 1  31 HIS CB   C  -5.678  13.921  18.717 1.00 . A A .  31 HIS CB   1 1 
        2  2064 1 1  31 HIS CD2  C  -3.084  14.230  18.791 1.00 . A A .  31 HIS CD2  1 1 
        2  2065 1 1  31 HIS CE1  C  -2.511  12.170  18.326 1.00 . A A .  31 HIS CE1  1 1 
        2  2066 1 1  31 HIS CG   C  -4.229  13.507  18.626 1.00 . A A .  31 HIS CG   1 1 
        2  2067 1 1  31 HIS H    H  -5.344  12.608  16.524 1.00 . A A .  31 HIS H    1 1 
        2  2068 1 1  31 HIS HA   H  -7.384  14.402  17.532 1.00 . A A .  31 HIS HA   1 1 
        2  2069 1 1  31 HIS HB2  H  -5.756  14.795  19.363 1.00 . A A .  31 HIS HB2  1 1 
        2  2070 1 1  31 HIS HB3  H  -6.245  13.121  19.193 1.00 . A A .  31 HIS HB3  1 1 
        2  2071 1 1  31 HIS HD1  H  -4.447  11.442  18.158 1.00 . A A .  31 HIS HD1  1 1 
        2  2072 1 1  31 HIS HD2  H  -3.030  15.292  19.030 1.00 . A A .  31 HIS HD2  1 1 
        2  2073 1 1  31 HIS HE1  H  -1.900  11.290  18.128 1.00 . A A .  31 HIS HE1  1 1 
        2  2074 1 1  31 HIS N    N  -6.201  13.118  16.456 1.00 . A A .  31 HIS N    1 1 
        2  2075 1 1  31 HIS ND1  N  -3.835  12.213  18.333 1.00 . A A .  31 HIS ND1  1 1 
        2  2076 1 1  31 HIS NE2  N  -2.047  13.421  18.611 1.00 . A A .  31 HIS NE2  1 1 
        2  2077 1 1  31 HIS O    O  -5.854  16.597  17.245 1.00 . A A .  31 HIS O    1 1 
        2  2078 1 1  32 LEU C    C  -4.926  16.326  13.378 1.00 . A A .  32 LEU C    1 1 
        2  2079 1 1  32 LEU CA   C  -4.478  16.380  14.840 1.00 . A A .  32 LEU CA   1 1 
        2  2080 1 1  32 LEU CB   C  -2.959  16.361  15.020 1.00 . A A .  32 LEU CB   1 1 
        2  2081 1 1  32 LEU CD1  C  -2.250  14.099  14.159 1.00 . A A .  32 LEU CD1  1 1 
        2  2082 1 1  32 LEU CD2  C  -0.987  15.191  16.069 1.00 . A A .  32 LEU CD2  1 1 
        2  2083 1 1  32 LEU CG   C  -2.344  15.009  15.386 1.00 . A A .  32 LEU CG   1 1 
        2  2084 1 1  32 LEU H    H  -4.991  14.384  15.145 1.00 . A A .  32 LEU H    1 1 
        2  2085 1 1  32 LEU HA   H  -4.843  17.309  15.279 1.00 . A A .  32 LEU HA   1 1 
        2  2086 1 1  32 LEU HB2  H  -2.499  16.708  14.094 1.00 . A A .  32 LEU HB2  1 1 
        2  2087 1 1  32 LEU HB3  H  -2.696  17.080  15.796 1.00 . A A .  32 LEU HB3  1 1 
        2  2088 1 1  32 LEU HD11 H  -3.163  14.188  13.570 1.00 . A A .  32 LEU HD11 1 1 
        2  2089 1 1  32 LEU HD12 H  -1.395  14.396  13.551 1.00 . A A .  32 LEU HD12 1 1 
        2  2090 1 1  32 LEU HD13 H  -2.125  13.065  14.482 1.00 . A A .  32 LEU HD13 1 1 
        2  2091 1 1  32 LEU HD21 H  -1.137  15.350  17.137 1.00 . A A .  32 LEU HD21 1 1 
        2  2092 1 1  32 LEU HD22 H  -0.381  14.298  15.917 1.00 . A A .  32 LEU HD22 1 1 
        2  2093 1 1  32 LEU HD23 H  -0.477  16.053  15.641 1.00 . A A .  32 LEU HD23 1 1 
        2  2094 1 1  32 LEU HG   H  -3.002  14.517  16.102 1.00 . A A .  32 LEU HG   1 1 
        2  2095 1 1  32 LEU N    N  -5.091  15.283  15.571 1.00 . A A .  32 LEU N    1 1 
        2  2096 1 1  32 LEU O    O  -5.486  15.325  12.933 1.00 . A A .  32 LEU O    1 1 
        2  2097 1 1  33 PRO C    C  -4.079  16.696  10.381 1.00 . A A .  33 PRO C    1 1 
        2  2098 1 1  33 PRO CA   C  -5.021  17.532  11.249 1.00 . A A .  33 PRO CA   1 1 
        2  2099 1 1  33 PRO CB   C  -4.971  19.016  10.922 1.00 . A A .  33 PRO CB   1 1 
        2  2100 1 1  33 PRO CD   C  -3.990  18.647  13.145 1.00 . A A .  33 PRO CD   1 1 
        2  2101 1 1  33 PRO CG   C  -4.131  19.655  12.016 1.00 . A A .  33 PRO CG   1 1 
        2  2102 1 1  33 PRO HA   H  -5.935  17.152  11.105 1.00 . A A .  33 PRO HA   1 1 
        2  2103 1 1  33 PRO HB2  H  -4.528  19.185   9.941 1.00 . A A .  33 PRO HB2  1 1 
        2  2104 1 1  33 PRO HB3  H  -5.973  19.445  10.898 1.00 . A A .  33 PRO HB3  1 1 
        2  2105 1 1  33 PRO HD2  H  -2.943  18.455  13.376 1.00 . A A .  33 PRO HD2  1 1 
        2  2106 1 1  33 PRO HD3  H  -4.458  19.009  14.060 1.00 . A A .  33 PRO HD3  1 1 
        2  2107 1 1  33 PRO HG2  H  -3.151  19.936  11.631 1.00 . A A .  33 PRO HG2  1 1 
        2  2108 1 1  33 PRO HG3  H  -4.605  20.568  12.377 1.00 . A A .  33 PRO HG3  1 1 
        2  2109 1 1  33 PRO N    N  -4.653  17.443  12.652 1.00 . A A .  33 PRO N    1 1 
        2  2110 1 1  33 PRO O    O  -2.971  16.367  10.800 1.00 . A A .  33 PRO O    1 1 
        2  2111 1 1  34 LEU C    C  -2.338  16.129   8.211 1.00 . A A .  34 LEU C    1 1 
        2  2112 1 1  34 LEU CA   C  -3.767  15.586   8.255 1.00 . A A .  34 LEU CA   1 1 
        2  2113 1 1  34 LEU CB   C  -4.448  15.536   6.885 1.00 . A A .  34 LEU CB   1 1 
        2  2114 1 1  34 LEU CD1  C  -2.339  14.862   5.678 1.00 . A A .  34 LEU CD1  1 1 
        2  2115 1 1  34 LEU CD2  C  -4.095  13.122   6.250 1.00 . A A .  34 LEU CD2  1 1 
        2  2116 1 1  34 LEU CG   C  -3.831  14.579   5.864 1.00 . A A .  34 LEU CG   1 1 
        2  2117 1 1  34 LEU H    H  -5.456  16.649   8.852 1.00 . A A .  34 LEU H    1 1 
        2  2118 1 1  34 LEU HA   H  -3.738  14.565   8.637 1.00 . A A .  34 LEU HA   1 1 
        2  2119 1 1  34 LEU HB2  H  -5.492  15.258   7.031 1.00 . A A .  34 LEU HB2  1 1 
        2  2120 1 1  34 LEU HB3  H  -4.442  16.541   6.462 1.00 . A A .  34 LEU HB3  1 1 
        2  2121 1 1  34 LEU HD11 H  -2.039  14.580   4.669 1.00 . A A .  34 LEU HD11 1 1 
        2  2122 1 1  34 LEU HD12 H  -2.150  15.924   5.830 1.00 . A A .  34 LEU HD12 1 1 
        2  2123 1 1  34 LEU HD13 H  -1.767  14.283   6.402 1.00 . A A .  34 LEU HD13 1 1 
        2  2124 1 1  34 LEU HD21 H  -3.272  12.498   5.898 1.00 . A A .  34 LEU HD21 1 1 
        2  2125 1 1  34 LEU HD22 H  -4.174  13.041   7.334 1.00 . A A .  34 LEU HD22 1 1 
        2  2126 1 1  34 LEU HD23 H  -5.025  12.787   5.792 1.00 . A A .  34 LEU HD23 1 1 
        2  2127 1 1  34 LEU HG   H  -4.314  14.749   4.901 1.00 . A A .  34 LEU HG   1 1 
        2  2128 1 1  34 LEU N    N  -4.554  16.377   9.186 1.00 . A A .  34 LEU N    1 1 
        2  2129 1 1  34 LEU O    O  -1.385  15.404   8.494 1.00 . A A .  34 LEU O    1 1 
        2  2130 1 1  35 LYS C    C  -0.048  17.556   8.915 1.00 . A A .  35 LYS C    1 1 
        2  2131 1 1  35 LYS CA   C  -0.935  18.050   7.771 1.00 . A A .  35 LYS CA   1 1 
        2  2132 1 1  35 LYS CB   C  -1.099  19.571   7.731 1.00 . A A .  35 LYS CB   1 1 
        2  2133 1 1  35 LYS CD   C   1.049  20.225   6.583 1.00 . A A .  35 LYS CD   1 1 
        2  2134 1 1  35 LYS CE   C   2.431  20.858   6.761 1.00 . A A .  35 LYS CE   1 1 
        2  2135 1 1  35 LYS CG   C   0.253  20.271   7.888 1.00 . A A .  35 LYS CG   1 1 
        2  2136 1 1  35 LYS H    H  -3.012  17.984   7.626 1.00 . A A .  35 LYS H    1 1 
        2  2137 1 1  35 LYS HA   H  -0.480  17.750   6.827 1.00 . A A .  35 LYS HA   1 1 
        2  2138 1 1  35 LYS HB2  H  -1.558  19.867   6.788 1.00 . A A .  35 LYS HB2  1 1 
        2  2139 1 1  35 LYS HB3  H  -1.772  19.889   8.527 1.00 . A A .  35 LYS HB3  1 1 
        2  2140 1 1  35 LYS HD2  H   1.158  19.191   6.256 1.00 . A A .  35 LYS HD2  1 1 
        2  2141 1 1  35 LYS HD3  H   0.502  20.751   5.801 1.00 . A A .  35 LYS HD3  1 1 
        2  2142 1 1  35 LYS HE2  H   2.324  21.912   7.017 1.00 . A A .  35 LYS HE2  1 1 
        2  2143 1 1  35 LYS HE3  H   2.952  20.380   7.591 1.00 . A A .  35 LYS HE3  1 1 
        2  2144 1 1  35 LYS HG2  H   0.096  21.308   8.187 1.00 . A A .  35 LYS HG2  1 1 
        2  2145 1 1  35 LYS HG3  H   0.824  19.793   8.684 1.00 . A A .  35 LYS HG3  1 1 
        2  2146 1 1  35 LYS HZ1  H   3.997  21.359   5.548 1.00 . A A .  35 LYS HZ1  1 1 
        2  2147 1 1  35 LYS HZ2  H   3.572  19.785   5.449 1.00 . A A .  35 LYS HZ2  1 1 
        2  2148 1 1  35 LYS HZ3  H   2.651  20.927   4.731 1.00 . A A .  35 LYS HZ3  1 1 
        2  2149 1 1  35 LYS N    N  -2.233  17.401   7.855 1.00 . A A .  35 LYS N    1 1 
        2  2150 1 1  35 LYS NZ   N   3.227  20.721   5.522 1.00 . A A .  35 LYS NZ   1 1 
        2  2151 1 1  35 LYS O    O   1.171  17.476   8.770 1.00 . A A .  35 LYS O    1 1 
        2  2152 1 1  36 GLU C    C   0.087  15.226  11.183 1.00 . A A .  36 GLU C    1 1 
        2  2153 1 1  36 GLU CA   C   0.021  16.754  11.196 1.00 . A A .  36 GLU CA   1 1 
        2  2154 1 1  36 GLU CB   C  -0.626  17.264  12.485 1.00 . A A .  36 GLU CB   1 1 
        2  2155 1 1  36 GLU CD   C   0.217  18.785  14.312 1.00 . A A .  36 GLU CD   1 1 
        2  2156 1 1  36 GLU CG   C  -0.133  18.672  12.827 1.00 . A A .  36 GLU CG   1 1 
        2  2157 1 1  36 GLU H    H  -1.686  17.306  10.137 1.00 . A A .  36 GLU H    1 1 
        2  2158 1 1  36 GLU HA   H   1.026  17.169  11.113 1.00 . A A .  36 GLU HA   1 1 
        2  2159 1 1  36 GLU HB2  H  -1.710  17.272  12.374 1.00 . A A .  36 GLU HB2  1 1 
        2  2160 1 1  36 GLU HB3  H  -0.395  16.585  13.306 1.00 . A A .  36 GLU HB3  1 1 
        2  2161 1 1  36 GLU HG2  H   0.744  18.910  12.224 1.00 . A A .  36 GLU HG2  1 1 
        2  2162 1 1  36 GLU HG3  H  -0.902  19.402  12.574 1.00 . A A .  36 GLU HG3  1 1 
        2  2163 1 1  36 GLU N    N  -0.694  17.238  10.028 1.00 . A A .  36 GLU N    1 1 
        2  2164 1 1  36 GLU O    O   1.143  14.644  11.427 1.00 . A A .  36 GLU O    1 1 
        2  2165 1 1  36 GLU OE1  O   1.048  17.967  14.763 1.00 . A A .  36 GLU OE1  1 1 
        2  2166 1 1  36 GLU OE2  O  -0.355  19.686  14.963 1.00 . A A .  36 GLU OE2  1 1 
        2  2167 1 1  37 ARG C    C   0.073  12.589  10.119 1.00 . A A .  37 ARG C    1 1 
        2  2168 1 1  37 ARG CA   C  -1.140  13.169  10.849 1.00 . A A .  37 ARG CA   1 1 
        2  2169 1 1  37 ARG CB   C  -2.418  12.715  10.139 1.00 . A A .  37 ARG CB   1 1 
        2  2170 1 1  37 ARG CD   C  -4.886  12.342  10.496 1.00 . A A .  37 ARG CD   1 1 
        2  2171 1 1  37 ARG CG   C  -3.661  13.158  10.913 1.00 . A A .  37 ARG CG   1 1 
        2  2172 1 1  37 ARG CZ   C  -7.354  12.598  10.732 1.00 . A A .  37 ARG CZ   1 1 
        2  2173 1 1  37 ARG H    H  -1.910  15.099  10.700 1.00 . A A .  37 ARG H    1 1 
        2  2174 1 1  37 ARG HA   H  -1.156  12.856  11.893 1.00 . A A .  37 ARG HA   1 1 
        2  2175 1 1  37 ARG HB2  H  -2.445  13.130   9.132 1.00 . A A .  37 ARG HB2  1 1 
        2  2176 1 1  37 ARG HB3  H  -2.416  11.630  10.037 1.00 . A A .  37 ARG HB3  1 1 
        2  2177 1 1  37 ARG HD2  H  -4.981  12.343   9.410 1.00 . A A .  37 ARG HD2  1 1 
        2  2178 1 1  37 ARG HD3  H  -4.764  11.303  10.804 1.00 . A A .  37 ARG HD3  1 1 
        2  2179 1 1  37 ARG HE   H  -5.994  13.568  11.854 1.00 . A A .  37 ARG HE   1 1 
        2  2180 1 1  37 ARG HG2  H  -3.489  13.041  11.983 1.00 . A A .  37 ARG HG2  1 1 
        2  2181 1 1  37 ARG HG3  H  -3.847  14.217  10.734 1.00 . A A .  37 ARG HG3  1 1 
        2  2182 1 1  37 ARG HH11 H  -6.770  11.299   9.280 1.00 . A A .  37 ARG HH11 1 1 
        2  2183 1 1  37 ARG HH12 H  -8.483  11.488   9.456 1.00 . A A .  37 ARG HH12 1 1 
        2  2184 1 1  37 ARG HH21 H  -8.253  13.818  12.087 1.00 . A A .  37 ARG HH21 1 1 
        2  2185 1 1  37 ARG HH22 H  -9.332  12.931  11.064 1.00 . A A .  37 ARG HH22 1 1 
        2  2186 1 1  37 ARG N    N  -1.055  14.618  10.897 1.00 . A A .  37 ARG N    1 1 
        2  2187 1 1  37 ARG NE   N  -6.107  12.910  11.110 1.00 . A A .  37 ARG NE   1 1 
        2  2188 1 1  37 ARG NH1  N  -7.553  11.721   9.738 1.00 . A A .  37 ARG NH1  1 1 
        2  2189 1 1  37 ARG NH2  N  -8.402  13.163  11.346 1.00 . A A .  37 ARG NH2  1 1 
        2  2190 1 1  37 ARG O    O   0.848  11.831  10.700 1.00 . A A .  37 ARG O    1 1 
        2  2191 1 1  38 MET C    C   2.640  12.669   8.772 1.00 . A A .  38 MET C    1 1 
        2  2192 1 1  38 MET CA   C   1.307  12.496   8.041 1.00 . A A .  38 MET CA   1 1 
        2  2193 1 1  38 MET CB   C   1.341  13.276   6.725 1.00 . A A .  38 MET CB   1 1 
        2  2194 1 1  38 MET CE   C   0.728  10.042   5.401 1.00 . A A .  38 MET CE   1 1 
        2  2195 1 1  38 MET CG   C   0.314  12.725   5.734 1.00 . A A .  38 MET CG   1 1 
        2  2196 1 1  38 MET H    H  -0.434  13.586   8.391 1.00 . A A .  38 MET H    1 1 
        2  2197 1 1  38 MET HA   H   1.113  11.437   7.870 1.00 . A A .  38 MET HA   1 1 
        2  2198 1 1  38 MET HB2  H   1.137  14.330   6.917 1.00 . A A .  38 MET HB2  1 1 
        2  2199 1 1  38 MET HB3  H   2.339  13.219   6.290 1.00 . A A .  38 MET HB3  1 1 
        2  2200 1 1  38 MET HE1  H  -0.272  10.089   5.833 1.00 . A A .  38 MET HE1  1 1 
        2  2201 1 1  38 MET HE2  H   0.770   9.236   4.668 1.00 . A A .  38 MET HE2  1 1 
        2  2202 1 1  38 MET HE3  H   1.456   9.853   6.190 1.00 . A A .  38 MET HE3  1 1 
        2  2203 1 1  38 MET HG2  H  -0.485  12.215   6.271 1.00 . A A .  38 MET HG2  1 1 
        2  2204 1 1  38 MET HG3  H  -0.146  13.543   5.180 1.00 . A A .  38 MET HG3  1 1 
        2  2205 1 1  38 MET N    N   0.201  12.969   8.856 1.00 . A A .  38 MET N    1 1 
        2  2206 1 1  38 MET O    O   3.262  11.688   9.176 1.00 . A A .  38 MET O    1 1 
        2  2207 1 1  38 MET SD   S   1.105  11.593   4.602 1.00 . A A .  38 MET SD   1 1 
        2  2208 1 1  39 VAL C    C   4.425  13.356  10.837 1.00 . A A .  39 VAL C    1 1 
        2  2209 1 1  39 VAL CA   C   4.286  14.238   9.595 1.00 . A A .  39 VAL CA   1 1 
        2  2210 1 1  39 VAL CB   C   4.346  15.733   9.914 1.00 . A A .  39 VAL CB   1 1 
        2  2211 1 1  39 VAL CG1  C   3.072  16.194  10.624 1.00 . A A .  39 VAL CG1  1 1 
        2  2212 1 1  39 VAL CG2  C   5.588  16.067  10.743 1.00 . A A .  39 VAL CG2  1 1 
        2  2213 1 1  39 VAL H    H   2.526  14.717   8.588 1.00 . A A .  39 VAL H    1 1 
        2  2214 1 1  39 VAL HA   H   5.100  14.007   8.907 1.00 . A A .  39 VAL HA   1 1 
        2  2215 1 1  39 VAL HB   H   4.419  16.275   8.970 1.00 . A A .  39 VAL HB   1 1 
        2  2216 1 1  39 VAL HG11 H   3.093  17.278  10.742 1.00 . A A .  39 VAL HG11 1 1 
        2  2217 1 1  39 VAL HG12 H   2.203  15.910  10.031 1.00 . A A .  39 VAL HG12 1 1 
        2  2218 1 1  39 VAL HG13 H   3.012  15.723  11.605 1.00 . A A .  39 VAL HG13 1 1 
        2  2219 1 1  39 VAL HG21 H   6.315  16.584  10.117 1.00 . A A .  39 VAL HG21 1 1 
        2  2220 1 1  39 VAL HG22 H   5.305  16.710  11.578 1.00 . A A .  39 VAL HG22 1 1 
        2  2221 1 1  39 VAL HG23 H   6.028  15.147  11.126 1.00 . A A .  39 VAL HG23 1 1 
        2  2222 1 1  39 VAL N    N   3.039  13.924   8.919 1.00 . A A .  39 VAL N    1 1 
        2  2223 1 1  39 VAL O    O   5.461  12.724  11.041 1.00 . A A .  39 VAL O    1 1 
        2  2224 1 1  40 GLU C    C   3.753  11.100  12.542 1.00 . A A .  40 GLU C    1 1 
        2  2225 1 1  40 GLU CA   C   3.358  12.546  12.850 1.00 . A A .  40 GLU CA   1 1 
        2  2226 1 1  40 GLU CB   C   1.991  12.607  13.535 1.00 . A A .  40 GLU CB   1 1 
        2  2227 1 1  40 GLU CD   C   3.001  13.751  15.543 1.00 . A A .  40 GLU CD   1 1 
        2  2228 1 1  40 GLU CG   C   2.139  12.583  15.058 1.00 . A A .  40 GLU CG   1 1 
        2  2229 1 1  40 GLU H    H   2.528  13.857  11.460 1.00 . A A .  40 GLU H    1 1 
        2  2230 1 1  40 GLU HA   H   4.104  13.003  13.500 1.00 . A A .  40 GLU HA   1 1 
        2  2231 1 1  40 GLU HB2  H   1.468  13.514  13.231 1.00 . A A .  40 GLU HB2  1 1 
        2  2232 1 1  40 GLU HB3  H   1.380  11.764  13.212 1.00 . A A .  40 GLU HB3  1 1 
        2  2233 1 1  40 GLU HG2  H   1.155  12.635  15.523 1.00 . A A .  40 GLU HG2  1 1 
        2  2234 1 1  40 GLU HG3  H   2.589  11.640  15.368 1.00 . A A .  40 GLU HG3  1 1 
        2  2235 1 1  40 GLU N    N   3.367  13.340  11.634 1.00 . A A .  40 GLU N    1 1 
        2  2236 1 1  40 GLU O    O   4.539  10.499  13.272 1.00 . A A .  40 GLU O    1 1 
        2  2237 1 1  40 GLU OE1  O   2.524  14.899  15.416 1.00 . A A .  40 GLU OE1  1 1 
        2  2238 1 1  40 GLU OE2  O   4.117  13.468  16.029 1.00 . A A .  40 GLU OE2  1 1 
        2  2239 1 1  41 ILE C    C   4.973   9.068  10.799 1.00 . A A .  41 ILE C    1 1 
        2  2240 1 1  41 ILE CA   C   3.471   9.219  11.048 1.00 . A A .  41 ILE CA   1 1 
        2  2241 1 1  41 ILE CB   C   2.607   8.833   9.846 1.00 . A A .  41 ILE CB   1 1 
        2  2242 1 1  41 ILE CD1  C   0.292   9.295   8.959 1.00 . A A .  41 ILE CD1  1 1 
        2  2243 1 1  41 ILE CG1  C   1.119   8.920  10.190 1.00 . A A .  41 ILE CG1  1 1 
        2  2244 1 1  41 ILE CG2  C   2.993   7.451   9.315 1.00 . A A .  41 ILE CG2  1 1 
        2  2245 1 1  41 ILE H    H   2.549  11.079  10.872 1.00 . A A .  41 ILE H    1 1 
        2  2246 1 1  41 ILE HA   H   3.190   8.563  11.871 1.00 . A A .  41 ILE HA   1 1 
        2  2247 1 1  41 ILE HB   H   2.795   9.549   9.046 1.00 . A A .  41 ILE HB   1 1 
        2  2248 1 1  41 ILE HD11 H  -0.571   8.634   8.886 1.00 . A A .  41 ILE HD11 1 1 
        2  2249 1 1  41 ILE HD12 H  -0.048  10.327   9.050 1.00 . A A .  41 ILE HD12 1 1 
        2  2250 1 1  41 ILE HD13 H   0.906   9.192   8.064 1.00 . A A .  41 ILE HD13 1 1 
        2  2251 1 1  41 ILE HG12 H   0.777   7.963  10.585 1.00 . A A .  41 ILE HG12 1 1 
        2  2252 1 1  41 ILE HG13 H   0.966   9.661  10.975 1.00 . A A .  41 ILE HG13 1 1 
        2  2253 1 1  41 ILE HG21 H   2.095   6.844   9.195 1.00 . A A .  41 ILE HG21 1 1 
        2  2254 1 1  41 ILE HG22 H   3.490   7.558   8.350 1.00 . A A .  41 ILE HG22 1 1 
        2  2255 1 1  41 ILE HG23 H   3.668   6.966  10.020 1.00 . A A .  41 ILE HG23 1 1 
        2  2256 1 1  41 ILE N    N   3.188  10.583  11.461 1.00 . A A .  41 ILE N    1 1 
        2  2257 1 1  41 ILE O    O   5.633   8.252  11.441 1.00 . A A .  41 ILE O    1 1 
        2  2258 1 1  42 GLY C    C   7.742   9.613  10.770 1.00 . A A .  42 GLY C    1 1 
        2  2259 1 1  42 GLY CA   C   6.881   9.831   9.523 1.00 . A A .  42 GLY CA   1 1 
        2  2260 1 1  42 GLY H    H   4.926  10.526   9.347 1.00 . A A .  42 GLY H    1 1 
        2  2261 1 1  42 GLY HA2  H   7.066   9.031   8.806 1.00 . A A .  42 GLY HA2  1 1 
        2  2262 1 1  42 GLY HA3  H   7.165  10.765   9.039 1.00 . A A .  42 GLY HA3  1 1 
        2  2263 1 1  42 GLY N    N   5.470   9.866   9.865 1.00 . A A .  42 GLY N    1 1 
        2  2264 1 1  42 GLY O    O   8.804   8.997  10.696 1.00 . A A .  42 GLY O    1 1 
        2  2265 1 1  43 SER C    C   7.850   8.567  13.665 1.00 . A A .  43 SER C    1 1 
        2  2266 1 1  43 SER CA   C   7.962  10.002  13.147 1.00 . A A .  43 SER CA   1 1 
        2  2267 1 1  43 SER CB   C   7.422  10.986  14.187 1.00 . A A .  43 SER CB   1 1 
        2  2268 1 1  43 SER H    H   6.387  10.631  11.938 1.00 . A A .  43 SER H    1 1 
        2  2269 1 1  43 SER HA   H   8.999  10.247  12.920 1.00 . A A .  43 SER HA   1 1 
        2  2270 1 1  43 SER HB2  H   6.771  11.710  13.697 1.00 . A A .  43 SER HB2  1 1 
        2  2271 1 1  43 SER HB3  H   6.812  10.448  14.912 1.00 . A A .  43 SER HB3  1 1 
        2  2272 1 1  43 SER HG   H   8.747  11.159  15.677 1.00 . A A .  43 SER HG   1 1 
        2  2273 1 1  43 SER N    N   7.251  10.131  11.886 1.00 . A A .  43 SER N    1 1 
        2  2274 1 1  43 SER O    O   8.861   7.919  13.934 1.00 . A A .  43 SER O    1 1 
        2  2275 1 1  43 SER OG   O   8.470  11.673  14.865 1.00 . A A .  43 SER OG   1 1 
        2  2276 1 1  44 ARG C    C   7.076   5.741  13.395 1.00 . A A .  44 ARG C    1 1 
        2  2277 1 1  44 ARG CA   C   6.355   6.765  14.273 1.00 . A A .  44 ARG CA   1 1 
        2  2278 1 1  44 ARG CB   C   4.856   6.459  14.277 1.00 . A A .  44 ARG CB   1 1 
        2  2279 1 1  44 ARG CD   C   2.893   6.634  15.851 1.00 . A A .  44 ARG CD   1 1 
        2  2280 1 1  44 ARG CG   C   4.116   7.351  15.276 1.00 . A A .  44 ARG CG   1 1 
        2  2281 1 1  44 ARG CZ   C   2.478   4.978  17.666 1.00 . A A .  44 ARG CZ   1 1 
        2  2282 1 1  44 ARG H    H   5.795   8.645  13.571 1.00 . A A .  44 ARG H    1 1 
        2  2283 1 1  44 ARG HA   H   6.746   6.754  15.290 1.00 . A A .  44 ARG HA   1 1 
        2  2284 1 1  44 ARG HB2  H   4.448   6.609  13.278 1.00 . A A .  44 ARG HB2  1 1 
        2  2285 1 1  44 ARG HB3  H   4.696   5.411  14.532 1.00 . A A .  44 ARG HB3  1 1 
        2  2286 1 1  44 ARG HD2  H   2.122   7.361  16.107 1.00 . A A .  44 ARG HD2  1 1 
        2  2287 1 1  44 ARG HD3  H   2.467   5.967  15.101 1.00 . A A .  44 ARG HD3  1 1 
        2  2288 1 1  44 ARG HE   H   4.192   6.007  17.431 1.00 . A A .  44 ARG HE   1 1 
        2  2289 1 1  44 ARG HG2  H   4.790   7.633  16.085 1.00 . A A .  44 ARG HG2  1 1 
        2  2290 1 1  44 ARG HG3  H   3.805   8.272  14.785 1.00 . A A .  44 ARG HG3  1 1 
        2  2291 1 1  44 ARG HH11 H   0.921   5.240  16.384 1.00 . A A .  44 ARG HH11 1 1 
        2  2292 1 1  44 ARG HH12 H   0.647   4.092  17.652 1.00 . A A .  44 ARG HH12 1 1 
        2  2293 1 1  44 ARG HH21 H   3.831   4.493  19.104 1.00 . A A .  44 ARG HH21 1 1 
        2  2294 1 1  44 ARG HH22 H   2.314   3.664  19.210 1.00 . A A .  44 ARG HH22 1 1 
        2  2295 1 1  44 ARG N    N   6.612   8.112  13.791 1.00 . A A .  44 ARG N    1 1 
        2  2296 1 1  44 ARG NE   N   3.278   5.861  17.053 1.00 . A A .  44 ARG NE   1 1 
        2  2297 1 1  44 ARG NH1  N   1.244   4.751  17.194 1.00 . A A .  44 ARG NH1  1 1 
        2  2298 1 1  44 ARG NH2  N   2.911   4.323  18.752 1.00 . A A .  44 ARG NH2  1 1 
        2  2299 1 1  44 ARG O    O   7.647   4.776  13.901 1.00 . A A .  44 ARG O    1 1 
        2  2300 1 1  45 TRP C    C   9.179   5.172  11.364 1.00 . A A .  45 TRP C    1 1 
        2  2301 1 1  45 TRP CA   C   7.667   5.095  11.140 1.00 . A A .  45 TRP CA   1 1 
        2  2302 1 1  45 TRP CB   C   7.257   5.440   9.707 1.00 . A A .  45 TRP CB   1 1 
        2  2303 1 1  45 TRP CD1  C   9.147   5.217   7.964 1.00 . A A .  45 TRP CD1  1 1 
        2  2304 1 1  45 TRP CD2  C   7.894   3.397   8.133 1.00 . A A .  45 TRP CD2  1 1 
        2  2305 1 1  45 TRP CE2  C   8.857   3.148   7.177 1.00 . A A .  45 TRP CE2  1 1 
        2  2306 1 1  45 TRP CE3  C   6.934   2.429   8.477 1.00 . A A .  45 TRP CE3  1 1 
        2  2307 1 1  45 TRP CG   C   8.091   4.736   8.635 1.00 . A A .  45 TRP CG   1 1 
        2  2308 1 1  45 TRP CH2  C   8.008   0.955   6.811 1.00 . A A .  45 TRP CH2  1 1 
        2  2309 1 1  45 TRP CZ2  C   8.954   1.934   6.485 1.00 . A A .  45 TRP CZ2  1 1 
        2  2310 1 1  45 TRP CZ3  C   7.044   1.222   7.776 1.00 . A A .  45 TRP CZ3  1 1 
        2  2311 1 1  45 TRP H    H   6.560   6.772  11.690 1.00 . A A .  45 TRP H    1 1 
        2  2312 1 1  45 TRP HA   H   7.312   4.084  11.337 1.00 . A A .  45 TRP HA   1 1 
        2  2313 1 1  45 TRP HB2  H   6.208   5.178   9.567 1.00 . A A .  45 TRP HB2  1 1 
        2  2314 1 1  45 TRP HB3  H   7.337   6.518   9.566 1.00 . A A .  45 TRP HB3  1 1 
        2  2315 1 1  45 TRP HD1  H   9.562   6.214   8.106 1.00 . A A .  45 TRP HD1  1 1 
        2  2316 1 1  45 TRP HE1  H  10.495   4.426   6.405 1.00 . A A .  45 TRP HE1  1 1 
        2  2317 1 1  45 TRP HE3  H   6.164   2.602   9.228 1.00 . A A .  45 TRP HE3  1 1 
        2  2318 1 1  45 TRP HH2  H   8.027  -0.013   6.310 1.00 . A A .  45 TRP HH2  1 1 
        2  2319 1 1  45 TRP HZ2  H   9.724   1.761   5.734 1.00 . A A .  45 TRP HZ2  1 1 
        2  2320 1 1  45 TRP HZ3  H   6.324   0.437   8.004 1.00 . A A .  45 TRP HZ3  1 1 
        2  2321 1 1  45 TRP N    N   7.026   5.985  12.093 1.00 . A A .  45 TRP N    1 1 
        2  2322 1 1  45 TRP NE1  N   9.643   4.289   7.071 1.00 . A A .  45 TRP NE1  1 1 
        2  2323 1 1  45 TRP O    O   9.891   4.191  11.158 1.00 . A A .  45 TRP O    1 1 
        2  2324 1 1  46 GLN C    C  11.442   5.926  13.367 1.00 . A A .  46 GLN C    1 1 
        2  2325 1 1  46 GLN CA   C  11.037   6.566  12.038 1.00 . A A .  46 GLN CA   1 1 
        2  2326 1 1  46 GLN CB   C  11.374   8.058  12.023 1.00 . A A .  46 GLN CB   1 1 
        2  2327 1 1  46 GLN CD   C  13.143   8.549  10.294 1.00 . A A .  46 GLN CD   1 1 
        2  2328 1 1  46 GLN CG   C  11.643   8.545  10.598 1.00 . A A .  46 GLN CG   1 1 
        2  2329 1 1  46 GLN H    H   9.037   7.141  11.949 1.00 . A A .  46 GLN H    1 1 
        2  2330 1 1  46 GLN HA   H  11.559   6.074  11.216 1.00 . A A .  46 GLN HA   1 1 
        2  2331 1 1  46 GLN HB2  H  10.549   8.625  12.454 1.00 . A A .  46 GLN HB2  1 1 
        2  2332 1 1  46 GLN HB3  H  12.248   8.244  12.646 1.00 . A A .  46 GLN HB3  1 1 
        2  2333 1 1  46 GLN HE21 H  12.866  10.219   9.184 1.00 . A A .  46 GLN HE21 1 1 
        2  2334 1 1  46 GLN HE22 H  14.497   9.642   9.260 1.00 . A A .  46 GLN HE22 1 1 
        2  2335 1 1  46 GLN HG2  H  11.126   7.902   9.886 1.00 . A A .  46 GLN HG2  1 1 
        2  2336 1 1  46 GLN HG3  H  11.240   9.550  10.471 1.00 . A A .  46 GLN HG3  1 1 
        2  2337 1 1  46 GLN N    N   9.623   6.348  11.783 1.00 . A A .  46 GLN N    1 1 
        2  2338 1 1  46 GLN NE2  N  13.535   9.553   9.515 1.00 . A A .  46 GLN NE2  1 1 
        2  2339 1 1  46 GLN O    O  12.629   5.821  13.674 1.00 . A A .  46 GLN O    1 1 
        2  2340 1 1  46 GLN OE1  O  13.894   7.697  10.738 1.00 . A A .  46 GLN OE1  1 1 
        2  2341 1 1  47 ARG C    C  10.829   3.375  15.244 1.00 . A A .  47 ARG C    1 1 
        2  2342 1 1  47 ARG CA   C  10.669   4.887  15.410 1.00 . A A .  47 ARG CA   1 1 
        2  2343 1 1  47 ARG CB   C   9.519   5.168  16.378 1.00 . A A .  47 ARG CB   1 1 
        2  2344 1 1  47 ARG CD   C   8.270   6.971  17.624 1.00 . A A .  47 ARG CD   1 1 
        2  2345 1 1  47 ARG CG   C   9.545   6.623  16.853 1.00 . A A .  47 ARG CG   1 1 
        2  2346 1 1  47 ARG CZ   C   7.612   7.195  20.017 1.00 . A A .  47 ARG CZ   1 1 
        2  2347 1 1  47 ARG H    H   9.471   5.603  13.864 1.00 . A A .  47 ARG H    1 1 
        2  2348 1 1  47 ARG HA   H  11.591   5.341  15.776 1.00 . A A .  47 ARG HA   1 1 
        2  2349 1 1  47 ARG HB2  H   8.568   4.959  15.889 1.00 . A A .  47 ARG HB2  1 1 
        2  2350 1 1  47 ARG HB3  H   9.589   4.500  17.237 1.00 . A A .  47 ARG HB3  1 1 
        2  2351 1 1  47 ARG HD2  H   7.900   7.947  17.311 1.00 . A A .  47 ARG HD2  1 1 
        2  2352 1 1  47 ARG HD3  H   7.488   6.246  17.396 1.00 . A A .  47 ARG HD3  1 1 
        2  2353 1 1  47 ARG HE   H   9.482   6.808  19.380 1.00 . A A .  47 ARG HE   1 1 
        2  2354 1 1  47 ARG HG2  H  10.415   6.786  17.489 1.00 . A A .  47 ARG HG2  1 1 
        2  2355 1 1  47 ARG HG3  H   9.648   7.287  15.995 1.00 . A A .  47 ARG HG3  1 1 
        2  2356 1 1  47 ARG HH11 H   6.088   7.436  18.692 1.00 . A A .  47 ARG HH11 1 1 
        2  2357 1 1  47 ARG HH12 H   5.647   7.589  20.360 1.00 . A A .  47 ARG HH12 1 1 
        2  2358 1 1  47 ARG HH21 H   8.900   7.010  21.580 1.00 . A A .  47 ARG HH21 1 1 
        2  2359 1 1  47 ARG HH22 H   7.257   7.346  22.014 1.00 . A A .  47 ARG HH22 1 1 
        2  2360 1 1  47 ARG N    N  10.433   5.514  14.121 1.00 . A A .  47 ARG N    1 1 
        2  2361 1 1  47 ARG NE   N   8.543   6.977  19.078 1.00 . A A .  47 ARG NE   1 1 
        2  2362 1 1  47 ARG NH1  N   6.342   7.426  19.660 1.00 . A A .  47 ARG NH1  1 1 
        2  2363 1 1  47 ARG NH2  N   7.952   7.183  21.313 1.00 . A A .  47 ARG NH2  1 1 
        2  2364 1 1  47 ARG O    O  11.808   2.795  15.710 1.00 . A A .  47 ARG O    1 1 
        2  2365 1 1  48 ILE C    C  11.288   0.913  13.962 1.00 . A A .  48 ILE C    1 1 
        2  2366 1 1  48 ILE CA   C   9.870   1.345  14.344 1.00 . A A .  48 ILE CA   1 1 
        2  2367 1 1  48 ILE CB   C   8.810   0.956  13.311 1.00 . A A .  48 ILE CB   1 1 
        2  2368 1 1  48 ILE CD1  C   7.977   1.345  10.963 1.00 . A A .  48 ILE CD1  1 1 
        2  2369 1 1  48 ILE CG1  C   8.886   1.861  12.080 1.00 . A A .  48 ILE CG1  1 1 
        2  2370 1 1  48 ILE CG2  C   7.413   0.951  13.934 1.00 . A A .  48 ILE CG2  1 1 
        2  2371 1 1  48 ILE H    H   9.058   3.257  14.201 1.00 . A A .  48 ILE H    1 1 
        2  2372 1 1  48 ILE HA   H   9.601   0.857  15.281 1.00 . A A .  48 ILE HA   1 1 
        2  2373 1 1  48 ILE HB   H   9.017  -0.061  12.976 1.00 . A A .  48 ILE HB   1 1 
        2  2374 1 1  48 ILE HD11 H   7.683   0.318  11.179 1.00 . A A .  48 ILE HD11 1 1 
        2  2375 1 1  48 ILE HD12 H   7.087   1.972  10.901 1.00 . A A .  48 ILE HD12 1 1 
        2  2376 1 1  48 ILE HD13 H   8.511   1.379  10.014 1.00 . A A .  48 ILE HD13 1 1 
        2  2377 1 1  48 ILE HG12 H   8.595   2.876  12.352 1.00 . A A .  48 ILE HG12 1 1 
        2  2378 1 1  48 ILE HG13 H   9.915   1.910  11.723 1.00 . A A .  48 ILE HG13 1 1 
        2  2379 1 1  48 ILE HG21 H   7.291   1.836  14.559 1.00 . A A .  48 ILE HG21 1 1 
        2  2380 1 1  48 ILE HG22 H   6.663   0.959  13.144 1.00 . A A .  48 ILE HG22 1 1 
        2  2381 1 1  48 ILE HG23 H   7.290   0.056  14.544 1.00 . A A .  48 ILE HG23 1 1 
        2  2382 1 1  48 ILE N    N   9.851   2.779  14.577 1.00 . A A .  48 ILE N    1 1 
        2  2383 1 1  48 ILE O    O  12.111   1.743  13.578 1.00 . A A .  48 ILE O    1 1 
        2  2384 1 1  49 SER C    C  12.804  -1.553  12.355 1.00 . A A .  49 SER C    1 1 
        2  2385 1 1  49 SER CA   C  12.834  -0.935  13.754 1.00 . A A .  49 SER CA   1 1 
        2  2386 1 1  49 SER CB   C  13.265  -1.979  14.786 1.00 . A A .  49 SER CB   1 1 
        2  2387 1 1  49 SER H    H  10.855  -1.052  14.395 1.00 . A A .  49 SER H    1 1 
        2  2388 1 1  49 SER HA   H  13.521  -0.089  13.785 1.00 . A A .  49 SER HA   1 1 
        2  2389 1 1  49 SER HB2  H  12.389  -2.340  15.325 1.00 . A A .  49 SER HB2  1 1 
        2  2390 1 1  49 SER HB3  H  13.700  -2.837  14.274 1.00 . A A .  49 SER HB3  1 1 
        2  2391 1 1  49 SER HG   H  13.836  -1.493  16.642 1.00 . A A .  49 SER HG   1 1 
        2  2392 1 1  49 SER N    N  11.530  -0.384  14.082 1.00 . A A .  49 SER N    1 1 
        2  2393 1 1  49 SER O    O  11.821  -1.409  11.630 1.00 . A A .  49 SER O    1 1 
        2  2394 1 1  49 SER OG   O  14.209  -1.453  15.715 1.00 . A A .  49 SER OG   1 1 
        2  2395 1 1  50 GLN C    C  12.879  -3.886  10.530 1.00 . A A .  50 GLN C    1 1 
        2  2396 1 1  50 GLN CA   C  14.005  -2.867  10.718 1.00 . A A .  50 GLN CA   1 1 
        2  2397 1 1  50 GLN CB   C  15.375  -3.526  10.547 1.00 . A A .  50 GLN CB   1 1 
        2  2398 1 1  50 GLN CD   C  15.196  -3.056   8.076 1.00 . A A .  50 GLN CD   1 1 
        2  2399 1 1  50 GLN CG   C  15.534  -4.103   9.139 1.00 . A A .  50 GLN CG   1 1 
        2  2400 1 1  50 GLN H    H  14.689  -2.339  12.613 1.00 . A A .  50 GLN H    1 1 
        2  2401 1 1  50 GLN HA   H  13.902  -2.063   9.989 1.00 . A A .  50 GLN HA   1 1 
        2  2402 1 1  50 GLN HB2  H  16.161  -2.794  10.735 1.00 . A A .  50 GLN HB2  1 1 
        2  2403 1 1  50 GLN HB3  H  15.496  -4.320  11.284 1.00 . A A .  50 GLN HB3  1 1 
        2  2404 1 1  50 GLN HE21 H  13.251  -3.597   8.229 1.00 . A A .  50 GLN HE21 1 1 
        2  2405 1 1  50 GLN HE22 H  13.582  -2.337   7.088 1.00 . A A .  50 GLN HE22 1 1 
        2  2406 1 1  50 GLN HG2  H  16.557  -4.452   8.998 1.00 . A A .  50 GLN HG2  1 1 
        2  2407 1 1  50 GLN HG3  H  14.883  -4.969   9.021 1.00 . A A .  50 GLN HG3  1 1 
        2  2408 1 1  50 GLN N    N  13.894  -2.227  12.017 1.00 . A A .  50 GLN N    1 1 
        2  2409 1 1  50 GLN NE2  N  13.903  -2.991   7.772 1.00 . A A .  50 GLN NE2  1 1 
        2  2410 1 1  50 GLN O    O  12.167  -3.852   9.527 1.00 . A A .  50 GLN O    1 1 
        2  2411 1 1  50 GLN OE1  O  16.053  -2.353   7.565 1.00 . A A .  50 GLN OE1  1 1 
        2  2412 1 1  51 SER C    C  10.437  -5.221  10.876 1.00 . A A .  51 SER C    1 1 
        2  2413 1 1  51 SER CA   C  11.727  -5.796  11.465 1.00 . A A .  51 SER CA   1 1 
        2  2414 1 1  51 SER CB   C  11.463  -6.373  12.857 1.00 . A A .  51 SER CB   1 1 
        2  2415 1 1  51 SER H    H  13.337  -4.790  12.321 1.00 . A A .  51 SER H    1 1 
        2  2416 1 1  51 SER HA   H  12.127  -6.577  10.818 1.00 . A A .  51 SER HA   1 1 
        2  2417 1 1  51 SER HB2  H  12.393  -6.768  13.267 1.00 . A A .  51 SER HB2  1 1 
        2  2418 1 1  51 SER HB3  H  11.134  -5.576  13.523 1.00 . A A .  51 SER HB3  1 1 
        2  2419 1 1  51 SER HG   H  10.415  -7.790  11.910 1.00 . A A .  51 SER HG   1 1 
        2  2420 1 1  51 SER N    N  12.754  -4.769  11.510 1.00 . A A .  51 SER N    1 1 
        2  2421 1 1  51 SER O    O  10.044  -5.577   9.766 1.00 . A A .  51 SER O    1 1 
        2  2422 1 1  51 SER OG   O  10.480  -7.404  12.830 1.00 . A A .  51 SER OG   1 1 
        2  2423 1 1  52 GLN C    C   8.671  -3.310   9.741 1.00 . A A .  52 GLN C    1 1 
        2  2424 1 1  52 GLN CA   C   8.577  -3.713  11.214 1.00 . A A .  52 GLN CA   1 1 
        2  2425 1 1  52 GLN CB   C   8.239  -2.506  12.092 1.00 . A A .  52 GLN CB   1 1 
        2  2426 1 1  52 GLN CD   C   6.963  -4.136  13.531 1.00 . A A .  52 GLN CD   1 1 
        2  2427 1 1  52 GLN CG   C   6.955  -2.748  12.887 1.00 . A A .  52 GLN CG   1 1 
        2  2428 1 1  52 GLN H    H  10.140  -4.056  12.547 1.00 . A A .  52 GLN H    1 1 
        2  2429 1 1  52 GLN HA   H   7.806  -4.473  11.341 1.00 . A A .  52 GLN HA   1 1 
        2  2430 1 1  52 GLN HB2  H   9.064  -2.308  12.777 1.00 . A A .  52 GLN HB2  1 1 
        2  2431 1 1  52 GLN HB3  H   8.123  -1.619  11.468 1.00 . A A .  52 GLN HB3  1 1 
        2  2432 1 1  52 GLN HE21 H   8.190  -3.412  14.968 1.00 . A A .  52 GLN HE21 1 1 
        2  2433 1 1  52 GLN HE22 H   7.771  -5.085  15.126 1.00 . A A .  52 GLN HE22 1 1 
        2  2434 1 1  52 GLN HG2  H   6.852  -1.986  13.660 1.00 . A A .  52 GLN HG2  1 1 
        2  2435 1 1  52 GLN HG3  H   6.092  -2.654  12.229 1.00 . A A .  52 GLN HG3  1 1 
        2  2436 1 1  52 GLN N    N   9.814  -4.341  11.646 1.00 . A A .  52 GLN N    1 1 
        2  2437 1 1  52 GLN NE2  N   7.702  -4.218  14.633 1.00 . A A .  52 GLN NE2  1 1 
        2  2438 1 1  52 GLN O    O   8.044  -3.929   8.883 1.00 . A A .  52 GLN O    1 1 
        2  2439 1 1  52 GLN OE1  O   6.338  -5.072  13.058 1.00 . A A .  52 GLN OE1  1 1 
        2  2440 1 1  53 LYS C    C   9.726  -2.969   7.176 1.00 . A A .  53 LYS C    1 1 
        2  2441 1 1  53 LYS CA   C   9.646  -1.783   8.139 1.00 . A A .  53 LYS CA   1 1 
        2  2442 1 1  53 LYS CB   C  10.857  -0.850   8.068 1.00 . A A .  53 LYS CB   1 1 
        2  2443 1 1  53 LYS CD   C  11.765   1.422   8.679 1.00 . A A .  53 LYS CD   1 1 
        2  2444 1 1  53 LYS CE   C  11.343   2.847   9.040 1.00 . A A .  53 LYS CE   1 1 
        2  2445 1 1  53 LYS CG   C  10.595   0.448   8.834 1.00 . A A .  53 LYS CG   1 1 
        2  2446 1 1  53 LYS H    H   9.968  -1.777  10.197 1.00 . A A .  53 LYS H    1 1 
        2  2447 1 1  53 LYS HA   H   8.767  -1.189   7.884 1.00 . A A .  53 LYS HA   1 1 
        2  2448 1 1  53 LYS HB2  H  11.731  -1.352   8.484 1.00 . A A .  53 LYS HB2  1 1 
        2  2449 1 1  53 LYS HB3  H  11.086  -0.623   7.027 1.00 . A A .  53 LYS HB3  1 1 
        2  2450 1 1  53 LYS HD2  H  12.590   1.109   9.319 1.00 . A A .  53 LYS HD2  1 1 
        2  2451 1 1  53 LYS HD3  H  12.131   1.396   7.652 1.00 . A A .  53 LYS HD3  1 1 
        2  2452 1 1  53 LYS HE2  H  11.543   3.515   8.202 1.00 . A A .  53 LYS HE2  1 1 
        2  2453 1 1  53 LYS HE3  H  10.270   2.880   9.225 1.00 . A A .  53 LYS HE3  1 1 
        2  2454 1 1  53 LYS HG2  H   9.680   0.912   8.467 1.00 . A A .  53 LYS HG2  1 1 
        2  2455 1 1  53 LYS HG3  H  10.439   0.227   9.889 1.00 . A A .  53 LYS HG3  1 1 
        2  2456 1 1  53 LYS HZ1  H  12.464   4.218  10.061 1.00 . A A .  53 LYS HZ1  1 1 
        2  2457 1 1  53 LYS HZ2  H  11.441   3.372  11.013 1.00 . A A .  53 LYS HZ2  1 1 
        2  2458 1 1  53 LYS HZ3  H  12.807   2.671  10.456 1.00 . A A .  53 LYS HZ3  1 1 
        2  2459 1 1  53 LYS N    N   9.461  -2.275   9.493 1.00 . A A .  53 LYS N    1 1 
        2  2460 1 1  53 LYS NZ   N  12.073   3.315  10.240 1.00 . A A .  53 LYS NZ   1 1 
        2  2461 1 1  53 LYS O    O   9.025  -3.001   6.165 1.00 . A A .  53 LYS O    1 1 
        2  2462 1 1  54 GLU C    C   9.430  -5.815   6.500 1.00 . A A .  54 GLU C    1 1 
        2  2463 1 1  54 GLU CA   C  10.767  -5.100   6.702 1.00 . A A .  54 GLU CA   1 1 
        2  2464 1 1  54 GLU CB   C  11.804  -6.040   7.318 1.00 . A A .  54 GLU CB   1 1 
        2  2465 1 1  54 GLU CD   C  13.506  -6.944   5.691 1.00 . A A .  54 GLU CD   1 1 
        2  2466 1 1  54 GLU CG   C  13.181  -5.828   6.685 1.00 . A A .  54 GLU CG   1 1 
        2  2467 1 1  54 GLU H    H  11.153  -3.880   8.346 1.00 . A A .  54 GLU H    1 1 
        2  2468 1 1  54 GLU HA   H  11.140  -4.735   5.744 1.00 . A A .  54 GLU HA   1 1 
        2  2469 1 1  54 GLU HB2  H  11.863  -5.869   8.392 1.00 . A A .  54 GLU HB2  1 1 
        2  2470 1 1  54 GLU HB3  H  11.491  -7.075   7.177 1.00 . A A .  54 GLU HB3  1 1 
        2  2471 1 1  54 GLU HG2  H  13.207  -4.864   6.177 1.00 . A A .  54 GLU HG2  1 1 
        2  2472 1 1  54 GLU HG3  H  13.943  -5.798   7.465 1.00 . A A .  54 GLU HG3  1 1 
        2  2473 1 1  54 GLU N    N  10.586  -3.915   7.523 1.00 . A A .  54 GLU N    1 1 
        2  2474 1 1  54 GLU O    O   9.084  -6.188   5.380 1.00 . A A .  54 GLU O    1 1 
        2  2475 1 1  54 GLU OE1  O  13.001  -6.854   4.551 1.00 . A A .  54 GLU OE1  1 1 
        2  2476 1 1  54 GLU OE2  O  14.252  -7.863   6.092 1.00 . A A .  54 GLU OE2  1 1 
        2  2477 1 1  55 HIS C    C   6.492  -5.902   6.600 1.00 . A A .  55 HIS C    1 1 
        2  2478 1 1  55 HIS CA   C   7.422  -6.648   7.560 1.00 . A A .  55 HIS CA   1 1 
        2  2479 1 1  55 HIS CB   C   6.835  -6.785   8.966 1.00 . A A .  55 HIS CB   1 1 
        2  2480 1 1  55 HIS CD2  C   4.314  -7.296   9.430 1.00 . A A .  55 HIS CD2  1 1 
        2  2481 1 1  55 HIS CE1  C   4.305  -9.397   8.820 1.00 . A A .  55 HIS CE1  1 1 
        2  2482 1 1  55 HIS CG   C   5.577  -7.618   9.029 1.00 . A A .  55 HIS CG   1 1 
        2  2483 1 1  55 HIS H    H   9.002  -5.677   8.509 1.00 . A A .  55 HIS H    1 1 
        2  2484 1 1  55 HIS HA   H   7.598  -7.652   7.174 1.00 . A A .  55 HIS HA   1 1 
        2  2485 1 1  55 HIS HB2  H   7.586  -7.229   9.620 1.00 . A A .  55 HIS HB2  1 1 
        2  2486 1 1  55 HIS HB3  H   6.620  -5.790   9.357 1.00 . A A .  55 HIS HB3  1 1 
        2  2487 1 1  55 HIS HD1  H   6.314  -9.481   8.309 1.00 . A A .  55 HIS HD1  1 1 
        2  2488 1 1  55 HIS HD2  H   3.990  -6.320   9.793 1.00 . A A .  55 HIS HD2  1 1 
        2  2489 1 1  55 HIS HE1  H   3.956 -10.408   8.611 1.00 . A A .  55 HIS HE1  1 1 
        2  2490 1 1  55 HIS N    N   8.713  -5.984   7.602 1.00 . A A .  55 HIS N    1 1 
        2  2491 1 1  55 HIS ND1  N   5.540  -8.949   8.651 1.00 . A A .  55 HIS ND1  1 1 
        2  2492 1 1  55 HIS NE2  N   3.546  -8.371   9.302 1.00 . A A .  55 HIS NE2  1 1 
        2  2493 1 1  55 HIS O    O   6.044  -6.464   5.602 1.00 . A A .  55 HIS O    1 1 
        2  2494 1 1  56 TYR C    C   5.869  -3.753   4.674 1.00 . A A .  56 TYR C    1 1 
        2  2495 1 1  56 TYR CA   C   5.363  -3.819   6.117 1.00 . A A .  56 TYR CA   1 1 
        2  2496 1 1  56 TYR CB   C   5.417  -2.417   6.728 1.00 . A A .  56 TYR CB   1 1 
        2  2497 1 1  56 TYR CD1  C   3.283  -2.671   8.046 1.00 . A A .  56 TYR CD1  1 1 
        2  2498 1 1  56 TYR CD2  C   5.186  -1.727   9.142 1.00 . A A .  56 TYR CD2  1 1 
        2  2499 1 1  56 TYR CE1  C   2.515  -2.530   9.256 1.00 . A A .  56 TYR CE1  1 1 
        2  2500 1 1  56 TYR CE2  C   4.418  -1.586  10.353 1.00 . A A .  56 TYR CE2  1 1 
        2  2501 1 1  56 TYR CG   C   4.602  -2.267   8.014 1.00 . A A .  56 TYR CG   1 1 
        2  2502 1 1  56 TYR CZ   C   3.121  -1.994  10.350 1.00 . A A .  56 TYR CZ   1 1 
        2  2503 1 1  56 TYR H    H   6.599  -4.198   7.750 1.00 . A A .  56 TYR H    1 1 
        2  2504 1 1  56 TYR HA   H   4.367  -4.263   6.125 1.00 . A A .  56 TYR HA   1 1 
        2  2505 1 1  56 TYR HB2  H   6.457  -2.164   6.938 1.00 . A A .  56 TYR HB2  1 1 
        2  2506 1 1  56 TYR HB3  H   5.055  -1.697   5.995 1.00 . A A .  56 TYR HB3  1 1 
        2  2507 1 1  56 TYR HD1  H   2.822  -3.097   7.155 1.00 . A A .  56 TYR HD1  1 1 
        2  2508 1 1  56 TYR HD2  H   6.228  -1.408   9.117 1.00 . A A .  56 TYR HD2  1 1 
        2  2509 1 1  56 TYR HE1  H   1.473  -2.845   9.295 1.00 . A A .  56 TYR HE1  1 1 
        2  2510 1 1  56 TYR HE2  H   4.867  -1.162  11.251 1.00 . A A .  56 TYR HE2  1 1 
        2  2511 1 1  56 TYR HH   H   1.883  -1.003  11.474 1.00 . A A .  56 TYR HH   1 1 
        2  2512 1 1  56 TYR N    N   6.230  -4.647   6.936 1.00 . A A .  56 TYR N    1 1 
        2  2513 1 1  56 TYR O    O   5.076  -3.679   3.737 1.00 . A A .  56 TYR O    1 1 
        2  2514 1 1  56 TYR OH   O   2.396  -1.861  11.493 1.00 . A A .  56 TYR OH   1 1 
        2  2515 1 1  57 LYS C    C   7.522  -5.029   2.479 1.00 . A A .  57 LYS C    1 1 
        2  2516 1 1  57 LYS CA   C   7.809  -3.727   3.230 1.00 . A A .  57 LYS CA   1 1 
        2  2517 1 1  57 LYS CB   C   9.299  -3.406   3.356 1.00 . A A .  57 LYS CB   1 1 
        2  2518 1 1  57 LYS CD   C  11.455  -3.114   2.081 1.00 . A A .  57 LYS CD   1 1 
        2  2519 1 1  57 LYS CE   C  12.423  -4.124   2.701 1.00 . A A .  57 LYS CE   1 1 
        2  2520 1 1  57 LYS CG   C  10.031  -3.672   2.040 1.00 . A A .  57 LYS CG   1 1 
        2  2521 1 1  57 LYS H    H   7.825  -3.843   5.310 1.00 . A A .  57 LYS H    1 1 
        2  2522 1 1  57 LYS HA   H   7.347  -2.904   2.684 1.00 . A A .  57 LYS HA   1 1 
        2  2523 1 1  57 LYS HB2  H   9.427  -2.362   3.643 1.00 . A A .  57 LYS HB2  1 1 
        2  2524 1 1  57 LYS HB3  H   9.739  -4.009   4.150 1.00 . A A .  57 LYS HB3  1 1 
        2  2525 1 1  57 LYS HD2  H  11.782  -2.865   1.071 1.00 . A A .  57 LYS HD2  1 1 
        2  2526 1 1  57 LYS HD3  H  11.471  -2.189   2.658 1.00 . A A .  57 LYS HD3  1 1 
        2  2527 1 1  57 LYS HE2  H  12.822  -3.728   3.635 1.00 . A A .  57 LYS HE2  1 1 
        2  2528 1 1  57 LYS HE3  H  11.890  -5.043   2.947 1.00 . A A .  57 LYS HE3  1 1 
        2  2529 1 1  57 LYS HG2  H  10.063  -4.745   1.848 1.00 . A A .  57 LYS HG2  1 1 
        2  2530 1 1  57 LYS HG3  H   9.482  -3.217   1.215 1.00 . A A .  57 LYS HG3  1 1 
        2  2531 1 1  57 LYS HZ1  H  13.195  -4.999   1.023 1.00 . A A .  57 LYS HZ1  1 1 
        2  2532 1 1  57 LYS HZ2  H  13.888  -3.566   1.390 1.00 . A A .  57 LYS HZ2  1 1 
        2  2533 1 1  57 LYS HZ3  H  14.260  -4.900   2.256 1.00 . A A .  57 LYS HZ3  1 1 
        2  2534 1 1  57 LYS N    N   7.187  -3.782   4.542 1.00 . A A .  57 LYS N    1 1 
        2  2535 1 1  57 LYS NZ   N  13.531  -4.421   1.767 1.00 . A A .  57 LYS NZ   1 1 
        2  2536 1 1  57 LYS O    O   7.213  -5.008   1.289 1.00 . A A .  57 LYS O    1 1 
        2  2537 1 1  58 LYS C    C   5.918  -7.550   2.225 1.00 . A A .  58 LYS C    1 1 
        2  2538 1 1  58 LYS CA   C   7.391  -7.440   2.624 1.00 . A A .  58 LYS CA   1 1 
        2  2539 1 1  58 LYS CB   C   7.855  -8.544   3.576 1.00 . A A .  58 LYS CB   1 1 
        2  2540 1 1  58 LYS CD   C   5.921 -10.075   4.103 1.00 . A A .  58 LYS CD   1 1 
        2  2541 1 1  58 LYS CE   C   6.286 -10.218   5.582 1.00 . A A .  58 LYS CE   1 1 
        2  2542 1 1  58 LYS CG   C   7.173  -9.874   3.246 1.00 . A A .  58 LYS CG   1 1 
        2  2543 1 1  58 LYS H    H   7.886  -6.139   4.174 1.00 . A A .  58 LYS H    1 1 
        2  2544 1 1  58 LYS HA   H   8.000  -7.515   1.723 1.00 . A A .  58 LYS HA   1 1 
        2  2545 1 1  58 LYS HB2  H   8.936  -8.659   3.507 1.00 . A A .  58 LYS HB2  1 1 
        2  2546 1 1  58 LYS HB3  H   7.630  -8.261   4.604 1.00 . A A .  58 LYS HB3  1 1 
        2  2547 1 1  58 LYS HD2  H   5.246  -9.229   3.971 1.00 . A A .  58 LYS HD2  1 1 
        2  2548 1 1  58 LYS HD3  H   5.386 -10.964   3.768 1.00 . A A .  58 LYS HD3  1 1 
        2  2549 1 1  58 LYS HE2  H   7.303  -9.863   5.747 1.00 . A A .  58 LYS HE2  1 1 
        2  2550 1 1  58 LYS HE3  H   5.628  -9.595   6.187 1.00 . A A .  58 LYS HE3  1 1 
        2  2551 1 1  58 LYS HG2  H   6.903  -9.896   2.190 1.00 . A A .  58 LYS HG2  1 1 
        2  2552 1 1  58 LYS HG3  H   7.869 -10.695   3.415 1.00 . A A .  58 LYS HG3  1 1 
        2  2553 1 1  58 LYS HZ1  H   6.968 -12.142   5.687 1.00 . A A .  58 LYS HZ1  1 1 
        2  2554 1 1  58 LYS HZ2  H   6.128 -11.674   7.007 1.00 . A A .  58 LYS HZ2  1 1 
        2  2555 1 1  58 LYS HZ3  H   5.340 -12.030   5.622 1.00 . A A .  58 LYS HZ3  1 1 
        2  2556 1 1  58 LYS N    N   7.635  -6.131   3.206 1.00 . A A .  58 LYS N    1 1 
        2  2557 1 1  58 LYS NZ   N   6.171 -11.631   6.009 1.00 . A A .  58 LYS NZ   1 1 
        2  2558 1 1  58 LYS O    O   5.601  -8.000   1.125 1.00 . A A .  58 LYS O    1 1 
        2  2559 1 1  59 LEU C    C   3.299  -6.364   1.643 1.00 . A A .  59 LEU C    1 1 
        2  2560 1 1  59 LEU CA   C   3.625  -7.176   2.898 1.00 . A A .  59 LEU CA   1 1 
        2  2561 1 1  59 LEU CB   C   2.857  -6.723   4.141 1.00 . A A .  59 LEU CB   1 1 
        2  2562 1 1  59 LEU CD1  C   2.149  -7.080   6.535 1.00 . A A .  59 LEU CD1  1 1 
        2  2563 1 1  59 LEU CD2  C   2.590  -9.070   5.024 1.00 . A A .  59 LEU CD2  1 1 
        2  2564 1 1  59 LEU CG   C   2.973  -7.629   5.368 1.00 . A A .  59 LEU CG   1 1 
        2  2565 1 1  59 LEU H    H   5.323  -6.765   4.032 1.00 . A A .  59 LEU H    1 1 
        2  2566 1 1  59 LEU HA   H   3.358  -8.217   2.715 1.00 . A A .  59 LEU HA   1 1 
        2  2567 1 1  59 LEU HB2  H   3.203  -5.727   4.415 1.00 . A A .  59 LEU HB2  1 1 
        2  2568 1 1  59 LEU HB3  H   1.803  -6.633   3.878 1.00 . A A .  59 LEU HB3  1 1 
        2  2569 1 1  59 LEU HD11 H   1.089  -7.237   6.336 1.00 . A A .  59 LEU HD11 1 1 
        2  2570 1 1  59 LEU HD12 H   2.428  -7.598   7.452 1.00 . A A .  59 LEU HD12 1 1 
        2  2571 1 1  59 LEU HD13 H   2.343  -6.013   6.646 1.00 . A A .  59 LEU HD13 1 1 
        2  2572 1 1  59 LEU HD21 H   1.573  -9.092   4.631 1.00 . A A .  59 LEU HD21 1 1 
        2  2573 1 1  59 LEU HD22 H   3.278  -9.459   4.274 1.00 . A A .  59 LEU HD22 1 1 
        2  2574 1 1  59 LEU HD23 H   2.646  -9.685   5.922 1.00 . A A .  59 LEU HD23 1 1 
        2  2575 1 1  59 LEU HG   H   4.015  -7.640   5.687 1.00 . A A .  59 LEU HG   1 1 
        2  2576 1 1  59 LEU N    N   5.057  -7.130   3.140 1.00 . A A .  59 LEU N    1 1 
        2  2577 1 1  59 LEU O    O   2.522  -6.806   0.797 1.00 . A A .  59 LEU O    1 1 
        2  2578 1 1  60 ALA C    C   4.091  -5.041  -0.861 1.00 . A A .  60 ALA C    1 1 
        2  2579 1 1  60 ALA CA   C   3.692  -4.312   0.424 1.00 . A A .  60 ALA CA   1 1 
        2  2580 1 1  60 ALA CB   C   4.476  -3.014   0.625 1.00 . A A .  60 ALA CB   1 1 
        2  2581 1 1  60 ALA H    H   4.538  -4.838   2.253 1.00 . A A .  60 ALA H    1 1 
        2  2582 1 1  60 ALA HA   H   2.628  -4.077   0.384 1.00 . A A .  60 ALA HA   1 1 
        2  2583 1 1  60 ALA HB1  H   5.540  -3.207   0.490 1.00 . A A .  60 ALA HB1  1 1 
        2  2584 1 1  60 ALA HB2  H   4.147  -2.274  -0.105 1.00 . A A .  60 ALA HB2  1 1 
        2  2585 1 1  60 ALA HB3  H   4.300  -2.635   1.631 1.00 . A A .  60 ALA HB3  1 1 
        2  2586 1 1  60 ALA N    N   3.908  -5.190   1.561 1.00 . A A .  60 ALA N    1 1 
        2  2587 1 1  60 ALA O    O   3.231  -5.444  -1.643 1.00 . A A .  60 ALA O    1 1 
        2  2588 1 1  61 GLU C    C   5.075  -7.098  -2.538 1.00 . A A .  61 GLU C    1 1 
        2  2589 1 1  61 GLU CA   C   5.918  -5.863  -2.215 1.00 . A A .  61 GLU CA   1 1 
        2  2590 1 1  61 GLU CB   C   7.389  -6.237  -2.024 1.00 . A A .  61 GLU CB   1 1 
        2  2591 1 1  61 GLU CD   C   8.985  -7.887  -0.980 1.00 . A A .  61 GLU CD   1 1 
        2  2592 1 1  61 GLU CG   C   7.535  -7.402  -1.043 1.00 . A A .  61 GLU CG   1 1 
        2  2593 1 1  61 GLU H    H   6.088  -4.859  -0.398 1.00 . A A .  61 GLU H    1 1 
        2  2594 1 1  61 GLU HA   H   5.837  -5.137  -3.025 1.00 . A A .  61 GLU HA   1 1 
        2  2595 1 1  61 GLU HB2  H   7.827  -6.509  -2.985 1.00 . A A .  61 GLU HB2  1 1 
        2  2596 1 1  61 GLU HB3  H   7.943  -5.374  -1.654 1.00 . A A .  61 GLU HB3  1 1 
        2  2597 1 1  61 GLU HG2  H   7.209  -7.090  -0.051 1.00 . A A .  61 GLU HG2  1 1 
        2  2598 1 1  61 GLU HG3  H   6.886  -8.223  -1.348 1.00 . A A .  61 GLU HG3  1 1 
        2  2599 1 1  61 GLU N    N   5.395  -5.189  -1.039 1.00 . A A .  61 GLU N    1 1 
        2  2600 1 1  61 GLU O    O   4.799  -7.378  -3.704 1.00 . A A .  61 GLU O    1 1 
        2  2601 1 1  61 GLU OE1  O   9.878  -7.033  -1.170 1.00 . A A .  61 GLU OE1  1 1 
        2  2602 1 1  61 GLU OE2  O   9.167  -9.101  -0.743 1.00 . A A .  61 GLU OE2  1 1 
        2  2603 1 1  62 GLU C    C   2.524  -8.653  -2.248 1.00 . A A .  62 GLU C    1 1 
        2  2604 1 1  62 GLU CA   C   3.885  -9.003  -1.642 1.00 . A A .  62 GLU CA   1 1 
        2  2605 1 1  62 GLU CB   C   3.719  -9.731  -0.307 1.00 . A A .  62 GLU CB   1 1 
        2  2606 1 1  62 GLU CD   C   2.802 -11.955   0.450 1.00 . A A .  62 GLU CD   1 1 
        2  2607 1 1  62 GLU CG   C   2.518 -10.678  -0.344 1.00 . A A .  62 GLU CG   1 1 
        2  2608 1 1  62 GLU H    H   4.919  -7.570  -0.541 1.00 . A A .  62 GLU H    1 1 
        2  2609 1 1  62 GLU HA   H   4.443  -9.639  -2.329 1.00 . A A .  62 GLU HA   1 1 
        2  2610 1 1  62 GLU HB2  H   4.624 -10.294  -0.081 1.00 . A A .  62 GLU HB2  1 1 
        2  2611 1 1  62 GLU HB3  H   3.588  -9.003   0.494 1.00 . A A .  62 GLU HB3  1 1 
        2  2612 1 1  62 GLU HG2  H   1.642 -10.177   0.068 1.00 . A A .  62 GLU HG2  1 1 
        2  2613 1 1  62 GLU HG3  H   2.283 -10.932  -1.377 1.00 . A A .  62 GLU HG3  1 1 
        2  2614 1 1  62 GLU N    N   4.690  -7.804  -1.485 1.00 . A A .  62 GLU N    1 1 
        2  2615 1 1  62 GLU O    O   2.096  -9.272  -3.221 1.00 . A A .  62 GLU O    1 1 
        2  2616 1 1  62 GLU OE1  O   2.545 -11.932   1.673 1.00 . A A .  62 GLU OE1  1 1 
        2  2617 1 1  62 GLU OE2  O   3.269 -12.925  -0.185 1.00 . A A .  62 GLU OE2  1 1 
        2  2618 1 1  63 GLN C    C   0.609  -6.991  -3.629 1.00 . A A .  63 GLN C    1 1 
        2  2619 1 1  63 GLN CA   C   0.579  -7.220  -2.117 1.00 . A A .  63 GLN CA   1 1 
        2  2620 1 1  63 GLN CB   C   0.129  -5.958  -1.379 1.00 . A A .  63 GLN CB   1 1 
        2  2621 1 1  63 GLN CD   C  -2.354  -6.380  -1.505 1.00 . A A .  63 GLN CD   1 1 
        2  2622 1 1  63 GLN CG   C  -1.148  -6.217  -0.578 1.00 . A A .  63 GLN CG   1 1 
        2  2623 1 1  63 GLN H    H   2.238  -7.162  -0.858 1.00 . A A .  63 GLN H    1 1 
        2  2624 1 1  63 GLN HA   H  -0.104  -8.036  -1.880 1.00 . A A .  63 GLN HA   1 1 
        2  2625 1 1  63 GLN HB2  H   0.921  -5.622  -0.710 1.00 . A A .  63 GLN HB2  1 1 
        2  2626 1 1  63 GLN HB3  H  -0.044  -5.156  -2.096 1.00 . A A .  63 GLN HB3  1 1 
        2  2627 1 1  63 GLN HE21 H  -3.102  -4.654  -0.757 1.00 . A A .  63 GLN HE21 1 1 
        2  2628 1 1  63 GLN HE22 H  -4.076  -5.421  -1.967 1.00 . A A .  63 GLN HE22 1 1 
        2  2629 1 1  63 GLN HG2  H  -1.026  -7.116   0.027 1.00 . A A .  63 GLN HG2  1 1 
        2  2630 1 1  63 GLN HG3  H  -1.323  -5.391   0.111 1.00 . A A .  63 GLN HG3  1 1 
        2  2631 1 1  63 GLN N    N   1.883  -7.661  -1.648 1.00 . A A .  63 GLN N    1 1 
        2  2632 1 1  63 GLN NE2  N  -3.252  -5.405  -1.401 1.00 . A A .  63 GLN NE2  1 1 
        2  2633 1 1  63 GLN O    O  -0.313  -7.389  -4.340 1.00 . A A .  63 GLN O    1 1 
        2  2634 1 1  63 GLN OE1  O  -2.462  -7.329  -2.265 1.00 . A A .  63 GLN OE1  1 1 
        2  2635 1 1  64 GLN C    C   2.154  -7.345  -6.263 1.00 . A A .  64 GLN C    1 1 
        2  2636 1 1  64 GLN CA   C   1.840  -6.061  -5.492 1.00 . A A .  64 GLN CA   1 1 
        2  2637 1 1  64 GLN CB   C   2.926  -5.007  -5.717 1.00 . A A .  64 GLN CB   1 1 
        2  2638 1 1  64 GLN CD   C   3.783  -2.740  -5.020 1.00 . A A .  64 GLN CD   1 1 
        2  2639 1 1  64 GLN CG   C   2.616  -3.725  -4.941 1.00 . A A .  64 GLN CG   1 1 
        2  2640 1 1  64 GLN H    H   2.423  -6.028  -3.493 1.00 . A A .  64 GLN H    1 1 
        2  2641 1 1  64 GLN HA   H   0.880  -5.659  -5.818 1.00 . A A .  64 GLN HA   1 1 
        2  2642 1 1  64 GLN HB2  H   3.892  -5.402  -5.402 1.00 . A A .  64 GLN HB2  1 1 
        2  2643 1 1  64 GLN HB3  H   3.005  -4.782  -6.781 1.00 . A A .  64 GLN HB3  1 1 
        2  2644 1 1  64 GLN HE21 H   4.548  -3.583  -3.346 1.00 . A A .  64 GLN HE21 1 1 
        2  2645 1 1  64 GLN HE22 H   5.477  -2.281  -4.010 1.00 . A A .  64 GLN HE22 1 1 
        2  2646 1 1  64 GLN HG2  H   1.715  -3.261  -5.343 1.00 . A A .  64 GLN HG2  1 1 
        2  2647 1 1  64 GLN HG3  H   2.410  -3.968  -3.898 1.00 . A A .  64 GLN HG3  1 1 
        2  2648 1 1  64 GLN N    N   1.678  -6.348  -4.077 1.00 . A A .  64 GLN N    1 1 
        2  2649 1 1  64 GLN NE2  N   4.676  -2.880  -4.045 1.00 . A A .  64 GLN NE2  1 1 
        2  2650 1 1  64 GLN O    O   1.981  -7.401  -7.479 1.00 . A A .  64 GLN O    1 1 
        2  2651 1 1  64 GLN OE1  O   3.868  -1.908  -5.909 1.00 . A A .  64 GLN OE1  1 1 
        2  2652 1 1  65 ARG C    C   1.696 -10.488  -6.275 1.00 . A A .  65 ARG C    1 1 
        2  2653 1 1  65 ARG CA   C   2.950  -9.624  -6.121 1.00 . A A .  65 ARG CA   1 1 
        2  2654 1 1  65 ARG CB   C   3.976 -10.375  -5.269 1.00 . A A .  65 ARG CB   1 1 
        2  2655 1 1  65 ARG CD   C   5.074 -12.633  -5.035 1.00 . A A .  65 ARG CD   1 1 
        2  2656 1 1  65 ARG CG   C   3.785 -11.888  -5.387 1.00 . A A .  65 ARG CG   1 1 
        2  2657 1 1  65 ARG CZ   C   5.788 -15.013  -4.843 1.00 . A A .  65 ARG CZ   1 1 
        2  2658 1 1  65 ARG H    H   2.748  -8.290  -4.533 1.00 . A A .  65 ARG H    1 1 
        2  2659 1 1  65 ARG HA   H   3.376  -9.373  -7.092 1.00 . A A .  65 ARG HA   1 1 
        2  2660 1 1  65 ARG HB2  H   4.984 -10.106  -5.587 1.00 . A A .  65 ARG HB2  1 1 
        2  2661 1 1  65 ARG HB3  H   3.880 -10.072  -4.227 1.00 . A A .  65 ARG HB3  1 1 
        2  2662 1 1  65 ARG HD2  H   5.876 -12.326  -5.706 1.00 . A A .  65 ARG HD2  1 1 
        2  2663 1 1  65 ARG HD3  H   5.388 -12.375  -4.024 1.00 . A A .  65 ARG HD3  1 1 
        2  2664 1 1  65 ARG HE   H   3.965 -14.415  -5.451 1.00 . A A .  65 ARG HE   1 1 
        2  2665 1 1  65 ARG HG2  H   2.982 -12.209  -4.724 1.00 . A A .  65 ARG HG2  1 1 
        2  2666 1 1  65 ARG HG3  H   3.480 -12.142  -6.403 1.00 . A A .  65 ARG HG3  1 1 
        2  2667 1 1  65 ARG HH11 H   7.212 -13.655  -4.328 1.00 . A A .  65 ARG HH11 1 1 
        2  2668 1 1  65 ARG HH12 H   7.693 -15.314  -4.199 1.00 . A A .  65 ARG HH12 1 1 
        2  2669 1 1  65 ARG HH21 H   4.599 -16.604  -5.282 1.00 . A A .  65 ARG HH21 1 1 
        2  2670 1 1  65 ARG HH22 H   6.197 -17.003  -4.746 1.00 . A A .  65 ARG HH22 1 1 
        2  2671 1 1  65 ARG N    N   2.610  -8.344  -5.522 1.00 . A A .  65 ARG N    1 1 
        2  2672 1 1  65 ARG NE   N   4.859 -14.094  -5.140 1.00 . A A .  65 ARG NE   1 1 
        2  2673 1 1  65 ARG NH1  N   7.000 -14.628  -4.421 1.00 . A A .  65 ARG NH1  1 1 
        2  2674 1 1  65 ARG NH2  N   5.504 -16.317  -4.967 1.00 . A A .  65 ARG NH2  1 1 
        2  2675 1 1  65 ARG O    O   1.570 -11.237  -7.242 1.00 . A A .  65 ARG O    1 1 
        2  2676 1 1  66 GLN C    C  -1.486 -10.398  -6.180 1.00 . A A .  66 GLN C    1 1 
        2  2677 1 1  66 GLN CA   C  -0.438 -11.112  -5.323 1.00 . A A .  66 GLN CA   1 1 
        2  2678 1 1  66 GLN CB   C  -0.957 -11.344  -3.903 1.00 . A A .  66 GLN CB   1 1 
        2  2679 1 1  66 GLN CD   C  -0.390 -12.460  -1.714 1.00 . A A .  66 GLN CD   1 1 
        2  2680 1 1  66 GLN CG   C   0.171 -11.799  -2.975 1.00 . A A .  66 GLN CG   1 1 
        2  2681 1 1  66 GLN H    H   0.912  -9.741  -4.524 1.00 . A A .  66 GLN H    1 1 
        2  2682 1 1  66 GLN HA   H  -0.184 -12.072  -5.773 1.00 . A A .  66 GLN HA   1 1 
        2  2683 1 1  66 GLN HB2  H  -1.400 -10.425  -3.519 1.00 . A A .  66 GLN HB2  1 1 
        2  2684 1 1  66 GLN HB3  H  -1.746 -12.096  -3.919 1.00 . A A .  66 GLN HB3  1 1 
        2  2685 1 1  66 GLN HE21 H  -0.522 -10.626  -0.868 1.00 . A A .  66 GLN HE21 1 1 
        2  2686 1 1  66 GLN HE22 H  -1.051 -11.940   0.128 1.00 . A A .  66 GLN HE22 1 1 
        2  2687 1 1  66 GLN HG2  H   0.818 -12.501  -3.500 1.00 . A A .  66 GLN HG2  1 1 
        2  2688 1 1  66 GLN HG3  H   0.786 -10.944  -2.698 1.00 . A A .  66 GLN HG3  1 1 
        2  2689 1 1  66 GLN N    N   0.801 -10.353  -5.307 1.00 . A A .  66 GLN N    1 1 
        2  2690 1 1  66 GLN NE2  N  -0.678 -11.605  -0.737 1.00 . A A .  66 GLN NE2  1 1 
        2  2691 1 1  66 GLN O    O  -2.199 -11.036  -6.954 1.00 . A A .  66 GLN O    1 1 
        2  2692 1 1  66 GLN OE1  O  -0.551 -13.667  -1.633 1.00 . A A .  66 GLN OE1  1 1 
        2  2693 1 1  67 TYR C    C  -2.410  -8.582  -8.260 1.00 . A A .  67 TYR C    1 1 
        2  2694 1 1  67 TYR CA   C  -2.494  -8.279  -6.763 1.00 . A A .  67 TYR CA   1 1 
        2  2695 1 1  67 TYR CB   C  -2.089  -6.822  -6.526 1.00 . A A .  67 TYR CB   1 1 
        2  2696 1 1  67 TYR CD1  C  -2.435  -5.802  -8.805 1.00 . A A .  67 TYR CD1  1 1 
        2  2697 1 1  67 TYR CD2  C  -3.717  -4.951  -6.977 1.00 . A A .  67 TYR CD2  1 1 
        2  2698 1 1  67 TYR CE1  C  -3.075  -4.864  -9.691 1.00 . A A .  67 TYR CE1  1 1 
        2  2699 1 1  67 TYR CE2  C  -4.358  -4.014  -7.862 1.00 . A A .  67 TYR CE2  1 1 
        2  2700 1 1  67 TYR CG   C  -2.769  -5.826  -7.467 1.00 . A A .  67 TYR CG   1 1 
        2  2701 1 1  67 TYR CZ   C  -4.005  -4.016  -9.176 1.00 . A A .  67 TYR CZ   1 1 
        2  2702 1 1  67 TYR H    H  -0.962  -8.574  -5.383 1.00 . A A .  67 TYR H    1 1 
        2  2703 1 1  67 TYR HA   H  -3.496  -8.520  -6.407 1.00 . A A .  67 TYR HA   1 1 
        2  2704 1 1  67 TYR HB2  H  -2.325  -6.553  -5.496 1.00 . A A .  67 TYR HB2  1 1 
        2  2705 1 1  67 TYR HB3  H  -1.008  -6.734  -6.639 1.00 . A A .  67 TYR HB3  1 1 
        2  2706 1 1  67 TYR HD1  H  -1.686  -6.493  -9.192 1.00 . A A .  67 TYR HD1  1 1 
        2  2707 1 1  67 TYR HD2  H  -3.982  -4.970  -5.919 1.00 . A A .  67 TYR HD2  1 1 
        2  2708 1 1  67 TYR HE1  H  -2.820  -4.835 -10.750 1.00 . A A .  67 TYR HE1  1 1 
        2  2709 1 1  67 TYR HE2  H  -5.108  -3.317  -7.488 1.00 . A A .  67 TYR HE2  1 1 
        2  2710 1 1  67 TYR HH   H  -5.021  -3.615 -10.784 1.00 . A A .  67 TYR HH   1 1 
        2  2711 1 1  67 TYR N    N  -1.545  -9.085  -6.014 1.00 . A A .  67 TYR N    1 1 
        2  2712 1 1  67 TYR O    O  -3.351  -8.312  -9.006 1.00 . A A .  67 TYR O    1 1 
        2  2713 1 1  67 TYR OH   O  -4.610  -3.131 -10.012 1.00 . A A .  67 TYR OH   1 1 
        2  2714 1 1  68 LYS C    C  -1.882 -10.718 -10.403 1.00 . A A .  68 LYS C    1 1 
        2  2715 1 1  68 LYS CA   C  -1.055  -9.480 -10.051 1.00 . A A .  68 LYS CA   1 1 
        2  2716 1 1  68 LYS CB   C   0.440  -9.638 -10.335 1.00 . A A .  68 LYS CB   1 1 
        2  2717 1 1  68 LYS CD   C   1.817  -8.046 -11.724 1.00 . A A .  68 LYS CD   1 1 
        2  2718 1 1  68 LYS CE   C   2.316  -6.604 -11.848 1.00 . A A .  68 LYS CE   1 1 
        2  2719 1 1  68 LYS CG   C   1.137  -8.276 -10.373 1.00 . A A .  68 LYS CG   1 1 
        2  2720 1 1  68 LYS H    H  -0.514  -9.353  -8.043 1.00 . A A .  68 LYS H    1 1 
        2  2721 1 1  68 LYS HA   H  -1.411  -8.644 -10.652 1.00 . A A .  68 LYS HA   1 1 
        2  2722 1 1  68 LYS HB2  H   0.897 -10.263  -9.568 1.00 . A A .  68 LYS HB2  1 1 
        2  2723 1 1  68 LYS HB3  H   0.581 -10.149 -11.287 1.00 . A A .  68 LYS HB3  1 1 
        2  2724 1 1  68 LYS HD2  H   2.655  -8.735 -11.836 1.00 . A A .  68 LYS HD2  1 1 
        2  2725 1 1  68 LYS HD3  H   1.116  -8.262 -12.530 1.00 . A A .  68 LYS HD3  1 1 
        2  2726 1 1  68 LYS HE2  H   2.035  -6.199 -12.820 1.00 . A A .  68 LYS HE2  1 1 
        2  2727 1 1  68 LYS HE3  H   1.838  -5.982 -11.092 1.00 . A A .  68 LYS HE3  1 1 
        2  2728 1 1  68 LYS HG2  H   0.410  -7.486 -10.188 1.00 . A A .  68 LYS HG2  1 1 
        2  2729 1 1  68 LYS HG3  H   1.878  -8.220  -9.575 1.00 . A A .  68 LYS HG3  1 1 
        2  2730 1 1  68 LYS HZ1  H   4.100  -7.366 -11.203 1.00 . A A .  68 LYS HZ1  1 1 
        2  2731 1 1  68 LYS HZ2  H   4.219  -6.508 -12.588 1.00 . A A .  68 LYS HZ2  1 1 
        2  2732 1 1  68 LYS HZ3  H   4.033  -5.735 -11.162 1.00 . A A .  68 LYS HZ3  1 1 
        2  2733 1 1  68 LYS N    N  -1.274  -9.138  -8.656 1.00 . A A .  68 LYS N    1 1 
        2  2734 1 1  68 LYS NZ   N   3.786  -6.549 -11.687 1.00 . A A .  68 LYS NZ   1 1 
        2  2735 1 1  68 LYS O    O  -2.725 -10.672 -11.298 1.00 . A A .  68 LYS O    1 1 
        2  2736 1 1  69 VAL C    C  -3.820 -12.815  -9.724 1.00 . A A .  69 VAL C    1 1 
        2  2737 1 1  69 VAL CA   C  -2.319 -13.045  -9.908 1.00 . A A .  69 VAL CA   1 1 
        2  2738 1 1  69 VAL CB   C  -1.764 -14.135  -8.989 1.00 . A A .  69 VAL CB   1 1 
        2  2739 1 1  69 VAL CG1  C  -0.241 -14.036  -8.878 1.00 . A A .  69 VAL CG1  1 1 
        2  2740 1 1  69 VAL CG2  C  -2.420 -14.074  -7.608 1.00 . A A .  69 VAL CG2  1 1 
        2  2741 1 1  69 VAL H    H  -0.923 -11.826  -8.957 1.00 . A A .  69 VAL H    1 1 
        2  2742 1 1  69 VAL HA   H  -2.134 -13.346 -10.939 1.00 . A A .  69 VAL HA   1 1 
        2  2743 1 1  69 VAL HB   H  -2.005 -15.101  -9.432 1.00 . A A .  69 VAL HB   1 1 
        2  2744 1 1  69 VAL HG11 H   0.193 -15.034  -8.936 1.00 . A A .  69 VAL HG11 1 1 
        2  2745 1 1  69 VAL HG12 H   0.143 -13.424  -9.695 1.00 . A A .  69 VAL HG12 1 1 
        2  2746 1 1  69 VAL HG13 H   0.025 -13.578  -7.925 1.00 . A A .  69 VAL HG13 1 1 
        2  2747 1 1  69 VAL HG21 H  -2.151 -14.964  -7.039 1.00 . A A .  69 VAL HG21 1 1 
        2  2748 1 1  69 VAL HG22 H  -2.072 -13.186  -7.080 1.00 . A A .  69 VAL HG22 1 1 
        2  2749 1 1  69 VAL HG23 H  -3.503 -14.028  -7.722 1.00 . A A .  69 VAL HG23 1 1 
        2  2750 1 1  69 VAL N    N  -1.611 -11.797  -9.683 1.00 . A A .  69 VAL N    1 1 
        2  2751 1 1  69 VAL O    O  -4.631 -13.344 -10.483 1.00 . A A .  69 VAL O    1 1 
        2  2752 1 1  70 HIS C    C  -6.286 -11.440  -9.722 1.00 . A A .  70 HIS C    1 1 
        2  2753 1 1  70 HIS CA   C  -5.535 -11.719  -8.418 1.00 . A A .  70 HIS CA   1 1 
        2  2754 1 1  70 HIS CB   C  -5.638 -10.566  -7.417 1.00 . A A .  70 HIS CB   1 1 
        2  2755 1 1  70 HIS CD2  C  -4.225 -11.890  -5.662 1.00 . A A .  70 HIS CD2  1 1 
        2  2756 1 1  70 HIS CE1  C  -4.585 -10.598  -3.933 1.00 . A A .  70 HIS CE1  1 1 
        2  2757 1 1  70 HIS CG   C  -5.033 -10.869  -6.067 1.00 . A A .  70 HIS CG   1 1 
        2  2758 1 1  70 HIS H    H  -3.481 -11.599  -8.099 1.00 . A A .  70 HIS H    1 1 
        2  2759 1 1  70 HIS HA   H  -5.959 -12.606  -7.947 1.00 . A A .  70 HIS HA   1 1 
        2  2760 1 1  70 HIS HB2  H  -5.144  -9.689  -7.836 1.00 . A A .  70 HIS HB2  1 1 
        2  2761 1 1  70 HIS HB3  H  -6.688 -10.307  -7.283 1.00 . A A .  70 HIS HB3  1 1 
        2  2762 1 1  70 HIS HD1  H  -5.797  -9.240  -4.929 1.00 . A A .  70 HIS HD1  1 1 
        2  2763 1 1  70 HIS HD2  H  -3.862 -12.704  -6.290 1.00 . A A .  70 HIS HD2  1 1 
        2  2764 1 1  70 HIS HE1  H  -4.553 -10.201  -2.919 1.00 . A A .  70 HIS HE1  1 1 
        2  2765 1 1  70 HIS N    N  -4.146 -12.025  -8.711 1.00 . A A .  70 HIS N    1 1 
        2  2766 1 1  70 HIS ND1  N  -5.243 -10.072  -4.955 1.00 . A A .  70 HIS ND1  1 1 
        2  2767 1 1  70 HIS NE2  N  -3.954 -11.725  -4.373 1.00 . A A .  70 HIS NE2  1 1 
        2  2768 1 1  70 HIS O    O  -7.351 -12.007  -9.962 1.00 . A A .  70 HIS O    1 1 
        2  2769 1 1  71 LEU C    C  -6.615 -11.480 -12.592 1.00 . A A .  71 LEU C    1 1 
        2  2770 1 1  71 LEU CA   C  -6.301 -10.208 -11.803 1.00 . A A .  71 LEU CA   1 1 
        2  2771 1 1  71 LEU CB   C  -5.407  -9.221 -12.556 1.00 . A A .  71 LEU CB   1 1 
        2  2772 1 1  71 LEU CD1  C  -4.040  -7.102 -12.546 1.00 . A A .  71 LEU CD1  1 1 
        2  2773 1 1  71 LEU CD2  C  -6.484  -7.047 -11.869 1.00 . A A .  71 LEU CD2  1 1 
        2  2774 1 1  71 LEU CG   C  -5.190  -7.864 -11.884 1.00 . A A .  71 LEU CG   1 1 
        2  2775 1 1  71 LEU H    H  -4.834 -10.112 -10.326 1.00 . A A .  71 LEU H    1 1 
        2  2776 1 1  71 LEU HA   H  -7.238  -9.694 -11.588 1.00 . A A .  71 LEU HA   1 1 
        2  2777 1 1  71 LEU HB2  H  -4.433  -9.688 -12.710 1.00 . A A .  71 LEU HB2  1 1 
        2  2778 1 1  71 LEU HB3  H  -5.837  -9.051 -13.543 1.00 . A A .  71 LEU HB3  1 1 
        2  2779 1 1  71 LEU HD11 H  -4.070  -6.057 -12.235 1.00 . A A .  71 LEU HD11 1 1 
        2  2780 1 1  71 LEU HD12 H  -3.090  -7.543 -12.243 1.00 . A A .  71 LEU HD12 1 1 
        2  2781 1 1  71 LEU HD13 H  -4.140  -7.162 -13.629 1.00 . A A .  71 LEU HD13 1 1 
        2  2782 1 1  71 LEU HD21 H  -6.737  -6.747 -12.886 1.00 . A A .  71 LEU HD21 1 1 
        2  2783 1 1  71 LEU HD22 H  -7.291  -7.654 -11.457 1.00 . A A .  71 LEU HD22 1 1 
        2  2784 1 1  71 LEU HD23 H  -6.346  -6.160 -11.252 1.00 . A A .  71 LEU HD23 1 1 
        2  2785 1 1  71 LEU HG   H  -4.907  -8.038 -10.846 1.00 . A A .  71 LEU HG   1 1 
        2  2786 1 1  71 LEU N    N  -5.701 -10.568 -10.529 1.00 . A A .  71 LEU N    1 1 
        2  2787 1 1  71 LEU O    O  -7.722 -11.642 -13.101 1.00 . A A .  71 LEU O    1 1 
        2  2788 1 1  72 ASP C    C  -6.969 -14.371 -12.815 1.00 . A A .  72 ASP C    1 1 
        2  2789 1 1  72 ASP CA   C  -5.775 -13.604 -13.388 1.00 . A A .  72 ASP CA   1 1 
        2  2790 1 1  72 ASP CB   C  -4.532 -14.484 -13.237 1.00 . A A .  72 ASP CB   1 1 
        2  2791 1 1  72 ASP CG   C  -3.696 -14.645 -14.509 1.00 . A A .  72 ASP CG   1 1 
        2  2792 1 1  72 ASP H    H  -4.721 -12.212 -12.252 1.00 . A A .  72 ASP H    1 1 
        2  2793 1 1  72 ASP HA   H  -5.923 -13.320 -14.430 1.00 . A A .  72 ASP HA   1 1 
        2  2794 1 1  72 ASP HB2  H  -3.900 -14.063 -12.456 1.00 . A A .  72 ASP HB2  1 1 
        2  2795 1 1  72 ASP HB3  H  -4.843 -15.472 -12.898 1.00 . A A .  72 ASP HB3  1 1 
        2  2796 1 1  72 ASP N    N  -5.619 -12.351 -12.669 1.00 . A A .  72 ASP N    1 1 
        2  2797 1 1  72 ASP O    O  -7.790 -14.897 -13.564 1.00 . A A .  72 ASP O    1 1 
        2  2798 1 1  72 ASP OD1  O  -3.853 -13.786 -15.404 1.00 . A A .  72 ASP OD1  1 1 
        2  2799 1 1  72 ASP OD2  O  -2.919 -15.622 -14.557 1.00 . A A .  72 ASP OD2  1 1 
        2  2800 1 1  73 LEU C    C  -9.428 -14.386 -11.096 1.00 . A A .  73 LEU C    1 1 
        2  2801 1 1  73 LEU CA   C  -8.106 -15.102 -10.810 1.00 . A A .  73 LEU CA   1 1 
        2  2802 1 1  73 LEU CB   C  -7.794 -15.245  -9.319 1.00 . A A .  73 LEU CB   1 1 
        2  2803 1 1  73 LEU CD1  C  -6.192 -15.916  -7.491 1.00 . A A .  73 LEU CD1  1 1 
        2  2804 1 1  73 LEU CD2  C  -5.735 -16.581  -9.896 1.00 . A A .  73 LEU CD2  1 1 
        2  2805 1 1  73 LEU CG   C  -6.333 -15.526  -8.964 1.00 . A A .  73 LEU CG   1 1 
        2  2806 1 1  73 LEU H    H  -6.355 -13.978 -10.890 1.00 . A A .  73 LEU H    1 1 
        2  2807 1 1  73 LEU HA   H  -8.162 -16.109 -11.225 1.00 . A A .  73 LEU HA   1 1 
        2  2808 1 1  73 LEU HB2  H  -8.100 -14.329  -8.814 1.00 . A A .  73 LEU HB2  1 1 
        2  2809 1 1  73 LEU HB3  H  -8.407 -16.051  -8.915 1.00 . A A .  73 LEU HB3  1 1 
        2  2810 1 1  73 LEU HD11 H  -5.466 -16.724  -7.397 1.00 . A A .  73 LEU HD11 1 1 
        2  2811 1 1  73 LEU HD12 H  -5.851 -15.053  -6.918 1.00 . A A .  73 LEU HD12 1 1 
        2  2812 1 1  73 LEU HD13 H  -7.157 -16.248  -7.109 1.00 . A A .  73 LEU HD13 1 1 
        2  2813 1 1  73 LEU HD21 H  -4.648 -16.502  -9.884 1.00 . A A .  73 LEU HD21 1 1 
        2  2814 1 1  73 LEU HD22 H  -6.030 -17.574  -9.557 1.00 . A A .  73 LEU HD22 1 1 
        2  2815 1 1  73 LEU HD23 H  -6.100 -16.419 -10.910 1.00 . A A .  73 LEU HD23 1 1 
        2  2816 1 1  73 LEU HG   H  -5.763 -14.608  -9.109 1.00 . A A .  73 LEU HG   1 1 
        2  2817 1 1  73 LEU N    N  -7.027 -14.409 -11.492 1.00 . A A .  73 LEU N    1 1 
        2  2818 1 1  73 LEU O    O -10.447 -15.030 -11.339 1.00 . A A .  73 LEU O    1 1 
        2  2819 1 1  74 TRP C    C -10.992 -12.500 -12.750 1.00 . A A .  74 TRP C    1 1 
        2  2820 1 1  74 TRP CA   C -10.546 -12.252 -11.307 1.00 . A A .  74 TRP CA   1 1 
        2  2821 1 1  74 TRP CB   C -10.270 -10.776 -11.013 1.00 . A A .  74 TRP CB   1 1 
        2  2822 1 1  74 TRP CD1  C -12.405  -9.380 -11.405 1.00 . A A .  74 TRP CD1  1 1 
        2  2823 1 1  74 TRP CD2  C -10.909  -9.164 -13.025 1.00 . A A .  74 TRP CD2  1 1 
        2  2824 1 1  74 TRP CE2  C -11.991  -8.374 -13.354 1.00 . A A .  74 TRP CE2  1 1 
        2  2825 1 1  74 TRP CE3  C  -9.780  -9.246 -13.859 1.00 . A A .  74 TRP CE3  1 1 
        2  2826 1 1  74 TRP CG   C -11.187  -9.809 -11.764 1.00 . A A .  74 TRP CG   1 1 
        2  2827 1 1  74 TRP CH2  C -10.938  -7.671 -15.369 1.00 . A A .  74 TRP CH2  1 1 
        2  2828 1 1  74 TRP CZ2  C -12.051  -7.605 -14.523 1.00 . A A .  74 TRP CZ2  1 1 
        2  2829 1 1  74 TRP CZ3  C  -9.855  -8.471 -15.023 1.00 . A A .  74 TRP CZ3  1 1 
        2  2830 1 1  74 TRP H    H  -8.534 -12.547 -10.857 1.00 . A A .  74 TRP H    1 1 
        2  2831 1 1  74 TRP HA   H -11.325 -12.573 -10.616 1.00 . A A .  74 TRP HA   1 1 
        2  2832 1 1  74 TRP HB2  H -10.377 -10.604  -9.942 1.00 . A A .  74 TRP HB2  1 1 
        2  2833 1 1  74 TRP HB3  H  -9.235 -10.553 -11.270 1.00 . A A .  74 TRP HB3  1 1 
        2  2834 1 1  74 TRP HD1  H -12.917  -9.681 -10.491 1.00 . A A .  74 TRP HD1  1 1 
        2  2835 1 1  74 TRP HE1  H -13.902  -8.018 -12.288 1.00 . A A .  74 TRP HE1  1 1 
        2  2836 1 1  74 TRP HE3  H  -8.913  -9.862 -13.621 1.00 . A A .  74 TRP HE3  1 1 
        2  2837 1 1  74 TRP HH2  H -10.919  -7.096 -16.295 1.00 . A A .  74 TRP HH2  1 1 
        2  2838 1 1  74 TRP HZ2  H -12.918  -6.989 -14.761 1.00 . A A .  74 TRP HZ2  1 1 
        2  2839 1 1  74 TRP HZ3  H  -9.006  -8.498 -15.705 1.00 . A A .  74 TRP HZ3  1 1 
        2  2840 1 1  74 TRP N    N  -9.367 -13.063 -11.056 1.00 . A A .  74 TRP N    1 1 
        2  2841 1 1  74 TRP NE1  N -12.930  -8.509 -12.338 1.00 . A A .  74 TRP NE1  1 1 
        2  2842 1 1  74 TRP O    O -12.181 -12.430 -13.057 1.00 . A A .  74 TRP O    1 1 
        2  2843 1 1  75 VAL C    C -11.032 -14.377 -15.131 1.00 . A A .  75 VAL C    1 1 
        2  2844 1 1  75 VAL CA   C -10.290 -13.045 -15.000 1.00 . A A .  75 VAL CA   1 1 
        2  2845 1 1  75 VAL CB   C  -8.991 -13.002 -15.806 1.00 . A A .  75 VAL CB   1 1 
        2  2846 1 1  75 VAL CG1  C  -9.205 -13.545 -17.220 1.00 . A A .  75 VAL CG1  1 1 
        2  2847 1 1  75 VAL CG2  C  -8.415 -11.585 -15.843 1.00 . A A .  75 VAL CG2  1 1 
        2  2848 1 1  75 VAL H    H  -9.049 -12.841 -13.339 1.00 . A A .  75 VAL H    1 1 
        2  2849 1 1  75 VAL HA   H -10.938 -12.246 -15.360 1.00 . A A .  75 VAL HA   1 1 
        2  2850 1 1  75 VAL HB   H  -8.265 -13.645 -15.307 1.00 . A A .  75 VAL HB   1 1 
        2  2851 1 1  75 VAL HG11 H -10.013 -12.995 -17.702 1.00 . A A .  75 VAL HG11 1 1 
        2  2852 1 1  75 VAL HG12 H  -8.288 -13.425 -17.798 1.00 . A A .  75 VAL HG12 1 1 
        2  2853 1 1  75 VAL HG13 H  -9.466 -14.602 -17.168 1.00 . A A .  75 VAL HG13 1 1 
        2  2854 1 1  75 VAL HG21 H  -7.484 -11.556 -15.277 1.00 . A A .  75 VAL HG21 1 1 
        2  2855 1 1  75 VAL HG22 H  -8.221 -11.299 -16.877 1.00 . A A .  75 VAL HG22 1 1 
        2  2856 1 1  75 VAL HG23 H  -9.130 -10.891 -15.403 1.00 . A A .  75 VAL HG23 1 1 
        2  2857 1 1  75 VAL N    N -10.014 -12.786 -13.597 1.00 . A A .  75 VAL N    1 1 
        2  2858 1 1  75 VAL O    O -12.077 -14.448 -15.776 1.00 . A A .  75 VAL O    1 1 
        2  2859 1 1  76 LYS C    C -12.539 -16.625 -14.185 1.00 . A A .  76 LYS C    1 1 
        2  2860 1 1  76 LYS CA   C -11.056 -16.724 -14.549 1.00 . A A .  76 LYS CA   1 1 
        2  2861 1 1  76 LYS CB   C -10.268 -17.691 -13.663 1.00 . A A .  76 LYS CB   1 1 
        2  2862 1 1  76 LYS CD   C  -7.853 -18.365 -13.394 1.00 . A A .  76 LYS CD   1 1 
        2  2863 1 1  76 LYS CE   C  -6.621 -17.581 -13.850 1.00 . A A .  76 LYS CE   1 1 
        2  2864 1 1  76 LYS CG   C  -9.011 -18.189 -14.379 1.00 . A A .  76 LYS CG   1 1 
        2  2865 1 1  76 LYS H    H  -9.612 -15.332 -13.988 1.00 . A A .  76 LYS H    1 1 
        2  2866 1 1  76 LYS HA   H -10.976 -17.088 -15.574 1.00 . A A .  76 LYS HA   1 1 
        2  2867 1 1  76 LYS HB2  H  -9.990 -17.195 -12.734 1.00 . A A .  76 LYS HB2  1 1 
        2  2868 1 1  76 LYS HB3  H -10.898 -18.539 -13.395 1.00 . A A .  76 LYS HB3  1 1 
        2  2869 1 1  76 LYS HD2  H  -8.158 -18.025 -12.404 1.00 . A A .  76 LYS HD2  1 1 
        2  2870 1 1  76 LYS HD3  H  -7.604 -19.422 -13.305 1.00 . A A .  76 LYS HD3  1 1 
        2  2871 1 1  76 LYS HE2  H  -6.925 -16.762 -14.502 1.00 . A A .  76 LYS HE2  1 1 
        2  2872 1 1  76 LYS HE3  H  -6.126 -17.135 -12.988 1.00 . A A .  76 LYS HE3  1 1 
        2  2873 1 1  76 LYS HG2  H  -9.220 -19.138 -14.872 1.00 . A A .  76 LYS HG2  1 1 
        2  2874 1 1  76 LYS HG3  H  -8.726 -17.482 -15.157 1.00 . A A .  76 LYS HG3  1 1 
        2  2875 1 1  76 LYS HZ1  H  -5.243 -19.089 -13.914 1.00 . A A .  76 LYS HZ1  1 1 
        2  2876 1 1  76 LYS HZ2  H  -6.177 -19.001 -15.251 1.00 . A A .  76 LYS HZ2  1 1 
        2  2877 1 1  76 LYS HZ3  H  -4.979 -17.916 -15.020 1.00 . A A .  76 LYS HZ3  1 1 
        2  2878 1 1  76 LYS N    N -10.462 -15.399 -14.510 1.00 . A A .  76 LYS N    1 1 
        2  2879 1 1  76 LYS NZ   N  -5.678 -18.469 -14.567 1.00 . A A .  76 LYS NZ   1 1 
        2  2880 1 1  76 LYS O    O -13.332 -17.490 -14.553 1.00 . A A .  76 LYS O    1 1 
        2  2881 1 1  77 SER C    C -14.996 -14.555 -14.122 1.00 . A A .  77 SER C    1 1 
        2  2882 1 1  77 SER CA   C -14.242 -15.339 -13.046 1.00 . A A .  77 SER CA   1 1 
        2  2883 1 1  77 SER CB   C -14.296 -14.595 -11.710 1.00 . A A .  77 SER CB   1 1 
        2  2884 1 1  77 SER H    H -12.217 -14.864 -13.169 1.00 . A A .  77 SER H    1 1 
        2  2885 1 1  77 SER HA   H -14.672 -16.333 -12.925 1.00 . A A .  77 SER HA   1 1 
        2  2886 1 1  77 SER HB2  H -13.808 -15.194 -10.942 1.00 . A A .  77 SER HB2  1 1 
        2  2887 1 1  77 SER HB3  H -13.737 -13.663 -11.791 1.00 . A A .  77 SER HB3  1 1 
        2  2888 1 1  77 SER HG   H -16.256 -15.001 -11.684 1.00 . A A .  77 SER HG   1 1 
        2  2889 1 1  77 SER N    N -12.868 -15.563 -13.465 1.00 . A A .  77 SER N    1 1 
        2  2890 1 1  77 SER O    O -16.197 -14.744 -14.306 1.00 . A A .  77 SER O    1 1 
        2  2891 1 1  77 SER OG   O -15.634 -14.311 -11.312 1.00 . A A .  77 SER OG   1 1 
        2  2892 1 1  78 LEU C    C -15.634 -13.774 -16.810 1.00 . A A .  78 LEU C    1 1 
        2  2893 1 1  78 LEU CA   C -14.843 -12.876 -15.856 1.00 . A A .  78 LEU CA   1 1 
        2  2894 1 1  78 LEU CB   C -13.764 -12.042 -16.550 1.00 . A A .  78 LEU CB   1 1 
        2  2895 1 1  78 LEU CD1  C -12.406  -9.920 -16.672 1.00 . A A .  78 LEU CD1  1 1 
        2  2896 1 1  78 LEU CD2  C -14.425 -10.057 -15.142 1.00 . A A .  78 LEU CD2  1 1 
        2  2897 1 1  78 LEU CG   C -13.262 -10.820 -15.778 1.00 . A A .  78 LEU CG   1 1 
        2  2898 1 1  78 LEU H    H -13.283 -13.542 -14.648 1.00 . A A .  78 LEU H    1 1 
        2  2899 1 1  78 LEU HA   H -15.536 -12.179 -15.384 1.00 . A A .  78 LEU HA   1 1 
        2  2900 1 1  78 LEU HB2  H -12.913 -12.689 -16.761 1.00 . A A .  78 LEU HB2  1 1 
        2  2901 1 1  78 LEU HB3  H -14.155 -11.705 -17.510 1.00 . A A .  78 LEU HB3  1 1 
        2  2902 1 1  78 LEU HD11 H -12.771  -8.895 -16.610 1.00 . A A .  78 LEU HD11 1 1 
        2  2903 1 1  78 LEU HD12 H -11.369  -9.958 -16.339 1.00 . A A .  78 LEU HD12 1 1 
        2  2904 1 1  78 LEU HD13 H -12.470 -10.267 -17.703 1.00 . A A .  78 LEU HD13 1 1 
        2  2905 1 1  78 LEU HD21 H -14.131  -9.020 -14.974 1.00 . A A .  78 LEU HD21 1 1 
        2  2906 1 1  78 LEU HD22 H -15.287 -10.086 -15.809 1.00 . A A .  78 LEU HD22 1 1 
        2  2907 1 1  78 LEU HD23 H -14.687 -10.519 -14.190 1.00 . A A .  78 LEU HD23 1 1 
        2  2908 1 1  78 LEU HG   H -12.623 -11.168 -14.966 1.00 . A A .  78 LEU HG   1 1 
        2  2909 1 1  78 LEU N    N -14.259 -13.690 -14.804 1.00 . A A .  78 LEU N    1 1 
        2  2910 1 1  78 LEU O    O -15.094 -14.736 -17.354 1.00 . A A .  78 LEU O    1 1 
        2  2911 1 1  79 SER C    C -17.094 -14.398 -19.219 1.00 . A A .  79 SER C    1 1 
        2  2912 1 1  79 SER CA   C -17.771 -14.190 -17.863 1.00 . A A .  79 SER CA   1 1 
        2  2913 1 1  79 SER CB   C -19.120 -13.491 -18.045 1.00 . A A .  79 SER CB   1 1 
        2  2914 1 1  79 SER H    H -17.333 -12.644 -16.538 1.00 . A A .  79 SER H    1 1 
        2  2915 1 1  79 SER HA   H -17.923 -15.146 -17.360 1.00 . A A .  79 SER HA   1 1 
        2  2916 1 1  79 SER HB2  H -19.151 -12.595 -17.423 1.00 . A A .  79 SER HB2  1 1 
        2  2917 1 1  79 SER HB3  H -19.222 -13.164 -19.079 1.00 . A A .  79 SER HB3  1 1 
        2  2918 1 1  79 SER HG   H -21.078 -13.875 -17.887 1.00 . A A .  79 SER HG   1 1 
        2  2919 1 1  79 SER N    N -16.901 -13.428 -16.984 1.00 . A A .  79 SER N    1 1 
        2  2920 1 1  79 SER O    O -15.976 -13.934 -19.436 1.00 . A A .  79 SER O    1 1 
        2  2921 1 1  79 SER OG   O -20.212 -14.341 -17.705 1.00 . A A .  79 SER OG   1 1 
        2  2922 1 1  80 PRO C    C -17.368 -14.142 -22.333 1.00 . A A .  80 PRO C    1 1 
        2  2923 1 1  80 PRO CA   C -17.300 -15.389 -21.449 1.00 . A A .  80 PRO CA   1 1 
        2  2924 1 1  80 PRO CB   C -18.148 -16.536 -21.973 1.00 . A A .  80 PRO CB   1 1 
        2  2925 1 1  80 PRO CD   C -19.146 -15.679 -19.898 1.00 . A A .  80 PRO CD   1 1 
        2  2926 1 1  80 PRO CG   C -19.403 -16.552 -21.115 1.00 . A A .  80 PRO CG   1 1 
        2  2927 1 1  80 PRO HA   H -16.332 -15.636 -21.399 1.00 . A A .  80 PRO HA   1 1 
        2  2928 1 1  80 PRO HB2  H -18.396 -16.390 -23.024 1.00 . A A .  80 PRO HB2  1 1 
        2  2929 1 1  80 PRO HB3  H -17.612 -17.482 -21.900 1.00 . A A .  80 PRO HB3  1 1 
        2  2930 1 1  80 PRO HD2  H -19.900 -14.896 -19.806 1.00 . A A .  80 PRO HD2  1 1 
        2  2931 1 1  80 PRO HD3  H -19.180 -16.262 -18.978 1.00 . A A .  80 PRO HD3  1 1 
        2  2932 1 1  80 PRO HG2  H -20.256 -16.179 -21.680 1.00 . A A .  80 PRO HG2  1 1 
        2  2933 1 1  80 PRO HG3  H -19.643 -17.571 -20.810 1.00 . A A .  80 PRO HG3  1 1 
        2  2934 1 1  80 PRO N    N -17.819 -15.114 -20.120 1.00 . A A .  80 PRO N    1 1 
        2  2935 1 1  80 PRO O    O -16.727 -14.083 -23.380 1.00 . A A .  80 PRO O    1 1 
        2  2936 1 1  81 GLN C    C -17.330 -10.879 -22.099 1.00 . A A .  81 GLN C    1 1 
        2  2937 1 1  81 GLN CA   C -18.313 -11.933 -22.614 1.00 . A A .  81 GLN CA   1 1 
        2  2938 1 1  81 GLN CB   C -19.754 -11.427 -22.528 1.00 . A A .  81 GLN CB   1 1 
        2  2939 1 1  81 GLN CD   C -21.306  -9.663 -23.443 1.00 . A A .  81 GLN CD   1 1 
        2  2940 1 1  81 GLN CG   C -19.865  -9.994 -23.052 1.00 . A A .  81 GLN CG   1 1 
        2  2941 1 1  81 GLN H    H -18.670 -13.231 -21.024 1.00 . A A .  81 GLN H    1 1 
        2  2942 1 1  81 GLN HA   H -18.082 -12.179 -23.651 1.00 . A A .  81 GLN HA   1 1 
        2  2943 1 1  81 GLN HB2  H -20.408 -12.081 -23.105 1.00 . A A .  81 GLN HB2  1 1 
        2  2944 1 1  81 GLN HB3  H -20.096 -11.467 -21.494 1.00 . A A .  81 GLN HB3  1 1 
        2  2945 1 1  81 GLN HE21 H -20.608  -8.080 -24.495 1.00 . A A .  81 GLN HE21 1 1 
        2  2946 1 1  81 GLN HE22 H -22.327  -8.292 -24.529 1.00 . A A .  81 GLN HE22 1 1 
        2  2947 1 1  81 GLN HG2  H -19.522  -9.296 -22.289 1.00 . A A .  81 GLN HG2  1 1 
        2  2948 1 1  81 GLN HG3  H -19.212  -9.868 -23.916 1.00 . A A .  81 GLN HG3  1 1 
        2  2949 1 1  81 GLN N    N -18.152 -13.175 -21.878 1.00 . A A .  81 GLN N    1 1 
        2  2950 1 1  81 GLN NE2  N -21.423  -8.590 -24.220 1.00 . A A .  81 GLN NE2  1 1 
        2  2951 1 1  81 GLN O    O -16.593 -10.278 -22.879 1.00 . A A .  81 GLN O    1 1 
        2  2952 1 1  81 GLN OE1  O -22.250 -10.337 -23.065 1.00 . A A .  81 GLN OE1  1 1 
        2  2953 1 1  82 ASP C    C -15.023 -10.026 -20.542 1.00 . A A .  82 ASP C    1 1 
        2  2954 1 1  82 ASP CA   C -16.472  -9.717 -20.159 1.00 . A A .  82 ASP CA   1 1 
        2  2955 1 1  82 ASP CB   C -16.582  -9.780 -18.634 1.00 . A A .  82 ASP CB   1 1 
        2  2956 1 1  82 ASP CG   C -17.837  -9.129 -18.049 1.00 . A A .  82 ASP CG   1 1 
        2  2957 1 1  82 ASP H    H -17.954 -11.181 -20.160 1.00 . A A .  82 ASP H    1 1 
        2  2958 1 1  82 ASP HA   H -16.803  -8.747 -20.530 1.00 . A A .  82 ASP HA   1 1 
        2  2959 1 1  82 ASP HB2  H -16.555 -10.825 -18.326 1.00 . A A .  82 ASP HB2  1 1 
        2  2960 1 1  82 ASP HB3  H -15.705  -9.298 -18.202 1.00 . A A .  82 ASP HB3  1 1 
        2  2961 1 1  82 ASP N    N -17.351 -10.688 -20.788 1.00 . A A .  82 ASP N    1 1 
        2  2962 1 1  82 ASP O    O -14.307  -9.154 -21.032 1.00 . A A .  82 ASP O    1 1 
        2  2963 1 1  82 ASP OD1  O -17.762  -7.917 -17.755 1.00 . A A .  82 ASP OD1  1 1 
        2  2964 1 1  82 ASP OD2  O -18.842  -9.859 -17.910 1.00 . A A .  82 ASP OD2  1 1 
        2  2965 1 1  83 ARG C    C -12.987 -11.490 -22.101 1.00 . A A .  83 ARG C    1 1 
        2  2966 1 1  83 ARG CA   C -13.283 -11.704 -20.615 1.00 . A A .  83 ARG CA   1 1 
        2  2967 1 1  83 ARG CB   C -13.085 -13.181 -20.270 1.00 . A A .  83 ARG CB   1 1 
        2  2968 1 1  83 ARG CD   C -11.643 -14.707 -18.873 1.00 . A A .  83 ARG CD   1 1 
        2  2969 1 1  83 ARG CG   C -11.680 -13.433 -19.720 1.00 . A A .  83 ARG CG   1 1 
        2  2970 1 1  83 ARG CZ   C -10.943 -16.436 -20.525 1.00 . A A .  83 ARG CZ   1 1 
        2  2971 1 1  83 ARG H    H -15.221 -11.973 -19.903 1.00 . A A .  83 ARG H    1 1 
        2  2972 1 1  83 ARG HA   H -12.638 -11.082 -19.994 1.00 . A A .  83 ARG HA   1 1 
        2  2973 1 1  83 ARG HB2  H -13.828 -13.489 -19.535 1.00 . A A .  83 ARG HB2  1 1 
        2  2974 1 1  83 ARG HB3  H -13.246 -13.791 -21.160 1.00 . A A .  83 ARG HB3  1 1 
        2  2975 1 1  83 ARG HD2  H -11.353 -14.465 -17.850 1.00 . A A .  83 ARG HD2  1 1 
        2  2976 1 1  83 ARG HD3  H -12.637 -15.151 -18.826 1.00 . A A .  83 ARG HD3  1 1 
        2  2977 1 1  83 ARG HE   H  -9.788 -15.763 -19.020 1.00 . A A .  83 ARG HE   1 1 
        2  2978 1 1  83 ARG HG2  H -10.973 -13.520 -20.545 1.00 . A A .  83 ARG HG2  1 1 
        2  2979 1 1  83 ARG HG3  H -11.364 -12.582 -19.118 1.00 . A A .  83 ARG HG3  1 1 
        2  2980 1 1  83 ARG HH11 H -12.825 -15.715 -20.797 1.00 . A A .  83 ARG HH11 1 1 
        2  2981 1 1  83 ARG HH12 H -12.324 -16.918 -21.938 1.00 . A A .  83 ARG HH12 1 1 
        2  2982 1 1  83 ARG HH21 H  -9.127 -17.351 -20.525 1.00 . A A .  83 ARG HH21 1 1 
        2  2983 1 1  83 ARG HH22 H -10.207 -17.855 -21.782 1.00 . A A .  83 ARG HH22 1 1 
        2  2984 1 1  83 ARG N    N -14.633 -11.269 -20.302 1.00 . A A .  83 ARG N    1 1 
        2  2985 1 1  83 ARG NE   N -10.685 -15.674 -19.454 1.00 . A A .  83 ARG NE   1 1 
        2  2986 1 1  83 ARG NH1  N -12.132 -16.349 -21.138 1.00 . A A .  83 ARG NH1  1 1 
        2  2987 1 1  83 ARG NH2  N -10.014 -17.286 -20.983 1.00 . A A .  83 ARG NH2  1 1 
        2  2988 1 1  83 ARG O    O -11.915 -11.009 -22.462 1.00 . A A .  83 ARG O    1 1 
        2  2989 1 1  84 ALA C    C -13.340 -10.296 -24.683 1.00 . A A .  84 ALA C    1 1 
        2  2990 1 1  84 ALA CA   C -13.816 -11.715 -24.362 1.00 . A A .  84 ALA CA   1 1 
        2  2991 1 1  84 ALA CB   C -15.144 -12.051 -25.043 1.00 . A A .  84 ALA CB   1 1 
        2  2992 1 1  84 ALA H    H -14.828 -12.251 -22.622 1.00 . A A .  84 ALA H    1 1 
        2  2993 1 1  84 ALA HA   H -13.061 -12.427 -24.695 1.00 . A A .  84 ALA HA   1 1 
        2  2994 1 1  84 ALA HB1  H -15.968 -11.824 -24.367 1.00 . A A .  84 ALA HB1  1 1 
        2  2995 1 1  84 ALA HB2  H -15.247 -11.459 -25.953 1.00 . A A .  84 ALA HB2  1 1 
        2  2996 1 1  84 ALA HB3  H -15.164 -13.112 -25.296 1.00 . A A .  84 ALA HB3  1 1 
        2  2997 1 1  84 ALA N    N -13.958 -11.860 -22.924 1.00 . A A .  84 ALA N    1 1 
        2  2998 1 1  84 ALA O    O -12.475 -10.106 -25.537 1.00 . A A .  84 ALA O    1 1 
        2  2999 1 1  85 ALA C    C -12.209  -7.669 -23.539 1.00 . A A .  85 ALA C    1 1 
        2  3000 1 1  85 ALA CA   C -13.571  -7.942 -24.180 1.00 . A A .  85 ALA CA   1 1 
        2  3001 1 1  85 ALA CB   C -14.674  -7.049 -23.608 1.00 . A A .  85 ALA CB   1 1 
        2  3002 1 1  85 ALA H    H -14.627  -9.500 -23.288 1.00 . A A .  85 ALA H    1 1 
        2  3003 1 1  85 ALA HA   H -13.500  -7.768 -25.254 1.00 . A A .  85 ALA HA   1 1 
        2  3004 1 1  85 ALA HB1  H -15.586  -7.180 -24.190 1.00 . A A .  85 ALA HB1  1 1 
        2  3005 1 1  85 ALA HB2  H -14.862  -7.323 -22.571 1.00 . A A .  85 ALA HB2  1 1 
        2  3006 1 1  85 ALA HB3  H -14.359  -6.006 -23.657 1.00 . A A .  85 ALA HB3  1 1 
        2  3007 1 1  85 ALA N    N -13.925  -9.337 -23.981 1.00 . A A .  85 ALA N    1 1 
        2  3008 1 1  85 ALA O    O -11.291  -7.191 -24.204 1.00 . A A .  85 ALA O    1 1 
        2  3009 1 1  86 TYR C    C  -9.692  -8.370 -22.271 1.00 . A A .  86 TYR C    1 1 
        2  3010 1 1  86 TYR CA   C -10.886  -7.780 -21.517 1.00 . A A .  86 TYR CA   1 1 
        2  3011 1 1  86 TYR CB   C -11.057  -8.527 -20.193 1.00 . A A .  86 TYR CB   1 1 
        2  3012 1 1  86 TYR CD1  C  -9.437  -7.544 -18.530 1.00 . A A .  86 TYR CD1  1 1 
        2  3013 1 1  86 TYR CD2  C  -8.978  -9.719 -19.409 1.00 . A A .  86 TYR CD2  1 1 
        2  3014 1 1  86 TYR CE1  C  -8.238  -7.612 -17.736 1.00 . A A .  86 TYR CE1  1 1 
        2  3015 1 1  86 TYR CE2  C  -7.779  -9.787 -18.616 1.00 . A A .  86 TYR CE2  1 1 
        2  3016 1 1  86 TYR CG   C  -9.783  -8.599 -19.350 1.00 . A A .  86 TYR CG   1 1 
        2  3017 1 1  86 TYR CZ   C  -7.468  -8.730 -17.818 1.00 . A A .  86 TYR CZ   1 1 
        2  3018 1 1  86 TYR H    H -12.872  -8.374 -21.722 1.00 . A A .  86 TYR H    1 1 
        2  3019 1 1  86 TYR HA   H -10.738  -6.706 -21.401 1.00 . A A .  86 TYR HA   1 1 
        2  3020 1 1  86 TYR HB2  H -11.839  -8.039 -19.611 1.00 . A A .  86 TYR HB2  1 1 
        2  3021 1 1  86 TYR HB3  H -11.401  -9.541 -20.401 1.00 . A A .  86 TYR HB3  1 1 
        2  3022 1 1  86 TYR HD1  H -10.073  -6.660 -18.483 1.00 . A A .  86 TYR HD1  1 1 
        2  3023 1 1  86 TYR HD2  H  -9.251 -10.552 -20.057 1.00 . A A .  86 TYR HD2  1 1 
        2  3024 1 1  86 TYR HE1  H  -7.953  -6.786 -17.084 1.00 . A A .  86 TYR HE1  1 1 
        2  3025 1 1  86 TYR HE2  H  -7.135 -10.665 -18.653 1.00 . A A .  86 TYR HE2  1 1 
        2  3026 1 1  86 TYR HH   H  -5.916  -7.888 -17.004 1.00 . A A .  86 TYR HH   1 1 
        2  3027 1 1  86 TYR N    N -12.121  -7.985 -22.256 1.00 . A A .  86 TYR N    1 1 
        2  3028 1 1  86 TYR O    O  -8.765  -7.648 -22.634 1.00 . A A .  86 TYR O    1 1 
        2  3029 1 1  86 TYR OH   O  -6.335  -8.794 -17.069 1.00 . A A .  86 TYR OH   1 1 
        2  3030 1 1  87 LYS C    C  -8.470  -9.710 -24.551 1.00 . A A .  87 LYS C    1 1 
        2  3031 1 1  87 LYS CA   C  -8.690 -10.370 -23.189 1.00 . A A .  87 LYS CA   1 1 
        2  3032 1 1  87 LYS CB   C  -8.992 -11.868 -23.273 1.00 . A A .  87 LYS CB   1 1 
        2  3033 1 1  87 LYS CD   C  -7.171 -13.613 -23.262 1.00 . A A .  87 LYS CD   1 1 
        2  3034 1 1  87 LYS CE   C  -5.729 -13.664 -22.753 1.00 . A A .  87 LYS CE   1 1 
        2  3035 1 1  87 LYS CG   C  -8.022 -12.673 -22.406 1.00 . A A .  87 LYS CG   1 1 
        2  3036 1 1  87 LYS H    H -10.512 -10.256 -22.186 1.00 . A A .  87 LYS H    1 1 
        2  3037 1 1  87 LYS HA   H  -7.780 -10.258 -22.599 1.00 . A A .  87 LYS HA   1 1 
        2  3038 1 1  87 LYS HB2  H -10.016 -12.055 -22.950 1.00 . A A .  87 LYS HB2  1 1 
        2  3039 1 1  87 LYS HB3  H  -8.920 -12.199 -24.309 1.00 . A A .  87 LYS HB3  1 1 
        2  3040 1 1  87 LYS HD2  H  -7.602 -14.614 -23.247 1.00 . A A .  87 LYS HD2  1 1 
        2  3041 1 1  87 LYS HD3  H  -7.182 -13.276 -24.299 1.00 . A A .  87 LYS HD3  1 1 
        2  3042 1 1  87 LYS HE2  H  -5.040 -13.478 -23.576 1.00 . A A .  87 LYS HE2  1 1 
        2  3043 1 1  87 LYS HE3  H  -5.569 -12.875 -22.018 1.00 . A A .  87 LYS HE3  1 1 
        2  3044 1 1  87 LYS HG2  H  -7.374 -11.993 -21.852 1.00 . A A .  87 LYS HG2  1 1 
        2  3045 1 1  87 LYS HG3  H  -8.581 -13.251 -21.670 1.00 . A A .  87 LYS HG3  1 1 
        2  3046 1 1  87 LYS HZ1  H  -5.036 -15.585 -22.833 1.00 . A A .  87 LYS HZ1  1 1 
        2  3047 1 1  87 LYS HZ2  H  -4.802 -14.867 -21.385 1.00 . A A .  87 LYS HZ2  1 1 
        2  3048 1 1  87 LYS HZ3  H  -6.291 -15.387 -21.807 1.00 . A A .  87 LYS HZ3  1 1 
        2  3049 1 1  87 LYS N    N  -9.754  -9.676 -22.485 1.00 . A A .  87 LYS N    1 1 
        2  3050 1 1  87 LYS NZ   N  -5.441 -14.983 -22.145 1.00 . A A .  87 LYS NZ   1 1 
        2  3051 1 1  87 LYS O    O  -7.331  -9.474 -24.954 1.00 . A A .  87 LYS O    1 1 
        2  3052 1 1  88 GLU C    C  -8.559  -7.608 -26.505 1.00 . A A .  88 GLU C    1 1 
        2  3053 1 1  88 GLU CA   C  -9.518  -8.800 -26.531 1.00 . A A .  88 GLU CA   1 1 
        2  3054 1 1  88 GLU CB   C -10.912  -8.372 -26.997 1.00 . A A .  88 GLU CB   1 1 
        2  3055 1 1  88 GLU CD   C -12.014  -7.036 -28.830 1.00 . A A .  88 GLU CD   1 1 
        2  3056 1 1  88 GLU CG   C -10.840  -7.105 -27.851 1.00 . A A .  88 GLU CG   1 1 
        2  3057 1 1  88 GLU H    H -10.498  -9.624 -24.888 1.00 . A A .  88 GLU H    1 1 
        2  3058 1 1  88 GLU HA   H  -9.137  -9.568 -27.205 1.00 . A A .  88 GLU HA   1 1 
        2  3059 1 1  88 GLU HB2  H -11.370  -9.177 -27.571 1.00 . A A .  88 GLU HB2  1 1 
        2  3060 1 1  88 GLU HB3  H -11.550  -8.196 -26.131 1.00 . A A .  88 GLU HB3  1 1 
        2  3061 1 1  88 GLU HG2  H -10.847  -6.227 -27.206 1.00 . A A .  88 GLU HG2  1 1 
        2  3062 1 1  88 GLU HG3  H  -9.900  -7.088 -28.403 1.00 . A A .  88 GLU HG3  1 1 
        2  3063 1 1  88 GLU N    N  -9.576  -9.429 -25.223 1.00 . A A .  88 GLU N    1 1 
        2  3064 1 1  88 GLU O    O  -7.914  -7.304 -27.508 1.00 . A A .  88 GLU O    1 1 
        2  3065 1 1  88 GLU OE1  O -12.169  -8.009 -29.599 1.00 . A A .  88 GLU OE1  1 1 
        2  3066 1 1  88 GLU OE2  O -12.729  -6.012 -28.786 1.00 . A A .  88 GLU OE2  1 1 
        2  3067 1 1  89 TYR C    C  -6.238  -6.241 -24.698 1.00 . A A .  89 TYR C    1 1 
        2  3068 1 1  89 TYR CA   C  -7.626  -5.814 -25.179 1.00 . A A .  89 TYR CA   1 1 
        2  3069 1 1  89 TYR CB   C  -8.281  -4.946 -24.102 1.00 . A A .  89 TYR CB   1 1 
        2  3070 1 1  89 TYR CD1  C  -6.509  -3.175 -23.821 1.00 . A A .  89 TYR CD1  1 1 
        2  3071 1 1  89 TYR CD2  C  -7.164  -4.437 -21.900 1.00 . A A .  89 TYR CD2  1 1 
        2  3072 1 1  89 TYR CE1  C  -5.572  -2.435 -23.016 1.00 . A A .  89 TYR CE1  1 1 
        2  3073 1 1  89 TYR CE2  C  -6.228  -3.697 -21.094 1.00 . A A .  89 TYR CE2  1 1 
        2  3074 1 1  89 TYR CG   C  -7.285  -4.160 -23.246 1.00 . A A .  89 TYR CG   1 1 
        2  3075 1 1  89 TYR CZ   C  -5.478  -2.732 -21.692 1.00 . A A .  89 TYR CZ   1 1 
        2  3076 1 1  89 TYR H    H  -9.024  -7.220 -24.538 1.00 . A A .  89 TYR H    1 1 
        2  3077 1 1  89 TYR HA   H  -7.531  -5.319 -26.145 1.00 . A A .  89 TYR HA   1 1 
        2  3078 1 1  89 TYR HB2  H  -8.965  -4.246 -24.581 1.00 . A A .  89 TYR HB2  1 1 
        2  3079 1 1  89 TYR HB3  H  -8.880  -5.583 -23.452 1.00 . A A .  89 TYR HB3  1 1 
        2  3080 1 1  89 TYR HD1  H  -6.604  -2.957 -24.885 1.00 . A A .  89 TYR HD1  1 1 
        2  3081 1 1  89 TYR HD2  H  -7.778  -5.215 -21.446 1.00 . A A .  89 TYR HD2  1 1 
        2  3082 1 1  89 TYR HE1  H  -4.952  -1.654 -23.457 1.00 . A A .  89 TYR HE1  1 1 
        2  3083 1 1  89 TYR HE2  H  -6.122  -3.905 -20.030 1.00 . A A .  89 TYR HE2  1 1 
        2  3084 1 1  89 TYR HH   H  -4.215  -1.272 -21.458 1.00 . A A .  89 TYR HH   1 1 
        2  3085 1 1  89 TYR N    N  -8.496  -6.966 -25.349 1.00 . A A .  89 TYR N    1 1 
        2  3086 1 1  89 TYR O    O  -5.230  -5.674 -25.117 1.00 . A A .  89 TYR O    1 1 
        2  3087 1 1  89 TYR OH   O  -4.593  -2.034 -20.931 1.00 . A A .  89 TYR OH   1 1 
        2  3088 1 1  90 ILE C    C  -4.081  -8.205 -24.432 1.00 . A A .  90 ILE C    1 1 
        2  3089 1 1  90 ILE CA   C  -4.982  -7.748 -23.283 1.00 . A A .  90 ILE CA   1 1 
        2  3090 1 1  90 ILE CB   C  -5.254  -8.838 -22.245 1.00 . A A .  90 ILE CB   1 1 
        2  3091 1 1  90 ILE CD1  C  -5.402  -7.746 -19.977 1.00 . A A .  90 ILE CD1  1 1 
        2  3092 1 1  90 ILE CG1  C  -6.193  -8.329 -21.149 1.00 . A A .  90 ILE CG1  1 1 
        2  3093 1 1  90 ILE CG2  C  -3.947  -9.387 -21.670 1.00 . A A .  90 ILE CG2  1 1 
        2  3094 1 1  90 ILE H    H  -7.054  -7.694 -23.490 1.00 . A A .  90 ILE H    1 1 
        2  3095 1 1  90 ILE HA   H  -4.490  -6.925 -22.765 1.00 . A A .  90 ILE HA   1 1 
        2  3096 1 1  90 ILE HB   H  -5.760  -9.666 -22.743 1.00 . A A .  90 ILE HB   1 1 
        2  3097 1 1  90 ILE HD11 H  -4.720  -6.979 -20.344 1.00 . A A .  90 ILE HD11 1 1 
        2  3098 1 1  90 ILE HD12 H  -6.091  -7.304 -19.257 1.00 . A A .  90 ILE HD12 1 1 
        2  3099 1 1  90 ILE HD13 H  -4.831  -8.539 -19.493 1.00 . A A .  90 ILE HD13 1 1 
        2  3100 1 1  90 ILE HG12 H  -6.857  -7.568 -21.559 1.00 . A A .  90 ILE HG12 1 1 
        2  3101 1 1  90 ILE HG13 H  -6.823  -9.146 -20.797 1.00 . A A .  90 ILE HG13 1 1 
        2  3102 1 1  90 ILE HG21 H  -3.442  -9.988 -22.426 1.00 . A A .  90 ILE HG21 1 1 
        2  3103 1 1  90 ILE HG22 H  -3.304  -8.559 -21.375 1.00 . A A .  90 ILE HG22 1 1 
        2  3104 1 1  90 ILE HG23 H  -4.165 -10.007 -20.800 1.00 . A A .  90 ILE HG23 1 1 
        2  3105 1 1  90 ILE N    N  -6.230  -7.238 -23.825 1.00 . A A .  90 ILE N    1 1 
        2  3106 1 1  90 ILE O    O  -2.974  -7.695 -24.598 1.00 . A A .  90 ILE O    1 1 
        2  3107 1 1  91 SER C    C  -3.127  -8.558 -27.060 1.00 . A A .  91 SER C    1 1 
        2  3108 1 1  91 SER CA   C  -3.843  -9.693 -26.324 1.00 . A A .  91 SER CA   1 1 
        2  3109 1 1  91 SER CB   C  -4.762 -10.450 -27.284 1.00 . A A .  91 SER CB   1 1 
        2  3110 1 1  91 SER H    H  -5.489  -9.571 -25.054 1.00 . A A .  91 SER H    1 1 
        2  3111 1 1  91 SER HA   H  -3.120 -10.385 -25.893 1.00 . A A .  91 SER HA   1 1 
        2  3112 1 1  91 SER HB2  H  -5.072 -11.389 -26.825 1.00 . A A .  91 SER HB2  1 1 
        2  3113 1 1  91 SER HB3  H  -5.667  -9.867 -27.456 1.00 . A A .  91 SER HB3  1 1 
        2  3114 1 1  91 SER HG   H  -4.362 -10.010 -29.195 1.00 . A A .  91 SER HG   1 1 
        2  3115 1 1  91 SER N    N  -4.588  -9.161 -25.196 1.00 . A A .  91 SER N    1 1 
        2  3116 1 1  91 SER O    O  -1.957  -8.685 -27.416 1.00 . A A .  91 SER O    1 1 
        2  3117 1 1  91 SER OG   O  -4.127 -10.719 -28.531 1.00 . A A .  91 SER OG   1 1 
        2  3118 1 1  92 ASN C    C  -2.857  -5.284 -26.918 1.00 . A A .  92 ASN C    1 1 
        2  3119 1 1  92 ASN CA   C  -3.310  -6.317 -27.951 1.00 . A A .  92 ASN CA   1 1 
        2  3120 1 1  92 ASN CB   C  -4.360  -5.659 -28.849 1.00 . A A .  92 ASN CB   1 1 
        2  3121 1 1  92 ASN CG   C  -4.960  -6.672 -29.825 1.00 . A A .  92 ASN CG   1 1 
        2  3122 1 1  92 ASN H    H  -4.812  -7.378 -26.971 1.00 . A A .  92 ASN H    1 1 
        2  3123 1 1  92 ASN HA   H  -2.482  -6.704 -28.545 1.00 . A A .  92 ASN HA   1 1 
        2  3124 1 1  92 ASN HB2  H  -5.150  -5.228 -28.235 1.00 . A A .  92 ASN HB2  1 1 
        2  3125 1 1  92 ASN HB3  H  -3.905  -4.839 -29.405 1.00 . A A .  92 ASN HB3  1 1 
        2  3126 1 1  92 ASN HD21 H  -6.781  -6.296 -29.023 1.00 . A A .  92 ASN HD21 1 1 
        2  3127 1 1  92 ASN HD22 H  -6.762  -7.464 -30.301 1.00 . A A .  92 ASN HD22 1 1 
        2  3128 1 1  92 ASN N    N  -3.860  -7.473 -27.265 1.00 . A A .  92 ASN N    1 1 
        2  3129 1 1  92 ASN ND2  N  -6.276  -6.823 -29.707 1.00 . A A .  92 ASN ND2  1 1 
        2  3130 1 1  92 ASN O    O  -3.438  -4.204 -26.818 1.00 . A A .  92 ASN O    1 1 
        2  3131 1 1  92 ASN OD1  O  -4.274  -7.278 -30.632 1.00 . A A .  92 ASN OD1  1 1 
        2  3132 1 1  93 LYS C    C  -0.191  -5.504 -24.376 1.00 . A A .  93 LYS C    1 1 
        2  3133 1 1  93 LYS CA   C  -1.285  -4.770 -25.153 1.00 . A A .  93 LYS CA   1 1 
        2  3134 1 1  93 LYS CB   C  -2.409  -4.228 -24.267 1.00 . A A .  93 LYS CB   1 1 
        2  3135 1 1  93 LYS CD   C  -2.154  -1.948 -23.219 1.00 . A A .  93 LYS CD   1 1 
        2  3136 1 1  93 LYS CE   C  -0.809  -1.255 -23.441 1.00 . A A .  93 LYS CE   1 1 
        2  3137 1 1  93 LYS CG   C  -2.586  -2.721 -24.467 1.00 . A A .  93 LYS CG   1 1 
        2  3138 1 1  93 LYS H    H  -1.356  -6.531 -26.262 1.00 . A A .  93 LYS H    1 1 
        2  3139 1 1  93 LYS HA   H  -0.835  -3.917 -25.661 1.00 . A A .  93 LYS HA   1 1 
        2  3140 1 1  93 LYS HB2  H  -3.342  -4.741 -24.501 1.00 . A A .  93 LYS HB2  1 1 
        2  3141 1 1  93 LYS HB3  H  -2.185  -4.436 -23.221 1.00 . A A .  93 LYS HB3  1 1 
        2  3142 1 1  93 LYS HD2  H  -2.912  -1.207 -22.966 1.00 . A A .  93 LYS HD2  1 1 
        2  3143 1 1  93 LYS HD3  H  -2.080  -2.630 -22.372 1.00 . A A .  93 LYS HD3  1 1 
        2  3144 1 1  93 LYS HE2  H  -0.407  -0.913 -22.487 1.00 . A A .  93 LYS HE2  1 1 
        2  3145 1 1  93 LYS HE3  H  -0.091  -1.964 -23.854 1.00 . A A .  93 LYS HE3  1 1 
        2  3146 1 1  93 LYS HG2  H  -1.998  -2.393 -25.324 1.00 . A A .  93 LYS HG2  1 1 
        2  3147 1 1  93 LYS HG3  H  -3.629  -2.501 -24.693 1.00 . A A .  93 LYS HG3  1 1 
        2  3148 1 1  93 LYS HZ1  H  -1.494   0.613 -23.909 1.00 . A A .  93 LYS HZ1  1 1 
        2  3149 1 1  93 LYS HZ2  H  -0.062   0.250 -24.606 1.00 . A A .  93 LYS HZ2  1 1 
        2  3150 1 1  93 LYS HZ3  H  -1.442  -0.402 -25.188 1.00 . A A .  93 LYS HZ3  1 1 
        2  3151 1 1  93 LYS N    N  -1.823  -5.651 -26.175 1.00 . A A .  93 LYS N    1 1 
        2  3152 1 1  93 LYS NZ   N  -0.964  -0.105 -24.361 1.00 . A A .  93 LYS NZ   1 1 
        2  3153 1 1  93 LYS O    O   0.989  -5.177 -24.499 1.00 . A A .  93 LYS O    1 1 
        2  3154 1 1  94 ARG C    C   1.040  -8.281 -23.680 1.00 . A A .  94 ARG C    1 1 
        2  3155 1 1  94 ARG CA   C   0.309  -7.268 -22.798 1.00 . A A .  94 ARG CA   1 1 
        2  3156 1 1  94 ARG CB   C  -0.419  -8.010 -21.675 1.00 . A A .  94 ARG CB   1 1 
        2  3157 1 1  94 ARG CD   C   0.512  -8.853 -19.488 1.00 . A A .  94 ARG CD   1 1 
        2  3158 1 1  94 ARG CG   C   0.138  -7.615 -20.306 1.00 . A A .  94 ARG CG   1 1 
        2  3159 1 1  94 ARG CZ   C  -0.498 -10.155 -17.619 1.00 . A A .  94 ARG CZ   1 1 
        2  3160 1 1  94 ARG H    H  -1.581  -6.744 -23.500 1.00 . A A .  94 ARG H    1 1 
        2  3161 1 1  94 ARG HA   H   1.003  -6.538 -22.381 1.00 . A A .  94 ARG HA   1 1 
        2  3162 1 1  94 ARG HB2  H  -1.484  -7.786 -21.717 1.00 . A A .  94 ARG HB2  1 1 
        2  3163 1 1  94 ARG HB3  H  -0.313  -9.086 -21.818 1.00 . A A .  94 ARG HB3  1 1 
        2  3164 1 1  94 ARG HD2  H   0.628  -9.714 -20.148 1.00 . A A .  94 ARG HD2  1 1 
        2  3165 1 1  94 ARG HD3  H   1.472  -8.698 -18.996 1.00 . A A .  94 ARG HD3  1 1 
        2  3166 1 1  94 ARG HE   H  -1.319  -8.509 -18.437 1.00 . A A .  94 ARG HE   1 1 
        2  3167 1 1  94 ARG HG2  H   1.016  -6.982 -20.435 1.00 . A A .  94 ARG HG2  1 1 
        2  3168 1 1  94 ARG HG3  H  -0.602  -7.027 -19.764 1.00 . A A .  94 ARG HG3  1 1 
        2  3169 1 1  94 ARG HH11 H   1.276 -10.882 -18.297 1.00 . A A .  94 ARG HH11 1 1 
        2  3170 1 1  94 ARG HH12 H   0.561 -11.776 -16.997 1.00 . A A .  94 ARG HH12 1 1 
        2  3171 1 1  94 ARG HH21 H  -2.262  -9.688 -16.721 1.00 . A A .  94 ARG HH21 1 1 
        2  3172 1 1  94 ARG HH22 H  -1.465 -11.092 -16.095 1.00 . A A .  94 ARG HH22 1 1 
        2  3173 1 1  94 ARG N    N  -0.620  -6.484 -23.594 1.00 . A A .  94 ARG N    1 1 
        2  3174 1 1  94 ARG NE   N  -0.535  -9.128 -18.479 1.00 . A A .  94 ARG NE   1 1 
        2  3175 1 1  94 ARG NH1  N   0.534 -11.009 -17.639 1.00 . A A .  94 ARG NH1  1 1 
        2  3176 1 1  94 ARG NH2  N  -1.492 -10.326 -16.737 1.00 . A A .  94 ARG NH2  1 1 
        2  3177 1 1  94 ARG O    O   2.268  -8.268 -23.761 1.00 . A A .  94 ARG O    1 1 
        2  3178 1 1  95 LYS C    C   0.992  -9.573 -26.598 1.00 . A A .  95 LYS C    1 1 
        2  3179 1 1  95 LYS CA   C   0.813 -10.154 -25.194 1.00 . A A .  95 LYS CA   1 1 
        2  3180 1 1  95 LYS CB   C  -0.045 -11.420 -25.157 1.00 . A A .  95 LYS CB   1 1 
        2  3181 1 1  95 LYS CD   C   0.236 -13.851 -24.546 1.00 . A A .  95 LYS CD   1 1 
        2  3182 1 1  95 LYS CE   C   0.998 -15.142 -24.851 1.00 . A A .  95 LYS CE   1 1 
        2  3183 1 1  95 LYS CG   C   0.818 -12.672 -25.328 1.00 . A A .  95 LYS CG   1 1 
        2  3184 1 1  95 LYS H    H  -0.742  -9.139 -24.250 1.00 . A A .  95 LYS H    1 1 
        2  3185 1 1  95 LYS HA   H   1.795 -10.418 -24.802 1.00 . A A .  95 LYS HA   1 1 
        2  3186 1 1  95 LYS HB2  H  -0.583 -11.472 -24.210 1.00 . A A .  95 LYS HB2  1 1 
        2  3187 1 1  95 LYS HB3  H  -0.794 -11.379 -25.947 1.00 . A A .  95 LYS HB3  1 1 
        2  3188 1 1  95 LYS HD2  H   0.283 -13.641 -23.477 1.00 . A A .  95 LYS HD2  1 1 
        2  3189 1 1  95 LYS HD3  H  -0.817 -13.976 -24.800 1.00 . A A .  95 LYS HD3  1 1 
        2  3190 1 1  95 LYS HE2  H   0.354 -16.003 -24.670 1.00 . A A .  95 LYS HE2  1 1 
        2  3191 1 1  95 LYS HE3  H   1.274 -15.167 -25.905 1.00 . A A .  95 LYS HE3  1 1 
        2  3192 1 1  95 LYS HG2  H   0.884 -12.930 -26.385 1.00 . A A .  95 LYS HG2  1 1 
        2  3193 1 1  95 LYS HG3  H   1.833 -12.469 -24.986 1.00 . A A .  95 LYS HG3  1 1 
        2  3194 1 1  95 LYS HZ1  H   2.722 -14.379 -24.062 1.00 . A A .  95 LYS HZ1  1 1 
        2  3195 1 1  95 LYS HZ2  H   1.949 -15.414 -23.063 1.00 . A A .  95 LYS HZ2  1 1 
        2  3196 1 1  95 LYS HZ3  H   2.787 -15.987 -24.341 1.00 . A A .  95 LYS HZ3  1 1 
        2  3197 1 1  95 LYS N    N   0.256  -9.135 -24.321 1.00 . A A .  95 LYS N    1 1 
        2  3198 1 1  95 LYS NZ   N   2.212 -15.238 -24.011 1.00 . A A .  95 LYS NZ   1 1 
        2  3199 1 1  95 LYS O    O   0.618  -8.429 -26.853 1.00 . A A .  95 LYS O    1 1 
        2  3200 1 1  96 SER C    C   2.441 -11.109 -29.637 1.00 . A A .  96 SER C    1 1 
        2  3201 1 1  96 SER CA   C   1.795  -9.970 -28.845 1.00 . A A .  96 SER CA   1 1 
        2  3202 1 1  96 SER CB   C   2.677  -8.721 -28.898 1.00 . A A .  96 SER CB   1 1 
        2  3203 1 1  96 SER H    H   1.864 -11.318 -27.258 1.00 . A A .  96 SER H    1 1 
        2  3204 1 1  96 SER HA   H   0.809  -9.736 -29.246 1.00 . A A .  96 SER HA   1 1 
        2  3205 1 1  96 SER HB2  H   2.270  -7.961 -28.230 1.00 . A A .  96 SER HB2  1 1 
        2  3206 1 1  96 SER HB3  H   3.674  -8.965 -28.532 1.00 . A A .  96 SER HB3  1 1 
        2  3207 1 1  96 SER HG   H   3.608  -8.516 -30.657 1.00 . A A .  96 SER HG   1 1 
        2  3208 1 1  96 SER N    N   1.563 -10.389 -27.473 1.00 . A A .  96 SER N    1 1 
        2  3209 1 1  96 SER O    O   3.663 -11.170 -29.758 1.00 . A A .  96 SER O    1 1 
        2  3210 1 1  96 SER OG   O   2.772  -8.190 -30.217 1.00 . A A .  96 SER OG   1 1 
        2  3211 1 1  97 GLY C    C   1.012 -13.554 -31.956 1.00 . A A .  97 GLY C    1 1 
        2  3212 1 1  97 GLY CA   C   2.062 -13.116 -30.933 1.00 . A A .  97 GLY CA   1 1 
        2  3213 1 1  97 GLY H    H   0.597 -11.925 -30.052 1.00 . A A .  97 GLY H    1 1 
        2  3214 1 1  97 GLY HA2  H   2.986 -12.850 -31.446 1.00 . A A .  97 GLY HA2  1 1 
        2  3215 1 1  97 GLY HA3  H   2.295 -13.946 -30.267 1.00 . A A .  97 GLY HA3  1 1 
        2  3216 1 1  97 GLY N    N   1.590 -11.982 -30.156 1.00 . A A .  97 GLY N    1 1 
        2  3217 1 1  97 GLY O    O  -0.186 -13.404 -31.724 1.00 . A A .  97 GLY O    1 1 
        2  3218 1 1  98 PRO C    C  -0.037 -15.885 -33.773 1.00 . A A .  98 PRO C    1 1 
        2  3219 1 1  98 PRO CA   C   0.633 -14.564 -34.154 1.00 . A A .  98 PRO CA   1 1 
        2  3220 1 1  98 PRO CB   C   1.521 -14.681 -35.382 1.00 . A A .  98 PRO CB   1 1 
        2  3221 1 1  98 PRO CD   C   2.928 -14.296 -33.404 1.00 . A A .  98 PRO CD   1 1 
        2  3222 1 1  98 PRO CG   C   2.948 -14.730 -34.861 1.00 . A A .  98 PRO CG   1 1 
        2  3223 1 1  98 PRO HA   H  -0.111 -13.911 -34.296 1.00 . A A .  98 PRO HA   1 1 
        2  3224 1 1  98 PRO HB2  H   1.283 -15.579 -35.952 1.00 . A A .  98 PRO HB2  1 1 
        2  3225 1 1  98 PRO HB3  H   1.379 -13.832 -36.050 1.00 . A A .  98 PRO HB3  1 1 
        2  3226 1 1  98 PRO HD2  H   3.374 -15.052 -32.759 1.00 . A A .  98 PRO HD2  1 1 
        2  3227 1 1  98 PRO HD3  H   3.495 -13.377 -33.257 1.00 . A A .  98 PRO HD3  1 1 
        2  3228 1 1  98 PRO HG2  H   3.354 -15.737 -34.953 1.00 . A A .  98 PRO HG2  1 1 
        2  3229 1 1  98 PRO HG3  H   3.591 -14.072 -35.446 1.00 . A A .  98 PRO HG3  1 1 
        2  3230 1 1  98 PRO N    N   1.514 -14.102 -33.095 1.00 . A A .  98 PRO N    1 1 
        2  3231 1 1  98 PRO O    O  -1.260 -15.954 -33.656 1.00 . A A .  98 PRO O    1 1 
        2  3232 1 1  99 SER C    C   1.465 -19.187 -33.045 1.00 . A A .  99 SER C    1 1 
        2  3233 1 1  99 SER CA   C   0.296 -18.217 -33.224 1.00 . A A .  99 SER CA   1 1 
        2  3234 1 1  99 SER CB   C  -0.679 -18.750 -34.276 1.00 . A A .  99 SER CB   1 1 
        2  3235 1 1  99 SER H    H   1.786 -16.837 -33.687 1.00 . A A .  99 SER H    1 1 
        2  3236 1 1  99 SER HA   H  -0.231 -18.075 -32.281 1.00 . A A .  99 SER HA   1 1 
        2  3237 1 1  99 SER HB2  H  -0.961 -17.941 -34.952 1.00 . A A .  99 SER HB2  1 1 
        2  3238 1 1  99 SER HB3  H  -0.183 -19.510 -34.879 1.00 . A A .  99 SER HB3  1 1 
        2  3239 1 1  99 SER HG   H  -1.987 -18.922 -32.772 1.00 . A A .  99 SER HG   1 1 
        2  3240 1 1  99 SER N    N   0.793 -16.902 -33.590 1.00 . A A .  99 SER N    1 1 
        2  3241 1 1  99 SER O    O   2.617 -18.828 -33.285 1.00 . A A .  99 SER O    1 1 
        2  3242 1 1  99 SER OG   O  -1.852 -19.303 -33.686 1.00 . A A .  99 SER OG   1 1 
        2  3243 1 1 100 SER C    C   3.086 -20.997 -31.291 1.00 . A A . 100 SER C    1 1 
        2  3244 1 1 100 SER CA   C   2.137 -21.423 -32.412 1.00 . A A . 100 SER CA   1 1 
        2  3245 1 1 100 SER CB   C   2.922 -21.699 -33.696 1.00 . A A . 100 SER CB   1 1 
        2  3246 1 1 100 SER H    H   0.190 -20.683 -32.434 1.00 . A A . 100 SER H    1 1 
        2  3247 1 1 100 SER HA   H   1.583 -22.317 -32.126 1.00 . A A . 100 SER HA   1 1 
        2  3248 1 1 100 SER HB2  H   2.361 -21.325 -34.552 1.00 . A A . 100 SER HB2  1 1 
        2  3249 1 1 100 SER HB3  H   3.865 -21.153 -33.669 1.00 . A A . 100 SER HB3  1 1 
        2  3250 1 1 100 SER HG   H   3.368 -23.517 -32.988 1.00 . A A . 100 SER HG   1 1 
        2  3251 1 1 100 SER N    N   1.129 -20.398 -32.626 1.00 . A A . 100 SER N    1 1 
        2  3252 1 1 100 SER O    O   3.182 -19.813 -30.970 1.00 . A A . 100 SER O    1 1 
        2  3253 1 1 100 SER OG   O   3.185 -23.089 -33.872 1.00 . A A . 100 SER OG   1 1 
        2  3254 1 1 101 GLY C    C   4.773 -22.915 -28.685 1.00 . A A . 101 GLY C    1 1 
        2  3255 1 1 101 GLY CA   C   4.703 -21.727 -29.647 1.00 . A A . 101 GLY CA   1 1 
        2  3256 1 1 101 GLY H    H   3.680 -22.945 -30.992 1.00 . A A . 101 GLY H    1 1 
        2  3257 1 1 101 GLY HA2  H   5.692 -21.530 -30.060 1.00 . A A . 101 GLY HA2  1 1 
        2  3258 1 1 101 GLY HA3  H   4.401 -20.832 -29.103 1.00 . A A . 101 GLY HA3  1 1 
        2  3259 1 1 101 GLY N    N   3.764 -21.985 -30.725 1.00 . A A . 101 GLY N    1 1 
        2  3260 1 1 101 GLY O    O   4.062 -22.949 -27.682 1.00 . A A . 101 GLY O    1 1 
        3  3261 1 1   1 GLY C    C -16.399   7.728   5.134 1.00 . A A .   1 GLY C    1 1 
        3  3262 1 1   1 GLY CA   C -17.343   8.186   6.247 1.00 . A A .   1 GLY CA   1 1 
        3  3263 1 1   1 GLY H1   H -15.680   9.129   7.074 1.00 . A A .   1 GLY H1   1 1 
        3  3264 1 1   1 GLY HA2  H -17.880   7.327   6.650 1.00 . A A .   1 GLY HA2  1 1 
        3  3265 1 1   1 GLY HA3  H -18.091   8.866   5.839 1.00 . A A .   1 GLY HA3  1 1 
        3  3266 1 1   1 GLY N    N -16.610   8.849   7.312 1.00 . A A .   1 GLY N    1 1 
        3  3267 1 1   1 GLY O    O -15.308   8.274   4.977 1.00 . A A .   1 GLY O    1 1 
        3  3268 1 1   2 SER C    C -16.888   5.177   2.503 1.00 . A A .   2 SER C    1 1 
        3  3269 1 1   2 SER CA   C -16.063   6.194   3.295 1.00 . A A .   2 SER CA   1 1 
        3  3270 1 1   2 SER CB   C -14.777   5.547   3.811 1.00 . A A .   2 SER CB   1 1 
        3  3271 1 1   2 SER H    H -17.743   6.293   4.523 1.00 . A A .   2 SER H    1 1 
        3  3272 1 1   2 SER HA   H -15.813   7.052   2.671 1.00 . A A .   2 SER HA   1 1 
        3  3273 1 1   2 SER HB2  H -14.556   5.924   4.809 1.00 . A A .   2 SER HB2  1 1 
        3  3274 1 1   2 SER HB3  H -14.923   4.470   3.902 1.00 . A A .   2 SER HB3  1 1 
        3  3275 1 1   2 SER HG   H -13.107   6.539   3.329 1.00 . A A .   2 SER HG   1 1 
        3  3276 1 1   2 SER N    N -16.854   6.731   4.389 1.00 . A A .   2 SER N    1 1 
        3  3277 1 1   2 SER O    O -17.563   4.331   3.087 1.00 . A A .   2 SER O    1 1 
        3  3278 1 1   2 SER OG   O -13.669   5.803   2.952 1.00 . A A .   2 SER OG   1 1 
        3  3279 1 1   3 SER C    C -16.789   4.235  -1.016 1.00 . A A .   3 SER C    1 1 
        3  3280 1 1   3 SER CA   C -17.538   4.396   0.308 1.00 . A A .   3 SER CA   1 1 
        3  3281 1 1   3 SER CB   C -18.958   4.907   0.056 1.00 . A A .   3 SER CB   1 1 
        3  3282 1 1   3 SER H    H -16.256   5.986   0.719 1.00 . A A .   3 SER H    1 1 
        3  3283 1 1   3 SER HA   H -17.583   3.446   0.840 1.00 . A A .   3 SER HA   1 1 
        3  3284 1 1   3 SER HB2  H -19.048   5.927   0.429 1.00 . A A .   3 SER HB2  1 1 
        3  3285 1 1   3 SER HB3  H -19.146   4.942  -1.017 1.00 . A A .   3 SER HB3  1 1 
        3  3286 1 1   3 SER HG   H -19.965   3.188   0.244 1.00 . A A .   3 SER HG   1 1 
        3  3287 1 1   3 SER N    N -16.807   5.295   1.186 1.00 . A A .   3 SER N    1 1 
        3  3288 1 1   3 SER O    O -16.588   5.207  -1.742 1.00 . A A .   3 SER O    1 1 
        3  3289 1 1   3 SER OG   O -19.940   4.086   0.683 1.00 . A A .   3 SER OG   1 1 
        3  3290 1 1   4 GLY C    C -16.216   1.427  -3.172 1.00 . A A .   4 GLY C    1 1 
        3  3291 1 1   4 GLY CA   C -15.674   2.698  -2.515 1.00 . A A .   4 GLY CA   1 1 
        3  3292 1 1   4 GLY H    H -16.564   2.214  -0.695 1.00 . A A .   4 GLY H    1 1 
        3  3293 1 1   4 GLY HA2  H -15.761   3.535  -3.208 1.00 . A A .   4 GLY HA2  1 1 
        3  3294 1 1   4 GLY HA3  H -14.614   2.575  -2.295 1.00 . A A .   4 GLY HA3  1 1 
        3  3295 1 1   4 GLY N    N -16.397   2.999  -1.291 1.00 . A A .   4 GLY N    1 1 
        3  3296 1 1   4 GLY O    O -16.920   0.646  -2.534 1.00 . A A .   4 GLY O    1 1 
        3  3297 1 1   5 SER C    C -15.247  -0.296  -6.219 1.00 . A A .   5 SER C    1 1 
        3  3298 1 1   5 SER CA   C -16.308   0.096  -5.189 1.00 . A A .   5 SER CA   1 1 
        3  3299 1 1   5 SER CB   C -17.646   0.363  -5.881 1.00 . A A .   5 SER CB   1 1 
        3  3300 1 1   5 SER H    H -15.293   1.899  -4.950 1.00 . A A .   5 SER H    1 1 
        3  3301 1 1   5 SER HA   H -16.433  -0.695  -4.449 1.00 . A A .   5 SER HA   1 1 
        3  3302 1 1   5 SER HB2  H -17.796   1.438  -5.979 1.00 . A A .   5 SER HB2  1 1 
        3  3303 1 1   5 SER HB3  H -17.621  -0.048  -6.890 1.00 . A A .   5 SER HB3  1 1 
        3  3304 1 1   5 SER HG   H -18.536  -0.223  -4.187 1.00 . A A .   5 SER HG   1 1 
        3  3305 1 1   5 SER N    N -15.866   1.259  -4.439 1.00 . A A .   5 SER N    1 1 
        3  3306 1 1   5 SER O    O -15.144   0.324  -7.277 1.00 . A A .   5 SER O    1 1 
        3  3307 1 1   5 SER OG   O -18.740  -0.205  -5.165 1.00 . A A .   5 SER OG   1 1 
        3  3308 1 1   6 SER C    C -12.851  -3.110  -6.210 1.00 . A A .   6 SER C    1 1 
        3  3309 1 1   6 SER CA   C -13.435  -1.806  -6.756 1.00 . A A .   6 SER CA   1 1 
        3  3310 1 1   6 SER CB   C -12.332  -0.759  -6.924 1.00 . A A .   6 SER CB   1 1 
        3  3311 1 1   6 SER H    H -14.575  -1.823  -5.013 1.00 . A A .   6 SER H    1 1 
        3  3312 1 1   6 SER HA   H -13.921  -1.978  -7.717 1.00 . A A .   6 SER HA   1 1 
        3  3313 1 1   6 SER HB2  H -12.104  -0.315  -5.955 1.00 . A A .   6 SER HB2  1 1 
        3  3314 1 1   6 SER HB3  H -11.421  -1.245  -7.274 1.00 . A A .   6 SER HB3  1 1 
        3  3315 1 1   6 SER HG   H -12.928   1.105  -7.343 1.00 . A A .   6 SER HG   1 1 
        3  3316 1 1   6 SER N    N -14.485  -1.324  -5.875 1.00 . A A .   6 SER N    1 1 
        3  3317 1 1   6 SER O    O -12.751  -3.290  -4.997 1.00 . A A .   6 SER O    1 1 
        3  3318 1 1   6 SER OG   O -12.704   0.267  -7.840 1.00 . A A .   6 SER OG   1 1 
        3  3319 1 1   7 GLY C    C -10.593  -5.082  -5.996 1.00 . A A .   7 GLY C    1 1 
        3  3320 1 1   7 GLY CA   C -11.908  -5.269  -6.757 1.00 . A A .   7 GLY CA   1 1 
        3  3321 1 1   7 GLY H    H -12.564  -3.833  -8.115 1.00 . A A .   7 GLY H    1 1 
        3  3322 1 1   7 GLY HA2  H -12.615  -5.820  -6.137 1.00 . A A .   7 GLY HA2  1 1 
        3  3323 1 1   7 GLY HA3  H -11.733  -5.869  -7.650 1.00 . A A .   7 GLY HA3  1 1 
        3  3324 1 1   7 GLY N    N -12.480  -3.987  -7.131 1.00 . A A .   7 GLY N    1 1 
        3  3325 1 1   7 GLY O    O -10.599  -4.791  -4.801 1.00 . A A .   7 GLY O    1 1 
        3  3326 1 1   8 PRO C    C  -7.808  -3.641  -5.926 1.00 . A A .   8 PRO C    1 1 
        3  3327 1 1   8 PRO CA   C  -8.149  -5.116  -6.149 1.00 . A A .   8 PRO CA   1 1 
        3  3328 1 1   8 PRO CB   C  -7.205  -5.804  -7.121 1.00 . A A .   8 PRO CB   1 1 
        3  3329 1 1   8 PRO CD   C  -9.423  -5.607  -8.158 1.00 . A A .   8 PRO CD   1 1 
        3  3330 1 1   8 PRO CG   C  -7.958  -5.901  -8.437 1.00 . A A .   8 PRO CG   1 1 
        3  3331 1 1   8 PRO HA   H  -8.125  -5.541  -5.244 1.00 . A A .   8 PRO HA   1 1 
        3  3332 1 1   8 PRO HB2  H  -6.283  -5.234  -7.239 1.00 . A A .   8 PRO HB2  1 1 
        3  3333 1 1   8 PRO HB3  H  -6.923  -6.792  -6.758 1.00 . A A .   8 PRO HB3  1 1 
        3  3334 1 1   8 PRO HD2  H  -9.788  -4.787  -8.777 1.00 . A A .   8 PRO HD2  1 1 
        3  3335 1 1   8 PRO HD3  H -10.049  -6.473  -8.374 1.00 . A A .   8 PRO HD3  1 1 
        3  3336 1 1   8 PRO HG2  H  -7.558  -5.190  -9.160 1.00 . A A .   8 PRO HG2  1 1 
        3  3337 1 1   8 PRO HG3  H  -7.844  -6.894  -8.870 1.00 . A A .   8 PRO HG3  1 1 
        3  3338 1 1   8 PRO N    N  -9.469  -5.262  -6.740 1.00 . A A .   8 PRO N    1 1 
        3  3339 1 1   8 PRO O    O  -7.887  -2.835  -6.852 1.00 . A A .   8 PRO O    1 1 
        3  3340 1 1   9 LYS C    C  -5.581  -1.765  -4.543 1.00 . A A .   9 LYS C    1 1 
        3  3341 1 1   9 LYS CA   C  -7.083  -1.969  -4.336 1.00 . A A .   9 LYS CA   1 1 
        3  3342 1 1   9 LYS CB   C  -7.558  -1.645  -2.918 1.00 . A A .   9 LYS CB   1 1 
        3  3343 1 1   9 LYS CD   C  -6.802  -3.698  -1.664 1.00 . A A .   9 LYS CD   1 1 
        3  3344 1 1   9 LYS CE   C  -6.691  -4.066  -0.183 1.00 . A A .   9 LYS CE   1 1 
        3  3345 1 1   9 LYS CG   C  -6.586  -2.198  -1.875 1.00 . A A .   9 LYS CG   1 1 
        3  3346 1 1   9 LYS H    H  -7.375  -3.994  -3.945 1.00 . A A .   9 LYS H    1 1 
        3  3347 1 1   9 LYS HA   H  -7.618  -1.305  -5.015 1.00 . A A .   9 LYS HA   1 1 
        3  3348 1 1   9 LYS HB2  H  -7.650  -0.566  -2.799 1.00 . A A .   9 LYS HB2  1 1 
        3  3349 1 1   9 LYS HB3  H  -8.549  -2.068  -2.757 1.00 . A A .   9 LYS HB3  1 1 
        3  3350 1 1   9 LYS HD2  H  -7.784  -3.984  -2.041 1.00 . A A .   9 LYS HD2  1 1 
        3  3351 1 1   9 LYS HD3  H  -6.065  -4.260  -2.238 1.00 . A A .   9 LYS HD3  1 1 
        3  3352 1 1   9 LYS HE2  H  -6.107  -4.979  -0.072 1.00 . A A .   9 LYS HE2  1 1 
        3  3353 1 1   9 LYS HE3  H  -6.160  -3.280   0.354 1.00 . A A .   9 LYS HE3  1 1 
        3  3354 1 1   9 LYS HG2  H  -5.560  -2.017  -2.196 1.00 . A A .   9 LYS HG2  1 1 
        3  3355 1 1   9 LYS HG3  H  -6.722  -1.671  -0.930 1.00 . A A .   9 LYS HG3  1 1 
        3  3356 1 1   9 LYS HZ1  H  -7.959  -4.308   1.401 1.00 . A A .   9 LYS HZ1  1 1 
        3  3357 1 1   9 LYS HZ2  H  -8.620  -3.481   0.158 1.00 . A A .   9 LYS HZ2  1 1 
        3  3358 1 1   9 LYS HZ3  H  -8.437  -5.101   0.056 1.00 . A A .   9 LYS HZ3  1 1 
        3  3359 1 1   9 LYS N    N  -7.436  -3.332  -4.692 1.00 . A A .   9 LYS N    1 1 
        3  3360 1 1   9 LYS NZ   N  -8.036  -4.254   0.406 1.00 . A A .   9 LYS NZ   1 1 
        3  3361 1 1   9 LYS O    O  -4.787  -2.669  -4.287 1.00 . A A .   9 LYS O    1 1 
        3  3362 1 1  10 LYS C    C  -3.044  -0.427  -3.958 1.00 . A A .  10 LYS C    1 1 
        3  3363 1 1  10 LYS CA   C  -3.843  -0.238  -5.249 1.00 . A A .  10 LYS CA   1 1 
        3  3364 1 1  10 LYS CB   C  -3.725   1.166  -5.846 1.00 . A A .  10 LYS CB   1 1 
        3  3365 1 1  10 LYS CD   C  -1.235   1.028  -6.224 1.00 . A A .  10 LYS CD   1 1 
        3  3366 1 1  10 LYS CE   C  -0.424  -0.042  -6.958 1.00 . A A .  10 LYS CE   1 1 
        3  3367 1 1  10 LYS CG   C  -2.602   1.228  -6.883 1.00 . A A .  10 LYS CG   1 1 
        3  3368 1 1  10 LYS H    H  -5.888   0.158  -5.211 1.00 . A A .  10 LYS H    1 1 
        3  3369 1 1  10 LYS HA   H  -3.465  -0.938  -5.995 1.00 . A A .  10 LYS HA   1 1 
        3  3370 1 1  10 LYS HB2  H  -4.670   1.448  -6.310 1.00 . A A .  10 LYS HB2  1 1 
        3  3371 1 1  10 LYS HB3  H  -3.532   1.887  -5.052 1.00 . A A .  10 LYS HB3  1 1 
        3  3372 1 1  10 LYS HD2  H  -0.686   1.969  -6.224 1.00 . A A .  10 LYS HD2  1 1 
        3  3373 1 1  10 LYS HD3  H  -1.369   0.736  -5.182 1.00 . A A .  10 LYS HD3  1 1 
        3  3374 1 1  10 LYS HE2  H   0.153  -0.625  -6.241 1.00 . A A .  10 LYS HE2  1 1 
        3  3375 1 1  10 LYS HE3  H  -1.098  -0.734  -7.463 1.00 . A A .  10 LYS HE3  1 1 
        3  3376 1 1  10 LYS HG2  H  -2.760   0.461  -7.642 1.00 . A A .  10 LYS HG2  1 1 
        3  3377 1 1  10 LYS HG3  H  -2.626   2.191  -7.393 1.00 . A A .  10 LYS HG3  1 1 
        3  3378 1 1  10 LYS HZ1  H   0.124   0.442  -8.867 1.00 . A A .  10 LYS HZ1  1 1 
        3  3379 1 1  10 LYS HZ2  H   0.554   1.564  -7.760 1.00 . A A .  10 LYS HZ2  1 1 
        3  3380 1 1  10 LYS HZ3  H   1.391   0.166  -7.874 1.00 . A A .  10 LYS HZ3  1 1 
        3  3381 1 1  10 LYS N    N  -5.236  -0.572  -5.005 1.00 . A A .  10 LYS N    1 1 
        3  3382 1 1  10 LYS NZ   N   0.485   0.583  -7.945 1.00 . A A .  10 LYS NZ   1 1 
        3  3383 1 1  10 LYS O    O  -3.196   0.343  -3.011 1.00 . A A .  10 LYS O    1 1 
        3  3384 1 1  11 PRO C    C  -0.201  -0.795  -2.686 1.00 . A A .  11 PRO C    1 1 
        3  3385 1 1  11 PRO CA   C  -1.364  -1.783  -2.802 1.00 . A A .  11 PRO CA   1 1 
        3  3386 1 1  11 PRO CB   C  -0.906  -3.218  -3.005 1.00 . A A .  11 PRO CB   1 1 
        3  3387 1 1  11 PRO CD   C  -1.980  -2.417  -5.065 1.00 . A A .  11 PRO CD   1 1 
        3  3388 1 1  11 PRO CG   C  -1.103  -3.513  -4.483 1.00 . A A .  11 PRO CG   1 1 
        3  3389 1 1  11 PRO HA   H  -1.896  -1.678  -1.962 1.00 . A A .  11 PRO HA   1 1 
        3  3390 1 1  11 PRO HB2  H   0.138  -3.339  -2.718 1.00 . A A .  11 PRO HB2  1 1 
        3  3391 1 1  11 PRO HB3  H  -1.488  -3.904  -2.388 1.00 . A A .  11 PRO HB3  1 1 
        3  3392 1 1  11 PRO HD2  H  -1.495  -1.929  -5.910 1.00 . A A .  11 PRO HD2  1 1 
        3  3393 1 1  11 PRO HD3  H  -2.927  -2.817  -5.427 1.00 . A A .  11 PRO HD3  1 1 
        3  3394 1 1  11 PRO HG2  H  -0.143  -3.547  -4.997 1.00 . A A .  11 PRO HG2  1 1 
        3  3395 1 1  11 PRO HG3  H  -1.571  -4.488  -4.618 1.00 . A A .  11 PRO HG3  1 1 
        3  3396 1 1  11 PRO N    N  -2.187  -1.483  -3.961 1.00 . A A .  11 PRO N    1 1 
        3  3397 1 1  11 PRO O    O   0.009   0.030  -3.573 1.00 . A A .  11 PRO O    1 1 
        3  3398 1 1  12 PRO C    C   2.874  -0.442  -2.180 1.00 . A A .  12 PRO C    1 1 
        3  3399 1 1  12 PRO CA   C   1.680  -0.043  -1.310 1.00 . A A .  12 PRO CA   1 1 
        3  3400 1 1  12 PRO CB   C   1.961  -0.170   0.178 1.00 . A A .  12 PRO CB   1 1 
        3  3401 1 1  12 PRO CD   C   0.325  -1.881  -0.481 1.00 . A A .  12 PRO CD   1 1 
        3  3402 1 1  12 PRO CG   C   1.277  -1.453   0.624 1.00 . A A .  12 PRO CG   1 1 
        3  3403 1 1  12 PRO HA   H   1.458   0.897  -1.566 1.00 . A A .  12 PRO HA   1 1 
        3  3404 1 1  12 PRO HB2  H   3.033  -0.212   0.371 1.00 . A A .  12 PRO HB2  1 1 
        3  3405 1 1  12 PRO HB3  H   1.573   0.690   0.724 1.00 . A A .  12 PRO HB3  1 1 
        3  3406 1 1  12 PRO HD2  H   0.536  -2.897  -0.814 1.00 . A A .  12 PRO HD2  1 1 
        3  3407 1 1  12 PRO HD3  H  -0.710  -1.866  -0.140 1.00 . A A .  12 PRO HD3  1 1 
        3  3408 1 1  12 PRO HG2  H   2.014  -2.232   0.816 1.00 . A A .  12 PRO HG2  1 1 
        3  3409 1 1  12 PRO HG3  H   0.733  -1.292   1.555 1.00 . A A .  12 PRO HG3  1 1 
        3  3410 1 1  12 PRO N    N   0.544  -0.915  -1.554 1.00 . A A .  12 PRO N    1 1 
        3  3411 1 1  12 PRO O    O   2.889  -1.526  -2.761 1.00 . A A .  12 PRO O    1 1 
        3  3412 1 1  13 MET C    C   6.284   0.152  -2.140 1.00 . A A .  13 MET C    1 1 
        3  3413 1 1  13 MET CA   C   5.042   0.211  -3.031 1.00 . A A .  13 MET CA   1 1 
        3  3414 1 1  13 MET CB   C   5.208   1.326  -4.065 1.00 . A A .  13 MET CB   1 1 
        3  3415 1 1  13 MET CE   C   8.233   1.906  -3.800 1.00 . A A .  13 MET CE   1 1 
        3  3416 1 1  13 MET CG   C   5.628   2.636  -3.397 1.00 . A A .  13 MET CG   1 1 
        3  3417 1 1  13 MET H    H   3.827   1.335  -1.766 1.00 . A A .  13 MET H    1 1 
        3  3418 1 1  13 MET HA   H   4.884  -0.755  -3.510 1.00 . A A .  13 MET HA   1 1 
        3  3419 1 1  13 MET HB2  H   5.955   1.034  -4.803 1.00 . A A .  13 MET HB2  1 1 
        3  3420 1 1  13 MET HB3  H   4.270   1.472  -4.602 1.00 . A A .  13 MET HB3  1 1 
        3  3421 1 1  13 MET HE1  H   7.901   1.013  -4.330 1.00 . A A .  13 MET HE1  1 1 
        3  3422 1 1  13 MET HE2  H   9.239   2.169  -4.126 1.00 . A A .  13 MET HE2  1 1 
        3  3423 1 1  13 MET HE3  H   8.238   1.711  -2.727 1.00 . A A .  13 MET HE3  1 1 
        3  3424 1 1  13 MET HG2  H   4.831   3.373  -3.488 1.00 . A A .  13 MET HG2  1 1 
        3  3425 1 1  13 MET HG3  H   5.792   2.474  -2.331 1.00 . A A .  13 MET HG3  1 1 
        3  3426 1 1  13 MET N    N   3.847   0.456  -2.242 1.00 . A A .  13 MET N    1 1 
        3  3427 1 1  13 MET O    O   7.321  -0.369  -2.548 1.00 . A A .  13 MET O    1 1 
        3  3428 1 1  13 MET SD   S   7.121   3.257  -4.154 1.00 . A A .  13 MET SD   1 1 
        3  3429 1 1  14 ASN C    C   6.697   0.405   1.412 1.00 . A A .  14 ASN C    1 1 
        3  3430 1 1  14 ASN CA   C   7.236   0.709   0.013 1.00 . A A .  14 ASN CA   1 1 
        3  3431 1 1  14 ASN CB   C   7.910   2.082   0.054 1.00 . A A .  14 ASN CB   1 1 
        3  3432 1 1  14 ASN CG   C   6.870   3.203   0.062 1.00 . A A .  14 ASN CG   1 1 
        3  3433 1 1  14 ASN H    H   5.292   1.115  -0.615 1.00 . A A .  14 ASN H    1 1 
        3  3434 1 1  14 ASN HA   H   7.933  -0.052  -0.340 1.00 . A A .  14 ASN HA   1 1 
        3  3435 1 1  14 ASN HB2  H   8.537   2.156   0.943 1.00 . A A .  14 ASN HB2  1 1 
        3  3436 1 1  14 ASN HB3  H   8.566   2.195  -0.809 1.00 . A A .  14 ASN HB3  1 1 
        3  3437 1 1  14 ASN HD21 H   7.596   3.825  -1.722 1.00 . A A .  14 ASN HD21 1 1 
        3  3438 1 1  14 ASN HD22 H   6.278   4.757  -1.094 1.00 . A A .  14 ASN HD22 1 1 
        3  3439 1 1  14 ASN N    N   6.139   0.693  -0.939 1.00 . A A .  14 ASN N    1 1 
        3  3440 1 1  14 ASN ND2  N   6.919   3.994  -1.006 1.00 . A A .  14 ASN ND2  1 1 
        3  3441 1 1  14 ASN O    O   5.553   0.732   1.724 1.00 . A A .  14 ASN O    1 1 
        3  3442 1 1  14 ASN OD1  O   6.075   3.342   0.977 1.00 . A A .  14 ASN OD1  1 1 
        3  3443 1 1  15 GLY C    C   6.440   0.588   4.259 1.00 . A A .  15 GLY C    1 1 
        3  3444 1 1  15 GLY CA   C   7.168  -0.570   3.574 1.00 . A A .  15 GLY CA   1 1 
        3  3445 1 1  15 GLY H    H   8.474  -0.481   1.954 1.00 . A A .  15 GLY H    1 1 
        3  3446 1 1  15 GLY HA2  H   6.526  -1.451   3.560 1.00 . A A .  15 GLY HA2  1 1 
        3  3447 1 1  15 GLY HA3  H   8.058  -0.834   4.146 1.00 . A A .  15 GLY HA3  1 1 
        3  3448 1 1  15 GLY N    N   7.545  -0.218   2.216 1.00 . A A .  15 GLY N    1 1 
        3  3449 1 1  15 GLY O    O   5.431   0.381   4.932 1.00 . A A .  15 GLY O    1 1 
        3  3450 1 1  16 TYR C    C   4.909   3.086   4.303 1.00 . A A .  16 TYR C    1 1 
        3  3451 1 1  16 TYR CA   C   6.394   2.974   4.654 1.00 . A A .  16 TYR CA   1 1 
        3  3452 1 1  16 TYR CB   C   7.142   4.159   4.040 1.00 . A A .  16 TYR CB   1 1 
        3  3453 1 1  16 TYR CD1  C   6.397   5.774   5.828 1.00 . A A .  16 TYR CD1  1 1 
        3  3454 1 1  16 TYR CD2  C   6.367   6.508   3.554 1.00 . A A .  16 TYR CD2  1 1 
        3  3455 1 1  16 TYR CE1  C   5.904   7.059   6.250 1.00 . A A .  16 TYR CE1  1 1 
        3  3456 1 1  16 TYR CE2  C   5.874   7.794   3.976 1.00 . A A .  16 TYR CE2  1 1 
        3  3457 1 1  16 TYR CG   C   6.618   5.525   4.489 1.00 . A A .  16 TYR CG   1 1 
        3  3458 1 1  16 TYR CZ   C   5.667   8.006   5.303 1.00 . A A .  16 TYR CZ   1 1 
        3  3459 1 1  16 TYR H    H   7.801   1.942   3.515 1.00 . A A .  16 TYR H    1 1 
        3  3460 1 1  16 TYR HA   H   6.500   2.900   5.736 1.00 . A A .  16 TYR HA   1 1 
        3  3461 1 1  16 TYR HB2  H   8.198   4.084   4.300 1.00 . A A .  16 TYR HB2  1 1 
        3  3462 1 1  16 TYR HB3  H   7.076   4.095   2.954 1.00 . A A .  16 TYR HB3  1 1 
        3  3463 1 1  16 TYR HD1  H   6.596   4.997   6.567 1.00 . A A .  16 TYR HD1  1 1 
        3  3464 1 1  16 TYR HD2  H   6.541   6.312   2.496 1.00 . A A .  16 TYR HD2  1 1 
        3  3465 1 1  16 TYR HE1  H   5.725   7.268   7.305 1.00 . A A .  16 TYR HE1  1 1 
        3  3466 1 1  16 TYR HE2  H   5.671   8.579   3.248 1.00 . A A .  16 TYR HE2  1 1 
        3  3467 1 1  16 TYR HH   H   5.932   9.738   6.144 1.00 . A A .  16 TYR HH   1 1 
        3  3468 1 1  16 TYR N    N   6.980   1.782   4.063 1.00 . A A .  16 TYR N    1 1 
        3  3469 1 1  16 TYR O    O   4.050   2.944   5.171 1.00 . A A .  16 TYR O    1 1 
        3  3470 1 1  16 TYR OH   O   5.201   9.220   5.702 1.00 . A A .  16 TYR OH   1 1 
        3  3471 1 1  17 GLN C    C   2.402   2.388   3.166 1.00 . A A .  17 GLN C    1 1 
        3  3472 1 1  17 GLN CA   C   3.287   3.475   2.552 1.00 . A A .  17 GLN CA   1 1 
        3  3473 1 1  17 GLN CB   C   3.232   3.428   1.024 1.00 . A A .  17 GLN CB   1 1 
        3  3474 1 1  17 GLN CD   C   2.987   4.882  -1.022 1.00 . A A .  17 GLN CD   1 1 
        3  3475 1 1  17 GLN CG   C   3.485   4.812   0.423 1.00 . A A .  17 GLN CG   1 1 
        3  3476 1 1  17 GLN H    H   5.358   3.456   2.328 1.00 . A A .  17 GLN H    1 1 
        3  3477 1 1  17 GLN HA   H   2.956   4.456   2.891 1.00 . A A .  17 GLN HA   1 1 
        3  3478 1 1  17 GLN HB2  H   3.976   2.724   0.651 1.00 . A A .  17 GLN HB2  1 1 
        3  3479 1 1  17 GLN HB3  H   2.257   3.061   0.702 1.00 . A A .  17 GLN HB3  1 1 
        3  3480 1 1  17 GLN HE21 H   3.940   3.133  -1.386 1.00 . A A .  17 GLN HE21 1 1 
        3  3481 1 1  17 GLN HE22 H   3.099   3.814  -2.738 1.00 . A A .  17 GLN HE22 1 1 
        3  3482 1 1  17 GLN HG2  H   2.981   5.570   1.022 1.00 . A A .  17 GLN HG2  1 1 
        3  3483 1 1  17 GLN HG3  H   4.551   5.037   0.455 1.00 . A A .  17 GLN HG3  1 1 
        3  3484 1 1  17 GLN N    N   4.653   3.341   3.028 1.00 . A A .  17 GLN N    1 1 
        3  3485 1 1  17 GLN NE2  N   3.374   3.858  -1.778 1.00 . A A .  17 GLN NE2  1 1 
        3  3486 1 1  17 GLN O    O   1.246   2.640   3.501 1.00 . A A .  17 GLN O    1 1 
        3  3487 1 1  17 GLN OE1  O   2.298   5.804  -1.424 1.00 . A A .  17 GLN OE1  1 1 
        3  3488 1 1  18 LYS C    C   1.937   0.369   5.330 1.00 . A A .  18 LYS C    1 1 
        3  3489 1 1  18 LYS CA   C   2.258   0.076   3.862 1.00 . A A .  18 LYS CA   1 1 
        3  3490 1 1  18 LYS CB   C   3.039  -1.223   3.651 1.00 . A A .  18 LYS CB   1 1 
        3  3491 1 1  18 LYS CD   C   1.770  -3.394   3.467 1.00 . A A .  18 LYS CD   1 1 
        3  3492 1 1  18 LYS CE   C   0.648  -4.173   4.156 1.00 . A A .  18 LYS CE   1 1 
        3  3493 1 1  18 LYS CG   C   2.400  -2.379   4.422 1.00 . A A .  18 LYS CG   1 1 
        3  3494 1 1  18 LYS H    H   3.920   1.006   3.019 1.00 . A A .  18 LYS H    1 1 
        3  3495 1 1  18 LYS HA   H   1.319  -0.020   3.316 1.00 . A A .  18 LYS HA   1 1 
        3  3496 1 1  18 LYS HB2  H   3.071  -1.463   2.588 1.00 . A A .  18 LYS HB2  1 1 
        3  3497 1 1  18 LYS HB3  H   4.070  -1.088   3.977 1.00 . A A .  18 LYS HB3  1 1 
        3  3498 1 1  18 LYS HD2  H   1.375  -2.879   2.591 1.00 . A A .  18 LYS HD2  1 1 
        3  3499 1 1  18 LYS HD3  H   2.533  -4.086   3.111 1.00 . A A .  18 LYS HD3  1 1 
        3  3500 1 1  18 LYS HE2  H   0.891  -4.317   5.209 1.00 . A A .  18 LYS HE2  1 1 
        3  3501 1 1  18 LYS HE3  H  -0.278  -3.599   4.118 1.00 . A A .  18 LYS HE3  1 1 
        3  3502 1 1  18 LYS HG2  H   3.153  -2.871   5.037 1.00 . A A .  18 LYS HG2  1 1 
        3  3503 1 1  18 LYS HG3  H   1.639  -1.992   5.100 1.00 . A A .  18 LYS HG3  1 1 
        3  3504 1 1  18 LYS HZ1  H   0.720  -5.424   2.541 1.00 . A A .  18 LYS HZ1  1 1 
        3  3505 1 1  18 LYS HZ2  H   1.014  -6.175   3.961 1.00 . A A .  18 LYS HZ2  1 1 
        3  3506 1 1  18 LYS HZ3  H  -0.512  -5.748   3.563 1.00 . A A .  18 LYS HZ3  1 1 
        3  3507 1 1  18 LYS N    N   2.979   1.202   3.295 1.00 . A A .  18 LYS N    1 1 
        3  3508 1 1  18 LYS NZ   N   0.452  -5.487   3.502 1.00 . A A .  18 LYS NZ   1 1 
        3  3509 1 1  18 LYS O    O   0.773   0.370   5.726 1.00 . A A .  18 LYS O    1 1 
        3  3510 1 1  19 PHE C    C   1.887   2.083   7.725 1.00 . A A .  19 PHE C    1 1 
        3  3511 1 1  19 PHE CA   C   2.837   0.903   7.510 1.00 . A A .  19 PHE CA   1 1 
        3  3512 1 1  19 PHE CB   C   4.222   1.274   8.044 1.00 . A A .  19 PHE CB   1 1 
        3  3513 1 1  19 PHE CD1  C   3.894   1.822  10.466 1.00 . A A .  19 PHE CD1  1 1 
        3  3514 1 1  19 PHE CD2  C   4.470   3.575   9.001 1.00 . A A .  19 PHE CD2  1 1 
        3  3515 1 1  19 PHE CE1  C   3.869   2.737  11.551 1.00 . A A .  19 PHE CE1  1 1 
        3  3516 1 1  19 PHE CE2  C   4.444   4.490  10.087 1.00 . A A .  19 PHE CE2  1 1 
        3  3517 1 1  19 PHE CG   C   4.194   2.260   9.214 1.00 . A A .  19 PHE CG   1 1 
        3  3518 1 1  19 PHE CZ   C   4.144   4.051  11.339 1.00 . A A .  19 PHE CZ   1 1 
        3  3519 1 1  19 PHE H    H   3.935   0.607   5.765 1.00 . A A .  19 PHE H    1 1 
        3  3520 1 1  19 PHE HA   H   2.420   0.013   7.981 1.00 . A A .  19 PHE HA   1 1 
        3  3521 1 1  19 PHE HB2  H   4.734   0.365   8.360 1.00 . A A .  19 PHE HB2  1 1 
        3  3522 1 1  19 PHE HB3  H   4.809   1.705   7.233 1.00 . A A .  19 PHE HB3  1 1 
        3  3523 1 1  19 PHE HD1  H   3.673   0.768  10.636 1.00 . A A .  19 PHE HD1  1 1 
        3  3524 1 1  19 PHE HD2  H   4.710   3.926   7.998 1.00 . A A .  19 PHE HD2  1 1 
        3  3525 1 1  19 PHE HE1  H   3.628   2.385  12.555 1.00 . A A .  19 PHE HE1  1 1 
        3  3526 1 1  19 PHE HE2  H   4.665   5.544   9.917 1.00 . A A .  19 PHE HE2  1 1 
        3  3527 1 1  19 PHE HZ   H   4.124   4.754  12.172 1.00 . A A .  19 PHE HZ   1 1 
        3  3528 1 1  19 PHE N    N   2.991   0.610   6.096 1.00 . A A .  19 PHE N    1 1 
        3  3529 1 1  19 PHE O    O   1.040   2.049   8.616 1.00 . A A .  19 PHE O    1 1 
        3  3530 1 1  20 SER C    C  -0.245   3.908   6.834 1.00 . A A .  20 SER C    1 1 
        3  3531 1 1  20 SER CA   C   1.230   4.288   6.980 1.00 . A A .  20 SER CA   1 1 
        3  3532 1 1  20 SER CB   C   1.621   5.314   5.915 1.00 . A A .  20 SER CB   1 1 
        3  3533 1 1  20 SER H    H   2.752   3.119   6.170 1.00 . A A .  20 SER H    1 1 
        3  3534 1 1  20 SER HA   H   1.422   4.702   7.970 1.00 . A A .  20 SER HA   1 1 
        3  3535 1 1  20 SER HB2  H   1.420   4.904   4.925 1.00 . A A .  20 SER HB2  1 1 
        3  3536 1 1  20 SER HB3  H   1.002   6.204   6.023 1.00 . A A .  20 SER HB3  1 1 
        3  3537 1 1  20 SER HG   H   3.539   4.897   6.309 1.00 . A A .  20 SER HG   1 1 
        3  3538 1 1  20 SER N    N   2.060   3.100   6.893 1.00 . A A .  20 SER N    1 1 
        3  3539 1 1  20 SER O    O  -1.054   4.194   7.716 1.00 . A A .  20 SER O    1 1 
        3  3540 1 1  20 SER OG   O   2.996   5.679   6.005 1.00 . A A .  20 SER OG   1 1 
        3  3541 1 1  21 GLN C    C  -2.526   2.195   6.683 1.00 . A A .  21 GLN C    1 1 
        3  3542 1 1  21 GLN CA   C  -1.913   2.847   5.441 1.00 . A A .  21 GLN CA   1 1 
        3  3543 1 1  21 GLN CB   C  -1.964   1.897   4.243 1.00 . A A .  21 GLN CB   1 1 
        3  3544 1 1  21 GLN CD   C  -1.593   2.354   1.790 1.00 . A A .  21 GLN CD   1 1 
        3  3545 1 1  21 GLN CG   C  -2.495   2.612   2.999 1.00 . A A .  21 GLN CG   1 1 
        3  3546 1 1  21 GLN H    H   0.114   3.040   5.002 1.00 . A A .  21 GLN H    1 1 
        3  3547 1 1  21 GLN HA   H  -2.456   3.760   5.197 1.00 . A A .  21 GLN HA   1 1 
        3  3548 1 1  21 GLN HB2  H  -0.967   1.505   4.043 1.00 . A A .  21 GLN HB2  1 1 
        3  3549 1 1  21 GLN HB3  H  -2.601   1.044   4.476 1.00 . A A .  21 GLN HB3  1 1 
        3  3550 1 1  21 GLN HE21 H  -2.133   0.404   1.863 1.00 . A A .  21 GLN HE21 1 1 
        3  3551 1 1  21 GLN HE22 H  -1.022   0.819   0.601 1.00 . A A .  21 GLN HE22 1 1 
        3  3552 1 1  21 GLN HG2  H  -3.507   2.269   2.782 1.00 . A A .  21 GLN HG2  1 1 
        3  3553 1 1  21 GLN HG3  H  -2.557   3.684   3.189 1.00 . A A .  21 GLN HG3  1 1 
        3  3554 1 1  21 GLN N    N  -0.550   3.269   5.714 1.00 . A A .  21 GLN N    1 1 
        3  3555 1 1  21 GLN NE2  N  -1.582   1.088   1.384 1.00 . A A .  21 GLN NE2  1 1 
        3  3556 1 1  21 GLN O    O  -3.728   2.309   6.919 1.00 . A A .  21 GLN O    1 1 
        3  3557 1 1  21 GLN OE1  O  -0.950   3.246   1.262 1.00 . A A .  21 GLN OE1  1 1 
        3  3558 1 1  22 GLU C    C  -2.635   1.880   9.667 1.00 . A A .  22 GLU C    1 1 
        3  3559 1 1  22 GLU CA   C  -2.114   0.857   8.655 1.00 . A A .  22 GLU CA   1 1 
        3  3560 1 1  22 GLU CB   C  -0.988   0.014   9.258 1.00 . A A .  22 GLU CB   1 1 
        3  3561 1 1  22 GLU CD   C  -1.078  -1.708  11.098 1.00 . A A .  22 GLU CD   1 1 
        3  3562 1 1  22 GLU CG   C  -1.497  -1.370   9.666 1.00 . A A .  22 GLU CG   1 1 
        3  3563 1 1  22 GLU H    H  -0.695   1.439   7.245 1.00 . A A .  22 GLU H    1 1 
        3  3564 1 1  22 GLU HA   H  -2.924   0.199   8.343 1.00 . A A .  22 GLU HA   1 1 
        3  3565 1 1  22 GLU HB2  H  -0.180  -0.090   8.534 1.00 . A A .  22 GLU HB2  1 1 
        3  3566 1 1  22 GLU HB3  H  -0.573   0.524  10.127 1.00 . A A .  22 GLU HB3  1 1 
        3  3567 1 1  22 GLU HG2  H  -2.583  -1.400   9.584 1.00 . A A .  22 GLU HG2  1 1 
        3  3568 1 1  22 GLU HG3  H  -1.105  -2.122   8.981 1.00 . A A .  22 GLU HG3  1 1 
        3  3569 1 1  22 GLU N    N  -1.671   1.527   7.444 1.00 . A A .  22 GLU N    1 1 
        3  3570 1 1  22 GLU O    O  -3.669   1.663  10.297 1.00 . A A .  22 GLU O    1 1 
        3  3571 1 1  22 GLU OE1  O  -0.009  -1.206  11.510 1.00 . A A .  22 GLU OE1  1 1 
        3  3572 1 1  22 GLU OE2  O  -1.835  -2.461  11.748 1.00 . A A .  22 GLU OE2  1 1 
        3  3573 1 1  23 LEU C    C  -3.504   4.755  10.180 1.00 . A A .  23 LEU C    1 1 
        3  3574 1 1  23 LEU CA   C  -2.269   4.028  10.716 1.00 . A A .  23 LEU CA   1 1 
        3  3575 1 1  23 LEU CB   C  -1.080   4.952  10.984 1.00 . A A .  23 LEU CB   1 1 
        3  3576 1 1  23 LEU CD1  C   1.433   4.807  11.132 1.00 . A A .  23 LEU CD1  1 1 
        3  3577 1 1  23 LEU CD2  C   0.017   4.582  13.224 1.00 . A A .  23 LEU CD2  1 1 
        3  3578 1 1  23 LEU CG   C   0.106   4.324  11.719 1.00 . A A .  23 LEU CG   1 1 
        3  3579 1 1  23 LEU H    H  -1.055   3.140   9.275 1.00 . A A .  23 LEU H    1 1 
        3  3580 1 1  23 LEU HA   H  -2.530   3.556  11.663 1.00 . A A .  23 LEU HA   1 1 
        3  3581 1 1  23 LEU HB2  H  -0.725   5.341  10.030 1.00 . A A .  23 LEU HB2  1 1 
        3  3582 1 1  23 LEU HB3  H  -1.431   5.805  11.565 1.00 . A A .  23 LEU HB3  1 1 
        3  3583 1 1  23 LEU HD11 H   2.083   5.150  11.937 1.00 . A A .  23 LEU HD11 1 1 
        3  3584 1 1  23 LEU HD12 H   1.916   3.986  10.600 1.00 . A A .  23 LEU HD12 1 1 
        3  3585 1 1  23 LEU HD13 H   1.247   5.628  10.440 1.00 . A A .  23 LEU HD13 1 1 
        3  3586 1 1  23 LEU HD21 H  -0.325   5.602  13.398 1.00 . A A .  23 LEU HD21 1 1 
        3  3587 1 1  23 LEU HD22 H  -0.688   3.881  13.672 1.00 . A A .  23 LEU HD22 1 1 
        3  3588 1 1  23 LEU HD23 H   1.000   4.446  13.675 1.00 . A A .  23 LEU HD23 1 1 
        3  3589 1 1  23 LEU HG   H   0.064   3.244  11.574 1.00 . A A .  23 LEU HG   1 1 
        3  3590 1 1  23 LEU N    N  -1.895   2.972   9.791 1.00 . A A .  23 LEU N    1 1 
        3  3591 1 1  23 LEU O    O  -4.288   5.307  10.951 1.00 . A A .  23 LEU O    1 1 
        3  3592 1 1  24 LEU C    C  -6.020   4.524   8.399 1.00 . A A .  24 LEU C    1 1 
        3  3593 1 1  24 LEU CA   C  -4.766   5.381   8.214 1.00 . A A .  24 LEU CA   1 1 
        3  3594 1 1  24 LEU CB   C  -4.440   5.685   6.750 1.00 . A A .  24 LEU CB   1 1 
        3  3595 1 1  24 LEU CD1  C  -3.453   7.275   5.060 1.00 . A A .  24 LEU CD1  1 1 
        3  3596 1 1  24 LEU CD2  C  -3.576   7.930   7.507 1.00 . A A .  24 LEU CD2  1 1 
        3  3597 1 1  24 LEU CG   C  -3.404   6.784   6.508 1.00 . A A .  24 LEU CG   1 1 
        3  3598 1 1  24 LEU H    H  -2.998   4.280   8.242 1.00 . A A .  24 LEU H    1 1 
        3  3599 1 1  24 LEU HA   H  -4.924   6.337   8.714 1.00 . A A .  24 LEU HA   1 1 
        3  3600 1 1  24 LEU HB2  H  -4.084   4.768   6.280 1.00 . A A .  24 LEU HB2  1 1 
        3  3601 1 1  24 LEU HB3  H  -5.363   5.965   6.243 1.00 . A A .  24 LEU HB3  1 1 
        3  3602 1 1  24 LEU HD11 H  -4.154   6.663   4.493 1.00 . A A .  24 LEU HD11 1 1 
        3  3603 1 1  24 LEU HD12 H  -3.779   8.315   5.039 1.00 . A A .  24 LEU HD12 1 1 
        3  3604 1 1  24 LEU HD13 H  -2.461   7.197   4.616 1.00 . A A .  24 LEU HD13 1 1 
        3  3605 1 1  24 LEU HD21 H  -4.609   8.277   7.487 1.00 . A A .  24 LEU HD21 1 1 
        3  3606 1 1  24 LEU HD22 H  -3.331   7.578   8.509 1.00 . A A .  24 LEU HD22 1 1 
        3  3607 1 1  24 LEU HD23 H  -2.912   8.751   7.237 1.00 . A A .  24 LEU HD23 1 1 
        3  3608 1 1  24 LEU HG   H  -2.412   6.361   6.671 1.00 . A A .  24 LEU HG   1 1 
        3  3609 1 1  24 LEU N    N  -3.640   4.731   8.862 1.00 . A A .  24 LEU N    1 1 
        3  3610 1 1  24 LEU O    O  -7.135   5.044   8.415 1.00 . A A .  24 LEU O    1 1 
        3  3611 1 1  25 SER C    C  -7.103   2.018  10.210 1.00 . A A .  25 SER C    1 1 
        3  3612 1 1  25 SER CA   C  -6.893   2.291   8.720 1.00 . A A .  25 SER CA   1 1 
        3  3613 1 1  25 SER CB   C  -6.633   0.982   7.972 1.00 . A A .  25 SER CB   1 1 
        3  3614 1 1  25 SER H    H  -4.885   2.811   8.522 1.00 . A A .  25 SER H    1 1 
        3  3615 1 1  25 SER HA   H  -7.766   2.785   8.294 1.00 . A A .  25 SER HA   1 1 
        3  3616 1 1  25 SER HB2  H  -5.700   1.063   7.413 1.00 . A A .  25 SER HB2  1 1 
        3  3617 1 1  25 SER HB3  H  -6.505   0.173   8.691 1.00 . A A .  25 SER HB3  1 1 
        3  3618 1 1  25 SER HG   H  -7.343   0.576   6.145 1.00 . A A .  25 SER HG   1 1 
        3  3619 1 1  25 SER N    N  -5.795   3.225   8.536 1.00 . A A .  25 SER N    1 1 
        3  3620 1 1  25 SER O    O  -8.189   1.613  10.623 1.00 . A A .  25 SER O    1 1 
        3  3621 1 1  25 SER OG   O  -7.694   0.659   7.077 1.00 . A A .  25 SER OG   1 1 
        3  3622 1 1  26 ASN C    C  -6.886   3.177  13.066 1.00 . A A .  26 ASN C    1 1 
        3  3623 1 1  26 ASN CA   C  -6.104   2.036  12.413 1.00 . A A .  26 ASN CA   1 1 
        3  3624 1 1  26 ASN CB   C  -4.700   2.016  13.021 1.00 . A A .  26 ASN CB   1 1 
        3  3625 1 1  26 ASN CG   C  -3.973   0.713  12.680 1.00 . A A .  26 ASN CG   1 1 
        3  3626 1 1  26 ASN H    H  -5.169   2.581  10.633 1.00 . A A .  26 ASN H    1 1 
        3  3627 1 1  26 ASN HA   H  -6.593   1.069  12.538 1.00 . A A .  26 ASN HA   1 1 
        3  3628 1 1  26 ASN HB2  H  -4.127   2.865  12.650 1.00 . A A .  26 ASN HB2  1 1 
        3  3629 1 1  26 ASN HB3  H  -4.768   2.126  14.104 1.00 . A A .  26 ASN HB3  1 1 
        3  3630 1 1  26 ASN HD21 H  -2.260   1.775  12.490 1.00 . A A .  26 ASN HD21 1 1 
        3  3631 1 1  26 ASN HD22 H  -2.112   0.073  12.207 1.00 . A A .  26 ASN HD22 1 1 
        3  3632 1 1  26 ASN N    N  -6.048   2.251  10.977 1.00 . A A .  26 ASN N    1 1 
        3  3633 1 1  26 ASN ND2  N  -2.674   0.866  12.439 1.00 . A A .  26 ASN ND2  1 1 
        3  3634 1 1  26 ASN O    O  -7.945   2.953  13.651 1.00 . A A .  26 ASN O    1 1 
        3  3635 1 1  26 ASN OD1  O  -4.553  -0.359  12.639 1.00 . A A .  26 ASN OD1  1 1 
        3  3636 1 1  27 GLY C    C  -6.285   5.963  14.820 1.00 . A A .  27 GLY C    1 1 
        3  3637 1 1  27 GLY CA   C  -6.968   5.552  13.514 1.00 . A A .  27 GLY CA   1 1 
        3  3638 1 1  27 GLY H    H  -5.474   4.549  12.465 1.00 . A A .  27 GLY H    1 1 
        3  3639 1 1  27 GLY HA2  H  -6.923   6.376  12.801 1.00 . A A .  27 GLY HA2  1 1 
        3  3640 1 1  27 GLY HA3  H  -8.023   5.348  13.699 1.00 . A A .  27 GLY HA3  1 1 
        3  3641 1 1  27 GLY N    N  -6.335   4.375  12.943 1.00 . A A .  27 GLY N    1 1 
        3  3642 1 1  27 GLY O    O  -6.916   6.551  15.696 1.00 . A A .  27 GLY O    1 1 
        3  3643 1 1  28 GLU C    C  -3.952   7.469  16.146 1.00 . A A .  28 GLU C    1 1 
        3  3644 1 1  28 GLU CA   C  -4.228   5.965  16.092 1.00 . A A .  28 GLU CA   1 1 
        3  3645 1 1  28 GLU CB   C  -2.924   5.166  16.131 1.00 . A A .  28 GLU CB   1 1 
        3  3646 1 1  28 GLU CD   C  -2.126   2.779  15.979 1.00 . A A .  28 GLU CD   1 1 
        3  3647 1 1  28 GLU CG   C  -3.077   3.830  15.402 1.00 . A A .  28 GLU CG   1 1 
        3  3648 1 1  28 GLU H    H  -4.498   5.159  14.190 1.00 . A A .  28 GLU H    1 1 
        3  3649 1 1  28 GLU HA   H  -4.851   5.673  16.937 1.00 . A A .  28 GLU HA   1 1 
        3  3650 1 1  28 GLU HB2  H  -2.124   5.746  15.671 1.00 . A A .  28 GLU HB2  1 1 
        3  3651 1 1  28 GLU HB3  H  -2.633   4.989  17.167 1.00 . A A .  28 GLU HB3  1 1 
        3  3652 1 1  28 GLU HG2  H  -4.106   3.481  15.488 1.00 . A A .  28 GLU HG2  1 1 
        3  3653 1 1  28 GLU HG3  H  -2.873   3.966  14.340 1.00 . A A .  28 GLU HG3  1 1 
        3  3654 1 1  28 GLU N    N  -5.004   5.637  14.908 1.00 . A A .  28 GLU N    1 1 
        3  3655 1 1  28 GLU O    O  -3.608   8.003  17.199 1.00 . A A .  28 GLU O    1 1 
        3  3656 1 1  28 GLU OE1  O  -2.287   2.466  17.179 1.00 . A A .  28 GLU OE1  1 1 
        3  3657 1 1  28 GLU OE2  O  -1.261   2.311  15.207 1.00 . A A .  28 GLU OE2  1 1 
        3  3658 1 1  29 LEU C    C  -5.118  10.209  14.291 1.00 . A A .  29 LEU C    1 1 
        3  3659 1 1  29 LEU CA   C  -3.884   9.541  14.900 1.00 . A A .  29 LEU CA   1 1 
        3  3660 1 1  29 LEU CB   C  -2.590   9.827  14.136 1.00 . A A .  29 LEU CB   1 1 
        3  3661 1 1  29 LEU CD1  C  -0.766   8.836  12.704 1.00 . A A .  29 LEU CD1  1 1 
        3  3662 1 1  29 LEU CD2  C  -0.830   8.365  15.196 1.00 . A A .  29 LEU CD2  1 1 
        3  3663 1 1  29 LEU CG   C  -1.652   8.635  13.935 1.00 . A A .  29 LEU CG   1 1 
        3  3664 1 1  29 LEU H    H  -4.392   7.667  14.145 1.00 . A A .  29 LEU H    1 1 
        3  3665 1 1  29 LEU HA   H  -3.751   9.920  15.913 1.00 . A A .  29 LEU HA   1 1 
        3  3666 1 1  29 LEU HB2  H  -2.851  10.229  13.157 1.00 . A A .  29 LEU HB2  1 1 
        3  3667 1 1  29 LEU HB3  H  -2.044  10.608  14.665 1.00 . A A .  29 LEU HB3  1 1 
        3  3668 1 1  29 LEU HD11 H   0.248   9.080  13.023 1.00 . A A .  29 LEU HD11 1 1 
        3  3669 1 1  29 LEU HD12 H  -0.751   7.921  12.113 1.00 . A A .  29 LEU HD12 1 1 
        3  3670 1 1  29 LEU HD13 H  -1.163   9.652  12.100 1.00 . A A .  29 LEU HD13 1 1 
        3  3671 1 1  29 LEU HD21 H   0.213   8.626  15.013 1.00 . A A .  29 LEU HD21 1 1 
        3  3672 1 1  29 LEU HD22 H  -1.216   8.968  16.018 1.00 . A A .  29 LEU HD22 1 1 
        3  3673 1 1  29 LEU HD23 H  -0.899   7.309  15.456 1.00 . A A .  29 LEU HD23 1 1 
        3  3674 1 1  29 LEU HG   H  -2.261   7.749  13.751 1.00 . A A .  29 LEU HG   1 1 
        3  3675 1 1  29 LEU N    N  -4.112   8.109  14.997 1.00 . A A .  29 LEU N    1 1 
        3  3676 1 1  29 LEU O    O  -4.996  11.151  13.509 1.00 . A A .  29 LEU O    1 1 
        3  3677 1 1  30 ASN C    C  -7.910  11.475  14.983 1.00 . A A .  30 ASN C    1 1 
        3  3678 1 1  30 ASN CA   C  -7.534  10.232  14.174 1.00 . A A .  30 ASN CA   1 1 
        3  3679 1 1  30 ASN CB   C  -8.665   9.212  14.322 1.00 . A A .  30 ASN CB   1 1 
        3  3680 1 1  30 ASN CG   C  -9.198   8.784  12.953 1.00 . A A .  30 ASN CG   1 1 
        3  3681 1 1  30 ASN H    H  -6.369   8.931  15.310 1.00 . A A .  30 ASN H    1 1 
        3  3682 1 1  30 ASN HA   H  -7.352  10.457  13.124 1.00 . A A .  30 ASN HA   1 1 
        3  3683 1 1  30 ASN HB2  H  -8.304   8.339  14.865 1.00 . A A .  30 ASN HB2  1 1 
        3  3684 1 1  30 ASN HB3  H  -9.473   9.643  14.912 1.00 . A A .  30 ASN HB3  1 1 
        3  3685 1 1  30 ASN HD21 H  -7.302   8.334  12.407 1.00 . A A .  30 ASN HD21 1 1 
        3  3686 1 1  30 ASN HD22 H  -8.508   8.052  11.197 1.00 . A A .  30 ASN HD22 1 1 
        3  3687 1 1  30 ASN N    N  -6.279   9.696  14.673 1.00 . A A .  30 ASN N    1 1 
        3  3688 1 1  30 ASN ND2  N  -8.258   8.354  12.116 1.00 . A A .  30 ASN ND2  1 1 
        3  3689 1 1  30 ASN O    O  -8.915  12.124  14.698 1.00 . A A .  30 ASN O    1 1 
        3  3690 1 1  30 ASN OD1  O -10.385   8.839  12.676 1.00 . A A .  30 ASN OD1  1 1 
        3  3691 1 1  31 HIS C    C  -6.950  14.202  16.070 1.00 . A A .  31 HIS C    1 1 
        3  3692 1 1  31 HIS CA   C  -7.316  12.923  16.827 1.00 . A A .  31 HIS CA   1 1 
        3  3693 1 1  31 HIS CB   C  -6.563  12.782  18.151 1.00 . A A .  31 HIS CB   1 1 
        3  3694 1 1  31 HIS CD2  C  -4.031  13.430  18.132 1.00 . A A .  31 HIS CD2  1 1 
        3  3695 1 1  31 HIS CE1  C  -3.213  11.474  17.592 1.00 . A A .  31 HIS CE1  1 1 
        3  3696 1 1  31 HIS CG   C  -5.077  12.566  17.993 1.00 . A A .  31 HIS CG   1 1 
        3  3697 1 1  31 HIS H    H  -6.267  11.236  16.200 1.00 . A A .  31 HIS H    1 1 
        3  3698 1 1  31 HIS HA   H  -8.383  12.937  17.050 1.00 . A A .  31 HIS HA   1 1 
        3  3699 1 1  31 HIS HB2  H  -6.728  13.679  18.748 1.00 . A A .  31 HIS HB2  1 1 
        3  3700 1 1  31 HIS HB3  H  -6.984  11.946  18.709 1.00 . A A .  31 HIS HB3  1 1 
        3  3701 1 1  31 HIS HD1  H  -5.041  10.499  17.480 1.00 . A A .  31 HIS HD1  1 1 
        3  3702 1 1  31 HIS HD2  H  -4.107  14.485  18.396 1.00 . A A .  31 HIS HD2  1 1 
        3  3703 1 1  31 HIS HE1  H  -2.500  10.686  17.347 1.00 . A A .  31 HIS HE1  1 1 
        3  3704 1 1  31 HIS N    N  -7.083  11.769  15.975 1.00 . A A .  31 HIS N    1 1 
        3  3705 1 1  31 HIS ND1  N  -4.530  11.341  17.652 1.00 . A A .  31 HIS ND1  1 1 
        3  3706 1 1  31 HIS NE2  N  -2.906  12.769  17.890 1.00 . A A .  31 HIS NE2  1 1 
        3  3707 1 1  31 HIS O    O  -7.344  15.297  16.468 1.00 . A A .  31 HIS O    1 1 
        3  3708 1 1  32 LEU C    C  -6.255  14.936  12.739 1.00 . A A .  32 LEU C    1 1 
        3  3709 1 1  32 LEU CA   C  -5.776  15.145  14.178 1.00 . A A .  32 LEU CA   1 1 
        3  3710 1 1  32 LEU CB   C  -4.265  15.356  14.298 1.00 . A A .  32 LEU CB   1 1 
        3  3711 1 1  32 LEU CD1  C  -3.186  13.165  13.668 1.00 . A A .  32 LEU CD1  1 1 
        3  3712 1 1  32 LEU CD2  C  -2.170  14.612  15.488 1.00 . A A .  32 LEU CD2  1 1 
        3  3713 1 1  32 LEU CG   C  -3.459  14.157  14.801 1.00 . A A .  32 LEU CG   1 1 
        3  3714 1 1  32 LEU H    H  -5.883  13.126  14.677 1.00 . A A .  32 LEU H    1 1 
        3  3715 1 1  32 LEU HA   H  -6.259  16.038  14.576 1.00 . A A .  32 LEU HA   1 1 
        3  3716 1 1  32 LEU HB2  H  -3.879  15.644  13.321 1.00 . A A .  32 LEU HB2  1 1 
        3  3717 1 1  32 LEU HB3  H  -4.089  16.195  14.971 1.00 . A A .  32 LEU HB3  1 1 
        3  3718 1 1  32 LEU HD11 H  -3.991  13.221  12.936 1.00 . A A .  32 LEU HD11 1 1 
        3  3719 1 1  32 LEU HD12 H  -2.240  13.414  13.188 1.00 . A A .  32 LEU HD12 1 1 
        3  3720 1 1  32 LEU HD13 H  -3.133  12.155  14.074 1.00 . A A .  32 LEU HD13 1 1 
        3  3721 1 1  32 LEU HD21 H  -1.588  13.739  15.785 1.00 . A A .  32 LEU HD21 1 1 
        3  3722 1 1  32 LEU HD22 H  -1.585  15.219  14.797 1.00 . A A .  32 LEU HD22 1 1 
        3  3723 1 1  32 LEU HD23 H  -2.417  15.202  16.370 1.00 . A A .  32 LEU HD23 1 1 
        3  3724 1 1  32 LEU HG   H  -4.055  13.634  15.550 1.00 . A A .  32 LEU HG   1 1 
        3  3725 1 1  32 LEU N    N  -6.200  14.020  14.993 1.00 . A A .  32 LEU N    1 1 
        3  3726 1 1  32 LEU O    O  -6.701  13.847  12.382 1.00 . A A .  32 LEU O    1 1 
        3  3727 1 1  33 PRO C    C  -5.545  15.196   9.695 1.00 . A A .  33 PRO C    1 1 
        3  3728 1 1  33 PRO CA   C  -6.558  15.970  10.541 1.00 . A A .  33 PRO CA   1 1 
        3  3729 1 1  33 PRO CB   C  -6.699  17.423  10.116 1.00 . A A .  33 PRO CB   1 1 
        3  3730 1 1  33 PRO CD   C  -5.618  17.330  12.321 1.00 . A A .  33 PRO CD   1 1 
        3  3731 1 1  33 PRO CG   C  -5.913  18.233  11.134 1.00 . A A .  33 PRO CG   1 1 
        3  3732 1 1  33 PRO HA   H  -7.422  15.474  10.456 1.00 . A A .  33 PRO HA   1 1 
        3  3733 1 1  33 PRO HB2  H  -6.308  17.575   9.110 1.00 . A A .  33 PRO HB2  1 1 
        3  3734 1 1  33 PRO HB3  H  -7.746  17.725  10.100 1.00 . A A .  33 PRO HB3  1 1 
        3  3735 1 1  33 PRO HD2  H  -4.549  17.283  12.526 1.00 . A A .  33 PRO HD2  1 1 
        3  3736 1 1  33 PRO HD3  H  -6.100  17.697  13.227 1.00 . A A .  33 PRO HD3  1 1 
        3  3737 1 1  33 PRO HG2  H  -4.987  18.602  10.695 1.00 . A A .  33 PRO HG2  1 1 
        3  3738 1 1  33 PRO HG3  H  -6.485  19.105  11.451 1.00 . A A .  33 PRO HG3  1 1 
        3  3739 1 1  33 PRO N    N  -6.142  16.024  11.932 1.00 . A A .  33 PRO N    1 1 
        3  3740 1 1  33 PRO O    O  -4.396  15.024  10.099 1.00 . A A .  33 PRO O    1 1 
        3  3741 1 1  34 LEU C    C  -3.765  14.630   7.602 1.00 . A A .  34 LEU C    1 1 
        3  3742 1 1  34 LEU CA   C  -5.157  13.996   7.632 1.00 . A A .  34 LEU CA   1 1 
        3  3743 1 1  34 LEU CB   C  -5.811  13.881   6.253 1.00 . A A .  34 LEU CB   1 1 
        3  3744 1 1  34 LEU CD1  C  -3.619  13.197   5.211 1.00 . A A .  34 LEU CD1  1 1 
        3  3745 1 1  34 LEU CD2  C  -5.446  11.477   5.585 1.00 . A A .  34 LEU CD2  1 1 
        3  3746 1 1  34 LEU CG   C  -5.126  12.938   5.262 1.00 . A A .  34 LEU CG   1 1 
        3  3747 1 1  34 LEU H    H  -6.944  14.892   8.217 1.00 . A A .  34 LEU H    1 1 
        3  3748 1 1  34 LEU HA   H  -5.068  12.985   8.031 1.00 . A A .  34 LEU HA   1 1 
        3  3749 1 1  34 LEU HB2  H  -6.840  13.550   6.387 1.00 . A A .  34 LEU HB2  1 1 
        3  3750 1 1  34 LEU HB3  H  -5.851  14.876   5.809 1.00 . A A .  34 LEU HB3  1 1 
        3  3751 1 1  34 LEU HD11 H  -3.138  12.715   6.062 1.00 . A A .  34 LEU HD11 1 1 
        3  3752 1 1  34 LEU HD12 H  -3.211  12.789   4.286 1.00 . A A .  34 LEU HD12 1 1 
        3  3753 1 1  34 LEU HD13 H  -3.433  14.270   5.248 1.00 . A A .  34 LEU HD13 1 1 
        3  3754 1 1  34 LEU HD21 H  -6.386  11.197   5.109 1.00 . A A .  34 LEU HD21 1 1 
        3  3755 1 1  34 LEU HD22 H  -4.645  10.839   5.211 1.00 . A A .  34 LEU HD22 1 1 
        3  3756 1 1  34 LEU HD23 H  -5.535  11.355   6.665 1.00 . A A .  34 LEU HD23 1 1 
        3  3757 1 1  34 LEU HG   H  -5.521  13.142   4.267 1.00 . A A .  34 LEU HG   1 1 
        3  3758 1 1  34 LEU N    N  -6.008  14.748   8.538 1.00 . A A .  34 LEU N    1 1 
        3  3759 1 1  34 LEU O    O  -2.768  13.961   7.872 1.00 . A A .  34 LEU O    1 1 
        3  3760 1 1  35 LYS C    C  -1.548  16.142   8.300 1.00 . A A .  35 LYS C    1 1 
        3  3761 1 1  35 LYS CA   C  -2.488  16.644   7.203 1.00 . A A .  35 LYS CA   1 1 
        3  3762 1 1  35 LYS CB   C  -2.744  18.152   7.255 1.00 . A A .  35 LYS CB   1 1 
        3  3763 1 1  35 LYS CD   C  -0.958  19.249   5.853 1.00 . A A .  35 LYS CD   1 1 
        3  3764 1 1  35 LYS CE   C   0.371  20.007   5.872 1.00 . A A .  35 LYS CE   1 1 
        3  3765 1 1  35 LYS CG   C  -1.428  18.931   7.274 1.00 . A A .  35 LYS CG   1 1 
        3  3766 1 1  35 LYS H    H  -4.556  16.449   7.053 1.00 . A A .  35 LYS H    1 1 
        3  3767 1 1  35 LYS HA   H  -2.036  16.428   6.235 1.00 . A A .  35 LYS HA   1 1 
        3  3768 1 1  35 LYS HB2  H  -3.337  18.454   6.392 1.00 . A A .  35 LYS HB2  1 1 
        3  3769 1 1  35 LYS HB3  H  -3.328  18.395   8.143 1.00 . A A .  35 LYS HB3  1 1 
        3  3770 1 1  35 LYS HD2  H  -0.845  18.324   5.288 1.00 . A A .  35 LYS HD2  1 1 
        3  3771 1 1  35 LYS HD3  H  -1.713  19.846   5.342 1.00 . A A .  35 LYS HD3  1 1 
        3  3772 1 1  35 LYS HE2  H   0.808  19.963   6.870 1.00 . A A .  35 LYS HE2  1 1 
        3  3773 1 1  35 LYS HE3  H   1.078  19.530   5.194 1.00 . A A .  35 LYS HE3  1 1 
        3  3774 1 1  35 LYS HG2  H  -1.558  19.858   7.834 1.00 . A A .  35 LYS HG2  1 1 
        3  3775 1 1  35 LYS HG3  H  -0.664  18.351   7.792 1.00 . A A .  35 LYS HG3  1 1 
        3  3776 1 1  35 LYS HZ1  H  -0.591  21.806   5.996 1.00 . A A .  35 LYS HZ1  1 1 
        3  3777 1 1  35 LYS HZ2  H   1.002  21.940   5.662 1.00 . A A .  35 LYS HZ2  1 1 
        3  3778 1 1  35 LYS HZ3  H  -0.040  21.463   4.498 1.00 . A A .  35 LYS HZ3  1 1 
        3  3779 1 1  35 LYS N    N  -3.741  15.913   7.271 1.00 . A A .  35 LYS N    1 1 
        3  3780 1 1  35 LYS NZ   N   0.169  21.418   5.475 1.00 . A A .  35 LYS NZ   1 1 
        3  3781 1 1  35 LYS O    O  -0.532  15.511   8.012 1.00 . A A .  35 LYS O    1 1 
        3  3782 1 1  36 GLU C    C  -0.844  14.524  10.615 1.00 . A A .  36 GLU C    1 1 
        3  3783 1 1  36 GLU CA   C  -1.123  16.027  10.678 1.00 . A A .  36 GLU CA   1 1 
        3  3784 1 1  36 GLU CB   C  -1.812  16.401  11.992 1.00 . A A .  36 GLU CB   1 1 
        3  3785 1 1  36 GLU CD   C  -0.920  17.719  13.949 1.00 . A A .  36 GLU CD   1 1 
        3  3786 1 1  36 GLU CG   C  -1.350  17.775  12.481 1.00 . A A .  36 GLU CG   1 1 
        3  3787 1 1  36 GLU H    H  -2.748  16.954   9.762 1.00 . A A .  36 GLU H    1 1 
        3  3788 1 1  36 GLU HA   H  -0.188  16.581  10.595 1.00 . A A .  36 GLU HA   1 1 
        3  3789 1 1  36 GLU HB2  H  -2.893  16.405  11.852 1.00 . A A .  36 GLU HB2  1 1 
        3  3790 1 1  36 GLU HB3  H  -1.592  15.649  12.750 1.00 . A A .  36 GLU HB3  1 1 
        3  3791 1 1  36 GLU HG2  H  -0.519  18.123  11.868 1.00 . A A .  36 GLU HG2  1 1 
        3  3792 1 1  36 GLU HG3  H  -2.158  18.498  12.363 1.00 . A A .  36 GLU HG3  1 1 
        3  3793 1 1  36 GLU N    N  -1.920  16.440   9.536 1.00 . A A .  36 GLU N    1 1 
        3  3794 1 1  36 GLU O    O   0.307  14.098  10.700 1.00 . A A .  36 GLU O    1 1 
        3  3795 1 1  36 GLU OE1  O  -1.824  17.800  14.808 1.00 . A A .  36 GLU OE1  1 1 
        3  3796 1 1  36 GLU OE2  O   0.303  17.596  14.177 1.00 . A A .  36 GLU OE2  1 1 
        3  3797 1 1  37 ARG C    C  -0.559  11.922   9.586 1.00 . A A .  37 ARG C    1 1 
        3  3798 1 1  37 ARG CA   C  -1.802  12.314  10.389 1.00 . A A .  37 ARG CA   1 1 
        3  3799 1 1  37 ARG CB   C  -3.039  11.697   9.733 1.00 . A A .  37 ARG CB   1 1 
        3  3800 1 1  37 ARG CD   C  -5.216  10.490  10.138 1.00 . A A .  37 ARG CD   1 1 
        3  3801 1 1  37 ARG CG   C  -3.925  11.009  10.774 1.00 . A A .  37 ARG CG   1 1 
        3  3802 1 1  37 ARG CZ   C  -7.656  10.820  10.522 1.00 . A A .  37 ARG CZ   1 1 
        3  3803 1 1  37 ARG H    H  -2.849  14.115  10.396 1.00 . A A .  37 ARG H    1 1 
        3  3804 1 1  37 ARG HA   H  -1.719  11.986  11.425 1.00 . A A .  37 ARG HA   1 1 
        3  3805 1 1  37 ARG HB2  H  -3.609  12.473   9.222 1.00 . A A .  37 ARG HB2  1 1 
        3  3806 1 1  37 ARG HB3  H  -2.732  10.975   8.977 1.00 . A A .  37 ARG HB3  1 1 
        3  3807 1 1  37 ARG HD2  H  -5.190  10.650   9.060 1.00 . A A .  37 ARG HD2  1 1 
        3  3808 1 1  37 ARG HD3  H  -5.305   9.416  10.299 1.00 . A A .  37 ARG HD3  1 1 
        3  3809 1 1  37 ARG HE   H  -6.212  11.981  11.306 1.00 . A A .  37 ARG HE   1 1 
        3  3810 1 1  37 ARG HG2  H  -3.381  10.180  11.229 1.00 . A A .  37 ARG HG2  1 1 
        3  3811 1 1  37 ARG HG3  H  -4.164  11.710  11.574 1.00 . A A .  37 ARG HG3  1 1 
        3  3812 1 1  37 ARG HH11 H  -7.191   9.246   9.321 1.00 . A A .  37 ARG HH11 1 1 
        3  3813 1 1  37 ARG HH12 H  -8.883   9.487   9.597 1.00 . A A .  37 ARG HH12 1 1 
        3  3814 1 1  37 ARG HH21 H  -8.445  12.301  11.671 1.00 . A A .  37 ARG HH21 1 1 
        3  3815 1 1  37 ARG HH22 H  -9.601  11.237  10.943 1.00 . A A .  37 ARG HH22 1 1 
        3  3816 1 1  37 ARG N    N  -1.917  13.761  10.465 1.00 . A A .  37 ARG N    1 1 
        3  3817 1 1  37 ARG NE   N  -6.383  11.187  10.724 1.00 . A A .  37 ARG NE   1 1 
        3  3818 1 1  37 ARG NH1  N  -7.933   9.761   9.748 1.00 . A A .  37 ARG NH1  1 1 
        3  3819 1 1  37 ARG NH2  N  -8.652  11.511  11.093 1.00 . A A .  37 ARG NH2  1 1 
        3  3820 1 1  37 ARG O    O   0.356  11.297  10.119 1.00 . A A .  37 ARG O    1 1 
        3  3821 1 1  38 MET C    C   1.883  12.330   8.110 1.00 . A A .  38 MET C    1 1 
        3  3822 1 1  38 MET CA   C   0.548  12.003   7.437 1.00 . A A .  38 MET CA   1 1 
        3  3823 1 1  38 MET CB   C   0.414  12.813   6.147 1.00 . A A .  38 MET CB   1 1 
        3  3824 1 1  38 MET CE   C  -0.254   9.506   4.941 1.00 . A A .  38 MET CE   1 1 
        3  3825 1 1  38 MET CG   C  -0.638  12.200   5.221 1.00 . A A .  38 MET CG   1 1 
        3  3826 1 1  38 MET H    H  -1.316  12.815   7.893 1.00 . A A .  38 MET H    1 1 
        3  3827 1 1  38 MET HA   H   0.484  10.933   7.243 1.00 . A A .  38 MET HA   1 1 
        3  3828 1 1  38 MET HB2  H   0.139  13.841   6.385 1.00 . A A .  38 MET HB2  1 1 
        3  3829 1 1  38 MET HB3  H   1.376  12.851   5.635 1.00 . A A .  38 MET HB3  1 1 
        3  3830 1 1  38 MET HE1  H  -1.018   8.969   4.380 1.00 . A A .  38 MET HE1  1 1 
        3  3831 1 1  38 MET HE2  H   0.644   8.893   5.011 1.00 . A A .  38 MET HE2  1 1 
        3  3832 1 1  38 MET HE3  H  -0.625   9.722   5.943 1.00 . A A .  38 MET HE3  1 1 
        3  3833 1 1  38 MET HG2  H  -1.405  11.698   5.810 1.00 . A A .  38 MET HG2  1 1 
        3  3834 1 1  38 MET HG3  H  -1.136  12.985   4.652 1.00 . A A .  38 MET HG3  1 1 
        3  3835 1 1  38 MET N    N  -0.567  12.307   8.318 1.00 . A A .  38 MET N    1 1 
        3  3836 1 1  38 MET O    O   2.655  11.430   8.435 1.00 . A A .  38 MET O    1 1 
        3  3837 1 1  38 MET SD   S   0.132  11.036   4.107 1.00 . A A .  38 MET SD   1 1 
        3  3838 1 1  39 VAL C    C   3.600  13.255  10.190 1.00 . A A .  39 VAL C    1 1 
        3  3839 1 1  39 VAL CA   C   3.341  14.079   8.927 1.00 . A A .  39 VAL CA   1 1 
        3  3840 1 1  39 VAL CB   C   3.261  15.582   9.199 1.00 . A A .  39 VAL CB   1 1 
        3  3841 1 1  39 VAL CG1  C   1.993  15.931   9.981 1.00 . A A .  39 VAL CG1  1 1 
        3  3842 1 1  39 VAL CG2  C   4.510  16.074   9.933 1.00 . A A .  39 VAL CG2  1 1 
        3  3843 1 1  39 VAL H    H   1.479  14.347   8.032 1.00 . A A .  39 VAL H    1 1 
        3  3844 1 1  39 VAL HA   H   4.154  13.906   8.222 1.00 . A A .  39 VAL HA   1 1 
        3  3845 1 1  39 VAL HB   H   3.213  16.095   8.238 1.00 . A A .  39 VAL HB   1 1 
        3  3846 1 1  39 VAL HG11 H   2.002  15.410  10.939 1.00 . A A .  39 VAL HG11 1 1 
        3  3847 1 1  39 VAL HG12 H   1.956  17.007  10.153 1.00 . A A .  39 VAL HG12 1 1 
        3  3848 1 1  39 VAL HG13 H   1.117  15.624   9.409 1.00 . A A .  39 VAL HG13 1 1 
        3  3849 1 1  39 VAL HG21 H   5.093  15.217  10.271 1.00 . A A .  39 VAL HG21 1 1 
        3  3850 1 1  39 VAL HG22 H   5.114  16.679   9.256 1.00 . A A .  39 VAL HG22 1 1 
        3  3851 1 1  39 VAL HG23 H   4.214  16.675  10.792 1.00 . A A .  39 VAL HG23 1 1 
        3  3852 1 1  39 VAL N    N   2.113  13.621   8.299 1.00 . A A .  39 VAL N    1 1 
        3  3853 1 1  39 VAL O    O   4.714  12.781  10.408 1.00 . A A .  39 VAL O    1 1 
        3  3854 1 1  40 GLU C    C   3.107  10.920  11.933 1.00 . A A .  40 GLU C    1 1 
        3  3855 1 1  40 GLU CA   C   2.653  12.352  12.224 1.00 . A A .  40 GLU CA   1 1 
        3  3856 1 1  40 GLU CB   C   1.325  12.363  12.983 1.00 . A A .  40 GLU CB   1 1 
        3  3857 1 1  40 GLU CD   C   2.405  13.706  14.825 1.00 . A A .  40 GLU CD   1 1 
        3  3858 1 1  40 GLU CG   C   1.557  12.477  14.492 1.00 . A A .  40 GLU CG   1 1 
        3  3859 1 1  40 GLU H    H   1.650  13.499  10.803 1.00 . A A .  40 GLU H    1 1 
        3  3860 1 1  40 GLU HA   H   3.409  12.866  12.818 1.00 . A A .  40 GLU HA   1 1 
        3  3861 1 1  40 GLU HB2  H   0.714  13.199  12.642 1.00 . A A .  40 GLU HB2  1 1 
        3  3862 1 1  40 GLU HB3  H   0.769  11.451  12.765 1.00 . A A .  40 GLU HB3  1 1 
        3  3863 1 1  40 GLU HG2  H   0.598  12.541  15.007 1.00 . A A .  40 GLU HG2  1 1 
        3  3864 1 1  40 GLU HG3  H   2.054  11.577  14.855 1.00 . A A .  40 GLU HG3  1 1 
        3  3865 1 1  40 GLU N    N   2.553  13.110  10.988 1.00 . A A .  40 GLU N    1 1 
        3  3866 1 1  40 GLU O    O   3.909  10.356  12.675 1.00 . A A .  40 GLU O    1 1 
        3  3867 1 1  40 GLU OE1  O   1.805  14.796  14.939 1.00 . A A .  40 GLU OE1  1 1 
        3  3868 1 1  40 GLU OE2  O   3.635  13.527  14.958 1.00 . A A .  40 GLU OE2  1 1 
        3  3869 1 1  41 ILE C    C   4.413   8.936  10.164 1.00 . A A .  41 ILE C    1 1 
        3  3870 1 1  41 ILE CA   C   2.912   9.017  10.452 1.00 . A A .  41 ILE CA   1 1 
        3  3871 1 1  41 ILE CB   C   2.036   8.568   9.282 1.00 . A A .  41 ILE CB   1 1 
        3  3872 1 1  41 ILE CD1  C  -0.369   8.693   8.532 1.00 . A A .  41 ILE CD1  1 1 
        3  3873 1 1  41 ILE CG1  C   0.573   8.436   9.710 1.00 . A A .  41 ILE CG1  1 1 
        3  3874 1 1  41 ILE CG2  C   2.570   7.275   8.662 1.00 . A A .  41 ILE CG2  1 1 
        3  3875 1 1  41 ILE H    H   1.920  10.838  10.252 1.00 . A A .  41 ILE H    1 1 
        3  3876 1 1  41 ILE HA   H   2.686   8.363  11.294 1.00 . A A .  41 ILE HA   1 1 
        3  3877 1 1  41 ILE HB   H   2.077   9.336   8.509 1.00 . A A .  41 ILE HB   1 1 
        3  3878 1 1  41 ILE HD11 H   0.199   8.671   7.602 1.00 . A A .  41 ILE HD11 1 1 
        3  3879 1 1  41 ILE HD12 H  -1.138   7.921   8.507 1.00 . A A .  41 ILE HD12 1 1 
        3  3880 1 1  41 ILE HD13 H  -0.838   9.670   8.649 1.00 . A A .  41 ILE HD13 1 1 
        3  3881 1 1  41 ILE HG12 H   0.396   7.438  10.111 1.00 . A A .  41 ILE HG12 1 1 
        3  3882 1 1  41 ILE HG13 H   0.360   9.144  10.512 1.00 . A A .  41 ILE HG13 1 1 
        3  3883 1 1  41 ILE HG21 H   2.808   7.446   7.612 1.00 . A A .  41 ILE HG21 1 1 
        3  3884 1 1  41 ILE HG22 H   3.470   6.963   9.192 1.00 . A A .  41 ILE HG22 1 1 
        3  3885 1 1  41 ILE HG23 H   1.813   6.494   8.741 1.00 . A A .  41 ILE HG23 1 1 
        3  3886 1 1  41 ILE N    N   2.573  10.373  10.851 1.00 . A A .  41 ILE N    1 1 
        3  3887 1 1  41 ILE O    O   5.116   8.113  10.747 1.00 . A A .  41 ILE O    1 1 
        3  3888 1 1  42 GLY C    C   7.160   9.726  10.127 1.00 . A A .  42 GLY C    1 1 
        3  3889 1 1  42 GLY CA   C   6.262   9.837   8.893 1.00 . A A .  42 GLY CA   1 1 
        3  3890 1 1  42 GLY H    H   4.279  10.468   8.796 1.00 . A A .  42 GLY H    1 1 
        3  3891 1 1  42 GLY HA2  H   6.481   9.021   8.205 1.00 . A A .  42 GLY HA2  1 1 
        3  3892 1 1  42 GLY HA3  H   6.478  10.766   8.364 1.00 . A A .  42 GLY HA3  1 1 
        3  3893 1 1  42 GLY N    N   4.858   9.801   9.265 1.00 . A A .  42 GLY N    1 1 
        3  3894 1 1  42 GLY O    O   8.205   9.080  10.082 1.00 . A A .  42 GLY O    1 1 
        3  3895 1 1  43 SER C    C   7.503   8.927  13.013 1.00 . A A .  43 SER C    1 1 
        3  3896 1 1  43 SER CA   C   7.468  10.347  12.444 1.00 . A A .  43 SER CA   1 1 
        3  3897 1 1  43 SER CB   C   6.866  11.313  13.466 1.00 . A A .  43 SER CB   1 1 
        3  3898 1 1  43 SER H    H   5.866  10.889  11.228 1.00 . A A .  43 SER H    1 1 
        3  3899 1 1  43 SER HA   H   8.473  10.678  12.180 1.00 . A A .  43 SER HA   1 1 
        3  3900 1 1  43 SER HB2  H   6.239  12.041  12.950 1.00 . A A .  43 SER HB2  1 1 
        3  3901 1 1  43 SER HB3  H   6.219  10.762  14.148 1.00 . A A .  43 SER HB3  1 1 
        3  3902 1 1  43 SER HG   H   7.602  12.054  15.173 1.00 . A A .  43 SER HG   1 1 
        3  3903 1 1  43 SER N    N   6.718  10.366  11.200 1.00 . A A .  43 SER N    1 1 
        3  3904 1 1  43 SER O    O   8.574   8.400  13.310 1.00 . A A .  43 SER O    1 1 
        3  3905 1 1  43 SER OG   O   7.869  11.997  14.211 1.00 . A A .  43 SER OG   1 1 
        3  3906 1 1  44 ARG C    C   7.045   6.030  12.846 1.00 . A A .  44 ARG C    1 1 
        3  3907 1 1  44 ARG CA   C   6.200   7.000  13.675 1.00 . A A .  44 ARG CA   1 1 
        3  3908 1 1  44 ARG CB   C   4.743   6.532  13.667 1.00 . A A .  44 ARG CB   1 1 
        3  3909 1 1  44 ARG CD   C   2.726   6.470  15.179 1.00 . A A .  44 ARG CD   1 1 
        3  3910 1 1  44 ARG CG   C   3.914   7.304  14.695 1.00 . A A .  44 ARG CG   1 1 
        3  3911 1 1  44 ARG CZ   C   2.237   5.022  17.147 1.00 . A A .  44 ARG CZ   1 1 
        3  3912 1 1  44 ARG H    H   5.452   8.785  12.902 1.00 . A A .  44 ARG H    1 1 
        3  3913 1 1  44 ARG HA   H   6.570   7.068  14.698 1.00 . A A .  44 ARG HA   1 1 
        3  3914 1 1  44 ARG HB2  H   4.318   6.671  12.673 1.00 . A A .  44 ARG HB2  1 1 
        3  3915 1 1  44 ARG HB3  H   4.699   5.465  13.886 1.00 . A A .  44 ARG HB3  1 1 
        3  3916 1 1  44 ARG HD2  H   1.824   7.081  15.193 1.00 . A A .  44 ARG HD2  1 1 
        3  3917 1 1  44 ARG HD3  H   2.542   5.648  14.487 1.00 . A A .  44 ARG HD3  1 1 
        3  3918 1 1  44 ARG HE   H   3.799   6.285  17.020 1.00 . A A .  44 ARG HE   1 1 
        3  3919 1 1  44 ARG HG2  H   4.542   7.575  15.544 1.00 . A A .  44 ARG HG2  1 1 
        3  3920 1 1  44 ARG HG3  H   3.555   8.234  14.254 1.00 . A A .  44 ARG HG3  1 1 
        3  3921 1 1  44 ARG HH11 H   0.912   4.846  15.614 1.00 . A A .  44 ARG HH11 1 1 
        3  3922 1 1  44 ARG HH12 H   0.586   3.845  16.990 1.00 . A A .  44 ARG HH12 1 1 
        3  3923 1 1  44 ARG HH21 H   3.369   4.965  18.835 1.00 . A A .  44 ARG HH21 1 1 
        3  3924 1 1  44 ARG HH22 H   1.993   3.914  18.834 1.00 . A A .  44 ARG HH22 1 1 
        3  3925 1 1  44 ARG N    N   6.319   8.349  13.147 1.00 . A A .  44 ARG N    1 1 
        3  3926 1 1  44 ARG NE   N   2.998   5.938  16.533 1.00 . A A .  44 ARG NE   1 1 
        3  3927 1 1  44 ARG NH1  N   1.153   4.529  16.532 1.00 . A A .  44 ARG NH1  1 1 
        3  3928 1 1  44 ARG NH2  N   2.560   4.598  18.376 1.00 . A A .  44 ARG NH2  1 1 
        3  3929 1 1  44 ARG O    O   7.663   5.118  13.393 1.00 . A A .  44 ARG O    1 1 
        3  3930 1 1  45 TRP C    C   9.289   5.625  10.925 1.00 . A A .  45 TRP C    1 1 
        3  3931 1 1  45 TRP CA   C   7.802   5.417  10.633 1.00 . A A .  45 TRP CA   1 1 
        3  3932 1 1  45 TRP CB   C   7.433   5.709   9.177 1.00 . A A .  45 TRP CB   1 1 
        3  3933 1 1  45 TRP CD1  C   9.406   5.642   7.515 1.00 . A A .  45 TRP CD1  1 1 
        3  3934 1 1  45 TRP CD2  C   8.336   3.709   7.680 1.00 . A A .  45 TRP CD2  1 1 
        3  3935 1 1  45 TRP CE2  C   9.357   3.538   6.768 1.00 . A A .  45 TRP CE2  1 1 
        3  3936 1 1  45 TRP CE3  C   7.464   2.656   8.010 1.00 . A A .  45 TRP CE3  1 1 
        3  3937 1 1  45 TRP CG   C   8.376   5.071   8.155 1.00 . A A .  45 TRP CG   1 1 
        3  3938 1 1  45 TRP CH2  C   8.748   1.264   6.424 1.00 . A A .  45 TRP CH2  1 1 
        3  3939 1 1  45 TRP CZ2  C   9.604   2.327   6.111 1.00 . A A .  45 TRP CZ2  1 1 
        3  3940 1 1  45 TRP CZ3  C   7.723   1.452   7.344 1.00 . A A .  45 TRP CZ3  1 1 
        3  3941 1 1  45 TRP H    H   6.538   7.004  11.105 1.00 . A A .  45 TRP H    1 1 
        3  3942 1 1  45 TRP HA   H   7.525   4.381  10.829 1.00 . A A .  45 TRP HA   1 1 
        3  3943 1 1  45 TRP HB2  H   6.419   5.353   8.992 1.00 . A A .  45 TRP HB2  1 1 
        3  3944 1 1  45 TRP HB3  H   7.424   6.788   9.024 1.00 . A A .  45 TRP HB3  1 1 
        3  3945 1 1  45 TRP HD1  H   9.712   6.679   7.648 1.00 . A A .  45 TRP HD1  1 1 
        3  3946 1 1  45 TRP HE1  H  10.889   4.960   6.029 1.00 . A A .  45 TRP HE1  1 1 
        3  3947 1 1  45 TRP HE3  H   6.650   2.766   8.726 1.00 . A A .  45 TRP HE3  1 1 
        3  3948 1 1  45 TRP HH2  H   8.884   0.293   5.947 1.00 . A A .  45 TRP HH2  1 1 
        3  3949 1 1  45 TRP HZ2  H  10.418   2.217   5.395 1.00 . A A .  45 TRP HZ2  1 1 
        3  3950 1 1  45 TRP HZ3  H   7.077   0.603   7.563 1.00 . A A .  45 TRP HZ3  1 1 
        3  3951 1 1  45 TRP N    N   7.044   6.259  11.542 1.00 . A A .  45 TRP N    1 1 
        3  3952 1 1  45 TRP NE1  N  10.029   4.751   6.665 1.00 . A A .  45 TRP NE1  1 1 
        3  3953 1 1  45 TRP O    O  10.088   4.699  10.790 1.00 . A A .  45 TRP O    1 1 
        3  3954 1 1  46 GLN C    C  11.347   6.727  13.049 1.00 . A A .  46 GLN C    1 1 
        3  3955 1 1  46 GLN CA   C  10.994   7.188  11.633 1.00 . A A .  46 GLN CA   1 1 
        3  3956 1 1  46 GLN CB   C  11.238   8.689  11.468 1.00 . A A .  46 GLN CB   1 1 
        3  3957 1 1  46 GLN CD   C  12.687   9.586   9.609 1.00 . A A .  46 GLN CD   1 1 
        3  3958 1 1  46 GLN CG   C  11.295   9.077   9.989 1.00 . A A .  46 GLN CG   1 1 
        3  3959 1 1  46 GLN H    H   8.961   7.594  11.427 1.00 . A A .  46 GLN H    1 1 
        3  3960 1 1  46 GLN HA   H  11.599   6.646  10.906 1.00 . A A .  46 GLN HA   1 1 
        3  3961 1 1  46 GLN HB2  H  10.443   9.247  11.963 1.00 . A A .  46 GLN HB2  1 1 
        3  3962 1 1  46 GLN HB3  H  12.172   8.966  11.957 1.00 . A A .  46 GLN HB3  1 1 
        3  3963 1 1  46 GLN HE21 H  12.109   9.577   7.669 1.00 . A A .  46 GLN HE21 1 1 
        3  3964 1 1  46 GLN HE22 H  13.735  10.101   7.956 1.00 . A A .  46 GLN HE22 1 1 
        3  3965 1 1  46 GLN HG2  H  11.039   8.214   9.374 1.00 . A A .  46 GLN HG2  1 1 
        3  3966 1 1  46 GLN HG3  H  10.553   9.848   9.782 1.00 . A A .  46 GLN HG3  1 1 
        3  3967 1 1  46 GLN N    N   9.617   6.847  11.320 1.00 . A A .  46 GLN N    1 1 
        3  3968 1 1  46 GLN NE2  N  12.858   9.770   8.303 1.00 . A A .  46 GLN NE2  1 1 
        3  3969 1 1  46 GLN O    O  12.510   6.765  13.446 1.00 . A A .  46 GLN O    1 1 
        3  3970 1 1  46 GLN OE1  O  13.549   9.798  10.447 1.00 . A A .  46 GLN OE1  1 1 
        3  3971 1 1  47 ARG C    C  10.766   4.327  15.148 1.00 . A A .  47 ARG C    1 1 
        3  3972 1 1  47 ARG CA   C  10.508   5.835  15.134 1.00 . A A .  47 ARG CA   1 1 
        3  3973 1 1  47 ARG CB   C   9.281   6.144  15.996 1.00 . A A .  47 ARG CB   1 1 
        3  3974 1 1  47 ARG CD   C   7.953   7.957  17.140 1.00 . A A .  47 ARG CD   1 1 
        3  3975 1 1  47 ARG CG   C   9.236   7.626  16.374 1.00 . A A .  47 ARG CG   1 1 
        3  3976 1 1  47 ARG CZ   C   7.225   7.886  19.522 1.00 . A A .  47 ARG CZ   1 1 
        3  3977 1 1  47 ARG H    H   9.377   6.275  13.441 1.00 . A A .  47 ARG H    1 1 
        3  3978 1 1  47 ARG HA   H  11.375   6.385  15.501 1.00 . A A .  47 ARG HA   1 1 
        3  3979 1 1  47 ARG HB2  H   8.375   5.875  15.453 1.00 . A A .  47 ARG HB2  1 1 
        3  3980 1 1  47 ARG HB3  H   9.305   5.535  16.899 1.00 . A A .  47 ARG HB3  1 1 
        3  3981 1 1  47 ARG HD2  H   7.751   9.026  17.081 1.00 . A A .  47 ARG HD2  1 1 
        3  3982 1 1  47 ARG HD3  H   7.105   7.446  16.683 1.00 . A A .  47 ARG HD3  1 1 
        3  3983 1 1  47 ARG HE   H   8.872   6.977  18.805 1.00 . A A .  47 ARG HE   1 1 
        3  3984 1 1  47 ARG HG2  H  10.103   7.876  16.985 1.00 . A A .  47 ARG HG2  1 1 
        3  3985 1 1  47 ARG HG3  H   9.294   8.237  15.473 1.00 . A A .  47 ARG HG3  1 1 
        3  3986 1 1  47 ARG HH11 H   6.009   8.959  18.295 1.00 . A A .  47 ARG HH11 1 1 
        3  3987 1 1  47 ARG HH12 H   5.516   8.900  19.954 1.00 . A A .  47 ARG HH12 1 1 
        3  3988 1 1  47 ARG HH21 H   8.222   6.899  20.995 1.00 . A A .  47 ARG HH21 1 1 
        3  3989 1 1  47 ARG HH22 H   6.783   7.721  21.500 1.00 . A A .  47 ARG HH22 1 1 
        3  3990 1 1  47 ARG N    N  10.321   6.303  13.772 1.00 . A A .  47 ARG N    1 1 
        3  3991 1 1  47 ARG NE   N   8.088   7.545  18.555 1.00 . A A .  47 ARG NE   1 1 
        3  3992 1 1  47 ARG NH1  N   6.160   8.646  19.232 1.00 . A A .  47 ARG NH1  1 1 
        3  3993 1 1  47 ARG NH2  N   7.427   7.466  20.778 1.00 . A A .  47 ARG NH2  1 1 
        3  3994 1 1  47 ARG O    O  11.632   3.848  15.878 1.00 . A A .  47 ARG O    1 1 
        3  3995 1 1  48 ILE C    C  11.599   1.820  13.996 1.00 . A A .  48 ILE C    1 1 
        3  3996 1 1  48 ILE CA   C  10.131   2.177  14.240 1.00 . A A .  48 ILE CA   1 1 
        3  3997 1 1  48 ILE CB   C   9.178   1.616  13.184 1.00 . A A .  48 ILE CB   1 1 
        3  3998 1 1  48 ILE CD1  C   8.639   1.632  10.720 1.00 . A A .  48 ILE CD1  1 1 
        3  3999 1 1  48 ILE CG1  C   9.290   2.398  11.873 1.00 . A A .  48 ILE CG1  1 1 
        3  4000 1 1  48 ILE CG2  C   7.741   1.577  13.707 1.00 . A A .  48 ILE CG2  1 1 
        3  4001 1 1  48 ILE H    H   9.295   4.018  13.741 1.00 . A A .  48 ILE H    1 1 
        3  4002 1 1  48 ILE HA   H   9.830   1.759  15.201 1.00 . A A .  48 ILE HA   1 1 
        3  4003 1 1  48 ILE HB   H   9.471   0.588  12.971 1.00 . A A .  48 ILE HB   1 1 
        3  4004 1 1  48 ILE HD11 H   7.612   1.976  10.589 1.00 . A A .  48 ILE HD11 1 1 
        3  4005 1 1  48 ILE HD12 H   9.201   1.809   9.803 1.00 . A A .  48 ILE HD12 1 1 
        3  4006 1 1  48 ILE HD13 H   8.639   0.566  10.946 1.00 . A A .  48 ILE HD13 1 1 
        3  4007 1 1  48 ILE HG12 H   8.811   3.371  11.985 1.00 . A A .  48 ILE HG12 1 1 
        3  4008 1 1  48 ILE HG13 H  10.339   2.584  11.645 1.00 . A A .  48 ILE HG13 1 1 
        3  4009 1 1  48 ILE HG21 H   7.489   2.540  14.151 1.00 . A A .  48 ILE HG21 1 1 
        3  4010 1 1  48 ILE HG22 H   7.059   1.368  12.883 1.00 . A A .  48 ILE HG22 1 1 
        3  4011 1 1  48 ILE HG23 H   7.650   0.795  14.461 1.00 . A A .  48 ILE HG23 1 1 
        3  4012 1 1  48 ILE N    N   9.997   3.621  14.332 1.00 . A A .  48 ILE N    1 1 
        3  4013 1 1  48 ILE O    O  12.456   2.701  13.947 1.00 . A A .  48 ILE O    1 1 
        3  4014 1 1  49 SER C    C  13.264  -0.663  12.255 1.00 . A A .  49 SER C    1 1 
        3  4015 1 1  49 SER CA   C  13.193   0.042  13.611 1.00 . A A .  49 SER CA   1 1 
        3  4016 1 1  49 SER CB   C  13.643  -0.905  14.725 1.00 . A A .  49 SER CB   1 1 
        3  4017 1 1  49 SER H    H  11.141  -0.184  13.890 1.00 . A A .  49 SER H    1 1 
        3  4018 1 1  49 SER HA   H  13.823   0.931  13.614 1.00 . A A .  49 SER HA   1 1 
        3  4019 1 1  49 SER HB2  H  12.775  -1.222  15.304 1.00 . A A .  49 SER HB2  1 1 
        3  4020 1 1  49 SER HB3  H  14.078  -1.802  14.285 1.00 . A A .  49 SER HB3  1 1 
        3  4021 1 1  49 SER HG   H  15.309  -0.950  15.832 1.00 . A A .  49 SER HG   1 1 
        3  4022 1 1  49 SER N    N  11.844   0.526  13.849 1.00 . A A .  49 SER N    1 1 
        3  4023 1 1  49 SER O    O  12.266  -0.745  11.541 1.00 . A A .  49 SER O    1 1 
        3  4024 1 1  49 SER OG   O  14.593  -0.294  15.593 1.00 . A A .  49 SER OG   1 1 
        3  4025 1 1  50 GLN C    C  13.659  -2.988  10.527 1.00 . A A .  50 GLN C    1 1 
        3  4026 1 1  50 GLN CA   C  14.668  -1.849  10.683 1.00 . A A .  50 GLN CA   1 1 
        3  4027 1 1  50 GLN CB   C  16.103  -2.371  10.583 1.00 . A A .  50 GLN CB   1 1 
        3  4028 1 1  50 GLN CD   C  16.101  -2.012   8.086 1.00 . A A .  50 GLN CD   1 1 
        3  4029 1 1  50 GLN CG   C  16.360  -3.010   9.217 1.00 . A A .  50 GLN CG   1 1 
        3  4030 1 1  50 GLN H    H  15.261  -1.083  12.527 1.00 . A A .  50 GLN H    1 1 
        3  4031 1 1  50 GLN HA   H  14.505  -1.101   9.907 1.00 . A A .  50 GLN HA   1 1 
        3  4032 1 1  50 GLN HB2  H  16.804  -1.551  10.741 1.00 . A A .  50 GLN HB2  1 1 
        3  4033 1 1  50 GLN HB3  H  16.284  -3.102  11.370 1.00 . A A .  50 GLN HB3  1 1 
        3  4034 1 1  50 GLN HE21 H  14.154  -2.569   8.104 1.00 . A A .  50 GLN HE21 1 1 
        3  4035 1 1  50 GLN HE22 H  14.567  -1.353   6.941 1.00 . A A .  50 GLN HE22 1 1 
        3  4036 1 1  50 GLN HG2  H  17.389  -3.365   9.165 1.00 . A A .  50 GLN HG2  1 1 
        3  4037 1 1  50 GLN HG3  H  15.716  -3.881   9.092 1.00 . A A .  50 GLN HG3  1 1 
        3  4038 1 1  50 GLN N    N  14.454  -1.154  11.941 1.00 . A A .  50 GLN N    1 1 
        3  4039 1 1  50 GLN NE2  N  14.836  -1.975   7.677 1.00 . A A .  50 GLN NE2  1 1 
        3  4040 1 1  50 GLN O    O  12.959  -3.068   9.519 1.00 . A A .  50 GLN O    1 1 
        3  4041 1 1  50 GLN OE1  O  16.990  -1.321   7.617 1.00 . A A .  50 GLN OE1  1 1 
        3  4042 1 1  51 SER C    C  11.361  -4.555  10.922 1.00 . A A .  51 SER C    1 1 
        3  4043 1 1  51 SER CA   C  12.703  -4.971  11.528 1.00 . A A .  51 SER CA   1 1 
        3  4044 1 1  51 SER CB   C  12.498  -5.529  12.938 1.00 . A A .  51 SER CB   1 1 
        3  4045 1 1  51 SER H    H  14.188  -3.768  12.357 1.00 . A A .  51 SER H    1 1 
        3  4046 1 1  51 SER HA   H  13.186  -5.725  10.906 1.00 . A A .  51 SER HA   1 1 
        3  4047 1 1  51 SER HB2  H  13.466  -5.645  13.426 1.00 . A A .  51 SER HB2  1 1 
        3  4048 1 1  51 SER HB3  H  11.926  -4.815  13.531 1.00 . A A .  51 SER HB3  1 1 
        3  4049 1 1  51 SER HG   H  11.604  -7.043  11.983 1.00 . A A .  51 SER HG   1 1 
        3  4050 1 1  51 SER N    N  13.615  -3.840  11.540 1.00 . A A .  51 SER N    1 1 
        3  4051 1 1  51 SER O    O  10.836  -5.234  10.041 1.00 . A A .  51 SER O    1 1 
        3  4052 1 1  51 SER OG   O  11.822  -6.783  12.923 1.00 . A A .  51 SER OG   1 1 
        3  4053 1 1  52 GLN C    C   9.684  -2.534   9.463 1.00 . A A .  52 GLN C    1 1 
        3  4054 1 1  52 GLN CA   C   9.574  -2.925  10.938 1.00 . A A .  52 GLN CA   1 1 
        3  4055 1 1  52 GLN CB   C   9.106  -1.740  11.786 1.00 . A A .  52 GLN CB   1 1 
        3  4056 1 1  52 GLN CD   C   7.410  -2.355  13.548 1.00 . A A .  52 GLN CD   1 1 
        3  4057 1 1  52 GLN CG   C   8.896  -2.158  13.243 1.00 . A A .  52 GLN CG   1 1 
        3  4058 1 1  52 GLN H    H  11.278  -2.894  12.136 1.00 . A A .  52 GLN H    1 1 
        3  4059 1 1  52 GLN HA   H   8.867  -3.747  11.051 1.00 . A A .  52 GLN HA   1 1 
        3  4060 1 1  52 GLN HB2  H   9.843  -0.939  11.736 1.00 . A A .  52 GLN HB2  1 1 
        3  4061 1 1  52 GLN HB3  H   8.176  -1.343  11.380 1.00 . A A .  52 GLN HB3  1 1 
        3  4062 1 1  52 GLN HE21 H   7.487  -4.117  12.554 1.00 . A A .  52 GLN HE21 1 1 
        3  4063 1 1  52 GLN HE22 H   5.939  -3.704  13.213 1.00 . A A .  52 GLN HE22 1 1 
        3  4064 1 1  52 GLN HG2  H   9.438  -3.083  13.441 1.00 . A A .  52 GLN HG2  1 1 
        3  4065 1 1  52 GLN HG3  H   9.310  -1.398  13.906 1.00 . A A .  52 GLN HG3  1 1 
        3  4066 1 1  52 GLN N    N  10.845  -3.440  11.419 1.00 . A A .  52 GLN N    1 1 
        3  4067 1 1  52 GLN NE2  N   6.903  -3.485  13.065 1.00 . A A .  52 GLN NE2  1 1 
        3  4068 1 1  52 GLN O    O   9.048  -3.145   8.605 1.00 . A A .  52 GLN O    1 1 
        3  4069 1 1  52 GLN OE1  O   6.766  -1.534  14.181 1.00 . A A .  52 GLN OE1  1 1 
        3  4070 1 1  53 LYS C    C  10.879  -2.232   6.918 1.00 . A A .  53 LYS C    1 1 
        3  4071 1 1  53 LYS CA   C  10.698  -1.037   7.856 1.00 . A A .  53 LYS CA   1 1 
        3  4072 1 1  53 LYS CB   C  11.855  -0.037   7.808 1.00 . A A .  53 LYS CB   1 1 
        3  4073 1 1  53 LYS CD   C  12.797   2.039   8.887 1.00 . A A .  53 LYS CD   1 1 
        3  4074 1 1  53 LYS CE   C  12.445   3.417   9.448 1.00 . A A .  53 LYS CE   1 1 
        3  4075 1 1  53 LYS CG   C  11.536   1.211   8.634 1.00 . A A .  53 LYS CG   1 1 
        3  4076 1 1  53 LYS H    H  11.010  -1.025   9.915 1.00 . A A .  53 LYS H    1 1 
        3  4077 1 1  53 LYS HA   H   9.796  -0.500   7.562 1.00 . A A .  53 LYS HA   1 1 
        3  4078 1 1  53 LYS HB2  H  12.762  -0.506   8.187 1.00 . A A .  53 LYS HB2  1 1 
        3  4079 1 1  53 LYS HB3  H  12.052   0.247   6.774 1.00 . A A .  53 LYS HB3  1 1 
        3  4080 1 1  53 LYS HD2  H  13.447   1.512   9.586 1.00 . A A .  53 LYS HD2  1 1 
        3  4081 1 1  53 LYS HD3  H  13.355   2.152   7.957 1.00 . A A .  53 LYS HD3  1 1 
        3  4082 1 1  53 LYS HE2  H  12.977   4.190   8.893 1.00 . A A .  53 LYS HE2  1 1 
        3  4083 1 1  53 LYS HE3  H  11.380   3.608   9.318 1.00 . A A .  53 LYS HE3  1 1 
        3  4084 1 1  53 LYS HG2  H  10.797   1.818   8.111 1.00 . A A .  53 LYS HG2  1 1 
        3  4085 1 1  53 LYS HG3  H  11.091   0.918   9.585 1.00 . A A .  53 LYS HG3  1 1 
        3  4086 1 1  53 LYS HZ1  H  12.445   4.353  11.266 1.00 . A A .  53 LYS HZ1  1 1 
        3  4087 1 1  53 LYS HZ2  H  12.393   2.724  11.370 1.00 . A A .  53 LYS HZ2  1 1 
        3  4088 1 1  53 LYS HZ3  H  13.792   3.472  10.985 1.00 . A A .  53 LYS HZ3  1 1 
        3  4089 1 1  53 LYS N    N  10.496  -1.517   9.212 1.00 . A A .  53 LYS N    1 1 
        3  4090 1 1  53 LYS NZ   N  12.797   3.498  10.884 1.00 . A A .  53 LYS NZ   1 1 
        3  4091 1 1  53 LYS O    O  10.245  -2.302   5.866 1.00 . A A .  53 LYS O    1 1 
        3  4092 1 1  54 GLU C    C  10.747  -5.166   6.384 1.00 . A A .  54 GLU C    1 1 
        3  4093 1 1  54 GLU CA   C  12.019  -4.332   6.544 1.00 . A A .  54 GLU CA   1 1 
        3  4094 1 1  54 GLU CB   C  13.143  -5.160   7.169 1.00 . A A .  54 GLU CB   1 1 
        3  4095 1 1  54 GLU CD   C  14.854  -5.935   5.486 1.00 . A A .  54 GLU CD   1 1 
        3  4096 1 1  54 GLU CG   C  14.486  -4.853   6.504 1.00 . A A .  54 GLU CG   1 1 
        3  4097 1 1  54 GLU H    H  12.258  -3.079   8.190 1.00 . A A .  54 GLU H    1 1 
        3  4098 1 1  54 GLU HA   H  12.345  -3.965   5.570 1.00 . A A .  54 GLU HA   1 1 
        3  4099 1 1  54 GLU HB2  H  13.206  -4.948   8.237 1.00 . A A .  54 GLU HB2  1 1 
        3  4100 1 1  54 GLU HB3  H  12.918  -6.222   7.068 1.00 . A A .  54 GLU HB3  1 1 
        3  4101 1 1  54 GLU HG2  H  14.437  -3.884   6.007 1.00 . A A .  54 GLU HG2  1 1 
        3  4102 1 1  54 GLU HG3  H  15.265  -4.783   7.263 1.00 . A A .  54 GLU HG3  1 1 
        3  4103 1 1  54 GLU N    N  11.747  -3.143   7.333 1.00 . A A .  54 GLU N    1 1 
        3  4104 1 1  54 GLU O    O  10.271  -5.372   5.269 1.00 . A A .  54 GLU O    1 1 
        3  4105 1 1  54 GLU OE1  O  14.289  -5.883   4.373 1.00 . A A .  54 GLU OE1  1 1 
        3  4106 1 1  54 GLU OE2  O  15.693  -6.790   5.845 1.00 . A A .  54 GLU OE2  1 1 
        3  4107 1 1  55 HIS C    C   7.969  -5.776   6.623 1.00 . A A .  55 HIS C    1 1 
        3  4108 1 1  55 HIS CA   C   9.024  -6.432   7.516 1.00 . A A .  55 HIS CA   1 1 
        3  4109 1 1  55 HIS CB   C   8.529  -6.669   8.944 1.00 . A A .  55 HIS CB   1 1 
        3  4110 1 1  55 HIS CD2  C   6.079  -7.329   9.570 1.00 . A A .  55 HIS CD2  1 1 
        3  4111 1 1  55 HIS CE1  C   6.087  -9.361   8.760 1.00 . A A .  55 HIS CE1  1 1 
        3  4112 1 1  55 HIS CG   C   7.311  -7.557   9.032 1.00 . A A .  55 HIS CG   1 1 
        3  4113 1 1  55 HIS H    H  10.626  -5.452   8.419 1.00 . A A .  55 HIS H    1 1 
        3  4114 1 1  55 HIS HA   H   9.295  -7.399   7.093 1.00 . A A .  55 HIS HA   1 1 
        3  4115 1 1  55 HIS HB2  H   9.334  -7.114   9.528 1.00 . A A .  55 HIS HB2  1 1 
        3  4116 1 1  55 HIS HB3  H   8.298  -5.707   9.402 1.00 . A A .  55 HIS HB3  1 1 
        3  4117 1 1  55 HIS HD1  H   8.044  -9.311   8.072 1.00 . A A .  55 HIS HD1  1 1 
        3  4118 1 1  55 HIS HD2  H   5.755  -6.407  10.054 1.00 . A A .  55 HIS HD2  1 1 
        3  4119 1 1  55 HIS HE1  H   5.756 -10.362   8.483 1.00 . A A .  55 HIS HE1  1 1 
        3  4120 1 1  55 HIS N    N  10.232  -5.624   7.516 1.00 . A A .  55 HIS N    1 1 
        3  4121 1 1  55 HIS ND1  N   7.286  -8.846   8.530 1.00 . A A .  55 HIS ND1  1 1 
        3  4122 1 1  55 HIS NE2  N   5.340  -8.419   9.404 1.00 . A A .  55 HIS NE2  1 1 
        3  4123 1 1  55 HIS O    O   7.607  -6.320   5.581 1.00 . A A .  55 HIS O    1 1 
        3  4124 1 1  56 TYR C    C   6.845  -3.831   4.830 1.00 . A A .  56 TYR C    1 1 
        3  4125 1 1  56 TYR CA   C   6.498  -3.880   6.319 1.00 . A A .  56 TYR CA   1 1 
        3  4126 1 1  56 TYR CB   C   6.513  -2.458   6.881 1.00 . A A .  56 TYR CB   1 1 
        3  4127 1 1  56 TYR CD1  C   4.311  -2.501   8.108 1.00 . A A .  56 TYR CD1  1 1 
        3  4128 1 1  56 TYR CD2  C   6.276  -1.898   9.328 1.00 . A A .  56 TYR CD2  1 1 
        3  4129 1 1  56 TYR CE1  C   3.519  -2.334   9.300 1.00 . A A .  56 TYR CE1  1 1 
        3  4130 1 1  56 TYR CE2  C   5.485  -1.731  10.520 1.00 . A A .  56 TYR CE2  1 1 
        3  4131 1 1  56 TYR CG   C   5.672  -2.280   8.147 1.00 . A A .  56 TYR CG   1 1 
        3  4132 1 1  56 TYR CZ   C   4.146  -1.957  10.447 1.00 . A A .  56 TYR CZ   1 1 
        3  4133 1 1  56 TYR H    H   7.804  -4.180   7.913 1.00 . A A .  56 TYR H    1 1 
        3  4134 1 1  56 TYR HA   H   5.544  -4.393   6.445 1.00 . A A .  56 TYR HA   1 1 
        3  4135 1 1  56 TYR HB2  H   7.542  -2.174   7.098 1.00 . A A .  56 TYR HB2  1 1 
        3  4136 1 1  56 TYR HB3  H   6.148  -1.772   6.116 1.00 . A A .  56 TYR HB3  1 1 
        3  4137 1 1  56 TYR HD1  H   3.834  -2.803   7.176 1.00 . A A .  56 TYR HD1  1 1 
        3  4138 1 1  56 TYR HD2  H   7.351  -1.723   9.359 1.00 . A A .  56 TYR HD2  1 1 
        3  4139 1 1  56 TYR HE1  H   2.443  -2.506   9.283 1.00 . A A .  56 TYR HE1  1 1 
        3  4140 1 1  56 TYR HE2  H   5.949  -1.430  11.459 1.00 . A A .  56 TYR HE2  1 1 
        3  4141 1 1  56 TYR HH   H   3.297  -0.827  11.781 1.00 . A A .  56 TYR HH   1 1 
        3  4142 1 1  56 TYR N    N   7.505  -4.616   7.065 1.00 . A A .  56 TYR N    1 1 
        3  4143 1 1  56 TYR O    O   5.983  -4.049   3.980 1.00 . A A .  56 TYR O    1 1 
        3  4144 1 1  56 TYR OH   O   3.399  -1.799  11.572 1.00 . A A .  56 TYR OH   1 1 
        3  4145 1 1  57 LYS C    C   8.320  -4.796   2.483 1.00 . A A .  57 LYS C    1 1 
        3  4146 1 1  57 LYS CA   C   8.582  -3.464   3.187 1.00 . A A .  57 LYS CA   1 1 
        3  4147 1 1  57 LYS CB   C  10.048  -3.027   3.150 1.00 . A A .  57 LYS CB   1 1 
        3  4148 1 1  57 LYS CD   C  11.926  -2.279   1.642 1.00 . A A .  57 LYS CD   1 1 
        3  4149 1 1  57 LYS CE   C  11.761  -0.769   1.825 1.00 . A A .  57 LYS CE   1 1 
        3  4150 1 1  57 LYS CG   C  10.573  -2.991   1.714 1.00 . A A .  57 LYS CG   1 1 
        3  4151 1 1  57 LYS H    H   8.805  -3.368   5.257 1.00 . A A .  57 LYS H    1 1 
        3  4152 1 1  57 LYS HA   H   8.002  -2.688   2.687 1.00 . A A .  57 LYS HA   1 1 
        3  4153 1 1  57 LYS HB2  H  10.150  -2.040   3.603 1.00 . A A .  57 LYS HB2  1 1 
        3  4154 1 1  57 LYS HB3  H  10.651  -3.713   3.745 1.00 . A A .  57 LYS HB3  1 1 
        3  4155 1 1  57 LYS HD2  H  12.589  -2.672   2.412 1.00 . A A .  57 LYS HD2  1 1 
        3  4156 1 1  57 LYS HD3  H  12.397  -2.483   0.681 1.00 . A A .  57 LYS HD3  1 1 
        3  4157 1 1  57 LYS HE2  H  10.727  -0.484   1.629 1.00 . A A .  57 LYS HE2  1 1 
        3  4158 1 1  57 LYS HE3  H  11.976  -0.496   2.858 1.00 . A A .  57 LYS HE3  1 1 
        3  4159 1 1  57 LYS HG2  H  10.673  -4.008   1.334 1.00 . A A .  57 LYS HG2  1 1 
        3  4160 1 1  57 LYS HG3  H   9.855  -2.480   1.073 1.00 . A A .  57 LYS HG3  1 1 
        3  4161 1 1  57 LYS HZ1  H  13.602  -0.361   1.038 1.00 . A A .  57 LYS HZ1  1 1 
        3  4162 1 1  57 LYS HZ2  H  12.382  -0.189  -0.034 1.00 . A A .  57 LYS HZ2  1 1 
        3  4163 1 1  57 LYS HZ3  H  12.623   0.944   1.118 1.00 . A A .  57 LYS HZ3  1 1 
        3  4164 1 1  57 LYS N    N   8.110  -3.544   4.559 1.00 . A A .  57 LYS N    1 1 
        3  4165 1 1  57 LYS NZ   N  12.666  -0.034   0.913 1.00 . A A .  57 LYS NZ   1 1 
        3  4166 1 1  57 LYS O    O   7.987  -4.822   1.299 1.00 . A A .  57 LYS O    1 1 
        3  4167 1 1  58 LYS C    C   6.769  -7.411   2.450 1.00 . A A .  58 LYS C    1 1 
        3  4168 1 1  58 LYS CA   C   8.264  -7.204   2.705 1.00 . A A .  58 LYS CA   1 1 
        3  4169 1 1  58 LYS CB   C   8.882  -8.259   3.625 1.00 . A A .  58 LYS CB   1 1 
        3  4170 1 1  58 LYS CD   C   7.155  -9.986   4.253 1.00 . A A .  58 LYS CD   1 1 
        3  4171 1 1  58 LYS CE   C   7.608  -9.996   5.715 1.00 . A A .  58 LYS CE   1 1 
        3  4172 1 1  58 LYS CG   C   8.320  -9.649   3.321 1.00 . A A .  58 LYS CG   1 1 
        3  4173 1 1  58 LYS H    H   8.750  -5.842   4.204 1.00 . A A .  58 LYS H    1 1 
        3  4174 1 1  58 LYS HA   H   8.788  -7.261   1.751 1.00 . A A .  58 LYS HA   1 1 
        3  4175 1 1  58 LYS HB2  H   9.965  -8.265   3.502 1.00 . A A .  58 LYS HB2  1 1 
        3  4176 1 1  58 LYS HB3  H   8.681  -8.001   4.665 1.00 . A A .  58 LYS HB3  1 1 
        3  4177 1 1  58 LYS HD2  H   6.356  -9.257   4.121 1.00 . A A .  58 LYS HD2  1 1 
        3  4178 1 1  58 LYS HD3  H   6.744 -10.961   3.990 1.00 . A A .  58 LYS HD3  1 1 
        3  4179 1 1  58 LYS HE2  H   8.645  -9.667   5.782 1.00 . A A .  58 LYS HE2  1 1 
        3  4180 1 1  58 LYS HE3  H   7.012  -9.289   6.291 1.00 . A A .  58 LYS HE3  1 1 
        3  4181 1 1  58 LYS HG2  H   7.985  -9.691   2.284 1.00 . A A .  58 LYS HG2  1 1 
        3  4182 1 1  58 LYS HG3  H   9.107 -10.395   3.431 1.00 . A A .  58 LYS HG3  1 1 
        3  4183 1 1  58 LYS HZ1  H   8.240 -11.920   5.988 1.00 . A A .  58 LYS HZ1  1 1 
        3  4184 1 1  58 LYS HZ2  H   7.476 -11.293   7.289 1.00 . A A .  58 LYS HZ2  1 1 
        3  4185 1 1  58 LYS HZ3  H   6.615 -11.762   5.983 1.00 . A A .  58 LYS HZ3  1 1 
        3  4186 1 1  58 LYS N    N   8.479  -5.871   3.241 1.00 . A A .  58 LYS N    1 1 
        3  4187 1 1  58 LYS NZ   N   7.474 -11.353   6.290 1.00 . A A .  58 LYS NZ   1 1 
        3  4188 1 1  58 LYS O    O   6.373  -7.823   1.360 1.00 . A A .  58 LYS O    1 1 
        3  4189 1 1  59 LEU C    C   4.049  -6.595   2.086 1.00 . A A .  59 LEU C    1 1 
        3  4190 1 1  59 LEU CA   C   4.538  -7.264   3.372 1.00 . A A .  59 LEU CA   1 1 
        3  4191 1 1  59 LEU CB   C   3.857  -6.737   4.636 1.00 . A A .  59 LEU CB   1 1 
        3  4192 1 1  59 LEU CD1  C   3.776  -6.602   7.153 1.00 . A A .  59 LEU CD1  1 1 
        3  4193 1 1  59 LEU CD2  C   3.781  -8.859   5.996 1.00 . A A .  59 LEU CD2  1 1 
        3  4194 1 1  59 LEU CG   C   4.265  -7.409   5.949 1.00 . A A .  59 LEU CG   1 1 
        3  4195 1 1  59 LEU H    H   6.310  -6.781   4.355 1.00 . A A .  59 LEU H    1 1 
        3  4196 1 1  59 LEU HA   H   4.323  -8.330   3.311 1.00 . A A .  59 LEU HA   1 1 
        3  4197 1 1  59 LEU HB2  H   4.063  -5.669   4.718 1.00 . A A .  59 LEU HB2  1 1 
        3  4198 1 1  59 LEU HB3  H   2.779  -6.845   4.516 1.00 . A A .  59 LEU HB3  1 1 
        3  4199 1 1  59 LEU HD11 H   2.734  -6.848   7.356 1.00 . A A .  59 LEU HD11 1 1 
        3  4200 1 1  59 LEU HD12 H   4.383  -6.847   8.025 1.00 . A A .  59 LEU HD12 1 1 
        3  4201 1 1  59 LEU HD13 H   3.863  -5.537   6.937 1.00 . A A .  59 LEU HD13 1 1 
        3  4202 1 1  59 LEU HD21 H   3.234  -9.090   5.081 1.00 . A A .  59 LEU HD21 1 1 
        3  4203 1 1  59 LEU HD22 H   4.638  -9.526   6.083 1.00 . A A .  59 LEU HD22 1 1 
        3  4204 1 1  59 LEU HD23 H   3.125  -8.996   6.855 1.00 . A A .  59 LEU HD23 1 1 
        3  4205 1 1  59 LEU HG   H   5.354  -7.431   5.997 1.00 . A A .  59 LEU HG   1 1 
        3  4206 1 1  59 LEU N    N   5.980  -7.115   3.472 1.00 . A A .  59 LEU N    1 1 
        3  4207 1 1  59 LEU O    O   3.351  -7.217   1.286 1.00 . A A .  59 LEU O    1 1 
        3  4208 1 1  60 ALA C    C   4.118  -5.483  -0.482 1.00 . A A .  60 ALA C    1 1 
        3  4209 1 1  60 ALA CA   C   4.045  -4.579   0.750 1.00 . A A .  60 ALA CA   1 1 
        3  4210 1 1  60 ALA CB   C   4.938  -3.343   0.621 1.00 . A A .  60 ALA CB   1 1 
        3  4211 1 1  60 ALA H    H   5.003  -4.840   2.581 1.00 . A A .  60 ALA H    1 1 
        3  4212 1 1  60 ALA HA   H   3.014  -4.254   0.892 1.00 . A A .  60 ALA HA   1 1 
        3  4213 1 1  60 ALA HB1  H   4.651  -2.779  -0.267 1.00 . A A .  60 ALA HB1  1 1 
        3  4214 1 1  60 ALA HB2  H   4.819  -2.715   1.504 1.00 . A A .  60 ALA HB2  1 1 
        3  4215 1 1  60 ALA HB3  H   5.979  -3.654   0.533 1.00 . A A .  60 ALA HB3  1 1 
        3  4216 1 1  60 ALA N    N   4.435  -5.338   1.926 1.00 . A A .  60 ALA N    1 1 
        3  4217 1 1  60 ALA O    O   3.183  -5.526  -1.281 1.00 . A A .  60 ALA O    1 1 
        3  4218 1 1  61 GLU C    C   4.276  -8.062  -1.837 1.00 . A A .  61 GLU C    1 1 
        3  4219 1 1  61 GLU CA   C   5.444  -7.082  -1.721 1.00 . A A .  61 GLU CA   1 1 
        3  4220 1 1  61 GLU CB   C   6.774  -7.827  -1.588 1.00 . A A .  61 GLU CB   1 1 
        3  4221 1 1  61 GLU CD   C   9.241  -7.317  -1.711 1.00 . A A .  61 GLU CD   1 1 
        3  4222 1 1  61 GLU CG   C   7.890  -6.881  -1.139 1.00 . A A .  61 GLU CG   1 1 
        3  4223 1 1  61 GLU H    H   5.993  -6.141   0.055 1.00 . A A .  61 GLU H    1 1 
        3  4224 1 1  61 GLU HA   H   5.480  -6.442  -2.602 1.00 . A A .  61 GLU HA   1 1 
        3  4225 1 1  61 GLU HB2  H   6.670  -8.639  -0.868 1.00 . A A .  61 GLU HB2  1 1 
        3  4226 1 1  61 GLU HB3  H   7.038  -8.280  -2.543 1.00 . A A .  61 GLU HB3  1 1 
        3  4227 1 1  61 GLU HG2  H   7.664  -5.866  -1.465 1.00 . A A .  61 GLU HG2  1 1 
        3  4228 1 1  61 GLU HG3  H   7.941  -6.863  -0.051 1.00 . A A .  61 GLU HG3  1 1 
        3  4229 1 1  61 GLU N    N   5.237  -6.182  -0.599 1.00 . A A .  61 GLU N    1 1 
        3  4230 1 1  61 GLU O    O   3.713  -8.237  -2.917 1.00 . A A .  61 GLU O    1 1 
        3  4231 1 1  61 GLU OE1  O   9.269  -7.636  -2.919 1.00 . A A .  61 GLU OE1  1 1 
        3  4232 1 1  61 GLU OE2  O  10.214  -7.320  -0.927 1.00 . A A .  61 GLU OE2  1 1 
        3  4233 1 1  62 GLU C    C   1.600  -9.037  -1.313 1.00 . A A .  62 GLU C    1 1 
        3  4234 1 1  62 GLU CA   C   2.854  -9.635  -0.672 1.00 . A A .  62 GLU CA   1 1 
        3  4235 1 1  62 GLU CB   C   2.573 -10.089   0.761 1.00 . A A .  62 GLU CB   1 1 
        3  4236 1 1  62 GLU CD   C   4.099 -12.087   0.558 1.00 . A A .  62 GLU CD   1 1 
        3  4237 1 1  62 GLU CG   C   2.682 -11.611   0.885 1.00 . A A .  62 GLU CG   1 1 
        3  4238 1 1  62 GLU H    H   4.408  -8.528   0.164 1.00 . A A .  62 GLU H    1 1 
        3  4239 1 1  62 GLU HA   H   3.197 -10.488  -1.257 1.00 . A A .  62 GLU HA   1 1 
        3  4240 1 1  62 GLU HB2  H   3.279  -9.614   1.442 1.00 . A A .  62 GLU HB2  1 1 
        3  4241 1 1  62 GLU HB3  H   1.576  -9.767   1.060 1.00 . A A .  62 GLU HB3  1 1 
        3  4242 1 1  62 GLU HG2  H   2.417 -11.917   1.897 1.00 . A A .  62 GLU HG2  1 1 
        3  4243 1 1  62 GLU HG3  H   1.970 -12.086   0.211 1.00 . A A .  62 GLU HG3  1 1 
        3  4244 1 1  62 GLU N    N   3.945  -8.676  -0.710 1.00 . A A .  62 GLU N    1 1 
        3  4245 1 1  62 GLU O    O   1.056  -9.597  -2.264 1.00 . A A .  62 GLU O    1 1 
        3  4246 1 1  62 GLU OE1  O   4.961 -11.962   1.455 1.00 . A A .  62 GLU OE1  1 1 
        3  4247 1 1  62 GLU OE2  O   4.288 -12.565  -0.581 1.00 . A A .  62 GLU OE2  1 1 
        3  4248 1 1  63 GLN C    C  -0.006  -7.236  -2.804 1.00 . A A .  63 GLN C    1 1 
        3  4249 1 1  63 GLN CA   C  -0.003  -7.226  -1.274 1.00 . A A .  63 GLN CA   1 1 
        3  4250 1 1  63 GLN CB   C  -0.085  -5.796  -0.735 1.00 . A A .  63 GLN CB   1 1 
        3  4251 1 1  63 GLN CD   C  -2.604  -5.678  -0.720 1.00 . A A .  63 GLN CD   1 1 
        3  4252 1 1  63 GLN CG   C  -1.334  -5.607   0.129 1.00 . A A .  63 GLN CG   1 1 
        3  4253 1 1  63 GLN H    H   1.625  -7.456   0.006 1.00 . A A .  63 GLN H    1 1 
        3  4254 1 1  63 GLN HA   H  -0.851  -7.798  -0.898 1.00 . A A .  63 GLN HA   1 1 
        3  4255 1 1  63 GLN HB2  H   0.805  -5.573  -0.148 1.00 . A A .  63 GLN HB2  1 1 
        3  4256 1 1  63 GLN HB3  H  -0.103  -5.091  -1.566 1.00 . A A .  63 GLN HB3  1 1 
        3  4257 1 1  63 GLN HE21 H  -2.985  -3.752  -0.229 1.00 . A A .  63 GLN HE21 1 1 
        3  4258 1 1  63 GLN HE22 H  -4.153  -4.496  -1.269 1.00 . A A .  63 GLN HE22 1 1 
        3  4259 1 1  63 GLN HG2  H  -1.365  -6.374   0.902 1.00 . A A .  63 GLN HG2  1 1 
        3  4260 1 1  63 GLN HG3  H  -1.286  -4.644   0.637 1.00 . A A .  63 GLN HG3  1 1 
        3  4261 1 1  63 GLN N    N   1.177  -7.906  -0.767 1.00 . A A .  63 GLN N    1 1 
        3  4262 1 1  63 GLN NE2  N  -3.306  -4.548  -0.741 1.00 . A A .  63 GLN NE2  1 1 
        3  4263 1 1  63 GLN O    O  -1.039  -7.483  -3.424 1.00 . A A .  63 GLN O    1 1 
        3  4264 1 1  63 GLN OE1  O  -2.927  -6.692  -1.317 1.00 . A A .  63 GLN OE1  1 1 
        3  4265 1 1  64 GLN C    C   1.218  -8.359  -5.380 1.00 . A A .  64 GLN C    1 1 
        3  4266 1 1  64 GLN CA   C   1.307  -6.941  -4.813 1.00 . A A .  64 GLN CA   1 1 
        3  4267 1 1  64 GLN CB   C   2.620  -6.269  -5.221 1.00 . A A .  64 GLN CB   1 1 
        3  4268 1 1  64 GLN CD   C   3.965  -4.137  -5.174 1.00 . A A .  64 GLN CD   1 1 
        3  4269 1 1  64 GLN CG   C   2.655  -4.811  -4.761 1.00 . A A .  64 GLN CG   1 1 
        3  4270 1 1  64 GLN H    H   1.997  -6.766  -2.856 1.00 . A A .  64 GLN H    1 1 
        3  4271 1 1  64 GLN HA   H   0.471  -6.344  -5.178 1.00 . A A .  64 GLN HA   1 1 
        3  4272 1 1  64 GLN HB2  H   3.460  -6.812  -4.788 1.00 . A A .  64 GLN HB2  1 1 
        3  4273 1 1  64 GLN HB3  H   2.735  -6.315  -6.304 1.00 . A A .  64 GLN HB3  1 1 
        3  4274 1 1  64 GLN HE21 H   4.677  -4.486  -3.311 1.00 . A A .  64 GLN HE21 1 1 
        3  4275 1 1  64 GLN HE22 H   5.771  -3.675  -4.382 1.00 . A A .  64 GLN HE22 1 1 
        3  4276 1 1  64 GLN HG2  H   1.812  -4.269  -5.191 1.00 . A A .  64 GLN HG2  1 1 
        3  4277 1 1  64 GLN HG3  H   2.544  -4.765  -3.677 1.00 . A A .  64 GLN HG3  1 1 
        3  4278 1 1  64 GLN N    N   1.162  -6.966  -3.368 1.00 . A A .  64 GLN N    1 1 
        3  4279 1 1  64 GLN NE2  N   4.880  -4.096  -4.209 1.00 . A A .  64 GLN NE2  1 1 
        3  4280 1 1  64 GLN O    O   0.662  -8.568  -6.458 1.00 . A A .  64 GLN O    1 1 
        3  4281 1 1  64 GLN OE1  O   4.135  -3.685  -6.294 1.00 . A A .  64 GLN OE1  1 1 
        3  4282 1 1  65 ARG C    C   0.326 -11.177  -5.240 1.00 . A A .  65 ARG C    1 1 
        3  4283 1 1  65 ARG CA   C   1.764 -10.691  -5.043 1.00 . A A .  65 ARG CA   1 1 
        3  4284 1 1  65 ARG CB   C   2.457 -11.579  -4.006 1.00 . A A .  65 ARG CB   1 1 
        3  4285 1 1  65 ARG CD   C   2.489 -13.852  -2.916 1.00 . A A .  65 ARG CD   1 1 
        3  4286 1 1  65 ARG CG   C   1.722 -12.911  -3.847 1.00 . A A .  65 ARG CG   1 1 
        3  4287 1 1  65 ARG CZ   C   1.392 -16.050  -3.334 1.00 . A A .  65 ARG CZ   1 1 
        3  4288 1 1  65 ARG H    H   2.224  -9.121  -3.753 1.00 . A A .  65 ARG H    1 1 
        3  4289 1 1  65 ARG HA   H   2.315 -10.707  -5.983 1.00 . A A .  65 ARG HA   1 1 
        3  4290 1 1  65 ARG HB2  H   3.487 -11.761  -4.310 1.00 . A A .  65 ARG HB2  1 1 
        3  4291 1 1  65 ARG HB3  H   2.494 -11.063  -3.047 1.00 . A A .  65 ARG HB3  1 1 
        3  4292 1 1  65 ARG HD2  H   3.393 -14.209  -3.410 1.00 . A A .  65 ARG HD2  1 1 
        3  4293 1 1  65 ARG HD3  H   2.806 -13.315  -2.022 1.00 . A A .  65 ARG HD3  1 1 
        3  4294 1 1  65 ARG HE   H   1.209 -14.989  -1.633 1.00 . A A .  65 ARG HE   1 1 
        3  4295 1 1  65 ARG HG2  H   0.723 -12.735  -3.449 1.00 . A A .  65 ARG HG2  1 1 
        3  4296 1 1  65 ARG HG3  H   1.598 -13.381  -4.823 1.00 . A A .  65 ARG HG3  1 1 
        3  4297 1 1  65 ARG HH11 H   2.529 -15.363  -4.873 1.00 . A A .  65 ARG HH11 1 1 
        3  4298 1 1  65 ARG HH12 H   1.760 -16.891  -5.149 1.00 . A A .  65 ARG HH12 1 1 
        3  4299 1 1  65 ARG HH21 H   0.194 -17.004  -1.996 1.00 . A A .  65 ARG HH21 1 1 
        3  4300 1 1  65 ARG HH22 H   0.423 -17.830  -3.501 1.00 . A A .  65 ARG HH22 1 1 
        3  4301 1 1  65 ARG N    N   1.774  -9.299  -4.629 1.00 . A A .  65 ARG N    1 1 
        3  4302 1 1  65 ARG NE   N   1.634 -14.999  -2.538 1.00 . A A .  65 ARG NE   1 1 
        3  4303 1 1  65 ARG NH1  N   1.940 -16.106  -4.555 1.00 . A A .  65 ARG NH1  1 1 
        3  4304 1 1  65 ARG NH2  N   0.603 -17.046  -2.908 1.00 . A A .  65 ARG NH2  1 1 
        3  4305 1 1  65 ARG O    O   0.022 -11.840  -6.230 1.00 . A A .  65 ARG O    1 1 
        3  4306 1 1  66 GLN C    C  -2.654 -10.404  -5.404 1.00 . A A .  66 GLN C    1 1 
        3  4307 1 1  66 GLN CA   C  -1.918 -11.217  -4.338 1.00 . A A .  66 GLN CA   1 1 
        3  4308 1 1  66 GLN CB   C  -2.586 -11.061  -2.971 1.00 . A A .  66 GLN CB   1 1 
        3  4309 1 1  66 GLN CD   C  -1.366 -10.912  -0.768 1.00 . A A .  66 GLN CD   1 1 
        3  4310 1 1  66 GLN CG   C  -1.824 -11.840  -1.896 1.00 . A A .  66 GLN CG   1 1 
        3  4311 1 1  66 GLN H    H  -0.263 -10.286  -3.480 1.00 . A A .  66 GLN H    1 1 
        3  4312 1 1  66 GLN HA   H  -1.912 -12.272  -4.615 1.00 . A A .  66 GLN HA   1 1 
        3  4313 1 1  66 GLN HB2  H  -2.627 -10.006  -2.700 1.00 . A A .  66 GLN HB2  1 1 
        3  4314 1 1  66 GLN HB3  H  -3.615 -11.418  -3.022 1.00 . A A .  66 GLN HB3  1 1 
        3  4315 1 1  66 GLN HE21 H   0.019 -12.297  -0.255 1.00 . A A .  66 GLN HE21 1 1 
        3  4316 1 1  66 GLN HE22 H   0.005 -10.865   0.721 1.00 . A A .  66 GLN HE22 1 1 
        3  4317 1 1  66 GLN HG2  H  -2.461 -12.625  -1.490 1.00 . A A .  66 GLN HG2  1 1 
        3  4318 1 1  66 GLN HG3  H  -0.959 -12.330  -2.342 1.00 . A A .  66 GLN HG3  1 1 
        3  4319 1 1  66 GLN N    N  -0.519 -10.826  -4.282 1.00 . A A .  66 GLN N    1 1 
        3  4320 1 1  66 GLN NE2  N  -0.365 -11.398  -0.041 1.00 . A A .  66 GLN NE2  1 1 
        3  4321 1 1  66 GLN O    O  -3.411 -10.958  -6.200 1.00 . A A .  66 GLN O    1 1 
        3  4322 1 1  66 GLN OE1  O  -1.888  -9.827  -0.572 1.00 . A A .  66 GLN OE1  1 1 
        3  4323 1 1  67 TYR C    C  -2.920  -8.755  -7.765 1.00 . A A .  67 TYR C    1 1 
        3  4324 1 1  67 TYR CA   C  -3.036  -8.208  -6.342 1.00 . A A .  67 TYR CA   1 1 
        3  4325 1 1  67 TYR CB   C  -2.270  -6.887  -6.251 1.00 . A A .  67 TYR CB   1 1 
        3  4326 1 1  67 TYR CD1  C  -2.575  -5.879  -8.542 1.00 . A A .  67 TYR CD1  1 1 
        3  4327 1 1  67 TYR CD2  C  -3.501  -4.726  -6.664 1.00 . A A .  67 TYR CD2  1 1 
        3  4328 1 1  67 TYR CE1  C  -3.074  -4.851  -9.419 1.00 . A A .  67 TYR CE1  1 1 
        3  4329 1 1  67 TYR CE2  C  -4.000  -3.698  -7.541 1.00 . A A .  67 TYR CE2  1 1 
        3  4330 1 1  67 TYR CG   C  -2.799  -5.795  -7.183 1.00 . A A .  67 TYR CG   1 1 
        3  4331 1 1  67 TYR CZ   C  -3.761  -3.811  -8.875 1.00 . A A .  67 TYR CZ   1 1 
        3  4332 1 1  67 TYR H    H  -1.789  -8.660  -4.736 1.00 . A A .  67 TYR H    1 1 
        3  4333 1 1  67 TYR HA   H  -4.091  -8.123  -6.078 1.00 . A A .  67 TYR HA   1 1 
        3  4334 1 1  67 TYR HB2  H  -2.310  -6.525  -5.224 1.00 . A A .  67 TYR HB2  1 1 
        3  4335 1 1  67 TYR HB3  H  -1.221  -7.071  -6.483 1.00 . A A .  67 TYR HB3  1 1 
        3  4336 1 1  67 TYR HD1  H  -2.021  -6.723  -8.952 1.00 . A A .  67 TYR HD1  1 1 
        3  4337 1 1  67 TYR HD2  H  -3.678  -4.659  -5.590 1.00 . A A .  67 TYR HD2  1 1 
        3  4338 1 1  67 TYR HE1  H  -2.904  -4.905 -10.494 1.00 . A A .  67 TYR HE1  1 1 
        3  4339 1 1  67 TYR HE2  H  -4.555  -2.848  -7.144 1.00 . A A .  67 TYR HE2  1 1 
        3  4340 1 1  67 TYR HH   H  -4.075  -1.940  -9.298 1.00 . A A .  67 TYR HH   1 1 
        3  4341 1 1  67 TYR N    N  -2.406  -9.103  -5.386 1.00 . A A .  67 TYR N    1 1 
        3  4342 1 1  67 TYR O    O  -3.910  -8.822  -8.492 1.00 . A A .  67 TYR O    1 1 
        3  4343 1 1  67 TYR OH   O  -4.232  -2.840  -9.703 1.00 . A A .  67 TYR OH   1 1 
        3  4344 1 1  68 LYS C    C  -2.314 -10.910  -9.667 1.00 . A A .  68 LYS C    1 1 
        3  4345 1 1  68 LYS CA   C  -1.441  -9.673  -9.446 1.00 . A A .  68 LYS CA   1 1 
        3  4346 1 1  68 LYS CB   C   0.054  -9.933  -9.635 1.00 . A A .  68 LYS CB   1 1 
        3  4347 1 1  68 LYS CD   C   0.898 -11.559 -11.368 1.00 . A A .  68 LYS CD   1 1 
        3  4348 1 1  68 LYS CE   C   1.652 -11.642 -12.697 1.00 . A A .  68 LYS CE   1 1 
        3  4349 1 1  68 LYS CG   C   0.393 -10.137 -11.113 1.00 . A A .  68 LYS CG   1 1 
        3  4350 1 1  68 LYS H    H  -0.901  -9.076  -7.525 1.00 . A A .  68 LYS H    1 1 
        3  4351 1 1  68 LYS HA   H  -1.730  -8.912 -10.171 1.00 . A A .  68 LYS HA   1 1 
        3  4352 1 1  68 LYS HB2  H   0.627  -9.094  -9.239 1.00 . A A .  68 LYS HB2  1 1 
        3  4353 1 1  68 LYS HB3  H   0.349 -10.815  -9.065 1.00 . A A .  68 LYS HB3  1 1 
        3  4354 1 1  68 LYS HD2  H   1.554 -11.867 -10.554 1.00 . A A .  68 LYS HD2  1 1 
        3  4355 1 1  68 LYS HD3  H   0.056 -12.251 -11.380 1.00 . A A .  68 LYS HD3  1 1 
        3  4356 1 1  68 LYS HE2  H   1.314 -12.512 -13.260 1.00 . A A .  68 LYS HE2  1 1 
        3  4357 1 1  68 LYS HE3  H   1.431 -10.764 -13.303 1.00 . A A .  68 LYS HE3  1 1 
        3  4358 1 1  68 LYS HG2  H  -0.491  -9.947 -11.721 1.00 . A A .  68 LYS HG2  1 1 
        3  4359 1 1  68 LYS HG3  H   1.152  -9.417 -11.418 1.00 . A A .  68 LYS HG3  1 1 
        3  4360 1 1  68 LYS HZ1  H   3.366 -12.690 -12.317 1.00 . A A .  68 LYS HZ1  1 1 
        3  4361 1 1  68 LYS HZ2  H   3.600 -11.373 -13.253 1.00 . A A .  68 LYS HZ2  1 1 
        3  4362 1 1  68 LYS HZ3  H   3.351 -11.200 -11.649 1.00 . A A .  68 LYS HZ3  1 1 
        3  4363 1 1  68 LYS N    N  -1.701  -9.133  -8.122 1.00 . A A .  68 LYS N    1 1 
        3  4364 1 1  68 LYS NZ   N   3.110 -11.734 -12.460 1.00 . A A .  68 LYS NZ   1 1 
        3  4365 1 1  68 LYS O    O  -2.627 -11.258 -10.805 1.00 . A A .  68 LYS O    1 1 
        3  4366 1 1  69 VAL C    C  -4.986 -12.321  -8.638 1.00 . A A .  69 VAL C    1 1 
        3  4367 1 1  69 VAL CA   C  -3.512 -12.732  -8.621 1.00 . A A .  69 VAL CA   1 1 
        3  4368 1 1  69 VAL CB   C  -3.166 -13.669  -7.462 1.00 . A A .  69 VAL CB   1 1 
        3  4369 1 1  69 VAL CG1  C  -4.366 -14.540  -7.084 1.00 . A A .  69 VAL CG1  1 1 
        3  4370 1 1  69 VAL CG2  C  -1.948 -14.531  -7.800 1.00 . A A .  69 VAL CG2  1 1 
        3  4371 1 1  69 VAL H    H  -2.423 -11.251  -7.640 1.00 . A A .  69 VAL H    1 1 
        3  4372 1 1  69 VAL HA   H  -3.281 -13.248  -9.553 1.00 . A A .  69 VAL HA   1 1 
        3  4373 1 1  69 VAL HB   H  -2.912 -13.055  -6.599 1.00 . A A .  69 VAL HB   1 1 
        3  4374 1 1  69 VAL HG11 H  -5.220 -13.902  -6.856 1.00 . A A .  69 VAL HG11 1 1 
        3  4375 1 1  69 VAL HG12 H  -4.615 -15.197  -7.917 1.00 . A A .  69 VAL HG12 1 1 
        3  4376 1 1  69 VAL HG13 H  -4.117 -15.141  -6.209 1.00 . A A .  69 VAL HG13 1 1 
        3  4377 1 1  69 VAL HG21 H  -1.173 -13.907  -8.245 1.00 . A A .  69 VAL HG21 1 1 
        3  4378 1 1  69 VAL HG22 H  -1.565 -14.992  -6.889 1.00 . A A .  69 VAL HG22 1 1 
        3  4379 1 1  69 VAL HG23 H  -2.237 -15.309  -8.506 1.00 . A A .  69 VAL HG23 1 1 
        3  4380 1 1  69 VAL N    N  -2.682 -11.541  -8.562 1.00 . A A .  69 VAL N    1 1 
        3  4381 1 1  69 VAL O    O  -5.761 -12.809  -9.459 1.00 . A A .  69 VAL O    1 1 
        3  4382 1 1  70 HIS C    C  -7.247 -10.670  -9.020 1.00 . A A .  70 HIS C    1 1 
        3  4383 1 1  70 HIS CA   C  -6.695 -10.946  -7.620 1.00 . A A .  70 HIS CA   1 1 
        3  4384 1 1  70 HIS CB   C  -6.774  -9.725  -6.700 1.00 . A A .  70 HIS CB   1 1 
        3  4385 1 1  70 HIS CD2  C  -5.895 -11.108  -4.664 1.00 . A A .  70 HIS CD2  1 1 
        3  4386 1 1  70 HIS CE1  C  -6.468  -9.719  -3.073 1.00 . A A .  70 HIS CE1  1 1 
        3  4387 1 1  70 HIS CG   C  -6.494 -10.031  -5.248 1.00 . A A .  70 HIS CG   1 1 
        3  4388 1 1  70 HIS H    H  -4.692 -11.036  -7.056 1.00 . A A .  70 HIS H    1 1 
        3  4389 1 1  70 HIS HA   H  -7.276 -11.746  -7.161 1.00 . A A .  70 HIS HA   1 1 
        3  4390 1 1  70 HIS HB2  H  -6.063  -8.975  -7.047 1.00 . A A .  70 HIS HB2  1 1 
        3  4391 1 1  70 HIS HB3  H  -7.768  -9.285  -6.783 1.00 . A A .  70 HIS HB3  1 1 
        3  4392 1 1  70 HIS HD1  H  -7.304  -8.291  -4.325 1.00 . A A .  70 HIS HD1  1 1 
        3  4393 1 1  70 HIS HD2  H  -5.497 -11.977  -5.187 1.00 . A A .  70 HIS HD2  1 1 
        3  4394 1 1  70 HIS HE1  H  -6.604  -9.286  -2.082 1.00 . A A .  70 HIS HE1  1 1 
        3  4395 1 1  70 HIS N    N  -5.328 -11.428  -7.721 1.00 . A A .  70 HIS N    1 1 
        3  4396 1 1  70 HIS ND1  N  -6.844  -9.173  -4.220 1.00 . A A .  70 HIS ND1  1 1 
        3  4397 1 1  70 HIS NE2  N  -5.879 -10.918  -3.350 1.00 . A A .  70 HIS NE2  1 1 
        3  4398 1 1  70 HIS O    O  -8.350 -11.101  -9.352 1.00 . A A .  70 HIS O    1 1 
        3  4399 1 1  71 LEU C    C  -7.421 -10.858 -11.844 1.00 . A A .  71 LEU C    1 1 
        3  4400 1 1  71 LEU CA   C  -6.850  -9.615 -11.159 1.00 . A A .  71 LEU CA   1 1 
        3  4401 1 1  71 LEU CB   C  -5.681  -8.979 -11.915 1.00 . A A .  71 LEU CB   1 1 
        3  4402 1 1  71 LEU CD1  C  -4.002  -7.113 -12.154 1.00 . A A .  71 LEU CD1  1 1 
        3  4403 1 1  71 LEU CD2  C  -6.463  -6.583 -11.835 1.00 . A A .  71 LEU CD2  1 1 
        3  4404 1 1  71 LEU CG   C  -5.321  -7.548 -11.511 1.00 . A A .  71 LEU CG   1 1 
        3  4405 1 1  71 LEU H    H  -5.558  -9.607  -9.525 1.00 . A A .  71 LEU H    1 1 
        3  4406 1 1  71 LEU HA   H  -7.637  -8.864 -11.093 1.00 . A A .  71 LEU HA   1 1 
        3  4407 1 1  71 LEU HB2  H  -4.801  -9.607 -11.778 1.00 . A A .  71 LEU HB2  1 1 
        3  4408 1 1  71 LEU HB3  H  -5.916  -8.987 -12.980 1.00 . A A .  71 LEU HB3  1 1 
        3  4409 1 1  71 LEU HD11 H  -3.777  -6.087 -11.862 1.00 . A A .  71 LEU HD11 1 1 
        3  4410 1 1  71 LEU HD12 H  -3.200  -7.770 -11.818 1.00 . A A .  71 LEU HD12 1 1 
        3  4411 1 1  71 LEU HD13 H  -4.090  -7.171 -13.239 1.00 . A A .  71 LEU HD13 1 1 
        3  4412 1 1  71 LEU HD21 H  -6.783  -6.732 -12.866 1.00 . A A .  71 LEU HD21 1 1 
        3  4413 1 1  71 LEU HD22 H  -7.300  -6.771 -11.163 1.00 . A A .  71 LEU HD22 1 1 
        3  4414 1 1  71 LEU HD23 H  -6.118  -5.556 -11.707 1.00 . A A .  71 LEU HD23 1 1 
        3  4415 1 1  71 LEU HG   H  -5.176  -7.524 -10.431 1.00 . A A .  71 LEU HG   1 1 
        3  4416 1 1  71 LEU N    N  -6.454  -9.953  -9.803 1.00 . A A .  71 LEU N    1 1 
        3  4417 1 1  71 LEU O    O  -8.607 -10.902 -12.169 1.00 . A A .  71 LEU O    1 1 
        3  4418 1 1  72 ASP C    C  -8.298 -13.530 -12.110 1.00 . A A .  72 ASP C    1 1 
        3  4419 1 1  72 ASP CA   C  -6.955 -13.077 -12.685 1.00 . A A .  72 ASP CA   1 1 
        3  4420 1 1  72 ASP CB   C  -5.933 -14.187 -12.429 1.00 . A A .  72 ASP CB   1 1 
        3  4421 1 1  72 ASP CG   C  -5.634 -15.081 -13.634 1.00 . A A .  72 ASP CG   1 1 
        3  4422 1 1  72 ASP H    H  -5.589 -11.793 -11.778 1.00 . A A .  72 ASP H    1 1 
        3  4423 1 1  72 ASP HA   H  -7.014 -12.845 -13.748 1.00 . A A .  72 ASP HA   1 1 
        3  4424 1 1  72 ASP HB2  H  -5.001 -13.732 -12.093 1.00 . A A .  72 ASP HB2  1 1 
        3  4425 1 1  72 ASP HB3  H  -6.295 -14.812 -11.613 1.00 . A A .  72 ASP HB3  1 1 
        3  4426 1 1  72 ASP N    N  -6.551 -11.837 -12.044 1.00 . A A .  72 ASP N    1 1 
        3  4427 1 1  72 ASP O    O  -9.200 -13.910 -12.855 1.00 . A A .  72 ASP O    1 1 
        3  4428 1 1  72 ASP OD1  O  -5.069 -14.545 -14.612 1.00 . A A .  72 ASP OD1  1 1 
        3  4429 1 1  72 ASP OD2  O  -5.977 -16.280 -13.551 1.00 . A A .  72 ASP OD2  1 1 
        3  4430 1 1  73 LEU C    C -10.755 -12.964 -10.544 1.00 . A A .  73 LEU C    1 1 
        3  4431 1 1  73 LEU CA   C  -9.607 -13.874 -10.105 1.00 . A A .  73 LEU CA   1 1 
        3  4432 1 1  73 LEU CB   C  -9.388 -13.901  -8.591 1.00 . A A .  73 LEU CB   1 1 
        3  4433 1 1  73 LEU CD1  C  -8.109 -14.734  -6.583 1.00 . A A .  73 LEU CD1  1 1 
        3  4434 1 1  73 LEU CD2  C  -7.970 -15.976  -8.791 1.00 . A A .  73 LEU CD2  1 1 
        3  4435 1 1  73 LEU CG   C  -8.124 -14.615  -8.109 1.00 . A A .  73 LEU CG   1 1 
        3  4436 1 1  73 LEU H    H  -7.650 -13.165 -10.190 1.00 . A A .  73 LEU H    1 1 
        3  4437 1 1  73 LEU HA   H  -9.836 -14.894 -10.415 1.00 . A A .  73 LEU HA   1 1 
        3  4438 1 1  73 LEU HB2  H  -9.360 -12.872  -8.230 1.00 . A A .  73 LEU HB2  1 1 
        3  4439 1 1  73 LEU HB3  H -10.251 -14.378  -8.127 1.00 . A A .  73 LEU HB3  1 1 
        3  4440 1 1  73 LEU HD11 H  -9.104 -14.521  -6.193 1.00 . A A .  73 LEU HD11 1 1 
        3  4441 1 1  73 LEU HD12 H  -7.817 -15.745  -6.300 1.00 . A A .  73 LEU HD12 1 1 
        3  4442 1 1  73 LEU HD13 H  -7.396 -14.021  -6.170 1.00 . A A .  73 LEU HD13 1 1 
        3  4443 1 1  73 LEU HD21 H  -8.660 -16.689  -8.340 1.00 . A A .  73 LEU HD21 1 1 
        3  4444 1 1  73 LEU HD22 H  -8.192 -15.877  -9.853 1.00 . A A .  73 LEU HD22 1 1 
        3  4445 1 1  73 LEU HD23 H  -6.947 -16.332  -8.665 1.00 . A A .  73 LEU HD23 1 1 
        3  4446 1 1  73 LEU HG   H  -7.261 -14.013  -8.393 1.00 . A A .  73 LEU HG   1 1 
        3  4447 1 1  73 LEU N    N  -8.389 -13.475 -10.789 1.00 . A A .  73 LEU N    1 1 
        3  4448 1 1  73 LEU O    O -11.868 -13.432 -10.780 1.00 . A A .  73 LEU O    1 1 
        3  4449 1 1  74 TRP C    C -11.817 -10.985 -12.502 1.00 . A A .  74 TRP C    1 1 
        3  4450 1 1  74 TRP CA   C -11.438 -10.699 -11.048 1.00 . A A .  74 TRP CA   1 1 
        3  4451 1 1  74 TRP CB   C -10.922  -9.275 -10.833 1.00 . A A .  74 TRP CB   1 1 
        3  4452 1 1  74 TRP CD1  C -12.728  -7.559 -11.510 1.00 . A A .  74 TRP CD1  1 1 
        3  4453 1 1  74 TRP CD2  C -11.107  -7.759 -13.007 1.00 . A A .  74 TRP CD2  1 1 
        3  4454 1 1  74 TRP CE2  C -11.997  -6.821 -13.486 1.00 . A A .  74 TRP CE2  1 1 
        3  4455 1 1  74 TRP CE3  C  -9.956  -8.115 -13.732 1.00 . A A .  74 TRP CE3  1 1 
        3  4456 1 1  74 TRP CG   C -11.589  -8.230 -11.730 1.00 . A A .  74 TRP CG   1 1 
        3  4457 1 1  74 TRP CH2  C -10.691  -6.499 -15.449 1.00 . A A .  74 TRP CH2  1 1 
        3  4458 1 1  74 TRP CZ2  C -11.830  -6.160 -14.709 1.00 . A A .  74 TRP CZ2  1 1 
        3  4459 1 1  74 TRP CZ3  C  -9.804  -7.446 -14.952 1.00 . A A .  74 TRP CZ3  1 1 
        3  4460 1 1  74 TRP H    H  -9.539 -11.306 -10.447 1.00 . A A .  74 TRP H    1 1 
        3  4461 1 1  74 TRP HA   H -12.310 -10.821 -10.405 1.00 . A A .  74 TRP HA   1 1 
        3  4462 1 1  74 TRP HB2  H -11.078  -8.996  -9.791 1.00 . A A .  74 TRP HB2  1 1 
        3  4463 1 1  74 TRP HB3  H  -9.847  -9.258 -11.011 1.00 . A A .  74 TRP HB3  1 1 
        3  4464 1 1  74 TRP HD1  H -13.350  -7.682 -10.624 1.00 . A A .  74 TRP HD1  1 1 
        3  4465 1 1  74 TRP HE1  H -13.880  -6.036 -12.617 1.00 . A A .  74 TRP HE1  1 1 
        3  4466 1 1  74 TRP HE3  H  -9.238  -8.853 -13.375 1.00 . A A .  74 TRP HE3  1 1 
        3  4467 1 1  74 TRP HH2  H -10.501  -6.022 -16.411 1.00 . A A .  74 TRP HH2  1 1 
        3  4468 1 1  74 TRP HZ2  H -12.549  -5.422 -15.066 1.00 . A A .  74 TRP HZ2  1 1 
        3  4469 1 1  74 TRP HZ3  H  -8.928  -7.685 -15.555 1.00 . A A .  74 TRP HZ3  1 1 
        3  4470 1 1  74 TRP N    N -10.446 -11.679 -10.641 1.00 . A A .  74 TRP N    1 1 
        3  4471 1 1  74 TRP NE1  N -13.015  -6.695 -12.547 1.00 . A A .  74 TRP NE1  1 1 
        3  4472 1 1  74 TRP O    O -12.968 -10.800 -12.896 1.00 . A A .  74 TRP O    1 1 
        3  4473 1 1  75 VAL C    C -12.041 -12.898 -14.777 1.00 . A A .  75 VAL C    1 1 
        3  4474 1 1  75 VAL CA   C -11.042 -11.745 -14.663 1.00 . A A .  75 VAL CA   1 1 
        3  4475 1 1  75 VAL CB   C  -9.704 -12.044 -15.344 1.00 . A A .  75 VAL CB   1 1 
        3  4476 1 1  75 VAL CG1  C  -9.919 -12.645 -16.734 1.00 . A A .  75 VAL CG1  1 1 
        3  4477 1 1  75 VAL CG2  C  -8.833 -10.788 -15.417 1.00 . A A .  75 VAL CG2  1 1 
        3  4478 1 1  75 VAL H    H  -9.894 -11.579 -12.933 1.00 . A A .  75 VAL H    1 1 
        3  4479 1 1  75 VAL HA   H -11.470 -10.861 -15.136 1.00 . A A .  75 VAL HA   1 1 
        3  4480 1 1  75 VAL HB   H  -9.178 -12.782 -14.738 1.00 . A A .  75 VAL HB   1 1 
        3  4481 1 1  75 VAL HG11 H -10.638 -12.039 -17.285 1.00 . A A .  75 VAL HG11 1 1 
        3  4482 1 1  75 VAL HG12 H  -8.971 -12.662 -17.273 1.00 . A A .  75 VAL HG12 1 1 
        3  4483 1 1  75 VAL HG13 H -10.300 -13.661 -16.636 1.00 . A A .  75 VAL HG13 1 1 
        3  4484 1 1  75 VAL HG21 H  -8.460 -10.664 -16.433 1.00 . A A .  75 VAL HG21 1 1 
        3  4485 1 1  75 VAL HG22 H  -9.427  -9.918 -15.139 1.00 . A A .  75 VAL HG22 1 1 
        3  4486 1 1  75 VAL HG23 H  -7.993 -10.889 -14.730 1.00 . A A .  75 VAL HG23 1 1 
        3  4487 1 1  75 VAL N    N -10.827 -11.432 -13.261 1.00 . A A .  75 VAL N    1 1 
        3  4488 1 1  75 VAL O    O -13.040 -12.790 -15.486 1.00 . A A .  75 VAL O    1 1 
        3  4489 1 1  76 LYS C    C -14.039 -14.718 -13.804 1.00 . A A .  76 LYS C    1 1 
        3  4490 1 1  76 LYS CA   C -12.596 -15.146 -14.079 1.00 . A A .  76 LYS CA   1 1 
        3  4491 1 1  76 LYS CB   C -12.072 -16.204 -13.106 1.00 . A A .  76 LYS CB   1 1 
        3  4492 1 1  76 LYS CD   C  -9.949 -17.315 -12.319 1.00 . A A .  76 LYS CD   1 1 
        3  4493 1 1  76 LYS CE   C -10.651 -18.604 -11.886 1.00 . A A .  76 LYS CE   1 1 
        3  4494 1 1  76 LYS CG   C -10.670 -16.670 -13.504 1.00 . A A .  76 LYS CG   1 1 
        3  4495 1 1  76 LYS H    H -10.922 -14.054 -13.493 1.00 . A A .  76 LYS H    1 1 
        3  4496 1 1  76 LYS HA   H -12.548 -15.576 -15.079 1.00 . A A .  76 LYS HA   1 1 
        3  4497 1 1  76 LYS HB2  H -12.051 -15.796 -12.095 1.00 . A A .  76 LYS HB2  1 1 
        3  4498 1 1  76 LYS HB3  H -12.751 -17.057 -13.090 1.00 . A A .  76 LYS HB3  1 1 
        3  4499 1 1  76 LYS HD2  H  -8.917 -17.533 -12.591 1.00 . A A .  76 LYS HD2  1 1 
        3  4500 1 1  76 LYS HD3  H  -9.918 -16.616 -11.483 1.00 . A A .  76 LYS HD3  1 1 
        3  4501 1 1  76 LYS HE2  H -11.637 -18.661 -12.348 1.00 . A A .  76 LYS HE2  1 1 
        3  4502 1 1  76 LYS HE3  H -10.085 -19.468 -12.234 1.00 . A A .  76 LYS HE3  1 1 
        3  4503 1 1  76 LYS HG2  H -10.740 -17.384 -14.325 1.00 . A A .  76 LYS HG2  1 1 
        3  4504 1 1  76 LYS HG3  H -10.091 -15.821 -13.868 1.00 . A A .  76 LYS HG3  1 1 
        3  4505 1 1  76 LYS HZ1  H -10.865 -19.604 -10.116 1.00 . A A .  76 LYS HZ1  1 1 
        3  4506 1 1  76 LYS HZ2  H  -9.977 -18.239  -9.992 1.00 . A A .  76 LYS HZ2  1 1 
        3  4507 1 1  76 LYS HZ3  H -11.601 -18.146 -10.135 1.00 . A A .  76 LYS HZ3  1 1 
        3  4508 1 1  76 LYS N    N -11.737 -13.975 -14.067 1.00 . A A .  76 LYS N    1 1 
        3  4509 1 1  76 LYS NZ   N -10.784 -18.652 -10.413 1.00 . A A .  76 LYS NZ   1 1 
        3  4510 1 1  76 LYS O    O -14.979 -15.422 -14.170 1.00 . A A .  76 LYS O    1 1 
        3  4511 1 1  77 SER C    C -16.019 -12.211 -14.004 1.00 . A A .  77 SER C    1 1 
        3  4512 1 1  77 SER CA   C -15.481 -13.036 -12.834 1.00 . A A .  77 SER CA   1 1 
        3  4513 1 1  77 SER CB   C -15.429 -12.185 -11.563 1.00 . A A .  77 SER CB   1 1 
        3  4514 1 1  77 SER H    H -13.398 -13.000 -12.868 1.00 . A A .  77 SER H    1 1 
        3  4515 1 1  77 SER HA   H -16.110 -13.909 -12.660 1.00 . A A .  77 SER HA   1 1 
        3  4516 1 1  77 SER HB2  H -14.419 -11.799 -11.427 1.00 . A A .  77 SER HB2  1 1 
        3  4517 1 1  77 SER HB3  H -16.087 -11.324 -11.677 1.00 . A A .  77 SER HB3  1 1 
        3  4518 1 1  77 SER HG   H -15.127 -12.820  -9.689 1.00 . A A .  77 SER HG   1 1 
        3  4519 1 1  77 SER N    N -14.169 -13.566 -13.162 1.00 . A A .  77 SER N    1 1 
        3  4520 1 1  77 SER O    O -17.229 -12.150 -14.221 1.00 . A A .  77 SER O    1 1 
        3  4521 1 1  77 SER OG   O -15.814 -12.926 -10.408 1.00 . A A .  77 SER OG   1 1 
        3  4522 1 1  78 LEU C    C -16.356 -11.590 -16.809 1.00 . A A .  78 LEU C    1 1 
        3  4523 1 1  78 LEU CA   C -15.462 -10.777 -15.870 1.00 . A A .  78 LEU CA   1 1 
        3  4524 1 1  78 LEU CB   C -14.213 -10.211 -16.547 1.00 . A A .  78 LEU CB   1 1 
        3  4525 1 1  78 LEU CD1  C -12.384  -8.477 -16.653 1.00 . A A .  78 LEU CD1  1 1 
        3  4526 1 1  78 LEU CD2  C -14.475  -8.045 -15.284 1.00 . A A .  78 LEU CD2  1 1 
        3  4527 1 1  78 LEU CG   C -13.487  -9.096 -15.792 1.00 . A A .  78 LEU CG   1 1 
        3  4528 1 1  78 LEU H    H -14.114 -11.651 -14.545 1.00 . A A .  78 LEU H    1 1 
        3  4529 1 1  78 LEU HA   H -16.037  -9.930 -15.494 1.00 . A A .  78 LEU HA   1 1 
        3  4530 1 1  78 LEU HB2  H -13.510 -11.029 -16.711 1.00 . A A .  78 LEU HB2  1 1 
        3  4531 1 1  78 LEU HB3  H -14.496  -9.833 -17.530 1.00 . A A .  78 LEU HB3  1 1 
        3  4532 1 1  78 LEU HD11 H -11.419  -8.623 -16.168 1.00 . A A .  78 LEU HD11 1 1 
        3  4533 1 1  78 LEU HD12 H -12.375  -8.958 -17.632 1.00 . A A .  78 LEU HD12 1 1 
        3  4534 1 1  78 LEU HD13 H -12.573  -7.411 -16.774 1.00 . A A .  78 LEU HD13 1 1 
        3  4535 1 1  78 LEU HD21 H -13.951  -7.104 -15.116 1.00 . A A .  78 LEU HD21 1 1 
        3  4536 1 1  78 LEU HD22 H -15.260  -7.896 -16.025 1.00 . A A .  78 LEU HD22 1 1 
        3  4537 1 1  78 LEU HD23 H -14.919  -8.386 -14.348 1.00 . A A .  78 LEU HD23 1 1 
        3  4538 1 1  78 LEU HG   H -13.005  -9.534 -14.917 1.00 . A A .  78 LEU HG   1 1 
        3  4539 1 1  78 LEU N    N -15.096 -11.596 -14.728 1.00 . A A .  78 LEU N    1 1 
        3  4540 1 1  78 LEU O    O -16.039 -12.732 -17.140 1.00 . A A .  78 LEU O    1 1 
        3  4541 1 1  79 SER C    C -17.696 -12.013 -19.410 1.00 . A A .  79 SER C    1 1 
        3  4542 1 1  79 SER CA   C -18.396 -11.622 -18.107 1.00 . A A .  79 SER CA   1 1 
        3  4543 1 1  79 SER CB   C -19.595 -10.717 -18.400 1.00 . A A .  79 SER CB   1 1 
        3  4544 1 1  79 SER H    H -17.706 -10.042 -16.940 1.00 . A A .  79 SER H    1 1 
        3  4545 1 1  79 SER HA   H -18.734 -12.510 -17.573 1.00 . A A .  79 SER HA   1 1 
        3  4546 1 1  79 SER HB2  H -19.504  -9.798 -17.822 1.00 . A A .  79 SER HB2  1 1 
        3  4547 1 1  79 SER HB3  H -19.587 -10.434 -19.453 1.00 . A A .  79 SER HB3  1 1 
        3  4548 1 1  79 SER HG   H -21.548 -10.666 -17.969 1.00 . A A .  79 SER HG   1 1 
        3  4549 1 1  79 SER N    N -17.455 -10.970 -17.213 1.00 . A A .  79 SER N    1 1 
        3  4550 1 1  79 SER O    O -16.507 -11.748 -19.583 1.00 . A A .  79 SER O    1 1 
        3  4551 1 1  79 SER OG   O -20.832 -11.353 -18.090 1.00 . A A .  79 SER OG   1 1 
        3  4552 1 1  80 PRO C    C -17.769 -11.895 -22.543 1.00 . A A .  80 PRO C    1 1 
        3  4553 1 1  80 PRO CA   C -17.950 -13.084 -21.598 1.00 . A A .  80 PRO CA   1 1 
        3  4554 1 1  80 PRO CB   C -18.947 -14.108 -22.114 1.00 . A A .  80 PRO CB   1 1 
        3  4555 1 1  80 PRO CD   C -19.894 -12.984 -20.145 1.00 . A A .  80 PRO CD   1 1 
        3  4556 1 1  80 PRO CG   C -20.229 -13.873 -21.331 1.00 . A A .  80 PRO CG   1 1 
        3  4557 1 1  80 PRO HA   H -17.039 -13.480 -21.480 1.00 . A A .  80 PRO HA   1 1 
        3  4558 1 1  80 PRO HB2  H -19.115 -13.984 -23.184 1.00 . A A .  80 PRO HB2  1 1 
        3  4559 1 1  80 PRO HB3  H -18.578 -15.122 -21.965 1.00 . A A .  80 PRO HB3  1 1 
        3  4560 1 1  80 PRO HD2  H -20.512 -12.087 -20.135 1.00 . A A .  80 PRO HD2  1 1 
        3  4561 1 1  80 PRO HD3  H -20.068 -13.501 -19.201 1.00 . A A .  80 PRO HD3  1 1 
        3  4562 1 1  80 PRO HG2  H -20.981 -13.400 -21.963 1.00 . A A .  80 PRO HG2  1 1 
        3  4563 1 1  80 PRO HG3  H -20.647 -14.821 -20.992 1.00 . A A .  80 PRO HG3  1 1 
        3  4564 1 1  80 PRO N    N -18.482 -12.654 -20.316 1.00 . A A .  80 PRO N    1 1 
        3  4565 1 1  80 PRO O    O -17.073 -11.999 -23.552 1.00 . A A .  80 PRO O    1 1 
        3  4566 1 1  81 GLN C    C -17.216  -8.672 -22.465 1.00 . A A .  81 GLN C    1 1 
        3  4567 1 1  81 GLN CA   C -18.328  -9.584 -22.988 1.00 . A A .  81 GLN CA   1 1 
        3  4568 1 1  81 GLN CB   C -19.671  -8.851 -23.014 1.00 . A A .  81 GLN CB   1 1 
        3  4569 1 1  81 GLN CD   C -22.098  -9.520 -22.879 1.00 . A A .  81 GLN CD   1 1 
        3  4570 1 1  81 GLN CG   C -20.768  -9.739 -23.603 1.00 . A A .  81 GLN CG   1 1 
        3  4571 1 1  81 GLN H    H -18.973 -10.715 -21.362 1.00 . A A .  81 GLN H    1 1 
        3  4572 1 1  81 GLN HA   H -18.086  -9.922 -23.995 1.00 . A A .  81 GLN HA   1 1 
        3  4573 1 1  81 GLN HB2  H -19.945  -8.551 -22.003 1.00 . A A .  81 GLN HB2  1 1 
        3  4574 1 1  81 GLN HB3  H -19.580  -7.939 -23.604 1.00 . A A .  81 GLN HB3  1 1 
        3  4575 1 1  81 GLN HE21 H -23.044 -10.348 -24.466 1.00 . A A .  81 GLN HE21 1 1 
        3  4576 1 1  81 GLN HE22 H -24.076  -9.836 -23.173 1.00 . A A .  81 GLN HE22 1 1 
        3  4577 1 1  81 GLN HG2  H -20.887  -9.521 -24.664 1.00 . A A .  81 GLN HG2  1 1 
        3  4578 1 1  81 GLN HG3  H -20.475 -10.786 -23.524 1.00 . A A .  81 GLN HG3  1 1 
        3  4579 1 1  81 GLN N    N -18.409 -10.791 -22.184 1.00 . A A .  81 GLN N    1 1 
        3  4580 1 1  81 GLN NE2  N -23.161  -9.936 -23.563 1.00 . A A .  81 GLN NE2  1 1 
        3  4581 1 1  81 GLN O    O -16.457  -8.101 -23.247 1.00 . A A .  81 GLN O    1 1 
        3  4582 1 1  81 GLN OE1  O -22.156  -9.008 -21.773 1.00 . A A .  81 GLN OE1  1 1 
        3  4583 1 1  82 ASP C    C -14.762  -8.325 -20.768 1.00 . A A .  82 ASP C    1 1 
        3  4584 1 1  82 ASP CA   C -16.148  -7.731 -20.509 1.00 . A A .  82 ASP CA   1 1 
        3  4585 1 1  82 ASP CB   C -16.361  -7.669 -18.996 1.00 . A A .  82 ASP CB   1 1 
        3  4586 1 1  82 ASP CG   C -17.510  -6.767 -18.540 1.00 . A A .  82 ASP CG   1 1 
        3  4587 1 1  82 ASP H    H -17.775  -9.031 -20.517 1.00 . A A .  82 ASP H    1 1 
        3  4588 1 1  82 ASP HA   H -16.268  -6.744 -20.956 1.00 . A A .  82 ASP HA   1 1 
        3  4589 1 1  82 ASP HB2  H -16.544  -8.679 -18.628 1.00 . A A .  82 ASP HB2  1 1 
        3  4590 1 1  82 ASP HB3  H -15.439  -7.322 -18.528 1.00 . A A .  82 ASP HB3  1 1 
        3  4591 1 1  82 ASP N    N -17.154  -8.563 -21.146 1.00 . A A .  82 ASP N    1 1 
        3  4592 1 1  82 ASP O    O -13.898  -7.667 -21.346 1.00 . A A .  82 ASP O    1 1 
        3  4593 1 1  82 ASP OD1  O -18.645  -7.019 -18.998 1.00 . A A .  82 ASP OD1  1 1 
        3  4594 1 1  82 ASP OD2  O -17.226  -5.845 -17.745 1.00 . A A .  82 ASP OD2  1 1 
        3  4595 1 1  83 ARG C    C -12.865 -10.152 -21.959 1.00 . A A .  83 ARG C    1 1 
        3  4596 1 1  83 ARG CA   C -13.327 -10.254 -20.504 1.00 . A A .  83 ARG CA   1 1 
        3  4597 1 1  83 ARG CB   C -13.445 -11.729 -20.116 1.00 . A A .  83 ARG CB   1 1 
        3  4598 1 1  83 ARG CD   C -12.462 -13.434 -18.539 1.00 . A A .  83 ARG CD   1 1 
        3  4599 1 1  83 ARG CG   C -12.173 -12.217 -19.420 1.00 . A A .  83 ARG CG   1 1 
        3  4600 1 1  83 ARG CZ   C -11.849 -15.849 -18.593 1.00 . A A .  83 ARG CZ   1 1 
        3  4601 1 1  83 ARG H    H -15.300 -10.091 -19.858 1.00 . A A .  83 ARG H    1 1 
        3  4602 1 1  83 ARG HA   H -12.634  -9.742 -19.835 1.00 . A A .  83 ARG HA   1 1 
        3  4603 1 1  83 ARG HB2  H -14.301 -11.867 -19.456 1.00 . A A .  83 ARG HB2  1 1 
        3  4604 1 1  83 ARG HB3  H -13.630 -12.329 -21.007 1.00 . A A .  83 ARG HB3  1 1 
        3  4605 1 1  83 ARG HD2  H -12.252 -13.197 -17.496 1.00 . A A .  83 ARG HD2  1 1 
        3  4606 1 1  83 ARG HD3  H -13.519 -13.694 -18.599 1.00 . A A .  83 ARG HD3  1 1 
        3  4607 1 1  83 ARG HE   H -10.867 -14.400 -19.588 1.00 . A A .  83 ARG HE   1 1 
        3  4608 1 1  83 ARG HG2  H -11.422 -12.475 -20.167 1.00 . A A .  83 ARG HG2  1 1 
        3  4609 1 1  83 ARG HG3  H -11.756 -11.414 -18.812 1.00 . A A .  83 ARG HG3  1 1 
        3  4610 1 1  83 ARG HH11 H -13.464 -15.409 -17.439 1.00 . A A .  83 ARG HH11 1 1 
        3  4611 1 1  83 ARG HH12 H -13.025 -17.084 -17.486 1.00 . A A .  83 ARG HH12 1 1 
        3  4612 1 1  83 ARG HH21 H -10.288 -16.610 -19.651 1.00 . A A .  83 ARG HH21 1 1 
        3  4613 1 1  83 ARG HH22 H -11.206 -17.771 -18.754 1.00 . A A .  83 ARG HH22 1 1 
        3  4614 1 1  83 ARG N    N -14.593  -9.563 -20.327 1.00 . A A .  83 ARG N    1 1 
        3  4615 1 1  83 ARG NE   N -11.635 -14.582 -18.973 1.00 . A A .  83 ARG NE   1 1 
        3  4616 1 1  83 ARG NH1  N -12.865 -16.138 -17.770 1.00 . A A .  83 ARG NH1  1 1 
        3  4617 1 1  83 ARG NH2  N -11.046 -16.826 -19.037 1.00 . A A .  83 ARG NH2  1 1 
        3  4618 1 1  83 ARG O    O -11.712  -9.815 -22.226 1.00 . A A .  83 ARG O    1 1 
        3  4619 1 1  84 ALA C    C -12.719  -9.108 -24.589 1.00 . A A .  84 ALA C    1 1 
        3  4620 1 1  84 ALA CA   C -13.490 -10.394 -24.283 1.00 . A A .  84 ALA CA   1 1 
        3  4621 1 1  84 ALA CB   C -14.790 -10.498 -25.082 1.00 . A A .  84 ALA CB   1 1 
        3  4622 1 1  84 ALA H    H -14.723 -10.721 -22.636 1.00 . A A .  84 ALA H    1 1 
        3  4623 1 1  84 ALA HA   H -12.860 -11.251 -24.523 1.00 . A A .  84 ALA HA   1 1 
        3  4624 1 1  84 ALA HB1  H -14.615 -10.168 -26.106 1.00 . A A .  84 ALA HB1  1 1 
        3  4625 1 1  84 ALA HB2  H -15.131 -11.534 -25.088 1.00 . A A .  84 ALA HB2  1 1 
        3  4626 1 1  84 ALA HB3  H -15.551  -9.868 -24.622 1.00 . A A .  84 ALA HB3  1 1 
        3  4627 1 1  84 ALA N    N -13.788 -10.448 -22.862 1.00 . A A .  84 ALA N    1 1 
        3  4628 1 1  84 ALA O    O -11.921  -9.066 -25.524 1.00 . A A .  84 ALA O    1 1 
        3  4629 1 1  85 ALA C    C -10.965  -6.839 -23.259 1.00 . A A .  85 ALA C    1 1 
        3  4630 1 1  85 ALA CA   C -12.327  -6.807 -23.956 1.00 . A A .  85 ALA CA   1 1 
        3  4631 1 1  85 ALA CB   C -13.230  -5.693 -23.421 1.00 . A A .  85 ALA CB   1 1 
        3  4632 1 1  85 ALA H    H -13.636  -8.133 -23.025 1.00 . A A .  85 ALA H    1 1 
        3  4633 1 1  85 ALA HA   H -12.175  -6.653 -25.025 1.00 . A A .  85 ALA HA   1 1 
        3  4634 1 1  85 ALA HB1  H -13.268  -5.748 -22.333 1.00 . A A .  85 ALA HB1  1 1 
        3  4635 1 1  85 ALA HB2  H -12.830  -4.725 -23.722 1.00 . A A .  85 ALA HB2  1 1 
        3  4636 1 1  85 ALA HB3  H -14.234  -5.814 -23.826 1.00 . A A .  85 ALA HB3  1 1 
        3  4637 1 1  85 ALA N    N -12.985  -8.090 -23.783 1.00 . A A .  85 ALA N    1 1 
        3  4638 1 1  85 ALA O    O  -9.955  -6.451 -23.845 1.00 . A A .  85 ALA O    1 1 
        3  4639 1 1  86 TYR C    C  -8.698  -8.215 -21.968 1.00 . A A .  86 TYR C    1 1 
        3  4640 1 1  86 TYR CA   C  -9.761  -7.392 -21.236 1.00 . A A .  86 TYR CA   1 1 
        3  4641 1 1  86 TYR CB   C -10.141  -8.110 -19.940 1.00 . A A .  86 TYR CB   1 1 
        3  4642 1 1  86 TYR CD1  C  -8.301  -9.729 -19.348 1.00 . A A .  86 TYR CD1  1 1 
        3  4643 1 1  86 TYR CD2  C  -8.504  -7.724 -18.062 1.00 . A A .  86 TYR CD2  1 1 
        3  4644 1 1  86 TYR CE1  C  -7.174 -10.129 -18.547 1.00 . A A .  86 TYR CE1  1 1 
        3  4645 1 1  86 TYR CE2  C  -7.376  -8.124 -17.261 1.00 . A A .  86 TYR CE2  1 1 
        3  4646 1 1  86 TYR CG   C  -8.943  -8.535 -19.089 1.00 . A A .  86 TYR CG   1 1 
        3  4647 1 1  86 TYR CZ   C  -6.766  -9.306 -17.543 1.00 . A A .  86 TYR CZ   1 1 
        3  4648 1 1  86 TYR H    H -11.808  -7.617 -21.550 1.00 . A A .  86 TYR H    1 1 
        3  4649 1 1  86 TYR HA   H  -9.385  -6.380 -21.084 1.00 . A A .  86 TYR HA   1 1 
        3  4650 1 1  86 TYR HB2  H -10.780  -7.455 -19.348 1.00 . A A .  86 TYR HB2  1 1 
        3  4651 1 1  86 TYR HB3  H -10.731  -8.993 -20.186 1.00 . A A .  86 TYR HB3  1 1 
        3  4652 1 1  86 TYR HD1  H  -8.648 -10.370 -20.159 1.00 . A A .  86 TYR HD1  1 1 
        3  4653 1 1  86 TYR HD2  H  -9.010  -6.781 -17.858 1.00 . A A .  86 TYR HD2  1 1 
        3  4654 1 1  86 TYR HE1  H  -6.658 -11.069 -18.741 1.00 . A A .  86 TYR HE1  1 1 
        3  4655 1 1  86 TYR HE2  H  -7.019  -7.493 -16.448 1.00 . A A .  86 TYR HE2  1 1 
        3  4656 1 1  86 TYR HH   H  -5.376  -8.910 -16.243 1.00 . A A .  86 TYR HH   1 1 
        3  4657 1 1  86 TYR N    N -10.982  -7.304 -22.019 1.00 . A A .  86 TYR N    1 1 
        3  4658 1 1  86 TYR O    O  -7.617  -7.712 -22.269 1.00 . A A .  86 TYR O    1 1 
        3  4659 1 1  86 TYR OH   O  -5.701  -9.684 -16.786 1.00 . A A .  86 TYR OH   1 1 
        3  4660 1 1  87 LYS C    C  -7.723  -9.738 -24.258 1.00 . A A .  87 LYS C    1 1 
        3  4661 1 1  87 LYS CA   C  -8.133 -10.363 -22.923 1.00 . A A .  87 LYS CA   1 1 
        3  4662 1 1  87 LYS CB   C  -8.753 -11.755 -23.061 1.00 . A A .  87 LYS CB   1 1 
        3  4663 1 1  87 LYS CD   C  -7.049 -13.612 -23.145 1.00 . A A .  87 LYS CD   1 1 
        3  4664 1 1  87 LYS CE   C  -7.306 -15.109 -22.968 1.00 . A A .  87 LYS CE   1 1 
        3  4665 1 1  87 LYS CG   C  -7.972 -12.787 -22.245 1.00 . A A .  87 LYS CG   1 1 
        3  4666 1 1  87 LYS H    H  -9.925  -9.868 -21.984 1.00 . A A .  87 LYS H    1 1 
        3  4667 1 1  87 LYS HA   H  -7.243 -10.467 -22.303 1.00 . A A .  87 LYS HA   1 1 
        3  4668 1 1  87 LYS HB2  H  -9.790 -11.730 -22.725 1.00 . A A .  87 LYS HB2  1 1 
        3  4669 1 1  87 LYS HB3  H  -8.766 -12.049 -24.110 1.00 . A A .  87 LYS HB3  1 1 
        3  4670 1 1  87 LYS HD2  H  -7.206 -13.332 -24.187 1.00 . A A .  87 LYS HD2  1 1 
        3  4671 1 1  87 LYS HD3  H  -6.009 -13.387 -22.908 1.00 . A A .  87 LYS HD3  1 1 
        3  4672 1 1  87 LYS HE2  H  -6.882 -15.448 -22.023 1.00 . A A .  87 LYS HE2  1 1 
        3  4673 1 1  87 LYS HE3  H  -8.379 -15.297 -22.921 1.00 . A A .  87 LYS HE3  1 1 
        3  4674 1 1  87 LYS HG2  H  -7.383 -12.281 -21.481 1.00 . A A .  87 LYS HG2  1 1 
        3  4675 1 1  87 LYS HG3  H  -8.666 -13.448 -21.727 1.00 . A A .  87 LYS HG3  1 1 
        3  4676 1 1  87 LYS HZ1  H  -5.732 -15.993 -23.926 1.00 . A A .  87 LYS HZ1  1 1 
        3  4677 1 1  87 LYS HZ2  H  -7.151 -16.769 -24.151 1.00 . A A .  87 LYS HZ2  1 1 
        3  4678 1 1  87 LYS HZ3  H  -6.849 -15.373 -24.943 1.00 . A A .  87 LYS HZ3  1 1 
        3  4679 1 1  87 LYS N    N  -9.043  -9.466 -22.233 1.00 . A A .  87 LYS N    1 1 
        3  4680 1 1  87 LYS NZ   N  -6.711 -15.873 -24.088 1.00 . A A .  87 LYS NZ   1 1 
        3  4681 1 1  87 LYS O    O  -6.567  -9.843 -24.668 1.00 . A A .  87 LYS O    1 1 
        3  4682 1 1  88 GLU C    C  -7.238  -7.528 -26.083 1.00 . A A .  88 GLU C    1 1 
        3  4683 1 1  88 GLU CA   C  -8.446  -8.461 -26.181 1.00 . A A .  88 GLU CA   1 1 
        3  4684 1 1  88 GLU CB   C  -9.686  -7.705 -26.662 1.00 . A A .  88 GLU CB   1 1 
        3  4685 1 1  88 GLU CD   C -10.373  -6.185 -28.553 1.00 . A A .  88 GLU CD   1 1 
        3  4686 1 1  88 GLU CG   C  -9.294  -6.496 -27.514 1.00 . A A .  88 GLU CG   1 1 
        3  4687 1 1  88 GLU H    H  -9.629  -9.023 -24.561 1.00 . A A .  88 GLU H    1 1 
        3  4688 1 1  88 GLU HA   H  -8.231  -9.273 -26.875 1.00 . A A .  88 GLU HA   1 1 
        3  4689 1 1  88 GLU HB2  H -10.321  -8.373 -27.243 1.00 . A A .  88 GLU HB2  1 1 
        3  4690 1 1  88 GLU HB3  H -10.271  -7.375 -25.804 1.00 . A A .  88 GLU HB3  1 1 
        3  4691 1 1  88 GLU HG2  H  -9.141  -5.628 -26.872 1.00 . A A .  88 GLU HG2  1 1 
        3  4692 1 1  88 GLU HG3  H  -8.346  -6.692 -28.016 1.00 . A A .  88 GLU HG3  1 1 
        3  4693 1 1  88 GLU N    N  -8.692  -9.103 -24.900 1.00 . A A .  88 GLU N    1 1 
        3  4694 1 1  88 GLU O    O  -6.443  -7.435 -27.018 1.00 . A A .  88 GLU O    1 1 
        3  4695 1 1  88 GLU OE1  O -10.543  -7.025 -29.464 1.00 . A A .  88 GLU OE1  1 1 
        3  4696 1 1  88 GLU OE2  O -11.003  -5.115 -28.414 1.00 . A A .  88 GLU OE2  1 1 
        3  4697 1 1  89 TYR C    C  -4.772  -6.686 -24.292 1.00 . A A .  89 TYR C    1 1 
        3  4698 1 1  89 TYR CA   C  -6.039  -5.937 -24.712 1.00 . A A .  89 TYR CA   1 1 
        3  4699 1 1  89 TYR CB   C  -6.485  -5.031 -23.563 1.00 . A A .  89 TYR CB   1 1 
        3  4700 1 1  89 TYR CD1  C  -4.672  -3.311 -23.229 1.00 . A A .  89 TYR CD1  1 1 
        3  4701 1 1  89 TYR CD2  C  -4.945  -5.006 -21.566 1.00 . A A .  89 TYR CD2  1 1 
        3  4702 1 1  89 TYR CE1  C  -3.584  -2.745 -22.473 1.00 . A A .  89 TYR CE1  1 1 
        3  4703 1 1  89 TYR CE2  C  -3.858  -4.440 -20.810 1.00 . A A .  89 TYR CE2  1 1 
        3  4704 1 1  89 TYR CG   C  -5.330  -4.429 -22.760 1.00 . A A .  89 TYR CG   1 1 
        3  4705 1 1  89 TYR CZ   C  -3.231  -3.337 -21.301 1.00 . A A .  89 TYR CZ   1 1 
        3  4706 1 1  89 TYR H    H  -7.787  -6.941 -24.188 1.00 . A A .  89 TYR H    1 1 
        3  4707 1 1  89 TYR HA   H  -5.845  -5.404 -25.642 1.00 . A A .  89 TYR HA   1 1 
        3  4708 1 1  89 TYR HB2  H  -7.093  -4.221 -23.967 1.00 . A A .  89 TYR HB2  1 1 
        3  4709 1 1  89 TYR HB3  H  -7.123  -5.602 -22.889 1.00 . A A .  89 TYR HB3  1 1 
        3  4710 1 1  89 TYR HD1  H  -4.975  -2.855 -24.172 1.00 . A A .  89 TYR HD1  1 1 
        3  4711 1 1  89 TYR HD2  H  -5.465  -5.889 -21.195 1.00 . A A .  89 TYR HD2  1 1 
        3  4712 1 1  89 TYR HE1  H  -3.056  -1.862 -22.833 1.00 . A A .  89 TYR HE1  1 1 
        3  4713 1 1  89 TYR HE2  H  -3.544  -4.885 -19.866 1.00 . A A .  89 TYR HE2  1 1 
        3  4714 1 1  89 TYR HH   H  -2.492  -1.943 -20.166 1.00 . A A .  89 TYR HH   1 1 
        3  4715 1 1  89 TYR N    N  -7.137  -6.860 -24.943 1.00 . A A .  89 TYR N    1 1 
        3  4716 1 1  89 TYR O    O  -3.663  -6.276 -24.632 1.00 . A A .  89 TYR O    1 1 
        3  4717 1 1  89 TYR OH   O  -2.204  -2.803 -20.587 1.00 . A A .  89 TYR OH   1 1 
        3  4718 1 1  90 ILE C    C  -3.046  -9.055 -24.291 1.00 . A A .  90 ILE C    1 1 
        3  4719 1 1  90 ILE CA   C  -3.868  -8.581 -23.091 1.00 . A A .  90 ILE CA   1 1 
        3  4720 1 1  90 ILE CB   C  -4.373  -9.720 -22.203 1.00 . A A .  90 ILE CB   1 1 
        3  4721 1 1  90 ILE CD1  C  -4.381  -8.942 -19.804 1.00 . A A .  90 ILE CD1  1 1 
        3  4722 1 1  90 ILE CG1  C  -5.229  -9.182 -21.055 1.00 . A A .  90 ILE CG1  1 1 
        3  4723 1 1  90 ILE CG2  C  -3.211 -10.577 -21.698 1.00 . A A .  90 ILE CG2  1 1 
        3  4724 1 1  90 ILE H    H  -5.885  -8.097 -23.289 1.00 . A A .  90 ILE H    1 1 
        3  4725 1 1  90 ILE HA   H  -3.238  -7.943 -22.471 1.00 . A A .  90 ILE HA   1 1 
        3  4726 1 1  90 ILE HB   H  -5.011 -10.366 -22.806 1.00 . A A .  90 ILE HB   1 1 
        3  4727 1 1  90 ILE HD11 H  -3.551  -8.280 -20.049 1.00 . A A .  90 ILE HD11 1 1 
        3  4728 1 1  90 ILE HD12 H  -4.997  -8.482 -19.031 1.00 . A A .  90 ILE HD12 1 1 
        3  4729 1 1  90 ILE HD13 H  -3.993  -9.894 -19.441 1.00 . A A .  90 ILE HD13 1 1 
        3  4730 1 1  90 ILE HG12 H  -5.707  -8.250 -21.359 1.00 . A A .  90 ILE HG12 1 1 
        3  4731 1 1  90 ILE HG13 H  -6.026  -9.890 -20.829 1.00 . A A .  90 ILE HG13 1 1 
        3  4732 1 1  90 ILE HG21 H  -3.557 -11.217 -20.887 1.00 . A A .  90 ILE HG21 1 1 
        3  4733 1 1  90 ILE HG22 H  -2.834 -11.196 -22.513 1.00 . A A .  90 ILE HG22 1 1 
        3  4734 1 1  90 ILE HG23 H  -2.413  -9.930 -21.335 1.00 . A A .  90 ILE HG23 1 1 
        3  4735 1 1  90 ILE N    N  -4.979  -7.771 -23.561 1.00 . A A .  90 ILE N    1 1 
        3  4736 1 1  90 ILE O    O  -1.827  -8.888 -24.318 1.00 . A A .  90 ILE O    1 1 
        3  4737 1 1  91 SER C    C  -2.134  -9.080 -27.007 1.00 . A A .  91 SER C    1 1 
        3  4738 1 1  91 SER CA   C  -3.095 -10.135 -26.455 1.00 . A A .  91 SER CA   1 1 
        3  4739 1 1  91 SER CB   C  -4.124 -10.524 -27.518 1.00 . A A .  91 SER CB   1 1 
        3  4740 1 1  91 SER H    H  -4.736  -9.767 -25.225 1.00 . A A .  91 SER H    1 1 
        3  4741 1 1  91 SER HA   H  -2.547 -11.023 -26.138 1.00 . A A .  91 SER HA   1 1 
        3  4742 1 1  91 SER HB2  H  -4.575 -11.480 -27.253 1.00 . A A .  91 SER HB2  1 1 
        3  4743 1 1  91 SER HB3  H  -4.926  -9.786 -27.532 1.00 . A A .  91 SER HB3  1 1 
        3  4744 1 1  91 SER HG   H  -2.738 -11.211 -28.787 1.00 . A A .  91 SER HG   1 1 
        3  4745 1 1  91 SER N    N  -3.745  -9.636 -25.255 1.00 . A A .  91 SER N    1 1 
        3  4746 1 1  91 SER O    O  -0.979  -9.382 -27.305 1.00 . A A .  91 SER O    1 1 
        3  4747 1 1  91 SER OG   O  -3.542 -10.617 -28.815 1.00 . A A .  91 SER OG   1 1 
        3  4748 1 1  92 ASN C    C  -1.184  -6.034 -26.467 1.00 . A A .  92 ASN C    1 1 
        3  4749 1 1  92 ASN CA   C  -1.848  -6.763 -27.637 1.00 . A A .  92 ASN CA   1 1 
        3  4750 1 1  92 ASN CB   C  -2.718  -5.754 -28.389 1.00 . A A .  92 ASN CB   1 1 
        3  4751 1 1  92 ASN CG   C  -3.917  -5.325 -27.541 1.00 . A A .  92 ASN CG   1 1 
        3  4752 1 1  92 ASN H    H  -3.586  -7.627 -26.881 1.00 . A A .  92 ASN H    1 1 
        3  4753 1 1  92 ASN HA   H  -1.122  -7.222 -28.308 1.00 . A A .  92 ASN HA   1 1 
        3  4754 1 1  92 ASN HB2  H  -2.123  -4.879 -28.652 1.00 . A A .  92 ASN HB2  1 1 
        3  4755 1 1  92 ASN HB3  H  -3.067  -6.195 -29.323 1.00 . A A .  92 ASN HB3  1 1 
        3  4756 1 1  92 ASN HD21 H  -5.137  -6.114 -28.952 1.00 . A A .  92 ASN HD21 1 1 
        3  4757 1 1  92 ASN HD22 H  -5.940  -5.401 -27.593 1.00 . A A .  92 ASN HD22 1 1 
        3  4758 1 1  92 ASN N    N  -2.646  -7.864 -27.126 1.00 . A A .  92 ASN N    1 1 
        3  4759 1 1  92 ASN ND2  N  -5.095  -5.640 -28.073 1.00 . A A .  92 ASN ND2  1 1 
        3  4760 1 1  92 ASN O    O  -1.402  -4.840 -26.270 1.00 . A A .  92 ASN O    1 1 
        3  4761 1 1  92 ASN OD1  O  -3.782  -4.747 -26.475 1.00 . A A .  92 ASN OD1  1 1 
        3  4762 1 1  93 LYS C    C   1.631  -6.973 -24.371 1.00 . A A .  93 LYS C    1 1 
        3  4763 1 1  93 LYS CA   C   0.312  -6.224 -24.575 1.00 . A A .  93 LYS CA   1 1 
        3  4764 1 1  93 LYS CB   C  -0.594  -6.227 -23.342 1.00 . A A .  93 LYS CB   1 1 
        3  4765 1 1  93 LYS CD   C  -0.790  -5.557 -20.919 1.00 . A A .  93 LYS CD   1 1 
        3  4766 1 1  93 LYS CE   C  -0.637  -6.711 -19.927 1.00 . A A .  93 LYS CE   1 1 
        3  4767 1 1  93 LYS CG   C   0.158  -5.725 -22.108 1.00 . A A .  93 LYS CG   1 1 
        3  4768 1 1  93 LYS H    H  -0.213  -7.754 -25.887 1.00 . A A .  93 LYS H    1 1 
        3  4769 1 1  93 LYS HA   H   0.538  -5.183 -24.807 1.00 . A A .  93 LYS HA   1 1 
        3  4770 1 1  93 LYS HB2  H  -1.464  -5.596 -23.524 1.00 . A A .  93 LYS HB2  1 1 
        3  4771 1 1  93 LYS HB3  H  -0.965  -7.236 -23.161 1.00 . A A .  93 LYS HB3  1 1 
        3  4772 1 1  93 LYS HD2  H  -0.585  -4.611 -20.417 1.00 . A A .  93 LYS HD2  1 1 
        3  4773 1 1  93 LYS HD3  H  -1.820  -5.512 -21.274 1.00 . A A .  93 LYS HD3  1 1 
        3  4774 1 1  93 LYS HE2  H  -1.593  -6.915 -19.446 1.00 . A A .  93 LYS HE2  1 1 
        3  4775 1 1  93 LYS HE3  H  -0.348  -7.619 -20.458 1.00 . A A .  93 LYS HE3  1 1 
        3  4776 1 1  93 LYS HG2  H   0.950  -6.429 -21.849 1.00 . A A .  93 LYS HG2  1 1 
        3  4777 1 1  93 LYS HG3  H   0.638  -4.773 -22.333 1.00 . A A .  93 LYS HG3  1 1 
        3  4778 1 1  93 LYS HZ1  H   0.622  -7.211 -18.396 1.00 . A A .  93 LYS HZ1  1 1 
        3  4779 1 1  93 LYS HZ2  H   1.197  -6.017 -19.350 1.00 . A A .  93 LYS HZ2  1 1 
        3  4780 1 1  93 LYS HZ3  H   0.011  -5.701 -18.273 1.00 . A A .  93 LYS HZ3  1 1 
        3  4781 1 1  93 LYS N    N  -0.385  -6.784 -25.720 1.00 . A A .  93 LYS N    1 1 
        3  4782 1 1  93 LYS NZ   N   0.381  -6.384 -18.904 1.00 . A A .  93 LYS NZ   1 1 
        3  4783 1 1  93 LYS O    O   2.701  -6.366 -24.383 1.00 . A A .  93 LYS O    1 1 
        3  4784 1 1  94 ARG C    C   3.260  -9.559 -25.327 1.00 . A A .  94 ARG C    1 1 
        3  4785 1 1  94 ARG CA   C   2.680  -9.117 -23.982 1.00 . A A .  94 ARG CA   1 1 
        3  4786 1 1  94 ARG CB   C   2.331 -10.355 -23.153 1.00 . A A .  94 ARG CB   1 1 
        3  4787 1 1  94 ARG CD   C   0.326 -10.291 -21.625 1.00 . A A .  94 ARG CD   1 1 
        3  4788 1 1  94 ARG CG   C   1.813  -9.960 -21.769 1.00 . A A .  94 ARG CG   1 1 
        3  4789 1 1  94 ARG CZ   C   0.449 -12.338 -20.210 1.00 . A A .  94 ARG CZ   1 1 
        3  4790 1 1  94 ARG H    H   0.636  -8.765 -24.180 1.00 . A A .  94 ARG H    1 1 
        3  4791 1 1  94 ARG HA   H   3.383  -8.485 -23.440 1.00 . A A .  94 ARG HA   1 1 
        3  4792 1 1  94 ARG HB2  H   1.576 -10.944 -23.674 1.00 . A A .  94 ARG HB2  1 1 
        3  4793 1 1  94 ARG HB3  H   3.213 -10.987 -23.049 1.00 . A A .  94 ARG HB3  1 1 
        3  4794 1 1  94 ARG HD2  H  -0.105  -9.715 -20.807 1.00 . A A .  94 ARG HD2  1 1 
        3  4795 1 1  94 ARG HD3  H  -0.208 -10.006 -22.532 1.00 . A A .  94 ARG HD3  1 1 
        3  4796 1 1  94 ARG HE   H  -0.209 -12.304 -22.112 1.00 . A A .  94 ARG HE   1 1 
        3  4797 1 1  94 ARG HG2  H   2.382 -10.484 -21.001 1.00 . A A .  94 ARG HG2  1 1 
        3  4798 1 1  94 ARG HG3  H   1.969  -8.893 -21.609 1.00 . A A .  94 ARG HG3  1 1 
        3  4799 1 1  94 ARG HH11 H   1.078 -10.635 -19.294 1.00 . A A .  94 ARG HH11 1 1 
        3  4800 1 1  94 ARG HH12 H   1.157 -12.067 -18.323 1.00 . A A .  94 ARG HH12 1 1 
        3  4801 1 1  94 ARG HH21 H  -0.105 -14.194 -20.831 1.00 . A A .  94 ARG HH21 1 1 
        3  4802 1 1  94 ARG HH22 H   0.480 -14.105 -19.203 1.00 . A A .  94 ARG HH22 1 1 
        3  4803 1 1  94 ARG N    N   1.510  -8.279 -24.189 1.00 . A A .  94 ARG N    1 1 
        3  4804 1 1  94 ARG NE   N   0.152 -11.738 -21.371 1.00 . A A .  94 ARG NE   1 1 
        3  4805 1 1  94 ARG NH1  N   0.936 -11.619 -19.190 1.00 . A A .  94 ARG NH1  1 1 
        3  4806 1 1  94 ARG NH2  N   0.258 -13.657 -20.070 1.00 . A A .  94 ARG NH2  1 1 
        3  4807 1 1  94 ARG O    O   2.618  -9.406 -26.365 1.00 . A A .  94 ARG O    1 1 
        3  4808 1 1  95 LYS C    C   5.294  -9.397 -27.445 1.00 . A A .  95 LYS C    1 1 
        3  4809 1 1  95 LYS CA   C   5.144 -10.562 -26.465 1.00 . A A .  95 LYS CA   1 1 
        3  4810 1 1  95 LYS CB   C   4.415 -11.771 -27.055 1.00 . A A .  95 LYS CB   1 1 
        3  4811 1 1  95 LYS CD   C   4.808 -14.196 -27.628 1.00 . A A .  95 LYS CD   1 1 
        3  4812 1 1  95 LYS CE   C   5.800 -15.212 -28.195 1.00 . A A .  95 LYS CE   1 1 
        3  4813 1 1  95 LYS CG   C   5.408 -12.789 -27.620 1.00 . A A .  95 LYS CG   1 1 
        3  4814 1 1  95 LYS H    H   4.985 -10.218 -24.417 1.00 . A A .  95 LYS H    1 1 
        3  4815 1 1  95 LYS HA   H   6.138 -10.897 -26.172 1.00 . A A .  95 LYS HA   1 1 
        3  4816 1 1  95 LYS HB2  H   3.803 -12.243 -26.286 1.00 . A A .  95 LYS HB2  1 1 
        3  4817 1 1  95 LYS HB3  H   3.737 -11.443 -27.843 1.00 . A A .  95 LYS HB3  1 1 
        3  4818 1 1  95 LYS HD2  H   4.528 -14.482 -26.614 1.00 . A A .  95 LYS HD2  1 1 
        3  4819 1 1  95 LYS HD3  H   3.895 -14.202 -28.224 1.00 . A A .  95 LYS HD3  1 1 
        3  4820 1 1  95 LYS HE2  H   5.359 -15.720 -29.053 1.00 . A A .  95 LYS HE2  1 1 
        3  4821 1 1  95 LYS HE3  H   6.692 -14.698 -28.553 1.00 . A A .  95 LYS HE3  1 1 
        3  4822 1 1  95 LYS HG2  H   5.689 -12.503 -28.634 1.00 . A A .  95 LYS HG2  1 1 
        3  4823 1 1  95 LYS HG3  H   6.320 -12.782 -27.023 1.00 . A A .  95 LYS HG3  1 1 
        3  4824 1 1  95 LYS HZ1  H   5.883 -15.875 -26.264 1.00 . A A .  95 LYS HZ1  1 1 
        3  4825 1 1  95 LYS HZ2  H   5.725 -17.076 -27.359 1.00 . A A .  95 LYS HZ2  1 1 
        3  4826 1 1  95 LYS HZ3  H   7.166 -16.331 -27.165 1.00 . A A .  95 LYS HZ3  1 1 
        3  4827 1 1  95 LYS N    N   4.469 -10.097 -25.265 1.00 . A A .  95 LYS N    1 1 
        3  4828 1 1  95 LYS NZ   N   6.174 -16.204 -27.162 1.00 . A A .  95 LYS NZ   1 1 
        3  4829 1 1  95 LYS O    O   4.775  -8.308 -27.204 1.00 . A A .  95 LYS O    1 1 
        3  4830 1 1  96 SER C    C   5.536  -9.054 -30.849 1.00 . A A .  96 SER C    1 1 
        3  4831 1 1  96 SER CA   C   6.231  -8.652 -29.546 1.00 . A A .  96 SER CA   1 1 
        3  4832 1 1  96 SER CB   C   7.726  -8.435 -29.787 1.00 . A A .  96 SER CB   1 1 
        3  4833 1 1  96 SER H    H   6.425 -10.553 -28.718 1.00 . A A .  96 SER H    1 1 
        3  4834 1 1  96 SER HA   H   5.792  -7.738 -29.145 1.00 . A A .  96 SER HA   1 1 
        3  4835 1 1  96 SER HB2  H   8.215  -8.198 -28.842 1.00 . A A .  96 SER HB2  1 1 
        3  4836 1 1  96 SER HB3  H   8.172  -9.360 -30.153 1.00 . A A .  96 SER HB3  1 1 
        3  4837 1 1  96 SER HG   H   7.834  -6.500 -30.285 1.00 . A A .  96 SER HG   1 1 
        3  4838 1 1  96 SER N    N   6.006  -9.665 -28.529 1.00 . A A .  96 SER N    1 1 
        3  4839 1 1  96 SER O    O   4.662  -8.340 -31.337 1.00 . A A .  96 SER O    1 1 
        3  4840 1 1  96 SER OG   O   7.970  -7.389 -30.723 1.00 . A A .  96 SER OG   1 1 
        3  4841 1 1  97 GLY C    C   6.467 -11.278 -33.522 1.00 . A A .  97 GLY C    1 1 
        3  4842 1 1  97 GLY CA   C   5.381 -10.704 -32.611 1.00 . A A .  97 GLY CA   1 1 
        3  4843 1 1  97 GLY H    H   6.664 -10.772 -30.972 1.00 . A A .  97 GLY H    1 1 
        3  4844 1 1  97 GLY HA2  H   4.644 -11.475 -32.386 1.00 . A A .  97 GLY HA2  1 1 
        3  4845 1 1  97 GLY HA3  H   4.855  -9.901 -33.128 1.00 . A A .  97 GLY HA3  1 1 
        3  4846 1 1  97 GLY N    N   5.952 -10.197 -31.375 1.00 . A A .  97 GLY N    1 1 
        3  4847 1 1  97 GLY O    O   7.151 -10.535 -34.225 1.00 . A A .  97 GLY O    1 1 
        3  4848 1 1  98 PRO C    C   7.154 -13.367 -35.759 1.00 . A A .  98 PRO C    1 1 
        3  4849 1 1  98 PRO CA   C   7.589 -13.314 -34.293 1.00 . A A .  98 PRO CA   1 1 
        3  4850 1 1  98 PRO CB   C   7.731 -14.691 -33.666 1.00 . A A .  98 PRO CB   1 1 
        3  4851 1 1  98 PRO CD   C   5.805 -13.544 -32.660 1.00 . A A .  98 PRO CD   1 1 
        3  4852 1 1  98 PRO CG   C   6.486 -14.893 -32.817 1.00 . A A .  98 PRO CG   1 1 
        3  4853 1 1  98 PRO HA   H   8.453 -12.811 -34.282 1.00 . A A .  98 PRO HA   1 1 
        3  4854 1 1  98 PRO HB2  H   7.811 -15.463 -34.432 1.00 . A A .  98 PRO HB2  1 1 
        3  4855 1 1  98 PRO HB3  H   8.633 -14.752 -33.057 1.00 . A A .  98 PRO HB3  1 1 
        3  4856 1 1  98 PRO HD2  H   4.769 -13.581 -32.997 1.00 . A A .  98 PRO HD2  1 1 
        3  4857 1 1  98 PRO HD3  H   5.789 -13.227 -31.617 1.00 . A A .  98 PRO HD3  1 1 
        3  4858 1 1  98 PRO HG2  H   5.813 -15.608 -33.290 1.00 . A A .  98 PRO HG2  1 1 
        3  4859 1 1  98 PRO HG3  H   6.752 -15.302 -31.842 1.00 . A A .  98 PRO HG3  1 1 
        3  4860 1 1  98 PRO N    N   6.597 -12.631 -33.480 1.00 . A A .  98 PRO N    1 1 
        3  4861 1 1  98 PRO O    O   6.168 -14.021 -36.095 1.00 . A A .  98 PRO O    1 1 
        3  4862 1 1  99 SER C    C   8.455 -13.672 -38.754 1.00 . A A .  99 SER C    1 1 
        3  4863 1 1  99 SER CA   C   7.616 -12.628 -38.015 1.00 . A A .  99 SER CA   1 1 
        3  4864 1 1  99 SER CB   C   7.875 -11.234 -38.591 1.00 . A A .  99 SER CB   1 1 
        3  4865 1 1  99 SER H    H   8.711 -12.139 -36.312 1.00 . A A .  99 SER H    1 1 
        3  4866 1 1  99 SER HA   H   6.555 -12.863 -38.097 1.00 . A A .  99 SER HA   1 1 
        3  4867 1 1  99 SER HB2  H   8.369 -10.618 -37.841 1.00 . A A .  99 SER HB2  1 1 
        3  4868 1 1  99 SER HB3  H   8.556 -11.313 -39.438 1.00 . A A .  99 SER HB3  1 1 
        3  4869 1 1  99 SER HG   H   6.692 -10.440 -39.996 1.00 . A A .  99 SER HG   1 1 
        3  4870 1 1  99 SER N    N   7.911 -12.669 -36.593 1.00 . A A .  99 SER N    1 1 
        3  4871 1 1  99 SER O    O   9.680 -13.679 -38.644 1.00 . A A .  99 SER O    1 1 
        3  4872 1 1  99 SER OG   O   6.670 -10.597 -39.009 1.00 . A A .  99 SER OG   1 1 
        3  4873 1 1 100 SER C    C   8.625 -15.127 -41.697 1.00 . A A . 100 SER C    1 1 
        3  4874 1 1 100 SER CA   C   8.429 -15.574 -40.247 1.00 . A A . 100 SER CA   1 1 
        3  4875 1 1 100 SER CB   C   7.635 -16.881 -40.197 1.00 . A A . 100 SER CB   1 1 
        3  4876 1 1 100 SER H    H   6.766 -14.515 -39.575 1.00 . A A . 100 SER H    1 1 
        3  4877 1 1 100 SER HA   H   9.392 -15.716 -39.757 1.00 . A A . 100 SER HA   1 1 
        3  4878 1 1 100 SER HB2  H   8.029 -17.573 -40.941 1.00 . A A . 100 SER HB2  1 1 
        3  4879 1 1 100 SER HB3  H   7.771 -17.350 -39.223 1.00 . A A . 100 SER HB3  1 1 
        3  4880 1 1 100 SER HG   H   5.783 -17.549 -40.554 1.00 . A A . 100 SER HG   1 1 
        3  4881 1 1 100 SER N    N   7.763 -14.528 -39.491 1.00 . A A . 100 SER N    1 1 
        3  4882 1 1 100 SER O    O   9.750 -15.091 -42.193 1.00 . A A . 100 SER O    1 1 
        3  4883 1 1 100 SER OG   O   6.246 -16.671 -40.434 1.00 . A A . 100 SER OG   1 1 
        3  4884 1 1 101 GLY C    C   7.291 -12.850 -43.821 1.00 . A A . 101 GLY C    1 1 
        3  4885 1 1 101 GLY CA   C   7.547 -14.355 -43.720 1.00 . A A . 101 GLY CA   1 1 
        3  4886 1 1 101 GLY H    H   6.601 -14.830 -41.927 1.00 . A A . 101 GLY H    1 1 
        3  4887 1 1 101 GLY HA2  H   8.517 -14.592 -44.157 1.00 . A A . 101 GLY HA2  1 1 
        3  4888 1 1 101 GLY HA3  H   6.797 -14.895 -44.298 1.00 . A A . 101 GLY HA3  1 1 
        3  4889 1 1 101 GLY N    N   7.512 -14.798 -42.337 1.00 . A A . 101 GLY N    1 1 
        3  4890 1 1 101 GLY O    O   6.738 -12.248 -42.901 1.00 . A A . 101 GLY O    1 1 
        4  4891 1 1   1 GLY C    C -18.761 -11.886   4.379 1.00 . A A .   1 GLY C    1 1 
        4  4892 1 1   1 GLY CA   C -19.862 -10.974   4.925 1.00 . A A .   1 GLY CA   1 1 
        4  4893 1 1   1 GLY H1   H -19.462 -11.767   6.809 1.00 . A A .   1 GLY H1   1 1 
        4  4894 1 1   1 GLY HA2  H -20.834 -11.321   4.574 1.00 . A A .   1 GLY HA2  1 1 
        4  4895 1 1   1 GLY HA3  H -19.726  -9.963   4.540 1.00 . A A .   1 GLY HA3  1 1 
        4  4896 1 1   1 GLY N    N -19.846 -10.950   6.377 1.00 . A A .   1 GLY N    1 1 
        4  4897 1 1   1 GLY O    O -17.609 -11.793   4.798 1.00 . A A .   1 GLY O    1 1 
        4  4898 1 1   2 SER C    C -18.721 -14.102   1.466 1.00 . A A .   2 SER C    1 1 
        4  4899 1 1   2 SER CA   C -18.217 -13.675   2.846 1.00 . A A .   2 SER CA   1 1 
        4  4900 1 1   2 SER CB   C -18.002 -14.902   3.735 1.00 . A A .   2 SER CB   1 1 
        4  4901 1 1   2 SER H    H -20.095 -12.817   3.118 1.00 . A A .   2 SER H    1 1 
        4  4902 1 1   2 SER HA   H -17.281 -13.123   2.757 1.00 . A A .   2 SER HA   1 1 
        4  4903 1 1   2 SER HB2  H -17.545 -14.592   4.675 1.00 . A A .   2 SER HB2  1 1 
        4  4904 1 1   2 SER HB3  H -18.967 -15.345   3.980 1.00 . A A .   2 SER HB3  1 1 
        4  4905 1 1   2 SER HG   H -17.744 -16.578   2.672 1.00 . A A .   2 SER HG   1 1 
        4  4906 1 1   2 SER N    N -19.156 -12.747   3.453 1.00 . A A .   2 SER N    1 1 
        4  4907 1 1   2 SER O    O -19.669 -14.879   1.360 1.00 . A A .   2 SER O    1 1 
        4  4908 1 1   2 SER OG   O -17.177 -15.879   3.106 1.00 . A A .   2 SER OG   1 1 
        4  4909 1 1   3 SER C    C -17.295 -14.641  -1.617 1.00 . A A .   3 SER C    1 1 
        4  4910 1 1   3 SER CA   C -18.436 -13.891  -0.927 1.00 . A A .   3 SER CA   1 1 
        4  4911 1 1   3 SER CB   C -18.788 -12.624  -1.709 1.00 . A A .   3 SER CB   1 1 
        4  4912 1 1   3 SER H    H -17.296 -12.943   0.536 1.00 . A A .   3 SER H    1 1 
        4  4913 1 1   3 SER HA   H -19.319 -14.525  -0.848 1.00 . A A .   3 SER HA   1 1 
        4  4914 1 1   3 SER HB2  H -18.031 -11.862  -1.525 1.00 . A A .   3 SER HB2  1 1 
        4  4915 1 1   3 SER HB3  H -18.769 -12.840  -2.777 1.00 . A A .   3 SER HB3  1 1 
        4  4916 1 1   3 SER HG   H -20.563 -12.786  -0.799 1.00 . A A .   3 SER HG   1 1 
        4  4917 1 1   3 SER N    N -18.066 -13.574   0.442 1.00 . A A .   3 SER N    1 1 
        4  4918 1 1   3 SER O    O -17.478 -15.765  -2.081 1.00 . A A .   3 SER O    1 1 
        4  4919 1 1   3 SER OG   O -20.070 -12.114  -1.352 1.00 . A A .   3 SER OG   1 1 
        4  4920 1 1   4 GLY C    C -13.889 -13.527  -2.531 1.00 . A A .   4 GLY C    1 1 
        4  4921 1 1   4 GLY CA   C -14.973 -14.580  -2.289 1.00 . A A .   4 GLY CA   1 1 
        4  4922 1 1   4 GLY H    H -16.002 -13.074  -1.284 1.00 . A A .   4 GLY H    1 1 
        4  4923 1 1   4 GLY HA2  H -14.578 -15.374  -1.655 1.00 . A A .   4 GLY HA2  1 1 
        4  4924 1 1   4 GLY HA3  H -15.256 -15.040  -3.236 1.00 . A A .   4 GLY HA3  1 1 
        4  4925 1 1   4 GLY N    N -16.143 -13.989  -1.663 1.00 . A A .   4 GLY N    1 1 
        4  4926 1 1   4 GLY O    O -13.811 -12.535  -1.809 1.00 . A A .   4 GLY O    1 1 
        4  4927 1 1   5 SER C    C -12.537 -11.433  -3.966 1.00 . A A .   5 SER C    1 1 
        4  4928 1 1   5 SER CA   C -12.005 -12.866  -3.896 1.00 . A A .   5 SER CA   1 1 
        4  4929 1 1   5 SER CB   C -11.357 -13.257  -5.225 1.00 . A A .   5 SER CB   1 1 
        4  4930 1 1   5 SER H    H -13.151 -14.589  -4.132 1.00 . A A .   5 SER H    1 1 
        4  4931 1 1   5 SER HA   H -11.274 -12.964  -3.093 1.00 . A A .   5 SER HA   1 1 
        4  4932 1 1   5 SER HB2  H -11.862 -14.133  -5.631 1.00 . A A .   5 SER HB2  1 1 
        4  4933 1 1   5 SER HB3  H -11.491 -12.449  -5.945 1.00 . A A .   5 SER HB3  1 1 
        4  4934 1 1   5 SER HG   H  -9.504 -12.758  -4.655 1.00 . A A .   5 SER HG   1 1 
        4  4935 1 1   5 SER N    N -13.081 -13.780  -3.550 1.00 . A A .   5 SER N    1 1 
        4  4936 1 1   5 SER O    O -12.083 -10.562  -3.227 1.00 . A A .   5 SER O    1 1 
        4  4937 1 1   5 SER OG   O  -9.967 -13.536  -5.080 1.00 . A A .   5 SER OG   1 1 
        4  4938 1 1   6 SER C    C -13.061  -8.948  -5.606 1.00 . A A .   6 SER C    1 1 
        4  4939 1 1   6 SER CA   C -14.093  -9.923  -5.036 1.00 . A A .   6 SER CA   1 1 
        4  4940 1 1   6 SER CB   C -14.653  -9.391  -3.715 1.00 . A A .   6 SER CB   1 1 
        4  4941 1 1   6 SER H    H -13.858 -11.949  -5.458 1.00 . A A .   6 SER H    1 1 
        4  4942 1 1   6 SER HA   H -14.910 -10.071  -5.743 1.00 . A A .   6 SER HA   1 1 
        4  4943 1 1   6 SER HB2  H -14.352 -10.052  -2.902 1.00 . A A .   6 SER HB2  1 1 
        4  4944 1 1   6 SER HB3  H -14.221  -8.412  -3.507 1.00 . A A .   6 SER HB3  1 1 
        4  4945 1 1   6 SER HG   H -16.467 -10.087  -4.195 1.00 . A A .   6 SER HG   1 1 
        4  4946 1 1   6 SER N    N -13.494 -11.235  -4.861 1.00 . A A .   6 SER N    1 1 
        4  4947 1 1   6 SER O    O -11.860  -9.212  -5.560 1.00 . A A .   6 SER O    1 1 
        4  4948 1 1   6 SER OG   O -16.074  -9.287  -3.741 1.00 . A A .   6 SER OG   1 1 
        4  4949 1 1   7 GLY C    C -11.445  -6.626  -5.859 1.00 . A A .   7 GLY C    1 1 
        4  4950 1 1   7 GLY CA   C -12.702  -6.825  -6.709 1.00 . A A .   7 GLY CA   1 1 
        4  4951 1 1   7 GLY H    H -14.543  -7.633  -6.164 1.00 . A A .   7 GLY H    1 1 
        4  4952 1 1   7 GLY HA2  H -12.419  -7.116  -7.720 1.00 . A A .   7 GLY HA2  1 1 
        4  4953 1 1   7 GLY HA3  H -13.245  -5.883  -6.788 1.00 . A A .   7 GLY HA3  1 1 
        4  4954 1 1   7 GLY N    N -13.566  -7.841  -6.130 1.00 . A A .   7 GLY N    1 1 
        4  4955 1 1   7 GLY O    O -11.535  -6.268  -4.685 1.00 . A A .   7 GLY O    1 1 
        4  4956 1 1   8 PRO C    C  -8.637  -5.246  -5.648 1.00 . A A .   8 PRO C    1 1 
        4  4957 1 1   8 PRO CA   C  -8.999  -6.723  -5.817 1.00 . A A .   8 PRO CA   1 1 
        4  4958 1 1   8 PRO CB   C  -8.001  -7.485  -6.674 1.00 . A A .   8 PRO CB   1 1 
        4  4959 1 1   8 PRO CD   C -10.127  -7.296  -7.890 1.00 . A A .   8 PRO CD   1 1 
        4  4960 1 1   8 PRO CG   C  -8.654  -7.638  -8.038 1.00 . A A .   8 PRO CG   1 1 
        4  4961 1 1   8 PRO HA   H  -9.056  -7.098  -4.892 1.00 . A A .   8 PRO HA   1 1 
        4  4962 1 1   8 PRO HB2  H  -7.058  -6.943  -6.750 1.00 . A A .   8 PRO HB2  1 1 
        4  4963 1 1   8 PRO HB3  H  -7.775  -8.458  -6.237 1.00 . A A .   8 PRO HB3  1 1 
        4  4964 1 1   8 PRO HD2  H -10.421  -6.504  -8.579 1.00 . A A .   8 PRO HD2  1 1 
        4  4965 1 1   8 PRO HD3  H -10.757  -8.159  -8.109 1.00 . A A .   8 PRO HD3  1 1 
        4  4966 1 1   8 PRO HG2  H  -8.179  -6.978  -8.764 1.00 . A A .   8 PRO HG2  1 1 
        4  4967 1 1   8 PRO HG3  H  -8.533  -8.656  -8.407 1.00 . A A .   8 PRO HG3  1 1 
        4  4968 1 1   8 PRO N    N -10.272  -6.872  -6.501 1.00 . A A .   8 PRO N    1 1 
        4  4969 1 1   8 PRO O    O  -8.693  -4.476  -6.606 1.00 . A A .   8 PRO O    1 1 
        4  4970 1 1   9 LYS C    C  -6.402  -3.340  -4.360 1.00 . A A .   9 LYS C    1 1 
        4  4971 1 1   9 LYS CA   C  -7.902  -3.524  -4.117 1.00 . A A .   9 LYS CA   1 1 
        4  4972 1 1   9 LYS CB   C  -8.345  -3.153  -2.700 1.00 . A A .   9 LYS CB   1 1 
        4  4973 1 1   9 LYS CD   C  -6.736  -2.381  -0.919 1.00 . A A .   9 LYS CD   1 1 
        4  4974 1 1   9 LYS CE   C  -5.391  -2.719  -0.272 1.00 . A A .   9 LYS CE   1 1 
        4  4975 1 1   9 LYS CG   C  -7.303  -3.588  -1.668 1.00 . A A .   9 LYS CG   1 1 
        4  4976 1 1   9 LYS H    H  -8.230  -5.528  -3.650 1.00 . A A .   9 LYS H    1 1 
        4  4977 1 1   9 LYS HA   H  -8.446  -2.877  -4.805 1.00 . A A .   9 LYS HA   1 1 
        4  4978 1 1   9 LYS HB2  H  -8.500  -2.076  -2.634 1.00 . A A .   9 LYS HB2  1 1 
        4  4979 1 1   9 LYS HB3  H  -9.301  -3.627  -2.479 1.00 . A A .   9 LYS HB3  1 1 
        4  4980 1 1   9 LYS HD2  H  -6.612  -1.546  -1.608 1.00 . A A .   9 LYS HD2  1 1 
        4  4981 1 1   9 LYS HD3  H  -7.441  -2.060  -0.152 1.00 . A A .   9 LYS HD3  1 1 
        4  4982 1 1   9 LYS HE2  H  -5.554  -3.162   0.710 1.00 . A A .   9 LYS HE2  1 1 
        4  4983 1 1   9 LYS HE3  H  -4.868  -3.462  -0.874 1.00 . A A .   9 LYS HE3  1 1 
        4  4984 1 1   9 LYS HG2  H  -7.755  -4.281  -0.959 1.00 . A A .   9 LYS HG2  1 1 
        4  4985 1 1   9 LYS HG3  H  -6.494  -4.124  -2.166 1.00 . A A .   9 LYS HG3  1 1 
        4  4986 1 1   9 LYS HZ1  H  -3.844  -1.511  -0.842 1.00 . A A .   9 LYS HZ1  1 1 
        4  4987 1 1   9 LYS HZ2  H  -5.131  -0.692  -0.261 1.00 . A A .   9 LYS HZ2  1 1 
        4  4988 1 1   9 LYS HZ3  H  -4.136  -1.483   0.765 1.00 . A A .   9 LYS HZ3  1 1 
        4  4989 1 1   9 LYS N    N  -8.273  -4.895  -4.424 1.00 . A A .   9 LYS N    1 1 
        4  4990 1 1   9 LYS NZ   N  -4.558  -1.502  -0.142 1.00 . A A .   9 LYS NZ   1 1 
        4  4991 1 1   9 LYS O    O  -5.645  -4.309  -4.350 1.00 . A A .   9 LYS O    1 1 
        4  4992 1 1  10 LYS C    C  -3.848  -1.844  -3.504 1.00 . A A .  10 LYS C    1 1 
        4  4993 1 1  10 LYS CA   C  -4.624  -1.766  -4.819 1.00 . A A .  10 LYS CA   1 1 
        4  4994 1 1  10 LYS CB   C  -4.504  -0.413  -5.525 1.00 . A A .  10 LYS CB   1 1 
        4  4995 1 1  10 LYS CD   C  -3.508  -0.663  -7.828 1.00 . A A .  10 LYS CD   1 1 
        4  4996 1 1  10 LYS CE   C  -4.555   0.292  -8.406 1.00 . A A .  10 LYS CE   1 1 
        4  4997 1 1  10 LYS CG   C  -3.224  -0.342  -6.360 1.00 . A A .  10 LYS CG   1 1 
        4  4998 1 1  10 LYS H    H  -6.642  -1.307  -4.581 1.00 . A A .  10 LYS H    1 1 
        4  4999 1 1  10 LYS HA   H  -4.229  -2.520  -5.500 1.00 . A A .  10 LYS HA   1 1 
        4  5000 1 1  10 LYS HB2  H  -5.371  -0.255  -6.167 1.00 . A A .  10 LYS HB2  1 1 
        4  5001 1 1  10 LYS HB3  H  -4.506   0.388  -4.786 1.00 . A A .  10 LYS HB3  1 1 
        4  5002 1 1  10 LYS HD2  H  -2.586  -0.591  -8.405 1.00 . A A .  10 LYS HD2  1 1 
        4  5003 1 1  10 LYS HD3  H  -3.860  -1.691  -7.918 1.00 . A A .  10 LYS HD3  1 1 
        4  5004 1 1  10 LYS HE2  H  -5.436  -0.269  -8.717 1.00 . A A .  10 LYS HE2  1 1 
        4  5005 1 1  10 LYS HE3  H  -4.879   0.993  -7.637 1.00 . A A .  10 LYS HE3  1 1 
        4  5006 1 1  10 LYS HG2  H  -2.788   0.654  -6.279 1.00 . A A .  10 LYS HG2  1 1 
        4  5007 1 1  10 LYS HG3  H  -2.489  -1.044  -5.966 1.00 . A A .  10 LYS HG3  1 1 
        4  5008 1 1  10 LYS HZ1  H  -3.097   0.666  -9.789 1.00 . A A .  10 LYS HZ1  1 1 
        4  5009 1 1  10 LYS HZ2  H  -4.609   0.935 -10.345 1.00 . A A .  10 LYS HZ2  1 1 
        4  5010 1 1  10 LYS HZ3  H  -3.913   2.002  -9.323 1.00 . A A .  10 LYS HZ3  1 1 
        4  5011 1 1  10 LYS N    N  -6.019  -2.090  -4.574 1.00 . A A .  10 LYS N    1 1 
        4  5012 1 1  10 LYS NZ   N  -3.998   1.034  -9.559 1.00 . A A .  10 LYS NZ   1 1 
        4  5013 1 1  10 LYS O    O  -4.091  -1.060  -2.588 1.00 . A A .  10 LYS O    1 1 
        4  5014 1 1  11 PRO C    C  -1.019  -1.928  -2.150 1.00 . A A .  11 PRO C    1 1 
        4  5015 1 1  11 PRO CA   C  -2.091  -3.014  -2.261 1.00 . A A .  11 PRO CA   1 1 
        4  5016 1 1  11 PRO CB   C  -1.509  -4.411  -2.404 1.00 . A A .  11 PRO CB   1 1 
        4  5017 1 1  11 PRO CD   C  -2.590  -3.770  -4.515 1.00 . A A .  11 PRO CD   1 1 
        4  5018 1 1  11 PRO CG   C  -1.640  -4.769  -3.875 1.00 . A A .  11 PRO CG   1 1 
        4  5019 1 1  11 PRO HA   H  -2.653  -2.928  -1.439 1.00 . A A .  11 PRO HA   1 1 
        4  5020 1 1  11 PRO HB2  H  -0.466  -4.433  -2.088 1.00 . A A .  11 PRO HB2  1 1 
        4  5021 1 1  11 PRO HB3  H  -2.046  -5.123  -1.779 1.00 . A A .  11 PRO HB3  1 1 
        4  5022 1 1  11 PRO HD2  H  -2.125  -3.270  -5.365 1.00 . A A .  11 PRO HD2  1 1 
        4  5023 1 1  11 PRO HD3  H  -3.489  -4.261  -4.887 1.00 . A A .  11 PRO HD3  1 1 
        4  5024 1 1  11 PRO HG2  H  -0.666  -4.737  -4.364 1.00 . A A .  11 PRO HG2  1 1 
        4  5025 1 1  11 PRO HG3  H  -2.020  -5.784  -3.988 1.00 . A A .  11 PRO HG3  1 1 
        4  5026 1 1  11 PRO N    N  -2.905  -2.823  -3.450 1.00 . A A .  11 PRO N    1 1 
        4  5027 1 1  11 PRO O    O  -0.859  -1.113  -3.058 1.00 . A A .  11 PRO O    1 1 
        4  5028 1 1  12 PRO C    C   2.002  -1.298  -1.589 1.00 . A A .  12 PRO C    1 1 
        4  5029 1 1  12 PRO CA   C   0.757  -0.978  -0.758 1.00 . A A .  12 PRO CA   1 1 
        4  5030 1 1  12 PRO CB   C   1.012  -1.038   0.739 1.00 . A A .  12 PRO CB   1 1 
        4  5031 1 1  12 PRO CD   C  -0.457  -2.900   0.097 1.00 . A A .  12 PRO CD   1 1 
        4  5032 1 1  12 PRO CG   C   0.428  -2.360   1.209 1.00 . A A .  12 PRO CG   1 1 
        4  5033 1 1  12 PRO HA   H   0.462  -0.068  -1.048 1.00 . A A .  12 PRO HA   1 1 
        4  5034 1 1  12 PRO HB2  H   2.079  -0.982   0.956 1.00 . A A .  12 PRO HB2  1 1 
        4  5035 1 1  12 PRO HB3  H   0.539  -0.199   1.249 1.00 . A A .  12 PRO HB3  1 1 
        4  5036 1 1  12 PRO HD2  H  -0.152  -3.904  -0.199 1.00 . A A .  12 PRO HD2  1 1 
        4  5037 1 1  12 PRO HD3  H  -1.497  -2.964   0.415 1.00 . A A .  12 PRO HD3  1 1 
        4  5038 1 1  12 PRO HG2  H   1.224  -3.068   1.441 1.00 . A A .  12 PRO HG2  1 1 
        4  5039 1 1  12 PRO HG3  H  -0.149  -2.220   2.122 1.00 . A A .  12 PRO HG3  1 1 
        4  5040 1 1  12 PRO N    N  -0.295  -1.951  -1.000 1.00 . A A .  12 PRO N    1 1 
        4  5041 1 1  12 PRO O    O   1.952  -2.133  -2.491 1.00 . A A .  12 PRO O    1 1 
        4  5042 1 1  13 MET C    C   5.531  -0.385  -1.099 1.00 . A A .  13 MET C    1 1 
        4  5043 1 1  13 MET CA   C   4.343  -0.818  -1.960 1.00 . A A .  13 MET CA   1 1 
        4  5044 1 1  13 MET CB   C   4.334  -0.012  -3.261 1.00 . A A .  13 MET CB   1 1 
        4  5045 1 1  13 MET CE   C   4.460   1.282  -5.969 1.00 . A A .  13 MET CE   1 1 
        4  5046 1 1  13 MET CG   C   3.635  -0.787  -4.381 1.00 . A A .  13 MET CG   1 1 
        4  5047 1 1  13 MET H    H   3.120   0.060  -0.521 1.00 . A A .  13 MET H    1 1 
        4  5048 1 1  13 MET HA   H   4.399  -1.889  -2.157 1.00 . A A .  13 MET HA   1 1 
        4  5049 1 1  13 MET HB2  H   3.826   0.938  -3.100 1.00 . A A .  13 MET HB2  1 1 
        4  5050 1 1  13 MET HB3  H   5.357   0.219  -3.557 1.00 . A A .  13 MET HB3  1 1 
        4  5051 1 1  13 MET HE1  H   3.689   1.626  -6.658 1.00 . A A .  13 MET HE1  1 1 
        4  5052 1 1  13 MET HE2  H   4.252   1.664  -4.970 1.00 . A A .  13 MET HE2  1 1 
        4  5053 1 1  13 MET HE3  H   5.432   1.644  -6.301 1.00 . A A .  13 MET HE3  1 1 
        4  5054 1 1  13 MET HG2  H   3.631  -1.852  -4.150 1.00 . A A .  13 MET HG2  1 1 
        4  5055 1 1  13 MET HG3  H   2.594  -0.473  -4.457 1.00 . A A .  13 MET HG3  1 1 
        4  5056 1 1  13 MET N    N   3.088  -0.617  -1.256 1.00 . A A .  13 MET N    1 1 
        4  5057 1 1  13 MET O    O   5.370   0.395  -0.161 1.00 . A A .  13 MET O    1 1 
        4  5058 1 1  13 MET SD   S   4.472  -0.503  -5.932 1.00 . A A .  13 MET SD   1 1 
        4  5059 1 1  14 ASN C    C   7.816  -1.154   0.698 1.00 . A A .  14 ASN C    1 1 
        4  5060 1 1  14 ASN CA   C   7.911  -0.585  -0.719 1.00 . A A .  14 ASN CA   1 1 
        4  5061 1 1  14 ASN CB   C   8.101   0.929  -0.609 1.00 . A A .  14 ASN CB   1 1 
        4  5062 1 1  14 ASN CG   C   9.206   1.413  -1.550 1.00 . A A .  14 ASN CG   1 1 
        4  5063 1 1  14 ASN H    H   6.819  -1.542  -2.213 1.00 . A A .  14 ASN H    1 1 
        4  5064 1 1  14 ASN HA   H   8.719  -1.034  -1.295 1.00 . A A .  14 ASN HA   1 1 
        4  5065 1 1  14 ASN HB2  H   7.166   1.435  -0.850 1.00 . A A .  14 ASN HB2  1 1 
        4  5066 1 1  14 ASN HB3  H   8.351   1.194   0.418 1.00 . A A .  14 ASN HB3  1 1 
        4  5067 1 1  14 ASN HD21 H   8.016   2.966  -2.073 1.00 . A A .  14 ASN HD21 1 1 
        4  5068 1 1  14 ASN HD22 H   9.561   2.920  -2.854 1.00 . A A .  14 ASN HD22 1 1 
        4  5069 1 1  14 ASN N    N   6.697  -0.908  -1.448 1.00 . A A .  14 ASN N    1 1 
        4  5070 1 1  14 ASN ND2  N   8.903   2.525  -2.214 1.00 . A A .  14 ASN ND2  1 1 
        4  5071 1 1  14 ASN O    O   8.474  -2.142   1.020 1.00 . A A .  14 ASN O    1 1 
        4  5072 1 1  14 ASN OD1  O  10.264   0.816  -1.666 1.00 . A A .  14 ASN OD1  1 1 
        4  5073 1 1  15 GLY C    C   6.250   0.206   3.742 1.00 . A A .  15 GLY C    1 1 
        4  5074 1 1  15 GLY CA   C   6.803  -0.934   2.883 1.00 . A A .  15 GLY CA   1 1 
        4  5075 1 1  15 GLY H    H   6.460   0.298   1.239 1.00 . A A .  15 GLY H    1 1 
        4  5076 1 1  15 GLY HA2  H   6.118  -1.781   2.913 1.00 . A A .  15 GLY HA2  1 1 
        4  5077 1 1  15 GLY HA3  H   7.752  -1.276   3.295 1.00 . A A .  15 GLY HA3  1 1 
        4  5078 1 1  15 GLY N    N   6.992  -0.505   1.508 1.00 . A A .  15 GLY N    1 1 
        4  5079 1 1  15 GLY O    O   5.514  -0.033   4.698 1.00 . A A .  15 GLY O    1 1 
        4  5080 1 1  16 TYR C    C   4.662   2.770   3.973 1.00 . A A .  16 TYR C    1 1 
        4  5081 1 1  16 TYR CA   C   6.177   2.598   4.093 1.00 . A A .  16 TYR CA   1 1 
        4  5082 1 1  16 TYR CB   C   6.868   3.790   3.429 1.00 . A A .  16 TYR CB   1 1 
        4  5083 1 1  16 TYR CD1  C   6.004   5.409   5.158 1.00 . A A .  16 TYR CD1  1 1 
        4  5084 1 1  16 TYR CD2  C   6.058   6.112   2.874 1.00 . A A .  16 TYR CD2  1 1 
        4  5085 1 1  16 TYR CE1  C   5.461   6.688   5.538 1.00 . A A .  16 TYR CE1  1 1 
        4  5086 1 1  16 TYR CE2  C   5.515   7.391   3.254 1.00 . A A .  16 TYR CE2  1 1 
        4  5087 1 1  16 TYR CG   C   6.291   5.148   3.833 1.00 . A A .  16 TYR CG   1 1 
        4  5088 1 1  16 TYR CZ   C   5.243   7.615   4.567 1.00 . A A .  16 TYR CZ   1 1 
        4  5089 1 1  16 TYR H    H   7.225   1.606   2.591 1.00 . A A .  16 TYR H    1 1 
        4  5090 1 1  16 TYR HA   H   6.439   2.467   5.143 1.00 . A A .  16 TYR HA   1 1 
        4  5091 1 1  16 TYR HB2  H   7.929   3.768   3.680 1.00 . A A .  16 TYR HB2  1 1 
        4  5092 1 1  16 TYR HB3  H   6.795   3.683   2.347 1.00 . A A .  16 TYR HB3  1 1 
        4  5093 1 1  16 TYR HD1  H   6.188   4.648   5.916 1.00 . A A .  16 TYR HD1  1 1 
        4  5094 1 1  16 TYR HD2  H   6.286   5.906   1.828 1.00 . A A .  16 TYR HD2  1 1 
        4  5095 1 1  16 TYR HE1  H   5.229   6.907   6.580 1.00 . A A .  16 TYR HE1  1 1 
        4  5096 1 1  16 TYR HE2  H   5.327   8.161   2.506 1.00 . A A .  16 TYR HE2  1 1 
        4  5097 1 1  16 TYR HH   H   4.856   9.481   4.185 1.00 . A A .  16 TYR HH   1 1 
        4  5098 1 1  16 TYR N    N   6.626   1.421   3.369 1.00 . A A .  16 TYR N    1 1 
        4  5099 1 1  16 TYR O    O   3.982   3.029   4.966 1.00 . A A .  16 TYR O    1 1 
        4  5100 1 1  16 TYR OH   O   4.730   8.822   4.927 1.00 . A A .  16 TYR OH   1 1 
        4  5101 1 1  17 GLN C    C   1.968   1.688   3.252 1.00 . A A .  17 GLN C    1 1 
        4  5102 1 1  17 GLN CA   C   2.754   2.756   2.487 1.00 . A A .  17 GLN CA   1 1 
        4  5103 1 1  17 GLN CB   C   2.463   2.681   0.987 1.00 . A A .  17 GLN CB   1 1 
        4  5104 1 1  17 GLN CD   C   2.651   3.879  -1.224 1.00 . A A .  17 GLN CD   1 1 
        4  5105 1 1  17 GLN CG   C   3.040   3.895   0.256 1.00 . A A .  17 GLN CG   1 1 
        4  5106 1 1  17 GLN H    H   4.736   2.409   1.948 1.00 . A A .  17 GLN H    1 1 
        4  5107 1 1  17 GLN HA   H   2.485   3.747   2.854 1.00 . A A .  17 GLN HA   1 1 
        4  5108 1 1  17 GLN HB2  H   2.891   1.767   0.575 1.00 . A A .  17 GLN HB2  1 1 
        4  5109 1 1  17 GLN HB3  H   1.387   2.631   0.823 1.00 . A A .  17 GLN HB3  1 1 
        4  5110 1 1  17 GLN HE21 H   3.268   1.953  -1.317 1.00 . A A .  17 GLN HE21 1 1 
        4  5111 1 1  17 GLN HE22 H   2.656   2.607  -2.799 1.00 . A A .  17 GLN HE22 1 1 
        4  5112 1 1  17 GLN HG2  H   2.675   4.811   0.721 1.00 . A A .  17 GLN HG2  1 1 
        4  5113 1 1  17 GLN HG3  H   4.125   3.899   0.350 1.00 . A A .  17 GLN HG3  1 1 
        4  5114 1 1  17 GLN N    N   4.176   2.620   2.750 1.00 . A A .  17 GLN N    1 1 
        4  5115 1 1  17 GLN NE2  N   2.877   2.717  -1.830 1.00 . A A .  17 GLN NE2  1 1 
        4  5116 1 1  17 GLN O    O   0.794   1.880   3.563 1.00 . A A .  17 GLN O    1 1 
        4  5117 1 1  17 GLN OE1  O   2.178   4.857  -1.779 1.00 . A A .  17 GLN OE1  1 1 
        4  5118 1 1  18 LYS C    C   1.747  -0.076   5.693 1.00 . A A .  18 LYS C    1 1 
        4  5119 1 1  18 LYS CA   C   2.029  -0.512   4.254 1.00 . A A .  18 LYS CA   1 1 
        4  5120 1 1  18 LYS CB   C   2.889  -1.773   4.152 1.00 . A A .  18 LYS CB   1 1 
        4  5121 1 1  18 LYS CD   C   1.630  -3.956   4.056 1.00 . A A .  18 LYS CD   1 1 
        4  5122 1 1  18 LYS CE   C   0.878  -5.008   4.874 1.00 . A A .  18 LYS CE   1 1 
        4  5123 1 1  18 LYS CG   C   2.285  -2.917   4.968 1.00 . A A .  18 LYS CG   1 1 
        4  5124 1 1  18 LYS H    H   3.603   0.438   3.275 1.00 . A A .  18 LYS H    1 1 
        4  5125 1 1  18 LYS HA   H   1.079  -0.729   3.766 1.00 . A A .  18 LYS HA   1 1 
        4  5126 1 1  18 LYS HB2  H   2.977  -2.074   3.108 1.00 . A A .  18 LYS HB2  1 1 
        4  5127 1 1  18 LYS HB3  H   3.897  -1.560   4.508 1.00 . A A .  18 LYS HB3  1 1 
        4  5128 1 1  18 LYS HD2  H   0.941  -3.462   3.371 1.00 . A A .  18 LYS HD2  1 1 
        4  5129 1 1  18 LYS HD3  H   2.393  -4.442   3.446 1.00 . A A .  18 LYS HD3  1 1 
        4  5130 1 1  18 LYS HE2  H   1.185  -6.007   4.563 1.00 . A A .  18 LYS HE2  1 1 
        4  5131 1 1  18 LYS HE3  H   1.135  -4.909   5.928 1.00 . A A .  18 LYS HE3  1 1 
        4  5132 1 1  18 LYS HG2  H   3.062  -3.392   5.567 1.00 . A A .  18 LYS HG2  1 1 
        4  5133 1 1  18 LYS HG3  H   1.544  -2.521   5.663 1.00 . A A .  18 LYS HG3  1 1 
        4  5134 1 1  18 LYS HZ1  H  -0.848  -5.195   3.795 1.00 . A A .  18 LYS HZ1  1 1 
        4  5135 1 1  18 LYS HZ2  H  -1.061  -5.375   5.404 1.00 . A A .  18 LYS HZ2  1 1 
        4  5136 1 1  18 LYS HZ3  H  -0.828  -3.887   4.773 1.00 . A A .  18 LYS HZ3  1 1 
        4  5137 1 1  18 LYS N    N   2.648   0.586   3.532 1.00 . A A .  18 LYS N    1 1 
        4  5138 1 1  18 LYS NZ   N  -0.583  -4.854   4.697 1.00 . A A .  18 LYS NZ   1 1 
        4  5139 1 1  18 LYS O    O   0.595  -0.055   6.125 1.00 . A A .  18 LYS O    1 1 
        4  5140 1 1  19 PHE C    C   1.711   1.857   7.905 1.00 . A A .  19 PHE C    1 1 
        4  5141 1 1  19 PHE CA   C   2.700   0.697   7.778 1.00 . A A .  19 PHE CA   1 1 
        4  5142 1 1  19 PHE CB   C   4.086   1.173   8.217 1.00 . A A .  19 PHE CB   1 1 
        4  5143 1 1  19 PHE CD1  C   3.730   1.720  10.635 1.00 . A A .  19 PHE CD1  1 1 
        4  5144 1 1  19 PHE CD2  C   4.377   3.463   9.188 1.00 . A A .  19 PHE CD2  1 1 
        4  5145 1 1  19 PHE CE1  C   3.709   2.631  11.724 1.00 . A A .  19 PHE CE1  1 1 
        4  5146 1 1  19 PHE CE2  C   4.357   4.374  10.277 1.00 . A A .  19 PHE CE2  1 1 
        4  5147 1 1  19 PHE CG   C   4.063   2.155   9.390 1.00 . A A .  19 PHE CG   1 1 
        4  5148 1 1  19 PHE CZ   C   4.023   3.939  11.522 1.00 . A A .  19 PHE CZ   1 1 
        4  5149 1 1  19 PHE H    H   3.751   0.242   6.038 1.00 . A A .  19 PHE H    1 1 
        4  5150 1 1  19 PHE HA   H   2.335  -0.154   8.354 1.00 . A A .  19 PHE HA   1 1 
        4  5151 1 1  19 PHE HB2  H   4.686   0.306   8.494 1.00 . A A .  19 PHE HB2  1 1 
        4  5152 1 1  19 PHE HB3  H   4.581   1.646   7.370 1.00 . A A .  19 PHE HB3  1 1 
        4  5153 1 1  19 PHE HD1  H   3.478   0.672  10.797 1.00 . A A .  19 PHE HD1  1 1 
        4  5154 1 1  19 PHE HD2  H   4.645   3.811   8.191 1.00 . A A .  19 PHE HD2  1 1 
        4  5155 1 1  19 PHE HE1  H   3.442   2.283  12.721 1.00 . A A .  19 PHE HE1  1 1 
        4  5156 1 1  19 PHE HE2  H   4.609   5.422  10.115 1.00 . A A .  19 PHE HE2  1 1 
        4  5157 1 1  19 PHE HZ   H   4.007   4.638  12.358 1.00 . A A .  19 PHE HZ   1 1 
        4  5158 1 1  19 PHE N    N   2.818   0.262   6.396 1.00 . A A .  19 PHE N    1 1 
        4  5159 1 1  19 PHE O    O   0.875   1.870   8.808 1.00 . A A .  19 PHE O    1 1 
        4  5160 1 1  20 SER C    C  -0.497   3.523   7.060 1.00 . A A .  20 SER C    1 1 
        4  5161 1 1  20 SER CA   C   0.966   3.966   6.985 1.00 . A A .  20 SER CA   1 1 
        4  5162 1 1  20 SER CB   C   1.197   4.826   5.741 1.00 . A A .  20 SER CB   1 1 
        4  5163 1 1  20 SER H    H   2.520   2.787   6.256 1.00 . A A .  20 SER H    1 1 
        4  5164 1 1  20 SER HA   H   1.240   4.534   7.874 1.00 . A A .  20 SER HA   1 1 
        4  5165 1 1  20 SER HB2  H   0.982   4.238   4.849 1.00 . A A .  20 SER HB2  1 1 
        4  5166 1 1  20 SER HB3  H   0.501   5.665   5.745 1.00 . A A .  20 SER HB3  1 1 
        4  5167 1 1  20 SER HG   H   3.178   4.591   5.902 1.00 . A A .  20 SER HG   1 1 
        4  5168 1 1  20 SER N    N   1.838   2.804   6.987 1.00 . A A .  20 SER N    1 1 
        4  5169 1 1  20 SER O    O  -1.218   3.907   7.980 1.00 . A A .  20 SER O    1 1 
        4  5170 1 1  20 SER OG   O   2.532   5.319   5.673 1.00 . A A .  20 SER OG   1 1 
        4  5171 1 1  21 GLN C    C  -2.713   1.776   7.414 1.00 . A A .  21 GLN C    1 1 
        4  5172 1 1  21 GLN CA   C  -2.253   2.223   6.025 1.00 . A A .  21 GLN CA   1 1 
        4  5173 1 1  21 GLN CB   C  -2.378   1.083   5.012 1.00 . A A .  21 GLN CB   1 1 
        4  5174 1 1  21 GLN CD   C  -4.374   2.225   3.979 1.00 . A A .  21 GLN CD   1 1 
        4  5175 1 1  21 GLN CG   C  -3.017   1.572   3.711 1.00 . A A .  21 GLN CG   1 1 
        4  5176 1 1  21 GLN H    H  -0.296   2.415   5.337 1.00 . A A .  21 GLN H    1 1 
        4  5177 1 1  21 GLN HA   H  -2.857   3.066   5.689 1.00 . A A .  21 GLN HA   1 1 
        4  5178 1 1  21 GLN HB2  H  -1.392   0.667   4.804 1.00 . A A .  21 GLN HB2  1 1 
        4  5179 1 1  21 GLN HB3  H  -2.979   0.279   5.437 1.00 . A A .  21 GLN HB3  1 1 
        4  5180 1 1  21 GLN HE21 H  -4.157   3.271   2.259 1.00 . A A .  21 GLN HE21 1 1 
        4  5181 1 1  21 GLN HE22 H  -5.622   3.576   3.131 1.00 . A A .  21 GLN HE22 1 1 
        4  5182 1 1  21 GLN HG2  H  -2.355   2.287   3.223 1.00 . A A .  21 GLN HG2  1 1 
        4  5183 1 1  21 GLN HG3  H  -3.142   0.734   3.025 1.00 . A A .  21 GLN HG3  1 1 
        4  5184 1 1  21 GLN N    N  -0.890   2.722   6.081 1.00 . A A .  21 GLN N    1 1 
        4  5185 1 1  21 GLN NE2  N  -4.749   3.096   3.046 1.00 . A A .  21 GLN NE2  1 1 
        4  5186 1 1  21 GLN O    O  -3.879   1.941   7.769 1.00 . A A .  21 GLN O    1 1 
        4  5187 1 1  21 GLN OE1  O  -5.038   1.956   4.966 1.00 . A A .  21 GLN OE1  1 1 
        4  5188 1 1  22 GLU C    C  -2.524   1.910  10.388 1.00 . A A .  22 GLU C    1 1 
        4  5189 1 1  22 GLU CA   C  -2.066   0.748   9.505 1.00 . A A .  22 GLU CA   1 1 
        4  5190 1 1  22 GLU CB   C  -0.854   0.041  10.115 1.00 . A A .  22 GLU CB   1 1 
        4  5191 1 1  22 GLU CD   C  -0.537  -2.443  10.418 1.00 . A A .  22 GLU CD   1 1 
        4  5192 1 1  22 GLU CG   C  -1.282  -1.198  10.905 1.00 . A A .  22 GLU CG   1 1 
        4  5193 1 1  22 GLU H    H  -0.826   1.089   7.866 1.00 . A A .  22 GLU H    1 1 
        4  5194 1 1  22 GLU HA   H  -2.877   0.029   9.388 1.00 . A A .  22 GLU HA   1 1 
        4  5195 1 1  22 GLU HB2  H  -0.161  -0.249   9.325 1.00 . A A .  22 GLU HB2  1 1 
        4  5196 1 1  22 GLU HB3  H  -0.319   0.728  10.771 1.00 . A A .  22 GLU HB3  1 1 
        4  5197 1 1  22 GLU HG2  H  -1.084  -1.043  11.966 1.00 . A A .  22 GLU HG2  1 1 
        4  5198 1 1  22 GLU HG3  H  -2.356  -1.348  10.800 1.00 . A A .  22 GLU HG3  1 1 
        4  5199 1 1  22 GLU N    N  -1.772   1.219   8.163 1.00 . A A .  22 GLU N    1 1 
        4  5200 1 1  22 GLU O    O  -3.488   1.779  11.141 1.00 . A A .  22 GLU O    1 1 
        4  5201 1 1  22 GLU OE1  O  -1.025  -3.050   9.441 1.00 . A A .  22 GLU OE1  1 1 
        4  5202 1 1  22 GLU OE2  O   0.503  -2.759  11.035 1.00 . A A .  22 GLU OE2  1 1 
        4  5203 1 1  23 LEU C    C  -3.462   4.786  10.553 1.00 . A A .  23 LEU C    1 1 
        4  5204 1 1  23 LEU CA   C  -2.134   4.205  11.043 1.00 . A A .  23 LEU CA   1 1 
        4  5205 1 1  23 LEU CB   C  -0.975   5.203  11.004 1.00 . A A .  23 LEU CB   1 1 
        4  5206 1 1  23 LEU CD1  C   1.538   5.160  10.802 1.00 . A A .  23 LEU CD1  1 1 
        4  5207 1 1  23 LEU CD2  C   0.443   5.229  13.089 1.00 . A A .  23 LEU CD2  1 1 
        4  5208 1 1  23 LEU CG   C   0.334   4.736  11.644 1.00 . A A .  23 LEU CG   1 1 
        4  5209 1 1  23 LEU H    H  -1.030   3.119   9.650 1.00 . A A .  23 LEU H    1 1 
        4  5210 1 1  23 LEU HA   H  -2.255   3.893  12.080 1.00 . A A .  23 LEU HA   1 1 
        4  5211 1 1  23 LEU HB2  H  -0.776   5.458   9.963 1.00 . A A .  23 LEU HB2  1 1 
        4  5212 1 1  23 LEU HB3  H  -1.293   6.119  11.501 1.00 . A A .  23 LEU HB3  1 1 
        4  5213 1 1  23 LEU HD11 H   2.268   5.661  11.437 1.00 . A A .  23 LEU HD11 1 1 
        4  5214 1 1  23 LEU HD12 H   1.994   4.278  10.351 1.00 . A A .  23 LEU HD12 1 1 
        4  5215 1 1  23 LEU HD13 H   1.211   5.841  10.016 1.00 . A A .  23 LEU HD13 1 1 
        4  5216 1 1  23 LEU HD21 H  -0.461   4.959  13.634 1.00 . A A .  23 LEU HD21 1 1 
        4  5217 1 1  23 LEU HD22 H   1.307   4.766  13.566 1.00 . A A .  23 LEU HD22 1 1 
        4  5218 1 1  23 LEU HD23 H   0.562   6.312  13.095 1.00 . A A .  23 LEU HD23 1 1 
        4  5219 1 1  23 LEU HG   H   0.329   3.647  11.675 1.00 . A A .  23 LEU HG   1 1 
        4  5220 1 1  23 LEU N    N  -1.812   3.021  10.265 1.00 . A A .  23 LEU N    1 1 
        4  5221 1 1  23 LEU O    O  -4.199   5.398  11.325 1.00 . A A .  23 LEU O    1 1 
        4  5222 1 1  24 LEU C    C  -6.125   4.188   9.110 1.00 . A A .  24 LEU C    1 1 
        4  5223 1 1  24 LEU CA   C  -4.954   5.069   8.671 1.00 . A A .  24 LEU CA   1 1 
        4  5224 1 1  24 LEU CB   C  -4.801   5.176   7.152 1.00 . A A .  24 LEU CB   1 1 
        4  5225 1 1  24 LEU CD1  C  -4.081   6.556   5.168 1.00 . A A .  24 LEU CD1  1 1 
        4  5226 1 1  24 LEU CD2  C  -3.939   7.519   7.510 1.00 . A A .  24 LEU CD2  1 1 
        4  5227 1 1  24 LEU CG   C  -3.843   6.258   6.649 1.00 . A A .  24 LEU CG   1 1 
        4  5228 1 1  24 LEU H    H  -3.123   4.076   8.651 1.00 . A A .  24 LEU H    1 1 
        4  5229 1 1  24 LEU HA   H  -5.120   6.078   9.050 1.00 . A A .  24 LEU HA   1 1 
        4  5230 1 1  24 LEU HB2  H  -4.461   4.213   6.772 1.00 . A A .  24 LEU HB2  1 1 
        4  5231 1 1  24 LEU HB3  H  -5.784   5.360   6.720 1.00 . A A .  24 LEU HB3  1 1 
        4  5232 1 1  24 LEU HD11 H  -4.730   7.427   5.072 1.00 . A A .  24 LEU HD11 1 1 
        4  5233 1 1  24 LEU HD12 H  -3.127   6.758   4.680 1.00 . A A .  24 LEU HD12 1 1 
        4  5234 1 1  24 LEU HD13 H  -4.555   5.696   4.696 1.00 . A A .  24 LEU HD13 1 1 
        4  5235 1 1  24 LEU HD21 H  -3.345   8.314   7.059 1.00 . A A .  24 LEU HD21 1 1 
        4  5236 1 1  24 LEU HD22 H  -4.980   7.836   7.575 1.00 . A A .  24 LEU HD22 1 1 
        4  5237 1 1  24 LEU HD23 H  -3.561   7.307   8.510 1.00 . A A .  24 LEU HD23 1 1 
        4  5238 1 1  24 LEU HG   H  -2.824   5.882   6.742 1.00 . A A .  24 LEU HG   1 1 
        4  5239 1 1  24 LEU N    N  -3.728   4.575   9.272 1.00 . A A .  24 LEU N    1 1 
        4  5240 1 1  24 LEU O    O  -7.263   4.649   9.176 1.00 . A A .  24 LEU O    1 1 
        4  5241 1 1  25 SER C    C  -6.852   1.915  11.357 1.00 . A A .  25 SER C    1 1 
        4  5242 1 1  25 SER CA   C  -6.815   1.984   9.829 1.00 . A A .  25 SER CA   1 1 
        4  5243 1 1  25 SER CB   C  -6.552   0.596   9.241 1.00 . A A .  25 SER CB   1 1 
        4  5244 1 1  25 SER H    H  -4.876   2.568   9.341 1.00 . A A .  25 SER H    1 1 
        4  5245 1 1  25 SER HA   H  -7.758   2.369   9.441 1.00 . A A .  25 SER HA   1 1 
        4  5246 1 1  25 SER HB2  H  -5.703   0.646   8.560 1.00 . A A .  25 SER HB2  1 1 
        4  5247 1 1  25 SER HB3  H  -6.278  -0.091  10.042 1.00 . A A .  25 SER HB3  1 1 
        4  5248 1 1  25 SER HG   H  -8.039  -0.724   9.017 1.00 . A A .  25 SER HG   1 1 
        4  5249 1 1  25 SER N    N  -5.805   2.935   9.398 1.00 . A A .  25 SER N    1 1 
        4  5250 1 1  25 SER O    O  -7.841   1.473  11.939 1.00 . A A .  25 SER O    1 1 
        4  5251 1 1  25 SER OG   O  -7.688   0.086   8.548 1.00 . A A .  25 SER OG   1 1 
        4  5252 1 1  26 ASN C    C  -6.447   3.535  13.982 1.00 . A A .  26 ASN C    1 1 
        4  5253 1 1  26 ASN CA   C  -5.656   2.355  13.413 1.00 . A A .  26 ASN CA   1 1 
        4  5254 1 1  26 ASN CB   C  -4.200   2.502  13.860 1.00 . A A .  26 ASN CB   1 1 
        4  5255 1 1  26 ASN CG   C  -3.430   1.196  13.658 1.00 . A A .  26 ASN CG   1 1 
        4  5256 1 1  26 ASN H    H  -4.961   2.719  11.483 1.00 . A A .  26 ASN H    1 1 
        4  5257 1 1  26 ASN HA   H  -6.060   1.392  13.726 1.00 . A A .  26 ASN HA   1 1 
        4  5258 1 1  26 ASN HB2  H  -3.721   3.302  13.295 1.00 . A A .  26 ASN HB2  1 1 
        4  5259 1 1  26 ASN HB3  H  -4.166   2.790  14.911 1.00 . A A .  26 ASN HB3  1 1 
        4  5260 1 1  26 ASN HD21 H  -1.825   2.286  13.079 1.00 . A A .  26 ASN HD21 1 1 
        4  5261 1 1  26 ASN HD22 H  -1.595   0.570  13.074 1.00 . A A .  26 ASN HD22 1 1 
        4  5262 1 1  26 ASN N    N  -5.761   2.360  11.964 1.00 . A A .  26 ASN N    1 1 
        4  5263 1 1  26 ASN ND2  N  -2.180   1.364  13.236 1.00 . A A .  26 ASN ND2  1 1 
        4  5264 1 1  26 ASN O    O  -7.385   3.343  14.754 1.00 . A A .  26 ASN O    1 1 
        4  5265 1 1  26 ASN OD1  O  -3.936   0.107  13.872 1.00 . A A .  26 ASN OD1  1 1 
        4  5266 1 1  27 GLY C    C  -5.883   6.623  15.137 1.00 . A A .  27 GLY C    1 1 
        4  5267 1 1  27 GLY CA   C  -6.698   5.939  14.037 1.00 . A A .  27 GLY CA   1 1 
        4  5268 1 1  27 GLY H    H  -5.275   4.876  12.949 1.00 . A A .  27 GLY H    1 1 
        4  5269 1 1  27 GLY HA2  H  -6.833   6.625  13.200 1.00 . A A .  27 GLY HA2  1 1 
        4  5270 1 1  27 GLY HA3  H  -7.692   5.697  14.414 1.00 . A A .  27 GLY HA3  1 1 
        4  5271 1 1  27 GLY N    N  -6.039   4.729  13.578 1.00 . A A .  27 GLY N    1 1 
        4  5272 1 1  27 GLY O    O  -6.434   7.352  15.961 1.00 . A A .  27 GLY O    1 1 
        4  5273 1 1  28 GLU C    C  -3.446   8.423  15.791 1.00 . A A .  28 GLU C    1 1 
        4  5274 1 1  28 GLU CA   C  -3.688   6.944  16.101 1.00 . A A .  28 GLU CA   1 1 
        4  5275 1 1  28 GLU CB   C  -2.368   6.174  16.163 1.00 . A A .  28 GLU CB   1 1 
        4  5276 1 1  28 GLU CD   C  -1.545   3.806  16.442 1.00 . A A .  28 GLU CD   1 1 
        4  5277 1 1  28 GLU CG   C  -2.566   4.714  15.751 1.00 . A A .  28 GLU CG   1 1 
        4  5278 1 1  28 GLU H    H  -4.144   5.769  14.442 1.00 . A A .  28 GLU H    1 1 
        4  5279 1 1  28 GLU HA   H  -4.205   6.846  17.056 1.00 . A A .  28 GLU HA   1 1 
        4  5280 1 1  28 GLU HB2  H  -1.636   6.645  15.507 1.00 . A A .  28 GLU HB2  1 1 
        4  5281 1 1  28 GLU HB3  H  -1.964   6.219  17.175 1.00 . A A .  28 GLU HB3  1 1 
        4  5282 1 1  28 GLU HG2  H  -3.575   4.393  16.008 1.00 . A A .  28 GLU HG2  1 1 
        4  5283 1 1  28 GLU HG3  H  -2.467   4.621  14.670 1.00 . A A .  28 GLU HG3  1 1 
        4  5284 1 1  28 GLU N    N  -4.584   6.363  15.116 1.00 . A A .  28 GLU N    1 1 
        4  5285 1 1  28 GLU O    O  -2.993   9.175  16.652 1.00 . A A .  28 GLU O    1 1 
        4  5286 1 1  28 GLU OE1  O  -0.340   3.996  16.168 1.00 . A A .  28 GLU OE1  1 1 
        4  5287 1 1  28 GLU OE2  O  -1.993   2.943  17.227 1.00 . A A .  28 GLU OE2  1 1 
        4  5288 1 1  29 LEU C    C  -4.913  10.715  13.608 1.00 . A A .  29 LEU C    1 1 
        4  5289 1 1  29 LEU CA   C  -3.580  10.170  14.124 1.00 . A A .  29 LEU CA   1 1 
        4  5290 1 1  29 LEU CB   C  -2.441  10.268  13.107 1.00 . A A .  29 LEU CB   1 1 
        4  5291 1 1  29 LEU CD1  C  -0.703   9.011  11.779 1.00 . A A .  29 LEU CD1  1 1 
        4  5292 1 1  29 LEU CD2  C  -0.450   9.271  14.290 1.00 . A A .  29 LEU CD2  1 1 
        4  5293 1 1  29 LEU CG   C  -1.428   9.122  13.123 1.00 . A A .  29 LEU CG   1 1 
        4  5294 1 1  29 LEU H    H  -4.126   8.177  13.864 1.00 . A A .  29 LEU H    1 1 
        4  5295 1 1  29 LEU HA   H  -3.283  10.753  14.996 1.00 . A A .  29 LEU HA   1 1 
        4  5296 1 1  29 LEU HB2  H  -2.876  10.328  12.109 1.00 . A A .  29 LEU HB2  1 1 
        4  5297 1 1  29 LEU HB3  H  -1.906  11.202  13.278 1.00 . A A .  29 LEU HB3  1 1 
        4  5298 1 1  29 LEU HD11 H   0.174   9.659  11.785 1.00 . A A .  29 LEU HD11 1 1 
        4  5299 1 1  29 LEU HD12 H  -0.392   7.979  11.618 1.00 . A A .  29 LEU HD12 1 1 
        4  5300 1 1  29 LEU HD13 H  -1.376   9.318  10.978 1.00 . A A .  29 LEU HD13 1 1 
        4  5301 1 1  29 LEU HD21 H  -0.756  10.109  14.916 1.00 . A A .  29 LEU HD21 1 1 
        4  5302 1 1  29 LEU HD22 H  -0.450   8.356  14.883 1.00 . A A .  29 LEU HD22 1 1 
        4  5303 1 1  29 LEU HD23 H   0.553   9.453  13.904 1.00 . A A .  29 LEU HD23 1 1 
        4  5304 1 1  29 LEU HG   H  -1.970   8.188  13.274 1.00 . A A .  29 LEU HG   1 1 
        4  5305 1 1  29 LEU N    N  -3.758   8.795  14.558 1.00 . A A .  29 LEU N    1 1 
        4  5306 1 1  29 LEU O    O  -4.951  11.432  12.609 1.00 . A A .  29 LEU O    1 1 
        4  5307 1 1  30 ASN C    C  -7.608  12.131  14.625 1.00 . A A .  30 ASN C    1 1 
        4  5308 1 1  30 ASN CA   C  -7.308  10.797  13.939 1.00 . A A .  30 ASN CA   1 1 
        4  5309 1 1  30 ASN CB   C  -8.369   9.788  14.383 1.00 . A A .  30 ASN CB   1 1 
        4  5310 1 1  30 ASN CG   C  -8.579   8.709  13.319 1.00 . A A .  30 ASN CG   1 1 
        4  5311 1 1  30 ASN H    H  -5.937   9.770  15.124 1.00 . A A .  30 ASN H    1 1 
        4  5312 1 1  30 ASN HA   H  -7.287  10.882  12.853 1.00 . A A .  30 ASN HA   1 1 
        4  5313 1 1  30 ASN HB2  H  -8.065   9.324  15.321 1.00 . A A .  30 ASN HB2  1 1 
        4  5314 1 1  30 ASN HB3  H  -9.310  10.305  14.573 1.00 . A A .  30 ASN HB3  1 1 
        4  5315 1 1  30 ASN HD21 H  -9.829   7.759  14.596 1.00 . A A .  30 ASN HD21 1 1 
        4  5316 1 1  30 ASN HD22 H  -9.609   6.985  13.062 1.00 . A A .  30 ASN HD22 1 1 
        4  5317 1 1  30 ASN N    N  -5.976  10.354  14.313 1.00 . A A .  30 ASN N    1 1 
        4  5318 1 1  30 ASN ND2  N  -9.408   7.738  13.690 1.00 . A A .  30 ASN ND2  1 1 
        4  5319 1 1  30 ASN O    O  -8.740  12.611  14.589 1.00 . A A .  30 ASN O    1 1 
        4  5320 1 1  30 ASN OD1  O  -8.026   8.756  12.233 1.00 . A A .  30 ASN OD1  1 1 
        4  5321 1 1  31 HIS C    C  -6.478  15.112  14.944 1.00 . A A .  31 HIS C    1 1 
        4  5322 1 1  31 HIS CA   C  -6.712  13.963  15.926 1.00 . A A .  31 HIS CA   1 1 
        4  5323 1 1  31 HIS CB   C  -5.785  14.023  17.141 1.00 . A A .  31 HIS CB   1 1 
        4  5324 1 1  31 HIS CD2  C  -3.331  14.769  16.637 1.00 . A A .  31 HIS CD2  1 1 
        4  5325 1 1  31 HIS CE1  C  -2.458  12.785  16.333 1.00 . A A .  31 HIS CE1  1 1 
        4  5326 1 1  31 HIS CG   C  -4.322  13.848  16.807 1.00 . A A .  31 HIS CG   1 1 
        4  5327 1 1  31 HIS H    H  -5.656  12.297  15.257 1.00 . A A .  31 HIS H    1 1 
        4  5328 1 1  31 HIS HA   H  -7.739  14.011  16.289 1.00 . A A .  31 HIS HA   1 1 
        4  5329 1 1  31 HIS HB2  H  -5.920  14.982  17.642 1.00 . A A .  31 HIS HB2  1 1 
        4  5330 1 1  31 HIS HB3  H  -6.080  13.249  17.849 1.00 . A A .  31 HIS HB3  1 1 
        4  5331 1 1  31 HIS HD1  H  -4.212  11.726  16.664 1.00 . A A .  31 HIS HD1  1 1 
        4  5332 1 1  31 HIS HD2  H  -3.444  15.850  16.721 1.00 . A A .  31 HIS HD2  1 1 
        4  5333 1 1  31 HIS HE1  H  -1.732  11.999  16.128 1.00 . A A .  31 HIS HE1  1 1 
        4  5334 1 1  31 HIS N    N  -6.574  12.693  15.233 1.00 . A A .  31 HIS N    1 1 
        4  5335 1 1  31 HIS ND1  N  -3.742  12.607  16.609 1.00 . A A .  31 HIS ND1  1 1 
        4  5336 1 1  31 HIS NE2  N  -2.205  14.126  16.352 1.00 . A A .  31 HIS NE2  1 1 
        4  5337 1 1  31 HIS O    O  -6.907  16.239  15.187 1.00 . A A .  31 HIS O    1 1 
        4  5338 1 1  32 LEU C    C  -6.055  15.302  11.490 1.00 . A A .  32 LEU C    1 1 
        4  5339 1 1  32 LEU CA   C  -5.500  15.778  12.834 1.00 . A A .  32 LEU CA   1 1 
        4  5340 1 1  32 LEU CB   C  -4.002  16.086  12.806 1.00 . A A .  32 LEU CB   1 1 
        4  5341 1 1  32 LEU CD1  C  -2.994  13.830  12.305 1.00 . A A .  32 LEU CD1  1 1 
        4  5342 1 1  32 LEU CD2  C  -1.698  15.531  13.669 1.00 . A A .  32 LEU CD2  1 1 
        4  5343 1 1  32 LEU CG   C  -3.079  14.976  13.314 1.00 . A A .  32 LEU CG   1 1 
        4  5344 1 1  32 LEU H    H  -5.451  13.868  13.664 1.00 . A A .  32 LEU H    1 1 
        4  5345 1 1  32 LEU HA   H  -6.013  16.699  13.113 1.00 . A A .  32 LEU HA   1 1 
        4  5346 1 1  32 LEU HB2  H  -3.719  16.326  11.781 1.00 . A A .  32 LEU HB2  1 1 
        4  5347 1 1  32 LEU HB3  H  -3.824  16.981  13.403 1.00 . A A .  32 LEU HB3  1 1 
        4  5348 1 1  32 LEU HD11 H  -2.266  13.095  12.650 1.00 . A A .  32 LEU HD11 1 1 
        4  5349 1 1  32 LEU HD12 H  -3.971  13.356  12.210 1.00 . A A .  32 LEU HD12 1 1 
        4  5350 1 1  32 LEU HD13 H  -2.684  14.221  11.336 1.00 . A A .  32 LEU HD13 1 1 
        4  5351 1 1  32 LEU HD21 H  -0.976  14.715  13.698 1.00 . A A .  32 LEU HD21 1 1 
        4  5352 1 1  32 LEU HD22 H  -1.394  16.259  12.917 1.00 . A A .  32 LEU HD22 1 1 
        4  5353 1 1  32 LEU HD23 H  -1.741  16.014  14.646 1.00 . A A .  32 LEU HD23 1 1 
        4  5354 1 1  32 LEU HG   H  -3.507  14.568  14.230 1.00 . A A .  32 LEU HG   1 1 
        4  5355 1 1  32 LEU N    N  -5.797  14.787  13.854 1.00 . A A .  32 LEU N    1 1 
        4  5356 1 1  32 LEU O    O  -6.405  14.133  11.338 1.00 . A A .  32 LEU O    1 1 
        4  5357 1 1  33 PRO C    C  -5.599  15.153   8.390 1.00 . A A .  33 PRO C    1 1 
        4  5358 1 1  33 PRO CA   C  -6.627  15.948   9.198 1.00 . A A .  33 PRO CA   1 1 
        4  5359 1 1  33 PRO CB   C  -6.955  17.296   8.578 1.00 . A A .  33 PRO CB   1 1 
        4  5360 1 1  33 PRO CD   C  -5.715  17.653  10.669 1.00 . A A .  33 PRO CD   1 1 
        4  5361 1 1  33 PRO CG   C  -6.191  18.327   9.392 1.00 . A A .  33 PRO CG   1 1 
        4  5362 1 1  33 PRO HA   H  -7.435  15.363   9.263 1.00 . A A .  33 PRO HA   1 1 
        4  5363 1 1  33 PRO HB2  H  -6.656  17.327   7.530 1.00 . A A .  33 PRO HB2  1 1 
        4  5364 1 1  33 PRO HB3  H  -8.027  17.489   8.609 1.00 . A A .  33 PRO HB3  1 1 
        4  5365 1 1  33 PRO HD2  H  -4.635  17.741  10.784 1.00 . A A .  33 PRO HD2  1 1 
        4  5366 1 1  33 PRO HD3  H  -6.168  18.107  11.550 1.00 . A A .  33 PRO HD3  1 1 
        4  5367 1 1  33 PRO HG2  H  -5.344  18.711   8.824 1.00 . A A .  33 PRO HG2  1 1 
        4  5368 1 1  33 PRO HG3  H  -6.831  19.178   9.626 1.00 . A A .  33 PRO HG3  1 1 
        4  5369 1 1  33 PRO N    N  -6.120  16.258  10.524 1.00 . A A .  33 PRO N    1 1 
        4  5370 1 1  33 PRO O    O  -4.410  15.165   8.708 1.00 . A A .  33 PRO O    1 1 
        4  5371 1 1  34 LEU C    C  -3.977  14.483   6.161 1.00 . A A .  34 LEU C    1 1 
        4  5372 1 1  34 LEU CA   C  -5.233  13.681   6.506 1.00 . A A .  34 LEU CA   1 1 
        4  5373 1 1  34 LEU CB   C  -6.004  13.189   5.280 1.00 . A A .  34 LEU CB   1 1 
        4  5374 1 1  34 LEU CD1  C  -5.591  10.755   4.765 1.00 . A A .  34 LEU CD1  1 1 
        4  5375 1 1  34 LEU CD2  C  -5.564  12.476   2.901 1.00 . A A .  34 LEU CD2  1 1 
        4  5376 1 1  34 LEU CG   C  -5.267  12.199   4.376 1.00 . A A .  34 LEU CG   1 1 
        4  5377 1 1  34 LEU H    H  -7.061  14.476   7.110 1.00 . A A .  34 LEU H    1 1 
        4  5378 1 1  34 LEU HA   H  -4.935  12.800   7.074 1.00 . A A .  34 LEU HA   1 1 
        4  5379 1 1  34 LEU HB2  H  -6.928  12.721   5.620 1.00 . A A .  34 LEU HB2  1 1 
        4  5380 1 1  34 LEU HB3  H  -6.288  14.055   4.682 1.00 . A A .  34 LEU HB3  1 1 
        4  5381 1 1  34 LEU HD11 H  -4.928  10.077   4.227 1.00 . A A .  34 LEU HD11 1 1 
        4  5382 1 1  34 LEU HD12 H  -5.450  10.627   5.838 1.00 . A A .  34 LEU HD12 1 1 
        4  5383 1 1  34 LEU HD13 H  -6.626  10.533   4.505 1.00 . A A .  34 LEU HD13 1 1 
        4  5384 1 1  34 LEU HD21 H  -6.363  13.213   2.824 1.00 . A A .  34 LEU HD21 1 1 
        4  5385 1 1  34 LEU HD22 H  -4.667  12.861   2.416 1.00 . A A .  34 LEU HD22 1 1 
        4  5386 1 1  34 LEU HD23 H  -5.873  11.552   2.413 1.00 . A A .  34 LEU HD23 1 1 
        4  5387 1 1  34 LEU HG   H  -4.195  12.338   4.520 1.00 . A A .  34 LEU HG   1 1 
        4  5388 1 1  34 LEU N    N  -6.094  14.480   7.362 1.00 . A A .  34 LEU N    1 1 
        4  5389 1 1  34 LEU O    O  -2.860  14.038   6.423 1.00 . A A .  34 LEU O    1 1 
        4  5390 1 1  35 LYS C    C  -2.028  16.488   6.285 1.00 . A A .  35 LYS C    1 1 
        4  5391 1 1  35 LYS CA   C  -3.101  16.521   5.196 1.00 . A A .  35 LYS CA   1 1 
        4  5392 1 1  35 LYS CB   C  -3.614  17.927   4.879 1.00 . A A .  35 LYS CB   1 1 
        4  5393 1 1  35 LYS CD   C  -2.162  18.738   2.984 1.00 . A A .  35 LYS CD   1 1 
        4  5394 1 1  35 LYS CE   C  -1.267  19.888   2.516 1.00 . A A .  35 LYS CE   1 1 
        4  5395 1 1  35 LYS CG   C  -2.464  18.853   4.480 1.00 . A A .  35 LYS CG   1 1 
        4  5396 1 1  35 LYS H    H  -5.113  16.007   5.370 1.00 . A A .  35 LYS H    1 1 
        4  5397 1 1  35 LYS HA   H  -2.673  16.120   4.277 1.00 . A A .  35 LYS HA   1 1 
        4  5398 1 1  35 LYS HB2  H  -4.345  17.879   4.072 1.00 . A A .  35 LYS HB2  1 1 
        4  5399 1 1  35 LYS HB3  H  -4.129  18.335   5.750 1.00 . A A .  35 LYS HB3  1 1 
        4  5400 1 1  35 LYS HD2  H  -1.672  17.786   2.781 1.00 . A A .  35 LYS HD2  1 1 
        4  5401 1 1  35 LYS HD3  H  -3.094  18.745   2.420 1.00 . A A .  35 LYS HD3  1 1 
        4  5402 1 1  35 LYS HE2  H  -0.978  20.502   3.369 1.00 . A A .  35 LYS HE2  1 1 
        4  5403 1 1  35 LYS HE3  H  -0.350  19.490   2.084 1.00 . A A .  35 LYS HE3  1 1 
        4  5404 1 1  35 LYS HG2  H  -2.721  19.884   4.725 1.00 . A A .  35 LYS HG2  1 1 
        4  5405 1 1  35 LYS HG3  H  -1.573  18.602   5.055 1.00 . A A .  35 LYS HG3  1 1 
        4  5406 1 1  35 LYS HZ1  H  -2.515  21.417   1.985 1.00 . A A .  35 LYS HZ1  1 1 
        4  5407 1 1  35 LYS HZ2  H  -1.305  21.162   0.918 1.00 . A A .  35 LYS HZ2  1 1 
        4  5408 1 1  35 LYS HZ3  H  -2.578  20.141   0.968 1.00 . A A .  35 LYS HZ3  1 1 
        4  5409 1 1  35 LYS N    N  -4.201  15.652   5.579 1.00 . A A .  35 LYS N    1 1 
        4  5410 1 1  35 LYS NZ   N  -1.974  20.720   1.516 1.00 . A A .  35 LYS NZ   1 1 
        4  5411 1 1  35 LYS O    O  -0.844  16.666   6.001 1.00 . A A .  35 LYS O    1 1 
        4  5412 1 1  36 GLU C    C  -1.174  14.753   8.930 1.00 . A A .  36 GLU C    1 1 
        4  5413 1 1  36 GLU CA   C  -1.572  16.202   8.643 1.00 . A A .  36 GLU CA   1 1 
        4  5414 1 1  36 GLU CB   C  -2.196  16.854   9.879 1.00 . A A .  36 GLU CB   1 1 
        4  5415 1 1  36 GLU CD   C  -0.658  18.765  10.461 1.00 . A A .  36 GLU CD   1 1 
        4  5416 1 1  36 GLU CG   C  -2.005  18.372   9.853 1.00 . A A .  36 GLU CG   1 1 
        4  5417 1 1  36 GLU H    H  -3.444  16.116   7.732 1.00 . A A .  36 GLU H    1 1 
        4  5418 1 1  36 GLU HA   H  -0.695  16.774   8.342 1.00 . A A .  36 GLU HA   1 1 
        4  5419 1 1  36 GLU HB2  H  -3.259  16.618   9.921 1.00 . A A .  36 GLU HB2  1 1 
        4  5420 1 1  36 GLU HB3  H  -1.742  16.442  10.780 1.00 . A A .  36 GLU HB3  1 1 
        4  5421 1 1  36 GLU HG2  H  -2.063  18.732   8.825 1.00 . A A .  36 GLU HG2  1 1 
        4  5422 1 1  36 GLU HG3  H  -2.812  18.853  10.405 1.00 . A A .  36 GLU HG3  1 1 
        4  5423 1 1  36 GLU N    N  -2.479  16.260   7.510 1.00 . A A .  36 GLU N    1 1 
        4  5424 1 1  36 GLU O    O  -0.022  14.476   9.260 1.00 . A A .  36 GLU O    1 1 
        4  5425 1 1  36 GLU OE1  O   0.350  18.656   9.729 1.00 . A A .  36 GLU OE1  1 1 
        4  5426 1 1  36 GLU OE2  O  -0.665  19.166  11.645 1.00 . A A .  36 GLU OE2  1 1 
        4  5427 1 1  37 ARG C    C  -0.737  11.959   8.195 1.00 . A A .  37 ARG C    1 1 
        4  5428 1 1  37 ARG CA   C  -1.915  12.453   9.037 1.00 . A A .  37 ARG CA   1 1 
        4  5429 1 1  37 ARG CB   C  -3.156  11.624   8.701 1.00 . A A .  37 ARG CB   1 1 
        4  5430 1 1  37 ARG CD   C  -5.490  11.052   9.464 1.00 . A A .  37 ARG CD   1 1 
        4  5431 1 1  37 ARG CG   C  -4.362  12.083   9.522 1.00 . A A .  37 ARG CG   1 1 
        4  5432 1 1  37 ARG CZ   C  -7.922  11.094  10.008 1.00 . A A .  37 ARG CZ   1 1 
        4  5433 1 1  37 ARG H    H  -3.084  14.100   8.528 1.00 . A A .  37 ARG H    1 1 
        4  5434 1 1  37 ARG HA   H  -1.692  12.385  10.101 1.00 . A A .  37 ARG HA   1 1 
        4  5435 1 1  37 ARG HB2  H  -3.380  11.713   7.638 1.00 . A A .  37 ARG HB2  1 1 
        4  5436 1 1  37 ARG HB3  H  -2.958  10.570   8.897 1.00 . A A .  37 ARG HB3  1 1 
        4  5437 1 1  37 ARG HD2  H  -5.748  10.841   8.427 1.00 . A A .  37 ARG HD2  1 1 
        4  5438 1 1  37 ARG HD3  H  -5.159  10.113   9.908 1.00 . A A .  37 ARG HD3  1 1 
        4  5439 1 1  37 ARG HE   H  -6.544  12.297  10.849 1.00 . A A .  37 ARG HE   1 1 
        4  5440 1 1  37 ARG HG2  H  -4.062  12.241  10.558 1.00 . A A .  37 ARG HG2  1 1 
        4  5441 1 1  37 ARG HG3  H  -4.720  13.041   9.145 1.00 . A A .  37 ARG HG3  1 1 
        4  5442 1 1  37 ARG HH11 H  -7.389   9.719   8.609 1.00 . A A .  37 ARG HH11 1 1 
        4  5443 1 1  37 ARG HH12 H  -9.077   9.760   8.998 1.00 . A A .  37 ARG HH12 1 1 
        4  5444 1 1  37 ARG HH21 H  -8.770  12.352  11.363 1.00 . A A .  37 ARG HH21 1 1 
        4  5445 1 1  37 ARG HH22 H  -9.867  11.268  10.575 1.00 . A A .  37 ARG HH22 1 1 
        4  5446 1 1  37 ARG N    N  -2.149  13.866   8.796 1.00 . A A .  37 ARG N    1 1 
        4  5447 1 1  37 ARG NE   N  -6.678  11.560  10.187 1.00 . A A .  37 ARG NE   1 1 
        4  5448 1 1  37 ARG NH1  N  -8.148  10.108   9.131 1.00 . A A .  37 ARG NH1  1 1 
        4  5449 1 1  37 ARG NH2  N  -8.939  11.616  10.708 1.00 . A A .  37 ARG NH2  1 1 
        4  5450 1 1  37 ARG O    O   0.206  11.372   8.724 1.00 . A A .  37 ARG O    1 1 
        4  5451 1 1  38 MET C    C   1.576  12.364   6.406 1.00 . A A .  38 MET C    1 1 
        4  5452 1 1  38 MET CA   C   0.218  11.804   5.978 1.00 . A A .  38 MET CA   1 1 
        4  5453 1 1  38 MET CB   C  -0.117  12.299   4.569 1.00 . A A .  38 MET CB   1 1 
        4  5454 1 1  38 MET CE   C  -0.685   9.407   3.936 1.00 . A A .  38 MET CE   1 1 
        4  5455 1 1  38 MET CG   C  -1.569  11.981   4.207 1.00 . A A .  38 MET CG   1 1 
        4  5456 1 1  38 MET H    H  -1.599  12.693   6.476 1.00 . A A .  38 MET H    1 1 
        4  5457 1 1  38 MET HA   H   0.235  10.715   6.022 1.00 . A A .  38 MET HA   1 1 
        4  5458 1 1  38 MET HB2  H   0.049  13.375   4.509 1.00 . A A .  38 MET HB2  1 1 
        4  5459 1 1  38 MET HB3  H   0.552  11.832   3.847 1.00 . A A .  38 MET HB3  1 1 
        4  5460 1 1  38 MET HE1  H  -0.270  10.001   3.121 1.00 . A A .  38 MET HE1  1 1 
        4  5461 1 1  38 MET HE2  H   0.101   9.180   4.656 1.00 . A A .  38 MET HE2  1 1 
        4  5462 1 1  38 MET HE3  H  -1.092   8.478   3.538 1.00 . A A .  38 MET HE3  1 1 
        4  5463 1 1  38 MET HG2  H  -2.237  12.702   4.678 1.00 . A A .  38 MET HG2  1 1 
        4  5464 1 1  38 MET HG3  H  -1.712  12.070   3.130 1.00 . A A .  38 MET HG3  1 1 
        4  5465 1 1  38 MET N    N  -0.829  12.215   6.898 1.00 . A A .  38 MET N    1 1 
        4  5466 1 1  38 MET O    O   2.616  11.910   5.932 1.00 . A A .  38 MET O    1 1 
        4  5467 1 1  38 MET SD   S  -1.984  10.329   4.742 1.00 . A A .  38 MET SD   1 1 
        4  5468 1 1  39 VAL C    C   3.206  13.230   9.052 1.00 . A A .  39 VAL C    1 1 
        4  5469 1 1  39 VAL CA   C   2.735  13.967   7.797 1.00 . A A .  39 VAL CA   1 1 
        4  5470 1 1  39 VAL CB   C   2.493  15.459   8.036 1.00 . A A .  39 VAL CB   1 1 
        4  5471 1 1  39 VAL CG1  C   3.794  16.254   7.903 1.00 . A A .  39 VAL CG1  1 1 
        4  5472 1 1  39 VAL CG2  C   1.420  16.000   7.089 1.00 . A A .  39 VAL CG2  1 1 
        4  5473 1 1  39 VAL H    H   0.671  13.704   7.681 1.00 . A A .  39 VAL H    1 1 
        4  5474 1 1  39 VAL HA   H   3.497  13.869   7.025 1.00 . A A .  39 VAL HA   1 1 
        4  5475 1 1  39 VAL HB   H   2.130  15.580   9.057 1.00 . A A .  39 VAL HB   1 1 
        4  5476 1 1  39 VAL HG11 H   3.584  17.316   8.023 1.00 . A A .  39 VAL HG11 1 1 
        4  5477 1 1  39 VAL HG12 H   4.496  15.933   8.672 1.00 . A A .  39 VAL HG12 1 1 
        4  5478 1 1  39 VAL HG13 H   4.227  16.078   6.918 1.00 . A A .  39 VAL HG13 1 1 
        4  5479 1 1  39 VAL HG21 H   1.354  17.082   7.195 1.00 . A A .  39 VAL HG21 1 1 
        4  5480 1 1  39 VAL HG22 H   1.686  15.752   6.061 1.00 . A A .  39 VAL HG22 1 1 
        4  5481 1 1  39 VAL HG23 H   0.458  15.550   7.334 1.00 . A A .  39 VAL HG23 1 1 
        4  5482 1 1  39 VAL N    N   1.522  13.341   7.299 1.00 . A A .  39 VAL N    1 1 
        4  5483 1 1  39 VAL O    O   4.332  12.735   9.099 1.00 . A A .  39 VAL O    1 1 
        4  5484 1 1  40 GLU C    C   3.159  11.098  11.019 1.00 . A A .  40 GLU C    1 1 
        4  5485 1 1  40 GLU CA   C   2.634  12.509  11.289 1.00 . A A .  40 GLU CA   1 1 
        4  5486 1 1  40 GLU CB   C   1.413  12.474  12.211 1.00 . A A .  40 GLU CB   1 1 
        4  5487 1 1  40 GLU CD   C   2.329  14.337  13.643 1.00 . A A .  40 GLU CD   1 1 
        4  5488 1 1  40 GLU CG   C   1.786  12.906  13.630 1.00 . A A .  40 GLU CG   1 1 
        4  5489 1 1  40 GLU H    H   1.409  13.583   9.991 1.00 . A A .  40 GLU H    1 1 
        4  5490 1 1  40 GLU HA   H   3.415  13.112  11.753 1.00 . A A .  40 GLU HA   1 1 
        4  5491 1 1  40 GLU HB2  H   0.638  13.131  11.818 1.00 . A A .  40 GLU HB2  1 1 
        4  5492 1 1  40 GLU HB3  H   0.997  11.467  12.231 1.00 . A A .  40 GLU HB3  1 1 
        4  5493 1 1  40 GLU HG2  H   0.910  12.840  14.276 1.00 . A A .  40 GLU HG2  1 1 
        4  5494 1 1  40 GLU HG3  H   2.534  12.226  14.037 1.00 . A A .  40 GLU HG3  1 1 
        4  5495 1 1  40 GLU N    N   2.322  13.178  10.037 1.00 . A A .  40 GLU N    1 1 
        4  5496 1 1  40 GLU O    O   4.096  10.645  11.674 1.00 . A A .  40 GLU O    1 1 
        4  5497 1 1  40 GLU OE1  O   1.527  15.251  13.358 1.00 . A A .  40 GLU OE1  1 1 
        4  5498 1 1  40 GLU OE2  O   3.535  14.483  13.938 1.00 . A A .  40 GLU OE2  1 1 
        4  5499 1 1  41 ILE C    C   4.399   9.083   9.289 1.00 . A A .  41 ILE C    1 1 
        4  5500 1 1  41 ILE CA   C   2.923   9.091   9.691 1.00 . A A .  41 ILE CA   1 1 
        4  5501 1 1  41 ILE CB   C   1.990   8.534   8.613 1.00 . A A .  41 ILE CB   1 1 
        4  5502 1 1  41 ILE CD1  C  -0.427   8.578   7.893 1.00 . A A .  41 ILE CD1  1 1 
        4  5503 1 1  41 ILE CG1  C   0.534   8.557   9.084 1.00 . A A .  41 ILE CG1  1 1 
        4  5504 1 1  41 ILE CG2  C   2.429   7.135   8.177 1.00 . A A .  41 ILE CG2  1 1 
        4  5505 1 1  41 ILE H    H   1.769  10.817   9.527 1.00 . A A .  41 ILE H    1 1 
        4  5506 1 1  41 ILE HA   H   2.802   8.466  10.576 1.00 . A A .  41 ILE HA   1 1 
        4  5507 1 1  41 ILE HB   H   2.055   9.180   7.738 1.00 . A A .  41 ILE HB   1 1 
        4  5508 1 1  41 ILE HD11 H  -1.106   9.424   7.990 1.00 . A A .  41 ILE HD11 1 1 
        4  5509 1 1  41 ILE HD12 H   0.143   8.673   6.969 1.00 . A A .  41 ILE HD12 1 1 
        4  5510 1 1  41 ILE HD13 H  -1.001   7.651   7.873 1.00 . A A .  41 ILE HD13 1 1 
        4  5511 1 1  41 ILE HG12 H   0.334   7.681   9.702 1.00 . A A .  41 ILE HG12 1 1 
        4  5512 1 1  41 ILE HG13 H   0.364   9.433   9.709 1.00 . A A .  41 ILE HG13 1 1 
        4  5513 1 1  41 ILE HG21 H   2.892   7.190   7.192 1.00 . A A .  41 ILE HG21 1 1 
        4  5514 1 1  41 ILE HG22 H   3.149   6.740   8.894 1.00 . A A .  41 ILE HG22 1 1 
        4  5515 1 1  41 ILE HG23 H   1.561   6.478   8.134 1.00 . A A .  41 ILE HG23 1 1 
        4  5516 1 1  41 ILE N    N   2.531  10.441  10.055 1.00 . A A .  41 ILE N    1 1 
        4  5517 1 1  41 ILE O    O   5.210   8.392   9.904 1.00 . A A .  41 ILE O    1 1 
        4  5518 1 1  42 GLY C    C   7.066   9.993   8.928 1.00 . A A .  42 GLY C    1 1 
        4  5519 1 1  42 GLY CA   C   6.068   9.952   7.769 1.00 . A A .  42 GLY CA   1 1 
        4  5520 1 1  42 GLY H    H   4.038  10.420   7.766 1.00 . A A .  42 GLY H    1 1 
        4  5521 1 1  42 GLY HA2  H   6.285   9.098   7.127 1.00 . A A .  42 GLY HA2  1 1 
        4  5522 1 1  42 GLY HA3  H   6.179  10.847   7.157 1.00 . A A .  42 GLY HA3  1 1 
        4  5523 1 1  42 GLY N    N   4.704   9.860   8.260 1.00 . A A .  42 GLY N    1 1 
        4  5524 1 1  42 GLY O    O   8.158   9.436   8.831 1.00 . A A .  42 GLY O    1 1 
        4  5525 1 1  43 SER C    C   7.612   9.426  11.879 1.00 . A A .  43 SER C    1 1 
        4  5526 1 1  43 SER CA   C   7.499  10.779  11.174 1.00 . A A .  43 SER CA   1 1 
        4  5527 1 1  43 SER CB   C   6.954  11.835  12.137 1.00 . A A .  43 SER CB   1 1 
        4  5528 1 1  43 SER H    H   5.765  11.108  10.068 1.00 . A A .  43 SER H    1 1 
        4  5529 1 1  43 SER HA   H   8.472  11.097  10.800 1.00 . A A .  43 SER HA   1 1 
        4  5530 1 1  43 SER HB2  H   6.464  12.626  11.569 1.00 . A A .  43 SER HB2  1 1 
        4  5531 1 1  43 SER HB3  H   6.196  11.385  12.777 1.00 . A A .  43 SER HB3  1 1 
        4  5532 1 1  43 SER HG   H   8.878  12.092  12.627 1.00 . A A .  43 SER HG   1 1 
        4  5533 1 1  43 SER N    N   6.655  10.658   9.998 1.00 . A A .  43 SER N    1 1 
        4  5534 1 1  43 SER O    O   8.714   8.945  12.136 1.00 . A A .  43 SER O    1 1 
        4  5535 1 1  43 SER OG   O   7.982  12.401  12.946 1.00 . A A .  43 SER OG   1 1 
        4  5536 1 1  44 ARG C    C   7.211   6.523  12.052 1.00 . A A .  44 ARG C    1 1 
        4  5537 1 1  44 ARG CA   C   6.410   7.560  12.841 1.00 . A A .  44 ARG CA   1 1 
        4  5538 1 1  44 ARG CB   C   4.969   7.071  12.997 1.00 . A A .  44 ARG CB   1 1 
        4  5539 1 1  44 ARG CD   C   3.097   7.178  14.683 1.00 . A A .  44 ARG CD   1 1 
        4  5540 1 1  44 ARG CG   C   4.184   7.970  13.954 1.00 . A A .  44 ARG CG   1 1 
        4  5541 1 1  44 ARG CZ   C   3.624   7.436  17.105 1.00 . A A .  44 ARG CZ   1 1 
        4  5542 1 1  44 ARG H    H   5.563   9.246  11.958 1.00 . A A .  44 ARG H    1 1 
        4  5543 1 1  44 ARG HA   H   6.856   7.739  13.820 1.00 . A A .  44 ARG HA   1 1 
        4  5544 1 1  44 ARG HB2  H   4.479   7.056  12.023 1.00 . A A .  44 ARG HB2  1 1 
        4  5545 1 1  44 ARG HB3  H   4.967   6.047  13.370 1.00 . A A .  44 ARG HB3  1 1 
        4  5546 1 1  44 ARG HD2  H   2.219   7.806  14.836 1.00 . A A .  44 ARG HD2  1 1 
        4  5547 1 1  44 ARG HD3  H   2.781   6.332  14.073 1.00 . A A .  44 ARG HD3  1 1 
        4  5548 1 1  44 ARG HE   H   3.964   5.765  16.036 1.00 . A A .  44 ARG HE   1 1 
        4  5549 1 1  44 ARG HG2  H   4.864   8.415  14.681 1.00 . A A .  44 ARG HG2  1 1 
        4  5550 1 1  44 ARG HG3  H   3.731   8.791  13.399 1.00 . A A .  44 ARG HG3  1 1 
        4  5551 1 1  44 ARG HH11 H   2.797   9.079  16.237 1.00 . A A .  44 ARG HH11 1 1 
        4  5552 1 1  44 ARG HH12 H   3.169   9.243  17.920 1.00 . A A .  44 ARG HH12 1 1 
        4  5553 1 1  44 ARG HH21 H   4.455   5.981  18.257 1.00 . A A .  44 ARG HH21 1 1 
        4  5554 1 1  44 ARG HH22 H   4.118   7.469  19.077 1.00 . A A .  44 ARG HH22 1 1 
        4  5555 1 1  44 ARG N    N   6.455   8.849  12.171 1.00 . A A .  44 ARG N    1 1 
        4  5556 1 1  44 ARG NE   N   3.608   6.698  15.987 1.00 . A A .  44 ARG NE   1 1 
        4  5557 1 1  44 ARG NH1  N   3.157   8.692  17.086 1.00 . A A .  44 ARG NH1  1 1 
        4  5558 1 1  44 ARG NH2  N   4.106   6.918  18.243 1.00 . A A .  44 ARG NH2  1 1 
        4  5559 1 1  44 ARG O    O   7.964   5.742  12.633 1.00 . A A .  44 ARG O    1 1 
        4  5560 1 1  45 TRP C    C   9.221   5.868  10.014 1.00 . A A .  45 TRP C    1 1 
        4  5561 1 1  45 TRP CA   C   7.718   5.620   9.866 1.00 . A A .  45 TRP CA   1 1 
        4  5562 1 1  45 TRP CB   C   7.229   5.755   8.423 1.00 . A A .  45 TRP CB   1 1 
        4  5563 1 1  45 TRP CD1  C   9.083   5.542   6.640 1.00 . A A .  45 TRP CD1  1 1 
        4  5564 1 1  45 TRP CD2  C   8.040   3.631   7.050 1.00 . A A .  45 TRP CD2  1 1 
        4  5565 1 1  45 TRP CE2  C   8.997   3.381   6.088 1.00 . A A .  45 TRP CE2  1 1 
        4  5566 1 1  45 TRP CE3  C   7.200   2.611   7.531 1.00 . A A .  45 TRP CE3  1 1 
        4  5567 1 1  45 TRP CG   C   8.104   5.030   7.399 1.00 . A A .  45 TRP CG   1 1 
        4  5568 1 1  45 TRP CH2  C   8.381   1.084   5.989 1.00 . A A .  45 TRP CH2  1 1 
        4  5569 1 1  45 TRP CZ2  C   9.206   2.116   5.525 1.00 . A A .  45 TRP CZ2  1 1 
        4  5570 1 1  45 TRP CZ3  C   7.421   1.353   6.958 1.00 . A A .  45 TRP CZ3  1 1 
        4  5571 1 1  45 TRP H    H   6.409   7.187  10.277 1.00 . A A .  45 TRP H    1 1 
        4  5572 1 1  45 TRP HA   H   7.473   4.609  10.191 1.00 . A A .  45 TRP HA   1 1 
        4  5573 1 1  45 TRP HB2  H   6.213   5.367   8.357 1.00 . A A .  45 TRP HB2  1 1 
        4  5574 1 1  45 TRP HB3  H   7.184   6.813   8.163 1.00 . A A .  45 TRP HB3  1 1 
        4  5575 1 1  45 TRP HD1  H   9.391   6.587   6.660 1.00 . A A .  45 TRP HD1  1 1 
        4  5576 1 1  45 TRP HE1  H  10.465   4.732   5.121 1.00 . A A .  45 TRP HE1  1 1 
        4  5577 1 1  45 TRP HE3  H   6.437   2.783   8.290 1.00 . A A .  45 TRP HE3  1 1 
        4  5578 1 1  45 TRP HH2  H   8.491   0.075   5.593 1.00 . A A .  45 TRP HH2  1 1 
        4  5579 1 1  45 TRP HZ2  H   9.969   1.944   4.767 1.00 . A A .  45 TRP HZ2  1 1 
        4  5580 1 1  45 TRP HZ3  H   6.797   0.526   7.296 1.00 . A A .  45 TRP HZ3  1 1 
        4  5581 1 1  45 TRP N    N   7.022   6.549  10.741 1.00 . A A .  45 TRP N    1 1 
        4  5582 1 1  45 TRP NE1  N   9.652   4.580   5.831 1.00 . A A .  45 TRP NE1  1 1 
        4  5583 1 1  45 TRP O    O  10.023   4.947   9.864 1.00 . A A .  45 TRP O    1 1 
        4  5584 1 1  46 GLN C    C  11.421   7.165  11.893 1.00 . A A .  46 GLN C    1 1 
        4  5585 1 1  46 GLN CA   C  10.949   7.496  10.476 1.00 . A A .  46 GLN CA   1 1 
        4  5586 1 1  46 GLN CB   C  11.155   8.979  10.162 1.00 . A A .  46 GLN CB   1 1 
        4  5587 1 1  46 GLN CD   C  12.784   9.496   8.307 1.00 . A A .  46 GLN CD   1 1 
        4  5588 1 1  46 GLN CG   C  11.324   9.203   8.658 1.00 . A A .  46 GLN CG   1 1 
        4  5589 1 1  46 GLN H    H   8.898   7.859  10.427 1.00 . A A .  46 GLN H    1 1 
        4  5590 1 1  46 GLN HA   H  11.503   6.898   9.752 1.00 . A A .  46 GLN HA   1 1 
        4  5591 1 1  46 GLN HB2  H  10.302   9.553  10.525 1.00 . A A .  46 GLN HB2  1 1 
        4  5592 1 1  46 GLN HB3  H  12.034   9.348  10.689 1.00 . A A .  46 GLN HB3  1 1 
        4  5593 1 1  46 GLN HE21 H  12.137  10.840   6.939 1.00 . A A .  46 GLN HE21 1 1 
        4  5594 1 1  46 GLN HE22 H  13.857  10.672   7.057 1.00 . A A .  46 GLN HE22 1 1 
        4  5595 1 1  46 GLN HG2  H  10.986   8.320   8.115 1.00 . A A .  46 GLN HG2  1 1 
        4  5596 1 1  46 GLN HG3  H  10.695  10.034   8.337 1.00 . A A .  46 GLN HG3  1 1 
        4  5597 1 1  46 GLN N    N   9.557   7.116  10.306 1.00 . A A .  46 GLN N    1 1 
        4  5598 1 1  46 GLN NE2  N  12.939  10.412   7.356 1.00 . A A .  46 GLN NE2  1 1 
        4  5599 1 1  46 GLN O    O  12.604   7.295  12.203 1.00 . A A .  46 GLN O    1 1 
        4  5600 1 1  46 GLN OE1  O  13.709   8.928   8.865 1.00 . A A .  46 GLN OE1  1 1 
        4  5601 1 1  47 ARG C    C  11.004   4.886  14.218 1.00 . A A .  47 ARG C    1 1 
        4  5602 1 1  47 ARG CA   C  10.775   6.393  14.092 1.00 . A A .  47 ARG CA   1 1 
        4  5603 1 1  47 ARG CB   C   9.640   6.810  15.030 1.00 . A A .  47 ARG CB   1 1 
        4  5604 1 1  47 ARG CD   C   8.374   8.761  16.005 1.00 . A A .  47 ARG CD   1 1 
        4  5605 1 1  47 ARG CG   C   9.612   8.328  15.216 1.00 . A A .  47 ARG CG   1 1 
        4  5606 1 1  47 ARG CZ   C   7.847   8.917  18.435 1.00 . A A .  47 ARG CZ   1 1 
        4  5607 1 1  47 ARG H    H   9.511   6.641  12.455 1.00 . A A .  47 ARG H    1 1 
        4  5608 1 1  47 ARG HA   H  11.683   6.949  14.328 1.00 . A A .  47 ARG HA   1 1 
        4  5609 1 1  47 ARG HB2  H   8.686   6.472  14.625 1.00 . A A .  47 ARG HB2  1 1 
        4  5610 1 1  47 ARG HB3  H   9.765   6.323  15.997 1.00 . A A .  47 ARG HB3  1 1 
        4  5611 1 1  47 ARG HD2  H   7.967   9.680  15.583 1.00 . A A .  47 ARG HD2  1 1 
        4  5612 1 1  47 ARG HD3  H   7.597   8.001  15.923 1.00 . A A .  47 ARG HD3  1 1 
        4  5613 1 1  47 ARG HE   H   9.683   9.166  17.648 1.00 . A A .  47 ARG HE   1 1 
        4  5614 1 1  47 ARG HG2  H  10.512   8.651  15.739 1.00 . A A .  47 ARG HG2  1 1 
        4  5615 1 1  47 ARG HG3  H   9.616   8.818  14.242 1.00 . A A .  47 ARG HG3  1 1 
        4  5616 1 1  47 ARG HH11 H   6.250   8.507  17.245 1.00 . A A .  47 ARG HH11 1 1 
        4  5617 1 1  47 ARG HH12 H   5.899   8.619  18.938 1.00 . A A .  47 ARG HH12 1 1 
        4  5618 1 1  47 ARG HH21 H   9.221   9.313  19.881 1.00 . A A .  47 ARG HH21 1 1 
        4  5619 1 1  47 ARG HH22 H   7.601   9.081  20.447 1.00 . A A .  47 ARG HH22 1 1 
        4  5620 1 1  47 ARG N    N  10.471   6.744  12.715 1.00 . A A .  47 ARG N    1 1 
        4  5621 1 1  47 ARG NE   N   8.727   8.971  17.426 1.00 . A A .  47 ARG NE   1 1 
        4  5622 1 1  47 ARG NH1  N   6.556   8.659  18.185 1.00 . A A .  47 ARG NH1  1 1 
        4  5623 1 1  47 ARG NH2  N   8.258   9.121  19.694 1.00 . A A .  47 ARG NH2  1 1 
        4  5624 1 1  47 ARG O    O  11.922   4.449  14.911 1.00 . A A .  47 ARG O    1 1 
        4  5625 1 1  48 ILE C    C  11.693   2.267  13.262 1.00 . A A .  48 ILE C    1 1 
        4  5626 1 1  48 ILE CA   C  10.252   2.682  13.564 1.00 . A A .  48 ILE CA   1 1 
        4  5627 1 1  48 ILE CB   C   9.222   2.058  12.621 1.00 . A A .  48 ILE CB   1 1 
        4  5628 1 1  48 ILE CD1  C   8.488   1.888  10.214 1.00 . A A .  48 ILE CD1  1 1 
        4  5629 1 1  48 ILE CG1  C   9.285   2.703  11.235 1.00 . A A .  48 ILE CG1  1 1 
        4  5630 1 1  48 ILE CG2  C   7.816   2.126  13.222 1.00 . A A .  48 ILE CG2  1 1 
        4  5631 1 1  48 ILE H    H   9.410   4.494  12.976 1.00 . A A .  48 ILE H    1 1 
        4  5632 1 1  48 ILE HA   H  10.004   2.356  14.574 1.00 . A A .  48 ILE HA   1 1 
        4  5633 1 1  48 ILE HB   H   9.468   1.003  12.497 1.00 . A A .  48 ILE HB   1 1 
        4  5634 1 1  48 ILE HD11 H   8.947   1.989   9.231 1.00 . A A .  48 ILE HD11 1 1 
        4  5635 1 1  48 ILE HD12 H   8.486   0.839  10.508 1.00 . A A .  48 ILE HD12 1 1 
        4  5636 1 1  48 ILE HD13 H   7.463   2.257  10.176 1.00 . A A .  48 ILE HD13 1 1 
        4  5637 1 1  48 ILE HG12 H   8.890   3.718  11.284 1.00 . A A .  48 ILE HG12 1 1 
        4  5638 1 1  48 ILE HG13 H  10.323   2.780  10.913 1.00 . A A .  48 ILE HG13 1 1 
        4  5639 1 1  48 ILE HG21 H   7.645   1.249  13.846 1.00 . A A .  48 ILE HG21 1 1 
        4  5640 1 1  48 ILE HG22 H   7.724   3.027  13.828 1.00 . A A .  48 ILE HG22 1 1 
        4  5641 1 1  48 ILE HG23 H   7.079   2.151  12.419 1.00 . A A .  48 ILE HG23 1 1 
        4  5642 1 1  48 ILE N    N  10.154   4.131  13.537 1.00 . A A .  48 ILE N    1 1 
        4  5643 1 1  48 ILE O    O  12.553   3.117  13.033 1.00 . A A .  48 ILE O    1 1 
        4  5644 1 1  49 SER C    C  13.211  -0.405  11.714 1.00 . A A .  49 SER C    1 1 
        4  5645 1 1  49 SER CA   C  13.236   0.423  13.000 1.00 . A A .  49 SER CA   1 1 
        4  5646 1 1  49 SER CB   C  13.734  -0.429  14.170 1.00 . A A .  49 SER CB   1 1 
        4  5647 1 1  49 SER H    H  11.209   0.276  13.458 1.00 . A A .  49 SER H    1 1 
        4  5648 1 1  49 SER HA   H  13.883   1.292  12.884 1.00 . A A .  49 SER HA   1 1 
        4  5649 1 1  49 SER HB2  H  12.882  -0.876  14.682 1.00 . A A .  49 SER HB2  1 1 
        4  5650 1 1  49 SER HB3  H  14.342  -1.249  13.788 1.00 . A A .  49 SER HB3  1 1 
        4  5651 1 1  49 SER HG   H  14.719   1.228  14.708 1.00 . A A .  49 SER HG   1 1 
        4  5652 1 1  49 SER N    N  11.914   0.961  13.271 1.00 . A A .  49 SER N    1 1 
        4  5653 1 1  49 SER O    O  12.157  -0.584  11.107 1.00 . A A .  49 SER O    1 1 
        4  5654 1 1  49 SER OG   O  14.498   0.335  15.100 1.00 . A A .  49 SER OG   1 1 
        4  5655 1 1  50 GLN C    C  13.488  -2.830  10.145 1.00 . A A .  50 GLN C    1 1 
        4  5656 1 1  50 GLN CA   C  14.512  -1.693  10.133 1.00 . A A .  50 GLN CA   1 1 
        4  5657 1 1  50 GLN CB   C  15.934  -2.237   9.984 1.00 . A A .  50 GLN CB   1 1 
        4  5658 1 1  50 GLN CD   C  15.800  -2.099   7.470 1.00 . A A .  50 GLN CD   1 1 
        4  5659 1 1  50 GLN CG   C  16.094  -3.002   8.669 1.00 . A A .  50 GLN CG   1 1 
        4  5660 1 1  50 GLN H    H  15.239  -0.738  11.836 1.00 . A A .  50 GLN H    1 1 
        4  5661 1 1  50 GLN HA   H  14.302  -1.013   9.307 1.00 . A A .  50 GLN HA   1 1 
        4  5662 1 1  50 GLN HB2  H  16.648  -1.414  10.019 1.00 . A A .  50 GLN HB2  1 1 
        4  5663 1 1  50 GLN HB3  H  16.166  -2.895  10.822 1.00 . A A .  50 GLN HB3  1 1 
        4  5664 1 1  50 GLN HE21 H  13.870  -2.709   7.543 1.00 . A A .  50 GLN HE21 1 1 
        4  5665 1 1  50 GLN HE22 H  14.241  -1.572   6.290 1.00 . A A .  50 GLN HE22 1 1 
        4  5666 1 1  50 GLN HG2  H  17.108  -3.395   8.593 1.00 . A A .  50 GLN HG2  1 1 
        4  5667 1 1  50 GLN HG3  H  15.419  -3.858   8.658 1.00 . A A .  50 GLN HG3  1 1 
        4  5668 1 1  50 GLN N    N  14.386  -0.888  11.336 1.00 . A A .  50 GLN N    1 1 
        4  5669 1 1  50 GLN NE2  N  14.532  -2.129   7.068 1.00 . A A .  50 GLN NE2  1 1 
        4  5670 1 1  50 GLN O    O  12.733  -2.999   9.189 1.00 . A A .  50 GLN O    1 1 
        4  5671 1 1  50 GLN OE1  O  16.666  -1.420   6.944 1.00 . A A .  50 GLN OE1  1 1 
        4  5672 1 1  51 SER C    C  11.202  -4.317  10.836 1.00 . A A .  51 SER C    1 1 
        4  5673 1 1  51 SER CA   C  12.578  -4.695  11.386 1.00 . A A .  51 SER CA   1 1 
        4  5674 1 1  51 SER CB   C  12.466  -5.125  12.850 1.00 . A A .  51 SER CB   1 1 
        4  5675 1 1  51 SER H    H  14.115  -3.435  12.010 1.00 . A A .  51 SER H    1 1 
        4  5676 1 1  51 SER HA   H  13.013  -5.507  10.803 1.00 . A A .  51 SER HA   1 1 
        4  5677 1 1  51 SER HB2  H  13.444  -5.052  13.326 1.00 . A A .  51 SER HB2  1 1 
        4  5678 1 1  51 SER HB3  H  11.803  -4.440  13.379 1.00 . A A .  51 SER HB3  1 1 
        4  5679 1 1  51 SER HG   H  10.986  -6.441  13.137 1.00 . A A .  51 SER HG   1 1 
        4  5680 1 1  51 SER N    N  13.497  -3.579  11.237 1.00 . A A .  51 SER N    1 1 
        4  5681 1 1  51 SER O    O  10.590  -5.089  10.100 1.00 . A A .  51 SER O    1 1 
        4  5682 1 1  51 SER OG   O  11.974  -6.456  12.980 1.00 . A A .  51 SER OG   1 1 
        4  5683 1 1  52 GLN C    C   9.480  -2.388   9.260 1.00 . A A .  52 GLN C    1 1 
        4  5684 1 1  52 GLN CA   C   9.461  -2.638  10.770 1.00 . A A .  52 GLN CA   1 1 
        4  5685 1 1  52 GLN CB   C   9.063  -1.372  11.530 1.00 . A A .  52 GLN CB   1 1 
        4  5686 1 1  52 GLN CD   C   7.516  -1.687  13.497 1.00 . A A .  52 GLN CD   1 1 
        4  5687 1 1  52 GLN CG   C   8.974  -1.641  13.034 1.00 . A A .  52 GLN CG   1 1 
        4  5688 1 1  52 GLN H    H  11.259  -2.507  11.815 1.00 . A A .  52 GLN H    1 1 
        4  5689 1 1  52 GLN HA   H   8.754  -3.433  11.004 1.00 . A A .  52 GLN HA   1 1 
        4  5690 1 1  52 GLN HB2  H   9.793  -0.585  11.341 1.00 . A A .  52 GLN HB2  1 1 
        4  5691 1 1  52 GLN HB3  H   8.102  -1.010  11.164 1.00 . A A .  52 GLN HB3  1 1 
        4  5692 1 1  52 GLN HE21 H   7.997  -0.402  14.985 1.00 . A A .  52 GLN HE21 1 1 
        4  5693 1 1  52 GLN HE22 H   6.338  -0.896  14.941 1.00 . A A .  52 GLN HE22 1 1 
        4  5694 1 1  52 GLN HG2  H   9.464  -2.586  13.268 1.00 . A A .  52 GLN HG2  1 1 
        4  5695 1 1  52 GLN HG3  H   9.508  -0.862  13.578 1.00 . A A .  52 GLN HG3  1 1 
        4  5696 1 1  52 GLN N    N  10.755  -3.129  11.215 1.00 . A A .  52 GLN N    1 1 
        4  5697 1 1  52 GLN NE2  N   7.263  -0.932  14.562 1.00 . A A .  52 GLN NE2  1 1 
        4  5698 1 1  52 GLN O    O   8.746  -3.031   8.512 1.00 . A A .  52 GLN O    1 1 
        4  5699 1 1  52 GLN OE1  O   6.677  -2.363  12.924 1.00 . A A .  52 GLN OE1  1 1 
        4  5700 1 1  53 LYS C    C  10.560  -2.393   6.626 1.00 . A A .  53 LYS C    1 1 
        4  5701 1 1  53 LYS CA   C  10.451  -1.110   7.452 1.00 . A A .  53 LYS CA   1 1 
        4  5702 1 1  53 LYS CB   C  11.615  -0.140   7.237 1.00 . A A .  53 LYS CB   1 1 
        4  5703 1 1  53 LYS CD   C  12.597   2.091   7.884 1.00 . A A .  53 LYS CD   1 1 
        4  5704 1 1  53 LYS CE   C  12.219   3.548   8.160 1.00 . A A .  53 LYS CE   1 1 
        4  5705 1 1  53 LYS CG   C  11.371   1.180   7.971 1.00 . A A .  53 LYS CG   1 1 
        4  5706 1 1  53 LYS H    H  10.921  -0.934   9.473 1.00 . A A .  53 LYS H    1 1 
        4  5707 1 1  53 LYS HA   H   9.539  -0.588   7.161 1.00 . A A .  53 LYS HA   1 1 
        4  5708 1 1  53 LYS HB2  H  12.541  -0.592   7.592 1.00 . A A .  53 LYS HB2  1 1 
        4  5709 1 1  53 LYS HB3  H  11.742   0.051   6.171 1.00 . A A .  53 LYS HB3  1 1 
        4  5710 1 1  53 LYS HD2  H  13.349   1.765   8.602 1.00 . A A .  53 LYS HD2  1 1 
        4  5711 1 1  53 LYS HD3  H  13.046   2.009   6.894 1.00 . A A .  53 LYS HD3  1 1 
        4  5712 1 1  53 LYS HE2  H  11.156   3.696   7.968 1.00 . A A .  53 LYS HE2  1 1 
        4  5713 1 1  53 LYS HE3  H  12.388   3.781   9.211 1.00 . A A .  53 LYS HE3  1 1 
        4  5714 1 1  53 LYS HG2  H  10.507   1.686   7.541 1.00 . A A .  53 LYS HG2  1 1 
        4  5715 1 1  53 LYS HG3  H  11.135   0.981   9.017 1.00 . A A .  53 LYS HG3  1 1 
        4  5716 1 1  53 LYS HZ1  H  12.890   5.402   7.622 1.00 . A A .  53 LYS HZ1  1 1 
        4  5717 1 1  53 LYS HZ2  H  13.982   4.214   7.370 1.00 . A A .  53 LYS HZ2  1 1 
        4  5718 1 1  53 LYS HZ3  H  12.710   4.381   6.360 1.00 . A A .  53 LYS HZ3  1 1 
        4  5719 1 1  53 LYS N    N  10.327  -1.453   8.858 1.00 . A A .  53 LYS N    1 1 
        4  5720 1 1  53 LYS NZ   N  13.015   4.460   7.309 1.00 . A A .  53 LYS NZ   1 1 
        4  5721 1 1  53 LYS O    O   9.847  -2.563   5.638 1.00 . A A .  53 LYS O    1 1 
        4  5722 1 1  54 GLU C    C  10.386  -5.358   6.383 1.00 . A A .  54 GLU C    1 1 
        4  5723 1 1  54 GLU CA   C  11.671  -4.527   6.374 1.00 . A A .  54 GLU CA   1 1 
        4  5724 1 1  54 GLU CB   C  12.831  -5.304   7.001 1.00 . A A .  54 GLU CB   1 1 
        4  5725 1 1  54 GLU CD   C  14.363  -6.169   5.194 1.00 . A A .  54 GLU CD   1 1 
        4  5726 1 1  54 GLU CG   C  14.130  -5.066   6.229 1.00 . A A .  54 GLU CG   1 1 
        4  5727 1 1  54 GLU H    H  12.036  -3.118   7.865 1.00 . A A .  54 GLU H    1 1 
        4  5728 1 1  54 GLU HA   H  11.932  -4.260   5.350 1.00 . A A .  54 GLU HA   1 1 
        4  5729 1 1  54 GLU HB2  H  12.959  -4.998   8.039 1.00 . A A .  54 GLU HB2  1 1 
        4  5730 1 1  54 GLU HB3  H  12.598  -6.369   7.008 1.00 . A A .  54 GLU HB3  1 1 
        4  5731 1 1  54 GLU HG2  H  14.089  -4.098   5.730 1.00 . A A .  54 GLU HG2  1 1 
        4  5732 1 1  54 GLU HG3  H  14.969  -5.032   6.924 1.00 . A A .  54 GLU HG3  1 1 
        4  5733 1 1  54 GLU N    N  11.459  -3.264   7.061 1.00 . A A .  54 GLU N    1 1 
        4  5734 1 1  54 GLU O    O   9.844  -5.680   5.327 1.00 . A A .  54 GLU O    1 1 
        4  5735 1 1  54 GLU OE1  O  14.356  -7.348   5.610 1.00 . A A .  54 GLU OE1  1 1 
        4  5736 1 1  54 GLU OE2  O  14.543  -5.808   4.011 1.00 . A A .  54 GLU OE2  1 1 
        4  5737 1 1  55 HIS C    C   7.618  -5.891   6.864 1.00 . A A .  55 HIS C    1 1 
        4  5738 1 1  55 HIS CA   C   8.726  -6.469   7.747 1.00 . A A .  55 HIS CA   1 1 
        4  5739 1 1  55 HIS CB   C   8.326  -6.555   9.221 1.00 . A A .  55 HIS CB   1 1 
        4  5740 1 1  55 HIS CD2  C   5.912  -7.143  10.034 1.00 . A A .  55 HIS CD2  1 1 
        4  5741 1 1  55 HIS CE1  C   5.913  -9.266   9.506 1.00 . A A .  55 HIS CE1  1 1 
        4  5742 1 1  55 HIS CG   C   7.124  -7.433   9.480 1.00 . A A .  55 HIS CG   1 1 
        4  5743 1 1  55 HIS H    H  10.384  -5.416   8.441 1.00 . A A .  55 HIS H    1 1 
        4  5744 1 1  55 HIS HA   H   8.962  -7.477   7.407 1.00 . A A .  55 HIS HA   1 1 
        4  5745 1 1  55 HIS HB2  H   9.171  -6.935   9.795 1.00 . A A .  55 HIS HB2  1 1 
        4  5746 1 1  55 HIS HB3  H   8.116  -5.551   9.590 1.00 . A A .  55 HIS HB3  1 1 
        4  5747 1 1  55 HIS HD1  H   7.840  -9.295   8.735 1.00 . A A .  55 HIS HD1  1 1 
        4  5748 1 1  55 HIS HD2  H   5.597  -6.166  10.402 1.00 . A A .  55 HIS HD2  1 1 
        4  5749 1 1  55 HIS HE1  H   5.584 -10.298   9.382 1.00 . A A .  55 HIS HE1  1 1 
        4  5750 1 1  55 HIS N    N   9.937  -5.681   7.587 1.00 . A A .  55 HIS N    1 1 
        4  5751 1 1  55 HIS ND1  N   7.095  -8.778   9.159 1.00 . A A .  55 HIS ND1  1 1 
        4  5752 1 1  55 HIS NE2  N   5.181  -8.251  10.048 1.00 . A A .  55 HIS NE2  1 1 
        4  5753 1 1  55 HIS O    O   7.158  -6.546   5.931 1.00 . A A .  55 HIS O    1 1 
        4  5754 1 1  56 TYR C    C   6.446  -4.071   4.936 1.00 . A A .  56 TYR C    1 1 
        4  5755 1 1  56 TYR CA   C   6.176  -3.996   6.440 1.00 . A A .  56 TYR CA   1 1 
        4  5756 1 1  56 TYR CB   C   6.216  -2.532   6.881 1.00 . A A .  56 TYR CB   1 1 
        4  5757 1 1  56 TYR CD1  C   4.190  -2.618   8.380 1.00 . A A .  56 TYR CD1  1 1 
        4  5758 1 1  56 TYR CD2  C   6.203  -1.668   9.250 1.00 . A A .  56 TYR CD2  1 1 
        4  5759 1 1  56 TYR CE1  C   3.529  -2.366   9.634 1.00 . A A .  56 TYR CE1  1 1 
        4  5760 1 1  56 TYR CE2  C   5.542  -1.416  10.504 1.00 . A A .  56 TYR CE2  1 1 
        4  5761 1 1  56 TYR CG   C   5.514  -2.264   8.214 1.00 . A A .  56 TYR CG   1 1 
        4  5762 1 1  56 TYR CZ   C   4.238  -1.777  10.634 1.00 . A A .  56 TYR CZ   1 1 
        4  5763 1 1  56 TYR H    H   7.601  -4.144   7.952 1.00 . A A .  56 TYR H    1 1 
        4  5764 1 1  56 TYR HA   H   5.231  -4.495   6.657 1.00 . A A .  56 TYR HA   1 1 
        4  5765 1 1  56 TYR HB2  H   7.256  -2.215   6.960 1.00 . A A .  56 TYR HB2  1 1 
        4  5766 1 1  56 TYR HB3  H   5.754  -1.917   6.109 1.00 . A A .  56 TYR HB3  1 1 
        4  5767 1 1  56 TYR HD1  H   3.645  -3.089   7.561 1.00 . A A .  56 TYR HD1  1 1 
        4  5768 1 1  56 TYR HD2  H   7.249  -1.388   9.119 1.00 . A A .  56 TYR HD2  1 1 
        4  5769 1 1  56 TYR HE1  H   2.484  -2.641   9.778 1.00 . A A .  56 TYR HE1  1 1 
        4  5770 1 1  56 TYR HE2  H   6.075  -0.946  11.330 1.00 . A A .  56 TYR HE2  1 1 
        4  5771 1 1  56 TYR HH   H   4.053  -2.063  12.548 1.00 . A A .  56 TYR HH   1 1 
        4  5772 1 1  56 TYR N    N   7.221  -4.670   7.191 1.00 . A A .  56 TYR N    1 1 
        4  5773 1 1  56 TYR O    O   5.528  -4.286   4.146 1.00 . A A .  56 TYR O    1 1 
        4  5774 1 1  56 TYR OH   O   3.613  -1.539  11.819 1.00 . A A .  56 TYR OH   1 1 
        4  5775 1 1  57 LYS C    C   7.831  -5.328   2.626 1.00 . A A .  57 LYS C    1 1 
        4  5776 1 1  57 LYS CA   C   8.114  -3.934   3.190 1.00 . A A .  57 LYS CA   1 1 
        4  5777 1 1  57 LYS CB   C   9.571  -3.493   3.039 1.00 . A A .  57 LYS CB   1 1 
        4  5778 1 1  57 LYS CD   C  11.229  -3.071   1.186 1.00 . A A .  57 LYS CD   1 1 
        4  5779 1 1  57 LYS CE   C  12.581  -3.288   1.869 1.00 . A A .  57 LYS CE   1 1 
        4  5780 1 1  57 LYS CG   C  10.175  -4.032   1.740 1.00 . A A .  57 LYS CG   1 1 
        4  5781 1 1  57 LYS H    H   8.452  -3.715   5.234 1.00 . A A .  57 LYS H    1 1 
        4  5782 1 1  57 LYS HA   H   7.502  -3.212   2.650 1.00 . A A .  57 LYS HA   1 1 
        4  5783 1 1  57 LYS HB2  H   9.630  -2.405   3.047 1.00 . A A .  57 LYS HB2  1 1 
        4  5784 1 1  57 LYS HB3  H  10.153  -3.850   3.889 1.00 . A A .  57 LYS HB3  1 1 
        4  5785 1 1  57 LYS HD2  H  11.333  -3.220   0.111 1.00 . A A .  57 LYS HD2  1 1 
        4  5786 1 1  57 LYS HD3  H  10.903  -2.042   1.336 1.00 . A A .  57 LYS HD3  1 1 
        4  5787 1 1  57 LYS HE2  H  12.677  -2.615   2.721 1.00 . A A .  57 LYS HE2  1 1 
        4  5788 1 1  57 LYS HE3  H  12.640  -4.305   2.257 1.00 . A A .  57 LYS HE3  1 1 
        4  5789 1 1  57 LYS HG2  H  10.627  -5.007   1.922 1.00 . A A .  57 LYS HG2  1 1 
        4  5790 1 1  57 LYS HG3  H   9.387  -4.178   1.002 1.00 . A A .  57 LYS HG3  1 1 
        4  5791 1 1  57 LYS HZ1  H  13.313  -2.908  -0.002 1.00 . A A .  57 LYS HZ1  1 1 
        4  5792 1 1  57 LYS HZ2  H  14.201  -2.240   1.195 1.00 . A A .  57 LYS HZ2  1 1 
        4  5793 1 1  57 LYS HZ3  H  14.296  -3.844   0.906 1.00 . A A .  57 LYS HZ3  1 1 
        4  5794 1 1  57 LYS N    N   7.711  -3.890   4.585 1.00 . A A .  57 LYS N    1 1 
        4  5795 1 1  57 LYS NZ   N  13.688  -3.051   0.914 1.00 . A A .  57 LYS NZ   1 1 
        4  5796 1 1  57 LYS O    O   7.180  -5.462   1.591 1.00 . A A .  57 LYS O    1 1 
        4  5797 1 1  58 LYS C    C   6.652  -7.970   2.699 1.00 . A A .  58 LYS C    1 1 
        4  5798 1 1  58 LYS CA   C   8.144  -7.709   2.913 1.00 . A A .  58 LYS CA   1 1 
        4  5799 1 1  58 LYS CB   C   8.799  -8.666   3.911 1.00 . A A .  58 LYS CB   1 1 
        4  5800 1 1  58 LYS CD   C   7.099 -10.344   4.720 1.00 . A A .  58 LYS CD   1 1 
        4  5801 1 1  58 LYS CE   C   7.579 -10.274   6.171 1.00 . A A .  58 LYS CE   1 1 
        4  5802 1 1  58 LYS CG   C   8.252 -10.086   3.749 1.00 . A A .  58 LYS CG   1 1 
        4  5803 1 1  58 LYS H    H   8.863  -6.212   4.172 1.00 . A A .  58 LYS H    1 1 
        4  5804 1 1  58 LYS HA   H   8.658  -7.835   1.960 1.00 . A A .  58 LYS HA   1 1 
        4  5805 1 1  58 LYS HB2  H   9.879  -8.669   3.763 1.00 . A A .  58 LYS HB2  1 1 
        4  5806 1 1  58 LYS HB3  H   8.618  -8.317   4.928 1.00 . A A .  58 LYS HB3  1 1 
        4  5807 1 1  58 LYS HD2  H   6.311  -9.608   4.558 1.00 . A A .  58 LYS HD2  1 1 
        4  5808 1 1  58 LYS HD3  H   6.665 -11.324   4.523 1.00 . A A .  58 LYS HD3  1 1 
        4  5809 1 1  58 LYS HE2  H   8.580  -9.845   6.209 1.00 . A A .  58 LYS HE2  1 1 
        4  5810 1 1  58 LYS HE3  H   6.927  -9.615   6.745 1.00 . A A .  58 LYS HE3  1 1 
        4  5811 1 1  58 LYS HG2  H   7.910 -10.232   2.724 1.00 . A A .  58 LYS HG2  1 1 
        4  5812 1 1  58 LYS HG3  H   9.049 -10.808   3.924 1.00 . A A .  58 LYS HG3  1 1 
        4  5813 1 1  58 LYS HZ1  H   6.926 -11.657   7.528 1.00 . A A .  58 LYS HZ1  1 1 
        4  5814 1 1  58 LYS HZ2  H   7.342 -12.303   6.087 1.00 . A A .  58 LYS HZ2  1 1 
        4  5815 1 1  58 LYS HZ3  H   8.501 -11.824   7.133 1.00 . A A .  58 LYS HZ3  1 1 
        4  5816 1 1  58 LYS N    N   8.334  -6.330   3.331 1.00 . A A .  58 LYS N    1 1 
        4  5817 1 1  58 LYS NZ   N   7.588 -11.624   6.779 1.00 . A A .  58 LYS NZ   1 1 
        4  5818 1 1  58 LYS O    O   6.256  -8.519   1.672 1.00 . A A .  58 LYS O    1 1 
        4  5819 1 1  59 LEU C    C   3.900  -7.148   2.311 1.00 . A A .  59 LEU C    1 1 
        4  5820 1 1  59 LEU CA   C   4.425  -7.749   3.616 1.00 . A A .  59 LEU CA   1 1 
        4  5821 1 1  59 LEU CB   C   3.753  -7.183   4.868 1.00 . A A .  59 LEU CB   1 1 
        4  5822 1 1  59 LEU CD1  C   3.526  -7.080   7.378 1.00 . A A .  59 LEU CD1  1 1 
        4  5823 1 1  59 LEU CD2  C   3.946  -9.300   6.225 1.00 . A A .  59 LEU CD2  1 1 
        4  5824 1 1  59 LEU CG   C   4.196  -7.791   6.201 1.00 . A A .  59 LEU CG   1 1 
        4  5825 1 1  59 LEU H    H   6.195  -7.120   4.516 1.00 . A A .  59 LEU H    1 1 
        4  5826 1 1  59 LEU HA   H   4.233  -8.822   3.604 1.00 . A A .  59 LEU HA   1 1 
        4  5827 1 1  59 LEU HB2  H   3.937  -6.109   4.902 1.00 . A A .  59 LEU HB2  1 1 
        4  5828 1 1  59 LEU HB3  H   2.676  -7.318   4.771 1.00 . A A .  59 LEU HB3  1 1 
        4  5829 1 1  59 LEU HD11 H   4.111  -7.245   8.283 1.00 . A A .  59 LEU HD11 1 1 
        4  5830 1 1  59 LEU HD12 H   3.469  -6.011   7.172 1.00 . A A .  59 LEU HD12 1 1 
        4  5831 1 1  59 LEU HD13 H   2.520  -7.477   7.517 1.00 . A A .  59 LEU HD13 1 1 
        4  5832 1 1  59 LEU HD21 H   4.894  -9.823   6.355 1.00 . A A .  59 LEU HD21 1 1 
        4  5833 1 1  59 LEU HD22 H   3.280  -9.545   7.052 1.00 . A A .  59 LEU HD22 1 1 
        4  5834 1 1  59 LEU HD23 H   3.487  -9.608   5.286 1.00 . A A .  59 LEU HD23 1 1 
        4  5835 1 1  59 LEU HG   H   5.271  -7.641   6.304 1.00 . A A .  59 LEU HG   1 1 
        4  5836 1 1  59 LEU N    N   5.865  -7.565   3.684 1.00 . A A .  59 LEU N    1 1 
        4  5837 1 1  59 LEU O    O   3.260  -7.838   1.519 1.00 . A A .  59 LEU O    1 1 
        4  5838 1 1  60 ALA C    C   3.922  -6.083  -0.282 1.00 . A A .  60 ALA C    1 1 
        4  5839 1 1  60 ALA CA   C   3.754  -5.167   0.932 1.00 . A A .  60 ALA CA   1 1 
        4  5840 1 1  60 ALA CB   C   4.541  -3.862   0.790 1.00 . A A .  60 ALA CB   1 1 
        4  5841 1 1  60 ALA H    H   4.710  -5.314   2.777 1.00 . A A .  60 ALA H    1 1 
        4  5842 1 1  60 ALA HA   H   2.698  -4.928   1.053 1.00 . A A .  60 ALA HA   1 1 
        4  5843 1 1  60 ALA HB1  H   4.286  -3.385  -0.156 1.00 . A A .  60 ALA HB1  1 1 
        4  5844 1 1  60 ALA HB2  H   4.289  -3.195   1.614 1.00 . A A .  60 ALA HB2  1 1 
        4  5845 1 1  60 ALA HB3  H   5.609  -4.078   0.812 1.00 . A A .  60 ALA HB3  1 1 
        4  5846 1 1  60 ALA N    N   4.189  -5.868   2.127 1.00 . A A .  60 ALA N    1 1 
        4  5847 1 1  60 ALA O    O   3.029  -6.174  -1.123 1.00 . A A .  60 ALA O    1 1 
        4  5848 1 1  61 GLU C    C   4.274  -8.709  -1.550 1.00 . A A .  61 GLU C    1 1 
        4  5849 1 1  61 GLU CA   C   5.368  -7.645  -1.430 1.00 . A A .  61 GLU CA   1 1 
        4  5850 1 1  61 GLU CB   C   6.743  -8.291  -1.252 1.00 . A A .  61 GLU CB   1 1 
        4  5851 1 1  61 GLU CD   C   7.533  -5.902  -1.426 1.00 . A A .  61 GLU CD   1 1 
        4  5852 1 1  61 GLU CG   C   7.772  -7.265  -0.773 1.00 . A A .  61 GLU CG   1 1 
        4  5853 1 1  61 GLU H    H   5.793  -6.659   0.355 1.00 . A A .  61 GLU H    1 1 
        4  5854 1 1  61 GLU HA   H   5.378  -7.023  -2.325 1.00 . A A .  61 GLU HA   1 1 
        4  5855 1 1  61 GLU HB2  H   6.676  -9.107  -0.533 1.00 . A A .  61 GLU HB2  1 1 
        4  5856 1 1  61 GLU HB3  H   7.070  -8.725  -2.197 1.00 . A A .  61 GLU HB3  1 1 
        4  5857 1 1  61 GLU HG2  H   7.716  -7.167   0.311 1.00 . A A .  61 GLU HG2  1 1 
        4  5858 1 1  61 GLU HG3  H   8.777  -7.614  -1.010 1.00 . A A .  61 GLU HG3  1 1 
        4  5859 1 1  61 GLU N    N   5.072  -6.739  -0.334 1.00 . A A .  61 GLU N    1 1 
        4  5860 1 1  61 GLU O    O   3.777  -8.973  -2.643 1.00 . A A .  61 GLU O    1 1 
        4  5861 1 1  61 GLU OE1  O   7.261  -5.898  -2.646 1.00 . A A .  61 GLU OE1  1 1 
        4  5862 1 1  61 GLU OE2  O   7.628  -4.896  -0.691 1.00 . A A .  61 GLU OE2  1 1 
        4  5863 1 1  62 GLU C    C   1.594  -9.781  -0.944 1.00 . A A .  62 GLU C    1 1 
        4  5864 1 1  62 GLU CA   C   2.907 -10.320  -0.373 1.00 . A A .  62 GLU CA   1 1 
        4  5865 1 1  62 GLU CB   C   2.711 -10.847   1.050 1.00 . A A .  62 GLU CB   1 1 
        4  5866 1 1  62 GLU CD   C   4.377 -12.665   0.518 1.00 . A A .  62 GLU CD   1 1 
        4  5867 1 1  62 GLU CG   C   3.008 -12.346   1.125 1.00 . A A .  62 GLU CG   1 1 
        4  5868 1 1  62 GLU H    H   4.342  -9.071   0.476 1.00 . A A .  62 GLU H    1 1 
        4  5869 1 1  62 GLU HA   H   3.282 -11.126  -1.004 1.00 . A A .  62 GLU HA   1 1 
        4  5870 1 1  62 GLU HB2  H   3.365 -10.308   1.735 1.00 . A A .  62 GLU HB2  1 1 
        4  5871 1 1  62 GLU HB3  H   1.687 -10.660   1.373 1.00 . A A .  62 GLU HB3  1 1 
        4  5872 1 1  62 GLU HG2  H   2.982 -12.674   2.164 1.00 . A A .  62 GLU HG2  1 1 
        4  5873 1 1  62 GLU HG3  H   2.234 -12.901   0.596 1.00 . A A .  62 GLU HG3  1 1 
        4  5874 1 1  62 GLU N    N   3.932  -9.291  -0.409 1.00 . A A .  62 GLU N    1 1 
        4  5875 1 1  62 GLU O    O   1.080 -10.307  -1.930 1.00 . A A .  62 GLU O    1 1 
        4  5876 1 1  62 GLU OE1  O   5.336 -11.946   0.873 1.00 . A A .  62 GLU OE1  1 1 
        4  5877 1 1  62 GLU OE2  O   4.432 -13.620  -0.286 1.00 . A A .  62 GLU OE2  1 1 
        4  5878 1 1  63 GLN C    C  -0.187  -8.005  -2.256 1.00 . A A .  63 GLN C    1 1 
        4  5879 1 1  63 GLN CA   C  -0.155  -8.124  -0.731 1.00 . A A .  63 GLN CA   1 1 
        4  5880 1 1  63 GLN CB   C  -0.349  -6.758  -0.070 1.00 . A A .  63 GLN CB   1 1 
        4  5881 1 1  63 GLN CD   C  -2.838  -7.078   0.175 1.00 . A A .  63 GLN CD   1 1 
        4  5882 1 1  63 GLN CG   C  -1.527  -6.784   0.906 1.00 . A A .  63 GLN CG   1 1 
        4  5883 1 1  63 GLN H    H   1.513  -8.318   0.501 1.00 . A A .  63 GLN H    1 1 
        4  5884 1 1  63 GLN HA   H  -0.943  -8.798  -0.396 1.00 . A A .  63 GLN HA   1 1 
        4  5885 1 1  63 GLN HB2  H   0.561  -6.474   0.459 1.00 . A A .  63 GLN HB2  1 1 
        4  5886 1 1  63 GLN HB3  H  -0.522  -6.001  -0.835 1.00 . A A .  63 GLN HB3  1 1 
        4  5887 1 1  63 GLN HE21 H  -3.486  -5.230   0.690 1.00 . A A .  63 GLN HE21 1 1 
        4  5888 1 1  63 GLN HE22 H  -4.603  -6.175  -0.237 1.00 . A A .  63 GLN HE22 1 1 
        4  5889 1 1  63 GLN HG2  H  -1.354  -7.541   1.670 1.00 . A A .  63 GLN HG2  1 1 
        4  5890 1 1  63 GLN HG3  H  -1.599  -5.825   1.419 1.00 . A A .  63 GLN HG3  1 1 
        4  5891 1 1  63 GLN N    N   1.089  -8.739  -0.300 1.00 . A A .  63 GLN N    1 1 
        4  5892 1 1  63 GLN NE2  N  -3.715  -6.079   0.213 1.00 . A A .  63 GLN NE2  1 1 
        4  5893 1 1  63 GLN O    O  -1.225  -8.223  -2.878 1.00 . A A .  63 GLN O    1 1 
        4  5894 1 1  63 GLN OE1  O  -3.041  -8.143  -0.385 1.00 . A A .  63 GLN OE1  1 1 
        4  5895 1 1  64 GLN C    C   1.118  -8.880  -4.932 1.00 . A A .  64 GLN C    1 1 
        4  5896 1 1  64 GLN CA   C   1.081  -7.508  -4.256 1.00 . A A .  64 GLN CA   1 1 
        4  5897 1 1  64 GLN CB   C   2.315  -6.682  -4.622 1.00 . A A .  64 GLN CB   1 1 
        4  5898 1 1  64 GLN CD   C   3.436  -4.430  -4.441 1.00 . A A .  64 GLN CD   1 1 
        4  5899 1 1  64 GLN CG   C   2.173  -5.238  -4.136 1.00 . A A .  64 GLN CG   1 1 
        4  5900 1 1  64 GLN H    H   1.804  -7.483  -2.302 1.00 . A A .  64 GLN H    1 1 
        4  5901 1 1  64 GLN HA   H   0.185  -6.968  -4.564 1.00 . A A .  64 GLN HA   1 1 
        4  5902 1 1  64 GLN HB2  H   3.203  -7.133  -4.179 1.00 . A A .  64 GLN HB2  1 1 
        4  5903 1 1  64 GLN HB3  H   2.458  -6.693  -5.703 1.00 . A A .  64 GLN HB3  1 1 
        4  5904 1 1  64 GLN HE21 H   4.248  -5.141  -2.728 1.00 . A A .  64 GLN HE21 1 1 
        4  5905 1 1  64 GLN HE22 H   5.258  -4.067  -3.636 1.00 . A A .  64 GLN HE22 1 1 
        4  5906 1 1  64 GLN HG2  H   1.314  -4.772  -4.618 1.00 . A A .  64 GLN HG2  1 1 
        4  5907 1 1  64 GLN HG3  H   1.981  -5.229  -3.063 1.00 . A A .  64 GLN HG3  1 1 
        4  5908 1 1  64 GLN N    N   0.964  -7.659  -2.815 1.00 . A A .  64 GLN N    1 1 
        4  5909 1 1  64 GLN NE2  N   4.393  -4.556  -3.526 1.00 . A A .  64 GLN NE2  1 1 
        4  5910 1 1  64 GLN O    O   0.556  -9.060  -6.011 1.00 . A A .  64 GLN O    1 1 
        4  5911 1 1  64 GLN OE1  O   3.536  -3.738  -5.441 1.00 . A A .  64 GLN OE1  1 1 
        4  5912 1 1  65 ARG C    C   0.519 -11.745  -5.076 1.00 . A A .  65 ARG C    1 1 
        4  5913 1 1  65 ARG CA   C   1.905 -11.163  -4.793 1.00 . A A .  65 ARG CA   1 1 
        4  5914 1 1  65 ARG CB   C   2.642 -12.073  -3.808 1.00 . A A .  65 ARG CB   1 1 
        4  5915 1 1  65 ARG CD   C   2.917 -14.462  -3.050 1.00 . A A .  65 ARG CD   1 1 
        4  5916 1 1  65 ARG CG   C   2.004 -13.462  -3.763 1.00 . A A .  65 ARG CG   1 1 
        4  5917 1 1  65 ARG CZ   C   2.760 -16.855  -2.373 1.00 . A A .  65 ARG CZ   1 1 
        4  5918 1 1  65 ARG H    H   2.241  -9.658  -3.392 1.00 . A A .  65 ARG H    1 1 
        4  5919 1 1  65 ARG HA   H   2.481 -11.056  -5.712 1.00 . A A .  65 ARG HA   1 1 
        4  5920 1 1  65 ARG HB2  H   3.689 -12.159  -4.101 1.00 . A A .  65 ARG HB2  1 1 
        4  5921 1 1  65 ARG HB3  H   2.625 -11.628  -2.813 1.00 . A A .  65 ARG HB3  1 1 
        4  5922 1 1  65 ARG HD2  H   3.793 -14.669  -3.665 1.00 . A A .  65 ARG HD2  1 1 
        4  5923 1 1  65 ARG HD3  H   3.278 -14.035  -2.115 1.00 . A A .  65 ARG HD3  1 1 
        4  5924 1 1  65 ARG HE   H   1.189 -15.717  -2.913 1.00 . A A .  65 ARG HE   1 1 
        4  5925 1 1  65 ARG HG2  H   1.045 -13.409  -3.247 1.00 . A A .  65 ARG HG2  1 1 
        4  5926 1 1  65 ARG HG3  H   1.802 -13.807  -4.777 1.00 . A A .  65 ARG HG3  1 1 
        4  5927 1 1  65 ARG HH11 H   4.643 -16.088  -2.348 1.00 . A A .  65 ARG HH11 1 1 
        4  5928 1 1  65 ARG HH12 H   4.517 -17.751  -1.880 1.00 . A A .  65 ARG HH12 1 1 
        4  5929 1 1  65 ARG HH21 H   1.023 -17.911  -2.295 1.00 . A A .  65 ARG HH21 1 1 
        4  5930 1 1  65 ARG HH22 H   2.444 -18.795  -1.850 1.00 . A A .  65 ARG HH22 1 1 
        4  5931 1 1  65 ARG N    N   1.787  -9.812  -4.269 1.00 . A A .  65 ARG N    1 1 
        4  5932 1 1  65 ARG NE   N   2.181 -15.717  -2.782 1.00 . A A .  65 ARG NE   1 1 
        4  5933 1 1  65 ARG NH1  N   4.085 -16.902  -2.185 1.00 . A A .  65 ARG NH1  1 1 
        4  5934 1 1  65 ARG NH2  N   2.013 -17.946  -2.154 1.00 . A A .  65 ARG NH2  1 1 
        4  5935 1 1  65 ARG O    O   0.239 -12.175  -6.194 1.00 . A A .  65 ARG O    1 1 
        4  5936 1 1  66 GLN C    C  -2.455 -11.450  -5.190 1.00 . A A .  66 GLN C    1 1 
        4  5937 1 1  66 GLN CA   C  -1.661 -12.265  -4.167 1.00 . A A .  66 GLN CA   1 1 
        4  5938 1 1  66 GLN CB   C  -2.369 -12.281  -2.811 1.00 . A A .  66 GLN CB   1 1 
        4  5939 1 1  66 GLN CD   C  -1.035 -12.274  -0.671 1.00 . A A .  66 GLN CD   1 1 
        4  5940 1 1  66 GLN CG   C  -1.601 -13.136  -1.801 1.00 . A A .  66 GLN CG   1 1 
        4  5941 1 1  66 GLN H    H  -0.076 -11.391  -3.137 1.00 . A A .  66 GLN H    1 1 
        4  5942 1 1  66 GLN HA   H  -1.544 -13.289  -4.521 1.00 . A A .  66 GLN HA   1 1 
        4  5943 1 1  66 GLN HB2  H  -2.463 -11.263  -2.433 1.00 . A A .  66 GLN HB2  1 1 
        4  5944 1 1  66 GLN HB3  H  -3.380 -12.672  -2.929 1.00 . A A .  66 GLN HB3  1 1 
        4  5945 1 1  66 GLN HE21 H   0.173 -13.817  -0.163 1.00 . A A .  66 GLN HE21 1 1 
        4  5946 1 1  66 GLN HE22 H   0.332 -12.397   0.817 1.00 . A A .  66 GLN HE22 1 1 
        4  5947 1 1  66 GLN HG2  H  -2.262 -13.897  -1.387 1.00 . A A .  66 GLN HG2  1 1 
        4  5948 1 1  66 GLN HG3  H  -0.789 -13.659  -2.306 1.00 . A A .  66 GLN HG3  1 1 
        4  5949 1 1  66 GLN N    N  -0.311 -11.742  -4.043 1.00 . A A .  66 GLN N    1 1 
        4  5950 1 1  66 GLN NE2  N  -0.099 -12.879   0.055 1.00 . A A .  66 GLN NE2  1 1 
        4  5951 1 1  66 GLN O    O  -3.110 -12.014  -6.065 1.00 . A A .  66 GLN O    1 1 
        4  5952 1 1  66 GLN OE1  O  -1.423 -11.134  -0.471 1.00 . A A .  66 GLN OE1  1 1 
        4  5953 1 1  67 TYR C    C  -2.877  -9.659  -7.405 1.00 . A A .  67 TYR C    1 1 
        4  5954 1 1  67 TYR CA   C  -3.072  -9.237  -5.947 1.00 . A A .  67 TYR CA   1 1 
        4  5955 1 1  67 TYR CB   C  -2.444  -7.857  -5.740 1.00 . A A .  67 TYR CB   1 1 
        4  5956 1 1  67 TYR CD1  C  -4.170  -6.144  -6.406 1.00 . A A .  67 TYR CD1  1 1 
        4  5957 1 1  67 TYR CD2  C  -2.271  -6.449  -7.825 1.00 . A A .  67 TYR CD2  1 1 
        4  5958 1 1  67 TYR CE1  C  -4.674  -5.132  -7.298 1.00 . A A .  67 TYR CE1  1 1 
        4  5959 1 1  67 TYR CE2  C  -2.774  -5.437  -8.717 1.00 . A A .  67 TYR CE2  1 1 
        4  5960 1 1  67 TYR CG   C  -2.979  -6.782  -6.688 1.00 . A A .  67 TYR CG   1 1 
        4  5961 1 1  67 TYR CZ   C  -3.951  -4.828  -8.409 1.00 . A A .  67 TYR CZ   1 1 
        4  5962 1 1  67 TYR H    H  -1.834  -9.684  -4.332 1.00 . A A .  67 TYR H    1 1 
        4  5963 1 1  67 TYR HA   H  -4.133  -9.278  -5.704 1.00 . A A .  67 TYR HA   1 1 
        4  5964 1 1  67 TYR HB2  H  -2.619  -7.540  -4.712 1.00 . A A .  67 TYR HB2  1 1 
        4  5965 1 1  67 TYR HB3  H  -1.365  -7.937  -5.870 1.00 . A A .  67 TYR HB3  1 1 
        4  5966 1 1  67 TYR HD1  H  -4.730  -6.407  -5.508 1.00 . A A .  67 TYR HD1  1 1 
        4  5967 1 1  67 TYR HD2  H  -1.330  -6.953  -8.047 1.00 . A A .  67 TYR HD2  1 1 
        4  5968 1 1  67 TYR HE1  H  -5.613  -4.620  -7.087 1.00 . A A .  67 TYR HE1  1 1 
        4  5969 1 1  67 TYR HE2  H  -2.225  -5.165  -9.618 1.00 . A A .  67 TYR HE2  1 1 
        4  5970 1 1  67 TYR HH   H  -5.141  -3.340  -8.797 1.00 . A A .  67 TYR HH   1 1 
        4  5971 1 1  67 TYR N    N  -2.370 -10.135  -5.047 1.00 . A A .  67 TYR N    1 1 
        4  5972 1 1  67 TYR O    O  -3.845  -9.793  -8.151 1.00 . A A .  67 TYR O    1 1 
        4  5973 1 1  67 TYR OH   O  -4.427  -3.872  -9.252 1.00 . A A .  67 TYR OH   1 1 
        4  5974 1 1  68 LYS C    C  -2.050 -11.538  -9.472 1.00 . A A .  68 LYS C    1 1 
        4  5975 1 1  68 LYS CA   C  -1.283 -10.262  -9.122 1.00 . A A .  68 LYS CA   1 1 
        4  5976 1 1  68 LYS CB   C   0.233 -10.390  -9.284 1.00 . A A .  68 LYS CB   1 1 
        4  5977 1 1  68 LYS CD   C   1.764  -8.437  -9.728 1.00 . A A .  68 LYS CD   1 1 
        4  5978 1 1  68 LYS CE   C   1.850  -6.946  -9.396 1.00 . A A .  68 LYS CE   1 1 
        4  5979 1 1  68 LYS CG   C   0.954  -9.188  -8.670 1.00 . A A .  68 LYS CG   1 1 
        4  5980 1 1  68 LYS H    H  -0.835  -9.746  -7.154 1.00 . A A .  68 LYS H    1 1 
        4  5981 1 1  68 LYS HA   H  -1.612  -9.466  -9.791 1.00 . A A .  68 LYS HA   1 1 
        4  5982 1 1  68 LYS HB2  H   0.577 -11.308  -8.806 1.00 . A A .  68 LYS HB2  1 1 
        4  5983 1 1  68 LYS HB3  H   0.484 -10.469 -10.341 1.00 . A A .  68 LYS HB3  1 1 
        4  5984 1 1  68 LYS HD2  H   2.768  -8.857  -9.790 1.00 . A A .  68 LYS HD2  1 1 
        4  5985 1 1  68 LYS HD3  H   1.303  -8.569 -10.707 1.00 . A A .  68 LYS HD3  1 1 
        4  5986 1 1  68 LYS HE2  H   1.431  -6.360 -10.215 1.00 . A A .  68 LYS HE2  1 1 
        4  5987 1 1  68 LYS HE3  H   1.252  -6.729  -8.511 1.00 . A A .  68 LYS HE3  1 1 
        4  5988 1 1  68 LYS HG2  H   0.226  -8.515  -8.218 1.00 . A A .  68 LYS HG2  1 1 
        4  5989 1 1  68 LYS HG3  H   1.615  -9.525  -7.872 1.00 . A A .  68 LYS HG3  1 1 
        4  5990 1 1  68 LYS HZ1  H   3.445  -6.554  -8.180 1.00 . A A .  68 LYS HZ1  1 1 
        4  5991 1 1  68 LYS HZ2  H   3.866  -7.190  -9.624 1.00 . A A .  68 LYS HZ2  1 1 
        4  5992 1 1  68 LYS HZ3  H   3.405  -5.626  -9.523 1.00 . A A .  68 LYS HZ3  1 1 
        4  5993 1 1  68 LYS N    N  -1.617  -9.857  -7.767 1.00 . A A .  68 LYS N    1 1 
        4  5994 1 1  68 LYS NZ   N   3.255  -6.546  -9.162 1.00 . A A .  68 LYS NZ   1 1 
        4  5995 1 1  68 LYS O    O  -2.391 -11.763 -10.632 1.00 . A A .  68 LYS O    1 1 
        4  5996 1 1  69 VAL C    C  -4.522 -13.310  -8.641 1.00 . A A .  69 VAL C    1 1 
        4  5997 1 1  69 VAL CA   C  -3.018 -13.590  -8.633 1.00 . A A .  69 VAL CA   1 1 
        4  5998 1 1  69 VAL CB   C  -2.603 -14.597  -7.559 1.00 . A A .  69 VAL CB   1 1 
        4  5999 1 1  69 VAL CG1  C  -3.630 -15.725  -7.440 1.00 . A A .  69 VAL CG1  1 1 
        4  6000 1 1  69 VAL CG2  C  -1.206 -15.155  -7.840 1.00 . A A .  69 VAL CG2  1 1 
        4  6001 1 1  69 VAL H    H  -2.017 -12.151  -7.507 1.00 . A A .  69 VAL H    1 1 
        4  6002 1 1  69 VAL HA   H  -2.731 -13.994  -9.604 1.00 . A A .  69 VAL HA   1 1 
        4  6003 1 1  69 VAL HB   H  -2.568 -14.074  -6.604 1.00 . A A .  69 VAL HB   1 1 
        4  6004 1 1  69 VAL HG11 H  -3.624 -16.321  -8.353 1.00 . A A .  69 VAL HG11 1 1 
        4  6005 1 1  69 VAL HG12 H  -3.376 -16.360  -6.591 1.00 . A A .  69 VAL HG12 1 1 
        4  6006 1 1  69 VAL HG13 H  -4.622 -15.299  -7.291 1.00 . A A .  69 VAL HG13 1 1 
        4  6007 1 1  69 VAL HG21 H  -0.826 -15.651  -6.947 1.00 . A A .  69 VAL HG21 1 1 
        4  6008 1 1  69 VAL HG22 H  -1.260 -15.872  -8.659 1.00 . A A .  69 VAL HG22 1 1 
        4  6009 1 1  69 VAL HG23 H  -0.538 -14.339  -8.115 1.00 . A A .  69 VAL HG23 1 1 
        4  6010 1 1  69 VAL N    N  -2.298 -12.341  -8.448 1.00 . A A .  69 VAL N    1 1 
        4  6011 1 1  69 VAL O    O  -5.211 -13.625  -9.610 1.00 . A A .  69 VAL O    1 1 
        4  6012 1 1  70 HIS C    C  -6.886 -11.705  -8.695 1.00 . A A .  70 HIS C    1 1 
        4  6013 1 1  70 HIS CA   C  -6.398 -12.395  -7.419 1.00 . A A .  70 HIS CA   1 1 
        4  6014 1 1  70 HIS CB   C  -6.648 -11.560  -6.161 1.00 . A A .  70 HIS CB   1 1 
        4  6015 1 1  70 HIS CD2  C  -5.685 -13.331  -4.497 1.00 . A A .  70 HIS CD2  1 1 
        4  6016 1 1  70 HIS CE1  C  -7.059 -12.974  -2.833 1.00 . A A .  70 HIS CE1  1 1 
        4  6017 1 1  70 HIS CG   C  -6.547 -12.343  -4.874 1.00 . A A .  70 HIS CG   1 1 
        4  6018 1 1  70 HIS H    H  -4.421 -12.467  -6.766 1.00 . A A .  70 HIS H    1 1 
        4  6019 1 1  70 HIS HA   H  -6.928 -13.340  -7.301 1.00 . A A .  70 HIS HA   1 1 
        4  6020 1 1  70 HIS HB2  H  -5.930 -10.740  -6.133 1.00 . A A .  70 HIS HB2  1 1 
        4  6021 1 1  70 HIS HB3  H  -7.640 -11.113  -6.226 1.00 . A A .  70 HIS HB3  1 1 
        4  6022 1 1  70 HIS HD1  H  -8.150 -11.478  -3.771 1.00 . A A .  70 HIS HD1  1 1 
        4  6023 1 1  70 HIS HD2  H  -4.878 -13.739  -5.106 1.00 . A A .  70 HIS HD2  1 1 
        4  6024 1 1  70 HIS HE1  H  -7.543 -13.056  -1.859 1.00 . A A .  70 HIS HE1  1 1 
        4  6025 1 1  70 HIS N    N  -4.988 -12.721  -7.550 1.00 . A A .  70 HIS N    1 1 
        4  6026 1 1  70 HIS ND1  N  -7.401 -12.141  -3.804 1.00 . A A .  70 HIS ND1  1 1 
        4  6027 1 1  70 HIS NE2  N  -5.995 -13.710  -3.264 1.00 . A A .  70 HIS NE2  1 1 
        4  6028 1 1  70 HIS O    O  -7.898 -12.102  -9.271 1.00 . A A .  70 HIS O    1 1 
        4  6029 1 1  71 LEU C    C  -6.780 -10.914 -11.437 1.00 . A A .  71 LEU C    1 1 
        4  6030 1 1  71 LEU CA   C  -6.487  -9.937 -10.296 1.00 . A A .  71 LEU CA   1 1 
        4  6031 1 1  71 LEU CB   C  -5.394  -8.919 -10.624 1.00 . A A .  71 LEU CB   1 1 
        4  6032 1 1  71 LEU CD1  C  -6.787  -6.820 -10.734 1.00 . A A .  71 LEU CD1  1 1 
        4  6033 1 1  71 LEU CD2  C  -4.602  -6.969 -12.014 1.00 . A A .  71 LEU CD2  1 1 
        4  6034 1 1  71 LEU CG   C  -5.820  -7.732 -11.491 1.00 . A A .  71 LEU CG   1 1 
        4  6035 1 1  71 LEU H    H  -5.321 -10.369  -8.625 1.00 . A A .  71 LEU H    1 1 
        4  6036 1 1  71 LEU HA   H  -7.396  -9.376 -10.080 1.00 . A A .  71 LEU HA   1 1 
        4  6037 1 1  71 LEU HB2  H  -4.992  -8.532  -9.688 1.00 . A A .  71 LEU HB2  1 1 
        4  6038 1 1  71 LEU HB3  H  -4.580  -9.439 -11.130 1.00 . A A .  71 LEU HB3  1 1 
        4  6039 1 1  71 LEU HD11 H  -6.421  -6.665  -9.719 1.00 . A A .  71 LEU HD11 1 1 
        4  6040 1 1  71 LEU HD12 H  -6.857  -5.860 -11.246 1.00 . A A .  71 LEU HD12 1 1 
        4  6041 1 1  71 LEU HD13 H  -7.773  -7.284 -10.698 1.00 . A A .  71 LEU HD13 1 1 
        4  6042 1 1  71 LEU HD21 H  -4.142  -7.531 -12.827 1.00 . A A .  71 LEU HD21 1 1 
        4  6043 1 1  71 LEU HD22 H  -4.915  -5.991 -12.380 1.00 . A A .  71 LEU HD22 1 1 
        4  6044 1 1  71 LEU HD23 H  -3.880  -6.841 -11.207 1.00 . A A .  71 LEU HD23 1 1 
        4  6045 1 1  71 LEU HG   H  -6.355  -8.118 -12.359 1.00 . A A .  71 LEU HG   1 1 
        4  6046 1 1  71 LEU N    N  -6.143 -10.685  -9.099 1.00 . A A .  71 LEU N    1 1 
        4  6047 1 1  71 LEU O    O  -7.742 -10.734 -12.182 1.00 . A A .  71 LEU O    1 1 
        4  6048 1 1  72 ASP C    C  -7.355 -13.746 -12.304 1.00 . A A .  72 ASP C    1 1 
        4  6049 1 1  72 ASP CA   C  -6.087 -12.933 -12.574 1.00 . A A .  72 ASP CA   1 1 
        4  6050 1 1  72 ASP CB   C  -4.900 -13.899 -12.587 1.00 . A A .  72 ASP CB   1 1 
        4  6051 1 1  72 ASP CG   C  -4.059 -13.871 -13.865 1.00 . A A .  72 ASP CG   1 1 
        4  6052 1 1  72 ASP H    H  -5.152 -12.067 -10.927 1.00 . A A .  72 ASP H    1 1 
        4  6053 1 1  72 ASP HA   H  -6.141 -12.375 -13.509 1.00 . A A .  72 ASP HA   1 1 
        4  6054 1 1  72 ASP HB2  H  -4.255 -13.669 -11.740 1.00 . A A .  72 ASP HB2  1 1 
        4  6055 1 1  72 ASP HB3  H  -5.274 -14.912 -12.438 1.00 . A A .  72 ASP HB3  1 1 
        4  6056 1 1  72 ASP N    N  -5.932 -11.928 -11.537 1.00 . A A .  72 ASP N    1 1 
        4  6057 1 1  72 ASP O    O  -8.121 -14.031 -13.223 1.00 . A A .  72 ASP O    1 1 
        4  6058 1 1  72 ASP OD1  O  -3.258 -12.920 -13.996 1.00 . A A .  72 ASP OD1  1 1 
        4  6059 1 1  72 ASP OD2  O  -4.235 -14.802 -14.680 1.00 . A A .  72 ASP OD2  1 1 
        4  6060 1 1  73 LEU C    C  -9.968 -14.071 -10.934 1.00 . A A .  73 LEU C    1 1 
        4  6061 1 1  73 LEU CA   C  -8.698 -14.871 -10.637 1.00 . A A .  73 LEU CA   1 1 
        4  6062 1 1  73 LEU CB   C  -8.573 -15.305  -9.175 1.00 . A A .  73 LEU CB   1 1 
        4  6063 1 1  73 LEU CD1  C  -7.325 -16.537  -7.363 1.00 . A A .  73 LEU CD1  1 1 
        4  6064 1 1  73 LEU CD2  C  -6.870 -17.056  -9.804 1.00 . A A .  73 LEU CD2  1 1 
        4  6065 1 1  73 LEU CG   C  -7.256 -15.981  -8.786 1.00 . A A .  73 LEU CG   1 1 
        4  6066 1 1  73 LEU H    H  -6.909 -13.861 -10.298 1.00 . A A .  73 LEU H    1 1 
        4  6067 1 1  73 LEU HA   H  -8.712 -15.778 -11.242 1.00 . A A .  73 LEU HA   1 1 
        4  6068 1 1  73 LEU HB2  H  -8.708 -14.427  -8.543 1.00 . A A .  73 LEU HB2  1 1 
        4  6069 1 1  73 LEU HB3  H  -9.390 -15.989  -8.948 1.00 . A A .  73 LEU HB3  1 1 
        4  6070 1 1  73 LEU HD11 H  -6.887 -15.819  -6.670 1.00 . A A .  73 LEU HD11 1 1 
        4  6071 1 1  73 LEU HD12 H  -8.366 -16.715  -7.092 1.00 . A A .  73 LEU HD12 1 1 
        4  6072 1 1  73 LEU HD13 H  -6.771 -17.475  -7.312 1.00 . A A .  73 LEU HD13 1 1 
        4  6073 1 1  73 LEU HD21 H  -7.552 -17.901  -9.715 1.00 . A A .  73 LEU HD21 1 1 
        4  6074 1 1  73 LEU HD22 H  -6.933 -16.642 -10.811 1.00 . A A .  73 LEU HD22 1 1 
        4  6075 1 1  73 LEU HD23 H  -5.851 -17.389  -9.611 1.00 . A A .  73 LEU HD23 1 1 
        4  6076 1 1  73 LEU HG   H  -6.469 -15.227  -8.799 1.00 . A A .  73 LEU HG   1 1 
        4  6077 1 1  73 LEU N    N  -7.537 -14.097 -11.039 1.00 . A A .  73 LEU N    1 1 
        4  6078 1 1  73 LEU O    O -11.008 -14.645 -11.253 1.00 . A A .  73 LEU O    1 1 
        4  6079 1 1  74 TRP C    C -11.246 -11.881 -12.576 1.00 . A A .  74 TRP C    1 1 
        4  6080 1 1  74 TRP CA   C -10.965 -11.871 -11.072 1.00 . A A .  74 TRP CA   1 1 
        4  6081 1 1  74 TRP CB   C -10.692 -10.469 -10.524 1.00 . A A .  74 TRP CB   1 1 
        4  6082 1 1  74 TRP CD1  C -12.790  -8.983 -10.751 1.00 . A A .  74 TRP CD1  1 1 
        4  6083 1 1  74 TRP CD2  C -11.244  -8.553 -12.279 1.00 . A A .  74 TRP CD2  1 1 
        4  6084 1 1  74 TRP CE2  C -12.302  -7.699 -12.511 1.00 . A A .  74 TRP CE2  1 1 
        4  6085 1 1  74 TRP CE3  C -10.093  -8.530 -13.085 1.00 . A A .  74 TRP CE3  1 1 
        4  6086 1 1  74 TRP CG   C -11.570  -9.378 -11.140 1.00 . A A .  74 TRP CG   1 1 
        4  6087 1 1  74 TRP CH2  C -11.178  -6.717 -14.364 1.00 . A A .  74 TRP CH2  1 1 
        4  6088 1 1  74 TRP CZ2  C -12.314  -6.758 -13.548 1.00 . A A .  74 TRP CZ2  1 1 
        4  6089 1 1  74 TRP CZ3  C -10.121  -7.585 -14.117 1.00 . A A .  74 TRP CZ3  1 1 
        4  6090 1 1  74 TRP H    H  -8.991 -12.298 -10.560 1.00 . A A .  74 TRP H    1 1 
        4  6091 1 1  74 TRP HA   H -11.826 -12.263 -10.529 1.00 . A A .  74 TRP HA   1 1 
        4  6092 1 1  74 TRP HB2  H -10.844 -10.476  -9.444 1.00 . A A .  74 TRP HB2  1 1 
        4  6093 1 1  74 TRP HB3  H  -9.646 -10.220 -10.696 1.00 . A A .  74 TRP HB3  1 1 
        4  6094 1 1  74 TRP HD1  H -13.334  -9.410  -9.909 1.00 . A A .  74 TRP HD1  1 1 
        4  6095 1 1  74 TRP HE1  H -14.236  -7.470 -11.453 1.00 . A A .  74 TRP HE1  1 1 
        4  6096 1 1  74 TRP HE3  H  -9.244  -9.195 -12.923 1.00 . A A .  74 TRP HE3  1 1 
        4  6097 1 1  74 TRP HH2  H -11.123  -6.008 -15.190 1.00 . A A .  74 TRP HH2  1 1 
        4  6098 1 1  74 TRP HZ2  H -13.163  -6.093 -13.710 1.00 . A A .  74 TRP HZ2  1 1 
        4  6099 1 1  74 TRP HZ3  H  -9.252  -7.525 -14.773 1.00 . A A .  74 TRP HZ3  1 1 
        4  6100 1 1  74 TRP N    N  -9.841 -12.757 -10.819 1.00 . A A .  74 TRP N    1 1 
        4  6101 1 1  74 TRP NE1  N -13.272  -7.968 -11.553 1.00 . A A .  74 TRP NE1  1 1 
        4  6102 1 1  74 TRP O    O -12.385 -11.693 -12.999 1.00 . A A .  74 TRP O    1 1 
        4  6103 1 1  75 VAL C    C -11.010 -13.432 -15.206 1.00 . A A .  75 VAL C    1 1 
        4  6104 1 1  75 VAL CA   C -10.306 -12.139 -14.789 1.00 . A A .  75 VAL CA   1 1 
        4  6105 1 1  75 VAL CB   C  -8.927 -11.975 -15.432 1.00 . A A .  75 VAL CB   1 1 
        4  6106 1 1  75 VAL CG1  C  -8.974 -12.310 -16.924 1.00 . A A .  75 VAL CG1  1 1 
        4  6107 1 1  75 VAL CG2  C  -8.381 -10.564 -15.204 1.00 . A A .  75 VAL CG2  1 1 
        4  6108 1 1  75 VAL H    H  -9.264 -12.255 -12.989 1.00 . A A .  75 VAL H    1 1 
        4  6109 1 1  75 VAL HA   H -10.922 -11.292 -15.090 1.00 . A A .  75 VAL HA   1 1 
        4  6110 1 1  75 VAL HB   H  -8.248 -12.678 -14.951 1.00 . A A .  75 VAL HB   1 1 
        4  6111 1 1  75 VAL HG11 H  -7.983 -12.175 -17.357 1.00 . A A .  75 VAL HG11 1 1 
        4  6112 1 1  75 VAL HG12 H  -9.289 -13.346 -17.053 1.00 . A A .  75 VAL HG12 1 1 
        4  6113 1 1  75 VAL HG13 H  -9.682 -11.649 -17.423 1.00 . A A .  75 VAL HG13 1 1 
        4  6114 1 1  75 VAL HG21 H  -8.060 -10.140 -16.156 1.00 . A A .  75 VAL HG21 1 1 
        4  6115 1 1  75 VAL HG22 H  -9.162  -9.937 -14.772 1.00 . A A .  75 VAL HG22 1 1 
        4  6116 1 1  75 VAL HG23 H  -7.533 -10.608 -14.521 1.00 . A A .  75 VAL HG23 1 1 
        4  6117 1 1  75 VAL N    N -10.188 -12.103 -13.342 1.00 . A A .  75 VAL N    1 1 
        4  6118 1 1  75 VAL O    O -11.939 -13.406 -16.012 1.00 . A A .  75 VAL O    1 1 
        4  6119 1 1  76 LYS C    C -12.625 -15.786 -14.718 1.00 . A A .  76 LYS C    1 1 
        4  6120 1 1  76 LYS CA   C -11.112 -15.834 -14.942 1.00 . A A .  76 LYS CA   1 1 
        4  6121 1 1  76 LYS CB   C -10.407 -16.930 -14.140 1.00 . A A .  76 LYS CB   1 1 
        4  6122 1 1  76 LYS CD   C  -8.157 -17.871 -13.495 1.00 . A A .  76 LYS CD   1 1 
        4  6123 1 1  76 LYS CE   C  -8.532 -19.345 -13.660 1.00 . A A .  76 LYS CE   1 1 
        4  6124 1 1  76 LYS CG   C  -8.919 -16.996 -14.492 1.00 . A A .  76 LYS CG   1 1 
        4  6125 1 1  76 LYS H    H  -9.784 -14.546 -13.984 1.00 . A A .  76 LYS H    1 1 
        4  6126 1 1  76 LYS HA   H -10.925 -16.036 -15.997 1.00 . A A .  76 LYS HA   1 1 
        4  6127 1 1  76 LYS HB2  H -10.523 -16.738 -13.073 1.00 . A A .  76 LYS HB2  1 1 
        4  6128 1 1  76 LYS HB3  H -10.875 -17.893 -14.343 1.00 . A A .  76 LYS HB3  1 1 
        4  6129 1 1  76 LYS HD2  H  -7.085 -17.746 -13.641 1.00 . A A .  76 LYS HD2  1 1 
        4  6130 1 1  76 LYS HD3  H  -8.380 -17.547 -12.478 1.00 . A A .  76 LYS HD3  1 1 
        4  6131 1 1  76 LYS HE2  H  -8.747 -19.784 -12.686 1.00 . A A .  76 LYS HE2  1 1 
        4  6132 1 1  76 LYS HE3  H  -9.441 -19.430 -14.256 1.00 . A A .  76 LYS HE3  1 1 
        4  6133 1 1  76 LYS HG2  H  -8.798 -17.396 -15.499 1.00 . A A .  76 LYS HG2  1 1 
        4  6134 1 1  76 LYS HG3  H  -8.498 -15.991 -14.496 1.00 . A A .  76 LYS HG3  1 1 
        4  6135 1 1  76 LYS HZ1  H  -7.096 -20.799 -13.696 1.00 . A A .  76 LYS HZ1  1 1 
        4  6136 1 1  76 LYS HZ2  H  -7.770 -20.512 -15.155 1.00 . A A .  76 LYS HZ2  1 1 
        4  6137 1 1  76 LYS HZ3  H  -6.688 -19.458 -14.534 1.00 . A A .  76 LYS HZ3  1 1 
        4  6138 1 1  76 LYS N    N -10.540 -14.534 -14.639 1.00 . A A .  76 LYS N    1 1 
        4  6139 1 1  76 LYS NZ   N  -7.433 -20.089 -14.314 1.00 . A A .  76 LYS NZ   1 1 
        4  6140 1 1  76 LYS O    O -13.362 -16.611 -15.255 1.00 . A A .  76 LYS O    1 1 
        4  6141 1 1  77 SER C    C -15.088 -13.664 -14.613 1.00 . A A .  77 SER C    1 1 
        4  6142 1 1  77 SER CA   C -14.454 -14.643 -13.623 1.00 . A A .  77 SER CA   1 1 
        4  6143 1 1  77 SER CB   C -14.657 -14.153 -12.188 1.00 . A A .  77 SER CB   1 1 
        4  6144 1 1  77 SER H    H -12.436 -14.143 -13.492 1.00 . A A .  77 SER H    1 1 
        4  6145 1 1  77 SER HA   H -14.892 -15.635 -13.733 1.00 . A A .  77 SER HA   1 1 
        4  6146 1 1  77 SER HB2  H -13.725 -14.263 -11.633 1.00 . A A .  77 SER HB2  1 1 
        4  6147 1 1  77 SER HB3  H -14.898 -13.091 -12.199 1.00 . A A .  77 SER HB3  1 1 
        4  6148 1 1  77 SER HG   H -16.545 -14.801 -12.041 1.00 . A A .  77 SER HG   1 1 
        4  6149 1 1  77 SER N    N -13.042 -14.810 -13.925 1.00 . A A .  77 SER N    1 1 
        4  6150 1 1  77 SER O    O -16.283 -13.744 -14.892 1.00 . A A .  77 SER O    1 1 
        4  6151 1 1  77 SER OG   O -15.693 -14.869 -11.521 1.00 . A A .  77 SER OG   1 1 
        4  6152 1 1  78 LEU C    C -15.413 -12.473 -17.240 1.00 . A A .  78 LEU C    1 1 
        4  6153 1 1  78 LEU CA   C -14.724 -11.768 -16.070 1.00 . A A .  78 LEU CA   1 1 
        4  6154 1 1  78 LEU CB   C -13.573 -10.854 -16.495 1.00 . A A .  78 LEU CB   1 1 
        4  6155 1 1  78 LEU CD1  C -12.248  -8.739 -16.135 1.00 . A A .  78 LEU CD1  1 1 
        4  6156 1 1  78 LEU CD2  C -14.390  -9.140 -14.836 1.00 . A A .  78 LEU CD2  1 1 
        4  6157 1 1  78 LEU CG   C -13.162  -9.780 -15.486 1.00 . A A .  78 LEU CG   1 1 
        4  6158 1 1  78 LEU H    H -13.288 -12.704 -14.886 1.00 . A A .  78 LEU H    1 1 
        4  6159 1 1  78 LEU HA   H -15.459 -11.146 -15.560 1.00 . A A .  78 LEU HA   1 1 
        4  6160 1 1  78 LEU HB2  H -12.703 -11.474 -16.711 1.00 . A A .  78 LEU HB2  1 1 
        4  6161 1 1  78 LEU HB3  H -13.851 -10.361 -17.427 1.00 . A A .  78 LEU HB3  1 1 
        4  6162 1 1  78 LEU HD11 H -12.241  -8.884 -17.215 1.00 . A A .  78 LEU HD11 1 1 
        4  6163 1 1  78 LEU HD12 H -12.615  -7.739 -15.905 1.00 . A A .  78 LEU HD12 1 1 
        4  6164 1 1  78 LEU HD13 H -11.235  -8.852 -15.747 1.00 . A A .  78 LEU HD13 1 1 
        4  6165 1 1  78 LEU HD21 H -14.663  -9.702 -13.943 1.00 . A A .  78 LEU HD21 1 1 
        4  6166 1 1  78 LEU HD22 H -14.160  -8.110 -14.561 1.00 . A A .  78 LEU HD22 1 1 
        4  6167 1 1  78 LEU HD23 H -15.221  -9.150 -15.541 1.00 . A A .  78 LEU HD23 1 1 
        4  6168 1 1  78 LEU HG   H -12.590 -10.260 -14.691 1.00 . A A .  78 LEU HG   1 1 
        4  6169 1 1  78 LEU N    N -14.259 -12.762 -15.117 1.00 . A A .  78 LEU N    1 1 
        4  6170 1 1  78 LEU O    O -14.826 -13.346 -17.877 1.00 . A A .  78 LEU O    1 1 
        4  6171 1 1  79 SER C    C -16.615 -12.625 -19.867 1.00 . A A .  79 SER C    1 1 
        4  6172 1 1  79 SER CA   C -17.426 -12.650 -18.570 1.00 . A A .  79 SER CA   1 1 
        4  6173 1 1  79 SER CB   C -18.751 -11.908 -18.758 1.00 . A A .  79 SER CB   1 1 
        4  6174 1 1  79 SER H    H -17.121 -11.357 -16.965 1.00 . A A .  79 SER H    1 1 
        4  6175 1 1  79 SER HA   H -17.625 -13.676 -18.263 1.00 . A A .  79 SER HA   1 1 
        4  6176 1 1  79 SER HB2  H -18.845 -11.134 -17.996 1.00 . A A .  79 SER HB2  1 1 
        4  6177 1 1  79 SER HB3  H -18.751 -11.405 -19.725 1.00 . A A .  79 SER HB3  1 1 
        4  6178 1 1  79 SER HG   H -20.612 -12.352 -18.171 1.00 . A A .  79 SER HG   1 1 
        4  6179 1 1  79 SER N    N -16.650 -12.068 -17.488 1.00 . A A .  79 SER N    1 1 
        4  6180 1 1  79 SER O    O -15.480 -12.151 -19.885 1.00 . A A .  79 SER O    1 1 
        4  6181 1 1  79 SER OG   O -19.870 -12.787 -18.681 1.00 . A A .  79 SER OG   1 1 
        4  6182 1 1  80 PRO C    C -16.573 -11.814 -22.897 1.00 . A A .  80 PRO C    1 1 
        4  6183 1 1  80 PRO CA   C -16.594 -13.200 -22.247 1.00 . A A .  80 PRO CA   1 1 
        4  6184 1 1  80 PRO CB   C -17.385 -14.220 -23.050 1.00 . A A .  80 PRO CB   1 1 
        4  6185 1 1  80 PRO CD   C -18.588 -13.727 -20.965 1.00 . A A .  80 PRO CD   1 1 
        4  6186 1 1  80 PRO CG   C -18.720 -14.366 -22.338 1.00 . A A .  80 PRO CG   1 1 
        4  6187 1 1  80 PRO HA   H -15.637 -13.469 -22.147 1.00 . A A .  80 PRO HA   1 1 
        4  6188 1 1  80 PRO HB2  H -17.525 -13.885 -24.078 1.00 . A A .  80 PRO HB2  1 1 
        4  6189 1 1  80 PRO HB3  H -16.860 -15.174 -23.095 1.00 . A A .  80 PRO HB3  1 1 
        4  6190 1 1  80 PRO HD2  H -19.347 -12.960 -20.810 1.00 . A A .  80 PRO HD2  1 1 
        4  6191 1 1  80 PRO HD3  H -18.715 -14.464 -20.172 1.00 . A A .  80 PRO HD3  1 1 
        4  6192 1 1  80 PRO HG2  H -19.513 -13.882 -22.909 1.00 . A A .  80 PRO HG2  1 1 
        4  6193 1 1  80 PRO HG3  H -18.991 -15.418 -22.246 1.00 . A A .  80 PRO HG3  1 1 
        4  6194 1 1  80 PRO N    N -17.245 -13.156 -20.949 1.00 . A A .  80 PRO N    1 1 
        4  6195 1 1  80 PRO O    O -15.810 -11.575 -23.831 1.00 . A A .  80 PRO O    1 1 
        4  6196 1 1  81 GLN C    C -16.607  -8.648 -22.084 1.00 . A A .  81 GLN C    1 1 
        4  6197 1 1  81 GLN CA   C -17.508  -9.584 -22.893 1.00 . A A .  81 GLN CA   1 1 
        4  6198 1 1  81 GLN CB   C -18.956  -9.089 -22.890 1.00 . A A .  81 GLN CB   1 1 
        4  6199 1 1  81 GLN CD   C -20.459  -7.080 -23.146 1.00 . A A .  81 GLN CD   1 1 
        4  6200 1 1  81 GLN CG   C -19.031  -7.613 -23.285 1.00 . A A .  81 GLN CG   1 1 
        4  6201 1 1  81 GLN H    H -18.037 -11.142 -21.615 1.00 . A A .  81 GLN H    1 1 
        4  6202 1 1  81 GLN HA   H -17.152  -9.643 -23.921 1.00 . A A .  81 GLN HA   1 1 
        4  6203 1 1  81 GLN HB2  H -19.549  -9.685 -23.584 1.00 . A A .  81 GLN HB2  1 1 
        4  6204 1 1  81 GLN HB3  H -19.389  -9.227 -21.900 1.00 . A A .  81 GLN HB3  1 1 
        4  6205 1 1  81 GLN HE21 H -19.742  -5.212 -23.451 1.00 . A A .  81 GLN HE21 1 1 
        4  6206 1 1  81 GLN HE22 H -21.453  -5.317 -23.203 1.00 . A A .  81 GLN HE22 1 1 
        4  6207 1 1  81 GLN HG2  H -18.359  -7.029 -22.656 1.00 . A A .  81 GLN HG2  1 1 
        4  6208 1 1  81 GLN HG3  H -18.692  -7.490 -24.314 1.00 . A A .  81 GLN HG3  1 1 
        4  6209 1 1  81 GLN N    N -17.420 -10.939 -22.375 1.00 . A A .  81 GLN N    1 1 
        4  6210 1 1  81 GLN NE2  N -20.559  -5.761 -23.277 1.00 . A A .  81 GLN NE2  1 1 
        4  6211 1 1  81 GLN O    O -15.851  -7.862 -22.655 1.00 . A A .  81 GLN O    1 1 
        4  6212 1 1  81 GLN OE1  O -21.406  -7.819 -22.934 1.00 . A A .  81 GLN OE1  1 1 
        4  6213 1 1  82 ASP C    C -14.437  -8.181 -20.150 1.00 . A A .  82 ASP C    1 1 
        4  6214 1 1  82 ASP CA   C -15.923  -7.935 -19.877 1.00 . A A .  82 ASP CA   1 1 
        4  6215 1 1  82 ASP CB   C -16.198  -8.283 -18.412 1.00 . A A .  82 ASP CB   1 1 
        4  6216 1 1  82 ASP CG   C -17.508  -7.727 -17.851 1.00 . A A .  82 ASP CG   1 1 
        4  6217 1 1  82 ASP H    H -17.335  -9.403 -20.313 1.00 . A A .  82 ASP H    1 1 
        4  6218 1 1  82 ASP HA   H -16.223  -6.910 -20.093 1.00 . A A .  82 ASP HA   1 1 
        4  6219 1 1  82 ASP HB2  H -16.207  -9.368 -18.308 1.00 . A A .  82 ASP HB2  1 1 
        4  6220 1 1  82 ASP HB3  H -15.372  -7.912 -17.805 1.00 . A A .  82 ASP HB3  1 1 
        4  6221 1 1  82 ASP N    N -16.718  -8.762 -20.769 1.00 . A A .  82 ASP N    1 1 
        4  6222 1 1  82 ASP O    O -13.680  -7.238 -20.375 1.00 . A A .  82 ASP O    1 1 
        4  6223 1 1  82 ASP OD1  O -18.556  -8.006 -18.472 1.00 . A A .  82 ASP OD1  1 1 
        4  6224 1 1  82 ASP OD2  O -17.431  -7.034 -16.813 1.00 . A A .  82 ASP OD2  1 1 
        4  6225 1 1  83 ARG C    C -12.233  -9.349 -21.742 1.00 . A A .  83 ARG C    1 1 
        4  6226 1 1  83 ARG CA   C -12.683  -9.833 -20.362 1.00 . A A .  83 ARG CA   1 1 
        4  6227 1 1  83 ARG CB   C -12.508 -11.350 -20.279 1.00 . A A .  83 ARG CB   1 1 
        4  6228 1 1  83 ARG CD   C -11.160 -13.099 -19.061 1.00 . A A .  83 ARG CD   1 1 
        4  6229 1 1  83 ARG CG   C -11.135 -11.713 -19.709 1.00 . A A .  83 ARG CG   1 1 
        4  6230 1 1  83 ARG CZ   C -10.054 -15.273 -19.570 1.00 . A A .  83 ARG CZ   1 1 
        4  6231 1 1  83 ARG H    H -14.687 -10.213 -19.936 1.00 . A A .  83 ARG H    1 1 
        4  6232 1 1  83 ARG HA   H -12.117  -9.343 -19.570 1.00 . A A .  83 ARG HA   1 1 
        4  6233 1 1  83 ARG HB2  H -13.291 -11.777 -19.651 1.00 . A A .  83 ARG HB2  1 1 
        4  6234 1 1  83 ARG HB3  H -12.621 -11.788 -21.271 1.00 . A A .  83 ARG HB3  1 1 
        4  6235 1 1  83 ARG HD2  H -11.050 -13.006 -17.980 1.00 . A A .  83 ARG HD2  1 1 
        4  6236 1 1  83 ARG HD3  H -12.122 -13.578 -19.243 1.00 . A A .  83 ARG HD3  1 1 
        4  6237 1 1  83 ARG HE   H  -9.291 -13.469 -20.035 1.00 . A A .  83 ARG HE   1 1 
        4  6238 1 1  83 ARG HG2  H -10.390 -11.693 -20.504 1.00 . A A .  83 ARG HG2  1 1 
        4  6239 1 1  83 ARG HG3  H -10.835 -10.968 -18.972 1.00 . A A .  83 ARG HG3  1 1 
        4  6240 1 1  83 ARG HH11 H -11.844 -15.434 -18.620 1.00 . A A .  83 ARG HH11 1 1 
        4  6241 1 1  83 ARG HH12 H -11.063 -16.937 -18.981 1.00 . A A .  83 ARG HH12 1 1 
        4  6242 1 1  83 ARG HH21 H  -8.260 -15.452 -20.511 1.00 . A A .  83 ARG HH21 1 1 
        4  6243 1 1  83 ARG HH22 H  -9.010 -16.947 -20.064 1.00 . A A .  83 ARG HH22 1 1 
        4  6244 1 1  83 ARG N    N -14.065  -9.452 -20.121 1.00 . A A .  83 ARG N    1 1 
        4  6245 1 1  83 ARG NE   N -10.068 -13.933 -19.609 1.00 . A A .  83 ARG NE   1 1 
        4  6246 1 1  83 ARG NH1  N -11.073 -15.937 -19.010 1.00 . A A .  83 ARG NH1  1 1 
        4  6247 1 1  83 ARG NH2  N  -9.021 -15.948 -20.093 1.00 . A A .  83 ARG NH2  1 1 
        4  6248 1 1  83 ARG O    O -11.107  -8.880 -21.902 1.00 . A A .  83 ARG O    1 1 
        4  6249 1 1  84 ALA C    C -12.309  -7.628 -24.049 1.00 . A A .  84 ALA C    1 1 
        4  6250 1 1  84 ALA CA   C -12.845  -9.061 -24.064 1.00 . A A .  84 ALA CA   1 1 
        4  6251 1 1  84 ALA CB   C -14.104  -9.204 -24.922 1.00 . A A .  84 ALA CB   1 1 
        4  6252 1 1  84 ALA H    H -14.049  -9.862 -22.564 1.00 . A A .  84 ALA H    1 1 
        4  6253 1 1  84 ALA HA   H -12.075  -9.724 -24.458 1.00 . A A .  84 ALA HA   1 1 
        4  6254 1 1  84 ALA HB1  H -14.968  -9.358 -24.276 1.00 . A A .  84 ALA HB1  1 1 
        4  6255 1 1  84 ALA HB2  H -14.247  -8.298 -25.511 1.00 . A A .  84 ALA HB2  1 1 
        4  6256 1 1  84 ALA HB3  H -13.993 -10.058 -25.590 1.00 . A A .  84 ALA HB3  1 1 
        4  6257 1 1  84 ALA N    N -13.135  -9.479 -22.703 1.00 . A A .  84 ALA N    1 1 
        4  6258 1 1  84 ALA O    O -11.467  -7.268 -24.871 1.00 . A A .  84 ALA O    1 1 
        4  6259 1 1  85 ALA C    C -11.088  -5.403 -22.194 1.00 . A A .  85 ALA C    1 1 
        4  6260 1 1  85 ALA CA   C -12.403  -5.464 -22.974 1.00 . A A .  85 ALA CA   1 1 
        4  6261 1 1  85 ALA CB   C -13.516  -4.657 -22.303 1.00 . A A .  85 ALA CB   1 1 
        4  6262 1 1  85 ALA H    H -13.504  -7.150 -22.443 1.00 . A A .  85 ALA H    1 1 
        4  6263 1 1  85 ALA HA   H -12.239  -5.069 -23.977 1.00 . A A .  85 ALA HA   1 1 
        4  6264 1 1  85 ALA HB1  H -14.367  -4.579 -22.980 1.00 . A A .  85 ALA HB1  1 1 
        4  6265 1 1  85 ALA HB2  H -13.827  -5.159 -21.387 1.00 . A A .  85 ALA HB2  1 1 
        4  6266 1 1  85 ALA HB3  H -13.149  -3.659 -22.064 1.00 . A A .  85 ALA HB3  1 1 
        4  6267 1 1  85 ALA N    N -12.819  -6.849 -23.107 1.00 . A A .  85 ALA N    1 1 
        4  6268 1 1  85 ALA O    O -10.123  -4.787 -22.644 1.00 . A A .  85 ALA O    1 1 
        4  6269 1 1  86 TYR C    C  -8.682  -6.535 -20.980 1.00 . A A .  86 TYR C    1 1 
        4  6270 1 1  86 TYR CA   C  -9.912  -6.079 -20.192 1.00 . A A .  86 TYR CA   1 1 
        4  6271 1 1  86 TYR CB   C -10.206  -7.101 -19.092 1.00 . A A .  86 TYR CB   1 1 
        4  6272 1 1  86 TYR CD1  C  -8.166  -8.536 -18.716 1.00 . A A .  86 TYR CD1  1 1 
        4  6273 1 1  86 TYR CD2  C  -8.679  -6.849 -17.102 1.00 . A A .  86 TYR CD2  1 1 
        4  6274 1 1  86 TYR CE1  C  -7.010  -8.919 -17.948 1.00 . A A .  86 TYR CE1  1 1 
        4  6275 1 1  86 TYR CE2  C  -7.522  -7.232 -16.334 1.00 . A A .  86 TYR CE2  1 1 
        4  6276 1 1  86 TYR CG   C  -8.977  -7.508 -18.276 1.00 . A A .  86 TYR CG   1 1 
        4  6277 1 1  86 TYR CZ   C  -6.745  -8.248 -16.795 1.00 . A A .  86 TYR CZ   1 1 
        4  6278 1 1  86 TYR H    H -11.881  -6.550 -20.680 1.00 . A A .  86 TYR H    1 1 
        4  6279 1 1  86 TYR HA   H  -9.741  -5.069 -19.819 1.00 . A A .  86 TYR HA   1 1 
        4  6280 1 1  86 TYR HB2  H -10.956  -6.689 -18.418 1.00 . A A .  86 TYR HB2  1 1 
        4  6281 1 1  86 TYR HB3  H -10.640  -7.992 -19.545 1.00 . A A .  86 TYR HB3  1 1 
        4  6282 1 1  86 TYR HD1  H  -8.402  -9.057 -19.644 1.00 . A A .  86 TYR HD1  1 1 
        4  6283 1 1  86 TYR HD2  H  -9.319  -6.037 -16.755 1.00 . A A .  86 TYR HD2  1 1 
        4  6284 1 1  86 TYR HE1  H  -6.362  -9.728 -18.284 1.00 . A A .  86 TYR HE1  1 1 
        4  6285 1 1  86 TYR HE2  H  -7.275  -6.719 -15.404 1.00 . A A .  86 TYR HE2  1 1 
        4  6286 1 1  86 TYR HH   H  -5.737  -9.562 -15.777 1.00 . A A .  86 TYR HH   1 1 
        4  6287 1 1  86 TYR N    N -11.092  -6.051 -21.038 1.00 . A A .  86 TYR N    1 1 
        4  6288 1 1  86 TYR O    O  -7.702  -5.800 -21.087 1.00 . A A .  86 TYR O    1 1 
        4  6289 1 1  86 TYR OH   O  -5.653  -8.610 -16.070 1.00 . A A .  86 TYR OH   1 1 
        4  6290 1 1  87 LYS C    C  -7.341  -7.362 -23.440 1.00 . A A .  87 LYS C    1 1 
        4  6291 1 1  87 LYS CA   C  -7.682  -8.308 -22.286 1.00 . A A .  87 LYS CA   1 1 
        4  6292 1 1  87 LYS CB   C  -8.021  -9.730 -22.736 1.00 . A A .  87 LYS CB   1 1 
        4  6293 1 1  87 LYS CD   C  -6.109 -11.350 -23.019 1.00 . A A .  87 LYS CD   1 1 
        4  6294 1 1  87 LYS CE   C  -6.397 -12.831 -23.273 1.00 . A A .  87 LYS CE   1 1 
        4  6295 1 1  87 LYS CG   C  -7.122 -10.754 -22.040 1.00 . A A .  87 LYS CG   1 1 
        4  6296 1 1  87 LYS H    H  -9.575  -8.336 -21.419 1.00 . A A .  87 LYS H    1 1 
        4  6297 1 1  87 LYS HA   H  -6.815  -8.375 -21.628 1.00 . A A .  87 LYS HA   1 1 
        4  6298 1 1  87 LYS HB2  H  -9.065  -9.947 -22.513 1.00 . A A .  87 LYS HB2  1 1 
        4  6299 1 1  87 LYS HB3  H  -7.902  -9.812 -23.816 1.00 . A A .  87 LYS HB3  1 1 
        4  6300 1 1  87 LYS HD2  H  -6.142 -10.802 -23.961 1.00 . A A .  87 LYS HD2  1 1 
        4  6301 1 1  87 LYS HD3  H  -5.101 -11.235 -22.620 1.00 . A A .  87 LYS HD3  1 1 
        4  6302 1 1  87 LYS HE2  H  -5.480 -13.410 -23.161 1.00 . A A .  87 LYS HE2  1 1 
        4  6303 1 1  87 LYS HE3  H  -7.102 -13.203 -22.530 1.00 . A A .  87 LYS HE3  1 1 
        4  6304 1 1  87 LYS HG2  H  -6.596 -10.278 -21.211 1.00 . A A .  87 LYS HG2  1 1 
        4  6305 1 1  87 LYS HG3  H  -7.733 -11.550 -21.614 1.00 . A A .  87 LYS HG3  1 1 
        4  6306 1 1  87 LYS HZ1  H  -6.279 -13.499 -25.201 1.00 . A A .  87 LYS HZ1  1 1 
        4  6307 1 1  87 LYS HZ2  H  -7.786 -13.573 -24.576 1.00 . A A .  87 LYS HZ2  1 1 
        4  6308 1 1  87 LYS HZ3  H  -7.162 -12.135 -25.036 1.00 . A A .  87 LYS HZ3  1 1 
        4  6309 1 1  87 LYS N    N  -8.774  -7.745 -21.511 1.00 . A A .  87 LYS N    1 1 
        4  6310 1 1  87 LYS NZ   N  -6.951 -13.025 -24.632 1.00 . A A .  87 LYS NZ   1 1 
        4  6311 1 1  87 LYS O    O  -6.170  -7.158 -23.755 1.00 . A A .  87 LYS O    1 1 
        4  6312 1 1  88 GLU C    C  -7.256  -4.763 -24.762 1.00 . A A .  88 GLU C    1 1 
        4  6313 1 1  88 GLU CA   C  -8.213  -5.892 -25.151 1.00 . A A .  88 GLU CA   1 1 
        4  6314 1 1  88 GLU CB   C  -9.559  -5.334 -25.616 1.00 . A A .  88 GLU CB   1 1 
        4  6315 1 1  88 GLU CD   C -10.450  -3.654 -27.272 1.00 . A A .  88 GLU CD   1 1 
        4  6316 1 1  88 GLU CG   C  -9.399  -3.927 -26.195 1.00 . A A .  88 GLU CG   1 1 
        4  6317 1 1  88 GLU H    H  -9.336  -6.982 -23.776 1.00 . A A .  88 GLU H    1 1 
        4  6318 1 1  88 GLU HA   H  -7.776  -6.487 -25.953 1.00 . A A .  88 GLU HA   1 1 
        4  6319 1 1  88 GLU HB2  H  -9.989  -5.994 -26.369 1.00 . A A .  88 GLU HB2  1 1 
        4  6320 1 1  88 GLU HB3  H -10.256  -5.309 -24.779 1.00 . A A .  88 GLU HB3  1 1 
        4  6321 1 1  88 GLU HG2  H  -9.489  -3.189 -25.398 1.00 . A A .  88 GLU HG2  1 1 
        4  6322 1 1  88 GLU HG3  H  -8.401  -3.816 -26.620 1.00 . A A .  88 GLU HG3  1 1 
        4  6323 1 1  88 GLU N    N  -8.386  -6.810 -24.039 1.00 . A A .  88 GLU N    1 1 
        4  6324 1 1  88 GLU O    O  -6.509  -4.261 -25.601 1.00 . A A .  88 GLU O    1 1 
        4  6325 1 1  88 GLU OE1  O -10.364  -4.314 -28.330 1.00 . A A .  88 GLU OE1  1 1 
        4  6326 1 1  88 GLU OE2  O -11.317  -2.791 -27.013 1.00 . A A .  88 GLU OE2  1 1 
        4  6327 1 1  89 TYR C    C  -5.105  -3.889 -22.527 1.00 . A A .  89 TYR C    1 1 
        4  6328 1 1  89 TYR CA   C  -6.458  -3.335 -22.980 1.00 . A A .  89 TYR CA   1 1 
        4  6329 1 1  89 TYR CB   C  -7.189  -2.752 -21.769 1.00 . A A .  89 TYR CB   1 1 
        4  6330 1 1  89 TYR CD1  C  -5.573  -2.839 -19.835 1.00 . A A .  89 TYR CD1  1 1 
        4  6331 1 1  89 TYR CD2  C  -6.129  -0.703 -20.752 1.00 . A A .  89 TYR CD2  1 1 
        4  6332 1 1  89 TYR CE1  C  -4.706  -2.203 -18.878 1.00 . A A .  89 TYR CE1  1 1 
        4  6333 1 1  89 TYR CE2  C  -5.262  -0.066 -19.795 1.00 . A A .  89 TYR CE2  1 1 
        4  6334 1 1  89 TYR CG   C  -6.267  -2.076 -20.752 1.00 . A A .  89 TYR CG   1 1 
        4  6335 1 1  89 TYR CZ   C  -4.593  -0.848 -18.905 1.00 . A A .  89 TYR CZ   1 1 
        4  6336 1 1  89 TYR H    H  -7.920  -4.809 -22.814 1.00 . A A .  89 TYR H    1 1 
        4  6337 1 1  89 TYR HA   H  -6.297  -2.617 -23.784 1.00 . A A .  89 TYR HA   1 1 
        4  6338 1 1  89 TYR HB2  H  -7.924  -2.027 -22.116 1.00 . A A .  89 TYR HB2  1 1 
        4  6339 1 1  89 TYR HB3  H  -7.739  -3.551 -21.271 1.00 . A A .  89 TYR HB3  1 1 
        4  6340 1 1  89 TYR HD1  H  -5.682  -3.924 -19.835 1.00 . A A .  89 TYR HD1  1 1 
        4  6341 1 1  89 TYR HD2  H  -6.677  -0.100 -21.476 1.00 . A A .  89 TYR HD2  1 1 
        4  6342 1 1  89 TYR HE1  H  -4.152  -2.794 -18.148 1.00 . A A .  89 TYR HE1  1 1 
        4  6343 1 1  89 TYR HE2  H  -5.144   1.017 -19.784 1.00 . A A .  89 TYR HE2  1 1 
        4  6344 1 1  89 TYR HH   H  -4.224  -0.200 -17.110 1.00 . A A .  89 TYR HH   1 1 
        4  6345 1 1  89 TYR N    N  -7.310  -4.396 -23.490 1.00 . A A .  89 TYR N    1 1 
        4  6346 1 1  89 TYR O    O  -4.097  -3.186 -22.569 1.00 . A A .  89 TYR O    1 1 
        4  6347 1 1  89 TYR OH   O  -3.774  -0.247 -18.001 1.00 . A A .  89 TYR OH   1 1 
        4  6348 1 1  90 ILE C    C  -2.910  -5.870 -22.792 1.00 . A A .  90 ILE C    1 1 
        4  6349 1 1  90 ILE CA   C  -3.916  -5.800 -21.642 1.00 . A A .  90 ILE CA   1 1 
        4  6350 1 1  90 ILE CB   C  -4.245  -7.163 -21.029 1.00 . A A .  90 ILE CB   1 1 
        4  6351 1 1  90 ILE CD1  C  -4.322  -6.716 -18.548 1.00 . A A .  90 ILE CD1  1 1 
        4  6352 1 1  90 ILE CG1  C  -5.147  -7.010 -19.803 1.00 . A A .  90 ILE CG1  1 1 
        4  6353 1 1  90 ILE CG2  C  -2.968  -7.942 -20.707 1.00 . A A .  90 ILE CG2  1 1 
        4  6354 1 1  90 ILE H    H  -5.953  -5.709 -22.071 1.00 . A A .  90 ILE H    1 1 
        4  6355 1 1  90 ILE HA   H  -3.493  -5.184 -20.849 1.00 . A A .  90 ILE HA   1 1 
        4  6356 1 1  90 ILE HB   H  -4.799  -7.744 -21.766 1.00 . A A .  90 ILE HB   1 1 
        4  6357 1 1  90 ILE HD11 H  -3.610  -5.919 -18.760 1.00 . A A .  90 ILE HD11 1 1 
        4  6358 1 1  90 ILE HD12 H  -4.986  -6.406 -17.741 1.00 . A A .  90 ILE HD12 1 1 
        4  6359 1 1  90 ILE HD13 H  -3.783  -7.615 -18.250 1.00 . A A .  90 ILE HD13 1 1 
        4  6360 1 1  90 ILE HG12 H  -5.860  -6.203 -19.970 1.00 . A A .  90 ILE HG12 1 1 
        4  6361 1 1  90 ILE HG13 H  -5.726  -7.922 -19.657 1.00 . A A .  90 ILE HG13 1 1 
        4  6362 1 1  90 ILE HG21 H  -2.273  -7.295 -20.173 1.00 . A A .  90 ILE HG21 1 1 
        4  6363 1 1  90 ILE HG22 H  -3.214  -8.803 -20.086 1.00 . A A .  90 ILE HG22 1 1 
        4  6364 1 1  90 ILE HG23 H  -2.507  -8.283 -21.634 1.00 . A A .  90 ILE HG23 1 1 
        4  6365 1 1  90 ILE N    N  -5.128  -5.144 -22.103 1.00 . A A .  90 ILE N    1 1 
        4  6366 1 1  90 ILE O    O  -1.855  -5.240 -22.737 1.00 . A A .  90 ILE O    1 1 
        4  6367 1 1  91 SER C    C  -1.774  -5.460 -25.335 1.00 . A A .  91 SER C    1 1 
        4  6368 1 1  91 SER CA   C  -2.414  -6.801 -24.968 1.00 . A A .  91 SER CA   1 1 
        4  6369 1 1  91 SER CB   C  -3.196  -7.359 -26.159 1.00 . A A .  91 SER CB   1 1 
        4  6370 1 1  91 SER H    H  -4.132  -7.150 -23.844 1.00 . A A .  91 SER H    1 1 
        4  6371 1 1  91 SER HA   H  -1.651  -7.519 -24.667 1.00 . A A .  91 SER HA   1 1 
        4  6372 1 1  91 SER HB2  H  -3.241  -8.446 -26.086 1.00 . A A .  91 SER HB2  1 1 
        4  6373 1 1  91 SER HB3  H  -4.223  -6.994 -26.121 1.00 . A A .  91 SER HB3  1 1 
        4  6374 1 1  91 SER HG   H  -1.622  -7.150 -27.376 1.00 . A A .  91 SER HG   1 1 
        4  6375 1 1  91 SER N    N  -3.272  -6.641 -23.807 1.00 . A A .  91 SER N    1 1 
        4  6376 1 1  91 SER O    O  -0.566  -5.383 -25.553 1.00 . A A .  91 SER O    1 1 
        4  6377 1 1  91 SER OG   O  -2.608  -6.991 -27.404 1.00 . A A .  91 SER OG   1 1 
        4  6378 1 1  92 ASN C    C  -1.713  -2.381 -24.451 1.00 . A A .  92 ASN C    1 1 
        4  6379 1 1  92 ASN CA   C  -2.145  -3.103 -25.729 1.00 . A A .  92 ASN CA   1 1 
        4  6380 1 1  92 ASN CB   C  -3.255  -2.279 -26.385 1.00 . A A .  92 ASN CB   1 1 
        4  6381 1 1  92 ASN CG   C  -3.778  -2.970 -27.646 1.00 . A A .  92 ASN CG   1 1 
        4  6382 1 1  92 ASN H    H  -3.595  -4.507 -25.214 1.00 . A A .  92 ASN H    1 1 
        4  6383 1 1  92 ASN HA   H  -1.318  -3.256 -26.421 1.00 . A A .  92 ASN HA   1 1 
        4  6384 1 1  92 ASN HB2  H  -4.072  -2.135 -25.679 1.00 . A A .  92 ASN HB2  1 1 
        4  6385 1 1  92 ASN HB3  H  -2.876  -1.289 -26.639 1.00 . A A .  92 ASN HB3  1 1 
        4  6386 1 1  92 ASN HD21 H  -5.644  -2.875 -26.866 1.00 . A A .  92 ASN HD21 1 1 
        4  6387 1 1  92 ASN HD22 H  -5.531  -3.615 -28.427 1.00 . A A .  92 ASN HD22 1 1 
        4  6388 1 1  92 ASN N    N  -2.613  -4.436 -25.392 1.00 . A A .  92 ASN N    1 1 
        4  6389 1 1  92 ASN ND2  N  -5.093  -3.170 -27.646 1.00 . A A .  92 ASN ND2  1 1 
        4  6390 1 1  92 ASN O    O  -2.227  -1.309 -24.135 1.00 . A A .  92 ASN O    1 1 
        4  6391 1 1  92 ASN OD1  O  -3.038  -3.299 -28.558 1.00 . A A .  92 ASN OD1  1 1 
        4  6392 1 1  93 LYS C    C   1.157  -2.934 -22.269 1.00 . A A .  93 LYS C    1 1 
        4  6393 1 1  93 LYS CA   C  -0.266  -2.428 -22.513 1.00 . A A .  93 LYS CA   1 1 
        4  6394 1 1  93 LYS CB   C  -1.228  -2.713 -21.358 1.00 . A A .  93 LYS CB   1 1 
        4  6395 1 1  93 LYS CD   C  -1.005  -1.107 -19.427 1.00 . A A .  93 LYS CD   1 1 
        4  6396 1 1  93 LYS CE   C  -0.195   0.187 -19.540 1.00 . A A .  93 LYS CE   1 1 
        4  6397 1 1  93 LYS CG   C  -1.737  -1.412 -20.735 1.00 . A A .  93 LYS CG   1 1 
        4  6398 1 1  93 LYS H    H  -0.361  -3.870 -24.013 1.00 . A A .  93 LYS H    1 1 
        4  6399 1 1  93 LYS HA   H  -0.230  -1.346 -22.643 1.00 . A A .  93 LYS HA   1 1 
        4  6400 1 1  93 LYS HB2  H  -2.071  -3.303 -21.718 1.00 . A A .  93 LYS HB2  1 1 
        4  6401 1 1  93 LYS HB3  H  -0.723  -3.311 -20.599 1.00 . A A .  93 LYS HB3  1 1 
        4  6402 1 1  93 LYS HD2  H  -1.726  -1.019 -18.614 1.00 . A A .  93 LYS HD2  1 1 
        4  6403 1 1  93 LYS HD3  H  -0.341  -1.934 -19.176 1.00 . A A .  93 LYS HD3  1 1 
        4  6404 1 1  93 LYS HE2  H  -0.599   0.806 -20.342 1.00 . A A .  93 LYS HE2  1 1 
        4  6405 1 1  93 LYS HE3  H  -0.285   0.761 -18.618 1.00 . A A .  93 LYS HE3  1 1 
        4  6406 1 1  93 LYS HG2  H  -1.596  -0.589 -21.435 1.00 . A A .  93 LYS HG2  1 1 
        4  6407 1 1  93 LYS HG3  H  -2.808  -1.490 -20.546 1.00 . A A .  93 LYS HG3  1 1 
        4  6408 1 1  93 LYS HZ1  H   1.727   0.739 -19.963 1.00 . A A .  93 LYS HZ1  1 1 
        4  6409 1 1  93 LYS HZ2  H   1.622  -0.591 -19.021 1.00 . A A .  93 LYS HZ2  1 1 
        4  6410 1 1  93 LYS HZ3  H   1.300  -0.695 -20.619 1.00 . A A .  93 LYS HZ3  1 1 
        4  6411 1 1  93 LYS N    N  -0.773  -2.998 -23.750 1.00 . A A .  93 LYS N    1 1 
        4  6412 1 1  93 LYS NZ   N   1.229  -0.115 -19.807 1.00 . A A .  93 LYS NZ   1 1 
        4  6413 1 1  93 LYS O    O   2.073  -2.142 -22.053 1.00 . A A .  93 LYS O    1 1 
        4  6414 1 1  94 ARG C    C   3.550  -4.510 -23.234 1.00 . A A .  94 ARG C    1 1 
        4  6415 1 1  94 ARG CA   C   2.593  -4.873 -22.097 1.00 . A A .  94 ARG CA   1 1 
        4  6416 1 1  94 ARG CB   C   2.466  -6.395 -22.012 1.00 . A A .  94 ARG CB   1 1 
        4  6417 1 1  94 ARG CD   C   2.111  -8.310 -20.410 1.00 . A A .  94 ARG CD   1 1 
        4  6418 1 1  94 ARG CG   C   1.869  -6.822 -20.670 1.00 . A A .  94 ARG CG   1 1 
        4  6419 1 1  94 ARG CZ   C   0.825 -10.181 -19.384 1.00 . A A .  94 ARG CZ   1 1 
        4  6420 1 1  94 ARG H    H   0.547  -4.888 -22.488 1.00 . A A .  94 ARG H    1 1 
        4  6421 1 1  94 ARG HA   H   2.942  -4.469 -21.147 1.00 . A A .  94 ARG HA   1 1 
        4  6422 1 1  94 ARG HB2  H   1.837  -6.757 -22.825 1.00 . A A .  94 ARG HB2  1 1 
        4  6423 1 1  94 ARG HB3  H   3.447  -6.853 -22.140 1.00 . A A .  94 ARG HB3  1 1 
        4  6424 1 1  94 ARG HD2  H   2.197  -8.843 -21.357 1.00 . A A .  94 ARG HD2  1 1 
        4  6425 1 1  94 ARG HD3  H   3.054  -8.446 -19.880 1.00 . A A .  94 ARG HD3  1 1 
        4  6426 1 1  94 ARG HE   H   0.334  -8.236 -19.221 1.00 . A A .  94 ARG HE   1 1 
        4  6427 1 1  94 ARG HG2  H   2.312  -6.232 -19.867 1.00 . A A .  94 ARG HG2  1 1 
        4  6428 1 1  94 ARG HG3  H   0.799  -6.617 -20.662 1.00 . A A .  94 ARG HG3  1 1 
        4  6429 1 1  94 ARG HH11 H   2.465 -10.757 -20.438 1.00 . A A .  94 ARG HH11 1 1 
        4  6430 1 1  94 ARG HH12 H   1.560 -12.047 -19.719 1.00 . A A .  94 ARG HH12 1 1 
        4  6431 1 1  94 ARG HH21 H  -0.860  -9.937 -18.271 1.00 . A A .  94 ARG HH21 1 1 
        4  6432 1 1  94 ARG HH22 H  -0.344 -11.577 -18.478 1.00 . A A .  94 ARG HH22 1 1 
        4  6433 1 1  94 ARG N    N   1.297  -4.251 -22.311 1.00 . A A .  94 ARG N    1 1 
        4  6434 1 1  94 ARG NE   N   0.999  -8.872 -19.613 1.00 . A A .  94 ARG NE   1 1 
        4  6435 1 1  94 ARG NH1  N   1.690 -11.070 -19.890 1.00 . A A .  94 ARG NH1  1 1 
        4  6436 1 1  94 ARG NH2  N  -0.214 -10.601 -18.649 1.00 . A A .  94 ARG NH2  1 1 
        4  6437 1 1  94 ARG O    O   4.618  -3.949 -22.996 1.00 . A A .  94 ARG O    1 1 
        4  6438 1 1  95 LYS C    C   3.044  -4.561 -26.861 1.00 . A A .  95 LYS C    1 1 
        4  6439 1 1  95 LYS CA   C   3.940  -4.562 -25.621 1.00 . A A .  95 LYS CA   1 1 
        4  6440 1 1  95 LYS CB   C   5.115  -5.538 -25.711 1.00 . A A .  95 LYS CB   1 1 
        4  6441 1 1  95 LYS CD   C   7.383  -5.448 -26.811 1.00 . A A .  95 LYS CD   1 1 
        4  6442 1 1  95 LYS CE   C   8.715  -4.701 -26.893 1.00 . A A .  95 LYS CE   1 1 
        4  6443 1 1  95 LYS CG   C   6.445  -4.787 -25.798 1.00 . A A .  95 LYS CG   1 1 
        4  6444 1 1  95 LYS H    H   2.263  -5.302 -24.631 1.00 . A A .  95 LYS H    1 1 
        4  6445 1 1  95 LYS HA   H   4.359  -3.564 -25.496 1.00 . A A .  95 LYS HA   1 1 
        4  6446 1 1  95 LYS HB2  H   5.118  -6.192 -24.839 1.00 . A A .  95 LYS HB2  1 1 
        4  6447 1 1  95 LYS HB3  H   4.996  -6.176 -26.587 1.00 . A A .  95 LYS HB3  1 1 
        4  6448 1 1  95 LYS HD2  H   7.560  -6.485 -26.524 1.00 . A A .  95 LYS HD2  1 1 
        4  6449 1 1  95 LYS HD3  H   6.910  -5.465 -27.792 1.00 . A A .  95 LYS HD3  1 1 
        4  6450 1 1  95 LYS HE2  H   8.935  -4.452 -27.932 1.00 . A A .  95 LYS HE2  1 1 
        4  6451 1 1  95 LYS HE3  H   8.645  -3.760 -26.348 1.00 . A A .  95 LYS HE3  1 1 
        4  6452 1 1  95 LYS HG2  H   6.264  -3.752 -26.087 1.00 . A A .  95 LYS HG2  1 1 
        4  6453 1 1  95 LYS HG3  H   6.920  -4.766 -24.817 1.00 . A A .  95 LYS HG3  1 1 
        4  6454 1 1  95 LYS HZ1  H  10.384  -4.960 -25.743 1.00 . A A .  95 LYS HZ1  1 1 
        4  6455 1 1  95 LYS HZ2  H   9.419  -6.276 -25.797 1.00 . A A .  95 LYS HZ2  1 1 
        4  6456 1 1  95 LYS HZ3  H  10.360  -5.900 -27.078 1.00 . A A .  95 LYS HZ3  1 1 
        4  6457 1 1  95 LYS N    N   3.133  -4.846 -24.446 1.00 . A A .  95 LYS N    1 1 
        4  6458 1 1  95 LYS NZ   N   9.808  -5.526 -26.332 1.00 . A A .  95 LYS NZ   1 1 
        4  6459 1 1  95 LYS O    O   2.824  -3.516 -27.471 1.00 . A A .  95 LYS O    1 1 
        4  6460 1 1  96 SER C    C   1.029  -7.275 -28.342 1.00 . A A .  96 SER C    1 1 
        4  6461 1 1  96 SER CA   C   1.685  -5.893 -28.354 1.00 . A A .  96 SER CA   1 1 
        4  6462 1 1  96 SER CB   C   2.464  -5.687 -29.655 1.00 . A A .  96 SER CB   1 1 
        4  6463 1 1  96 SER H    H   2.736  -6.590 -26.696 1.00 . A A .  96 SER H    1 1 
        4  6464 1 1  96 SER HA   H   0.933  -5.111 -28.254 1.00 . A A .  96 SER HA   1 1 
        4  6465 1 1  96 SER HB2  H   3.519  -5.540 -29.427 1.00 . A A .  96 SER HB2  1 1 
        4  6466 1 1  96 SER HB3  H   2.392  -6.586 -30.267 1.00 . A A .  96 SER HB3  1 1 
        4  6467 1 1  96 SER HG   H   2.314  -4.612 -31.337 1.00 . A A .  96 SER HG   1 1 
        4  6468 1 1  96 SER N    N   2.552  -5.745 -27.197 1.00 . A A .  96 SER N    1 1 
        4  6469 1 1  96 SER O    O   1.441  -8.156 -27.588 1.00 . A A .  96 SER O    1 1 
        4  6470 1 1  96 SER OG   O   1.979  -4.570 -30.396 1.00 . A A .  96 SER OG   1 1 
        4  6471 1 1  97 GLY C    C  -0.878  -9.102 -30.741 1.00 . A A .  97 GLY C    1 1 
        4  6472 1 1  97 GLY CA   C  -0.700  -8.682 -29.281 1.00 . A A .  97 GLY CA   1 1 
        4  6473 1 1  97 GLY H    H  -0.312  -6.701 -29.795 1.00 . A A .  97 GLY H    1 1 
        4  6474 1 1  97 GLY HA2  H  -0.157  -9.456 -28.739 1.00 . A A .  97 GLY HA2  1 1 
        4  6475 1 1  97 GLY HA3  H  -1.676  -8.585 -28.805 1.00 . A A .  97 GLY HA3  1 1 
        4  6476 1 1  97 GLY N    N   0.018  -7.422 -29.185 1.00 . A A .  97 GLY N    1 1 
        4  6477 1 1  97 GLY O    O  -1.647  -8.488 -31.479 1.00 . A A .  97 GLY O    1 1 
        4  6478 1 1  98 PRO C    C  -1.501 -11.459 -32.715 1.00 . A A .  98 PRO C    1 1 
        4  6479 1 1  98 PRO CA   C  -0.202 -10.684 -32.484 1.00 . A A .  98 PRO CA   1 1 
        4  6480 1 1  98 PRO CB   C   1.040 -11.546 -32.644 1.00 . A A .  98 PRO CB   1 1 
        4  6481 1 1  98 PRO CD   C   0.788 -10.927 -30.279 1.00 . A A .  98 PRO CD   1 1 
        4  6482 1 1  98 PRO CG   C   1.512 -11.862 -31.234 1.00 . A A .  98 PRO CG   1 1 
        4  6483 1 1  98 PRO HA   H  -0.215  -9.928 -33.139 1.00 . A A .  98 PRO HA   1 1 
        4  6484 1 1  98 PRO HB2  H   0.814 -12.459 -33.194 1.00 . A A .  98 PRO HB2  1 1 
        4  6485 1 1  98 PRO HB3  H   1.812 -11.019 -33.205 1.00 . A A .  98 PRO HB3  1 1 
        4  6486 1 1  98 PRO HD2  H   0.253 -11.483 -29.509 1.00 . A A .  98 PRO HD2  1 1 
        4  6487 1 1  98 PRO HD3  H   1.486 -10.264 -29.768 1.00 . A A .  98 PRO HD3  1 1 
        4  6488 1 1  98 PRO HG2  H   1.299 -12.902 -30.984 1.00 . A A .  98 PRO HG2  1 1 
        4  6489 1 1  98 PRO HG3  H   2.590 -11.729 -31.153 1.00 . A A .  98 PRO HG3  1 1 
        4  6490 1 1  98 PRO N    N  -0.134 -10.174 -31.125 1.00 . A A .  98 PRO N    1 1 
        4  6491 1 1  98 PRO O    O  -1.985 -12.147 -31.818 1.00 . A A .  98 PRO O    1 1 
        4  6492 1 1  99 SER C    C  -3.003 -12.986 -35.422 1.00 . A A .  99 SER C    1 1 
        4  6493 1 1  99 SER CA   C  -3.262 -11.998 -34.283 1.00 . A A .  99 SER CA   1 1 
        4  6494 1 1  99 SER CB   C  -4.344 -10.995 -34.686 1.00 . A A .  99 SER CB   1 1 
        4  6495 1 1  99 SER H    H  -1.628 -10.758 -34.647 1.00 . A A .  99 SER H    1 1 
        4  6496 1 1  99 SER HA   H  -3.574 -12.526 -33.382 1.00 . A A .  99 SER HA   1 1 
        4  6497 1 1  99 SER HB2  H  -4.001 -10.417 -35.544 1.00 . A A .  99 SER HB2  1 1 
        4  6498 1 1  99 SER HB3  H  -5.238 -11.534 -35.002 1.00 . A A .  99 SER HB3  1 1 
        4  6499 1 1  99 SER HG   H  -3.969  -9.410 -33.525 1.00 . A A .  99 SER HG   1 1 
        4  6500 1 1  99 SER N    N  -2.028 -11.320 -33.923 1.00 . A A .  99 SER N    1 1 
        4  6501 1 1  99 SER O    O  -3.290 -14.175 -35.294 1.00 . A A .  99 SER O    1 1 
        4  6502 1 1  99 SER OG   O  -4.676 -10.110 -33.620 1.00 . A A .  99 SER OG   1 1 
        4  6503 1 1 100 SER C    C  -3.453 -13.841 -38.263 1.00 . A A . 100 SER C    1 1 
        4  6504 1 1 100 SER CA   C  -2.160 -13.278 -37.670 1.00 . A A . 100 SER CA   1 1 
        4  6505 1 1 100 SER CB   C  -1.203 -14.415 -37.307 1.00 . A A . 100 SER CB   1 1 
        4  6506 1 1 100 SER H    H  -2.231 -11.489 -36.605 1.00 . A A . 100 SER H    1 1 
        4  6507 1 1 100 SER HA   H  -1.674 -12.608 -38.379 1.00 . A A . 100 SER HA   1 1 
        4  6508 1 1 100 SER HB2  H  -0.273 -13.997 -36.922 1.00 . A A . 100 SER HB2  1 1 
        4  6509 1 1 100 SER HB3  H  -1.639 -15.014 -36.508 1.00 . A A . 100 SER HB3  1 1 
        4  6510 1 1 100 SER HG   H  -0.140 -15.843 -38.221 1.00 . A A . 100 SER HG   1 1 
        4  6511 1 1 100 SER N    N  -2.462 -12.457 -36.509 1.00 . A A . 100 SER N    1 1 
        4  6512 1 1 100 SER O    O  -4.385 -14.170 -37.530 1.00 . A A . 100 SER O    1 1 
        4  6513 1 1 100 SER OG   O  -0.920 -15.252 -38.425 1.00 . A A . 100 SER OG   1 1 
        4  6514 1 1 101 GLY C    C  -4.727 -13.871 -41.696 1.00 . A A . 101 GLY C    1 1 
        4  6515 1 1 101 GLY CA   C  -4.633 -14.453 -40.284 1.00 . A A . 101 GLY CA   1 1 
        4  6516 1 1 101 GLY H    H  -2.707 -13.666 -40.173 1.00 . A A . 101 GLY H    1 1 
        4  6517 1 1 101 GLY HA2  H  -4.575 -15.540 -40.338 1.00 . A A . 101 GLY HA2  1 1 
        4  6518 1 1 101 GLY HA3  H  -5.536 -14.209 -39.725 1.00 . A A . 101 GLY HA3  1 1 
        4  6519 1 1 101 GLY N    N  -3.469 -13.935 -39.584 1.00 . A A . 101 GLY N    1 1 
        4  6520 1 1 101 GLY O    O  -4.725 -14.612 -42.678 1.00 . A A . 101 GLY O    1 1 
        5  6521 1 1   1 GLY C    C -18.186   6.158   5.245 1.00 . A A .   1 GLY C    1 1 
        5  6522 1 1   1 GLY CA   C -18.581   7.604   5.551 1.00 . A A .   1 GLY CA   1 1 
        5  6523 1 1   1 GLY H1   H -17.101   7.725   7.011 1.00 . A A .   1 GLY H1   1 1 
        5  6524 1 1   1 GLY HA2  H -19.667   7.692   5.570 1.00 . A A .   1 GLY HA2  1 1 
        5  6525 1 1   1 GLY HA3  H -18.222   8.259   4.756 1.00 . A A .   1 GLY HA3  1 1 
        5  6526 1 1   1 GLY N    N -18.033   8.035   6.825 1.00 . A A .   1 GLY N    1 1 
        5  6527 1 1   1 GLY O    O -17.686   5.449   6.117 1.00 . A A .   1 GLY O    1 1 
        5  6528 1 1   2 SER C    C -18.302   4.286   2.060 1.00 . A A .   2 SER C    1 1 
        5  6529 1 1   2 SER CA   C -18.099   4.414   3.571 1.00 . A A .   2 SER CA   1 1 
        5  6530 1 1   2 SER CB   C -18.950   3.379   4.310 1.00 . A A .   2 SER CB   1 1 
        5  6531 1 1   2 SER H    H -18.831   6.346   3.299 1.00 . A A .   2 SER H    1 1 
        5  6532 1 1   2 SER HA   H -17.050   4.273   3.829 1.00 . A A .   2 SER HA   1 1 
        5  6533 1 1   2 SER HB2  H -18.725   2.384   3.926 1.00 . A A .   2 SER HB2  1 1 
        5  6534 1 1   2 SER HB3  H -18.684   3.380   5.367 1.00 . A A .   2 SER HB3  1 1 
        5  6535 1 1   2 SER HG   H -20.547   4.579   4.439 1.00 . A A .   2 SER HG   1 1 
        5  6536 1 1   2 SER N    N -18.424   5.763   4.003 1.00 . A A .   2 SER N    1 1 
        5  6537 1 1   2 SER O    O -19.320   4.724   1.527 1.00 . A A .   2 SER O    1 1 
        5  6538 1 1   2 SER OG   O -20.344   3.637   4.171 1.00 . A A .   2 SER OG   1 1 
        5  6539 1 1   3 SER C    C -16.160   2.686  -0.497 1.00 . A A .   3 SER C    1 1 
        5  6540 1 1   3 SER CA   C -17.373   3.490  -0.027 1.00 . A A .   3 SER CA   1 1 
        5  6541 1 1   3 SER CB   C -17.436   4.832  -0.760 1.00 . A A .   3 SER CB   1 1 
        5  6542 1 1   3 SER H    H -16.491   3.328   1.853 1.00 . A A .   3 SER H    1 1 
        5  6543 1 1   3 SER HA   H -18.293   2.935  -0.208 1.00 . A A .   3 SER HA   1 1 
        5  6544 1 1   3 SER HB2  H -17.123   5.629  -0.085 1.00 . A A .   3 SER HB2  1 1 
        5  6545 1 1   3 SER HB3  H -16.731   4.824  -1.591 1.00 . A A .   3 SER HB3  1 1 
        5  6546 1 1   3 SER HG   H -18.763   6.016  -1.678 1.00 . A A .   3 SER HG   1 1 
        5  6547 1 1   3 SER N    N -17.316   3.682   1.412 1.00 . A A .   3 SER N    1 1 
        5  6548 1 1   3 SER O    O -15.051   2.883  -0.002 1.00 . A A .   3 SER O    1 1 
        5  6549 1 1   3 SER OG   O -18.744   5.113  -1.249 1.00 . A A .   3 SER OG   1 1 
        5  6550 1 1   4 GLY C    C -15.872  -0.441  -2.312 1.00 . A A .   4 GLY C    1 1 
        5  6551 1 1   4 GLY CA   C -15.352   0.960  -1.987 1.00 . A A .   4 GLY CA   1 1 
        5  6552 1 1   4 GLY H    H -17.315   1.641  -1.842 1.00 . A A .   4 GLY H    1 1 
        5  6553 1 1   4 GLY HA2  H -14.946   1.420  -2.888 1.00 . A A .   4 GLY HA2  1 1 
        5  6554 1 1   4 GLY HA3  H -14.535   0.891  -1.269 1.00 . A A .   4 GLY HA3  1 1 
        5  6555 1 1   4 GLY N    N -16.411   1.796  -1.445 1.00 . A A .   4 GLY N    1 1 
        5  6556 1 1   4 GLY O    O -16.356  -1.148  -1.430 1.00 . A A .   4 GLY O    1 1 
        5  6557 1 1   5 SER C    C -15.465  -2.503  -5.313 1.00 . A A .   5 SER C    1 1 
        5  6558 1 1   5 SER CA   C -16.206  -2.106  -4.035 1.00 . A A .   5 SER CA   1 1 
        5  6559 1 1   5 SER CB   C -17.718  -2.113  -4.275 1.00 . A A .   5 SER CB   1 1 
        5  6560 1 1   5 SER H    H -15.359  -0.221  -4.294 1.00 . A A .   5 SER H    1 1 
        5  6561 1 1   5 SER HA   H -15.965  -2.793  -3.223 1.00 . A A .   5 SER HA   1 1 
        5  6562 1 1   5 SER HB2  H -18.107  -1.101  -4.160 1.00 . A A .   5 SER HB2  1 1 
        5  6563 1 1   5 SER HB3  H -17.920  -2.418  -5.301 1.00 . A A .   5 SER HB3  1 1 
        5  6564 1 1   5 SER HG   H -19.245  -2.561  -3.062 1.00 . A A .   5 SER HG   1 1 
        5  6565 1 1   5 SER N    N -15.754  -0.802  -3.582 1.00 . A A .   5 SER N    1 1 
        5  6566 1 1   5 SER O    O -15.660  -1.892  -6.363 1.00 . A A .   5 SER O    1 1 
        5  6567 1 1   5 SER OG   O -18.397  -2.987  -3.377 1.00 . A A .   5 SER OG   1 1 
        5  6568 1 1   6 SER C    C -12.974  -5.179  -5.880 1.00 . A A .   6 SER C    1 1 
        5  6569 1 1   6 SER CA   C -13.857  -4.007  -6.313 1.00 . A A .   6 SER CA   1 1 
        5  6570 1 1   6 SER CB   C -13.000  -2.891  -6.914 1.00 . A A .   6 SER CB   1 1 
        5  6571 1 1   6 SER H    H -14.476  -4.013  -4.324 1.00 . A A .   6 SER H    1 1 
        5  6572 1 1   6 SER HA   H -14.594  -4.334  -7.046 1.00 . A A .   6 SER HA   1 1 
        5  6573 1 1   6 SER HB2  H -13.496  -1.932  -6.763 1.00 . A A .   6 SER HB2  1 1 
        5  6574 1 1   6 SER HB3  H -12.047  -2.843  -6.389 1.00 . A A .   6 SER HB3  1 1 
        5  6575 1 1   6 SER HG   H -11.827  -3.398  -8.454 1.00 . A A .   6 SER HG   1 1 
        5  6576 1 1   6 SER N    N -14.629  -3.522  -5.182 1.00 . A A .   6 SER N    1 1 
        5  6577 1 1   6 SER O    O -12.688  -5.341  -4.694 1.00 . A A .   6 SER O    1 1 
        5  6578 1 1   6 SER OG   O -12.766  -3.089  -8.306 1.00 . A A .   6 SER OG   1 1 
        5  6579 1 1   7 GLY C    C -10.409  -6.695  -5.934 1.00 . A A .   7 GLY C    1 1 
        5  6580 1 1   7 GLY CA   C -11.720  -7.118  -6.600 1.00 . A A .   7 GLY CA   1 1 
        5  6581 1 1   7 GLY H    H -12.801  -5.827  -7.826 1.00 . A A .   7 GLY H    1 1 
        5  6582 1 1   7 GLY HA2  H -12.249  -7.821  -5.956 1.00 . A A .   7 GLY HA2  1 1 
        5  6583 1 1   7 GLY HA3  H -11.507  -7.639  -7.533 1.00 . A A .   7 GLY HA3  1 1 
        5  6584 1 1   7 GLY N    N -12.565  -5.966  -6.864 1.00 . A A .   7 GLY N    1 1 
        5  6585 1 1   7 GLY O    O -10.352  -6.530  -4.717 1.00 . A A .   7 GLY O    1 1 
        5  6586 1 1   8 PRO C    C  -8.038  -4.642  -5.925 1.00 . A A .   8 PRO C    1 1 
        5  6587 1 1   8 PRO CA   C  -8.054  -6.128  -6.292 1.00 . A A .   8 PRO CA   1 1 
        5  6588 1 1   8 PRO CB   C  -7.088  -6.473  -7.413 1.00 . A A .   8 PRO CB   1 1 
        5  6589 1 1   8 PRO CD   C  -9.392  -6.715  -8.232 1.00 . A A .   8 PRO CD   1 1 
        5  6590 1 1   8 PRO CG   C  -7.938  -6.621  -8.665 1.00 . A A .   8 PRO CG   1 1 
        5  6591 1 1   8 PRO HA   H  -7.835  -6.620  -5.449 1.00 . A A .   8 PRO HA   1 1 
        5  6592 1 1   8 PRO HB2  H  -6.340  -5.690  -7.539 1.00 . A A .   8 PRO HB2  1 1 
        5  6593 1 1   8 PRO HB3  H  -6.549  -7.395  -7.195 1.00 . A A .   8 PRO HB3  1 1 
        5  6594 1 1   8 PRO HD2  H  -9.999  -5.951  -8.717 1.00 . A A .   8 PRO HD2  1 1 
        5  6595 1 1   8 PRO HD3  H  -9.822  -7.681  -8.497 1.00 . A A .   8 PRO HD3  1 1 
        5  6596 1 1   8 PRO HG2  H  -7.791  -5.769  -9.329 1.00 . A A .   8 PRO HG2  1 1 
        5  6597 1 1   8 PRO HG3  H  -7.646  -7.512  -9.221 1.00 . A A .   8 PRO HG3  1 1 
        5  6598 1 1   8 PRO N    N  -9.361  -6.528  -6.784 1.00 . A A .   8 PRO N    1 1 
        5  6599 1 1   8 PRO O    O  -8.723  -3.837  -6.553 1.00 . A A .   8 PRO O    1 1 
        5  6600 1 1   9 LYS C    C  -5.676  -2.502  -4.558 1.00 . A A .   9 LYS C    1 1 
        5  6601 1 1   9 LYS CA   C  -7.134  -2.951  -4.451 1.00 . A A .   9 LYS CA   1 1 
        5  6602 1 1   9 LYS CB   C  -7.721  -2.804  -3.045 1.00 . A A .   9 LYS CB   1 1 
        5  6603 1 1   9 LYS CD   C  -6.813  -4.857  -1.896 1.00 . A A .   9 LYS CD   1 1 
        5  6604 1 1   9 LYS CE   C  -7.181  -5.306  -0.480 1.00 . A A .   9 LYS CE   1 1 
        5  6605 1 1   9 LYS CG   C  -6.749  -3.331  -1.988 1.00 . A A .   9 LYS CG   1 1 
        5  6606 1 1   9 LYS H    H  -6.695  -4.987  -4.403 1.00 . A A .   9 LYS H    1 1 
        5  6607 1 1   9 LYS HA   H  -7.736  -2.333  -5.117 1.00 . A A .   9 LYS HA   1 1 
        5  6608 1 1   9 LYS HB2  H  -7.945  -1.756  -2.848 1.00 . A A .   9 LYS HB2  1 1 
        5  6609 1 1   9 LYS HB3  H  -8.663  -3.349  -2.982 1.00 . A A .   9 LYS HB3  1 1 
        5  6610 1 1   9 LYS HD2  H  -7.548  -5.237  -2.605 1.00 . A A .   9 LYS HD2  1 1 
        5  6611 1 1   9 LYS HD3  H  -5.849  -5.282  -2.177 1.00 . A A .   9 LYS HD3  1 1 
        5  6612 1 1   9 LYS HE2  H  -6.866  -4.551   0.241 1.00 . A A .   9 LYS HE2  1 1 
        5  6613 1 1   9 LYS HE3  H  -8.263  -5.400  -0.392 1.00 . A A .   9 LYS HE3  1 1 
        5  6614 1 1   9 LYS HG2  H  -5.734  -3.020  -2.234 1.00 . A A .   9 LYS HG2  1 1 
        5  6615 1 1   9 LYS HG3  H  -6.989  -2.894  -1.018 1.00 . A A .   9 LYS HG3  1 1 
        5  6616 1 1   9 LYS HZ1  H  -6.780  -7.273  -0.863 1.00 . A A .   9 LYS HZ1  1 1 
        5  6617 1 1   9 LYS HZ2  H  -5.545  -6.484  -0.144 1.00 . A A .   9 LYS HZ2  1 1 
        5  6618 1 1   9 LYS HZ3  H  -6.853  -6.920   0.730 1.00 . A A .   9 LYS HZ3  1 1 
        5  6619 1 1   9 LYS N    N  -7.248  -4.325  -4.909 1.00 . A A .   9 LYS N    1 1 
        5  6620 1 1   9 LYS NZ   N  -6.538  -6.601  -0.164 1.00 . A A .   9 LYS NZ   1 1 
        5  6621 1 1   9 LYS O    O  -4.760  -3.307  -4.392 1.00 . A A .   9 LYS O    1 1 
        5  6622 1 1  10 LYS C    C  -3.351  -0.996  -3.723 1.00 . A A .  10 LYS C    1 1 
        5  6623 1 1  10 LYS CA   C  -4.172  -0.652  -4.967 1.00 . A A .  10 LYS CA   1 1 
        5  6624 1 1  10 LYS CB   C  -4.254   0.849  -5.255 1.00 . A A .  10 LYS CB   1 1 
        5  6625 1 1  10 LYS CD   C  -3.360   2.073  -7.270 1.00 . A A .  10 LYS CD   1 1 
        5  6626 1 1  10 LYS CE   C  -2.477   1.611  -8.431 1.00 . A A .  10 LYS CE   1 1 
        5  6627 1 1  10 LYS CG   C  -2.998   1.337  -5.979 1.00 . A A .  10 LYS CG   1 1 
        5  6628 1 1  10 LYS H    H  -6.254  -0.570  -4.970 1.00 . A A .  10 LYS H    1 1 
        5  6629 1 1  10 LYS HA   H  -3.702  -1.120  -5.832 1.00 . A A .  10 LYS HA   1 1 
        5  6630 1 1  10 LYS HB2  H  -5.133   1.060  -5.863 1.00 . A A .  10 LYS HB2  1 1 
        5  6631 1 1  10 LYS HB3  H  -4.375   1.396  -4.320 1.00 . A A .  10 LYS HB3  1 1 
        5  6632 1 1  10 LYS HD2  H  -4.408   1.895  -7.513 1.00 . A A .  10 LYS HD2  1 1 
        5  6633 1 1  10 LYS HD3  H  -3.244   3.147  -7.126 1.00 . A A .  10 LYS HD3  1 1 
        5  6634 1 1  10 LYS HE2  H  -1.943   0.703  -8.150 1.00 . A A .  10 LYS HE2  1 1 
        5  6635 1 1  10 LYS HE3  H  -3.098   1.363  -9.292 1.00 . A A .  10 LYS HE3  1 1 
        5  6636 1 1  10 LYS HG2  H  -2.432   2.001  -5.325 1.00 . A A .  10 LYS HG2  1 1 
        5  6637 1 1  10 LYS HG3  H  -2.352   0.489  -6.208 1.00 . A A .  10 LYS HG3  1 1 
        5  6638 1 1  10 LYS HZ1  H  -1.775   3.074  -9.674 1.00 . A A .  10 LYS HZ1  1 1 
        5  6639 1 1  10 LYS HZ2  H  -1.503   3.376  -8.092 1.00 . A A .  10 LYS HZ2  1 1 
        5  6640 1 1  10 LYS HZ3  H  -0.595   2.271  -8.880 1.00 . A A .  10 LYS HZ3  1 1 
        5  6641 1 1  10 LYS N    N  -5.504  -1.218  -4.836 1.00 . A A .  10 LYS N    1 1 
        5  6642 1 1  10 LYS NZ   N  -1.509   2.669  -8.799 1.00 . A A .  10 LYS NZ   1 1 
        5  6643 1 1  10 LYS O    O  -3.586  -0.445  -2.648 1.00 . A A .  10 LYS O    1 1 
        5  6644 1 1  11 PRO C    C  -0.479  -1.283  -2.496 1.00 . A A .  11 PRO C    1 1 
        5  6645 1 1  11 PRO CA   C  -1.524  -2.353  -2.821 1.00 . A A .  11 PRO CA   1 1 
        5  6646 1 1  11 PRO CB   C  -0.907  -3.661  -3.288 1.00 . A A .  11 PRO CB   1 1 
        5  6647 1 1  11 PRO CD   C  -2.074  -2.602  -5.173 1.00 . A A .  11 PRO CD   1 1 
        5  6648 1 1  11 PRO CG   C  -1.076  -3.686  -4.798 1.00 . A A .  11 PRO CG   1 1 
        5  6649 1 1  11 PRO HA   H  -2.061  -2.473  -1.986 1.00 . A A .  11 PRO HA   1 1 
        5  6650 1 1  11 PRO HB2  H   0.145  -3.718  -3.012 1.00 . A A .  11 PRO HB2  1 1 
        5  6651 1 1  11 PRO HB3  H  -1.405  -4.514  -2.826 1.00 . A A .  11 PRO HB3  1 1 
        5  6652 1 1  11 PRO HD2  H  -1.652  -1.909  -5.901 1.00 . A A .  11 PRO HD2  1 1 
        5  6653 1 1  11 PRO HD3  H  -2.971  -3.028  -5.623 1.00 . A A .  11 PRO HD3  1 1 
        5  6654 1 1  11 PRO HG2  H  -0.120  -3.511  -5.292 1.00 . A A .  11 PRO HG2  1 1 
        5  6655 1 1  11 PRO HG3  H  -1.432  -4.662  -5.127 1.00 . A A .  11 PRO HG3  1 1 
        5  6656 1 1  11 PRO N    N  -2.381  -1.929  -3.915 1.00 . A A .  11 PRO N    1 1 
        5  6657 1 1  11 PRO O    O  -0.270  -0.357  -3.278 1.00 . A A .  11 PRO O    1 1 
        5  6658 1 1  12 PRO C    C   2.486  -0.710  -1.648 1.00 . A A .  12 PRO C    1 1 
        5  6659 1 1  12 PRO CA   C   1.182  -0.509  -0.872 1.00 . A A .  12 PRO CA   1 1 
        5  6660 1 1  12 PRO CB   C   1.334  -0.761   0.620 1.00 . A A .  12 PRO CB   1 1 
        5  6661 1 1  12 PRO CD   C  -0.057  -2.534  -0.358 1.00 . A A .  12 PRO CD   1 1 
        5  6662 1 1  12 PRO CG   C   0.741  -2.137   0.873 1.00 . A A .  12 PRO CG   1 1 
        5  6663 1 1  12 PRO HA   H   0.893   0.429  -1.062 1.00 . A A .  12 PRO HA   1 1 
        5  6664 1 1  12 PRO HB2  H   2.382  -0.726   0.917 1.00 . A A .  12 PRO HB2  1 1 
        5  6665 1 1  12 PRO HB3  H   0.814   0.002   1.199 1.00 . A A .  12 PRO HB3  1 1 
        5  6666 1 1  12 PRO HD2  H   0.283  -3.489  -0.759 1.00 . A A .  12 PRO HD2  1 1 
        5  6667 1 1  12 PRO HD3  H  -1.116  -2.646  -0.125 1.00 . A A .  12 PRO HD3  1 1 
        5  6668 1 1  12 PRO HG2  H   1.530  -2.863   1.067 1.00 . A A .  12 PRO HG2  1 1 
        5  6669 1 1  12 PRO HG3  H   0.100  -2.120   1.754 1.00 . A A .  12 PRO HG3  1 1 
        5  6670 1 1  12 PRO N    N   0.165  -1.450  -1.310 1.00 . A A .  12 PRO N    1 1 
        5  6671 1 1  12 PRO O    O   2.551  -1.539  -2.554 1.00 . A A .  12 PRO O    1 1 
        5  6672 1 1  13 MET C    C   5.898   0.477  -0.983 1.00 . A A .  13 MET C    1 1 
        5  6673 1 1  13 MET CA   C   4.789  -0.021  -1.911 1.00 . A A .  13 MET CA   1 1 
        5  6674 1 1  13 MET CB   C   4.776   0.820  -3.189 1.00 . A A .  13 MET CB   1 1 
        5  6675 1 1  13 MET CE   C   6.744  -0.138  -5.516 1.00 . A A .  13 MET CE   1 1 
        5  6676 1 1  13 MET CG   C   4.262   0.005  -4.377 1.00 . A A .  13 MET CG   1 1 
        5  6677 1 1  13 MET H    H   3.430   0.733  -0.524 1.00 . A A .  13 MET H    1 1 
        5  6678 1 1  13 MET HA   H   4.938  -1.078  -2.133 1.00 . A A .  13 MET HA   1 1 
        5  6679 1 1  13 MET HB2  H   4.145   1.697  -3.045 1.00 . A A .  13 MET HB2  1 1 
        5  6680 1 1  13 MET HB3  H   5.782   1.182  -3.400 1.00 . A A .  13 MET HB3  1 1 
        5  6681 1 1  13 MET HE1  H   7.273   0.562  -4.868 1.00 . A A .  13 MET HE1  1 1 
        5  6682 1 1  13 MET HE2  H   6.660  -1.103  -5.016 1.00 . A A .  13 MET HE2  1 1 
        5  6683 1 1  13 MET HE3  H   7.296  -0.258  -6.448 1.00 . A A .  13 MET HE3  1 1 
        5  6684 1 1  13 MET HG2  H   4.416  -1.058  -4.193 1.00 . A A .  13 MET HG2  1 1 
        5  6685 1 1  13 MET HG3  H   3.189   0.155  -4.495 1.00 . A A .  13 MET HG3  1 1 
        5  6686 1 1  13 MET N    N   3.491   0.062  -1.263 1.00 . A A .  13 MET N    1 1 
        5  6687 1 1  13 MET O    O   5.673   1.362  -0.159 1.00 . A A .  13 MET O    1 1 
        5  6688 1 1  13 MET SD   S   5.112   0.495  -5.868 1.00 . A A .  13 MET SD   1 1 
        5  6689 1 1  14 ASN C    C   8.050  -0.320   1.072 1.00 . A A .  14 ASN C    1 1 
        5  6690 1 1  14 ASN CA   C   8.218   0.259  -0.334 1.00 . A A .  14 ASN CA   1 1 
        5  6691 1 1  14 ASN CB   C   8.333   1.779  -0.209 1.00 . A A .  14 ASN CB   1 1 
        5  6692 1 1  14 ASN CG   C   8.089   2.461  -1.557 1.00 . A A .  14 ASN CG   1 1 
        5  6693 1 1  14 ASN H    H   7.248  -0.833  -1.820 1.00 . A A .  14 ASN H    1 1 
        5  6694 1 1  14 ASN HA   H   9.084  -0.152  -0.853 1.00 . A A .  14 ASN HA   1 1 
        5  6695 1 1  14 ASN HB2  H   7.612   2.144   0.522 1.00 . A A .  14 ASN HB2  1 1 
        5  6696 1 1  14 ASN HB3  H   9.324   2.044   0.162 1.00 . A A .  14 ASN HB3  1 1 
        5  6697 1 1  14 ASN HD21 H   6.192   2.846  -0.966 1.00 . A A .  14 ASN HD21 1 1 
        5  6698 1 1  14 ASN HD22 H   6.603   3.409  -2.552 1.00 . A A .  14 ASN HD22 1 1 
        5  6699 1 1  14 ASN N    N   7.073  -0.114  -1.147 1.00 . A A .  14 ASN N    1 1 
        5  6700 1 1  14 ASN ND2  N   6.860   2.945  -1.704 1.00 . A A .  14 ASN ND2  1 1 
        5  6701 1 1  14 ASN O    O   8.895  -1.081   1.539 1.00 . A A .  14 ASN O    1 1 
        5  6702 1 1  14 ASN OD1  O   8.960   2.541  -2.408 1.00 . A A .  14 ASN OD1  1 1 
        5  6703 1 1  15 GLY C    C   6.053   0.707   3.903 1.00 . A A .  15 GLY C    1 1 
        5  6704 1 1  15 GLY CA   C   6.662  -0.408   3.051 1.00 . A A .  15 GLY CA   1 1 
        5  6705 1 1  15 GLY H    H   6.269   0.683   1.320 1.00 . A A .  15 GLY H    1 1 
        5  6706 1 1  15 GLY HA2  H   5.973  -1.252   3.003 1.00 . A A .  15 GLY HA2  1 1 
        5  6707 1 1  15 GLY HA3  H   7.577  -0.769   3.519 1.00 . A A .  15 GLY HA3  1 1 
        5  6708 1 1  15 GLY N    N   6.952   0.064   1.708 1.00 . A A .  15 GLY N    1 1 
        5  6709 1 1  15 GLY O    O   5.092   0.478   4.637 1.00 . A A .  15 GLY O    1 1 
        5  6710 1 1  16 TYR C    C   4.685   3.313   4.241 1.00 . A A .  16 TYR C    1 1 
        5  6711 1 1  16 TYR CA   C   6.163   3.041   4.528 1.00 . A A .  16 TYR CA   1 1 
        5  6712 1 1  16 TYR CB   C   6.992   4.231   4.042 1.00 . A A .  16 TYR CB   1 1 
        5  6713 1 1  16 TYR CD1  C   6.291   5.804   5.884 1.00 . A A .  16 TYR CD1  1 1 
        5  6714 1 1  16 TYR CD2  C   6.214   6.594   3.629 1.00 . A A .  16 TYR CD2  1 1 
        5  6715 1 1  16 TYR CE1  C   5.812   7.080   6.348 1.00 . A A .  16 TYR CE1  1 1 
        5  6716 1 1  16 TYR CE2  C   5.735   7.870   4.093 1.00 . A A .  16 TYR CE2  1 1 
        5  6717 1 1  16 TYR CG   C   6.482   5.587   4.534 1.00 . A A .  16 TYR CG   1 1 
        5  6718 1 1  16 TYR CZ   C   5.557   8.050   5.430 1.00 . A A .  16 TYR CZ   1 1 
        5  6719 1 1  16 TYR H    H   7.417   2.068   3.179 1.00 . A A .  16 TYR H    1 1 
        5  6720 1 1  16 TYR HA   H   6.285   2.825   5.589 1.00 . A A .  16 TYR HA   1 1 
        5  6721 1 1  16 TYR HB2  H   8.023   4.101   4.370 1.00 . A A .  16 TYR HB2  1 1 
        5  6722 1 1  16 TYR HB3  H   7.002   4.233   2.952 1.00 . A A .  16 TYR HB3  1 1 
        5  6723 1 1  16 TYR HD1  H   6.503   5.008   6.599 1.00 . A A .  16 TYR HD1  1 1 
        5  6724 1 1  16 TYR HD2  H   6.365   6.423   2.564 1.00 . A A .  16 TYR HD2  1 1 
        5  6725 1 1  16 TYR HE1  H   5.657   7.264   7.411 1.00 . A A .  16 TYR HE1  1 1 
        5  6726 1 1  16 TYR HE2  H   5.519   8.674   3.389 1.00 . A A .  16 TYR HE2  1 1 
        5  6727 1 1  16 TYR HH   H   4.337   9.559   5.302 1.00 . A A .  16 TYR HH   1 1 
        5  6728 1 1  16 TYR N    N   6.636   1.890   3.778 1.00 . A A .  16 TYR N    1 1 
        5  6729 1 1  16 TYR O    O   3.909   3.580   5.157 1.00 . A A .  16 TYR O    1 1 
        5  6730 1 1  16 TYR OH   O   5.104   9.256   5.868 1.00 . A A .  16 TYR OH   1 1 
        5  6731 1 1  17 GLN C    C   2.029   2.461   3.211 1.00 . A A .  17 GLN C    1 1 
        5  6732 1 1  17 GLN CA   C   2.968   3.469   2.544 1.00 . A A .  17 GLN CA   1 1 
        5  6733 1 1  17 GLN CB   C   2.843   3.410   1.021 1.00 . A A .  17 GLN CB   1 1 
        5  6734 1 1  17 GLN CD   C   3.216   4.689  -1.120 1.00 . A A .  17 GLN CD   1 1 
        5  6735 1 1  17 GLN CG   C   3.568   4.587   0.365 1.00 . A A .  17 GLN CG   1 1 
        5  6736 1 1  17 GLN H    H   4.976   3.017   2.225 1.00 . A A .  17 GLN H    1 1 
        5  6737 1 1  17 GLN HA   H   2.729   4.477   2.883 1.00 . A A .  17 GLN HA   1 1 
        5  6738 1 1  17 GLN HB2  H   3.259   2.471   0.654 1.00 . A A .  17 GLN HB2  1 1 
        5  6739 1 1  17 GLN HB3  H   1.791   3.423   0.737 1.00 . A A .  17 GLN HB3  1 1 
        5  6740 1 1  17 GLN HE21 H   3.576   2.705  -1.295 1.00 . A A .  17 GLN HE21 1 1 
        5  6741 1 1  17 GLN HE22 H   3.090   3.501  -2.754 1.00 . A A .  17 GLN HE22 1 1 
        5  6742 1 1  17 GLN HG2  H   3.298   5.513   0.872 1.00 . A A .  17 GLN HG2  1 1 
        5  6743 1 1  17 GLN HG3  H   4.645   4.464   0.479 1.00 . A A .  17 GLN HG3  1 1 
        5  6744 1 1  17 GLN N    N   4.339   3.235   2.964 1.00 . A A .  17 GLN N    1 1 
        5  6745 1 1  17 GLN NE2  N   3.301   3.536  -1.777 1.00 . A A .  17 GLN NE2  1 1 
        5  6746 1 1  17 GLN O    O   0.867   2.768   3.472 1.00 . A A .  17 GLN O    1 1 
        5  6747 1 1  17 GLN OE1  O   2.888   5.746  -1.635 1.00 . A A .  17 GLN OE1  1 1 
        5  6748 1 1  18 LYS C    C   1.516   0.602   5.554 1.00 . A A .  18 LYS C    1 1 
        5  6749 1 1  18 LYS CA   C   1.794   0.223   4.097 1.00 . A A .  18 LYS CA   1 1 
        5  6750 1 1  18 LYS CB   C   2.496  -1.127   3.937 1.00 . A A .  18 LYS CB   1 1 
        5  6751 1 1  18 LYS CD   C   0.374  -2.291   4.647 1.00 . A A .  18 LYS CD   1 1 
        5  6752 1 1  18 LYS CE   C  -0.060  -3.756   4.573 1.00 . A A .  18 LYS CE   1 1 
        5  6753 1 1  18 LYS CG   C   1.884  -2.177   4.866 1.00 . A A .  18 LYS CG   1 1 
        5  6754 1 1  18 LYS H    H   3.515   1.036   3.251 1.00 . A A .  18 LYS H    1 1 
        5  6755 1 1  18 LYS HA   H   0.842   0.156   3.570 1.00 . A A .  18 LYS HA   1 1 
        5  6756 1 1  18 LYS HB2  H   2.417  -1.461   2.902 1.00 . A A .  18 LYS HB2  1 1 
        5  6757 1 1  18 LYS HB3  H   3.558  -1.017   4.155 1.00 . A A .  18 LYS HB3  1 1 
        5  6758 1 1  18 LYS HD2  H  -0.153  -1.792   5.460 1.00 . A A .  18 LYS HD2  1 1 
        5  6759 1 1  18 LYS HD3  H   0.097  -1.778   3.725 1.00 . A A .  18 LYS HD3  1 1 
        5  6760 1 1  18 LYS HE2  H  -0.434  -3.980   3.574 1.00 . A A .  18 LYS HE2  1 1 
        5  6761 1 1  18 LYS HE3  H   0.798  -4.405   4.745 1.00 . A A .  18 LYS HE3  1 1 
        5  6762 1 1  18 LYS HG2  H   2.355  -3.144   4.687 1.00 . A A .  18 LYS HG2  1 1 
        5  6763 1 1  18 LYS HG3  H   2.086  -1.911   5.904 1.00 . A A .  18 LYS HG3  1 1 
        5  6764 1 1  18 LYS HZ1  H  -0.867  -4.857   6.093 1.00 . A A .  18 LYS HZ1  1 1 
        5  6765 1 1  18 LYS HZ2  H  -1.190  -3.260   6.202 1.00 . A A .  18 LYS HZ2  1 1 
        5  6766 1 1  18 LYS HZ3  H  -1.985  -4.181   5.113 1.00 . A A .  18 LYS HZ3  1 1 
        5  6767 1 1  18 LYS N    N   2.569   1.278   3.467 1.00 . A A .  18 LYS N    1 1 
        5  6768 1 1  18 LYS NZ   N  -1.111  -4.036   5.576 1.00 . A A .  18 LYS NZ   1 1 
        5  6769 1 1  18 LYS O    O   0.360   0.741   5.953 1.00 . A A .  18 LYS O    1 1 
        5  6770 1 1  19 PHE C    C   1.577   2.339   7.892 1.00 . A A .  19 PHE C    1 1 
        5  6771 1 1  19 PHE CA   C   2.480   1.117   7.711 1.00 . A A .  19 PHE CA   1 1 
        5  6772 1 1  19 PHE CB   C   3.889   1.461   8.200 1.00 . A A .  19 PHE CB   1 1 
        5  6773 1 1  19 PHE CD1  C   3.665   2.023  10.630 1.00 . A A .  19 PHE CD1  1 1 
        5  6774 1 1  19 PHE CD2  C   4.197   3.764   9.135 1.00 . A A .  19 PHE CD2  1 1 
        5  6775 1 1  19 PHE CE1  C   3.692   2.943  11.711 1.00 . A A .  19 PHE CE1  1 1 
        5  6776 1 1  19 PHE CE2  C   4.224   4.684  10.216 1.00 . A A .  19 PHE CE2  1 1 
        5  6777 1 1  19 PHE CG   C   3.918   2.453   9.364 1.00 . A A .  19 PHE CG   1 1 
        5  6778 1 1  19 PHE CZ   C   3.971   4.254  11.481 1.00 . A A .  19 PHE CZ   1 1 
        5  6779 1 1  19 PHE H    H   3.530   0.642   5.975 1.00 . A A .  19 PHE H    1 1 
        5  6780 1 1  19 PHE HA   H   2.043   0.264   8.229 1.00 . A A .  19 PHE HA   1 1 
        5  6781 1 1  19 PHE HB2  H   4.391   0.543   8.505 1.00 . A A .  19 PHE HB2  1 1 
        5  6782 1 1  19 PHE HB3  H   4.459   1.876   7.369 1.00 . A A .  19 PHE HB3  1 1 
        5  6783 1 1  19 PHE HD1  H   3.441   0.972  10.814 1.00 . A A .  19 PHE HD1  1 1 
        5  6784 1 1  19 PHE HD2  H   4.400   4.108   8.121 1.00 . A A .  19 PHE HD2  1 1 
        5  6785 1 1  19 PHE HE1  H   3.489   2.599  12.725 1.00 . A A .  19 PHE HE1  1 1 
        5  6786 1 1  19 PHE HE2  H   4.448   5.735  10.032 1.00 . A A .  19 PHE HE2  1 1 
        5  6787 1 1  19 PHE HZ   H   3.992   4.961  12.311 1.00 . A A .  19 PHE HZ   1 1 
        5  6788 1 1  19 PHE N    N   2.594   0.757   6.307 1.00 . A A .  19 PHE N    1 1 
        5  6789 1 1  19 PHE O    O   0.757   2.379   8.808 1.00 . A A .  19 PHE O    1 1 
        5  6790 1 1  20 SER C    C  -0.518   4.191   6.960 1.00 . A A .  20 SER C    1 1 
        5  6791 1 1  20 SER CA   C   0.971   4.526   7.056 1.00 . A A .  20 SER CA   1 1 
        5  6792 1 1  20 SER CB   C   1.372   5.488   5.935 1.00 . A A .  20 SER CB   1 1 
        5  6793 1 1  20 SER H    H   2.429   3.266   6.263 1.00 . A A .  20 SER H    1 1 
        5  6794 1 1  20 SER HA   H   1.201   4.978   8.021 1.00 . A A .  20 SER HA   1 1 
        5  6795 1 1  20 SER HB2  H   1.189   5.016   4.970 1.00 . A A .  20 SER HB2  1 1 
        5  6796 1 1  20 SER HB3  H   0.744   6.377   5.979 1.00 . A A .  20 SER HB3  1 1 
        5  6797 1 1  20 SER HG   H   2.883   6.746   5.565 1.00 . A A .  20 SER HG   1 1 
        5  6798 1 1  20 SER N    N   1.759   3.306   7.005 1.00 . A A .  20 SER N    1 1 
        5  6799 1 1  20 SER O    O  -1.299   4.559   7.836 1.00 . A A .  20 SER O    1 1 
        5  6800 1 1  20 SER OG   O   2.742   5.869   6.024 1.00 . A A .  20 SER OG   1 1 
        5  6801 1 1  21 GLN C    C  -2.845   2.510   6.943 1.00 . A A .  21 GLN C    1 1 
        5  6802 1 1  21 GLN CA   C  -2.251   3.107   5.666 1.00 . A A .  21 GLN CA   1 1 
        5  6803 1 1  21 GLN CB   C  -2.364   2.126   4.498 1.00 . A A .  21 GLN CB   1 1 
        5  6804 1 1  21 GLN CD   C  -3.283   1.836   2.167 1.00 . A A .  21 GLN CD   1 1 
        5  6805 1 1  21 GLN CG   C  -2.817   2.841   3.223 1.00 . A A .  21 GLN CG   1 1 
        5  6806 1 1  21 GLN H    H  -0.227   3.200   5.179 1.00 . A A .  21 GLN H    1 1 
        5  6807 1 1  21 GLN HA   H  -2.774   4.029   5.410 1.00 . A A .  21 GLN HA   1 1 
        5  6808 1 1  21 GLN HB2  H  -1.400   1.646   4.326 1.00 . A A .  21 GLN HB2  1 1 
        5  6809 1 1  21 GLN HB3  H  -3.073   1.337   4.748 1.00 . A A .  21 GLN HB3  1 1 
        5  6810 1 1  21 GLN HE21 H  -1.771   2.461   0.974 1.00 . A A .  21 GLN HE21 1 1 
        5  6811 1 1  21 GLN HE22 H  -2.774   1.215   0.309 1.00 . A A .  21 GLN HE22 1 1 
        5  6812 1 1  21 GLN HG2  H  -3.629   3.530   3.458 1.00 . A A .  21 GLN HG2  1 1 
        5  6813 1 1  21 GLN HG3  H  -1.997   3.438   2.825 1.00 . A A .  21 GLN HG3  1 1 
        5  6814 1 1  21 GLN N    N  -0.868   3.496   5.888 1.00 . A A .  21 GLN N    1 1 
        5  6815 1 1  21 GLN NE2  N  -2.549   1.837   1.058 1.00 . A A .  21 GLN NE2  1 1 
        5  6816 1 1  21 GLN O    O  -4.034   2.672   7.213 1.00 . A A .  21 GLN O    1 1 
        5  6817 1 1  21 GLN OE1  O  -4.246   1.108   2.347 1.00 . A A .  21 GLN OE1  1 1 
        5  6818 1 1  22 GLU C    C  -2.870   2.275   9.936 1.00 . A A .  22 GLU C    1 1 
        5  6819 1 1  22 GLU CA   C  -2.417   1.209   8.937 1.00 . A A .  22 GLU CA   1 1 
        5  6820 1 1  22 GLU CB   C  -1.302   0.343   9.527 1.00 . A A .  22 GLU CB   1 1 
        5  6821 1 1  22 GLU CD   C  -1.181  -2.175   9.604 1.00 . A A .  22 GLU CD   1 1 
        5  6822 1 1  22 GLU CG   C  -1.872  -0.928  10.159 1.00 . A A .  22 GLU CG   1 1 
        5  6823 1 1  22 GLU H    H  -1.025   1.705   7.468 1.00 . A A .  22 GLU H    1 1 
        5  6824 1 1  22 GLU HA   H  -3.259   0.573   8.668 1.00 . A A .  22 GLU HA   1 1 
        5  6825 1 1  22 GLU HB2  H  -0.591   0.077   8.744 1.00 . A A .  22 GLU HB2  1 1 
        5  6826 1 1  22 GLU HB3  H  -0.753   0.912  10.276 1.00 . A A .  22 GLU HB3  1 1 
        5  6827 1 1  22 GLU HG2  H  -1.745  -0.888  11.241 1.00 . A A .  22 GLU HG2  1 1 
        5  6828 1 1  22 GLU HG3  H  -2.943  -0.985   9.967 1.00 . A A .  22 GLU HG3  1 1 
        5  6829 1 1  22 GLU N    N  -1.991   1.832   7.695 1.00 . A A .  22 GLU N    1 1 
        5  6830 1 1  22 GLU O    O  -3.888   2.110  10.607 1.00 . A A .  22 GLU O    1 1 
        5  6831 1 1  22 GLU OE1  O  -1.200  -2.329   8.364 1.00 . A A .  22 GLU OE1  1 1 
        5  6832 1 1  22 GLU OE2  O  -0.649  -2.945  10.432 1.00 . A A .  22 GLU OE2  1 1 
        5  6833 1 1  23 LEU C    C  -3.647   5.172  10.413 1.00 . A A .  23 LEU C    1 1 
        5  6834 1 1  23 LEU CA   C  -2.400   4.439  10.911 1.00 . A A .  23 LEU CA   1 1 
        5  6835 1 1  23 LEU CB   C  -1.182   5.347  11.089 1.00 . A A .  23 LEU CB   1 1 
        5  6836 1 1  23 LEU CD1  C   1.334   5.192  11.154 1.00 . A A .  23 LEU CD1  1 1 
        5  6837 1 1  23 LEU CD2  C  -0.013   4.996  13.295 1.00 . A A .  23 LEU CD2  1 1 
        5  6838 1 1  23 LEU CG   C   0.025   4.721  11.791 1.00 . A A .  23 LEU CG   1 1 
        5  6839 1 1  23 LEU H    H  -1.266   3.473   9.455 1.00 . A A .  23 LEU H    1 1 
        5  6840 1 1  23 LEU HA   H  -2.622   4.003  11.885 1.00 . A A .  23 LEU HA   1 1 
        5  6841 1 1  23 LEU HB2  H  -0.866   5.694  10.105 1.00 . A A .  23 LEU HB2  1 1 
        5  6842 1 1  23 LEU HB3  H  -1.490   6.227  11.654 1.00 . A A .  23 LEU HB3  1 1 
        5  6843 1 1  23 LEU HD11 H   1.794   4.364  10.615 1.00 . A A .  23 LEU HD11 1 1 
        5  6844 1 1  23 LEU HD12 H   1.128   6.008  10.462 1.00 . A A .  23 LEU HD12 1 1 
        5  6845 1 1  23 LEU HD13 H   2.012   5.539  11.934 1.00 . A A .  23 LEU HD13 1 1 
        5  6846 1 1  23 LEU HD21 H  -0.296   6.034  13.468 1.00 . A A .  23 LEU HD21 1 1 
        5  6847 1 1  23 LEU HD22 H  -0.741   4.337  13.767 1.00 . A A .  23 LEU HD22 1 1 
        5  6848 1 1  23 LEU HD23 H   0.973   4.813  13.723 1.00 . A A .  23 LEU HD23 1 1 
        5  6849 1 1  23 LEU HG   H  -0.027   3.640  11.660 1.00 . A A .  23 LEU HG   1 1 
        5  6850 1 1  23 LEU N    N  -2.092   3.346  10.004 1.00 . A A .  23 LEU N    1 1 
        5  6851 1 1  23 LEU O    O  -4.366   5.787  11.199 1.00 . A A .  23 LEU O    1 1 
        5  6852 1 1  24 LEU C    C  -6.258   4.871   8.720 1.00 . A A .  24 LEU C    1 1 
        5  6853 1 1  24 LEU CA   C  -5.013   5.731   8.496 1.00 . A A .  24 LEU CA   1 1 
        5  6854 1 1  24 LEU CB   C  -4.733   6.037   7.024 1.00 . A A .  24 LEU CB   1 1 
        5  6855 1 1  24 LEU CD1  C  -3.602   7.450   5.267 1.00 . A A .  24 LEU CD1  1 1 
        5  6856 1 1  24 LEU CD2  C  -3.820   8.305   7.645 1.00 . A A .  24 LEU CD2  1 1 
        5  6857 1 1  24 LEU CG   C  -3.644   7.077   6.750 1.00 . A A .  24 LEU CG   1 1 
        5  6858 1 1  24 LEU H    H  -3.276   4.582   8.476 1.00 . A A .  24 LEU H    1 1 
        5  6859 1 1  24 LEU HA   H  -5.158   6.686   9.002 1.00 . A A .  24 LEU HA   1 1 
        5  6860 1 1  24 LEU HB2  H  -4.454   5.108   6.527 1.00 . A A .  24 LEU HB2  1 1 
        5  6861 1 1  24 LEU HB3  H  -5.659   6.380   6.562 1.00 . A A .  24 LEU HB3  1 1 
        5  6862 1 1  24 LEU HD11 H  -3.025   8.365   5.139 1.00 . A A .  24 LEU HD11 1 1 
        5  6863 1 1  24 LEU HD12 H  -3.134   6.643   4.702 1.00 . A A .  24 LEU HD12 1 1 
        5  6864 1 1  24 LEU HD13 H  -4.617   7.606   4.903 1.00 . A A .  24 LEU HD13 1 1 
        5  6865 1 1  24 LEU HD21 H  -3.320   8.134   8.599 1.00 . A A .  24 LEU HD21 1 1 
        5  6866 1 1  24 LEU HD22 H  -3.384   9.176   7.157 1.00 . A A .  24 LEU HD22 1 1 
        5  6867 1 1  24 LEU HD23 H  -4.882   8.478   7.819 1.00 . A A .  24 LEU HD23 1 1 
        5  6868 1 1  24 LEU HG   H  -2.679   6.634   6.998 1.00 . A A .  24 LEU HG   1 1 
        5  6869 1 1  24 LEU N    N  -3.866   5.084   9.109 1.00 . A A .  24 LEU N    1 1 
        5  6870 1 1  24 LEU O    O  -7.375   5.386   8.757 1.00 . A A .  24 LEU O    1 1 
        5  6871 1 1  25 SER C    C  -7.286   2.376  10.578 1.00 . A A .  25 SER C    1 1 
        5  6872 1 1  25 SER CA   C  -7.113   2.637   9.081 1.00 . A A .  25 SER CA   1 1 
        5  6873 1 1  25 SER CB   C  -6.867   1.323   8.337 1.00 . A A .  25 SER CB   1 1 
        5  6874 1 1  25 SER H    H  -5.114   3.164   8.830 1.00 . A A .  25 SER H    1 1 
        5  6875 1 1  25 SER HA   H  -7.999   3.124   8.672 1.00 . A A .  25 SER HA   1 1 
        5  6876 1 1  25 SER HB2  H  -5.904   1.370   7.827 1.00 . A A .  25 SER HB2  1 1 
        5  6877 1 1  25 SER HB3  H  -6.806   0.506   9.056 1.00 . A A .  25 SER HB3  1 1 
        5  6878 1 1  25 SER HG   H  -8.098   0.067   7.383 1.00 . A A .  25 SER HG   1 1 
        5  6879 1 1  25 SER N    N  -6.025   3.574   8.862 1.00 . A A .  25 SER N    1 1 
        5  6880 1 1  25 SER O    O  -8.349   1.939  11.017 1.00 . A A .  25 SER O    1 1 
        5  6881 1 1  25 SER OG   O  -7.893   1.045   7.388 1.00 . A A .  25 SER OG   1 1 
        5  6882 1 1  26 ASN C    C  -7.035   3.589  13.417 1.00 . A A .  26 ASN C    1 1 
        5  6883 1 1  26 ASN CA   C  -6.247   2.455  12.760 1.00 . A A .  26 ASN CA   1 1 
        5  6884 1 1  26 ASN CB   C  -4.830   2.467  13.339 1.00 . A A .  26 ASN CB   1 1 
        5  6885 1 1  26 ASN CG   C  -4.088   1.173  12.999 1.00 . A A .  26 ASN CG   1 1 
        5  6886 1 1  26 ASN H    H  -5.365   3.009  10.956 1.00 . A A .  26 ASN H    1 1 
        5  6887 1 1  26 ASN HA   H  -6.715   1.482  12.908 1.00 . A A .  26 ASN HA   1 1 
        5  6888 1 1  26 ASN HB2  H  -4.280   3.321  12.944 1.00 . A A .  26 ASN HB2  1 1 
        5  6889 1 1  26 ASN HB3  H  -4.877   2.590  14.421 1.00 . A A .  26 ASN HB3  1 1 
        5  6890 1 1  26 ASN HD21 H  -2.401   2.262  12.746 1.00 . A A .  26 ASN HD21 1 1 
        5  6891 1 1  26 ASN HD22 H  -2.228   0.559  12.487 1.00 . A A .  26 ASN HD22 1 1 
        5  6892 1 1  26 ASN N    N  -6.225   2.654  11.321 1.00 . A A .  26 ASN N    1 1 
        5  6893 1 1  26 ASN ND2  N  -2.799   1.346  12.721 1.00 . A A .  26 ASN ND2  1 1 
        5  6894 1 1  26 ASN O    O  -8.053   3.349  14.064 1.00 . A A .  26 ASN O    1 1 
        5  6895 1 1  26 ASN OD1  O  -4.649   0.089  12.990 1.00 . A A .  26 ASN OD1  1 1 
        5  6896 1 1  27 GLY C    C  -6.421   6.478  15.022 1.00 . A A .  27 GLY C    1 1 
        5  6897 1 1  27 GLY CA   C  -7.180   5.974  13.793 1.00 . A A .  27 GLY CA   1 1 
        5  6898 1 1  27 GLY H    H  -5.707   4.988  12.699 1.00 . A A .  27 GLY H    1 1 
        5  6899 1 1  27 GLY HA2  H  -7.230   6.764  13.043 1.00 . A A .  27 GLY HA2  1 1 
        5  6900 1 1  27 GLY HA3  H  -8.206   5.731  14.069 1.00 . A A .  27 GLY HA3  1 1 
        5  6901 1 1  27 GLY N    N  -6.535   4.802  13.227 1.00 . A A .  27 GLY N    1 1 
        5  6902 1 1  27 GLY O    O  -7.003   7.120  15.895 1.00 . A A .  27 GLY O    1 1 
        5  6903 1 1  28 GLU C    C  -3.997   8.083  16.071 1.00 . A A .  28 GLU C    1 1 
        5  6904 1 1  28 GLU CA   C  -4.288   6.583  16.157 1.00 . A A .  28 GLU CA   1 1 
        5  6905 1 1  28 GLU CB   C  -2.990   5.774  16.189 1.00 . A A .  28 GLU CB   1 1 
        5  6906 1 1  28 GLU CD   C  -2.494   3.322  16.513 1.00 . A A .  28 GLU CD   1 1 
        5  6907 1 1  28 GLU CG   C  -3.213   4.360  15.648 1.00 . A A .  28 GLU CG   1 1 
        5  6908 1 1  28 GLU H    H  -4.667   5.648  14.335 1.00 . A A .  28 GLU H    1 1 
        5  6909 1 1  28 GLU HA   H  -4.865   6.369  17.057 1.00 . A A .  28 GLU HA   1 1 
        5  6910 1 1  28 GLU HB2  H  -2.228   6.279  15.596 1.00 . A A .  28 GLU HB2  1 1 
        5  6911 1 1  28 GLU HB3  H  -2.615   5.721  17.211 1.00 . A A .  28 GLU HB3  1 1 
        5  6912 1 1  28 GLU HG2  H  -4.280   4.141  15.621 1.00 . A A .  28 GLU HG2  1 1 
        5  6913 1 1  28 GLU HG3  H  -2.849   4.298  14.622 1.00 . A A .  28 GLU HG3  1 1 
        5  6914 1 1  28 GLU N    N  -5.133   6.170  15.050 1.00 . A A .  28 GLU N    1 1 
        5  6915 1 1  28 GLU O    O  -3.602   8.700  17.060 1.00 . A A .  28 GLU O    1 1 
        5  6916 1 1  28 GLU OE1  O  -1.285   3.526  16.757 1.00 . A A .  28 GLU OE1  1 1 
        5  6917 1 1  28 GLU OE2  O  -3.171   2.349  16.911 1.00 . A A .  28 GLU OE2  1 1 
        5  6918 1 1  29 LEU C    C  -5.164  10.640  13.908 1.00 . A A .  29 LEU C    1 1 
        5  6919 1 1  29 LEU CA   C  -3.968  10.042  14.653 1.00 . A A .  29 LEU CA   1 1 
        5  6920 1 1  29 LEU CB   C  -2.631  10.255  13.941 1.00 . A A .  29 LEU CB   1 1 
        5  6921 1 1  29 LEU CD1  C  -0.788   9.104  12.661 1.00 . A A .  29 LEU CD1  1 1 
        5  6922 1 1  29 LEU CD2  C  -0.900   8.909  15.188 1.00 . A A .  29 LEU CD2  1 1 
        5  6923 1 1  29 LEU CG   C  -1.698   9.043  13.889 1.00 . A A .  29 LEU CG   1 1 
        5  6924 1 1  29 LEU H    H  -4.525   8.117  14.082 1.00 . A A .  29 LEU H    1 1 
        5  6925 1 1  29 LEU HA   H  -3.894  10.522  15.629 1.00 . A A .  29 LEU HA   1 1 
        5  6926 1 1  29 LEU HB2  H  -2.833  10.576  12.919 1.00 . A A .  29 LEU HB2  1 1 
        5  6927 1 1  29 LEU HB3  H  -2.105  11.072  14.434 1.00 . A A .  29 LEU HB3  1 1 
        5  6928 1 1  29 LEU HD11 H  -0.623   8.096  12.280 1.00 . A A .  29 LEU HD11 1 1 
        5  6929 1 1  29 LEU HD12 H  -1.260   9.711  11.888 1.00 . A A .  29 LEU HD12 1 1 
        5  6930 1 1  29 LEU HD13 H   0.168   9.548  12.939 1.00 . A A .  29 LEU HD13 1 1 
        5  6931 1 1  29 LEU HD21 H   0.150   9.127  14.993 1.00 . A A .  29 LEU HD21 1 1 
        5  6932 1 1  29 LEU HD22 H  -1.286   9.613  15.925 1.00 . A A .  29 LEU HD22 1 1 
        5  6933 1 1  29 LEU HD23 H  -0.996   7.893  15.570 1.00 . A A .  29 LEU HD23 1 1 
        5  6934 1 1  29 LEU HG   H  -2.309   8.145  13.793 1.00 . A A .  29 LEU HG   1 1 
        5  6935 1 1  29 LEU N    N  -4.204   8.626  14.881 1.00 . A A .  29 LEU N    1 1 
        5  6936 1 1  29 LEU O    O  -4.991  11.459  13.007 1.00 . A A .  29 LEU O    1 1 
        5  6937 1 1  30 ASN C    C  -8.026  11.967  14.403 1.00 . A A .  30 ASN C    1 1 
        5  6938 1 1  30 ASN CA   C  -7.572  10.689  13.695 1.00 . A A .  30 ASN CA   1 1 
        5  6939 1 1  30 ASN CB   C  -8.695   9.657  13.817 1.00 . A A .  30 ASN CB   1 1 
        5  6940 1 1  30 ASN CG   C  -9.305   9.674  15.220 1.00 . A A .  30 ASN CG   1 1 
        5  6941 1 1  30 ASN H    H  -6.480   9.540  15.046 1.00 . A A .  30 ASN H    1 1 
        5  6942 1 1  30 ASN HA   H  -7.317  10.860  12.649 1.00 . A A .  30 ASN HA   1 1 
        5  6943 1 1  30 ASN HB2  H  -9.468   9.866  13.078 1.00 . A A .  30 ASN HB2  1 1 
        5  6944 1 1  30 ASN HB3  H  -8.305   8.663  13.598 1.00 . A A .  30 ASN HB3  1 1 
        5  6945 1 1  30 ASN HD21 H  -8.406   7.896  15.582 1.00 . A A .  30 ASN HD21 1 1 
        5  6946 1 1  30 ASN HD22 H  -9.344   8.532  16.892 1.00 . A A .  30 ASN HD22 1 1 
        5  6947 1 1  30 ASN N    N  -6.349  10.207  14.313 1.00 . A A .  30 ASN N    1 1 
        5  6948 1 1  30 ASN ND2  N  -8.992   8.613  15.959 1.00 . A A .  30 ASN ND2  1 1 
        5  6949 1 1  30 ASN O    O  -9.022  12.576  14.015 1.00 . A A .  30 ASN O    1 1 
        5  6950 1 1  30 ASN OD1  O -10.013  10.590  15.606 1.00 . A A .  30 ASN OD1  1 1 
        5  6951 1 1  31 HIS C    C  -7.139  14.771  15.416 1.00 . A A .  31 HIS C    1 1 
        5  6952 1 1  31 HIS CA   C  -7.586  13.532  16.194 1.00 . A A .  31 HIS CA   1 1 
        5  6953 1 1  31 HIS CB   C  -6.971  13.457  17.593 1.00 . A A .  31 HIS CB   1 1 
        5  6954 1 1  31 HIS CD2  C  -4.429  14.045  17.736 1.00 . A A .  31 HIS CD2  1 1 
        5  6955 1 1  31 HIS CE1  C  -3.627  12.024  17.494 1.00 . A A .  31 HIS CE1  1 1 
        5  6956 1 1  31 HIS CG   C  -5.484  13.193  17.598 1.00 . A A .  31 HIS CG   1 1 
        5  6957 1 1  31 HIS H    H  -6.465  11.836  15.738 1.00 . A A .  31 HIS H    1 1 
        5  6958 1 1  31 HIS HA   H  -8.670  13.556  16.308 1.00 . A A .  31 HIS HA   1 1 
        5  6959 1 1  31 HIS HB2  H  -7.165  14.394  18.115 1.00 . A A .  31 HIS HB2  1 1 
        5  6960 1 1  31 HIS HB3  H  -7.471  12.669  18.157 1.00 . A A .  31 HIS HB3  1 1 
        5  6961 1 1  31 HIS HD1  H  -5.467  11.081  17.323 1.00 . A A .  31 HIS HD1  1 1 
        5  6962 1 1  31 HIS HD2  H  -4.495  15.124  17.874 1.00 . A A .  31 HIS HD2  1 1 
        5  6963 1 1  31 HIS HE1  H  -2.920  11.199  17.405 1.00 . A A .  31 HIS HE1  1 1 
        5  6964 1 1  31 HIS N    N  -7.273  12.337  15.429 1.00 . A A .  31 HIS N    1 1 
        5  6965 1 1  31 HIS ND1  N  -4.947  11.926  17.447 1.00 . A A .  31 HIS ND1  1 1 
        5  6966 1 1  31 HIS NE2  N  -3.307  13.338  17.674 1.00 . A A .  31 HIS NE2  1 1 
        5  6967 1 1  31 HIS O    O  -7.699  15.852  15.589 1.00 . A A .  31 HIS O    1 1 
        5  6968 1 1  32 LEU C    C  -6.016  15.454  12.311 1.00 . A A .  32 LEU C    1 1 
        5  6969 1 1  32 LEU CA   C  -5.606  15.660  13.770 1.00 . A A .  32 LEU CA   1 1 
        5  6970 1 1  32 LEU CB   C  -4.095  15.791  13.972 1.00 . A A .  32 LEU CB   1 1 
        5  6971 1 1  32 LEU CD1  C  -3.306  13.529  13.187 1.00 . A A .  32 LEU CD1  1 1 
        5  6972 1 1  32 LEU CD2  C  -1.962  14.823  14.906 1.00 . A A .  32 LEU CD2  1 1 
        5  6973 1 1  32 LEU CG   C  -3.356  14.509  14.361 1.00 . A A .  32 LEU CG   1 1 
        5  6974 1 1  32 LEU H    H  -5.684  13.689  14.441 1.00 . A A .  32 LEU H    1 1 
        5  6975 1 1  32 LEU HA   H  -6.061  16.583  14.130 1.00 . A A .  32 LEU HA   1 1 
        5  6976 1 1  32 LEU HB2  H  -3.657  16.175  13.051 1.00 . A A .  32 LEU HB2  1 1 
        5  6977 1 1  32 LEU HB3  H  -3.915  16.539  14.745 1.00 . A A .  32 LEU HB3  1 1 
        5  6978 1 1  32 LEU HD11 H  -4.247  13.569  12.639 1.00 . A A .  32 LEU HD11 1 1 
        5  6979 1 1  32 LEU HD12 H  -2.486  13.800  12.522 1.00 . A A .  32 LEU HD12 1 1 
        5  6980 1 1  32 LEU HD13 H  -3.148  12.518  13.564 1.00 . A A .  32 LEU HD13 1 1 
        5  6981 1 1  32 LEU HD21 H  -1.882  14.461  15.931 1.00 . A A .  32 LEU HD21 1 1 
        5  6982 1 1  32 LEU HD22 H  -1.211  14.332  14.287 1.00 . A A .  32 LEU HD22 1 1 
        5  6983 1 1  32 LEU HD23 H  -1.799  15.901  14.888 1.00 . A A .  32 LEU HD23 1 1 
        5  6984 1 1  32 LEU HG   H  -3.913  14.023  15.162 1.00 . A A .  32 LEU HG   1 1 
        5  6985 1 1  32 LEU N    N  -6.134  14.572  14.575 1.00 . A A .  32 LEU N    1 1 
        5  6986 1 1  32 LEU O    O  -6.474  14.376  11.937 1.00 . A A .  32 LEU O    1 1 
        5  6987 1 1  33 PRO C    C  -5.143  15.672   9.306 1.00 . A A .  33 PRO C    1 1 
        5  6988 1 1  33 PRO CA   C  -6.176  16.482  10.094 1.00 . A A .  33 PRO CA   1 1 
        5  6989 1 1  33 PRO CB   C  -6.253  17.934   9.654 1.00 . A A .  33 PRO CB   1 1 
        5  6990 1 1  33 PRO CD   C  -5.290  17.827  11.912 1.00 . A A .  33 PRO CD   1 1 
        5  6991 1 1  33 PRO CG   C  -5.498  18.729  10.707 1.00 . A A .  33 PRO CG   1 1 
        5  6992 1 1  33 PRO HA   H  -7.048  16.009   9.967 1.00 . A A .  33 PRO HA   1 1 
        5  6993 1 1  33 PRO HB2  H  -5.806  18.068   8.668 1.00 . A A .  33 PRO HB2  1 1 
        5  6994 1 1  33 PRO HB3  H  -7.289  18.266   9.582 1.00 . A A .  33 PRO HB3  1 1 
        5  6995 1 1  33 PRO HD2  H  -4.234  17.750  12.172 1.00 . A A .  33 PRO HD2  1 1 
        5  6996 1 1  33 PRO HD3  H  -5.807  18.213  12.790 1.00 . A A .  33 PRO HD3  1 1 
        5  6997 1 1  33 PRO HG2  H  -4.539  19.069  10.314 1.00 . A A .  33 PRO HG2  1 1 
        5  6998 1 1  33 PRO HG3  H  -6.060  19.620  10.989 1.00 . A A .  33 PRO HG3  1 1 
        5  6999 1 1  33 PRO N    N  -5.831  16.533  11.504 1.00 . A A .  33 PRO N    1 1 
        5  7000 1 1  33 PRO O    O  -4.082  15.336   9.829 1.00 . A A .  33 PRO O    1 1 
        5  7001 1 1  34 LEU C    C  -3.190  15.188   7.291 1.00 . A A .  34 LEU C    1 1 
        5  7002 1 1  34 LEU CA   C  -4.607  14.619   7.196 1.00 . A A .  34 LEU CA   1 1 
        5  7003 1 1  34 LEU CB   C  -5.158  14.578   5.769 1.00 . A A .  34 LEU CB   1 1 
        5  7004 1 1  34 LEU CD1  C  -2.926  13.858   4.843 1.00 . A A .  34 LEU CD1  1 1 
        5  7005 1 1  34 LEU CD2  C  -4.815  12.180   5.068 1.00 . A A .  34 LEU CD2  1 1 
        5  7006 1 1  34 LEU CG   C  -4.439  13.639   4.799 1.00 . A A .  34 LEU CG   1 1 
        5  7007 1 1  34 LEU H    H  -6.356  15.660   7.642 1.00 . A A .  34 LEU H    1 1 
        5  7008 1 1  34 LEU HA   H  -4.594  13.594   7.565 1.00 . A A .  34 LEU HA   1 1 
        5  7009 1 1  34 LEU HB2  H  -6.208  14.288   5.814 1.00 . A A .  34 LEU HB2  1 1 
        5  7010 1 1  34 LEU HB3  H  -5.124  15.588   5.358 1.00 . A A .  34 LEU HB3  1 1 
        5  7011 1 1  34 LEU HD11 H  -2.716  14.922   4.957 1.00 . A A .  34 LEU HD11 1 1 
        5  7012 1 1  34 LEU HD12 H  -2.504  13.312   5.688 1.00 . A A .  34 LEU HD12 1 1 
        5  7013 1 1  34 LEU HD13 H  -2.479  13.496   3.917 1.00 . A A .  34 LEU HD13 1 1 
        5  7014 1 1  34 LEU HD21 H  -5.806  11.979   4.659 1.00 . A A .  34 LEU HD21 1 1 
        5  7015 1 1  34 LEU HD22 H  -4.086  11.524   4.594 1.00 . A A .  34 LEU HD22 1 1 
        5  7016 1 1  34 LEU HD23 H  -4.822  11.999   6.143 1.00 . A A .  34 LEU HD23 1 1 
        5  7017 1 1  34 LEU HG   H  -4.769  13.875   3.787 1.00 . A A .  34 LEU HG   1 1 
        5  7018 1 1  34 LEU N    N  -5.491  15.383   8.060 1.00 . A A .  34 LEU N    1 1 
        5  7019 1 1  34 LEU O    O  -2.256  14.479   7.662 1.00 . A A .  34 LEU O    1 1 
        5  7020 1 1  35 LYS C    C  -0.960  16.571   8.150 1.00 . A A .  35 LYS C    1 1 
        5  7021 1 1  35 LYS CA   C  -1.787  17.135   6.993 1.00 . A A .  35 LYS CA   1 1 
        5  7022 1 1  35 LYS CB   C  -1.976  18.652   7.056 1.00 . A A .  35 LYS CB   1 1 
        5  7023 1 1  35 LYS CD   C  -0.875  20.831   7.690 1.00 . A A .  35 LYS CD   1 1 
        5  7024 1 1  35 LYS CE   C   0.334  21.682   7.296 1.00 . A A .  35 LYS CE   1 1 
        5  7025 1 1  35 LYS CG   C  -0.649  19.359   7.336 1.00 . A A .  35 LYS CG   1 1 
        5  7026 1 1  35 LYS H    H  -3.839  17.033   6.650 1.00 . A A .  35 LYS H    1 1 
        5  7027 1 1  35 LYS HA   H  -1.271  16.913   6.059 1.00 . A A .  35 LYS HA   1 1 
        5  7028 1 1  35 LYS HB2  H  -2.391  19.010   6.114 1.00 . A A .  35 LYS HB2  1 1 
        5  7029 1 1  35 LYS HB3  H  -2.696  18.901   7.836 1.00 . A A .  35 LYS HB3  1 1 
        5  7030 1 1  35 LYS HD2  H  -1.765  21.198   7.181 1.00 . A A .  35 LYS HD2  1 1 
        5  7031 1 1  35 LYS HD3  H  -1.058  20.927   8.761 1.00 . A A .  35 LYS HD3  1 1 
        5  7032 1 1  35 LYS HE2  H   0.922  21.160   6.541 1.00 . A A .  35 LYS HE2  1 1 
        5  7033 1 1  35 LYS HE3  H  -0.003  22.616   6.847 1.00 . A A .  35 LYS HE3  1 1 
        5  7034 1 1  35 LYS HG2  H  -0.132  18.860   8.156 1.00 . A A .  35 LYS HG2  1 1 
        5  7035 1 1  35 LYS HG3  H  -0.002  19.288   6.461 1.00 . A A .  35 LYS HG3  1 1 
        5  7036 1 1  35 LYS HZ1  H   0.727  22.659   9.047 1.00 . A A .  35 LYS HZ1  1 1 
        5  7037 1 1  35 LYS HZ2  H   1.299  21.130   9.011 1.00 . A A .  35 LYS HZ2  1 1 
        5  7038 1 1  35 LYS HZ3  H   2.066  22.309   8.181 1.00 . A A .  35 LYS HZ3  1 1 
        5  7039 1 1  35 LYS N    N  -3.074  16.463   6.950 1.00 . A A .  35 LYS N    1 1 
        5  7040 1 1  35 LYS NZ   N   1.175  21.968   8.480 1.00 . A A .  35 LYS NZ   1 1 
        5  7041 1 1  35 LYS O    O   0.029  15.873   7.928 1.00 . A A .  35 LYS O    1 1 
        5  7042 1 1  36 GLU C    C  -0.519  14.909  10.495 1.00 . A A .  36 GLU C    1 1 
        5  7043 1 1  36 GLU CA   C  -0.707  16.426  10.551 1.00 . A A .  36 GLU CA   1 1 
        5  7044 1 1  36 GLU CB   C  -1.462  16.839  11.816 1.00 . A A .  36 GLU CB   1 1 
        5  7045 1 1  36 GLU CD   C  -1.180  18.420  13.761 1.00 . A A .  36 GLU CD   1 1 
        5  7046 1 1  36 GLU CG   C  -1.083  18.258  12.242 1.00 . A A .  36 GLU CG   1 1 
        5  7047 1 1  36 GLU H    H  -2.200  17.460   9.531 1.00 . A A .  36 GLU H    1 1 
        5  7048 1 1  36 GLU HA   H   0.264  16.920  10.537 1.00 . A A .  36 GLU HA   1 1 
        5  7049 1 1  36 GLU HB2  H  -2.536  16.783  11.638 1.00 . A A .  36 GLU HB2  1 1 
        5  7050 1 1  36 GLU HB3  H  -1.236  16.141  12.623 1.00 . A A .  36 GLU HB3  1 1 
        5  7051 1 1  36 GLU HG2  H  -0.068  18.482  11.913 1.00 . A A .  36 GLU HG2  1 1 
        5  7052 1 1  36 GLU HG3  H  -1.742  18.976  11.754 1.00 . A A .  36 GLU HG3  1 1 
        5  7053 1 1  36 GLU N    N  -1.395  16.893   9.359 1.00 . A A .  36 GLU N    1 1 
        5  7054 1 1  36 GLU O    O   0.594  14.411  10.658 1.00 . A A .  36 GLU O    1 1 
        5  7055 1 1  36 GLU OE1  O  -2.210  17.976  14.314 1.00 . A A .  36 GLU OE1  1 1 
        5  7056 1 1  36 GLU OE2  O  -0.223  18.984  14.334 1.00 . A A .  36 GLU OE2  1 1 
        5  7057 1 1  37 ARG C    C  -0.326  12.298   9.468 1.00 . A A .  37 ARG C    1 1 
        5  7058 1 1  37 ARG CA   C  -1.595  12.765  10.186 1.00 . A A .  37 ARG CA   1 1 
        5  7059 1 1  37 ARG CB   C  -2.820  12.228   9.442 1.00 . A A .  37 ARG CB   1 1 
        5  7060 1 1  37 ARG CD   C  -5.024  11.024   9.667 1.00 . A A .  37 ARG CD   1 1 
        5  7061 1 1  37 ARG CG   C  -3.787  11.538  10.406 1.00 . A A .  37 ARG CG   1 1 
        5  7062 1 1  37 ARG CZ   C  -7.487  11.162  10.021 1.00 . A A .  37 ARG CZ   1 1 
        5  7063 1 1  37 ARG H    H  -2.526  14.627  10.134 1.00 . A A .  37 ARG H    1 1 
        5  7064 1 1  37 ARG HA   H  -1.604  12.428  11.223 1.00 . A A .  37 ARG HA   1 1 
        5  7065 1 1  37 ARG HB2  H  -3.329  13.048   8.935 1.00 . A A .  37 ARG HB2  1 1 
        5  7066 1 1  37 ARG HB3  H  -2.503  11.525   8.673 1.00 . A A .  37 ARG HB3  1 1 
        5  7067 1 1  37 ARG HD2  H  -4.960  11.283   8.610 1.00 . A A .  37 ARG HD2  1 1 
        5  7068 1 1  37 ARG HD3  H  -5.068   9.937   9.727 1.00 . A A .  37 ARG HD3  1 1 
        5  7069 1 1  37 ARG HE   H  -6.142  12.395  10.871 1.00 . A A .  37 ARG HE   1 1 
        5  7070 1 1  37 ARG HG2  H  -3.283  10.707  10.900 1.00 . A A .  37 ARG HG2  1 1 
        5  7071 1 1  37 ARG HG3  H  -4.089  12.237  11.186 1.00 . A A .  37 ARG HG3  1 1 
        5  7072 1 1  37 ARG HH11 H  -6.891   9.671   8.773 1.00 . A A .  37 ARG HH11 1 1 
        5  7073 1 1  37 ARG HH12 H  -8.600   9.780   9.029 1.00 . A A .  37 ARG HH12 1 1 
        5  7074 1 1  37 ARG HH21 H  -8.397  12.539  11.209 1.00 . A A .  37 ARG HH21 1 1 
        5  7075 1 1  37 ARG HH22 H  -9.463  11.422  10.424 1.00 . A A .  37 ARG HH22 1 1 
        5  7076 1 1  37 ARG N    N  -1.624  14.215  10.265 1.00 . A A .  37 ARG N    1 1 
        5  7077 1 1  37 ARG NE   N  -6.247  11.612  10.257 1.00 . A A .  37 ARG NE   1 1 
        5  7078 1 1  37 ARG NH1  N  -7.675  10.116   9.205 1.00 . A A .  37 ARG NH1  1 1 
        5  7079 1 1  37 ARG NH2  N  -8.538  11.758  10.600 1.00 . A A .  37 ARG NH2  1 1 
        5  7080 1 1  37 ARG O    O   0.502  11.602  10.053 1.00 . A A .  37 ARG O    1 1 
        5  7081 1 1  38 MET C    C   2.240  12.569   8.175 1.00 . A A .  38 MET C    1 1 
        5  7082 1 1  38 MET CA   C   0.938  12.332   7.407 1.00 . A A .  38 MET CA   1 1 
        5  7083 1 1  38 MET CB   C   0.948  13.157   6.119 1.00 . A A .  38 MET CB   1 1 
        5  7084 1 1  38 MET CE   C   0.521   9.932   4.622 1.00 . A A .  38 MET CE   1 1 
        5  7085 1 1  38 MET CG   C  -0.017  12.573   5.085 1.00 . A A .  38 MET CG   1 1 
        5  7086 1 1  38 MET H    H  -0.893  13.266   7.742 1.00 . A A .  38 MET H    1 1 
        5  7087 1 1  38 MET HA   H   0.821  11.269   7.196 1.00 . A A .  38 MET HA   1 1 
        5  7088 1 1  38 MET HB2  H   0.668  14.187   6.341 1.00 . A A .  38 MET HB2  1 1 
        5  7089 1 1  38 MET HB3  H   1.956  13.183   5.706 1.00 . A A .  38 MET HB3  1 1 
        5  7090 1 1  38 MET HE1  H   0.993   9.163   4.011 1.00 . A A .  38 MET HE1  1 1 
        5  7091 1 1  38 MET HE2  H   0.911   9.878   5.638 1.00 . A A .  38 MET HE2  1 1 
        5  7092 1 1  38 MET HE3  H  -0.557   9.772   4.638 1.00 . A A .  38 MET HE3  1 1 
        5  7093 1 1  38 MET HG2  H  -0.790  11.990   5.586 1.00 . A A .  38 MET HG2  1 1 
        5  7094 1 1  38 MET HG3  H  -0.522  13.377   4.550 1.00 . A A .  38 MET HG3  1 1 
        5  7095 1 1  38 MET N    N  -0.215  12.700   8.210 1.00 . A A .  38 MET N    1 1 
        5  7096 1 1  38 MET O    O   2.929  11.619   8.544 1.00 . A A .  38 MET O    1 1 
        5  7097 1 1  38 MET SD   S   0.873  11.540   3.934 1.00 . A A .  38 MET SD   1 1 
        5  7098 1 1  39 VAL C    C   3.866  13.363  10.374 1.00 . A A .  39 VAL C    1 1 
        5  7099 1 1  39 VAL CA   C   3.746  14.215   9.109 1.00 . A A .  39 VAL CA   1 1 
        5  7100 1 1  39 VAL CB   C   3.738  15.717   9.399 1.00 . A A .  39 VAL CB   1 1 
        5  7101 1 1  39 VAL CG1  C   2.436  16.138  10.083 1.00 . A A .  39 VAL CG1  1 1 
        5  7102 1 1  39 VAL CG2  C   4.953  16.120  10.237 1.00 . A A .  39 VAL CG2  1 1 
        5  7103 1 1  39 VAL H    H   1.973  14.608   8.088 1.00 . A A .  39 VAL H    1 1 
        5  7104 1 1  39 VAL HA   H   4.594  14.001   8.460 1.00 . A A .  39 VAL HA   1 1 
        5  7105 1 1  39 VAL HB   H   3.801  16.242   8.446 1.00 . A A .  39 VAL HB   1 1 
        5  7106 1 1  39 VAL HG11 H   1.591  15.886   9.442 1.00 . A A .  39 VAL HG11 1 1 
        5  7107 1 1  39 VAL HG12 H   2.339  15.613  11.034 1.00 . A A .  39 VAL HG12 1 1 
        5  7108 1 1  39 VAL HG13 H   2.450  17.213  10.261 1.00 . A A .  39 VAL HG13 1 1 
        5  7109 1 1  39 VAL HG21 H   5.466  15.224  10.587 1.00 . A A .  39 VAL HG21 1 1 
        5  7110 1 1  39 VAL HG22 H   5.634  16.715   9.628 1.00 . A A .  39 VAL HG22 1 1 
        5  7111 1 1  39 VAL HG23 H   4.624  16.708  11.094 1.00 . A A .  39 VAL HG23 1 1 
        5  7112 1 1  39 VAL N    N   2.539  13.841   8.392 1.00 . A A .  39 VAL N    1 1 
        5  7113 1 1  39 VAL O    O   4.930  12.814  10.658 1.00 . A A .  39 VAL O    1 1 
        5  7114 1 1  40 GLU C    C   3.069  11.040  12.041 1.00 . A A .  40 GLU C    1 1 
        5  7115 1 1  40 GLU CA   C   2.730  12.504  12.329 1.00 . A A .  40 GLU CA   1 1 
        5  7116 1 1  40 GLU CB   C   1.371  12.627  13.021 1.00 . A A .  40 GLU CB   1 1 
        5  7117 1 1  40 GLU CD   C   2.158  14.232  14.799 1.00 . A A .  40 GLU CD   1 1 
        5  7118 1 1  40 GLU CG   C   1.539  12.860  14.523 1.00 . A A .  40 GLU CG   1 1 
        5  7119 1 1  40 GLU H    H   1.901  13.730  10.863 1.00 . A A .  40 GLU H    1 1 
        5  7120 1 1  40 GLU HA   H   3.497  12.943  12.968 1.00 . A A .  40 GLU HA   1 1 
        5  7121 1 1  40 GLU HB2  H   0.809  13.451  12.582 1.00 . A A .  40 GLU HB2  1 1 
        5  7122 1 1  40 GLU HB3  H   0.791  11.720  12.853 1.00 . A A .  40 GLU HB3  1 1 
        5  7123 1 1  40 GLU HG2  H   0.570  12.789  15.017 1.00 . A A .  40 GLU HG2  1 1 
        5  7124 1 1  40 GLU HG3  H   2.171  12.080  14.948 1.00 . A A .  40 GLU HG3  1 1 
        5  7125 1 1  40 GLU N    N   2.762  13.280  11.101 1.00 . A A .  40 GLU N    1 1 
        5  7126 1 1  40 GLU O    O   3.693  10.371  12.863 1.00 . A A .  40 GLU O    1 1 
        5  7127 1 1  40 GLU OE1  O   1.378  15.208  14.847 1.00 . A A .  40 GLU OE1  1 1 
        5  7128 1 1  40 GLU OE2  O   3.398  14.274  14.956 1.00 . A A .  40 GLU OE2  1 1 
        5  7129 1 1  41 ILE C    C   4.386   9.035  10.182 1.00 . A A .  41 ILE C    1 1 
        5  7130 1 1  41 ILE CA   C   2.893   9.214  10.465 1.00 . A A .  41 ILE CA   1 1 
        5  7131 1 1  41 ILE CB   C   1.993   8.831   9.289 1.00 . A A .  41 ILE CB   1 1 
        5  7132 1 1  41 ILE CD1  C  -0.402   9.103   8.546 1.00 . A A .  41 ILE CD1  1 1 
        5  7133 1 1  41 ILE CG1  C   0.525   8.771   9.717 1.00 . A A .  41 ILE CG1  1 1 
        5  7134 1 1  41 ILE CG2  C   2.457   7.522   8.647 1.00 . A A .  41 ILE CG2  1 1 
        5  7135 1 1  41 ILE H    H   2.135  11.138  10.209 1.00 . A A .  41 ILE H    1 1 
        5  7136 1 1  41 ILE HA   H   2.621   8.571  11.302 1.00 . A A .  41 ILE HA   1 1 
        5  7137 1 1  41 ILE HB   H   2.075   9.608   8.529 1.00 . A A .  41 ILE HB   1 1 
        5  7138 1 1  41 ILE HD11 H  -0.070   8.567   7.657 1.00 . A A .  41 ILE HD11 1 1 
        5  7139 1 1  41 ILE HD12 H  -1.420   8.802   8.793 1.00 . A A .  41 ILE HD12 1 1 
        5  7140 1 1  41 ILE HD13 H  -0.376  10.175   8.355 1.00 . A A .  41 ILE HD13 1 1 
        5  7141 1 1  41 ILE HG12 H   0.295   7.777  10.099 1.00 . A A .  41 ILE HG12 1 1 
        5  7142 1 1  41 ILE HG13 H   0.352   9.474  10.533 1.00 . A A .  41 ILE HG13 1 1 
        5  7143 1 1  41 ILE HG21 H   2.717   7.701   7.604 1.00 . A A .  41 ILE HG21 1 1 
        5  7144 1 1  41 ILE HG22 H   3.329   7.145   9.180 1.00 . A A .  41 ILE HG22 1 1 
        5  7145 1 1  41 ILE HG23 H   1.653   6.787   8.700 1.00 . A A .  41 ILE HG23 1 1 
        5  7146 1 1  41 ILE N    N   2.643  10.586  10.872 1.00 . A A .  41 ILE N    1 1 
        5  7147 1 1  41 ILE O    O   5.026   8.148  10.744 1.00 . A A .  41 ILE O    1 1 
        5  7148 1 1  42 GLY C    C   7.185   9.691  10.184 1.00 . A A .  42 GLY C    1 1 
        5  7149 1 1  42 GLY CA   C   6.302   9.839   8.944 1.00 . A A .  42 GLY CA   1 1 
        5  7150 1 1  42 GLY H    H   4.369  10.610   8.856 1.00 . A A .  42 GLY H    1 1 
        5  7151 1 1  42 GLY HA2  H   6.474   9.001   8.268 1.00 . A A .  42 GLY HA2  1 1 
        5  7152 1 1  42 GLY HA3  H   6.575  10.746   8.405 1.00 . A A .  42 GLY HA3  1 1 
        5  7153 1 1  42 GLY N    N   4.896   9.891   9.309 1.00 . A A .  42 GLY N    1 1 
        5  7154 1 1  42 GLY O    O   8.180   8.967  10.160 1.00 . A A .  42 GLY O    1 1 
        5  7155 1 1  43 SER C    C   7.480   8.933  13.078 1.00 . A A .  43 SER C    1 1 
        5  7156 1 1  43 SER CA   C   7.534  10.343  12.487 1.00 . A A .  43 SER CA   1 1 
        5  7157 1 1  43 SER CB   C   6.989  11.361  13.490 1.00 . A A .  43 SER CB   1 1 
        5  7158 1 1  43 SER H    H   5.981  10.974  11.251 1.00 . A A .  43 SER H    1 1 
        5  7159 1 1  43 SER HA   H   8.558  10.607  12.222 1.00 . A A .  43 SER HA   1 1 
        5  7160 1 1  43 SER HB2  H   6.316  12.049  12.979 1.00 . A A .  43 SER HB2  1 1 
        5  7161 1 1  43 SER HB3  H   6.400  10.844  14.248 1.00 . A A .  43 SER HB3  1 1 
        5  7162 1 1  43 SER HG   H   8.086  11.855  15.090 1.00 . A A .  43 SER HG   1 1 
        5  7163 1 1  43 SER N    N   6.791  10.388  11.239 1.00 . A A .  43 SER N    1 1 
        5  7164 1 1  43 SER O    O   8.516   8.336  13.365 1.00 . A A .  43 SER O    1 1 
        5  7165 1 1  43 SER OG   O   8.031  12.099  14.122 1.00 . A A .  43 SER OG   1 1 
        5  7166 1 1  44 ARG C    C   6.832   6.076  12.981 1.00 . A A .  44 ARG C    1 1 
        5  7167 1 1  44 ARG CA   C   6.057   7.114  13.796 1.00 . A A .  44 ARG CA   1 1 
        5  7168 1 1  44 ARG CB   C   4.573   6.741  13.802 1.00 . A A .  44 ARG CB   1 1 
        5  7169 1 1  44 ARG CD   C   2.527   6.881  15.270 1.00 . A A .  44 ARG CD   1 1 
        5  7170 1 1  44 ARG CG   C   3.797   7.597  14.806 1.00 . A A .  44 ARG CG   1 1 
        5  7171 1 1  44 ARG CZ   C   3.089   4.791  16.504 1.00 . A A .  44 ARG CZ   1 1 
        5  7172 1 1  44 ARG H    H   5.422   8.935  13.007 1.00 . A A .  44 ARG H    1 1 
        5  7173 1 1  44 ARG HA   H   6.435   7.175  14.816 1.00 . A A .  44 ARG HA   1 1 
        5  7174 1 1  44 ARG HB2  H   4.155   6.878  12.804 1.00 . A A .  44 ARG HB2  1 1 
        5  7175 1 1  44 ARG HB3  H   4.460   5.687  14.054 1.00 . A A .  44 ARG HB3  1 1 
        5  7176 1 1  44 ARG HD2  H   1.739   7.610  15.463 1.00 . A A .  44 ARG HD2  1 1 
        5  7177 1 1  44 ARG HD3  H   2.163   6.221  14.483 1.00 . A A .  44 ARG HD3  1 1 
        5  7178 1 1  44 ARG HE   H   2.778   6.580  17.373 1.00 . A A .  44 ARG HE   1 1 
        5  7179 1 1  44 ARG HG2  H   4.429   7.817  15.666 1.00 . A A .  44 ARG HG2  1 1 
        5  7180 1 1  44 ARG HG3  H   3.535   8.552  14.350 1.00 . A A .  44 ARG HG3  1 1 
        5  7181 1 1  44 ARG HH11 H   2.957   4.575  14.486 1.00 . A A .  44 ARG HH11 1 1 
        5  7182 1 1  44 ARG HH12 H   3.347   3.131  15.359 1.00 . A A .  44 ARG HH12 1 1 
        5  7183 1 1  44 ARG HH21 H   3.293   4.674  18.524 1.00 . A A .  44 ARG HH21 1 1 
        5  7184 1 1  44 ARG HH22 H   3.539   3.187  17.671 1.00 . A A .  44 ARG HH22 1 1 
        5  7185 1 1  44 ARG N    N   6.260   8.442  13.243 1.00 . A A .  44 ARG N    1 1 
        5  7186 1 1  44 ARG NE   N   2.804   6.100  16.496 1.00 . A A .  44 ARG NE   1 1 
        5  7187 1 1  44 ARG NH1  N   3.135   4.108  15.352 1.00 . A A .  44 ARG NH1  1 1 
        5  7188 1 1  44 ARG NH2  N   3.327   4.164  17.665 1.00 . A A .  44 ARG NH2  1 1 
        5  7189 1 1  44 ARG O    O   7.393   5.135  13.542 1.00 . A A .  44 ARG O    1 1 
        5  7190 1 1  45 TRP C    C   9.029   5.441  11.106 1.00 . A A .  45 TRP C    1 1 
        5  7191 1 1  45 TRP CA   C   7.537   5.376  10.776 1.00 . A A .  45 TRP CA   1 1 
        5  7192 1 1  45 TRP CB   C   7.233   5.710   9.314 1.00 . A A .  45 TRP CB   1 1 
        5  7193 1 1  45 TRP CD1  C   9.236   5.540   7.696 1.00 . A A .  45 TRP CD1  1 1 
        5  7194 1 1  45 TRP CD2  C   8.062   3.666   7.835 1.00 . A A .  45 TRP CD2  1 1 
        5  7195 1 1  45 TRP CE2  C   9.093   3.442   6.945 1.00 . A A .  45 TRP CE2  1 1 
        5  7196 1 1  45 TRP CE3  C   7.129   2.660   8.143 1.00 . A A .  45 TRP CE3  1 1 
        5  7197 1 1  45 TRP CG   C   8.164   5.024   8.313 1.00 . A A .  45 TRP CG   1 1 
        5  7198 1 1  45 TRP CH2  C   8.373   1.203   6.584 1.00 . A A .  45 TRP CH2  1 1 
        5  7199 1 1  45 TRP CZ2  C   9.290   2.219   6.292 1.00 . A A .  45 TRP CZ2  1 1 
        5  7200 1 1  45 TRP CZ3  C   7.339   1.445   7.482 1.00 . A A .  45 TRP CZ3  1 1 
        5  7201 1 1  45 TRP H    H   6.380   7.050  11.225 1.00 . A A .  45 TRP H    1 1 
        5  7202 1 1  45 TRP HA   H   7.158   4.371  10.958 1.00 . A A .  45 TRP HA   1 1 
        5  7203 1 1  45 TRP HB2  H   6.204   5.424   9.093 1.00 . A A .  45 TRP HB2  1 1 
        5  7204 1 1  45 TRP HB3  H   7.300   6.789   9.177 1.00 . A A .  45 TRP HB3  1 1 
        5  7205 1 1  45 TRP HD1  H   9.594   6.559   7.838 1.00 . A A .  45 TRP HD1  1 1 
        5  7206 1 1  45 TRP HE1  H  10.714   4.781   6.242 1.00 . A A .  45 TRP HE1  1 1 
        5  7207 1 1  45 TRP HE3  H   6.306   2.812   8.842 1.00 . A A .  45 TRP HE3  1 1 
        5  7208 1 1  45 TRP HH2  H   8.468   0.226   6.109 1.00 . A A .  45 TRP HH2  1 1 
        5  7209 1 1  45 TRP HZ2  H  10.113   2.067   5.593 1.00 . A A .  45 TRP HZ2  1 1 
        5  7210 1 1  45 TRP HZ3  H   6.644   0.630   7.685 1.00 . A A .  45 TRP HZ3  1 1 
        5  7211 1 1  45 TRP N    N   6.839   6.282  11.673 1.00 . A A .  45 TRP N    1 1 
        5  7212 1 1  45 TRP NE1  N   9.830   4.617   6.858 1.00 . A A .  45 TRP NE1  1 1 
        5  7213 1 1  45 TRP O    O   9.753   4.464  10.918 1.00 . A A .  45 TRP O    1 1 
        5  7214 1 1  46 GLN C    C  11.123   6.217  13.334 1.00 . A A .  46 GLN C    1 1 
        5  7215 1 1  46 GLN CA   C  10.839   6.805  11.950 1.00 . A A .  46 GLN CA   1 1 
        5  7216 1 1  46 GLN CB   C  11.206   8.289  11.899 1.00 . A A .  46 GLN CB   1 1 
        5  7217 1 1  46 GLN CD   C  12.211  10.086  10.442 1.00 . A A .  46 GLN CD   1 1 
        5  7218 1 1  46 GLN CG   C  11.496   8.733  10.464 1.00 . A A .  46 GLN CG   1 1 
        5  7219 1 1  46 GLN H    H   8.851   7.390  11.742 1.00 . A A .  46 GLN H    1 1 
        5  7220 1 1  46 GLN HA   H  11.414   6.269  11.195 1.00 . A A .  46 GLN HA   1 1 
        5  7221 1 1  46 GLN HB2  H  10.390   8.884  12.309 1.00 . A A .  46 GLN HB2  1 1 
        5  7222 1 1  46 GLN HB3  H  12.080   8.473  12.524 1.00 . A A .  46 GLN HB3  1 1 
        5  7223 1 1  46 GLN HE21 H  12.066  10.077   8.423 1.00 . A A .  46 GLN HE21 1 1 
        5  7224 1 1  46 GLN HE22 H  12.848  11.464   9.103 1.00 . A A .  46 GLN HE22 1 1 
        5  7225 1 1  46 GLN HG2  H  12.111   7.984   9.965 1.00 . A A .  46 GLN HG2  1 1 
        5  7226 1 1  46 GLN HG3  H  10.563   8.802   9.905 1.00 . A A .  46 GLN HG3  1 1 
        5  7227 1 1  46 GLN N    N   9.446   6.600  11.592 1.00 . A A .  46 GLN N    1 1 
        5  7228 1 1  46 GLN NE2  N  12.390  10.584   9.222 1.00 . A A .  46 GLN NE2  1 1 
        5  7229 1 1  46 GLN O    O  12.258   6.258  13.808 1.00 . A A .  46 GLN O    1 1 
        5  7230 1 1  46 GLN OE1  O  12.576  10.640  11.465 1.00 . A A .  46 GLN OE1  1 1 
        5  7231 1 1  47 ARG C    C  10.441   3.583  15.144 1.00 . A A .  47 ARG C    1 1 
        5  7232 1 1  47 ARG CA   C  10.197   5.089  15.262 1.00 . A A .  47 ARG CA   1 1 
        5  7233 1 1  47 ARG CB   C   8.936   5.331  16.095 1.00 . A A .  47 ARG CB   1 1 
        5  7234 1 1  47 ARG CD   C   7.472   7.070  17.185 1.00 . A A .  47 ARG CD   1 1 
        5  7235 1 1  47 ARG CG   C   8.674   6.828  16.270 1.00 . A A .  47 ARG CG   1 1 
        5  7236 1 1  47 ARG CZ   C   8.407   8.326  19.124 1.00 . A A .  47 ARG CZ   1 1 
        5  7237 1 1  47 ARG H    H   9.155   5.655  13.549 1.00 . A A .  47 ARG H    1 1 
        5  7238 1 1  47 ARG HA   H  11.052   5.590  15.716 1.00 . A A .  47 ARG HA   1 1 
        5  7239 1 1  47 ARG HB2  H   8.080   4.862  15.609 1.00 . A A .  47 ARG HB2  1 1 
        5  7240 1 1  47 ARG HB3  H   9.045   4.860  17.072 1.00 . A A .  47 ARG HB3  1 1 
        5  7241 1 1  47 ARG HD2  H   6.948   7.976  16.880 1.00 . A A .  47 ARG HD2  1 1 
        5  7242 1 1  47 ARG HD3  H   6.764   6.247  17.095 1.00 . A A .  47 ARG HD3  1 1 
        5  7243 1 1  47 ARG HE   H   7.861   6.389  19.176 1.00 . A A .  47 ARG HE   1 1 
        5  7244 1 1  47 ARG HG2  H   9.558   7.309  16.690 1.00 . A A .  47 ARG HG2  1 1 
        5  7245 1 1  47 ARG HG3  H   8.493   7.286  15.298 1.00 . A A .  47 ARG HG3  1 1 
        5  7246 1 1  47 ARG HH11 H   8.220   9.416  17.417 1.00 . A A .  47 ARG HH11 1 1 
        5  7247 1 1  47 ARG HH12 H   8.869  10.275  18.774 1.00 . A A .  47 ARG HH12 1 1 
        5  7248 1 1  47 ARG HH21 H   8.717   7.522  20.966 1.00 . A A .  47 ARG HH21 1 1 
        5  7249 1 1  47 ARG HH22 H   9.153   9.191  20.806 1.00 . A A .  47 ARG HH22 1 1 
        5  7250 1 1  47 ARG N    N  10.074   5.684  13.942 1.00 . A A .  47 ARG N    1 1 
        5  7251 1 1  47 ARG NE   N   7.922   7.197  18.590 1.00 . A A .  47 ARG NE   1 1 
        5  7252 1 1  47 ARG NH1  N   8.507   9.433  18.375 1.00 . A A .  47 ARG NH1  1 1 
        5  7253 1 1  47 ARG NH2  N   8.791   8.348  20.408 1.00 . A A .  47 ARG NH2  1 1 
        5  7254 1 1  47 ARG O    O  11.385   3.056  15.731 1.00 . A A .  47 ARG O    1 1 
        5  7255 1 1  48 ILE C    C  11.150   1.131  13.947 1.00 . A A .  48 ILE C    1 1 
        5  7256 1 1  48 ILE CA   C   9.683   1.498  14.180 1.00 . A A .  48 ILE CA   1 1 
        5  7257 1 1  48 ILE CB   C   8.749   1.042  13.057 1.00 . A A .  48 ILE CB   1 1 
        5  7258 1 1  48 ILE CD1  C   8.077   1.385  10.651 1.00 . A A .  48 ILE CD1  1 1 
        5  7259 1 1  48 ILE CG1  C   8.928   1.909  11.809 1.00 . A A .  48 ILE CG1  1 1 
        5  7260 1 1  48 ILE CG2  C   7.295   1.013  13.532 1.00 . A A .  48 ILE CG2  1 1 
        5  7261 1 1  48 ILE H    H   8.809   3.369  13.908 1.00 . A A .  48 ILE H    1 1 
        5  7262 1 1  48 ILE HA   H   9.347   1.013  15.096 1.00 . A A .  48 ILE HA   1 1 
        5  7263 1 1  48 ILE HB   H   9.019   0.023  12.782 1.00 . A A .  48 ILE HB   1 1 
        5  7264 1 1  48 ILE HD11 H   7.152   1.959  10.592 1.00 . A A .  48 ILE HD11 1 1 
        5  7265 1 1  48 ILE HD12 H   8.630   1.490   9.718 1.00 . A A .  48 ILE HD12 1 1 
        5  7266 1 1  48 ILE HD13 H   7.843   0.334  10.819 1.00 . A A .  48 ILE HD13 1 1 
        5  7267 1 1  48 ILE HG12 H   8.648   2.939  12.034 1.00 . A A .  48 ILE HG12 1 1 
        5  7268 1 1  48 ILE HG13 H   9.978   1.921  11.518 1.00 . A A .  48 ILE HG13 1 1 
        5  7269 1 1  48 ILE HG21 H   6.975  -0.021  13.659 1.00 . A A .  48 ILE HG21 1 1 
        5  7270 1 1  48 ILE HG22 H   7.213   1.539  14.483 1.00 . A A .  48 ILE HG22 1 1 
        5  7271 1 1  48 ILE HG23 H   6.662   1.501  12.791 1.00 . A A .  48 ILE HG23 1 1 
        5  7272 1 1  48 ILE N    N   9.574   2.933  14.382 1.00 . A A .  48 ILE N    1 1 
        5  7273 1 1  48 ILE O    O  11.976   2.001  13.674 1.00 . A A .  48 ILE O    1 1 
        5  7274 1 1  49 SER C    C  12.882  -1.395  12.534 1.00 . A A .  49 SER C    1 1 
        5  7275 1 1  49 SER CA   C  12.783  -0.652  13.868 1.00 . A A .  49 SER CA   1 1 
        5  7276 1 1  49 SER CB   C  13.206  -1.568  15.018 1.00 . A A .  49 SER CB   1 1 
        5  7277 1 1  49 SER H    H  10.752  -0.860  14.284 1.00 . A A .  49 SER H    1 1 
        5  7278 1 1  49 SER HA   H  13.415   0.236  13.859 1.00 . A A .  49 SER HA   1 1 
        5  7279 1 1  49 SER HB2  H  14.277  -1.760  14.953 1.00 . A A .  49 SER HB2  1 1 
        5  7280 1 1  49 SER HB3  H  13.030  -1.062  15.967 1.00 . A A .  49 SER HB3  1 1 
        5  7281 1 1  49 SER HG   H  11.817  -2.819  15.732 1.00 . A A .  49 SER HG   1 1 
        5  7282 1 1  49 SER N    N  11.430  -0.159  14.062 1.00 . A A .  49 SER N    1 1 
        5  7283 1 1  49 SER O    O  11.865  -1.745  11.937 1.00 . A A .  49 SER O    1 1 
        5  7284 1 1  49 SER OG   O  12.501  -2.806  15.002 1.00 . A A .  49 SER OG   1 1 
        5  7285 1 1  50 GLN C    C  13.367  -3.458  10.680 1.00 . A A .  50 GLN C    1 1 
        5  7286 1 1  50 GLN CA   C  14.362  -2.309  10.853 1.00 . A A .  50 GLN CA   1 1 
        5  7287 1 1  50 GLN CB   C  15.803  -2.816  10.781 1.00 . A A .  50 GLN CB   1 1 
        5  7288 1 1  50 GLN CD   C  15.902  -2.163   8.346 1.00 . A A .  50 GLN CD   1 1 
        5  7289 1 1  50 GLN CG   C  16.151  -3.278   9.364 1.00 . A A .  50 GLN CG   1 1 
        5  7290 1 1  50 GLN H    H  14.938  -1.326  12.597 1.00 . A A .  50 GLN H    1 1 
        5  7291 1 1  50 GLN HA   H  14.205  -1.564  10.073 1.00 . A A .  50 GLN HA   1 1 
        5  7292 1 1  50 GLN HB2  H  16.487  -2.024  11.086 1.00 . A A .  50 GLN HB2  1 1 
        5  7293 1 1  50 GLN HB3  H  15.938  -3.641  11.480 1.00 . A A .  50 GLN HB3  1 1 
        5  7294 1 1  50 GLN HE21 H  14.020  -2.869   8.105 1.00 . A A .  50 GLN HE21 1 1 
        5  7295 1 1  50 GLN HE22 H  14.420  -1.482   7.147 1.00 . A A .  50 GLN HE22 1 1 
        5  7296 1 1  50 GLN HG2  H  17.196  -3.585   9.325 1.00 . A A .  50 GLN HG2  1 1 
        5  7297 1 1  50 GLN HG3  H  15.553  -4.152   9.106 1.00 . A A .  50 GLN HG3  1 1 
        5  7298 1 1  50 GLN N    N  14.116  -1.614  12.105 1.00 . A A .  50 GLN N    1 1 
        5  7299 1 1  50 GLN NE2  N  14.679  -2.172   7.823 1.00 . A A .  50 GLN NE2  1 1 
        5  7300 1 1  50 GLN O    O  12.618  -3.494   9.705 1.00 . A A .  50 GLN O    1 1 
        5  7301 1 1  50 GLN OE1  O  16.763  -1.349   8.056 1.00 . A A .  50 GLN OE1  1 1 
        5  7302 1 1  51 SER C    C  11.126  -5.097  11.083 1.00 . A A .  51 SER C    1 1 
        5  7303 1 1  51 SER CA   C  12.501  -5.517  11.608 1.00 . A A .  51 SER CA   1 1 
        5  7304 1 1  51 SER CB   C  12.368  -6.152  12.994 1.00 . A A .  51 SER CB   1 1 
        5  7305 1 1  51 SER H    H  14.003  -4.332  12.432 1.00 . A A .  51 SER H    1 1 
        5  7306 1 1  51 SER HA   H  12.970  -6.227  10.928 1.00 . A A .  51 SER HA   1 1 
        5  7307 1 1  51 SER HB2  H  13.274  -6.711  13.225 1.00 . A A .  51 SER HB2  1 1 
        5  7308 1 1  51 SER HB3  H  12.278  -5.367  13.745 1.00 . A A .  51 SER HB3  1 1 
        5  7309 1 1  51 SER HG   H  10.999  -7.174  14.036 1.00 . A A .  51 SER HG   1 1 
        5  7310 1 1  51 SER N    N  13.391  -4.369  11.642 1.00 . A A .  51 SER N    1 1 
        5  7311 1 1  51 SER O    O  10.536  -5.791  10.257 1.00 . A A .  51 SER O    1 1 
        5  7312 1 1  51 SER OG   O  11.241  -7.020  13.078 1.00 . A A .  51 SER OG   1 1 
        5  7313 1 1  52 GLN C    C   9.390  -3.059   9.694 1.00 . A A .  52 GLN C    1 1 
        5  7314 1 1  52 GLN CA   C   9.363  -3.444  11.175 1.00 . A A .  52 GLN CA   1 1 
        5  7315 1 1  52 GLN CB   C   8.951  -2.254  12.044 1.00 . A A .  52 GLN CB   1 1 
        5  7316 1 1  52 GLN CD   C   7.890  -2.116  14.327 1.00 . A A .  52 GLN CD   1 1 
        5  7317 1 1  52 GLN CG   C   7.716  -2.589  12.882 1.00 . A A .  52 GLN CG   1 1 
        5  7318 1 1  52 GLN H    H  11.144  -3.405  12.255 1.00 . A A .  52 GLN H    1 1 
        5  7319 1 1  52 GLN HA   H   8.660  -4.262  11.332 1.00 . A A .  52 GLN HA   1 1 
        5  7320 1 1  52 GLN HB2  H   9.776  -1.975  12.699 1.00 . A A .  52 GLN HB2  1 1 
        5  7321 1 1  52 GLN HB3  H   8.742  -1.392  11.410 1.00 . A A .  52 GLN HB3  1 1 
        5  7322 1 1  52 GLN HE21 H   5.911  -2.429  14.618 1.00 . A A .  52 GLN HE21 1 1 
        5  7323 1 1  52 GLN HE22 H   6.778  -1.836  15.995 1.00 . A A .  52 GLN HE22 1 1 
        5  7324 1 1  52 GLN HG2  H   6.836  -2.118  12.445 1.00 . A A .  52 GLN HG2  1 1 
        5  7325 1 1  52 GLN HG3  H   7.543  -3.666  12.867 1.00 . A A .  52 GLN HG3  1 1 
        5  7326 1 1  52 GLN N    N  10.657  -3.964  11.583 1.00 . A A .  52 GLN N    1 1 
        5  7327 1 1  52 GLN NE2  N   6.767  -2.128  15.039 1.00 . A A .  52 GLN NE2  1 1 
        5  7328 1 1  52 GLN O    O   8.791  -3.738   8.862 1.00 . A A .  52 GLN O    1 1 
        5  7329 1 1  52 GLN OE1  O   8.972  -1.764  14.766 1.00 . A A .  52 GLN OE1  1 1 
        5  7330 1 1  53 LYS C    C  10.344  -2.679   7.097 1.00 . A A .  53 LYS C    1 1 
        5  7331 1 1  53 LYS CA   C  10.203  -1.487   8.046 1.00 . A A .  53 LYS CA   1 1 
        5  7332 1 1  53 LYS CB   C  11.340  -0.470   7.929 1.00 . A A .  53 LYS CB   1 1 
        5  7333 1 1  53 LYS CD   C  11.992   1.940   8.287 1.00 . A A .  53 LYS CD   1 1 
        5  7334 1 1  53 LYS CE   C  11.689   3.222   9.064 1.00 . A A .  53 LYS CE   1 1 
        5  7335 1 1  53 LYS CG   C  10.969   0.848   8.611 1.00 . A A .  53 LYS CG   1 1 
        5  7336 1 1  53 LYS H    H  10.575  -1.424  10.094 1.00 . A A .  53 LYS H    1 1 
        5  7337 1 1  53 LYS HA   H   9.277  -0.963   7.807 1.00 . A A .  53 LYS HA   1 1 
        5  7338 1 1  53 LYS HB2  H  12.244  -0.876   8.383 1.00 . A A .  53 LYS HB2  1 1 
        5  7339 1 1  53 LYS HB3  H  11.565  -0.290   6.878 1.00 . A A .  53 LYS HB3  1 1 
        5  7340 1 1  53 LYS HD2  H  12.994   1.589   8.533 1.00 . A A .  53 LYS HD2  1 1 
        5  7341 1 1  53 LYS HD3  H  11.981   2.147   7.217 1.00 . A A .  53 LYS HD3  1 1 
        5  7342 1 1  53 LYS HE2  H  12.105   4.081   8.537 1.00 . A A .  53 LYS HE2  1 1 
        5  7343 1 1  53 LYS HE3  H  10.611   3.375   9.121 1.00 . A A .  53 LYS HE3  1 1 
        5  7344 1 1  53 LYS HG2  H   9.979   1.165   8.284 1.00 . A A .  53 LYS HG2  1 1 
        5  7345 1 1  53 LYS HG3  H  10.917   0.702   9.690 1.00 . A A .  53 LYS HG3  1 1 
        5  7346 1 1  53 LYS HZ1  H  12.784   3.978  10.616 1.00 . A A .  53 LYS HZ1  1 1 
        5  7347 1 1  53 LYS HZ2  H  11.517   3.066  11.095 1.00 . A A .  53 LYS HZ2  1 1 
        5  7348 1 1  53 LYS HZ3  H  12.858   2.351  10.497 1.00 . A A .  53 LYS HZ3  1 1 
        5  7349 1 1  53 LYS N    N  10.090  -1.970   9.411 1.00 . A A .  53 LYS N    1 1 
        5  7350 1 1  53 LYS NZ   N  12.258   3.148  10.429 1.00 . A A .  53 LYS NZ   1 1 
        5  7351 1 1  53 LYS O    O   9.718  -2.712   6.039 1.00 . A A .  53 LYS O    1 1 
        5  7352 1 1  54 GLU C    C  10.087  -5.569   6.483 1.00 . A A .  54 GLU C    1 1 
        5  7353 1 1  54 GLU CA   C  11.401  -4.820   6.710 1.00 . A A .  54 GLU CA   1 1 
        5  7354 1 1  54 GLU CB   C  12.443  -5.727   7.366 1.00 . A A .  54 GLU CB   1 1 
        5  7355 1 1  54 GLU CD   C  14.435  -6.532   6.046 1.00 . A A .  54 GLU CD   1 1 
        5  7356 1 1  54 GLU CG   C  13.852  -5.387   6.876 1.00 . A A .  54 GLU CG   1 1 
        5  7357 1 1  54 GLU H    H  11.675  -3.594   8.373 1.00 . A A .  54 GLU H    1 1 
        5  7358 1 1  54 GLU HA   H  11.790  -4.458   5.759 1.00 . A A .  54 GLU HA   1 1 
        5  7359 1 1  54 GLU HB2  H  12.395  -5.618   8.450 1.00 . A A .  54 GLU HB2  1 1 
        5  7360 1 1  54 GLU HB3  H  12.217  -6.769   7.141 1.00 . A A .  54 GLU HB3  1 1 
        5  7361 1 1  54 GLU HG2  H  13.823  -4.477   6.277 1.00 . A A .  54 GLU HG2  1 1 
        5  7362 1 1  54 GLU HG3  H  14.500  -5.186   7.730 1.00 . A A .  54 GLU HG3  1 1 
        5  7363 1 1  54 GLU N    N  11.170  -3.629   7.510 1.00 . A A .  54 GLU N    1 1 
        5  7364 1 1  54 GLU O    O   9.693  -5.807   5.342 1.00 . A A .  54 GLU O    1 1 
        5  7365 1 1  54 GLU OE1  O  13.967  -6.697   4.899 1.00 . A A .  54 GLU OE1  1 1 
        5  7366 1 1  54 GLU OE2  O  15.336  -7.217   6.577 1.00 . A A .  54 GLU OE2  1 1 
        5  7367 1 1  55 HIS C    C   7.250  -5.950   6.525 1.00 . A A .  55 HIS C    1 1 
        5  7368 1 1  55 HIS CA   C   8.183  -6.640   7.523 1.00 . A A .  55 HIS CA   1 1 
        5  7369 1 1  55 HIS CB   C   7.565  -6.778   8.915 1.00 . A A .  55 HIS CB   1 1 
        5  7370 1 1  55 HIS CD2  C   5.032  -7.263   9.342 1.00 . A A .  55 HIS CD2  1 1 
        5  7371 1 1  55 HIS CE1  C   4.997  -9.347   8.678 1.00 . A A .  55 HIS CE1  1 1 
        5  7372 1 1  55 HIS CG   C   6.294  -7.594   8.945 1.00 . A A .  55 HIS CG   1 1 
        5  7373 1 1  55 HIS H    H   9.772  -5.725   8.511 1.00 . A A .  55 HIS H    1 1 
        5  7374 1 1  55 HIS HA   H   8.412  -7.642   7.160 1.00 . A A .  55 HIS HA   1 1 
        5  7375 1 1  55 HIS HB2  H   8.295  -7.238   9.582 1.00 . A A .  55 HIS HB2  1 1 
        5  7376 1 1  55 HIS HB3  H   7.356  -5.784   9.309 1.00 . A A .  55 HIS HB3  1 1 
        5  7377 1 1  55 HIS HD1  H   7.010  -9.449   8.183 1.00 . A A .  55 HIS HD1  1 1 
        5  7378 1 1  55 HIS HD2  H   4.719  -6.292   9.728 1.00 . A A .  55 HIS HD2  1 1 
        5  7379 1 1  55 HIS HE1  H   4.635 -10.347   8.439 1.00 . A A .  55 HIS HE1  1 1 
        5  7380 1 1  55 HIS N    N   9.445  -5.922   7.587 1.00 . A A .  55 HIS N    1 1 
        5  7381 1 1  55 HIS ND1  N   6.241  -8.914   8.532 1.00 . A A .  55 HIS ND1  1 1 
        5  7382 1 1  55 HIS NE2  N   4.250  -8.323   9.180 1.00 . A A .  55 HIS NE2  1 1 
        5  7383 1 1  55 HIS O    O   6.893  -6.530   5.501 1.00 . A A .  55 HIS O    1 1 
        5  7384 1 1  56 TYR C    C   6.474  -3.977   4.553 1.00 . A A .  56 TYR C    1 1 
        5  7385 1 1  56 TYR CA   C   5.999  -3.947   6.007 1.00 . A A .  56 TYR CA   1 1 
        5  7386 1 1  56 TYR CB   C   6.068  -2.508   6.524 1.00 . A A .  56 TYR CB   1 1 
        5  7387 1 1  56 TYR CD1  C   3.875  -2.582   7.765 1.00 . A A .  56 TYR CD1  1 1 
        5  7388 1 1  56 TYR CD2  C   5.785  -1.691   8.892 1.00 . A A .  56 TYR CD2  1 1 
        5  7389 1 1  56 TYR CE1  C   3.072  -2.341   8.936 1.00 . A A .  56 TYR CE1  1 1 
        5  7390 1 1  56 TYR CE2  C   4.982  -1.450  10.063 1.00 . A A .  56 TYR CE2  1 1 
        5  7391 1 1  56 TYR CG   C   5.215  -2.252   7.768 1.00 . A A .  56 TYR CG   1 1 
        5  7392 1 1  56 TYR CZ   C   3.665  -1.787  10.027 1.00 . A A .  56 TYR CZ   1 1 
        5  7393 1 1  56 TYR H    H   7.179  -4.258   7.695 1.00 . A A .  56 TYR H    1 1 
        5  7394 1 1  56 TYR HA   H   5.003  -4.387   6.065 1.00 . A A .  56 TYR HA   1 1 
        5  7395 1 1  56 TYR HB2  H   7.106  -2.264   6.751 1.00 . A A .  56 TYR HB2  1 1 
        5  7396 1 1  56 TYR HB3  H   5.748  -1.832   5.731 1.00 . A A .  56 TYR HB3  1 1 
        5  7397 1 1  56 TYR HD1  H   3.424  -3.025   6.877 1.00 . A A .  56 TYR HD1  1 1 
        5  7398 1 1  56 TYR HD2  H   6.844  -1.431   8.894 1.00 . A A .  56 TYR HD2  1 1 
        5  7399 1 1  56 TYR HE1  H   2.012  -2.597   8.947 1.00 . A A .  56 TYR HE1  1 1 
        5  7400 1 1  56 TYR HE2  H   5.420  -1.008  10.958 1.00 . A A .  56 TYR HE2  1 1 
        5  7401 1 1  56 TYR HH   H   2.019  -1.182  10.867 1.00 . A A .  56 TYR HH   1 1 
        5  7402 1 1  56 TYR N    N   6.883  -4.722   6.860 1.00 . A A .  56 TYR N    1 1 
        5  7403 1 1  56 TYR O    O   5.734  -4.392   3.663 1.00 . A A .  56 TYR O    1 1 
        5  7404 1 1  56 TYR OH   O   2.907  -1.559  11.133 1.00 . A A .  56 TYR OH   1 1 
        5  7405 1 1  57 LYS C    C   8.049  -4.848   2.340 1.00 . A A .  57 LYS C    1 1 
        5  7406 1 1  57 LYS CA   C   8.289  -3.502   3.027 1.00 . A A .  57 LYS CA   1 1 
        5  7407 1 1  57 LYS CB   C   9.764  -3.102   3.097 1.00 . A A .  57 LYS CB   1 1 
        5  7408 1 1  57 LYS CD   C  11.571  -2.300   1.530 1.00 . A A .  57 LYS CD   1 1 
        5  7409 1 1  57 LYS CE   C  12.846  -2.706   2.270 1.00 . A A .  57 LYS CE   1 1 
        5  7410 1 1  57 LYS CG   C  10.458  -3.327   1.751 1.00 . A A .  57 LYS CG   1 1 
        5  7411 1 1  57 LYS H    H   8.302  -3.195   5.087 1.00 . A A .  57 LYS H    1 1 
        5  7412 1 1  57 LYS HA   H   7.772  -2.728   2.460 1.00 . A A .  57 LYS HA   1 1 
        5  7413 1 1  57 LYS HB2  H   9.848  -2.053   3.382 1.00 . A A .  57 LYS HB2  1 1 
        5  7414 1 1  57 LYS HB3  H  10.266  -3.683   3.870 1.00 . A A .  57 LYS HB3  1 1 
        5  7415 1 1  57 LYS HD2  H  11.778  -2.208   0.464 1.00 . A A .  57 LYS HD2  1 1 
        5  7416 1 1  57 LYS HD3  H  11.241  -1.321   1.876 1.00 . A A .  57 LYS HD3  1 1 
        5  7417 1 1  57 LYS HE2  H  13.182  -1.886   2.905 1.00 . A A .  57 LYS HE2  1 1 
        5  7418 1 1  57 LYS HE3  H  12.640  -3.552   2.926 1.00 . A A .  57 LYS HE3  1 1 
        5  7419 1 1  57 LYS HG2  H  10.875  -4.333   1.717 1.00 . A A .  57 LYS HG2  1 1 
        5  7420 1 1  57 LYS HG3  H   9.728  -3.256   0.945 1.00 . A A .  57 LYS HG3  1 1 
        5  7421 1 1  57 LYS HZ1  H  14.726  -2.512   1.490 1.00 . A A .  57 LYS HZ1  1 1 
        5  7422 1 1  57 LYS HZ2  H  14.139  -4.034   1.408 1.00 . A A .  57 LYS HZ2  1 1 
        5  7423 1 1  57 LYS HZ3  H  13.593  -2.892   0.377 1.00 . A A .  57 LYS HZ3  1 1 
        5  7424 1 1  57 LYS N    N   7.706  -3.531   4.357 1.00 . A A .  57 LYS N    1 1 
        5  7425 1 1  57 LYS NZ   N  13.912  -3.065   1.308 1.00 . A A .  57 LYS NZ   1 1 
        5  7426 1 1  57 LYS O    O   7.644  -4.893   1.179 1.00 . A A .  57 LYS O    1 1 
        5  7427 1 1  58 LYS C    C   6.667  -7.439   2.141 1.00 . A A .  58 LYS C    1 1 
        5  7428 1 1  58 LYS CA   C   8.126  -7.255   2.563 1.00 . A A .  58 LYS CA   1 1 
        5  7429 1 1  58 LYS CB   C   8.609  -8.294   3.576 1.00 . A A .  58 LYS CB   1 1 
        5  7430 1 1  58 LYS CD   C   6.884 -10.108   3.887 1.00 . A A .  58 LYS CD   1 1 
        5  7431 1 1  58 LYS CE   C   7.089 -10.137   5.403 1.00 . A A .  58 LYS CE   1 1 
        5  7432 1 1  58 LYS CG   C   8.172  -9.703   3.168 1.00 . A A .  58 LYS CG   1 1 
        5  7433 1 1  58 LYS H    H   8.637  -5.866   4.029 1.00 . A A .  58 LYS H    1 1 
        5  7434 1 1  58 LYS HA   H   8.756  -7.350   1.679 1.00 . A A .  58 LYS HA   1 1 
        5  7435 1 1  58 LYS HB2  H   9.695  -8.255   3.654 1.00 . A A .  58 LYS HB2  1 1 
        5  7436 1 1  58 LYS HB3  H   8.210  -8.058   4.563 1.00 . A A .  58 LYS HB3  1 1 
        5  7437 1 1  58 LYS HD2  H   6.088  -9.407   3.637 1.00 . A A .  58 LYS HD2  1 1 
        5  7438 1 1  58 LYS HD3  H   6.564 -11.090   3.541 1.00 . A A .  58 LYS HD3  1 1 
        5  7439 1 1  58 LYS HE2  H   8.068  -9.729   5.652 1.00 . A A .  58 LYS HE2  1 1 
        5  7440 1 1  58 LYS HE3  H   6.347  -9.503   5.888 1.00 . A A .  58 LYS HE3  1 1 
        5  7441 1 1  58 LYS HG2  H   8.018  -9.741   2.089 1.00 . A A .  58 LYS HG2  1 1 
        5  7442 1 1  58 LYS HG3  H   8.963 -10.415   3.402 1.00 . A A .  58 LYS HG3  1 1 
        5  7443 1 1  58 LYS HZ1  H   7.295 -12.162   5.215 1.00 . A A .  58 LYS HZ1  1 1 
        5  7444 1 1  58 LYS HZ2  H   7.540 -11.620   6.735 1.00 . A A .  58 LYS HZ2  1 1 
        5  7445 1 1  58 LYS HZ3  H   6.023 -11.718   6.139 1.00 . A A .  58 LYS HZ3  1 1 
        5  7446 1 1  58 LYS N    N   8.309  -5.911   3.086 1.00 . A A .  58 LYS N    1 1 
        5  7447 1 1  58 LYS NZ   N   6.978 -11.522   5.914 1.00 . A A .  58 LYS NZ   1 1 
        5  7448 1 1  58 LYS O    O   6.386  -7.772   0.991 1.00 . A A .  58 LYS O    1 1 
        5  7449 1 1  59 LEU C    C   4.014  -6.687   1.501 1.00 . A A .  59 LEU C    1 1 
        5  7450 1 1  59 LEU CA   C   4.352  -7.351   2.838 1.00 . A A .  59 LEU CA   1 1 
        5  7451 1 1  59 LEU CB   C   3.539  -6.811   4.016 1.00 . A A .  59 LEU CB   1 1 
        5  7452 1 1  59 LEU CD1  C   3.193  -6.671   6.510 1.00 . A A .  59 LEU CD1  1 1 
        5  7453 1 1  59 LEU CD2  C   3.211  -8.926   5.349 1.00 . A A .  59 LEU CD2  1 1 
        5  7454 1 1  59 LEU CG   C   3.769  -7.502   5.362 1.00 . A A .  59 LEU CG   1 1 
        5  7455 1 1  59 LEU H    H   6.011  -6.944   4.029 1.00 . A A .  59 LEU H    1 1 
        5  7456 1 1  59 LEU HA   H   4.135  -8.417   2.758 1.00 . A A .  59 LEU HA   1 1 
        5  7457 1 1  59 LEU HB2  H   3.764  -5.751   4.131 1.00 . A A .  59 LEU HB2  1 1 
        5  7458 1 1  59 LEU HB3  H   2.481  -6.887   3.767 1.00 . A A .  59 LEU HB3  1 1 
        5  7459 1 1  59 LEU HD11 H   2.127  -6.879   6.610 1.00 . A A .  59 LEU HD11 1 1 
        5  7460 1 1  59 LEU HD12 H   3.702  -6.930   7.438 1.00 . A A .  59 LEU HD12 1 1 
        5  7461 1 1  59 LEU HD13 H   3.337  -5.611   6.300 1.00 . A A .  59 LEU HD13 1 1 
        5  7462 1 1  59 LEU HD21 H   3.776  -9.543   6.049 1.00 . A A .  59 LEU HD21 1 1 
        5  7463 1 1  59 LEU HD22 H   2.163  -8.909   5.645 1.00 . A A .  59 LEU HD22 1 1 
        5  7464 1 1  59 LEU HD23 H   3.299  -9.342   4.345 1.00 . A A .  59 LEU HD23 1 1 
        5  7465 1 1  59 LEU HG   H   4.844  -7.578   5.528 1.00 . A A .  59 LEU HG   1 1 
        5  7466 1 1  59 LEU N    N   5.775  -7.214   3.096 1.00 . A A .  59 LEU N    1 1 
        5  7467 1 1  59 LEU O    O   3.470  -7.330   0.605 1.00 . A A .  59 LEU O    1 1 
        5  7468 1 1  60 ALA C    C   4.389  -5.525  -1.019 1.00 . A A .  60 ALA C    1 1 
        5  7469 1 1  60 ALA CA   C   4.089  -4.650   0.199 1.00 . A A .  60 ALA CA   1 1 
        5  7470 1 1  60 ALA CB   C   4.919  -3.365   0.213 1.00 . A A .  60 ALA CB   1 1 
        5  7471 1 1  60 ALA H    H   4.792  -4.893   2.145 1.00 . A A .  60 ALA H    1 1 
        5  7472 1 1  60 ALA HA   H   3.032  -4.386   0.195 1.00 . A A .  60 ALA HA   1 1 
        5  7473 1 1  60 ALA HB1  H   5.101  -3.039  -0.811 1.00 . A A .  60 ALA HB1  1 1 
        5  7474 1 1  60 ALA HB2  H   4.376  -2.588   0.750 1.00 . A A .  60 ALA HB2  1 1 
        5  7475 1 1  60 ALA HB3  H   5.871  -3.552   0.709 1.00 . A A .  60 ALA HB3  1 1 
        5  7476 1 1  60 ALA N    N   4.350  -5.409   1.411 1.00 . A A .  60 ALA N    1 1 
        5  7477 1 1  60 ALA O    O   3.594  -5.586  -1.956 1.00 . A A .  60 ALA O    1 1 
        5  7478 1 1  61 GLU C    C   4.911  -8.145  -2.289 1.00 . A A .  61 GLU C    1 1 
        5  7479 1 1  61 GLU CA   C   5.955  -7.050  -2.057 1.00 . A A .  61 GLU CA   1 1 
        5  7480 1 1  61 GLU CB   C   7.332  -7.655  -1.780 1.00 . A A .  61 GLU CB   1 1 
        5  7481 1 1  61 GLU CD   C   9.728  -6.913  -1.518 1.00 . A A .  61 GLU CD   1 1 
        5  7482 1 1  61 GLU CG   C   8.271  -6.621  -1.155 1.00 . A A .  61 GLU CG   1 1 
        5  7483 1 1  61 GLU H    H   6.181  -6.126  -0.203 1.00 . A A .  61 GLU H    1 1 
        5  7484 1 1  61 GLU HA   H   6.017  -6.406  -2.934 1.00 . A A .  61 GLU HA   1 1 
        5  7485 1 1  61 GLU HB2  H   7.230  -8.510  -1.110 1.00 . A A .  61 GLU HB2  1 1 
        5  7486 1 1  61 GLU HB3  H   7.763  -8.028  -2.709 1.00 . A A .  61 GLU HB3  1 1 
        5  7487 1 1  61 GLU HG2  H   7.999  -5.623  -1.501 1.00 . A A .  61 GLU HG2  1 1 
        5  7488 1 1  61 GLU HG3  H   8.153  -6.625  -0.072 1.00 . A A .  61 GLU HG3  1 1 
        5  7489 1 1  61 GLU N    N   5.540  -6.181  -0.968 1.00 . A A .  61 GLU N    1 1 
        5  7490 1 1  61 GLU O    O   4.535  -8.416  -3.428 1.00 . A A .  61 GLU O    1 1 
        5  7491 1 1  61 GLU OE1  O  10.211  -7.989  -1.105 1.00 . A A .  61 GLU OE1  1 1 
        5  7492 1 1  61 GLU OE2  O  10.327  -6.053  -2.200 1.00 . A A .  61 GLU OE2  1 1 
        5  7493 1 1  62 GLU C    C   2.147  -9.247  -1.764 1.00 . A A .  62 GLU C    1 1 
        5  7494 1 1  62 GLU CA   C   3.481  -9.802  -1.262 1.00 . A A .  62 GLU CA   1 1 
        5  7495 1 1  62 GLU CB   C   3.313 -10.488   0.096 1.00 . A A .  62 GLU CB   1 1 
        5  7496 1 1  62 GLU CD   C   2.505 -12.852   0.439 1.00 . A A .  62 GLU CD   1 1 
        5  7497 1 1  62 GLU CG   C   2.098 -11.418   0.094 1.00 . A A .  62 GLU CG   1 1 
        5  7498 1 1  62 GLU H    H   4.784  -8.516  -0.269 1.00 . A A .  62 GLU H    1 1 
        5  7499 1 1  62 GLU HA   H   3.876 -10.522  -1.979 1.00 . A A .  62 GLU HA   1 1 
        5  7500 1 1  62 GLU HB2  H   4.212 -11.058   0.333 1.00 . A A .  62 GLU HB2  1 1 
        5  7501 1 1  62 GLU HB3  H   3.199  -9.735   0.876 1.00 . A A .  62 GLU HB3  1 1 
        5  7502 1 1  62 GLU HG2  H   1.362 -11.061   0.815 1.00 . A A .  62 GLU HG2  1 1 
        5  7503 1 1  62 GLU HG3  H   1.621 -11.397  -0.885 1.00 . A A .  62 GLU HG3  1 1 
        5  7504 1 1  62 GLU N    N   4.473  -8.743  -1.192 1.00 . A A .  62 GLU N    1 1 
        5  7505 1 1  62 GLU O    O   1.480  -9.872  -2.587 1.00 . A A .  62 GLU O    1 1 
        5  7506 1 1  62 GLU OE1  O   3.277 -13.005   1.410 1.00 . A A .  62 GLU OE1  1 1 
        5  7507 1 1  62 GLU OE2  O   2.035 -13.763  -0.276 1.00 . A A .  62 GLU OE2  1 1 
        5  7508 1 1  63 GLN C    C   0.484  -7.280  -3.154 1.00 . A A .  63 GLN C    1 1 
        5  7509 1 1  63 GLN CA   C   0.554  -7.431  -1.633 1.00 . A A .  63 GLN CA   1 1 
        5  7510 1 1  63 GLN CB   C   0.404  -6.075  -0.940 1.00 . A A .  63 GLN CB   1 1 
        5  7511 1 1  63 GLN CD   C  -1.591  -5.143   0.290 1.00 . A A .  63 GLN CD   1 1 
        5  7512 1 1  63 GLN CG   C  -0.476  -6.191   0.306 1.00 . A A .  63 GLN CG   1 1 
        5  7513 1 1  63 GLN H    H   2.345  -7.576  -0.579 1.00 . A A .  63 GLN H    1 1 
        5  7514 1 1  63 GLN HA   H  -0.238  -8.097  -1.290 1.00 . A A .  63 GLN HA   1 1 
        5  7515 1 1  63 GLN HB2  H   1.386  -5.694  -0.662 1.00 . A A .  63 GLN HB2  1 1 
        5  7516 1 1  63 GLN HB3  H  -0.033  -5.356  -1.633 1.00 . A A .  63 GLN HB3  1 1 
        5  7517 1 1  63 GLN HE21 H  -2.244  -5.932  -1.456 1.00 . A A .  63 GLN HE21 1 1 
        5  7518 1 1  63 GLN HE22 H  -3.157  -4.584  -0.865 1.00 . A A .  63 GLN HE22 1 1 
        5  7519 1 1  63 GLN HG2  H  -0.912  -7.189   0.357 1.00 . A A .  63 GLN HG2  1 1 
        5  7520 1 1  63 GLN HG3  H   0.134  -6.064   1.200 1.00 . A A .  63 GLN HG3  1 1 
        5  7521 1 1  63 GLN N    N   1.797  -8.078  -1.247 1.00 . A A .  63 GLN N    1 1 
        5  7522 1 1  63 GLN NE2  N  -2.397  -5.227  -0.764 1.00 . A A .  63 GLN NE2  1 1 
        5  7523 1 1  63 GLN O    O  -0.507  -7.663  -3.774 1.00 . A A .  63 GLN O    1 1 
        5  7524 1 1  63 GLN OE1  O  -1.710  -4.313   1.176 1.00 . A A .  63 GLN OE1  1 1 
        5  7525 1 1  64 GLN C    C   1.614  -7.861  -5.878 1.00 . A A .  64 GLN C    1 1 
        5  7526 1 1  64 GLN CA   C   1.621  -6.517  -5.148 1.00 . A A .  64 GLN CA   1 1 
        5  7527 1 1  64 GLN CB   C   2.856  -5.695  -5.523 1.00 . A A .  64 GLN CB   1 1 
        5  7528 1 1  64 GLN CD   C   4.075  -3.511  -5.202 1.00 . A A .  64 GLN CD   1 1 
        5  7529 1 1  64 GLN CG   C   2.856  -4.346  -4.803 1.00 . A A .  64 GLN CG   1 1 
        5  7530 1 1  64 GLN H    H   2.351  -6.415  -3.200 1.00 . A A .  64 GLN H    1 1 
        5  7531 1 1  64 GLN HA   H   0.725  -5.952  -5.405 1.00 . A A .  64 GLN HA   1 1 
        5  7532 1 1  64 GLN HB2  H   3.758  -6.250  -5.265 1.00 . A A .  64 GLN HB2  1 1 
        5  7533 1 1  64 GLN HB3  H   2.877  -5.536  -6.601 1.00 . A A .  64 GLN HB3  1 1 
        5  7534 1 1  64 GLN HE21 H   5.137  -4.460  -3.764 1.00 . A A .  64 GLN HE21 1 1 
        5  7535 1 1  64 GLN HE22 H   6.015  -3.276  -4.674 1.00 . A A .  64 GLN HE22 1 1 
        5  7536 1 1  64 GLN HG2  H   1.943  -3.801  -5.043 1.00 . A A .  64 GLN HG2  1 1 
        5  7537 1 1  64 GLN HG3  H   2.858  -4.505  -3.724 1.00 . A A .  64 GLN HG3  1 1 
        5  7538 1 1  64 GLN N    N   1.549  -6.723  -3.711 1.00 . A A .  64 GLN N    1 1 
        5  7539 1 1  64 GLN NE2  N   5.166  -3.771  -4.488 1.00 . A A .  64 GLN NE2  1 1 
        5  7540 1 1  64 GLN O    O   1.083  -7.970  -6.982 1.00 . A A .  64 GLN O    1 1 
        5  7541 1 1  64 GLN OE1  O   4.027  -2.687  -6.100 1.00 . A A .  64 GLN OE1  1 1 
        5  7542 1 1  65 ARG C    C   0.883 -10.808  -5.871 1.00 . A A .  65 ARG C    1 1 
        5  7543 1 1  65 ARG CA   C   2.279 -10.186  -5.805 1.00 . A A .  65 ARG CA   1 1 
        5  7544 1 1  65 ARG CB   C   3.196 -11.093  -4.982 1.00 . A A .  65 ARG CB   1 1 
        5  7545 1 1  65 ARG CD   C   3.675 -13.467  -4.280 1.00 . A A .  65 ARG CD   1 1 
        5  7546 1 1  65 ARG CG   C   2.688 -12.536  -4.988 1.00 . A A .  65 ARG CG   1 1 
        5  7547 1 1  65 ARG CZ   C   3.729 -15.874  -3.637 1.00 . A A .  65 ARG CZ   1 1 
        5  7548 1 1  65 ARG H    H   2.640  -8.756  -4.333 1.00 . A A .  65 ARG H    1 1 
        5  7549 1 1  65 ARG HA   H   2.691 -10.038  -6.804 1.00 . A A .  65 ARG HA   1 1 
        5  7550 1 1  65 ARG HB2  H   4.207 -11.057  -5.387 1.00 . A A .  65 ARG HB2  1 1 
        5  7551 1 1  65 ARG HB3  H   3.251 -10.727  -3.957 1.00 . A A .  65 ARG HB3  1 1 
        5  7552 1 1  65 ARG HD2  H   4.590 -13.554  -4.866 1.00 . A A .  65 ARG HD2  1 1 
        5  7553 1 1  65 ARG HD3  H   3.955 -13.048  -3.314 1.00 . A A .  65 ARG HD3  1 1 
        5  7554 1 1  65 ARG HE   H   2.098 -14.913  -4.323 1.00 . A A .  65 ARG HE   1 1 
        5  7555 1 1  65 ARG HG2  H   1.718 -12.586  -4.494 1.00 . A A .  65 ARG HG2  1 1 
        5  7556 1 1  65 ARG HG3  H   2.541 -12.869  -6.015 1.00 . A A .  65 ARG HG3  1 1 
        5  7557 1 1  65 ARG HH11 H   5.499 -14.898  -3.419 1.00 . A A .  65 ARG HH11 1 1 
        5  7558 1 1  65 ARG HH12 H   5.521 -16.572  -2.976 1.00 . A A .  65 ARG HH12 1 1 
        5  7559 1 1  65 ARG HH21 H   2.126 -17.122  -3.738 1.00 . A A .  65 ARG HH21 1 1 
        5  7560 1 1  65 ARG HH22 H   3.589 -17.846  -3.159 1.00 . A A .  65 ARG HH22 1 1 
        5  7561 1 1  65 ARG N    N   2.210  -8.853  -5.231 1.00 . A A .  65 ARG N    1 1 
        5  7562 1 1  65 ARG NE   N   3.066 -14.803  -4.094 1.00 . A A .  65 ARG NE   1 1 
        5  7563 1 1  65 ARG NH1  N   5.026 -15.773  -3.317 1.00 . A A .  65 ARG NH1  1 1 
        5  7564 1 1  65 ARG NH2  N   3.094 -17.046  -3.500 1.00 . A A .  65 ARG NH2  1 1 
        5  7565 1 1  65 ARG O    O   0.511 -11.400  -6.884 1.00 . A A .  65 ARG O    1 1 
        5  7566 1 1  66 GLN C    C  -2.132 -10.427  -5.640 1.00 . A A .  66 GLN C    1 1 
        5  7567 1 1  66 GLN CA   C  -1.198 -11.193  -4.701 1.00 . A A .  66 GLN CA   1 1 
        5  7568 1 1  66 GLN CB   C  -1.719 -11.160  -3.263 1.00 . A A .  66 GLN CB   1 1 
        5  7569 1 1  66 GLN CD   C  -1.435 -12.103  -0.941 1.00 . A A .  66 GLN CD   1 1 
        5  7570 1 1  66 GLN CG   C  -1.064 -12.255  -2.418 1.00 . A A .  66 GLN CG   1 1 
        5  7571 1 1  66 GLN H    H   0.459 -10.171  -3.961 1.00 . A A .  66 GLN H    1 1 
        5  7572 1 1  66 GLN HA   H  -1.114 -12.230  -5.027 1.00 . A A .  66 GLN HA   1 1 
        5  7573 1 1  66 GLN HB2  H  -1.516 -10.185  -2.821 1.00 . A A .  66 GLN HB2  1 1 
        5  7574 1 1  66 GLN HB3  H  -2.801 -11.293  -3.261 1.00 . A A .  66 GLN HB3  1 1 
        5  7575 1 1  66 GLN HE21 H  -0.277 -10.444  -0.870 1.00 . A A .  66 GLN HE21 1 1 
        5  7576 1 1  66 GLN HE22 H  -1.059 -10.865   0.616 1.00 . A A .  66 GLN HE22 1 1 
        5  7577 1 1  66 GLN HG2  H  -1.381 -13.235  -2.777 1.00 . A A .  66 GLN HG2  1 1 
        5  7578 1 1  66 GLN HG3  H   0.019 -12.209  -2.532 1.00 . A A .  66 GLN HG3  1 1 
        5  7579 1 1  66 GLN N    N   0.149 -10.653  -4.780 1.00 . A A .  66 GLN N    1 1 
        5  7580 1 1  66 GLN NE2  N  -0.877 -11.050  -0.349 1.00 . A A .  66 GLN NE2  1 1 
        5  7581 1 1  66 GLN O    O  -2.903 -11.032  -6.384 1.00 . A A .  66 GLN O    1 1 
        5  7582 1 1  66 GLN OE1  O  -2.177 -12.889  -0.377 1.00 . A A .  66 GLN OE1  1 1 
        5  7583 1 1  67 TYR C    C  -2.791  -8.686  -7.876 1.00 . A A .  67 TYR C    1 1 
        5  7584 1 1  67 TYR CA   C  -2.860  -8.253  -6.410 1.00 . A A .  67 TYR CA   1 1 
        5  7585 1 1  67 TYR CB   C  -2.277  -6.844  -6.278 1.00 . A A .  67 TYR CB   1 1 
        5  7586 1 1  67 TYR CD1  C  -2.417  -5.966  -8.638 1.00 . A A .  67 TYR CD1  1 1 
        5  7587 1 1  67 TYR CD2  C  -3.668  -4.847  -6.936 1.00 . A A .  67 TYR CD2  1 1 
        5  7588 1 1  67 TYR CE1  C  -2.913  -5.033  -9.616 1.00 . A A .  67 TYR CE1  1 1 
        5  7589 1 1  67 TYR CE2  C  -4.164  -3.914  -7.914 1.00 . A A .  67 TYR CE2  1 1 
        5  7590 1 1  67 TYR CG   C  -2.805  -5.853  -7.318 1.00 . A A .  67 TYR CG   1 1 
        5  7591 1 1  67 TYR CZ   C  -3.763  -4.053  -9.206 1.00 . A A .  67 TYR CZ   1 1 
        5  7592 1 1  67 TYR H    H  -1.404  -8.623  -4.967 1.00 . A A .  67 TYR H    1 1 
        5  7593 1 1  67 TYR HA   H  -3.889  -8.337  -6.062 1.00 . A A .  67 TYR HA   1 1 
        5  7594 1 1  67 TYR HB2  H  -2.498  -6.462  -5.282 1.00 . A A .  67 TYR HB2  1 1 
        5  7595 1 1  67 TYR HB3  H  -1.192  -6.901  -6.364 1.00 . A A .  67 TYR HB3  1 1 
        5  7596 1 1  67 TYR HD1  H  -1.735  -6.761  -8.939 1.00 . A A .  67 TYR HD1  1 1 
        5  7597 1 1  67 TYR HD2  H  -3.974  -4.758  -5.893 1.00 . A A .  67 TYR HD2  1 1 
        5  7598 1 1  67 TYR HE1  H  -2.615  -5.110 -10.662 1.00 . A A .  67 TYR HE1  1 1 
        5  7599 1 1  67 TYR HE2  H  -4.847  -3.114  -7.626 1.00 . A A .  67 TYR HE2  1 1 
        5  7600 1 1  67 TYR HH   H  -4.859  -2.525  -9.698 1.00 . A A .  67 TYR HH   1 1 
        5  7601 1 1  67 TYR N    N  -2.033  -9.107  -5.575 1.00 . A A .  67 TYR N    1 1 
        5  7602 1 1  67 TYR O    O  -3.689  -8.382  -8.659 1.00 . A A .  67 TYR O    1 1 
        5  7603 1 1  67 TYR OH   O  -4.232  -3.172 -10.130 1.00 . A A .  67 TYR OH   1 1 
        5  7604 1 1  68 LYS C    C  -2.484 -11.019  -9.836 1.00 . A A .  68 LYS C    1 1 
        5  7605 1 1  68 LYS CA   C  -1.518  -9.866  -9.560 1.00 . A A .  68 LYS CA   1 1 
        5  7606 1 1  68 LYS CB   C  -0.049 -10.225  -9.792 1.00 . A A .  68 LYS CB   1 1 
        5  7607 1 1  68 LYS CD   C   1.494  -8.784 -11.172 1.00 . A A .  68 LYS CD   1 1 
        5  7608 1 1  68 LYS CE   C   1.996  -7.349 -11.345 1.00 . A A .  68 LYS CE   1 1 
        5  7609 1 1  68 LYS CG   C   0.827  -8.970  -9.808 1.00 . A A .  68 LYS CG   1 1 
        5  7610 1 1  68 LYS H    H  -0.990  -9.631  -7.558 1.00 . A A .  68 LYS H    1 1 
        5  7611 1 1  68 LYS HA   H  -1.759  -9.044 -10.234 1.00 . A A .  68 LYS HA   1 1 
        5  7612 1 1  68 LYS HB2  H   0.293 -10.902  -9.009 1.00 . A A .  68 LYS HB2  1 1 
        5  7613 1 1  68 LYS HB3  H   0.054 -10.756 -10.739 1.00 . A A .  68 LYS HB3  1 1 
        5  7614 1 1  68 LYS HD2  H   2.328  -9.479 -11.271 1.00 . A A .  68 LYS HD2  1 1 
        5  7615 1 1  68 LYS HD3  H   0.784  -9.023 -11.964 1.00 . A A .  68 LYS HD3  1 1 
        5  7616 1 1  68 LYS HE2  H   2.032  -7.095 -12.404 1.00 . A A .  68 LYS HE2  1 1 
        5  7617 1 1  68 LYS HE3  H   1.300  -6.654 -10.875 1.00 . A A .  68 LYS HE3  1 1 
        5  7618 1 1  68 LYS HG2  H   0.220  -8.096  -9.573 1.00 . A A .  68 LYS HG2  1 1 
        5  7619 1 1  68 LYS HG3  H   1.590  -9.046  -9.033 1.00 . A A .  68 LYS HG3  1 1 
        5  7620 1 1  68 LYS HZ1  H   3.942  -6.727 -11.393 1.00 . A A .  68 LYS HZ1  1 1 
        5  7621 1 1  68 LYS HZ2  H   3.271  -6.655  -9.906 1.00 . A A .  68 LYS HZ2  1 1 
        5  7622 1 1  68 LYS HZ3  H   3.716  -8.096 -10.533 1.00 . A A .  68 LYS HZ3  1 1 
        5  7623 1 1  68 LYS N    N  -1.716  -9.388  -8.202 1.00 . A A .  68 LYS N    1 1 
        5  7624 1 1  68 LYS NZ   N   3.340  -7.194 -10.746 1.00 . A A .  68 LYS NZ   1 1 
        5  7625 1 1  68 LYS O    O  -3.416 -10.878 -10.626 1.00 . A A .  68 LYS O    1 1 
        5  7626 1 1  69 VAL C    C  -4.534 -12.914  -9.185 1.00 . A A .  69 VAL C    1 1 
        5  7627 1 1  69 VAL CA   C  -3.064 -13.313  -9.333 1.00 . A A .  69 VAL CA   1 1 
        5  7628 1 1  69 VAL CB   C  -2.637 -14.399  -8.344 1.00 . A A .  69 VAL CB   1 1 
        5  7629 1 1  69 VAL CG1  C  -1.114 -14.541  -8.309 1.00 . A A .  69 VAL CG1  1 1 
        5  7630 1 1  69 VAL CG2  C  -3.195 -14.119  -6.947 1.00 . A A .  69 VAL