NMR Restraints Grid

Result table
 (Save to zip file containing files for each block)

image mrblock_id pdb_id bmrb_id cing stage program type subtype item_count
558580 2ltq 18493 cing 4-filtered-FRED STAR entry full 1138


data_FRED_restraints_with_modified_coordinates_PDB_code_2ltq

# This FRED archive file contains, for PDB entry <2ltq>:
# 
# - Coordinates and sequence information from the PDB mmCIF file
# - NMR restraints from the PDB MR file
# 
# In this file, the coordinates and NMR restraints share the same atom names,
# and in this way can differ from the data deposited at the wwPDB. To achieve
# this aim, the NMR restraints were parsed from their original format files, and
# the coordinates and NMR restraints information were subsequently harmonized.
# 
# Due to the complexity of this harmonization process and the filtering process
# used in creating these files, the NMR restraints information in these files
# may differ significantly from that in the originally deposited file. Other 
# modifications could have occurred to the NMR restraints information, or data 
# could have been lost because of parsing or conversion errors. The PDB file 
# remains the authoritative reference for the atomic coordinates and the 
# originally deposited restraints files remain the primary reference for these 
# data.
# 
# This file is generated at the BioMagResBank (BMRB) in collaboration with the 
# PDBe (formerly MSD) group at the European Bioinformatics Institute (EBI) and 
# the CMBI/IMM group at the Radboud University of Nijmegen.
# 
# Several software packages were used to produce this file:
# 
# - Wattos (BMRB and CMBI/IMM).
# - FormatConverter and NMRStarExport (PDBe).
# - CCPN framework (http://www.ccpn.ac.uk/).
# 
# More information about this process can be found in the references below.
# Please cite the original reference for this PDB entry.
# 
# JF Doreleijers, A Nederveen, W Vranken, J Lin, AM Bonvin, R Kaptein, JL
# Markley, and EL Ulrich (2005). BioMagResBank databases DOCR and FRED
# containing converted and filtered sets of experimental NMR restraints and
# coordinates from over 500 protein PDB structures. J. Biomol. NMR 32, 1-12.
# 
# WF Vranken, W Boucher, TJ Stevens, RH Fogh, A Pajon, M Llinas, EL Ulrich, JL
# Markley, J Ionides, ED Laue (2005). The CCPN data model for NMR spectroscopy:
# development of a software pipeline. Proteins 59, 687-696. 
# 
# JF Doreleijers, WF Vranken, C Schulte, J Lin, JR Wedell, CJ Penkett, GW Vuister, 
# G Vriend, JL Markley, and EL Ulrich (2009). The NMR Restraints Grid at BMRB for 
# 5,266 Protein and Nucleic Acid PDB Entries. J Biomol. NMR 45, 389?396.




save_Conversion_project_for_entry_Name_1
    _Study_list.Sf_category  study_list
    _Study_list.Entry_ID     1
    _Study_list.ID           1

    loop_
       _Study.ID
       _Study.Name
       _Study.Type
       _Study.Details
       _Study.Entry_ID
       _Study.Study_list_ID

       1 "Conversion project for entry 1" NMR . 1 1 
    stop_

save_


save_originalConstraints_1
    _Entry.PDB_coordinate_file_version  .
    _Entry.Sf_category                  entry_information
    _Entry.ID                           1
    _Entry.Title                        "Data for entry 1"
    _Entry.NMR_STAR_version             3.1.0.8
    _Entry.Experimental_method          NMR
    _Entry.Details                      .

save_


save_assembly_2ltq
    _Assembly.Sf_category           assembly
    _Assembly.Entry_ID              1
    _Assembly.ID                    1
    _Assembly.Name                  2ltq
    _Assembly.Number_of_components  8
    _Assembly.Organic_ligands       .
    _Assembly.Metal_ions            .
    _Assembly.Paramagnetic          .
    _Assembly.Thiol_state           unknown
    _Assembly.Molecular_mass        127726.67

    loop_
       _Entity_assembly.ID
       _Entity_assembly.Entity_assembly_name
       _Entity_assembly.Entity_ID
       _Entity_assembly.Entity_label
       _Entity_assembly.Asym_ID
       _Entity_assembly.Details
       _Entity_assembly.Entry_ID
       _Entity_assembly.Assembly_ID

       1 . 1 $Disulfide_bond_formation_protein_B A . 1 1 
       2 . 2 $Fab_fragment_light_chain           B . 1 1 
       3 . 3 $Fab_fragment_heavy_chain           C . 1 1 
       4 . 1 $Disulfide_bond_formation_protein_B D . 1 1 
       5 . 2 $Fab_fragment_light_chain           E . 1 1 
       6 . 3 $Fab_fragment_heavy_chain           F . 1 1 
       7 . 4 $UBIQUINONE_1                       G . 1 1 
       8 . 4 $UBIQUINONE_1                       H . 1 1 
    stop_

    loop_
       _PDBX_nonpoly_scheme.Entity_assembly_ID
       _PDBX_nonpoly_scheme.Entity_ID
       _PDBX_nonpoly_scheme.Mon_ID
       _PDBX_nonpoly_scheme.Comp_index_ID
       _PDBX_nonpoly_scheme.Comp_ID
       _PDBX_nonpoly_scheme.Entry_ID
       _PDBX_nonpoly_scheme.Assembly_ID

       7 4 UQ1 1 UQ1 1 1 
       8 4 UQ1 1 UQ1 1 1 
    stop_

save_


save_Disulfide_bond_formation_protein_B
    _Entity.Sf_category                  entity
    _Entity.Entry_ID                     1
    _Entity.ID                           1
    _Entity.Name                         "Disulfide bond formation protein B"
    _Entity.Type                         polymer
    _Entity.Polymer_type                 polypeptide(L)
    _Entity.Polymer_seq_one_letter_code  MLRFLNQASQGRGAWLLMAFTALALELTALWFQHVMLLKPSVLCIYERVALFGVLGAALIGAIAPKTPLRYVAMVIWLYSAFRGVQLTYEHTMLQLYPSPFATCDFMVRFPEWLPLDKWVPQVFVASGDCAERQWDFLGLEMPQWLLGIFIAYLIVAVLVVISQPFKAKKRDLFGR
    _Entity.Number_of_monomers           176

    loop_
       _Entity_comp_index.ID
       _Entity_comp_index.Comp_ID
       _Entity_comp_index.Comp_label
       _Entity_comp_index.Entry_ID
       _Entity_comp_index.Entity_ID

         1 MET . 1 1 
         2 LEU . 1 1 
         3 ARG . 1 1 
         4 PHE . 1 1 
         5 LEU . 1 1 
         6 ASN . 1 1 
         7 GLN . 1 1 
         8 ALA . 1 1 
         9 SER . 1 1 
        10 GLN . 1 1 
        11 GLY . 1 1 
        12 ARG . 1 1 
        13 GLY . 1 1 
        14 ALA . 1 1 
        15 TRP . 1 1 
        16 LEU . 1 1 
        17 LEU . 1 1 
        18 MET . 1 1 
        19 ALA . 1 1 
        20 PHE . 1 1 
        21 THR . 1 1 
        22 ALA . 1 1 
        23 LEU . 1 1 
        24 ALA . 1 1 
        25 LEU . 1 1 
        26 GLU . 1 1 
        27 LEU . 1 1 
        28 THR . 1 1 
        29 ALA . 1 1 
        30 LEU . 1 1 
        31 TRP . 1 1 
        32 PHE . 1 1 
        33 GLN . 1 1 
        34 HIS . 1 1 
        35 VAL . 1 1 
        36 MET . 1 1 
        37 LEU . 1 1 
        38 LEU . 1 1 
        39 LYS . 1 1 
        40 PRO . 1 1 
        41 SER . 1 1 
        42 VAL . 1 1 
        43 LEU . 1 1 
        44 CYS . 1 1 
        45 ILE . 1 1 
        46 TYR . 1 1 
        47 GLU . 1 1 
        48 ARG . 1 1 
        49 VAL . 1 1 
        50 ALA . 1 1 
        51 LEU . 1 1 
        52 PHE . 1 1 
        53 GLY . 1 1 
        54 VAL . 1 1 
        55 LEU . 1 1 
        56 GLY . 1 1 
        57 ALA . 1 1 
        58 ALA . 1 1 
        59 LEU . 1 1 
        60 ILE . 1 1 
        61 GLY . 1 1 
        62 ALA . 1 1 
        63 ILE . 1 1 
        64 ALA . 1 1 
        65 PRO . 1 1 
        66 LYS . 1 1 
        67 THR . 1 1 
        68 PRO . 1 1 
        69 LEU . 1 1 
        70 ARG . 1 1 
        71 TYR . 1 1 
        72 VAL . 1 1 
        73 ALA . 1 1 
        74 MET . 1 1 
        75 VAL . 1 1 
        76 ILE . 1 1 
        77 TRP . 1 1 
        78 LEU . 1 1 
        79 TYR . 1 1 
        80 SER . 1 1 
        81 ALA . 1 1 
        82 PHE . 1 1 
        83 ARG . 1 1 
        84 GLY . 1 1 
        85 VAL . 1 1 
        86 GLN . 1 1 
        87 LEU . 1 1 
        88 THR . 1 1 
        89 TYR . 1 1 
        90 GLU . 1 1 
        91 HIS . 1 1 
        92 THR . 1 1 
        93 MET . 1 1 
        94 LEU . 1 1 
        95 GLN . 1 1 
        96 LEU . 1 1 
        97 TYR . 1 1 
        98 PRO . 1 1 
        99 SER . 1 1 
       100 PRO . 1 1 
       101 PHE . 1 1 
       102 ALA . 1 1 
       103 THR . 1 1 
       104 CYS . 1 1 
       105 ASP . 1 1 
       106 PHE . 1 1 
       107 MET . 1 1 
       108 VAL . 1 1 
       109 ARG . 1 1 
       110 PHE . 1 1 
       111 PRO . 1 1 
       112 GLU . 1 1 
       113 TRP . 1 1 
       114 LEU . 1 1 
       115 PRO . 1 1 
       116 LEU . 1 1 
       117 ASP . 1 1 
       118 LYS . 1 1 
       119 TRP . 1 1 
       120 VAL . 1 1 
       121 PRO . 1 1 
       122 GLN . 1 1 
       123 VAL . 1 1 
       124 PHE . 1 1 
       125 VAL . 1 1 
       126 ALA . 1 1 
       127 SER . 1 1 
       128 GLY . 1 1 
       129 ASP . 1 1 
       130 CYS . 1 1 
       131 ALA . 1 1 
       132 GLU . 1 1 
       133 ARG . 1 1 
       134 GLN . 1 1 
       135 TRP . 1 1 
       136 ASP . 1 1 
       137 PHE . 1 1 
       138 LEU . 1 1 
       139 GLY . 1 1 
       140 LEU . 1 1 
       141 GLU . 1 1 
       142 MET . 1 1 
       143 PRO . 1 1 
       144 GLN . 1 1 
       145 TRP . 1 1 
       146 LEU . 1 1 
       147 LEU . 1 1 
       148 GLY . 1 1 
       149 ILE . 1 1 
       150 PHE . 1 1 
       151 ILE . 1 1 
       152 ALA . 1 1 
       153 TYR . 1 1 
       154 LEU . 1 1 
       155 ILE . 1 1 
       156 VAL . 1 1 
       157 ALA . 1 1 
       158 VAL . 1 1 
       159 LEU . 1 1 
       160 VAL . 1 1 
       161 VAL . 1 1 
       162 ILE . 1 1 
       163 SER . 1 1 
       164 GLN . 1 1 
       165 PRO . 1 1 
       166 PHE . 1 1 
       167 LYS . 1 1 
       168 ALA . 1 1 
       169 LYS . 1 1 
       170 LYS . 1 1 
       171 ARG . 1 1 
       172 ASP . 1 1 
       173 LEU . 1 1 
       174 PHE . 1 1 
       175 GLY . 1 1 
       176 ARG . 1 1 
    stop_

    loop_
       _Entity_poly_seq.Mon_ID
       _Entity_poly_seq.Num
       _Entity_poly_seq.Comp_index_ID
       _Entity_poly_seq.Entry_ID
       _Entity_poly_seq.Entity_ID

       MET   1   1 1 1 
       LEU   2   2 1 1 
       ARG   3   3 1 1 
       PHE   4   4 1 1 
       LEU   5   5 1 1 
       ASN   6   6 1 1 
       GLN   7   7 1 1 
       ALA   8   8 1 1 
       SER   9   9 1 1 
       GLN  10  10 1 1 
       GLY  11  11 1 1 
       ARG  12  12 1 1 
       GLY  13  13 1 1 
       ALA  14  14 1 1 
       TRP  15  15 1 1 
       LEU  16  16 1 1 
       LEU  17  17 1 1 
       MET  18  18 1 1 
       ALA  19  19 1 1 
       PHE  20  20 1 1 
       THR  21  21 1 1 
       ALA  22  22 1 1 
       LEU  23  23 1 1 
       ALA  24  24 1 1 
       LEU  25  25 1 1 
       GLU  26  26 1 1 
       LEU  27  27 1 1 
       THR  28  28 1 1 
       ALA  29  29 1 1 
       LEU  30  30 1 1 
       TRP  31  31 1 1 
       PHE  32  32 1 1 
       GLN  33  33 1 1 
       HIS  34  34 1 1 
       VAL  35  35 1 1 
       MET  36  36 1 1 
       LEU  37  37 1 1 
       LEU  38  38 1 1 
       LYS  39  39 1 1 
       PRO  40  40 1 1 
       SER  41  41 1 1 
       VAL  42  42 1 1 
       LEU  43  43 1 1 
       CYS  44  44 1 1 
       ILE  45  45 1 1 
       TYR  46  46 1 1 
       GLU  47  47 1 1 
       ARG  48  48 1 1 
       VAL  49  49 1 1 
       ALA  50  50 1 1 
       LEU  51  51 1 1 
       PHE  52  52 1 1 
       GLY  53  53 1 1 
       VAL  54  54 1 1 
       LEU  55  55 1 1 
       GLY  56  56 1 1 
       ALA  57  57 1 1 
       ALA  58  58 1 1 
       LEU  59  59 1 1 
       ILE  60  60 1 1 
       GLY  61  61 1 1 
       ALA  62  62 1 1 
       ILE  63  63 1 1 
       ALA  64  64 1 1 
       PRO  65  65 1 1 
       LYS  66  66 1 1 
       THR  67  67 1 1 
       PRO  68  68 1 1 
       LEU  69  69 1 1 
       ARG  70  70 1 1 
       TYR  71  71 1 1 
       VAL  72  72 1 1 
       ALA  73  73 1 1 
       MET  74  74 1 1 
       VAL  75  75 1 1 
       ILE  76  76 1 1 
       TRP  77  77 1 1 
       LEU  78  78 1 1 
       TYR  79  79 1 1 
       SER  80  80 1 1 
       ALA  81  81 1 1 
       PHE  82  82 1 1 
       ARG  83  83 1 1 
       GLY  84  84 1 1 
       VAL  85  85 1 1 
       GLN  86  86 1 1 
       LEU  87  87 1 1 
       THR  88  88 1 1 
       TYR  89  89 1 1 
       GLU  90  90 1 1 
       HIS  91  91 1 1 
       THR  92  92 1 1 
       MET  93  93 1 1 
       LEU  94  94 1 1 
       GLN  95  95 1 1 
       LEU  96  96 1 1 
       TYR  97  97 1 1 
       PRO  98  98 1 1 
       SER  99  99 1 1 
       PRO 100 100 1 1 
       PHE 101 101 1 1 
       ALA 102 102 1 1 
       THR 103 103 1 1 
       CYS 104 104 1 1 
       ASP 105 105 1 1 
       PHE 106 106 1 1 
       MET 107 107 1 1 
       VAL 108 108 1 1 
       ARG 109 109 1 1 
       PHE 110 110 1 1 
       PRO 111 111 1 1 
       GLU 112 112 1 1 
       TRP 113 113 1 1 
       LEU 114 114 1 1 
       PRO 115 115 1 1 
       LEU 116 116 1 1 
       ASP 117 117 1 1 
       LYS 118 118 1 1 
       TRP 119 119 1 1 
       VAL 120 120 1 1 
       PRO 121 121 1 1 
       GLN 122 122 1 1 
       VAL 123 123 1 1 
       PHE 124 124 1 1 
       VAL 125 125 1 1 
       ALA 126 126 1 1 
       SER 127 127 1 1 
       GLY 128 128 1 1 
       ASP 129 129 1 1 
       CYS 130 130 1 1 
       ALA 131 131 1 1 
       GLU 132 132 1 1 
       ARG 133 133 1 1 
       GLN 134 134 1 1 
       TRP 135 135 1 1 
       ASP 136 136 1 1 
       PHE 137 137 1 1 
       LEU 138 138 1 1 
       GLY 139 139 1 1 
       LEU 140 140 1 1 
       GLU 141 141 1 1 
       MET 142 142 1 1 
       PRO 143 143 1 1 
       GLN 144 144 1 1 
       TRP 145 145 1 1 
       LEU 146 146 1 1 
       LEU 147 147 1 1 
       GLY 148 148 1 1 
       ILE 149 149 1 1 
       PHE 150 150 1 1 
       ILE 151 151 1 1 
       ALA 152 152 1 1 
       TYR 153 153 1 1 
       LEU 154 154 1 1 
       ILE 155 155 1 1 
       VAL 156 156 1 1 
       ALA 157 157 1 1 
       VAL 158 158 1 1 
       LEU 159 159 1 1 
       VAL 160 160 1 1 
       VAL 161 161 1 1 
       ILE 162 162 1 1 
       SER 163 163 1 1 
       GLN 164 164 1 1 
       PRO 165 165 1 1 
       PHE 166 166 1 1 
       LYS 167 167 1 1 
       ALA 168 168 1 1 
       LYS 169 169 1 1 
       LYS 170 170 1 1 
       ARG 171 171 1 1 
       ASP 172 172 1 1 
       LEU 173 173 1 1 
       PHE 174 174 1 1 
       GLY 175 175 1 1 
       ARG 176 176 1 1 
    stop_

save_


save_Fab_fragment_light_chain
    _Entity.Sf_category                  entity
    _Entity.Entry_ID                     1
    _Entity.ID                           2
    _Entity.Name                         "Fab fragment light chain"
    _Entity.Type                         polymer
    _Entity.Polymer_type                 polypeptide(L)
    _Entity.Polymer_seq_one_letter_code  MDSQAQVLILLLLWVSGTCGDIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSYNLYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
    _Entity.Number_of_monomers           239

    loop_
       _Entity_comp_index.ID
       _Entity_comp_index.Comp_ID
       _Entity_comp_index.Comp_label
       _Entity_comp_index.Entry_ID
       _Entity_comp_index.Entity_ID

         1 MET . 1 2 
         2 ASP . 1 2 
         3 SER . 1 2 
         4 GLN . 1 2 
         5 ALA . 1 2 
         6 GLN . 1 2 
         7 VAL . 1 2 
         8 LEU . 1 2 
         9 ILE . 1 2 
        10 LEU . 1 2 
        11 LEU . 1 2 
        12 LEU . 1 2 
        13 LEU . 1 2 
        14 TRP . 1 2 
        15 VAL . 1 2 
        16 SER . 1 2 
        17 GLY . 1 2 
        18 THR . 1 2 
        19 CYS . 1 2 
        20 GLY . 1 2 
        21 ASP . 1 2 
        22 ILE . 1 2 
        23 VAL . 1 2 
        24 MET . 1 2 
        25 SER . 1 2 
        26 GLN . 1 2 
        27 SER . 1 2 
        28 PRO . 1 2 
        29 SER . 1 2 
        30 SER . 1 2 
        31 LEU . 1 2 
        32 ALA . 1 2 
        33 VAL . 1 2 
        34 SER . 1 2 
        35 ALA . 1 2 
        36 GLY . 1 2 
        37 GLU . 1 2 
        38 LYS . 1 2 
        39 VAL . 1 2 
        40 THR . 1 2 
        41 MET . 1 2 
        42 SER . 1 2 
        43 CYS . 1 2 
        44 LYS . 1 2 
        45 SER . 1 2 
        46 SER . 1 2 
        47 GLN . 1 2 
        48 SER . 1 2 
        49 LEU . 1 2 
        50 LEU . 1 2 
        51 ASN . 1 2 
        52 SER . 1 2 
        53 ARG . 1 2 
        54 THR . 1 2 
        55 ARG . 1 2 
        56 LYS . 1 2 
        57 ASN . 1 2 
        58 TYR . 1 2 
        59 LEU . 1 2 
        60 ALA . 1 2 
        61 TRP . 1 2 
        62 TYR . 1 2 
        63 GLN . 1 2 
        64 GLN . 1 2 
        65 LYS . 1 2 
        66 PRO . 1 2 
        67 GLY . 1 2 
        68 GLN . 1 2 
        69 SER . 1 2 
        70 PRO . 1 2 
        71 LYS . 1 2 
        72 LEU . 1 2 
        73 LEU . 1 2 
        74 ILE . 1 2 
        75 TYR . 1 2 
        76 TRP . 1 2 
        77 ALA . 1 2 
        78 SER . 1 2 
        79 THR . 1 2 
        80 ARG . 1 2 
        81 GLU . 1 2 
        82 SER . 1 2 
        83 GLY . 1 2 
        84 VAL . 1 2 
        85 PRO . 1 2 
        86 ASP . 1 2 
        87 ARG . 1 2 
        88 PHE . 1 2 
        89 THR . 1 2 
        90 GLY . 1 2 
        91 SER . 1 2 
        92 GLY . 1 2 
        93 SER . 1 2 
        94 GLY . 1 2 
        95 THR . 1 2 
        96 ASP . 1 2 
        97 PHE . 1 2 
        98 THR . 1 2 
        99 LEU . 1 2 
       100 THR . 1 2 
       101 ILE . 1 2 
       102 SER . 1 2 
       103 SER . 1 2 
       104 VAL . 1 2 
       105 GLN . 1 2 
       106 ALA . 1 2 
       107 GLU . 1 2 
       108 ASP . 1 2 
       109 LEU . 1 2 
       110 ALA . 1 2 
       111 VAL . 1 2 
       112 TYR . 1 2 
       113 TYR . 1 2 
       114 CYS . 1 2 
       115 LYS . 1 2 
       116 GLN . 1 2 
       117 SER . 1 2 
       118 TYR . 1 2 
       119 ASN . 1 2 
       120 LEU . 1 2 
       121 TYR . 1 2 
       122 THR . 1 2 
       123 PHE . 1 2 
       124 GLY . 1 2 
       125 GLY . 1 2 
       126 GLY . 1 2 
       127 THR . 1 2 
       128 LYS . 1 2 
       129 LEU . 1 2 
       130 GLU . 1 2 
       131 ILE . 1 2 
       132 LYS . 1 2 
       133 ARG . 1 2 
       134 ALA . 1 2 
       135 ASP . 1 2 
       136 ALA . 1 2 
       137 ALA . 1 2 
       138 PRO . 1 2 
       139 THR . 1 2 
       140 VAL . 1 2 
       141 SER . 1 2 
       142 ILE . 1 2 
       143 PHE . 1 2 
       144 PRO . 1 2 
       145 PRO . 1 2 
       146 SER . 1 2 
       147 SER . 1 2 
       148 GLU . 1 2 
       149 GLN . 1 2 
       150 LEU . 1 2 
       151 THR . 1 2 
       152 SER . 1 2 
       153 GLY . 1 2 
       154 GLY . 1 2 
       155 ALA . 1 2 
       156 SER . 1 2 
       157 VAL . 1 2 
       158 VAL . 1 2 
       159 CYS . 1 2 
       160 PHE . 1 2 
       161 LEU . 1 2 
       162 ASN . 1 2 
       163 ASN . 1 2 
       164 PHE . 1 2 
       165 TYR . 1 2 
       166 PRO . 1 2 
       167 LYS . 1 2 
       168 ASP . 1 2 
       169 ILE . 1 2 
       170 ASN . 1 2 
       171 VAL . 1 2 
       172 LYS . 1 2 
       173 TRP . 1 2 
       174 LYS . 1 2 
       175 ILE . 1 2 
       176 ASP . 1 2 
       177 GLY . 1 2 
       178 SER . 1 2 
       179 GLU . 1 2 
       180 ARG . 1 2 
       181 GLN . 1 2 
       182 ASN . 1 2 
       183 GLY . 1 2 
       184 VAL . 1 2 
       185 LEU . 1 2 
       186 ASN . 1 2 
       187 SER . 1 2 
       188 TRP . 1 2 
       189 THR . 1 2 
       190 ASP . 1 2 
       191 GLN . 1 2 
       192 ASP . 1 2 
       193 SER . 1 2 
       194 LYS . 1 2 
       195 ASP . 1 2 
       196 SER . 1 2 
       197 THR . 1 2 
       198 TYR . 1 2 
       199 SER . 1 2 
       200 MET . 1 2 
       201 SER . 1 2 
       202 SER . 1 2 
       203 THR . 1 2 
       204 LEU . 1 2 
       205 THR . 1 2 
       206 LEU . 1 2 
       207 THR . 1 2 
       208 LYS . 1 2 
       209 ASP . 1 2 
       210 GLU . 1 2 
       211 TYR . 1 2 
       212 GLU . 1 2 
       213 ARG . 1 2 
       214 HIS . 1 2 
       215 ASN . 1 2 
       216 SER . 1 2 
       217 TYR . 1 2 
       218 THR . 1 2 
       219 CYS . 1 2 
       220 GLU . 1 2 
       221 ALA . 1 2 
       222 THR . 1 2 
       223 HIS . 1 2 
       224 LYS . 1 2 
       225 THR . 1 2 
       226 SER . 1 2 
       227 THR . 1 2 
       228 SER . 1 2 
       229 PRO . 1 2 
       230 ILE . 1 2 
       231 VAL . 1 2 
       232 LYS . 1 2 
       233 SER . 1 2 
       234 PHE . 1 2 
       235 ASN . 1 2 
       236 ARG . 1 2 
       237 ASN . 1 2 
       238 GLU . 1 2 
       239 CYS . 1 2 
    stop_

    loop_
       _Entity_poly_seq.Mon_ID
       _Entity_poly_seq.Num
       _Entity_poly_seq.Comp_index_ID
       _Entity_poly_seq.Entry_ID
       _Entity_poly_seq.Entity_ID

       MET   1   1 1 2 
       ASP   2   2 1 2 
       SER   3   3 1 2 
       GLN   4   4 1 2 
       ALA   5   5 1 2 
       GLN   6   6 1 2 
       VAL   7   7 1 2 
       LEU   8   8 1 2 
       ILE   9   9 1 2 
       LEU  10  10 1 2 
       LEU  11  11 1 2 
       LEU  12  12 1 2 
       LEU  13  13 1 2 
       TRP  14  14 1 2 
       VAL  15  15 1 2 
       SER  16  16 1 2 
       GLY  17  17 1 2 
       THR  18  18 1 2 
       CYS  19  19 1 2 
       GLY  20  20 1 2 
       ASP  21  21 1 2 
       ILE  22  22 1 2 
       VAL  23  23 1 2 
       MET  24  24 1 2 
       SER  25  25 1 2 
       GLN  26  26 1 2 
       SER  27  27 1 2 
       PRO  28  28 1 2 
       SER  29  29 1 2 
       SER  30  30 1 2 
       LEU  31  31 1 2 
       ALA  32  32 1 2 
       VAL  33  33 1 2 
       SER  34  34 1 2 
       ALA  35  35 1 2 
       GLY  36  36 1 2 
       GLU  37  37 1 2 
       LYS  38  38 1 2 
       VAL  39  39 1 2 
       THR  40  40 1 2 
       MET  41  41 1 2 
       SER  42  42 1 2 
       CYS  43  43 1 2 
       LYS  44  44 1 2 
       SER  45  45 1 2 
       SER  46  46 1 2 
       GLN  47  47 1 2 
       SER  48  48 1 2 
       LEU  49  49 1 2 
       LEU  50  50 1 2 
       ASN  51  51 1 2 
       SER  52  52 1 2 
       ARG  53  53 1 2 
       THR  54  54 1 2 
       ARG  55  55 1 2 
       LYS  56  56 1 2 
       ASN  57  57 1 2 
       TYR  58  58 1 2 
       LEU  59  59 1 2 
       ALA  60  60 1 2 
       TRP  61  61 1 2 
       TYR  62  62 1 2 
       GLN  63  63 1 2 
       GLN  64  64 1 2 
       LYS  65  65 1 2 
       PRO  66  66 1 2 
       GLY  67  67 1 2 
       GLN  68  68 1 2 
       SER  69  69 1 2 
       PRO  70  70 1 2 
       LYS  71  71 1 2 
       LEU  72  72 1 2 
       LEU  73  73 1 2 
       ILE  74  74 1 2 
       TYR  75  75 1 2 
       TRP  76  76 1 2 
       ALA  77  77 1 2 
       SER  78  78 1 2 
       THR  79  79 1 2 
       ARG  80  80 1 2 
       GLU  81  81 1 2 
       SER  82  82 1 2 
       GLY  83  83 1 2 
       VAL  84  84 1 2 
       PRO  85  85 1 2 
       ASP  86  86 1 2 
       ARG  87  87 1 2 
       PHE  88  88 1 2 
       THR  89  89 1 2 
       GLY  90  90 1 2 
       SER  91  91 1 2 
       GLY  92  92 1 2 
       SER  93  93 1 2 
       GLY  94  94 1 2 
       THR  95  95 1 2 
       ASP  96  96 1 2 
       PHE  97  97 1 2 
       THR  98  98 1 2 
       LEU  99  99 1 2 
       THR 100 100 1 2 
       ILE 101 101 1 2 
       SER 102 102 1 2 
       SER 103 103 1 2 
       VAL 104 104 1 2 
       GLN 105 105 1 2 
       ALA 106 106 1 2 
       GLU 107 107 1 2 
       ASP 108 108 1 2 
       LEU 109 109 1 2 
       ALA 110 110 1 2 
       VAL 111 111 1 2 
       TYR 112 112 1 2 
       TYR 113 113 1 2 
       CYS 114 114 1 2 
       LYS 115 115 1 2 
       GLN 116 116 1 2 
       SER 117 117 1 2 
       TYR 118 118 1 2 
       ASN 119 119 1 2 
       LEU 120 120 1 2 
       TYR 121 121 1 2 
       THR 122 122 1 2 
       PHE 123 123 1 2 
       GLY 124 124 1 2 
       GLY 125 125 1 2 
       GLY 126 126 1 2 
       THR 127 127 1 2 
       LYS 128 128 1 2 
       LEU 129 129 1 2 
       GLU 130 130 1 2 
       ILE 131 131 1 2 
       LYS 132 132 1 2 
       ARG 133 133 1 2 
       ALA 134 134 1 2 
       ASP 135 135 1 2 
       ALA 136 136 1 2 
       ALA 137 137 1 2 
       PRO 138 138 1 2 
       THR 139 139 1 2 
       VAL 140 140 1 2 
       SER 141 141 1 2 
       ILE 142 142 1 2 
       PHE 143 143 1 2 
       PRO 144 144 1 2 
       PRO 145 145 1 2 
       SER 146 146 1 2 
       SER 147 147 1 2 
       GLU 148 148 1 2 
       GLN 149 149 1 2 
       LEU 150 150 1 2 
       THR 151 151 1 2 
       SER 152 152 1 2 
       GLY 153 153 1 2 
       GLY 154 154 1 2 
       ALA 155 155 1 2 
       SER 156 156 1 2 
       VAL 157 157 1 2 
       VAL 158 158 1 2 
       CYS 159 159 1 2 
       PHE 160 160 1 2 
       LEU 161 161 1 2 
       ASN 162 162 1 2 
       ASN 163 163 1 2 
       PHE 164 164 1 2 
       TYR 165 165 1 2 
       PRO 166 166 1 2 
       LYS 167 167 1 2 
       ASP 168 168 1 2 
       ILE 169 169 1 2 
       ASN 170 170 1 2 
       VAL 171 171 1 2 
       LYS 172 172 1 2 
       TRP 173 173 1 2 
       LYS 174 174 1 2 
       ILE 175 175 1 2 
       ASP 176 176 1 2 
       GLY 177 177 1 2 
       SER 178 178 1 2 
       GLU 179 179 1 2 
       ARG 180 180 1 2 
       GLN 181 181 1 2 
       ASN 182 182 1 2 
       GLY 183 183 1 2 
       VAL 184 184 1 2 
       LEU 185 185 1 2 
       ASN 186 186 1 2 
       SER 187 187 1 2 
       TRP 188 188 1 2 
       THR 189 189 1 2 
       ASP 190 190 1 2 
       GLN 191 191 1 2 
       ASP 192 192 1 2 
       SER 193 193 1 2 
       LYS 194 194 1 2 
       ASP 195 195 1 2 
       SER 196 196 1 2 
       THR 197 197 1 2 
       TYR 198 198 1 2 
       SER 199 199 1 2 
       MET 200 200 1 2 
       SER 201 201 1 2 
       SER 202 202 1 2 
       THR 203 203 1 2 
       LEU 204 204 1 2 
       THR 205 205 1 2 
       LEU 206 206 1 2 
       THR 207 207 1 2 
       LYS 208 208 1 2 
       ASP 209 209 1 2 
       GLU 210 210 1 2 
       TYR 211 211 1 2 
       GLU 212 212 1 2 
       ARG 213 213 1 2 
       HIS 214 214 1 2 
       ASN 215 215 1 2 
       SER 216 216 1 2 
       TYR 217 217 1 2 
       THR 218 218 1 2 
       CYS 219 219 1 2 
       GLU 220 220 1 2 
       ALA 221 221 1 2 
       THR 222 222 1 2 
       HIS 223 223 1 2 
       LYS 224 224 1 2 
       THR 225 225 1 2 
       SER 226 226 1 2 
       THR 227 227 1 2 
       SER 228 228 1 2 
       PRO 229 229 1 2 
       ILE 230 230 1 2 
       VAL 231 231 1 2 
       LYS 232 232 1 2 
       SER 233 233 1 2 
       PHE 234 234 1 2 
       ASN 235 235 1 2 
       ARG 236 236 1 2 
       ASN 237 237 1 2 
       GLU 238 238 1 2 
       CYS 239 239 1 2 
    stop_

save_


save_Fab_fragment_heavy_chain
    _Entity.Sf_category                  entity
    _Entity.Entry_ID                     1
    _Entity.ID                           3
    _Entity.Name                         "Fab fragment heavy chain"
    _Entity.Type                         polymer
    _Entity.Polymer_type                 polypeptide(L)
    _Entity.Polymer_seq_one_letter_code  EVQLVESGGGLVKPGGSLKLSCAASGFAFSSYDMSWVRQTPEKRLEWVAYISSGGGSTYYPDTVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCARPDYRSYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGP
    _Entity.Number_of_monomers           221

    loop_
       _Entity_comp_index.ID
       _Entity_comp_index.Comp_ID
       _Entity_comp_index.Comp_label
       _Entity_comp_index.Entry_ID
       _Entity_comp_index.Entity_ID

         1 GLU . 1 3 
         2 VAL . 1 3 
         3 GLN . 1 3 
         4 LEU . 1 3 
         5 VAL . 1 3 
         6 GLU . 1 3 
         7 SER . 1 3 
         8 GLY . 1 3 
         9 GLY . 1 3 
        10 GLY . 1 3 
        11 LEU . 1 3 
        12 VAL . 1 3 
        13 LYS . 1 3 
        14 PRO . 1 3 
        15 GLY . 1 3 
        16 GLY . 1 3 
        17 SER . 1 3 
        18 LEU . 1 3 
        19 LYS . 1 3 
        20 LEU . 1 3 
        21 SER . 1 3 
        22 CYS . 1 3 
        23 ALA . 1 3 
        24 ALA . 1 3 
        25 SER . 1 3 
        26 GLY . 1 3 
        27 PHE . 1 3 
        28 ALA . 1 3 
        29 PHE . 1 3 
        30 SER . 1 3 
        31 SER . 1 3 
        32 TYR . 1 3 
        33 ASP . 1 3 
        34 MET . 1 3 
        35 SER . 1 3 
        36 TRP . 1 3 
        37 VAL . 1 3 
        38 ARG . 1 3 
        39 GLN . 1 3 
        40 THR . 1 3 
        41 PRO . 1 3 
        42 GLU . 1 3 
        43 LYS . 1 3 
        44 ARG . 1 3 
        45 LEU . 1 3 
        46 GLU . 1 3 
        47 TRP . 1 3 
        48 VAL . 1 3 
        49 ALA . 1 3 
        50 TYR . 1 3 
        51 ILE . 1 3 
        52 SER . 1 3 
        53 SER . 1 3 
        54 GLY . 1 3 
        55 GLY . 1 3 
        56 GLY . 1 3 
        57 SER . 1 3 
        58 THR . 1 3 
        59 TYR . 1 3 
        60 TYR . 1 3 
        61 PRO . 1 3 
        62 ASP . 1 3 
        63 THR . 1 3 
        64 VAL . 1 3 
        65 LYS . 1 3 
        66 GLY . 1 3 
        67 ARG . 1 3 
        68 PHE . 1 3 
        69 THR . 1 3 
        70 ILE . 1 3 
        71 SER . 1 3 
        72 ARG . 1 3 
        73 ASP . 1 3 
        74 ASN . 1 3 
        75 ALA . 1 3 
        76 LYS . 1 3 
        77 ASN . 1 3 
        78 THR . 1 3 
        79 LEU . 1 3 
        80 TYR . 1 3 
        81 LEU . 1 3 
        82 GLN . 1 3 
        83 MET . 1 3 
        84 SER . 1 3 
        85 SER . 1 3 
        86 LEU . 1 3 
        87 LYS . 1 3 
        88 SER . 1 3 
        89 GLU . 1 3 
        90 ASP . 1 3 
        91 THR . 1 3 
        92 ALA . 1 3 
        93 MET . 1 3 
        94 TYR . 1 3 
        95 TYR . 1 3 
        96 CYS . 1 3 
        97 ALA . 1 3 
        98 ARG . 1 3 
        99 PRO . 1 3 
       100 ASP . 1 3 
       101 TYR . 1 3 
       102 ARG . 1 3 
       103 SER . 1 3 
       104 TYR . 1 3 
       105 ALA . 1 3 
       106 MET . 1 3 
       107 ASP . 1 3 
       108 TYR . 1 3 
       109 TRP . 1 3 
       110 GLY . 1 3 
       111 GLN . 1 3 
       112 GLY . 1 3 
       113 THR . 1 3 
       114 SER . 1 3 
       115 VAL . 1 3 
       116 THR . 1 3 
       117 VAL . 1 3 
       118 SER . 1 3 
       119 SER . 1 3 
       120 ALA . 1 3 
       121 LYS . 1 3 
       122 THR . 1 3 
       123 THR . 1 3 
       124 ALA . 1 3 
       125 PRO . 1 3 
       126 SER . 1 3 
       127 VAL . 1 3 
       128 TYR . 1 3 
       129 PRO . 1 3 
       130 LEU . 1 3 
       131 ALA . 1 3 
       132 PRO . 1 3 
       133 VAL . 1 3 
       134 CYS . 1 3 
       135 GLY . 1 3 
       136 ASP . 1 3 
       137 THR . 1 3 
       138 THR . 1 3 
       139 GLY . 1 3 
       140 SER . 1 3 
       141 SER . 1 3 
       142 VAL . 1 3 
       143 THR . 1 3 
       144 LEU . 1 3 
       145 GLY . 1 3 
       146 CYS . 1 3 
       147 LEU . 1 3 
       148 VAL . 1 3 
       149 LYS . 1 3 
       150 GLY . 1 3 
       151 TYR . 1 3 
       152 PHE . 1 3 
       153 PRO . 1 3 
       154 GLU . 1 3 
       155 PRO . 1 3 
       156 VAL . 1 3 
       157 THR . 1 3 
       158 LEU . 1 3 
       159 THR . 1 3 
       160 TRP . 1 3 
       161 ASN . 1 3 
       162 SER . 1 3 
       163 GLY . 1 3 
       164 SER . 1 3 
       165 LEU . 1 3 
       166 SER . 1 3 
       167 SER . 1 3 
       168 GLY . 1 3 
       169 VAL . 1 3 
       170 HIS . 1 3 
       171 THR . 1 3 
       172 PHE . 1 3 
       173 PRO . 1 3 
       174 ALA . 1 3 
       175 VAL . 1 3 
       176 LEU . 1 3 
       177 GLN . 1 3 
       178 SER . 1 3 
       179 ASP . 1 3 
       180 LEU . 1 3 
       181 TYR . 1 3 
       182 THR . 1 3 
       183 LEU . 1 3 
       184 SER . 1 3 
       185 SER . 1 3 
       186 SER . 1 3 
       187 VAL . 1 3 
       188 THR . 1 3 
       189 VAL . 1 3 
       190 THR . 1 3 
       191 SER . 1 3 
       192 SER . 1 3 
       193 THR . 1 3 
       194 TRP . 1 3 
       195 PRO . 1 3 
       196 SER . 1 3 
       197 GLN . 1 3 
       198 SER . 1 3 
       199 ILE . 1 3 
       200 THR . 1 3 
       201 CYS . 1 3 
       202 ASN . 1 3 
       203 VAL . 1 3 
       204 ALA . 1 3 
       205 HIS . 1 3 
       206 PRO . 1 3 
       207 ALA . 1 3 
       208 SER . 1 3 
       209 SER . 1 3 
       210 THR . 1 3 
       211 LYS . 1 3 
       212 VAL . 1 3 
       213 ASP . 1 3 
       214 LYS . 1 3 
       215 LYS . 1 3 
       216 ILE . 1 3 
       217 GLU . 1 3 
       218 PRO . 1 3 
       219 ARG . 1 3 
       220 GLY . 1 3 
       221 PRO . 1 3 
    stop_

    loop_
       _Entity_poly_seq.Mon_ID
       _Entity_poly_seq.Num
       _Entity_poly_seq.Comp_index_ID
       _Entity_poly_seq.Entry_ID
       _Entity_poly_seq.Entity_ID

       GLU   1   1 1 3 
       VAL   2   2 1 3 
       GLN   3   3 1 3 
       LEU   4   4 1 3 
       VAL   5   5 1 3 
       GLU   6   6 1 3 
       SER   7   7 1 3 
       GLY   8   8 1 3 
       GLY   9   9 1 3 
       GLY  10  10 1 3 
       LEU  11  11 1 3 
       VAL  12  12 1 3 
       LYS  13  13 1 3 
       PRO  14  14 1 3 
       GLY  15  15 1 3 
       GLY  16  16 1 3 
       SER  17  17 1 3 
       LEU  18  18 1 3 
       LYS  19  19 1 3 
       LEU  20  20 1 3 
       SER  21  21 1 3 
       CYS  22  22 1 3 
       ALA  23  23 1 3 
       ALA  24  24 1 3 
       SER  25  25 1 3 
       GLY  26  26 1 3 
       PHE  27  27 1 3 
       ALA  28  28 1 3 
       PHE  29  29 1 3 
       SER  30  30 1 3 
       SER  31  31 1 3 
       TYR  32  32 1 3 
       ASP  33  33 1 3 
       MET  34  34 1 3 
       SER  35  35 1 3 
       TRP  36  36 1 3 
       VAL  37  37 1 3 
       ARG  38  38 1 3 
       GLN  39  39 1 3 
       THR  40  40 1 3 
       PRO  41  41 1 3 
       GLU  42  42 1 3 
       LYS  43  43 1 3 
       ARG  44  44 1 3 
       LEU  45  45 1 3 
       GLU  46  46 1 3 
       TRP  47  47 1 3 
       VAL  48  48 1 3 
       ALA  49  49 1 3 
       TYR  50  50 1 3 
       ILE  51  51 1 3 
       SER  52  52 1 3 
       SER  53  53 1 3 
       GLY  54  54 1 3 
       GLY  55  55 1 3 
       GLY  56  56 1 3 
       SER  57  57 1 3 
       THR  58  58 1 3 
       TYR  59  59 1 3 
       TYR  60  60 1 3 
       PRO  61  61 1 3 
       ASP  62  62 1 3 
       THR  63  63 1 3 
       VAL  64  64 1 3 
       LYS  65  65 1 3 
       GLY  66  66 1 3 
       ARG  67  67 1 3 
       PHE  68  68 1 3 
       THR  69  69 1 3 
       ILE  70  70 1 3 
       SER  71  71 1 3 
       ARG  72  72 1 3 
       ASP  73  73 1 3 
       ASN  74  74 1 3 
       ALA  75  75 1 3 
       LYS  76  76 1 3 
       ASN  77  77 1 3 
       THR  78  78 1 3 
       LEU  79  79 1 3 
       TYR  80  80 1 3 
       LEU  81  81 1 3 
       GLN  82  82 1 3 
       MET  83  83 1 3 
       SER  84  84 1 3 
       SER  85  85 1 3 
       LEU  86  86 1 3 
       LYS  87  87 1 3 
       SER  88  88 1 3 
       GLU  89  89 1 3 
       ASP  90  90 1 3 
       THR  91  91 1 3 
       ALA  92  92 1 3 
       MET  93  93 1 3 
       TYR  94  94 1 3 
       TYR  95  95 1 3 
       CYS  96  96 1 3 
       ALA  97  97 1 3 
       ARG  98  98 1 3 
       PRO  99  99 1 3 
       ASP 100 100 1 3 
       TYR 101 101 1 3 
       ARG 102 102 1 3 
       SER 103 103 1 3 
       TYR 104 104 1 3 
       ALA 105 105 1 3 
       MET 106 106 1 3 
       ASP 107 107 1 3 
       TYR 108 108 1 3 
       TRP 109 109 1 3 
       GLY 110 110 1 3 
       GLN 111 111 1 3 
       GLY 112 112 1 3 
       THR 113 113 1 3 
       SER 114 114 1 3 
       VAL 115 115 1 3 
       THR 116 116 1 3 
       VAL 117 117 1 3 
       SER 118 118 1 3 
       SER 119 119 1 3 
       ALA 120 120 1 3 
       LYS 121 121 1 3 
       THR 122 122 1 3 
       THR 123 123 1 3 
       ALA 124 124 1 3 
       PRO 125 125 1 3 
       SER 126 126 1 3 
       VAL 127 127 1 3 
       TYR 128 128 1 3 
       PRO 129 129 1 3 
       LEU 130 130 1 3 
       ALA 131 131 1 3 
       PRO 132 132 1 3 
       VAL 133 133 1 3 
       CYS 134 134 1 3 
       GLY 135 135 1 3 
       ASP 136 136 1 3 
       THR 137 137 1 3 
       THR 138 138 1 3 
       GLY 139 139 1 3 
       SER 140 140 1 3 
       SER 141 141 1 3 
       VAL 142 142 1 3 
       THR 143 143 1 3 
       LEU 144 144 1 3 
       GLY 145 145 1 3 
       CYS 146 146 1 3 
       LEU 147 147 1 3 
       VAL 148 148 1 3 
       LYS 149 149 1 3 
       GLY 150 150 1 3 
       TYR 151 151 1 3 
       PHE 152 152 1 3 
       PRO 153 153 1 3 
       GLU 154 154 1 3 
       PRO 155 155 1 3 
       VAL 156 156 1 3 
       THR 157 157 1 3 
       LEU 158 158 1 3 
       THR 159 159 1 3 
       TRP 160 160 1 3 
       ASN 161 161 1 3 
       SER 162 162 1 3 
       GLY 163 163 1 3 
       SER 164 164 1 3 
       LEU 165 165 1 3 
       SER 166 166 1 3 
       SER 167 167 1 3 
       GLY 168 168 1 3 
       VAL 169 169 1 3 
       HIS 170 170 1 3 
       THR 171 171 1 3 
       PHE 172 172 1 3 
       PRO 173 173 1 3 
       ALA 174 174 1 3 
       VAL 175 175 1 3 
       LEU 176 176 1 3 
       GLN 177 177 1 3 
       SER 178 178 1 3 
       ASP 179 179 1 3 
       LEU 180 180 1 3 
       TYR 181 181 1 3 
       THR 182 182 1 3 
       LEU 183 183 1 3 
       SER 184 184 1 3 
       SER 185 185 1 3 
       SER 186 186 1 3 
       VAL 187 187 1 3 
       THR 188 188 1 3 
       VAL 189 189 1 3 
       THR 190 190 1 3 
       SER 191 191 1 3 
       SER 192 192 1 3 
       THR 193 193 1 3 
       TRP 194 194 1 3 
       PRO 195 195 1 3 
       SER 196 196 1 3 
       GLN 197 197 1 3 
       SER 198 198 1 3 
       ILE 199 199 1 3 
       THR 200 200 1 3 
       CYS 201 201 1 3 
       ASN 202 202 1 3 
       VAL 203 203 1 3 
       ALA 204 204 1 3 
       HIS 205 205 1 3 
       PRO 206 206 1 3 
       ALA 207 207 1 3 
       SER 208 208 1 3 
       SER 209 209 1 3 
       THR 210 210 1 3 
       LYS 211 211 1 3 
       VAL 212 212 1 3 
       ASP 213 213 1 3 
       LYS 214 214 1 3 
       LYS 215 215 1 3 
       ILE 216 216 1 3 
       GLU 217 217 1 3 
       PRO 218 218 1 3 
       ARG 219 219 1 3 
       GLY 220 220 1 3 
       PRO 221 221 1 3 
    stop_

save_


save_UBIQUINONE_1
    _Entity.Sf_category  entity
    _Entity.Entry_ID     1
    _Entity.ID           4
    _Entity.Name         "UBIQUINONE 1"
    _Entity.Type         non-polymer

    loop_
       _Entity_comp_index.ID
       _Entity_comp_index.Comp_ID
       _Entity_comp_index.Comp_label
       _Entity_comp_index.Entry_ID
       _Entity_comp_index.Entity_ID

       1 UQ1 $UQ1 1 4 
    stop_

save_


save_UQ1
    _Chem_comp.Sf_category  chem_comp
    _Chem_comp.Entry_ID     1
    _Chem_comp.ID           UQ1
    _Chem_comp.Type         non-polymer

save_


save_CNS/XPLOR_distance_constraints_3_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  1
    _Distance_constraint_list.Constraint_type     "general distance"
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

         1  1 2  . OR 1 1 
         1  2 .  3 .  1 1 
         1  3 .  4 .  1 1 
         1  4 .  . .  1 1 
         2  1 .  . .  1 1 
         3  1 2  . OR 1 1 
         3  2 .  3 .  1 1 
         3  3 .  4 .  1 1 
         3  4 .  5 .  1 1 
         3  5 .  6 .  1 1 
         3  6 .  . .  1 1 
         4  1 2  . OR 1 1 
         4  2 .  3 .  1 1 
         4  3 .  4 .  1 1 
         4  4 .  5 .  1 1 
         4  5 .  6 .  1 1 
         4  6 .  7 .  1 1 
         4  7 .  8 .  1 1 
         4  8 .  9 .  1 1 
         4  9 . 10 .  1 1 
         4 10 .  . .  1 1 
         5  1 2  . OR 1 1 
         5  2 .  3 .  1 1 
         5  3 .  . .  1 1 
         6  1 2  . OR 1 1 
         6  2 .  3 .  1 1 
         6  3 .  4 .  1 1 
         6  4 .  . .  1 1 
         7  1 2  . OR 1 1 
         7  2 .  3 .  1 1 
         7  3 .  . .  1 1 
         8  1 .  . .  1 1 
         9  1 .  . .  1 1 
        10  1 2  . OR 1 1 
        10  2 .  3 .  1 1 
        10  3 .  4 .  1 1 
        10  4 .  . .  1 1 
        11  1 2  . OR 1 1 
        11  2 .  3 .  1 1 
        11  3 .  4 .  1 1 
        11  4 .  . .  1 1 
        12  1 .  . .  1 1 
        13  1 2  . OR 1 1 
        13  2 .  3 .  1 1 
        13  3 .  . .  1 1 
        14  1 .  . .  1 1 
        15  1 2  . OR 1 1 
        15  2 .  3 .  1 1 
        15  3 .  . .  1 1 
        16  1 .  . .  1 1 
        17  1 .  . .  1 1 
        18  1 .  . .  1 1 
        19  1 2  . OR 1 1 
        19  2 .  3 .  1 1 
        19  3 .  . .  1 1 
        20  1 2  . OR 1 1 
        20  2 .  3 .  1 1 
        20  3 .  . .  1 1 
        21  1 2  . OR 1 1 
        21  2 .  3 .  1 1 
        21  3 .  . .  1 1 
        22  1 2  . OR 1 1 
        22  2 .  3 .  1 1 
        22  3 .  4 .  1 1 
        22  4 .  5 .  1 1 
        22  5 .  . .  1 1 
        23  1 2  . OR 1 1 
        23  2 .  3 .  1 1 
        23  3 .  . .  1 1 
        24  1 2  . OR 1 1 
        24  2 .  3 .  1 1 
        24  3 .  . .  1 1 
        25  1 2  . OR 1 1 
        25  2 .  3 .  1 1 
        25  3 .  4 .  1 1 
        25  4 .  . .  1 1 
        26  1 2  . OR 1 1 
        26  2 .  3 .  1 1 
        26  3 .  . .  1 1 
        27  1 .  . .  1 1 
        28  1 2  . OR 1 1 
        28  2 .  3 .  1 1 
        28  3 .  4 .  1 1 
        28  4 .  . .  1 1 
        29  1 2  . OR 1 1 
        29  2 .  3 .  1 1 
        29  3 .  . .  1 1 
        30  1 2  . OR 1 1 
        30  2 .  3 .  1 1 
        30  3 .  . .  1 1 
        31  1 2  . OR 1 1 
        31  2 .  3 .  1 1 
        31  3 .  . .  1 1 
        32  1 .  . .  1 1 
        33  1 .  . .  1 1 
        34  1 .  . .  1 1 
        35  1 2  . OR 1 1 
        35  2 .  3 .  1 1 
        35  3 .  . .  1 1 
        36  1 .  . .  1 1 
        37  1 2  . OR 1 1 
        37  2 .  3 .  1 1 
        37  3 .  . .  1 1 
        38  1 2  . OR 1 1 
        38  2 .  3 .  1 1 
        38  3 .  . .  1 1 
        39  1 2  . OR 1 1 
        39  2 .  3 .  1 1 
        39  3 .  . .  1 1 
        40  1 2  . OR 1 1 
        40  2 .  3 .  1 1 
        40  3 .  . .  1 1 
        41  1 2  . OR 1 1 
        41  2 .  3 .  1 1 
        41  3 .  . .  1 1 
        42  1 2  . OR 1 1 
        42  2 .  3 .  1 1 
        42  3 .  4 .  1 1 
        42  4 .  5 .  1 1 
        42  5 .  . .  1 1 
        43  1 2  . OR 1 1 
        43  2 .  3 .  1 1 
        43  3 .  . .  1 1 
        44  1 .  . .  1 1 
        45  1 2  . OR 1 1 
        45  2 .  3 .  1 1 
        45  3 .  . .  1 1 
        46  1 2  . OR 1 1 
        46  2 .  3 .  1 1 
        46  3 .  . .  1 1 
        47  1 .  . .  1 1 
        48  1 .  . .  1 1 
        49  1 2  . OR 1 1 
        49  2 .  3 .  1 1 
        49  3 .  . .  1 1 
        50  1 2  . OR 1 1 
        50  2 .  3 .  1 1 
        50  3 .  . .  1 1 
        51  1 2  . OR 1 1 
        51  2 .  3 .  1 1 
        51  3 .  . .  1 1 
        52  1 .  . .  1 1 
        53  1 .  . .  1 1 
        54  1 2  . OR 1 1 
        54  2 .  3 .  1 1 
        54  3 .  4 .  1 1 
        54  4 .  . .  1 1 
        55  1 .  . .  1 1 
        56  1 2  . OR 1 1 
        56  2 .  3 .  1 1 
        56  3 .  . .  1 1 
        57  1 2  . OR 1 1 
        57  2 .  3 .  1 1 
        57  3 .  . .  1 1 
        58  1 .  . .  1 1 
        59  1 .  . .  1 1 
        60  1 .  . .  1 1 
        61  1 2  . OR 1 1 
        61  2 .  3 .  1 1 
        61  3 .  . .  1 1 
        62  1 .  . .  1 1 
        63  1 .  . .  1 1 
        64  1 .  . .  1 1 
        65  1 2  . OR 1 1 
        65  2 .  3 .  1 1 
        65  3 .  . .  1 1 
        66  1 2  . OR 1 1 
        66  2 .  3 .  1 1 
        66  3 .  . .  1 1 
        67  1 .  . .  1 1 
        68  1 .  . .  1 1 
        69  1 2  . OR 1 1 
        69  2 .  3 .  1 1 
        69  3 .  4 .  1 1 
        69  4 .  5 .  1 1 
        69  5 .  . .  1 1 
        70  1 2  . OR 1 1 
        70  2 .  3 .  1 1 
        70  3 .  . .  1 1 
        71  1 2  . OR 1 1 
        71  2 .  3 .  1 1 
        71  3 .  4 .  1 1 
        71  4 .  . .  1 1 
        72  1 2  . OR 1 1 
        72  2 .  3 .  1 1 
        72  3 .  4 .  1 1 
        72  4 .  . .  1 1 
        73  1 .  . .  1 1 
        74  1 .  . .  1 1 
        75  1 2  . OR 1 1 
        75  2 .  3 .  1 1 
        75  3 .  . .  1 1 
        76  1 .  . .  1 1 
        77  1 .  . .  1 1 
        78  1 .  . .  1 1 
        79  1 2  . OR 1 1 
        79  2 .  3 .  1 1 
        79  3 .  . .  1 1 
        80  1 2  . OR 1 1 
        80  2 .  3 .  1 1 
        80  3 .  . .  1 1 
        81  1 .  . .  1 1 
        82  1 .  . .  1 1 
        83  1 2  . OR 1 1 
        83  2 .  3 .  1 1 
        83  3 .  . .  1 1 
        84  1 2  . OR 1 1 
        84  2 .  3 .  1 1 
        84  3 .  . .  1 1 
        85  1 2  . OR 1 1 
        85  2 .  3 .  1 1 
        85  3 .  4 .  1 1 
        85  4 .  5 .  1 1 
        85  5 .  . .  1 1 
        86  1 .  . .  1 1 
        87  1 2  . OR 1 1 
        87  2 .  3 .  1 1 
        87  3 .  4 .  1 1 
        87  4 .  . .  1 1 
        88  1 2  . OR 1 1 
        88  2 .  3 .  1 1 
        88  3 .  4 .  1 1 
        88  4 .  5 .  1 1 
        88  5 .  . .  1 1 
        89  1 .  . .  1 1 
        90  1 2  . OR 1 1 
        90  2 .  3 .  1 1 
        90  3 .  . .  1 1 
        91  1 .  . .  1 1 
        92  1 2  . OR 1 1 
        92  2 .  3 .  1 1 
        92  3 .  . .  1 1 
        93  1 .  . .  1 1 
        94  1 2  . OR 1 1 
        94  2 .  3 .  1 1 
        94  3 .  . .  1 1 
        95  1 2  . OR 1 1 
        95  2 .  3 .  1 1 
        95  3 .  4 .  1 1 
        95  4 .  . .  1 1 
        96  1 .  . .  1 1 
        97  1 .  . .  1 1 
        98  1 2  . OR 1 1 
        98  2 .  3 .  1 1 
        98  3 .  4 .  1 1 
        98  4 .  . .  1 1 
        99  1 .  . .  1 1 
       100  1 2  . OR 1 1 
       100  2 .  3 .  1 1 
       100  3 .  . .  1 1 
       101  1 2  . OR 1 1 
       101  2 .  3 .  1 1 
       101  3 .  . .  1 1 
       102  1 .  . .  1 1 
       103  1 .  . .  1 1 
       104  1 .  . .  1 1 
       105  1 2  . OR 1 1 
       105  2 .  3 .  1 1 
       105  3 .  4 .  1 1 
       105  4 .  . .  1 1 
       106  1 2  . OR 1 1 
       106  2 .  3 .  1 1 
       106  3 .  . .  1 1 
       107  1 .  . .  1 1 
       108  1 2  . OR 1 1 
       108  2 .  3 .  1 1 
       108  3 .  4 .  1 1 
       108  4 .  . .  1 1 
       109  1 .  . .  1 1 
       110  1 2  . OR 1 1 
       110  2 .  3 .  1 1 
       110  3 .  . .  1 1 
       111  1 2  . OR 1 1 
       111  2 .  3 .  1 1 
       111  3 .  . .  1 1 
       112  1 2  . OR 1 1 
       112  2 .  3 .  1 1 
       112  3 .  4 .  1 1 
       112  4 .  5 .  1 1 
       112  5 .  . .  1 1 
       113  1 2  . OR 1 1 
       113  2 .  3 .  1 1 
       113  3 .  4 .  1 1 
       113  4 .  . .  1 1 
       114  1 2  . OR 1 1 
       114  2 .  3 .  1 1 
       114  3 .  4 .  1 1 
       114  4 .  . .  1 1 
       115  1 .  . .  1 1 
       116  1 2  . OR 1 1 
       116  2 .  3 .  1 1 
       116  3 .  . .  1 1 
       117  1 2  . OR 1 1 
       117  2 .  3 .  1 1 
       117  3 .  4 .  1 1 
       117  4 .  . .  1 1 
       118  1 .  . .  1 1 
       119  1 .  . .  1 1 
       120  1 2  . OR 1 1 
       120  2 .  3 .  1 1 
       120  3 .  4 .  1 1 
       120  4 .  5 .  1 1 
       120  5 .  . .  1 1 
       121  1 2  . OR 1 1 
       121  2 .  3 .  1 1 
       121  3 .  . .  1 1 
       122  1 2  . OR 1 1 
       122  2 .  3 .  1 1 
       122  3 .  4 .  1 1 
       122  4 .  . .  1 1 
       123  1 .  . .  1 1 
       124  1 2  . OR 1 1 
       124  2 .  3 .  1 1 
       124  3 .  . .  1 1 
       125  1 .  . .  1 1 
       126  1 2  . OR 1 1 
       126  2 .  3 .  1 1 
       126  3 .  . .  1 1 
       127  1 .  . .  1 1 
       128  1 2  . OR 1 1 
       128  2 .  3 .  1 1 
       128  3 .  . .  1 1 
       129  1 2  . OR 1 1 
       129  2 .  3 .  1 1 
       129  3 .  . .  1 1 
       130  1 2  . OR 1 1 
       130  2 .  3 .  1 1 
       130  3 .  4 .  1 1 
       130  4 .  . .  1 1 
       131  1 2  . OR 1 1 
       131  2 .  3 .  1 1 
       131  3 .  . .  1 1 
       132  1 2  . OR 1 1 
       132  2 .  3 .  1 1 
       132  3 .  4 .  1 1 
       132  4 .  5 .  1 1 
       132  5 .  . .  1 1 
       133  1 .  . .  1 1 
       134  1 2  . OR 1 1 
       134  2 .  3 .  1 1 
       134  3 .  4 .  1 1 
       134  4 .  . .  1 1 
       135  1 .  . .  1 1 
       136  1 2  . OR 1 1 
       136  2 .  3 .  1 1 
       136  3 .  4 .  1 1 
       136  4 .  5 .  1 1 
       136  5 .  6 .  1 1 
       136  6 .  . .  1 1 
       137  1 .  . .  1 1 
       138  1 2  . OR 1 1 
       138  2 .  3 .  1 1 
       138  3 .  4 .  1 1 
       138  4 .  . .  1 1 
       139  1 2  . OR 1 1 
       139  2 .  3 .  1 1 
       139  3 .  . .  1 1 
       140  1 .  . .  1 1 
       141  1 .  . .  1 1 
       142  1 .  . .  1 1 
       143  1 .  . .  1 1 
       144  1 .  . .  1 1 
       145  1 .  . .  1 1 
       146  1 2  . OR 1 1 
       146  2 .  3 .  1 1 
       146  3 .  4 .  1 1 
       146  4 .  . .  1 1 
       147  1 2  . OR 1 1 
       147  2 .  3 .  1 1 
       147  3 .  . .  1 1 
       148  1 .  . .  1 1 
       149  1 2  . OR 1 1 
       149  2 .  3 .  1 1 
       149  3 .  . .  1 1 
       150  1 .  . .  1 1 
       151  1 .  . .  1 1 
       152  1 .  . .  1 1 
       153  1 .  . .  1 1 
       154  1 2  . OR 1 1 
       154  2 .  3 .  1 1 
       154  3 .  . .  1 1 
       155  1 .  . .  1 1 
       156  1 .  . .  1 1 
       157  1 .  . .  1 1 
       158  1 .  . .  1 1 
       159  1 .  . .  1 1 
       160  1 .  . .  1 1 
       161  1 .  . .  1 1 
       162  1 .  . .  1 1 
       163  1 .  . .  1 1 
       164  1 .  . .  1 1 
       165  1 2  . OR 1 1 
       165  2 .  3 .  1 1 
       165  3 .  . .  1 1 
       166  1 .  . .  1 1 
       167  1 .  . .  1 1 
       168  1 2  . OR 1 1 
       168  2 .  3 .  1 1 
       168  3 .  . .  1 1 
       169  1 2  . OR 1 1 
       169  2 .  3 .  1 1 
       169  3 .  . .  1 1 
       170  1 .  . .  1 1 
       171  1 2  . OR 1 1 
       171  2 .  3 .  1 1 
       171  3 .  . .  1 1 
       172  1 2  . OR 1 1 
       172  2 .  3 .  1 1 
       172  3 .  . .  1 1 
       173  1 2  . OR 1 1 
       173  2 .  3 .  1 1 
       173  3 .  4 .  1 1 
       173  4 .  . .  1 1 
       174  1 2  . OR 1 1 
       174  2 .  3 .  1 1 
       174  3 .  . .  1 1 
       175  1 .  . .  1 1 
       176  1 .  . .  1 1 
       177  1 2  . OR 1 1 
       177  2 .  3 .  1 1 
       177  3 .  . .  1 1 
       178  1 2  . OR 1 1 
       178  2 .  3 .  1 1 
       178  3 .  . .  1 1 
       179  1 .  . .  1 1 
       180  1 .  . .  1 1 
       181  1 .  . .  1 1 
       182  1 2  . OR 1 1 
       182  2 .  3 .  1 1 
       182  3 .  4 .  1 1 
       182  4 .  . .  1 1 
       183  1 2  . OR 1 1 
       183  2 .  3 .  1 1 
       183  3 .  . .  1 1 
       184  1 .  . .  1 1 
       185  1 .  . .  1 1 
       186  1 2  . OR 1 1 
       186  2 .  3 .  1 1 
       186  3 .  . .  1 1 
       187  1 .  . .  1 1 
       188  1 .  . .  1 1 
       189  1 .  . .  1 1 
       190  1 2  . OR 1 1 
       190  2 .  3 .  1 1 
       190  3 .  . .  1 1 
       191  1 .  . .  1 1 
       192  1 .  . .  1 1 
       193  1 .  . .  1 1 
       194  1 .  . .  1 1 
       195  1 .  . .  1 1 
       196  1 2  . OR 1 1 
       196  2 .  3 .  1 1 
       196  3 .  . .  1 1 
       197  1 2  . OR 1 1 
       197  2 .  3 .  1 1 
       197  3 .  . .  1 1 
       198  1 .  . .  1 1 
       199  1 2  . OR 1 1 
       199  2 .  3 .  1 1 
       199  3 .  . .  1 1 
       200  1 .  . .  1 1 
       201  1 .  . .  1 1 
       202  1 2  . OR 1 1 
       202  2 .  3 .  1 1 
       202  3 .  . .  1 1 
       203  1 .  . .  1 1 
       204  1 .  . .  1 1 
       205  1 .  . .  1 1 
       206  1 .  . .  1 1 
       207  1 .  . .  1 1 
       208  1 .  . .  1 1 
       209  1 .  . .  1 1 
       210  1 .  . .  1 1 
       211  1 2  . OR 1 1 
       211  2 .  3 .  1 1 
       211  3 .  . .  1 1 
       212  1 .  . .  1 1 
       213  1 .  . .  1 1 
       214  1 .  . .  1 1 
       215  1 2  . OR 1 1 
       215  2 .  3 .  1 1 
       215  3 .  . .  1 1 
       216  1 2  . OR 1 1 
       216  2 .  3 .  1 1 
       216  3 .  . .  1 1 
       217  1 .  . .  1 1 
       218  1 .  . .  1 1 
       219  1 .  . .  1 1 
       220  1 2  . OR 1 1 
       220  2 .  3 .  1 1 
       220  3 .  . .  1 1 
       221  1 2  . OR 1 1 
       221  2 .  3 .  1 1 
       221  3 .  4 .  1 1 
       221  4 .  . .  1 1 
       222  1 .  . .  1 1 
       223  1 .  . .  1 1 
       224  1 .  . .  1 1 
       225  1 .  . .  1 1 
       226  1 .  . .  1 1 
       227  1 .  . .  1 1 
       228  1 2  . OR 1 1 
       228  2 .  3 .  1 1 
       228  3 .  . .  1 1 
       229  1 .  . .  1 1 
       230  1 2  . OR 1 1 
       230  2 .  3 .  1 1 
       230  3 .  . .  1 1 
       231  1 2  . OR 1 1 
       231  2 .  3 .  1 1 
       231  3 .  . .  1 1 
       232  1 2  . OR 1 1 
       232  2 .  3 .  1 1 
       232  3 .  4 .  1 1 
       232  4 .  . .  1 1 
       233  1 .  . .  1 1 
       234  1 .  . .  1 1 
       235  1 2  . OR 1 1 
       235  2 .  3 .  1 1 
       235  3 .  . .  1 1 
       236  1 .  . .  1 1 
       237  1 2  . OR 1 1 
       237  2 .  3 .  1 1 
       237  3 .  . .  1 1 
       238  1 2  . OR 1 1 
       238  2 .  3 .  1 1 
       238  3 .  4 .  1 1 
       238  4 .  5 .  1 1 
       238  5 .  6 .  1 1 
       238  6 .  7 .  1 1 
       238  7 .  . .  1 1 
       239  1 2  . OR 1 1 
       239  2 .  3 .  1 1 
       239  3 .  . .  1 1 
       240  1 .  . .  1 1 
       241  1 .  . .  1 1 
       242  1 2  . OR 1 1 
       242  2 .  3 .  1 1 
       242  3 .  . .  1 1 
       243  1 .  . .  1 1 
       244  1 2  . OR 1 1 
       244  2 .  3 .  1 1 
       244  3 .  . .  1 1 
       245  1 .  . .  1 1 
       246  1 .  . .  1 1 
       247  1 2  . OR 1 1 
       247  2 .  3 .  1 1 
       247  3 .  . .  1 1 
       248  1 .  . .  1 1 
       249  1 2  . OR 1 1 
       249  2 .  3 .  1 1 
       249  3 .  4 .  1 1 
       249  4 .  . .  1 1 
       250  1 2  . OR 1 1 
       250  2 .  3 .  1 1 
       250  3 .  4 .  1 1 
       250  4 .  . .  1 1 
       251  1 .  . .  1 1 
       252  1 2  . OR 1 1 
       252  2 .  3 .  1 1 
       252  3 .  . .  1 1 
       253  1 .  . .  1 1 
       254  1 .  . .  1 1 
       255  1 2  . OR 1 1 
       255  2 .  3 .  1 1 
       255  3 .  . .  1 1 
       256  1 .  . .  1 1 
       257  1 .  . .  1 1 
       258  1 2  . OR 1 1 
       258  2 .  3 .  1 1 
       258  3 .  . .  1 1 
       259  1 2  . OR 1 1 
       259  2 .  3 .  1 1 
       259  3 .  . .  1 1 
       260  1 2  . OR 1 1 
       260  2 .  3 .  1 1 
       260  3 .  . .  1 1 
       261  1 .  . .  1 1 
       262  1 .  . .  1 1 
       263  1 .  . .  1 1 
       264  1 2  . OR 1 1 
       264  2 .  3 .  1 1 
       264  3 .  . .  1 1 
       265  1 .  . .  1 1 
       266  1 .  . .  1 1 
       267  1 .  . .  1 1 
       268  1 .  . .  1 1 
       269  1 .  . .  1 1 
       270  1 2  . OR 1 1 
       270  2 .  3 .  1 1 
       270  3 .  4 .  1 1 
       270  4 .  . .  1 1 
       271  1 2  . OR 1 1 
       271  2 .  3 .  1 1 
       271  3 .  . .  1 1 
       272  1 2  . OR 1 1 
       272  2 .  3 .  1 1 
       272  3 .  4 .  1 1 
       272  4 .  . .  1 1 
       273  1 2  . OR 1 1 
       273  2 .  3 .  1 1 
       273  3 .  4 .  1 1 
       273  4 .  . .  1 1 
       274  1 .  . .  1 1 
       275  1 .  . .  1 1 
       276  1 .  . .  1 1 
       277  1 2  . OR 1 1 
       277  2 .  3 .  1 1 
       277  3 .  . .  1 1 
       278  1 2  . OR 1 1 
       278  2 .  3 .  1 1 
       278  3 .  . .  1 1 
       279  1 .  . .  1 1 
       280  1 .  . .  1 1 
       281  1 .  . .  1 1 
       282  1 .  . .  1 1 
       283  1 .  . .  1 1 
       284  1 .  . .  1 1 
       285  1 2  . OR 1 1 
       285  2 .  3 .  1 1 
       285  3 .  . .  1 1 
       286  1 .  . .  1 1 
       287  1 .  . .  1 1 
       288  1 .  . .  1 1 
       289  1 .  . .  1 1 
       290  1 2  . OR 1 1 
       290  2 .  3 .  1 1 
       290  3 .  . .  1 1 
       291  1 2  . OR 1 1 
       291  2 .  3 .  1 1 
       291  3 .  . .  1 1 
       292  1 2  . OR 1 1 
       292  2 .  3 .  1 1 
       292  3 .  4 .  1 1 
       292  4 .  5 .  1 1 
       292  5 .  . .  1 1 
       293  1 .  . .  1 1 
       294  1 .  . .  1 1 
       295  1 .  . .  1 1 
       296  1 .  . .  1 1 
       297  1 .  . .  1 1 
       298  1 .  . .  1 1 
       299  1 .  . .  1 1 
       300  1 .  . .  1 1 
       301  1 2  . OR 1 1 
       301  2 .  3 .  1 1 
       301  3 .  . .  1 1 
       302  1 .  . .  1 1 
       303  1 .  . .  1 1 
       304  1 .  . .  1 1 
       305  1 .  . .  1 1 
       306  1 .  . .  1 1 
       307  1 .  . .  1 1 
       308  1 .  . .  1 1 
       309  1 .  . .  1 1 
       310  1 .  . .  1 1 
       311  1 2  . OR 1 1 
       311  2 .  3 .  1 1 
       311  3 .  . .  1 1 
       312  1 .  . .  1 1 
       313  1 .  . .  1 1 
       314  1 .  . .  1 1 
       315  1 2  . OR 1 1 
       315  2 .  3 .  1 1 
       315  3 .  . .  1 1 
       316  1 2  . OR 1 1 
       316  2 .  3 .  1 1 
       316  3 .  . .  1 1 
       317  1 2  . OR 1 1 
       317  2 .  3 .  1 1 
       317  3 .  . .  1 1 
       318  1 .  . .  1 1 
       319  1 .  . .  1 1 
       320  1 .  . .  1 1 
       321  1 .  . .  1 1 
       322  1 .  . .  1 1 
       323  1 2  . OR 1 1 
       323  2 .  3 .  1 1 
       323  3 .  . .  1 1 
       324  1 .  . .  1 1 
       325  1 .  . .  1 1 
       326  1 .  . .  1 1 
       327  1 .  . .  1 1 
       328  1 .  . .  1 1 
       329  1 .  . .  1 1 
       330  1 .  . .  1 1 
       331  1 .  . .  1 1 
       332  1 .  . .  1 1 
       333  1 .  . .  1 1 
       334  1 .  . .  1 1 
       335  1 .  . .  1 1 
       336  1 .  . .  1 1 
       337  1 .  . .  1 1 
       338  1 .  . .  1 1 
       339  1 .  . .  1 1 
       340  1 .  . .  1 1 
       341  1 2  . OR 1 1 
       341  2 .  3 .  1 1 
       341  3 .  . .  1 1 
       342  1 .  . .  1 1 
       343  1 .  . .  1 1 
       344  1 .  . .  1 1 
       345  1 .  . .  1 1 
       346  1 2  . OR 1 1 
       346  2 .  3 .  1 1 
       346  3 .  . .  1 1 
       347  1 .  . .  1 1 
       348  1 .  . .  1 1 
       349  1 .  . .  1 1 
       350  1 .  . .  1 1 
       351  1 .  . .  1 1 
       352  1 .  . .  1 1 
       353  1 .  . .  1 1 
       354  1 .  . .  1 1 
       355  1 .  . .  1 1 
       356  1 .  . .  1 1 
       357  1 .  . .  1 1 
       358  1 .  . .  1 1 
       359  1 .  . .  1 1 
       360  1 2  . OR 1 1 
       360  2 .  3 .  1 1 
       360  3 .  . .  1 1 
       361  1 .  . .  1 1 
       362  1 .  . .  1 1 
       363  1 .  . .  1 1 
       364  1 2  . OR 1 1 
       364  2 .  3 .  1 1 
       364  3 .  . .  1 1 
       365  1 .  . .  1 1 
       366  1 .  . .  1 1 
       367  1 .  . .  1 1 
       368  1 .  . .  1 1 
       369  1 .  . .  1 1 
       370  1 .  . .  1 1 
       371  1 .  . .  1 1 
       372  1 .  . .  1 1 
       373  1 .  . .  1 1 
       374  1 .  . .  1 1 
       375  1 .  . .  1 1 
       376  1 .  . .  1 1 
       377  1 .  . .  1 1 
       378  1 .  . .  1 1 
       379  1 .  . .  1 1 
       380  1 .  . .  1 1 
       381  1 2  . OR 1 1 
       381  2 .  3 .  1 1 
       381  3 .  . .  1 1 
       382  1 .  . .  1 1 
       383  1 .  . .  1 1 
       384  1 .  . .  1 1 
       385  1 .  . .  1 1 
       386  1 .  . .  1 1 
       387  1 2  . OR 1 1 
       387  2 .  3 .  1 1 
       387  3 .  4 .  1 1 
       387  4 .  . .  1 1 
       388  1 .  . .  1 1 
       389  1 2  . OR 1 1 
       389  2 .  3 .  1 1 
       389  3 .  4 .  1 1 
       389  4 .  5 .  1 1 
       389  5 .  6 .  1 1 
       389  6 .  . .  1 1 
       390  1 2  . OR 1 1 
       390  2 .  3 .  1 1 
       390  3 .  4 .  1 1 
       390  4 .  5 .  1 1 
       390  5 .  6 .  1 1 
       390  6 .  7 .  1 1 
       390  7 .  8 .  1 1 
       390  8 .  9 .  1 1 
       390  9 . 10 .  1 1 
       390 10 .  . .  1 1 
       391  1 2  . OR 1 1 
       391  2 .  3 .  1 1 
       391  3 .  . .  1 1 
       392  1 2  . OR 1 1 
       392  2 .  3 .  1 1 
       392  3 .  4 .  1 1 
       392  4 .  . .  1 1 
       393  1 2  . OR 1 1 
       393  2 .  3 .  1 1 
       393  3 .  . .  1 1 
       394  1 .  . .  1 1 
       395  1 .  . .  1 1 
       396  1 2  . OR 1 1 
       396  2 .  3 .  1 1 
       396  3 .  4 .  1 1 
       396  4 .  . .  1 1 
       397  1 2  . OR 1 1 
       397  2 .  3 .  1 1 
       397  3 .  4 .  1 1 
       397  4 .  . .  1 1 
       398  1 .  . .  1 1 
       399  1 2  . OR 1 1 
       399  2 .  3 .  1 1 
       399  3 .  . .  1 1 
       400  1 .  . .  1 1 
       401  1 2  . OR 1 1 
       401  2 .  3 .  1 1 
       401  3 .  . .  1 1 
       402  1 .  . .  1 1 
       403  1 .  . .  1 1 
       404  1 .  . .  1 1 
       405  1 2  . OR 1 1 
       405  2 .  3 .  1 1 
       405  3 .  . .  1 1 
       406  1 2  . OR 1 1 
       406  2 .  3 .  1 1 
       406  3 .  . .  1 1 
       407  1 2  . OR 1 1 
       407  2 .  3 .  1 1 
       407  3 .  . .  1 1 
       408  1 2  . OR 1 1 
       408  2 .  3 .  1 1 
       408  3 .  4 .  1 1 
       408  4 .  5 .  1 1 
       408  5 .  . .  1 1 
       409  1 2  . OR 1 1 
       409  2 .  3 .  1 1 
       409  3 .  . .  1 1 
       410  1 2  . OR 1 1 
       410  2 .  3 .  1 1 
       410  3 .  . .  1 1 
       411  1 2  . OR 1 1 
       411  2 .  3 .  1 1 
       411  3 .  4 .  1 1 
       411  4 .  . .  1 1 
       412  1 2  . OR 1 1 
       412  2 .  3 .  1 1 
       412  3 .  . .  1 1 
       413  1 .  . .  1 1 
       414  1 2  . OR 1 1 
       414  2 .  3 .  1 1 
       414  3 .  4 .  1 1 
       414  4 .  . .  1 1 
       415  1 2  . OR 1 1 
       415  2 .  3 .  1 1 
       415  3 .  . .  1 1 
       416  1 2  . OR 1 1 
       416  2 .  3 .  1 1 
       416  3 .  . .  1 1 
       417  1 2  . OR 1 1 
       417  2 .  3 .  1 1 
       417  3 .  . .  1 1 
       418  1 .  . .  1 1 
       419  1 .  . .  1 1 
       420  1 .  . .  1 1 
       421  1 2  . OR 1 1 
       421  2 .  3 .  1 1 
       421  3 .  . .  1 1 
       422  1 .  . .  1 1 
       423  1 2  . OR 1 1 
       423  2 .  3 .  1 1 
       423  3 .  . .  1 1 
       424  1 2  . OR 1 1 
       424  2 .  3 .  1 1 
       424  3 .  . .  1 1 
       425  1 2  . OR 1 1 
       425  2 .  3 .  1 1 
       425  3 .  . .  1 1 
       426  1 2  . OR 1 1 
       426  2 .  3 .  1 1 
       426  3 .  . .  1 1 
       427  1 2  . OR 1 1 
       427  2 .  3 .  1 1 
       427  3 .  . .  1 1 
       428  1 2  . OR 1 1 
       428  2 .  3 .  1 1 
       428  3 .  4 .  1 1 
       428  4 .  5 .  1 1 
       428  5 .  . .  1 1 
       429  1 2  . OR 1 1 
       429  2 .  3 .  1 1 
       429  3 .  . .  1 1 
       430  1 .  . .  1 1 
       431  1 2  . OR 1 1 
       431  2 .  3 .  1 1 
       431  3 .  . .  1 1 
       432  1 2  . OR 1 1 
       432  2 .  3 .  1 1 
       432  3 .  . .  1 1 
       433  1 .  . .  1 1 
       434  1 .  . .  1 1 
       435  1 2  . OR 1 1 
       435  2 .  3 .  1 1 
       435  3 .  . .  1 1 
       436  1 2  . OR 1 1 
       436  2 .  3 .  1 1 
       436  3 .  . .  1 1 
       437  1 2  . OR 1 1 
       437  2 .  3 .  1 1 
       437  3 .  . .  1 1 
       438  1 .  . .  1 1 
       439  1 .  . .  1 1 
       440  1 2  . OR 1 1 
       440  2 .  3 .  1 1 
       440  3 .  4 .  1 1 
       440  4 .  . .  1 1 
       441  1 .  . .  1 1 
       442  1 2  . OR 1 1 
       442  2 .  3 .  1 1 
       442  3 .  . .  1 1 
       443  1 2  . OR 1 1 
       443  2 .  3 .  1 1 
       443  3 .  . .  1 1 
       444  1 .  . .  1 1 
       445  1 .  . .  1 1 
       446  1 .  . .  1 1 
       447  1 2  . OR 1 1 
       447  2 .  3 .  1 1 
       447  3 .  . .  1 1 
       448  1 .  . .  1 1 
       449  1 .  . .  1 1 
       450  1 .  . .  1 1 
       451  1 2  . OR 1 1 
       451  2 .  3 .  1 1 
       451  3 .  . .  1 1 
       452  1 2  . OR 1 1 
       452  2 .  3 .  1 1 
       452  3 .  . .  1 1 
       453  1 .  . .  1 1 
       454  1 .  . .  1 1 
       455  1 2  . OR 1 1 
       455  2 .  3 .  1 1 
       455  3 .  4 .  1 1 
       455  4 .  5 .  1 1 
       455  5 .  . .  1 1 
       456  1 2  . OR 1 1 
       456  2 .  3 .  1 1 
       456  3 .  . .  1 1 
       457  1 2  . OR 1 1 
       457  2 .  3 .  1 1 
       457  3 .  4 .  1 1 
       457  4 .  . .  1 1 
       458  1 2  . OR 1 1 
       458  2 .  3 .  1 1 
       458  3 .  4 .  1 1 
       458  4 .  . .  1 1 
       459  1 .  . .  1 1 
       460  1 .  . .  1 1 
       461  1 2  . OR 1 1 
       461  2 .  3 .  1 1 
       461  3 .  . .  1 1 
       462  1 .  . .  1 1 
       463  1 .  . .  1 1 
       464  1 .  . .  1 1 
       465  1 2  . OR 1 1 
       465  2 .  3 .  1 1 
       465  3 .  . .  1 1 
       466  1 2  . OR 1 1 
       466  2 .  3 .  1 1 
       466  3 .  . .  1 1 
       467  1 .  . .  1 1 
       468  1 .  . .  1 1 
       469  1 2  . OR 1 1 
       469  2 .  3 .  1 1 
       469  3 .  . .  1 1 
       470  1 2  . OR 1 1 
       470  2 .  3 .  1 1 
       470  3 .  . .  1 1 
       471  1 2  . OR 1 1 
       471  2 .  3 .  1 1 
       471  3 .  4 .  1 1 
       471  4 .  5 .  1 1 
       471  5 .  . .  1 1 
       472  1 .  . .  1 1 
       473  1 2  . OR 1 1 
       473  2 .  3 .  1 1 
       473  3 .  4 .  1 1 
       473  4 .  . .  1 1 
       474  1 2  . OR 1 1 
       474  2 .  3 .  1 1 
       474  3 .  4 .  1 1 
       474  4 .  5 .  1 1 
       474  5 .  . .  1 1 
       475  1 .  . .  1 1 
       476  1 2  . OR 1 1 
       476  2 .  3 .  1 1 
       476  3 .  . .  1 1 
       477  1 .  . .  1 1 
       478  1 2  . OR 1 1 
       478  2 .  3 .  1 1 
       478  3 .  . .  1 1 
       479  1 .  . .  1 1 
       480  1 2  . OR 1 1 
       480  2 .  3 .  1 1 
       480  3 .  . .  1 1 
       481  1 2  . OR 1 1 
       481  2 .  3 .  1 1 
       481  3 .  4 .  1 1 
       481  4 .  . .  1 1 
       482  1 .  . .  1 1 
       483  1 .  . .  1 1 
       484  1 2  . OR 1 1 
       484  2 .  3 .  1 1 
       484  3 .  4 .  1 1 
       484  4 .  . .  1 1 
       485  1 .  . .  1 1 
       486  1 2  . OR 1 1 
       486  2 .  3 .  1 1 
       486  3 .  . .  1 1 
       487  1 2  . OR 1 1 
       487  2 .  3 .  1 1 
       487  3 .  . .  1 1 
       488  1 .  . .  1 1 
       489  1 .  . .  1 1 
       490  1 .  . .  1 1 
       491  1 2  . OR 1 1 
       491  2 .  3 .  1 1 
       491  3 .  4 .  1 1 
       491  4 .  . .  1 1 
       492  1 2  . OR 1 1 
       492  2 .  3 .  1 1 
       492  3 .  . .  1 1 
       493  1 .  . .  1 1 
       494  1 2  . OR 1 1 
       494  2 .  3 .  1 1 
       494  3 .  4 .  1 1 
       494  4 .  . .  1 1 
       495  1 .  . .  1 1 
       496  1 2  . OR 1 1 
       496  2 .  3 .  1 1 
       496  3 .  . .  1 1 
       497  1 2  . OR 1 1 
       497  2 .  3 .  1 1 
       497  3 .  . .  1 1 
       498  1 2  . OR 1 1 
       498  2 .  3 .  1 1 
       498  3 .  4 .  1 1 
       498  4 .  5 .  1 1 
       498  5 .  . .  1 1 
       499  1 2  . OR 1 1 
       499  2 .  3 .  1 1 
       499  3 .  4 .  1 1 
       499  4 .  . .  1 1 
       500  1 2  . OR 1 1 
       500  2 .  3 .  1 1 
       500  3 .  4 .  1 1 
       500  4 .  . .  1 1 
       501  1 .  . .  1 1 
       502  1 2  . OR 1 1 
       502  2 .  3 .  1 1 
       502  3 .  . .  1 1 
       503  1 2  . OR 1 1 
       503  2 .  3 .  1 1 
       503  3 .  4 .  1 1 
       503  4 .  . .  1 1 
       504  1 .  . .  1 1 
       505  1 .  . .  1 1 
       506  1 2  . OR 1 1 
       506  2 .  3 .  1 1 
       506  3 .  4 .  1 1 
       506  4 .  5 .  1 1 
       506  5 .  . .  1 1 
       507  1 2  . OR 1 1 
       507  2 .  3 .  1 1 
       507  3 .  . .  1 1 
       508  1 2  . OR 1 1 
       508  2 .  3 .  1 1 
       508  3 .  4 .  1 1 
       508  4 .  . .  1 1 
       509  1 .  . .  1 1 
       510  1 2  . OR 1 1 
       510  2 .  3 .  1 1 
       510  3 .  . .  1 1 
       511  1 .  . .  1 1 
       512  1 2  . OR 1 1 
       512  2 .  3 .  1 1 
       512  3 .  . .  1 1 
       513  1 .  . .  1 1 
       514  1 2  . OR 1 1 
       514  2 .  3 .  1 1 
       514  3 .  . .  1 1 
       515  1 2  . OR 1 1 
       515  2 .  3 .  1 1 
       515  3 .  . .  1 1 
       516  1 2  . OR 1 1 
       516  2 .  3 .  1 1 
       516  3 .  4 .  1 1 
       516  4 .  . .  1 1 
       517  1 2  . OR 1 1 
       517  2 .  3 .  1 1 
       517  3 .  . .  1 1 
       518  1 2  . OR 1 1 
       518  2 .  3 .  1 1 
       518  3 .  4 .  1 1 
       518  4 .  5 .  1 1 
       518  5 .  . .  1 1 
       519  1 .  . .  1 1 
       520  1 2  . OR 1 1 
       520  2 .  3 .  1 1 
       520  3 .  4 .  1 1 
       520  4 .  . .  1 1 
       521  1 .  . .  1 1 
       522  1 2  . OR 1 1 
       522  2 .  3 .  1 1 
       522  3 .  4 .  1 1 
       522  4 .  5 .  1 1 
       522  5 .  6 .  1 1 
       522  6 .  . .  1 1 
       523  1 .  . .  1 1 
       524  1 2  . OR 1 1 
       524  2 .  3 .  1 1 
       524  3 .  4 .  1 1 
       524  4 .  . .  1 1 
       525  1 2  . OR 1 1 
       525  2 .  3 .  1 1 
       525  3 .  . .  1 1 
       526  1 .  . .  1 1 
       527  1 .  . .  1 1 
       528  1 .  . .  1 1 
       529  1 .  . .  1 1 
       530  1 .  . .  1 1 
       531  1 .  . .  1 1 
       532  1 2  . OR 1 1 
       532  2 .  3 .  1 1 
       532  3 .  4 .  1 1 
       532  4 .  . .  1 1 
       533  1 2  . OR 1 1 
       533  2 .  3 .  1 1 
       533  3 .  . .  1 1 
       534  1 .  . .  1 1 
       535  1 2  . OR 1 1 
       535  2 .  3 .  1 1 
       535  3 .  . .  1 1 
       536  1 .  . .  1 1 
       537  1 .  . .  1 1 
       538  1 .  . .  1 1 
       539  1 .  . .  1 1 
       540  1 2  . OR 1 1 
       540  2 .  3 .  1 1 
       540  3 .  . .  1 1 
       541  1 .  . .  1 1 
       542  1 .  . .  1 1 
       543  1 .  . .  1 1 
       544  1 .  . .  1 1 
       545  1 .  . .  1 1 
       546  1 .  . .  1 1 
       547  1 .  . .  1 1 
       548  1 .  . .  1 1 
       549  1 .  . .  1 1 
       550  1 .  . .  1 1 
       551  1 2  . OR 1 1 
       551  2 .  3 .  1 1 
       551  3 .  . .  1 1 
       552  1 .  . .  1 1 
       553  1 .  . .  1 1 
       554  1 2  . OR 1 1 
       554  2 .  3 .  1 1 
       554  3 .  . .  1 1 
       555  1 2  . OR 1 1 
       555  2 .  3 .  1 1 
       555  3 .  . .  1 1 
       556  1 .  . .  1 1 
       557  1 2  . OR 1 1 
       557  2 .  3 .  1 1 
       557  3 .  . .  1 1 
       558  1 2  . OR 1 1 
       558  2 .  3 .  1 1 
       558  3 .  . .  1 1 
       559  1 2  . OR 1 1 
       559  2 .  3 .  1 1 
       559  3 .  4 .  1 1 
       559  4 .  . .  1 1 
       560  1 2  . OR 1 1 
       560  2 .  3 .  1 1 
       560  3 .  . .  1 1 
       561  1 .  . .  1 1 
       562  1 .  . .  1 1 
       563  1 2  . OR 1 1 
       563  2 .  3 .  1 1 
       563  3 .  . .  1 1 
       564  1 2  . OR 1 1 
       564  2 .  3 .  1 1 
       564  3 .  . .  1 1 
       565  1 .  . .  1 1 
       566  1 .  . .  1 1 
       567  1 .  . .  1 1 
       568  1 2  . OR 1 1 
       568  2 .  3 .  1 1 
       568  3 .  4 .  1 1 
       568  4 .  . .  1 1 
       569  1 2  . OR 1 1 
       569  2 .  3 .  1 1 
       569  3 .  . .  1 1 
       570  1 .  . .  1 1 
       571  1 .  . .  1 1 
       572  1 2  . OR 1 1 
       572  2 .  3 .  1 1 
       572  3 .  . .  1 1 
       573  1 .  . .  1 1 
       574  1 .  . .  1 1 
       575  1 .  . .  1 1 
       576  1 2  . OR 1 1 
       576  2 .  3 .  1 1 
       576  3 .  . .  1 1 
       577  1 .  . .  1 1 
       578  1 .  . .  1 1 
       579  1 .  . .  1 1 
       580  1 .  . .  1 1 
       581  1 .  . .  1 1 
       582  1 2  . OR 1 1 
       582  2 .  3 .  1 1 
       582  3 .  . .  1 1 
       583  1 2  . OR 1 1 
       583  2 .  3 .  1 1 
       583  3 .  . .  1 1 
       584  1 .  . .  1 1 
       585  1 2  . OR 1 1 
       585  2 .  3 .  1 1 
       585  3 .  . .  1 1 
       586  1 .  . .  1 1 
       587  1 .  . .  1 1 
       588  1 2  . OR 1 1 
       588  2 .  3 .  1 1 
       588  3 .  . .  1 1 
       589  1 .  . .  1 1 
       590  1 .  . .  1 1 
       591  1 .  . .  1 1 
       592  1 .  . .  1 1 
       593  1 .  . .  1 1 
       594  1 .  . .  1 1 
       595  1 .  . .  1 1 
       596  1 .  . .  1 1 
       597  1 2  . OR 1 1 
       597  2 .  3 .  1 1 
       597  3 .  . .  1 1 
       598  1 .  . .  1 1 
       599  1 .  . .  1 1 
       600  1 .  . .  1 1 
       601  1 2  . OR 1 1 
       601  2 .  3 .  1 1 
       601  3 .  . .  1 1 
       602  1 2  . OR 1 1 
       602  2 .  3 .  1 1 
       602  3 .  . .  1 1 
       603  1 .  . .  1 1 
       604  1 .  . .  1 1 
       605  1 .  . .  1 1 
       606  1 2  . OR 1 1 
       606  2 .  3 .  1 1 
       606  3 .  . .  1 1 
       607  1 2  . OR 1 1 
       607  2 .  3 .  1 1 
       607  3 .  4 .  1 1 
       607  4 .  . .  1 1 
       608  1 .  . .  1 1 
       609  1 .  . .  1 1 
       610  1 .  . .  1 1 
       611  1 .  . .  1 1 
       612  1 .  . .  1 1 
       613  1 .  . .  1 1 
       614  1 2  . OR 1 1 
       614  2 .  3 .  1 1 
       614  3 .  . .  1 1 
       615  1 .  . .  1 1 
       616  1 2  . OR 1 1 
       616  2 .  3 .  1 1 
       616  3 .  . .  1 1 
       617  1 2  . OR 1 1 
       617  2 .  3 .  1 1 
       617  3 .  . .  1 1 
       618  1 2  . OR 1 1 
       618  2 .  3 .  1 1 
       618  3 .  4 .  1 1 
       618  4 .  . .  1 1 
       619  1 .  . .  1 1 
       620  1 .  . .  1 1 
       621  1 2  . OR 1 1 
       621  2 .  3 .  1 1 
       621  3 .  . .  1 1 
       622  1 .  . .  1 1 
       623  1 2  . OR 1 1 
       623  2 .  3 .  1 1 
       623  3 .  . .  1 1 
       624  1 2  . OR 1 1 
       624  2 .  3 .  1 1 
       624  3 .  4 .  1 1 
       624  4 .  5 .  1 1 
       624  5 .  6 .  1 1 
       624  6 .  7 .  1 1 
       624  7 .  . .  1 1 
       625  1 2  . OR 1 1 
       625  2 .  3 .  1 1 
       625  3 .  . .  1 1 
       626  1 .  . .  1 1 
       627  1 .  . .  1 1 
       628  1 2  . OR 1 1 
       628  2 .  3 .  1 1 
       628  3 .  . .  1 1 
       629  1 .  . .  1 1 
       630  1 2  . OR 1 1 
       630  2 .  3 .  1 1 
       630  3 .  . .  1 1 
       631  1 .  . .  1 1 
       632  1 .  . .  1 1 
       633  1 2  . OR 1 1 
       633  2 .  3 .  1 1 
       633  3 .  . .  1 1 
       634  1 .  . .  1 1 
       635  1 2  . OR 1 1 
       635  2 .  3 .  1 1 
       635  3 .  4 .  1 1 
       635  4 .  . .  1 1 
       636  1 2  . OR 1 1 
       636  2 .  3 .  1 1 
       636  3 .  4 .  1 1 
       636  4 .  . .  1 1 
       637  1 .  . .  1 1 
       638  1 2  . OR 1 1 
       638  2 .  3 .  1 1 
       638  3 .  . .  1 1 
       639  1 .  . .  1 1 
       640  1 .  . .  1 1 
       641  1 2  . OR 1 1 
       641  2 .  3 .  1 1 
       641  3 .  . .  1 1 
       642  1 .  . .  1 1 
       643  1 .  . .  1 1 
       644  1 2  . OR 1 1 
       644  2 .  3 .  1 1 
       644  3 .  . .  1 1 
       645  1 2  . OR 1 1 
       645  2 .  3 .  1 1 
       645  3 .  . .  1 1 
       646  1 2  . OR 1 1 
       646  2 .  3 .  1 1 
       646  3 .  . .  1 1 
       647  1 .  . .  1 1 
       648  1 .  . .  1 1 
       649  1 .  . .  1 1 
       650  1 2  . OR 1 1 
       650  2 .  3 .  1 1 
       650  3 .  . .  1 1 
       651  1 .  . .  1 1 
       652  1 .  . .  1 1 
       653  1 .  . .  1 1 
       654  1 .  . .  1 1 
       655  1 .  . .  1 1 
       656  1 2  . OR 1 1 
       656  2 .  3 .  1 1 
       656  3 .  4 .  1 1 
       656  4 .  . .  1 1 
       657  1 2  . OR 1 1 
       657  2 .  3 .  1 1 
       657  3 .  . .  1 1 
       658  1 2  . OR 1 1 
       658  2 .  3 .  1 1 
       658  3 .  4 .  1 1 
       658  4 .  . .  1 1 
       659  1 2  . OR 1 1 
       659  2 .  3 .  1 1 
       659  3 .  4 .  1 1 
       659  4 .  . .  1 1 
       660  1 .  . .  1 1 
       661  1 .  . .  1 1 
       662  1 .  . .  1 1 
       663  1 2  . OR 1 1 
       663  2 .  3 .  1 1 
       663  3 .  . .  1 1 
       664  1 2  . OR 1 1 
       664  2 .  3 .  1 1 
       664  3 .  . .  1 1 
       665  1 .  . .  1 1 
       666  1 .  . .  1 1 
       667  1 .  . .  1 1 
       668  1 .  . .  1 1 
       669  1 .  . .  1 1 
       670  1 .  . .  1 1 
       671  1 2  . OR 1 1 
       671  2 .  3 .  1 1 
       671  3 .  . .  1 1 
       672  1 .  . .  1 1 
       673  1 .  . .  1 1 
       674  1 .  . .  1 1 
       675  1 .  . .  1 1 
       676  1 2  . OR 1 1 
       676  2 .  3 .  1 1 
       676  3 .  . .  1 1 
       677  1 2  . OR 1 1 
       677  2 .  3 .  1 1 
       677  3 .  . .  1 1 
       678  1 2  . OR 1 1 
       678  2 .  3 .  1 1 
       678  3 .  4 .  1 1 
       678  4 .  5 .  1 1 
       678  5 .  . .  1 1 
       679  1 .  . .  1 1 
       680  1 .  . .  1 1 
       681  1 .  . .  1 1 
       682  1 .  . .  1 1 
       683  1 .  . .  1 1 
       684  1 .  . .  1 1 
       685  1 .  . .  1 1 
       686  1 .  . .  1 1 
       687  1 2  . OR 1 1 
       687  2 .  3 .  1 1 
       687  3 .  . .  1 1 
       688  1 .  . .  1 1 
       689  1 .  . .  1 1 
       690  1 .  . .  1 1 
       691  1 .  . .  1 1 
       692  1 .  . .  1 1 
       693  1 .  . .  1 1 
       694  1 .  . .  1 1 
       695  1 .  . .  1 1 
       696  1 .  . .  1 1 
       697  1 2  . OR 1 1 
       697  2 .  3 .  1 1 
       697  3 .  . .  1 1 
       698  1 .  . .  1 1 
       699  1 .  . .  1 1 
       700  1 .  . .  1 1 
       701  1 2  . OR 1 1 
       701  2 .  3 .  1 1 
       701  3 .  . .  1 1 
       702  1 2  . OR 1 1 
       702  2 .  3 .  1 1 
       702  3 .  . .  1 1 
       703  1 2  . OR 1 1 
       703  2 .  3 .  1 1 
       703  3 .  . .  1 1 
       704  1 .  . .  1 1 
       705  1 .  . .  1 1 
       706  1 .  . .  1 1 
       707  1 .  . .  1 1 
       708  1 .  . .  1 1 
       709  1 2  . OR 1 1 
       709  2 .  3 .  1 1 
       709  3 .  . .  1 1 
       710  1 .  . .  1 1 
       711  1 .  . .  1 1 
       712  1 .  . .  1 1 
       713  1 .  . .  1 1 
       714  1 .  . .  1 1 
       715  1 .  . .  1 1 
       716  1 .  . .  1 1 
       717  1 .  . .  1 1 
       718  1 .  . .  1 1 
       719  1 .  . .  1 1 
       720  1 .  . .  1 1 
       721  1 .  . .  1 1 
       722  1 .  . .  1 1 
       723  1 .  . .  1 1 
       724  1 .  . .  1 1 
       725  1 .  . .  1 1 
       726  1 .  . .  1 1 
       727  1 2  . OR 1 1 
       727  2 .  3 .  1 1 
       727  3 .  . .  1 1 
       728  1 .  . .  1 1 
       729  1 .  . .  1 1 
       730  1 .  . .  1 1 
       731  1 .  . .  1 1 
       732  1 2  . OR 1 1 
       732  2 .  3 .  1 1 
       732  3 .  . .  1 1 
       733  1 .  . .  1 1 
       734  1 .  . .  1 1 
       735  1 .  . .  1 1 
       736  1 .  . .  1 1 
       737  1 .  . .  1 1 
       738  1 .  . .  1 1 
       739  1 .  . .  1 1 
       740  1 .  . .  1 1 
       741  1 .  . .  1 1 
       742  1 .  . .  1 1 
       743  1 .  . .  1 1 
       744  1 .  . .  1 1 
       745  1 .  . .  1 1 
       746  1 2  . OR 1 1 
       746  2 .  3 .  1 1 
       746  3 .  . .  1 1 
       747  1 .  . .  1 1 
       748  1 .  . .  1 1 
       749  1 .  . .  1 1 
       750  1 2  . OR 1 1 
       750  2 .  3 .  1 1 
       750  3 .  . .  1 1 
       751  1 .  . .  1 1 
       752  1 .  . .  1 1 
       753  1 .  . .  1 1 
       754  1 .  . .  1 1 
       755  1 .  . .  1 1 
       756  1 .  . .  1 1 
       757  1 .  . .  1 1 
       758  1 .  . .  1 1 
       759  1 .  . .  1 1 
       760  1 .  . .  1 1 
       761  1 .  . .  1 1 
       762  1 .  . .  1 1 
       763  1 .  . .  1 1 
       764  1 .  . .  1 1 
       765  1 .  . .  1 1 
       766  1 .  . .  1 1 
       767  1 2  . OR 1 1 
       767  2 .  3 .  1 1 
       767  3 .  . .  1 1 
       768  1 .  . .  1 1 
       769  1 .  . .  1 1 
       770  1 .  . .  1 1 
       771  1 .  . .  1 1 
       772  1 .  . .  1 1 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

         1  2 1 1 1  14 ALA C   A  14 ala C   1 1 
         1  2 1 1 1  15 TRP C   A  15 trp C   1 1 
         1  2 1 1 1  22 ALA C   A  22 ala C   1 1 
         1  2 2 1 1  18 MET CA  A  18 met CA  1 1 
         1  3 1 1 1  48 ARG CA  A  48 arg CA  1 1 
         1  3 2 1 1  50 ALA C   A  50 ala C   1 1 
         1  4 1 1 1  73 ALA C   A  73 ala C   1 1 
         1  4 2 1 1  74 MET CA  A  74 met CA  1 1 
         2  1 1 1 1  14 ALA CA  A  14 ala CA  1 1 
         2  1 2 1 1  15 TRP CA  A  15 trp CA  1 1 
         3  2 1 1 1  14 ALA CA  A  14 ala CA  1 1 
         3  2 2 1 1  17 LEU CB  A  17 leu CB  1 1 
         3  3 1 1 1  22 ALA CA  A  22 ala CA  1 1 
         3  3 1 1 1  24 ALA CA  A  24 ala CA  1 1 
         3  3 2 1 1  23 LEU CB  A  23 leu CB  1 1 
         3  4 1 1 1  24 ALA CA  A  24 ala CA  1 1 
         3  4 2 1 1  27 LEU CB  A  27 leu CB  1 1 
         3  5 1 1 1  58 ALA CA  A  58 ala CA  1 1 
         3  5 2 1 1  59 LEU CB  A  59 leu CB  1 1 
         3  6 1 1 1 157 ALA CA  A 157 ala CA  1 1 
         3  6 2 1 1 159 LEU CB  A 159 leu CB  1 1 
         4  2 1 1 1  15 TRP C   A  15 trp C   1 1 
         4  2 2 1 1  16 LEU CA  A  16 leu CA  1 1 
         4  2 2 1 1  17 LEU CA  A  17 leu CA  1 1 
         4  3 1 1 1  22 ALA C   A  22 ala C   1 1 
         4  3 2 1 1  23 LEU CA  A  23 leu CA  1 1 
         4  4 1 1 1  25 LEU CA  A  25 leu CA  1 1 
         4  4 1 1 1  27 LEU CA  A  27 leu CA  1 1 
         4  4 2 1 1  26 GLU C   A  26 glu C   1 1 
         4  5 1 1 1  29 ALA C   A  29 ala C   1 1 
         4  5 2 1 1  30 LEU CA  A  30 leu CA  1 1 
         4  6 1 1 1  50 ALA C   A  50 ala C   1 1 
         4  6 1 1 1  52 PHE C   A  52 phe C   1 1 
         4  6 2 1 1  51 LEU CA  A  51 leu CA  1 1 
         4  7 1 1 1  57 ALA C   A  57 ala C   1 1 
         4  7 1 1 1  58 ALA C   A  58 ala C   1 1 
         4  7 2 1 1  59 LEU CA  A  59 leu CA  1 1 
         4  8 1 1 1 145 TRP C   A 145 trp C   1 1 
         4  8 2 1 1 146 LEU CA  A 146 leu CA  1 1 
         4  8 2 1 1 147 LEU CA  A 147 leu CA  1 1 
         4  9 1 1 1 152 ALA C   A 152 ala C   1 1 
         4  9 1 1 1 153 TYR C   A 153 tyr C   1 1 
         4  9 2 1 1 154 LEU CA  A 154 leu CA  1 1 
         4 10 1 1 1 157 ALA C   A 157 ala C   1 1 
         4 10 2 1 1 159 LEU CA  A 159 leu CA  1 1 
         5  2 1 1 1  15 TRP C   A  15 trp C   1 1 
         5  2 1 1 1  19 ALA C   A  19 ala C   1 1 
         5  2 2 1 1  18 MET CG  A  18 met CG  1 1 
         5  3 1 1 1  74 MET CB  A  74 met CB  1 1 
         5  3 2 1 1  76 ILE C   A  76 ile C   1 1 
         6  2 1 1 1  15 TRP CA  A  15 trp CA  1 1 
         6  2 2 1 1  16 LEU CB  A  16 leu CB  1 1 
         6  3 1 1 1  23 LEU CB  A  23 leu CB  1 1 
         6  3 1 1 1  27 LEU CB  A  27 leu CB  1 1 
         6  3 2 1 1  26 GLU CA  A  26 glu CA  1 1 
         6  4 1 1 1  30 LEU CB  A  30 leu CB  1 1 
         6  4 2 1 1  31 TRP CA  A  31 trp CA  1 1 
         7  2 1 1 1  15 TRP CA  A  15 trp CA  1 1 
         7  2 2 1 1  16 LEU CB  A  16 leu CB  1 1 
         7  3 1 1 1  30 LEU CB  A  30 leu CB  1 1 
         7  3 2 1 1  31 TRP CA  A  31 trp CA  1 1 
         8  1 1 1 1  15 TRP CA  A  15 trp CA  1 1 
         8  1 2 1 1  18 MET C   A  18 met C   1 1 
         9  1 1 1 1  15 TRP CB  A  15 trp CB  1 1 
         9  1 2 1 1  16 LEU CA  A  16 leu CA  1 1 
        10  2 1 1 1  15 TRP CB  A  15 trp CB  1 1 
        10  2 2 1 1  16 LEU CA  A  16 leu CA  1 1 
        10  3 1 1 1  86 GLN CB  A  86 gln CB  1 1 
        10  3 2 1 1  87 LEU CA  A  87 leu CA  1 1 
        10  4 1 1 1 145 TRP CB  A 145 trp CB  1 1 
        10  4 2 1 1 146 LEU CA  A 146 leu CA  1 1 
        11  2 1 1 1  16 LEU CA  A  16 leu CA  1 1 
        11  2 1 1 1  17 LEU CA  A  17 leu CA  1 1 
        11  2 2 1 1  18 MET CB  A  18 met CB  1 1 
        11  3 1 1 1 121 PRO CB  A 121 pro CB  1 1 
        11  3 2 1 1 122 GLN CA  A 122 gln CA  1 1 
        11  4 1 1 1 154 LEU CA  A 154 leu CA  1 1 
        11  4 2 1 1 155 ILE CG1 A 155 ile CG1 1 1 
        12  1 1 1 1  16 LEU CB  A  16 leu CB  1 1 
        12  1 1 1 1  17 LEU CB  A  17 leu CB  1 1 
        12  1 2 1 1  18 MET CA  A  18 met CA  1 1 
        13  2 1 1 1  17 LEU C   A  17 leu C   1 1 
        13  2 2 1 1  18 MET CA  A  18 met CA  1 1 
        13  3 1 1 1  45 ILE C   A  45 ile C   1 1 
        13  3 2 1 1  48 ARG CA  A  48 arg CA  1 1 
        14  1 1 1 1  17 LEU C   A  17 leu C   1 1 
        14  1 2 1 1  19 ALA CA  A  19 ala CA  1 1 
        15  2 1 1 1  17 LEU CA  A  17 leu CA  1 1 
        15  2 2 1 1  18 MET C   A  18 met C   1 1 
        15  3 1 1 1  24 ALA C   A  24 ala C   1 1 
        15  3 2 1 1  25 LEU CA  A  25 leu CA  1 1 
        15  3 2 1 1  27 LEU CA  A  27 leu CA  1 1 
        16  1 1 1 1  17 LEU CB  A  17 leu CB  1 1 
        16  1 2 1 1  18 MET C   A  18 met C   1 1 
        17  1 1 1 1  17 LEU CB  A  17 leu CB  1 1 
        17  1 2 1 1  18 MET CA  A  18 met CA  1 1 
        18  1 1 1 1  17 LEU CB  A  17 leu CB  1 1 
        18  1 2 1 1  18 MET CG  A  18 met CG  1 1 
        19  2 1 1 1  18 MET C   A  18 met C   1 1 
        19  2 2 1 1  19 ALA CA  A  19 ala CA  1 1 
        19  3 1 1 1  47 GLU C   A  47 glu C   1 1 
        19  3 2 1 1  50 ALA CA  A  50 ala CA  1 1 
        20  2 1 1 1  18 MET C   A  18 met C   1 1 
        20  2 1 1 1  24 ALA C   A  24 ala C   1 1 
        20  2 2 1 1  21 THR C   A  21 thr C   1 1 
        20  3 1 1 1  60 ILE C   A  60 ile C   1 1 
        20  3 2 1 1  61 GLY C   A  61 gly C   1 1 
        21  2 1 1 1  18 MET C   A  18 met C   1 1 
        21  2 2 1 1  22 ALA CA  A  22 ala CA  1 1 
        21  3 1 1 1  58 ALA CA  A  58 ala CA  1 1 
        21  3 2 1 1  60 ILE C   A  60 ile C   1 1 
        22  2 1 1 1  18 MET CA  A  18 met CA  1 1 
        22  2 2 1 1  19 ALA CA  A  19 ala CA  1 1 
        22  3 1 1 1  48 ARG CA  A  48 arg CA  1 1 
        22  3 2 1 1  50 ALA CA  A  50 ala CA  1 1 
        22  4 1 1 1  73 ALA CA  A  73 ala CA  1 1 
        22  4 2 1 1  74 MET CA  A  74 met CA  1 1 
        22  5 1 1 1 103 THR CA  A 103 thr CA  1 1 
        22  5 2 1 1 104 CYS CA  A 104 cys CA  1 1 
        23  2 1 1 1  18 MET CA  A  18 met CA  1 1 
        23  2 2 1 1  19 ALA CA  A  19 ala CA  1 1 
        23  3 1 1 1  73 ALA CA  A  73 ala CA  1 1 
        23  3 2 1 1  74 MET CA  A  74 met CA  1 1 
        24  2 1 1 1  18 MET CA  A  18 met CA  1 1 
        24  2 2 1 1  19 ALA CB  A  19 ala CB  1 1 
        24  2 2 1 1  22 ALA CB  A  22 ala CB  1 1 
        24  3 1 1 1  81 ALA CB  A  81 ala CB  1 1 
        24  3 2 1 1  83 ARG CA  A  83 arg CA  1 1 
        25  2 1 1 1  18 MET CA  A  18 met CA  1 1 
        25  2 2 1 1  20 PHE C   A  20 phe C   1 1 
        25  3 1 1 1  70 ARG C   A  70 arg C   1 1 
        25  3 2 1 1  74 MET CA  A  74 met CA  1 1 
        25  4 1 1 1  80 SER C   A  80 ser C   1 1 
        25  4 1 1 1  85 VAL C   A  85 val C   1 1 
        25  4 2 1 1  83 ARG CA  A  83 arg CA  1 1 
        26  2 1 1 1  18 MET CA  A  18 met CA  1 1 
        26  2 2 1 1  20 PHE C   A  20 phe C   1 1 
        26  3 1 1 1  83 ARG CA  A  83 arg CA  1 1 
        26  3 2 1 1  85 VAL C   A  85 val C   1 1 
        27  1 1 1 1  18 MET CA  A  18 met CA  1 1 
        27  1 2 1 1  21 THR C   A  21 thr C   1 1 
        28  2 1 1 1  18 MET CB  A  18 met CB  1 1 
        28  2 2 1 1  19 ALA CA  A  19 ala CA  1 1 
        28  3 1 1 1  49 VAL CB  A  49 val CB  1 1 
        28  3 2 1 1  50 ALA CA  A  50 ala CA  1 1 
        28  4 1 1 1  72 VAL CB  A  72 val CB  1 1 
        28  4 2 1 1  73 ALA CA  A  73 ala CA  1 1 
        29  2 1 1 1  18 MET CB  A  18 met CB  1 1 
        29  2 2 1 1  19 ALA CA  A  19 ala CA  1 1 
        29  3 1 1 1 156 VAL CB  A 156 val CB  1 1 
        29  3 1 1 1 158 VAL CB  A 158 val CB  1 1 
        29  3 2 1 1 157 ALA CA  A 157 ala CA  1 1 
        30  2 1 1 1  18 MET CB  A  18 met CB  1 1 
        30  2 2 1 1  20 PHE CA  A  20 phe CA  1 1 
        30  3 1 1 1  52 PHE CA  A  52 phe CA  1 1 
        30  3 2 1 1  54 VAL CB  A  54 val CB  1 1 
        31  2 1 1 1  18 MET CB  A  18 met CB  1 1 
        31  2 2 1 1  21 THR C   A  21 thr C   1 1 
        31  3 1 1 1 121 PRO CB  A 121 pro CB  1 1 
        31  3 2 1 1 122 GLN C   A 122 gln C   1 1 
        32  1 1 1 1  18 MET CB  A  18 met CB  1 1 
        32  1 2 1 1  21 THR CG2 A  21 thr CG2 1 1 
        33  1 1 1 1  18 MET CG  A  18 met CG  1 1 
        33  1 2 1 1  19 ALA CB  A  19 ala CB  1 1 
        33  1 2 1 1  22 ALA CB  A  22 ala CB  1 1 
        34  1 1 1 1  19 ALA C   A  19 ala C   1 1 
        34  1 1 1 1  22 ALA C   A  22 ala C   1 1 
        34  1 2 1 1  23 LEU CD1 A  23 LEU CD* 1 1 
        34  1 2 1 1  23 LEU CD2 A  23 LEU CD* 1 1 
        35  2 1 1 1  19 ALA C   A  19 ala C   1 1 
        35  2 2 1 1  23 LEU CD1 A  23 LEU CD* 1 1 
        35  2 2 1 1  23 LEU CD2 A  23 LEU CD* 1 1 
        35  3 1 1 1 157 ALA C   A 157 ala C   1 1 
        35  3 2 1 1 158 VAL CG2 A 158 val CG2 1 1 
        36  1 1 1 1  19 ALA CA  A  19 ala CA  1 1 
        36  1 2 1 1  20 PHE CA  A  20 phe CA  1 1 
        37  2 1 1 1  19 ALA CA  A  19 ala CA  1 1 
        37  2 2 1 1  20 PHE CA  A  20 phe CA  1 1 
        37  3 1 1 1  79 TYR CA  A  79 tyr CA  1 1 
        37  3 2 1 1  81 ALA CA  A  81 ala CA  1 1 
        38  2 1 1 1  19 ALA CB  A  19 ala CB  1 1 
        38  2 1 1 1  22 ALA CB  A  22 ala CB  1 1 
        38  2 2 1 1  23 LEU CD1 A  23 LEU CD* 1 1 
        38  2 2 1 1  23 LEU CD2 A  23 LEU CD* 1 1 
        38  3 1 1 1 155 ILE CG2 A 155 ile CG2 1 1 
        38  3 2 1 1 156 VAL CG1 A 156 val CG1 1 1 
        38  3 2 1 1 158 VAL CG1 A 158 val CG1 1 1 
        39  2 1 1 1  20 PHE C   A  20 phe C   1 1 
        39  2 2 1 1  21 THR C   A  21 thr C   1 1 
        39  3 1 1 1  54 VAL C   A  54 val C   1 1 
        39  3 2 1 1  56 GLY C   A  56 gly C   1 1 
        40  2 1 1 1  20 PHE C   A  20 phe C   1 1 
        40  2 2 1 1  21 THR CB  A  21 thr CB  1 1 
        40  3 1 1 1  84 GLY C   A  84 gly C   1 1 
        40  3 1 1 1  85 VAL C   A  85 val C   1 1 
        40  3 2 1 1  88 THR CB  A  88 thr CB  1 1 
        41  2 1 1 1  20 PHE C   A  20 phe C   1 1 
        41  2 2 1 1  21 THR CG2 A  21 thr CG2 1 1 
        41  2 2 1 1  23 LEU CD1 A  23 LEU CD* 1 1 
        41  2 2 1 1  23 LEU CD2 A  23 LEU CD* 1 1 
        41  3 1 1 1 156 VAL C   A 156 val C   1 1 
        41  3 2 1 1 156 VAL CG1 A 156 val CG1 1 1 
        42  2 1 1 1  20 PHE C   A  20 phe C   1 1 
        42  2 2 1 1  21 THR CG2 A  21 thr CG2 1 1 
        42  3 1 1 1  54 VAL C   A  54 val C   1 1 
        42  3 2 1 1  54 VAL CG1 A  54 val CG1 1 1 
        42  4 1 1 1  93 MET C   A  93 met C   1 1 
        42  4 2 1 1  94 LEU CD1 A  94 LEU CD* 1 1 
        42  4 2 1 1  94 LEU CD2 A  94 LEU CD* 1 1 
        42  5 1 1 1 155 ILE C   A 155 ile C   1 1 
        42  5 2 1 1 156 VAL CG1 A 156 val CG1 1 1 
        43  2 1 1 1  20 PHE C   A  20 phe C   1 1 
        43  2 2 1 1  22 ALA C   A  22 ala C   1 1 
        43  3 1 1 1 156 VAL C   A 156 val C   1 1 
        43  3 2 1 1 157 ALA C   A 157 ala C   1 1 
        44  1 1 1 1  20 PHE CA  A  20 phe CA  1 1 
        44  1 2 1 1  21 THR CA  A  21 thr CA  1 1 
        45  2 1 1 1  20 PHE CA  A  20 phe CA  1 1 
        45  2 2 1 1  21 THR CA  A  21 thr CA  1 1 
        45  3 1 1 1  76 ILE CA  A  76 ile CA  1 1 
        45  3 2 1 1  79 TYR CA  A  79 tyr CA  1 1 
        46  2 1 1 1  20 PHE CA  A  20 phe CA  1 1 
        46  2 2 1 1  23 LEU CB  A  23 leu CB  1 1 
        46  3 1 1 1  51 LEU CB  A  51 leu CB  1 1 
        46  3 2 1 1  52 PHE CA  A  52 phe CA  1 1 
        47  1 1 1 1  21 THR C   A  21 thr C   1 1 
        47  1 2 1 1  22 ALA CA  A  22 ala CA  1 1 
        48  1 1 1 1  21 THR C   A  21 thr C   1 1 
        48  1 2 1 1  22 ALA CA  A  22 ala CA  1 1 
        48  1 2 1 1  24 ALA CA  A  24 ala CA  1 1 
        49  2 1 1 1  21 THR C   A  21 thr C   1 1 
        49  2 2 1 1  22 ALA CB  A  22 ala CB  1 1 
        49  3 1 1 1  56 GLY C   A  56 gly C   1 1 
        49  3 2 1 1  57 ALA CB  A  57 ala CB  1 1 
        49  3 2 1 1  58 ALA CB  A  58 ala CB  1 1 
        50  2 1 1 1  21 THR C   A  21 thr C   1 1 
        50  2 2 1 1  23 LEU CA  A  23 leu CA  1 1 
        50  3 1 1 1  55 LEU CA  A  55 leu CA  1 1 
        50  3 1 1 1  59 LEU CA  A  59 leu CA  1 1 
        50  3 2 1 1  56 GLY C   A  56 gly C   1 1 
        51  2 1 1 1  21 THR C   A  21 thr C   1 1 
        51  2 2 1 1  23 LEU CB  A  23 leu CB  1 1 
        51  3 1 1 1 104 CYS C   A 104 cys C   1 1 
        51  3 2 1 1 105 ASP CB  A 105 asp CB  1 1 
        52  1 1 1 1  21 THR C   A  21 thr C   1 1 
        52  1 2 1 1  26 GLU CA  A  26 glu CA  1 1 
        53  1 1 1 1  21 THR CA  A  21 thr CA  1 1 
        53  1 2 1 1  22 ALA CA  A  22 ala CA  1 1 
        54  2 1 1 1  21 THR CA  A  21 thr CA  1 1 
        54  2 2 1 1  23 LEU CB  A  23 leu CB  1 1 
        54  3 1 1 1 146 LEU CB  A 146 leu CB  1 1 
        54  3 2 1 1 149 ILE CA  A 149 ile CA  1 1 
        54  4 1 1 1 154 LEU CB  A 154 leu CB  1 1 
        54  4 2 1 1 155 ILE CA  A 155 ile CA  1 1 
        55  1 1 1 1  21 THR CB  A  21 thr CB  1 1 
        55  1 2 1 1  22 ALA C   A  22 ala C   1 1 
        56  2 1 1 1  21 THR CG2 A  21 thr CG2 1 1 
        56  2 2 1 1  22 ALA CB  A  22 ala CB  1 1 
        56  2 2 1 1  24 ALA CB  A  24 ala CB  1 1 
        56  3 1 1 1  54 VAL CG1 A  54 val CG1 1 1 
        56  3 2 1 1  57 ALA CB  A  57 ala CB  1 1 
        57  2 1 1 1  22 ALA C   A  22 ala C   1 1 
        57  2 2 1 1  23 LEU CD1 A  23 LEU CD* 1 1 
        57  2 2 1 1  23 LEU CD2 A  23 LEU CD* 1 1 
        57  3 1 1 1 157 ALA C   A 157 ala C   1 1 
        57  3 2 1 1 158 VAL CG2 A 158 val CG2 1 1 
        58  1 1 1 1  22 ALA CA  A  22 ala CA  1 1 
        58  1 2 1 1  25 LEU CB  A  25 leu CB  1 1 
        59  1 1 1 1  22 ALA CA  A  22 ala CA  1 1 
        59  1 2 1 1  26 GLU CA  A  26 glu CA  1 1 
        60  1 1 1 1  22 ALA CA  A  22 ala CA  1 1 
        60  1 2 1 1  26 GLU CB  A  26 glu CB  1 1 
        61  2 1 1 1  22 ALA CB  A  22 ala CB  1 1 
        61  2 1 1 1  24 ALA CB  A  24 ala CB  1 1 
        61  2 2 1 1  23 LEU CA  A  23 leu CA  1 1 
        61  3 1 1 1  58 ALA CB  A  58 ala CB  1 1 
        61  3 2 1 1  59 LEU CA  A  59 leu CA  1 1 
        62  1 1 1 1  22 ALA CB  A  22 ala CB  1 1 
        62  1 1 1 1  24 ALA CB  A  24 ala CB  1 1 
        62  1 2 1 1  26 GLU CA  A  26 glu CA  1 1 
        63  1 1 1 1  22 ALA CB  A  22 ala CB  1 1 
        63  1 1 1 1  24 ALA CB  A  24 ala CB  1 1 
        63  1 2 1 1  26 GLU CB  A  26 glu CB  1 1 
        64  1 1 1 1  22 ALA CB  A  22 ala CB  1 1 
        64  1 2 1 1  26 GLU CB  A  26 glu CB  1 1 
        65  2 1 1 1  23 LEU C   A  23 leu C   1 1 
        65  2 2 1 1  24 ALA CA  A  24 ala CA  1 1 
        65  3 1 1 1  55 LEU C   A  55 leu C   1 1 
        65  3 2 1 1  57 ALA CA  A  57 ala CA  1 1 
        66  2 1 1 1  23 LEU C   A  23 leu C   1 1 
        66  2 2 1 1  26 GLU CA  A  26 glu CA  1 1 
        66  3 1 1 1 145 TRP CA  A 145 trp CA  1 1 
        66  3 2 1 1 147 LEU C   A 147 leu C   1 1 
        67  1 1 1 1  23 LEU CA  A  23 leu CA  1 1 
        67  1 2 1 1  23 LEU CD1 A  23 LEU CD* 1 1 
        67  1 2 1 1  23 LEU CD2 A  23 LEU CD* 1 1 
        68  1 1 1 1  23 LEU CA  A  23 leu CA  1 1 
        68  1 1 1 1  25 LEU CA  A  25 leu CA  1 1 
        68  1 1 1 1  27 LEU CA  A  27 leu CA  1 1 
        68  1 2 1 1  26 GLU CB  A  26 glu CB  1 1 
        69  2 1 1 1  23 LEU CB  A  23 leu CB  1 1 
        69  2 2 1 1  24 ALA CA  A  24 ala CA  1 1 
        69  3 1 1 1  29 ALA CA  A  29 ala CA  1 1 
        69  3 2 1 1  30 LEU CB  A  30 leu CB  1 1 
        69  4 1 1 1  50 ALA CA  A  50 ala CA  1 1 
        69  4 2 1 1  51 LEU CB  A  51 leu CB  1 1 
        69  5 1 1 1 104 CYS CA  A 104 cys CA  1 1 
        69  5 2 1 1 105 ASP CB  A 105 asp CB  1 1 
        70  2 1 1 1  23 LEU CB  A  23 leu CB  1 1 
        70  2 2 1 1  24 ALA CA  A  24 ala CA  1 1 
        70  3 1 1 1  50 ALA CA  A  50 ala CA  1 1 
        70  3 2 1 1  51 LEU CB  A  51 leu CB  1 1 
        71  2 1 1 1  23 LEU CB  A  23 leu CB  1 1 
        71  2 1 1 1  27 LEU CB  A  27 leu CB  1 1 
        71  2 2 1 1  26 GLU CA  A  26 glu CA  1 1 
        71  3 1 1 1  48 ARG CA  A  48 arg CA  1 1 
        71  3 2 1 1  51 LEU CB  A  51 leu CB  1 1 
        71  4 1 1 1 145 TRP CA  A 145 trp CA  1 1 
        71  4 2 1 1 146 LEU CB  A 146 leu CB  1 1 
        72  2 1 1 1  23 LEU CB  A  23 leu CB  1 1 
        72  2 1 1 1  27 LEU CB  A  27 leu CB  1 1 
        72  2 2 1 1  26 GLU CA  A  26 glu CA  1 1 
        72  3 1 1 1  48 ARG CA  A  48 arg CA  1 1 
        72  3 2 1 1  51 LEU CB  A  51 leu CB  1 1 
        72  4 1 1 1 145 TRP CA  A 145 trp CA  1 1 
        72  4 2 1 1 146 LEU CB  A 146 leu CB  1 1 
        72  4 2 1 1 147 LEU CB  A 147 leu CB  1 1 
        73  1 1 1 1  24 ALA CA  A  24 ala CA  1 1 
        73  1 2 1 1  26 GLU C   A  26 glu C   1 1 
        74  1 1 1 1  25 LEU CB  A  25 leu CB  1 1 
        74  1 2 1 1  26 GLU C   A  26 glu C   1 1 
        75  2 1 1 1  25 LEU CB  A  25 leu CB  1 1 
        75  2 2 1 1  28 THR C   A  28 thr C   1 1 
        75  3 1 1 1  92 THR C   A  92 thr C   1 1 
        75  3 2 1 1  94 LEU CB  A  94 leu CB  1 1 
        76  1 1 1 1  26 GLU C   A  26 glu C   1 1 
        76  1 2 1 1  28 THR CA  A  28 thr CA  1 1 
        77  1 1 1 1  26 GLU C   A  26 glu C   1 1 
        77  1 2 1 1  28 THR CB  A  28 thr CB  1 1 
        78  1 1 1 1  26 GLU C   A  26 glu C   1 1 
        78  1 2 1 1  29 ALA CA  A  29 ala CA  1 1 
        79  2 1 1 1  26 GLU C   A  26 glu C   1 1 
        79  2 2 1 1  29 ALA CA  A  29 ala CA  1 1 
        79  3 1 1 1  47 GLU C   A  47 glu C   1 1 
        79  3 2 1 1  50 ALA CA  A  50 ala CA  1 1 
        80  2 1 1 1  26 GLU CA  A  26 glu CA  1 1 
        80  2 2 1 1  27 LEU CB  A  27 leu CB  1 1 
        80  3 1 1 1 145 TRP CA  A 145 trp CA  1 1 
        80  3 2 1 1 146 LEU CB  A 146 leu CB  1 1 
        81  1 1 1 1  26 GLU CB  A  26 glu CB  1 1 
        81  1 1 1 1  27 LEU CG  A  27 leu CG  1 1 
        81  1 2 1 1  28 THR C   A  28 thr C   1 1 
        82  1 1 1 1  26 GLU CB  A  26 glu CB  1 1 
        82  1 2 1 1  28 THR C   A  28 thr C   1 1 
        83  2 1 1 1  26 GLU CB  A  26 glu CB  1 1 
        83  2 2 1 1  28 THR C   A  28 thr C   1 1 
        83  3 1 1 1  92 THR C   A  92 thr C   1 1 
        83  3 2 1 1  95 GLN CB  A  95 gln CB  1 1 
        84  2 1 1 1  26 GLU CB  A  26 glu CB  1 1 
        84  2 2 1 1  29 ALA CB  A  29 ala CB  1 1 
        84  3 1 1 1  48 ARG CG  A  48 arg CG  1 1 
        84  3 2 1 1  50 ALA CB  A  50 ala CB  1 1 
        85  2 1 1 1  27 LEU CA  A  27 leu CA  1 1 
        85  2 1 1 1  30 LEU CA  A  30 leu CA  1 1 
        85  2 2 1 1  28 THR C   A  28 thr C   1 1 
        85  3 1 1 1  51 LEU CA  A  51 leu CA  1 1 
        85  3 1 1 1  55 LEU CA  A  55 leu CA  1 1 
        85  3 2 1 1  53 GLY C   A  53 gly C   1 1 
        85  4 1 1 1  91 HIS CA  A  91 his CA  1 1 
        85  4 1 1 1  94 LEU CA  A  94 leu CA  1 1 
        85  4 2 1 1  92 THR C   A  92 thr C   1 1 
        85  5 1 1 1 146 LEU CA  A 146 leu CA  1 1 
        85  5 1 1 1 147 LEU CA  A 147 leu CA  1 1 
        85  5 2 1 1 148 GLY C   A 148 gly C   1 1 
        86  1 1 1 1  27 LEU CB  A  27 leu CB  1 1 
        86  1 1 1 1  30 LEU CB  A  30 leu CB  1 1 
        86  1 2 1 1  28 THR C   A  28 thr C   1 1 
        87  2 1 1 1  27 LEU CB  A  27 leu CB  1 1 
        87  2 2 1 1  28 THR CA  A  28 thr CA  1 1 
        87  2 2 1 1  28 THR CB  A  28 thr CB  1 1 
        87  3 1 1 1 154 LEU CB  A 154 leu CB  1 1 
        87  3 2 1 1 155 ILE CA  A 155 ile CA  1 1 
        87  4 1 1 1 158 VAL CA  A 158 val CA  1 1 
        87  4 1 1 1 160 VAL CA  A 160 val CA  1 1 
        87  4 2 1 1 159 LEU CB  A 159 leu CB  1 1 
        88  2 1 1 1  27 LEU CB  A  27 leu CB  1 1 
        88  2 2 1 1  28 THR CA  A  28 thr CA  1 1 
        88  3 1 1 1  49 VAL CA  A  49 val CA  1 1 
        88  3 1 1 1  54 VAL CA  A  54 val CA  1 1 
        88  3 2 1 1  51 LEU CB  A  51 leu CB  1 1 
        88  4 1 1 1 147 LEU CB  A 147 leu CB  1 1 
        88  4 2 1 1 151 ILE CA  A 151 ile CA  1 1 
        88  5 1 1 1 159 LEU CB  A 159 leu CB  1 1 
        88  5 2 1 1 160 VAL CA  A 160 val CA  1 1 
        89  1 1 1 1  27 LEU CG  A  27 leu CG  1 1 
        89  1 2 1 1  28 THR C   A  28 thr C   1 1 
        90  2 1 1 1  27 LEU CG  A  27 leu CG  1 1 
        90  2 2 1 1  28 THR C   A  28 thr C   1 1 
        90  3 1 1 1  92 THR C   A  92 thr C   1 1 
        90  3 2 1 1  95 GLN CB  A  95 gln CB  1 1 
        91  1 1 1 1  27 LEU CG  A  27 leu CG  1 1 
        91  1 2 1 1  28 THR CA  A  28 thr CA  1 1 
        92  2 1 1 1  28 THR C   A  28 thr C   1 1 
        92  2 2 1 1  31 TRP CA  A  31 trp CA  1 1 
        92  3 1 1 1  34 HIS CA  A  34 his CA  1 1 
        92  3 2 1 1  36 MET C   A  36 met C   1 1 
        93  1 1 1 1  28 THR C   A  28 thr C   1 1 
        93  1 2 1 1  31 TRP CB  A  31 trp CB  1 1 
        94  2 1 1 1  28 THR CA  A  28 thr CA  1 1 
        94  2 1 1 1  28 THR CB  A  28 thr CB  1 1 
        94  2 2 1 1  29 ALA CA  A  29 ala CA  1 1 
        94  3 1 1 1  49 VAL CA  A  49 val CA  1 1 
        94  3 2 1 1  50 ALA CA  A  50 ala CA  1 1 
        95  2 1 1 1  28 THR CA  A  28 thr CA  1 1 
        95  2 2 1 1  29 ALA CA  A  29 ala CA  1 1 
        95  3 1 1 1  49 VAL CA  A  49 val CA  1 1 
        95  3 2 1 1  50 ALA CA  A  50 ala CA  1 1 
        95  4 1 1 1 151 ILE CA  A 151 ile CA  1 1 
        95  4 2 1 1 152 ALA CA  A 152 ala CA  1 1 
        96  1 1 1 1  28 THR CA  A  28 thr CA  1 1 
        96  1 2 1 1  30 LEU CD1 A  30 LEU CD* 1 1 
        96  1 2 1 1  30 LEU CD2 A  30 LEU CD* 1 1 
        97  1 1 1 1  28 THR CB  A  28 thr CB  1 1 
        97  1 2 1 1  29 ALA CA  A  29 ala CA  1 1 
        98  2 1 1 1  28 THR CG2 A  28 thr CG2 1 1 
        98  2 2 1 1  29 ALA CB  A  29 ala CB  1 1 
        98  3 1 1 1  49 VAL CG1 A  49 val CG1 1 1 
        98  3 2 1 1  50 ALA CB  A  50 ala CB  1 1 
        98  4 1 1 1  75 VAL CG1 A  75 val CG1 1 1 
        98  4 2 1 1  76 ILE CG2 A  76 ile CG2 1 1 
        99  1 1 1 1  29 ALA C   A  29 ala C   1 1 
        99  1 2 1 1  30 LEU CD1 A  30 LEU CD* 1 1 
        99  1 2 1 1  30 LEU CD2 A  30 LEU CD* 1 1 
       100  2 1 1 1  29 ALA C   A  29 ala C   1 1 
       100  2 2 1 1  30 LEU CD1 A  30 LEU CD* 1 1 
       100  2 2 1 1  30 LEU CD2 A  30 LEU CD* 1 1 
       100  3 1 1 1 157 ALA C   A 157 ala C   1 1 
       100  3 2 1 1 158 VAL CG2 A 158 val CG2 1 1 
       101  2 1 1 1  29 ALA CB  A  29 ala CB  1 1 
       101  2 2 1 1  30 LEU CA  A  30 leu CA  1 1 
       101  3 1 1 1  50 ALA CB  A  50 ala CB  1 1 
       101  3 2 1 1  51 LEU CA  A  51 leu CA  1 1 
       102  1 1 1 1  30 LEU CA  A  30 leu CA  1 1 
       102  1 2 1 1  30 LEU CD1 A  30 LEU CD* 1 1 
       102  1 2 1 1  30 LEU CD2 A  30 LEU CD* 1 1 
       103  1 1 1 1  30 LEU CB  A  30 leu CB  1 1 
       103  1 2 1 1  31 TRP CA  A  31 trp CA  1 1 
       104  1 1 1 1  31 TRP CA  A  31 trp CA  1 1 
       104  1 2 1 1  32 PHE CA  A  32 phe CA  1 1 
       105  2 1 1 1  31 TRP CA  A  31 trp CA  1 1 
       105  2 2 1 1  32 PHE CA  A  32 phe CA  1 1 
       105  3 1 1 1  44 CYS CA  A  44 cys CA  1 1 
       105  3 1 1 1  46 TYR CA  A  46 tyr CA  1 1 
       105  3 1 1 1  47 GLU CA  A  47 glu CA  1 1 
       105  3 2 1 1  45 ILE CA  A  45 ile CA  1 1 
       105  4 1 1 1 122 GLN CA  A 122 gln CA  1 1 
       105  4 2 1 1 123 VAL CA  A 123 val CA  1 1 
       106  2 1 1 1  31 TRP CB  A  31 trp CB  1 1 
       106  2 2 1 1  32 PHE CB  A  32 phe CB  1 1 
       106  3 1 1 1  40 PRO CB  A  40 pro CB  1 1 
       106  3 2 1 1  44 CYS CB  A  44 cys CB  1 1 
       107  1 1 1 1  32 PHE CA  A  32 phe CA  1 1 
       107  1 2 1 1  35 VAL CB  A  35 val CB  1 1 
       108  2 1 1 1  32 PHE CB  A  32 phe CB  1 1 
       108  2 2 1 1  33 GLN C   A  33 gln C   1 1 
       108  3 1 1 1  81 ALA C   A  81 ala C   1 1 
       108  3 2 1 1  82 PHE CB  A  82 phe CB  1 1 
       108  4 1 1 1 149 ILE C   A 149 ile C   1 1 
       108  4 2 1 1 150 PHE CB  A 150 phe CB  1 1 
       109  1 1 1 1  32 PHE CB  A  32 phe CB  1 1 
       109  1 2 1 1  33 GLN CB  A  33 gln CB  1 1 
       110  2 1 1 1  33 GLN C   A  33 gln C   1 1 
       110  2 1 1 1  35 VAL C   A  35 val C   1 1 
       110  2 2 1 1  34 HIS CA  A  34 his CA  1 1 
       110  3 1 1 1  44 CYS CA  A  44 cys CA  1 1 
       110  3 1 1 1  47 GLU CA  A  47 glu CA  1 1 
       110  3 2 1 1  46 TYR C   A  46 tyr C   1 1 
       111  2 1 1 1  33 GLN C   A  33 gln C   1 1 
       111  2 1 1 1  35 VAL C   A  35 val C   1 1 
       111  2 2 1 1  36 MET CA  A  36 met CA  1 1 
       111  3 1 1 1  35 VAL C   A  35 val C   1 1 
       111  3 2 1 1  37 LEU CA  A  37 leu CA  1 1 
       112  2 1 1 1  33 GLN C   A  33 gln C   1 1 
       112  2 2 1 1  35 VAL CA  A  35 val CA  1 1 
       112  3 1 1 1  59 LEU C   A  59 leu C   1 1 
       112  3 2 1 1  60 ILE CA  A  60 ile CA  1 1 
       112  4 1 1 1 115 PRO CA  A 115 pro CA  1 1 
       112  4 2 1 1 117 ASP C   A 117 asp C   1 1 
       112  5 1 1 1 149 ILE C   A 149 ile C   1 1 
       112  5 1 1 1 151 ILE C   A 151 ile C   1 1 
       112  5 1 1 1 155 ILE C   A 155 ile C   1 1 
       112  5 2 1 1 153 TYR CA  A 153 tyr CA  1 1 
       113  2 1 1 1  33 GLN C   A  33 gln C   1 1 
       113  2 2 1 1  35 VAL CA  A  35 val CA  1 1 
       113  3 1 1 1  59 LEU C   A  59 leu C   1 1 
       113  3 2 1 1  60 ILE CA  A  60 ile CA  1 1 
       113  4 1 1 1 149 ILE C   A 149 ile C   1 1 
       113  4 1 1 1 151 ILE C   A 151 ile C   1 1 
       113  4 1 1 1 155 ILE C   A 155 ile C   1 1 
       113  4 2 1 1 153 TYR CA  A 153 tyr CA  1 1 
       114  2 1 1 1  33 GLN C   A  33 gln C   1 1 
       114  2 2 1 1  35 VAL CG2 A  35 val CG2 1 1 
       114  3 1 1 1  52 PHE C   A  52 phe C   1 1 
       114  3 2 1 1  54 VAL CG2 A  54 val CG2 1 1 
       114  4 1 1 1 120 VAL CG2 A 120 val CG2 1 1 
       114  4 1 1 1 123 VAL CG2 A 123 val CG2 1 1 
       114  4 2 1 1 121 PRO C   A 121 pro C   1 1 
       115  1 1 1 1  33 GLN CB  A  33 gln CB  1 1 
       115  1 2 1 1  34 HIS CB  A  34 his CB  1 1 
       116  2 1 1 1  33 GLN CB  A  33 gln CB  1 1 
       116  2 2 1 1  36 MET CA  A  36 met CA  1 1 
       116  3 1 1 1  48 ARG CB  A  48 arg CB  1 1 
       116  3 2 1 1  50 ALA CA  A  50 ala CA  1 1 
       117  2 1 1 1  33 GLN CB  A  33 gln CB  1 1 
       117  2 2 1 1  36 MET CA  A  36 met CA  1 1 
       117  3 1 1 1  48 ARG CB  A  48 arg CB  1 1 
       117  3 2 1 1  50 ALA CA  A  50 ala CA  1 1 
       117  4 1 1 1  57 ALA CA  A  57 ala CA  1 1 
       117  4 2 1 1  60 ILE CG1 A  60 ile CG1 1 1 
       118  1 1 1 1  34 HIS CA  A  34 his CA  1 1 
       118  1 2 1 1  35 VAL CA  A  35 val CA  1 1 
       119  1 1 1 1  34 HIS CB  A  34 his CB  1 1 
       119  1 2 1 1  36 MET C   A  36 met C   1 1 
       120  2 1 1 1  35 VAL C   A  35 val C   1 1 
       120  2 2 1 1  36 MET C   A  36 met C   1 1 
       120  3 1 1 1  80 SER C   A  80 ser C   1 1 
       120  3 2 1 1  81 ALA C   A  81 ala C   1 1 
       120  4 1 1 1  92 THR C   A  92 thr C   1 1 
       120  4 2 1 1  93 MET C   A  93 met C   1 1 
       120  5 1 1 1 148 GLY C   A 148 gly C   1 1 
       120  5 2 1 1 149 ILE C   A 149 ile C   1 1 
       121  2 1 1 1  35 VAL CA  A  35 val CA  1 1 
       121  2 2 1 1  36 MET CA  A  36 met CA  1 1 
       121  3 1 1 1 152 ALA CA  A 152 ala CA  1 1 
       121  3 2 1 1 153 TYR CA  A 153 tyr CA  1 1 
       122  2 1 1 1  35 VAL CB  A  35 val CB  1 1 
       122  2 2 1 1  36 MET CA  A  36 met CA  1 1 
       122  3 1 1 1  49 VAL CB  A  49 val CB  1 1 
       122  3 2 1 1  50 ALA CA  A  50 ala CA  1 1 
       122  4 1 1 1  72 VAL CB  A  72 val CB  1 1 
       122  4 2 1 1  73 ALA CA  A  73 ala CA  1 1 
       123  1 1 1 1  38 LEU C   A  38 leu C   1 1 
       123  1 2 1 1  39 LYS CA  A  39 lys CA  1 1 
       124  2 1 1 1  38 LEU C   A  38 leu C   1 1 
       124  2 2 1 1  39 LYS CA  A  39 lys CA  1 1 
       124  3 1 1 1 103 THR C   A 103 thr C   1 1 
       124  3 2 1 1 105 ASP CA  A 105 asp CA  1 1 
       125  1 1 1 1  38 LEU C   A  38 leu C   1 1 
       125  1 2 1 1  40 PRO CD  A  40 pro CD  1 1 
       126  2 1 1 1  39 LYS CA  A  39 lys CA  1 1 
       126  2 2 1 1  40 PRO CB  A  40 pro CB  1 1 
       126  3 1 1 1  62 ALA CA  A  62 ala CA  1 1 
       126  3 1 1 1  64 ALA CA  A  64 ala CA  1 1 
       126  3 2 1 1  63 ILE CB  A  63 ile CB  1 1 
       127  1 1 1 1  39 LYS CA  A  39 lys CA  1 1 
       127  1 2 1 1  40 PRO CD  A  40 pro CD  1 1 
       128  2 1 1 1  39 LYS CA  A  39 lys CA  1 1 
       128  2 2 1 1  40 PRO CD  A  40 pro CD  1 1 
       128  3 1 1 1  62 ALA CA  A  62 ala CA  1 1 
       128  3 1 1 1  64 ALA CA  A  64 ala CA  1 1 
       128  3 2 1 1  65 PRO CD  A  65 pro CD  1 1 
       129  2 1 1 1  39 LYS CA  A  39 lys CA  1 1 
       129  2 2 1 1  40 PRO CD  A  40 pro CD  1 1 
       129  3 1 1 1  64 ALA CA  A  64 ala CA  1 1 
       129  3 2 1 1  65 PRO CD  A  65 pro CD  1 1 
       130  2 1 1 1  40 PRO CA  A  40 pro CA  1 1 
       130  2 2 1 1  42 VAL CA  A  42 val CA  1 1 
       130  3 1 1 1  48 ARG CA  A  48 arg CA  1 1 
       130  3 2 1 1  49 VAL CA  A  49 val CA  1 1 
       130  4 1 1 1  83 ARG CA  A  83 arg CA  1 1 
       130  4 2 1 1  85 VAL CA  A  85 val CA  1 1 
       131  2 1 1 1  40 PRO CB  A  40 pro CB  1 1 
       131  2 2 1 1  44 CYS CB  A  44 cys CB  1 1 
       131  3 1 1 1  82 PHE CB  A  82 phe CB  1 1 
       131  3 2 1 1  83 ARG CG  A  83 arg CG  1 1 
       132  2 1 1 1  43 LEU C   A  43 leu C   1 1 
       132  2 1 1 1  45 ILE C   A  45 ile C   1 1 
       132  2 2 1 1  44 CYS CA  A  44 cys CA  1 1 
       132  2 2 1 1  46 TYR CA  A  46 tyr CA  1 1 
       132  3 1 1 1  45 ILE C   A  45 ile C   1 1 
       132  3 2 1 1  47 GLU CA  A  47 glu CA  1 1 
       132  4 1 1 1  76 ILE C   A  76 ile C   1 1 
       132  4 1 1 1  78 LEU C   A  78 leu C   1 1 
       132  4 2 1 1  77 TRP CA  A  77 trp CA  1 1 
       132  5 1 1 1 120 VAL CA  A 120 val CA  1 1 
       132  5 1 1 1 122 GLN CA  A 122 gln CA  1 1 
       132  5 2 1 1 121 PRO C   A 121 pro C   1 1 
       133  1 1 1 1  43 LEU CA  A  43 leu CA  1 1 
       133  1 2 1 1  44 CYS C   A  44 cys C   1 1 
       134  2 1 1 1  43 LEU CA  A  43 leu CA  1 1 
       134  2 2 1 1  44 CYS CB  A  44 cys CB  1 1 
       134  3 1 1 1  65 PRO CG  A  65 pro CG  1 1 
       134  3 2 1 1  66 LYS CA  A  66 lys CA  1 1 
       134  4 1 1 1  94 LEU CA  A  94 leu CA  1 1 
       134  4 2 1 1  95 GLN CB  A  95 gln CB  1 1 
       135  1 1 1 1  43 LEU CA  A  43 leu CA  1 1 
       135  1 2 1 1  45 ILE C   A  45 ile C   1 1 
       136  2 1 1 1  44 CYS C   A  44 cys C   1 1 
       136  2 2 1 1  45 ILE C   A  45 ile C   1 1 
       136  2 2 1 1  46 TYR C   A  46 tyr C   1 1 
       136  3 1 1 1  52 PHE C   A  52 phe C   1 1 
       136  3 2 1 1  54 VAL C   A  54 val C   1 1 
       136  4 1 1 1  74 MET C   A  74 met C   1 1 
       136  4 1 1 1  77 TRP C   A  77 trp C   1 1 
       136  4 2 1 1  76 ILE C   A  76 ile C   1 1 
       136  5 1 1 1 150 PHE C   A 150 phe C   1 1 
       136  5 1 1 1 152 ALA C   A 152 ala C   1 1 
       136  5 2 1 1 151 ILE C   A 151 ile C   1 1 
       136  6 1 1 1 155 ILE C   A 155 ile C   1 1 
       136  6 1 1 1 158 VAL C   A 158 val C   1 1 
       136  6 2 1 1 157 ALA C   A 157 ala C   1 1 
       137  1 1 1 1  44 CYS C   A  44 cys C   1 1 
       137  1 2 1 1  45 ILE CG1 A  45 ile CG1 1 1 
       138  2 1 1 1  44 CYS C   A  44 cys C   1 1 
       138  2 2 1 1  45 ILE CG2 A  45 ile CG2 1 1 
       138  3 1 1 1  73 ALA CB  A  73 ala CB  1 1 
       138  3 2 1 1  74 MET C   A  74 met C   1 1 
       138  4 1 1 1 102 ALA C   A 102 ala C   1 1 
       138  4 2 1 1 103 THR CG2 A 103 thr CG2 1 1 
       139  2 1 1 1  44 CYS C   A  44 cys C   1 1 
       139  2 2 1 1  48 ARG CA  A  48 arg CA  1 1 
       139  3 1 1 1  67 THR CA  A  67 thr CA  1 1 
       139  3 2 1 1  68 PRO C   A  68 pro C   1 1 
       139  3 2 1 1  69 LEU C   A  69 leu C   1 1 
       140  1 1 1 1  44 CYS CA  A  44 cys CA  1 1 
       140  1 1 1 1  46 TYR CA  A  46 tyr CA  1 1 
       140  1 1 1 1  47 GLU CA  A  47 glu CA  1 1 
       140  1 2 1 1  45 ILE CA  A  45 ile CA  1 1 
       141  1 1 1 1  44 CYS CA  A  44 cys CA  1 1 
       141  1 1 1 1  46 TYR CA  A  46 tyr CA  1 1 
       141  1 2 1 1  45 ILE CB  A  45 ile CB  1 1 
       142  1 1 1 1  44 CYS CB  A  44 cys CB  1 1 
       142  1 1 1 1  48 ARG CG  A  48 arg CG  1 1 
       142  1 2 1 1  45 ILE C   A  45 ile C   1 1 
       143  1 1 1 1  44 CYS CB  A  44 cys CB  1 1 
       143  1 2 1 1  45 ILE CA  A  45 ile CA  1 1 
       144  1 1 1 1  44 CYS CB  A  44 cys CB  1 1 
       144  1 2 1 1  45 ILE CB  A  45 ile CB  1 1 
       145  1 1 1 1  44 CYS CB  A  44 cys CB  1 1 
       145  1 1 1 1  48 ARG CG  A  48 arg CG  1 1 
       145  1 2 1 1  45 ILE CB  A  45 ile CB  1 1 
       146  2 1 1 1  45 ILE C   A  45 ile C   1 1 
       146  2 1 1 1  46 TYR C   A  46 tyr C   1 1 
       146  2 2 1 1  48 ARG CB  A  48 arg CB  1 1 
       146  3 1 1 1  76 ILE C   A  76 ile C   1 1 
       146  3 2 1 1  77 TRP CB  A  77 trp CB  1 1 
       146  4 1 1 1 150 PHE C   A 150 phe C   1 1 
       146  4 2 1 1 151 ILE CG1 A 151 ile CG1 1 1 
       147  2 1 1 1  45 ILE C   A  45 ile C   1 1 
       147  2 1 1 1  46 TYR C   A  46 tyr C   1 1 
       147  2 2 1 1  48 ARG CB  A  48 arg CB  1 1 
       147  3 1 1 1 150 PHE C   A 150 phe C   1 1 
       147  3 2 1 1 151 ILE CG1 A 151 ile CG1 1 1 
       148  1 1 1 1  45 ILE C   A  45 ile C   1 1 
       148  1 2 1 1  48 ARG CB  A  48 arg CB  1 1 
       149  2 1 1 1  45 ILE C   A  45 ile C   1 1 
       149  2 2 1 1  48 ARG CB  A  48 arg CB  1 1 
       149  3 1 1 1 147 LEU C   A 147 leu C   1 1 
       149  3 2 1 1 149 ILE CG1 A 149 ile CG1 1 1 
       150  1 1 1 1  45 ILE C   A  45 ile C   1 1 
       150  1 2 1 1  48 ARG CD  A  48 arg CD  1 1 
       151  1 1 1 1  45 ILE CA  A  45 ile CA  1 1 
       151  1 2 1 1  45 ILE CD1 A  45 ile CD1 1 1 
       152  1 1 1 1  45 ILE CA  A  45 ile CA  1 1 
       152  1 2 1 1  47 GLU C   A  47 glu C   1 1 
       153  1 1 1 1  45 ILE CA  A  45 ile CA  1 1 
       153  1 2 1 1  48 ARG CD  A  48 arg CD  1 1 
       154  2 1 1 1  45 ILE CA  A  45 ile CA  1 1 
       154  2 1 1 1  52 PHE CA  A  52 phe CA  1 1 
       154  2 2 1 1  49 VAL CA  A  49 val CA  1 1 
       154  3 1 1 1  92 THR CA  A  92 thr CA  1 1 
       154  3 2 1 1  93 MET CA  A  93 met CA  1 1 
       155  1 1 1 1  45 ILE CB  A  45 ile CB  1 1 
       155  1 2 1 1  47 GLU C   A  47 glu C   1 1 
       156  1 1 1 1  45 ILE CB  A  45 ile CB  1 1 
       156  1 2 1 1  48 ARG CA  A  48 arg CA  1 1 
       157  1 1 1 1  45 ILE CB  A  45 ile CB  1 1 
       157  1 2 1 1  48 ARG CB  A  48 arg CB  1 1 
       158  1 1 1 1  45 ILE CG1 A  45 ile CG1 1 1 
       158  1 2 1 1  48 ARG CB  A  48 arg CB  1 1 
       159  1 1 1 1  45 ILE CG2 A  45 ile CG2 1 1 
       159  1 2 1 1  48 ARG CB  A  48 arg CB  1 1 
       160  1 1 1 1  46 TYR C   A  46 tyr C   1 1 
       160  1 2 1 1  47 GLU C   A  47 glu C   1 1 
       161  1 1 1 1  46 TYR C   A  46 tyr C   1 1 
       161  1 1 1 1  49 VAL C   A  49 val C   1 1 
       161  1 2 1 1  50 ALA CB  A  50 ala CB  1 1 
       162  1 1 1 1  46 TYR CA  A  46 tyr CA  1 1 
       162  1 1 1 1  47 GLU CA  A  47 glu CA  1 1 
       162  1 2 1 1  49 VAL CA  A  49 val CA  1 1 
       163  1 1 1 1  47 GLU C   A  47 glu C   1 1 
       163  1 2 1 1  48 ARG CA  A  48 arg CA  1 1 
       164  1 1 1 1  47 GLU C   A  47 glu C   1 1 
       164  1 2 1 1  49 VAL CA  A  49 val CA  1 1 
       165  2 1 1 1  47 GLU CA  A  47 glu CA  1 1 
       165  2 2 1 1  48 ARG CB  A  48 arg CB  1 1 
       165  3 1 1 1  77 TRP CB  A  77 trp CB  1 1 
       165  3 2 1 1  78 LEU CA  A  78 leu CA  1 1 
       166  1 1 1 1  48 ARG CA  A  48 arg CA  1 1 
       166  1 2 1 1  48 ARG CD  A  48 arg CD  1 1 
       167  1 1 1 1  48 ARG CA  A  48 arg CA  1 1 
       167  1 2 1 1  49 VAL CB  A  49 val CB  1 1 
       168  2 1 1 1  48 ARG CA  A  48 arg CA  1 1 
       168  2 2 1 1  50 ALA CA  A  50 ala CA  1 1 
       168  3 1 1 1 103 THR CA  A 103 thr CA  1 1 
       168  3 2 1 1 104 CYS CA  A 104 cys CA  1 1 
       169  2 1 1 1  48 ARG CB  A  48 arg CB  1 1 
       169  2 2 1 1  49 VAL C   A  49 val C   1 1 
       169  3 1 1 1 151 ILE C   A 151 ile C   1 1 
       169  3 2 1 1 151 ILE CG1 A 151 ile CG1 1 1 
       170  1 1 1 1  48 ARG CD  A  48 arg CD  1 1 
       170  1 2 1 1  49 VAL CB  A  49 val CB  1 1 
       171  2 1 1 1  49 VAL CA  A  49 val CA  1 1 
       171  2 2 1 1  50 ALA CA  A  50 ala CA  1 1 
       171  3 1 1 1  54 VAL CA  A  54 val CA  1 1 
       171  3 2 1 1  57 ALA CA  A  57 ala CA  1 1 
       172  2 1 1 1  50 ALA CA  A  50 ala CA  1 1 
       172  2 2 1 1  53 GLY CA  A  53 gly CA  1 1 
       172  3 1 1 1 148 GLY CA  A 148 gly CA  1 1 
       172  3 2 1 1 152 ALA CA  A 152 ala CA  1 1 
       173  2 1 1 1  51 LEU C   A  51 leu C   1 1 
       173  2 2 1 1  53 GLY CA  A  53 gly CA  1 1 
       173  3 1 1 1  55 LEU C   A  55 leu C   1 1 
       173  3 2 1 1  56 GLY CA  A  56 gly CA  1 1 
       173  4 1 1 1 147 LEU C   A 147 leu C   1 1 
       173  4 1 1 1 149 ILE C   A 149 ile C   1 1 
       173  4 2 1 1 148 GLY CA  A 148 gly CA  1 1 
       174  2 1 1 1  51 LEU CB  A  51 leu CB  1 1 
       174  2 2 1 1  52 PHE CA  A  52 phe CA  1 1 
       174  3 1 1 1 115 PRO CA  A 115 pro CA  1 1 
       174  3 2 1 1 116 LEU CB  A 116 leu CB  1 1 
       175  1 1 1 1  52 PHE CA  A  52 phe CA  1 1 
       175  1 2 1 1  53 GLY CA  A  53 gly CA  1 1 
       176  1 1 1 1  52 PHE CA  A  52 phe CA  1 1 
       176  1 2 1 1  54 VAL CA  A  54 val CA  1 1 
       177  2 1 1 1  52 PHE CA  A  52 phe CA  1 1 
       177  2 2 1 1  54 VAL CA  A  54 val CA  1 1 
       177  3 1 1 1  92 THR CA  A  92 thr CA  1 1 
       177  3 2 1 1  93 MET CA  A  93 met CA  1 1 
       178  2 1 1 1  53 GLY C   A  53 gly C   1 1 
       178  2 2 1 1  54 VAL C   A  54 val C   1 1 
       178  3 1 1 1 102 ALA C   A 102 ala C   1 1 
       178  3 2 1 1 103 THR C   A 103 thr C   1 1 
       179  1 1 1 1  53 GLY C   A  53 gly C   1 1 
       179  1 2 1 1  54 VAL CG2 A  54 val CG2 1 1 
       180  1 1 1 1  53 GLY CA  A  53 gly CA  1 1 
       180  1 1 1 1  56 GLY CA  A  56 gly CA  1 1 
       180  1 2 1 1  54 VAL CA  A  54 val CA  1 1 
       181  1 1 1 1  53 GLY CA  A  53 gly CA  1 1 
       181  1 2 1 1  54 VAL CB  A  54 val CB  1 1 
       182  2 1 1 1  54 VAL C   A  54 val C   1 1 
       182  2 2 1 1  57 ALA CB  A  57 ala CB  1 1 
       182  3 1 1 1 151 ILE C   A 151 ile C   1 1 
       182  3 2 1 1 151 ILE CG2 A 151 ile CG2 1 1 
       182  3 2 1 1 152 ALA CB  A 152 ala CB  1 1 
       182  4 1 1 1 155 ILE C   A 155 ile C   1 1 
       182  4 2 1 1 155 ILE CG2 A 155 ile CG2 1 1 
       183  2 1 1 1  54 VAL CA  A  54 val CA  1 1 
       183  2 2 1 1  57 ALA CA  A  57 ala CA  1 1 
       183  3 1 1 1 155 ILE CA  A 155 ile CA  1 1 
       183  3 1 1 1 160 VAL CA  A 160 val CA  1 1 
       183  3 2 1 1 157 ALA CA  A 157 ala CA  1 1 
       184  1 1 1 1  54 VAL CB  A  54 val CB  1 1 
       184  1 2 1 1  55 LEU CB  A  55 leu CB  1 1 
       185  1 1 1 1  54 VAL CG1 A  54 val CG1 1 1 
       185  1 2 1 1  57 ALA CB  A  57 ala CB  1 1 
       186  2 1 1 1  54 VAL CG2 A  54 val CG2 1 1 
       186  2 2 1 1  56 GLY C   A  56 gly C   1 1 
       186  3 1 1 1 120 VAL CG2 A 120 val CG2 1 1 
       186  3 2 1 1 122 GLN C   A 122 gln C   1 1 
       187  1 1 1 1  54 VAL CG2 A  54 val CG2 1 1 
       187  1 2 1 1  57 ALA CB  A  57 ala CB  1 1 
       188  1 1 1 1  55 LEU C   A  55 leu C   1 1 
       188  1 2 1 1  56 GLY CA  A  56 gly CA  1 1 
       189  1 1 1 1  55 LEU CB  A  55 leu CB  1 1 
       189  1 2 1 1  56 GLY CA  A  56 gly CA  1 1 
       190  2 1 1 1  56 GLY C   A  56 gly C   1 1 
       190  2 2 1 1  57 ALA C   A  57 ala C   1 1 
       190  2 2 1 1  58 ALA C   A  58 ala C   1 1 
       190  3 1 1 1 121 PRO C   A 121 pro C   1 1 
       190  3 2 1 1 122 GLN C   A 122 gln C   1 1 
       191  1 1 1 1  56 GLY C   A  56 gly C   1 1 
       191  1 2 1 1  60 ILE CA  A  60 ile CA  1 1 
       192  1 1 1 1  56 GLY CA  A  56 gly CA  1 1 
       192  1 2 1 1  57 ALA CA  A  57 ala CA  1 1 
       193  1 1 1 1  56 GLY CA  A  56 gly CA  1 1 
       193  1 2 1 1  58 ALA CA  A  58 ala CA  1 1 
       194  1 1 1 1  56 GLY CA  A  56 gly CA  1 1 
       194  1 2 1 1  59 LEU CB  A  59 leu CB  1 1 
       195  1 1 1 1  56 GLY CA  A  56 gly CA  1 1 
       195  1 2 1 1  60 ILE C   A  60 ile C   1 1 
       196  2 1 1 1  56 GLY CA  A  56 gly CA  1 1 
       196  2 2 1 1  60 ILE CB  A  60 ile CB  1 1 
       196  3 1 1 1 148 GLY CA  A 148 gly CA  1 1 
       196  3 2 1 1 151 ILE CB  A 151 ile CB  1 1 
       197  2 1 1 1  57 ALA CA  A  57 ala CA  1 1 
       197  2 2 1 1  60 ILE CB  A  60 ile CB  1 1 
       197  3 1 1 1 151 ILE CB  A 151 ile CB  1 1 
       197  3 2 1 1 152 ALA CA  A 152 ala CA  1 1 
       198  1 1 1 1  57 ALA CA  A  57 ala CA  1 1 
       198  1 2 1 1  61 GLY CA  A  61 gly CA  1 1 
       199  2 1 1 1  59 LEU C   A  59 leu C   1 1 
       199  2 2 1 1  60 ILE CA  A  60 ile CA  1 1 
       199  3 1 1 1 149 ILE C   A 149 ile C   1 1 
       199  3 2 1 1 153 TYR CA  A 153 tyr CA  1 1 
       200  1 1 1 1  59 LEU C   A  59 leu C   1 1 
       200  1 2 1 1  60 ILE CG1 A  60 ile CG1 1 1 
       201  1 1 1 1  59 LEU C   A  59 leu C   1 1 
       201  1 2 1 1  61 GLY CA  A  61 gly CA  1 1 
       202  2 1 1 1  59 LEU C   A  59 leu C   1 1 
       202  2 2 1 1  61 GLY CA  A  61 gly CA  1 1 
       202  3 1 1 1  84 GLY CA  A  84 gly CA  1 1 
       202  3 2 1 1  87 LEU C   A  87 leu C   1 1 
       203  1 1 1 1  59 LEU C   A  59 leu C   1 1 
       203  1 2 1 1  62 ALA CA  A  62 ala CA  1 1 
       204  1 1 1 1  59 LEU CA  A  59 leu CA  1 1 
       204  1 2 1 1  61 GLY C   A  61 gly C   1 1 
       205  1 1 1 1  59 LEU CA  A  59 leu CA  1 1 
       205  1 2 1 1  62 ALA CB  A  62 ala CB  1 1 
       206  1 1 1 1  59 LEU CB  A  59 leu CB  1 1 
       206  1 2 1 1  60 ILE CB  A  60 ile CB  1 1 
       207  1 1 1 1  60 ILE C   A  60 ile C   1 1 
       207  1 2 1 1  60 ILE CG1 A  60 ile CG1 1 1 
       208  1 1 1 1  60 ILE C   A  60 ile C   1 1 
       208  1 2 1 1  61 GLY C   A  61 gly C   1 1 
       209  1 1 1 1  60 ILE C   A  60 ile C   1 1 
       209  1 2 1 1  62 ALA CA  A  62 ala CA  1 1 
       210  1 1 1 1  60 ILE C   A  60 ile C   1 1 
       210  1 2 1 1  63 ILE CG1 A  63 ile CG1 1 1 
       211  2 1 1 1  60 ILE CA  A  60 ile CA  1 1 
       211  2 1 1 1  65 PRO CA  A  65 pro CA  1 1 
       211  2 2 1 1  62 ALA C   A  62 ala C   1 1 
       211  3 1 1 1  85 VAL C   A  85 val C   1 1 
       211  3 2 1 1  88 THR CA  A  88 thr CA  1 1 
       212  1 1 1 1  60 ILE CB  A  60 ile CB  1 1 
       212  1 2 1 1  61 GLY CA  A  61 gly CA  1 1 
       213  1 1 1 1  60 ILE CD1 A  60 ile CD1 1 1 
       213  1 2 1 1  60 ILE CG2 A  60 ile CG2 1 1 
       214  1 1 1 1  60 ILE CG1 A  60 ile CG1 1 1 
       214  1 2 1 1  61 GLY C   A  61 gly C   1 1 
       215  2 1 1 1  60 ILE CG2 A  60 ile CG2 1 1 
       215  2 1 1 1  63 ILE CG2 A  63 ile CG2 1 1 
       215  2 2 1 1  61 GLY C   A  61 gly C   1 1 
       215  3 1 1 1 124 PHE C   A 124 phe C   1 1 
       215  3 2 1 1 126 ALA CB  A 126 ala CB  1 1 
       216  2 1 1 1  61 GLY C   A  61 gly C   1 1 
       216  2 2 1 1  62 ALA C   A  62 ala C   1 1 
       216  3 1 1 1 124 PHE C   A 124 phe C   1 1 
       216  3 2 1 1 125 VAL C   A 125 val C   1 1 
       217  1 1 1 1  61 GLY C   A  61 gly C   1 1 
       217  1 2 1 1  62 ALA CB  A  62 ala CB  1 1 
       218  1 1 1 1  61 GLY C   A  61 gly C   1 1 
       218  1 2 1 1  63 ILE CA  A  63 ile CA  1 1 
       219  1 1 1 1  61 GLY CA  A  61 gly CA  1 1 
       219  1 2 1 1  62 ALA CA  A  62 ala CA  1 1 
       220  2 1 1 1  62 ALA C   A  62 ala C   1 1 
       220  2 2 1 1  63 ILE CA  A  63 ile CA  1 1 
       220  3 1 1 1 155 ILE CA  A 155 ile CA  1 1 
       220  3 2 1 1 156 VAL C   A 156 val C   1 1 
       221  2 1 1 1  62 ALA C   A  62 ala C   1 1 
       221  2 2 1 1  63 ILE CG1 A  63 ile CG1 1 1 
       221  3 1 1 1  68 PRO CG  A  68 pro CG  1 1 
       221  3 2 1 1  70 ARG C   A  70 arg C   1 1 
       221  4 1 1 1  85 VAL C   A  85 val C   1 1 
       221  4 2 1 1  86 GLN CB  A  86 gln CB  1 1 
       222  1 1 1 1  62 ALA CA  A  62 ala CA  1 1 
       222  1 2 1 1  63 ILE CG1 A  63 ile CG1 1 1 
       223  1 1 1 1  63 ILE CA  A  63 ile CA  1 1 
       223  1 2 1 1  65 PRO CD  A  65 pro CD  1 1 
       224  1 1 1 1  63 ILE CD1 A  63 ile CD1 1 1 
       224  1 2 1 1  63 ILE CG2 A  63 ile CG2 1 1 
       225  1 1 1 1  64 ALA CA  A  64 ala CA  1 1 
       225  1 2 1 1  66 LYS CA  A  66 lys CA  1 1 
       226  1 1 1 1  65 PRO CA  A  65 pro CA  1 1 
       226  1 2 1 1  66 LYS CA  A  66 lys CA  1 1 
       227  1 1 1 1  65 PRO CA  A  65 pro CA  1 1 
       227  1 2 1 1  68 PRO CA  A  68 pro CA  1 1 
       228  2 1 1 1  65 PRO CA  A  65 pro CA  1 1 
       228  2 2 1 1  68 PRO CB  A  68 pro CB  1 1 
       228  3 1 1 1 153 TYR CA  A 153 tyr CA  1 1 
       228  3 2 1 1 156 VAL CB  A 156 val CB  1 1 
       229  1 1 1 1  65 PRO CD  A  65 pro CD  1 1 
       229  1 2 1 1  68 PRO CD  A  68 pro CD  1 1 
       230  2 1 1 1  66 LYS CA  A  66 lys CA  1 1 
       230  2 2 1 1  67 THR CA  A  67 thr CA  1 1 
       230  3 1 1 1  71 TYR CA  A  71 tyr CA  1 1 
       230  3 2 1 1  74 MET CA  A  74 met CA  1 1 
       231  2 1 1 1  66 LYS CA  A  66 lys CA  1 1 
       231  2 2 1 1  68 PRO CA  A  68 pro CA  1 1 
       231  3 1 1 1 142 MET CA  A 142 met CA  1 1 
       231  3 2 1 1 143 PRO CA  A 143 pro CA  1 1 
       232  2 1 1 1  66 LYS CA  A  66 lys CA  1 1 
       232  2 2 1 1  68 PRO CA  A  68 pro CA  1 1 
       232  3 1 1 1 142 MET CA  A 142 met CA  1 1 
       232  3 2 1 1 143 PRO CA  A 143 pro CA  1 1 
       232  4 1 1 1 150 PHE CA  A 150 phe CA  1 1 
       232  4 2 1 1 152 ALA CA  A 152 ala CA  1 1 
       233  1 1 1 1  66 LYS CE  A  66 lys CE  1 1 
       233  1 2 1 1  67 THR CA  A  67 thr CA  1 1 
       234  1 1 1 1  67 THR CA  A  67 thr CA  1 1 
       234  1 2 1 1  68 PRO CA  A  68 pro CA  1 1 
       235  2 1 1 1  67 THR CA  A  67 thr CA  1 1 
       235  2 2 1 1  68 PRO CA  A  68 pro CA  1 1 
       235  3 1 1 1 143 PRO CA  A 143 pro CA  1 1 
       235  3 2 1 1 145 TRP CA  A 145 trp CA  1 1 
       236  1 1 1 1  67 THR CA  A  67 thr CA  1 1 
       236  1 2 1 1  68 PRO CB  A  68 pro CB  1 1 
       237  2 1 1 1  68 PRO C   A  68 pro C   1 1 
       237  2 2 1 1  68 PRO CD  A  68 pro CD  1 1 
       237  3 1 1 1  96 LEU C   A  96 leu C   1 1 
       237  3 2 1 1  98 PRO CD  A  98 pro CD  1 1 
       238  2 1 1 1  68 PRO C   A  68 pro C   1 1 
       238  2 2 1 1  69 LEU CA  A  69 leu CA  1 1 
       238  2 2 1 1  70 ARG CA  A  70 arg CA  1 1 
       238  3 1 1 1  77 TRP C   A  77 trp C   1 1 
       238  3 2 1 1  78 LEU CA  A  78 leu CA  1 1 
       238  4 1 1 1  84 GLY C   A  84 gly C   1 1 
       238  4 2 1 1  87 LEU CA  A  87 leu CA  1 1 
       238  5 1 1 1 117 ASP C   A 117 asp C   1 1 
       238  5 1 1 1 119 TRP C   A 119 trp C   1 1 
       238  5 2 1 1 118 LYS CA  A 118 lys CA  1 1 
       238  6 1 1 1 154 LEU CA  A 154 leu CA  1 1 
       238  6 2 1 1 155 ILE C   A 155 ile C   1 1 
       238  7 1 1 1 158 VAL C   A 158 val C   1 1 
       238  7 1 1 1 160 VAL C   A 160 val C   1 1 
       238  7 2 1 1 159 LEU CA  A 159 leu CA  1 1 
       239  2 1 1 1  68 PRO C   A  68 pro C   1 1 
       239  2 1 1 1  70 ARG C   A  70 arg C   1 1 
       239  2 2 1 1  69 LEU CB  A  69 leu CB  1 1 
       239  3 1 1 1 103 THR C   A 103 thr C   1 1 
       239  3 2 1 1 104 CYS CB  A 104 cys CB  1 1 
       240  1 1 1 1  68 PRO C   A  68 pro C   1 1 
       240  1 1 1 1  70 ARG C   A  70 arg C   1 1 
       240  1 2 1 1  70 ARG CD  A  70 arg CD  1 1 
       241  1 1 1 1  68 PRO CA  A  68 pro CA  1 1 
       241  1 2 1 1  69 LEU CB  A  69 leu CB  1 1 
       242  2 1 1 1  68 PRO CA  A  68 pro CA  1 1 
       242  2 2 1 1  70 ARG C   A  70 arg C   1 1 
       242  3 1 1 1 158 VAL C   A 158 val C   1 1 
       242  3 1 1 1 161 VAL C   A 161 val C   1 1 
       242  3 2 1 1 162 ILE CA  A 162 ile CA  1 1 
       243  1 1 1 1  68 PRO CA  A  68 pro CA  1 1 
       243  1 2 1 1  70 ARG CG  A  70 arg CG  1 1 
       244  2 1 1 1  68 PRO CA  A  68 pro CA  1 1 
       244  2 2 1 1  71 TYR CA  A  71 tyr CA  1 1 
       244  3 1 1 1  97 TYR CA  A  97 tyr CA  1 1 
       244  3 2 1 1  98 PRO CA  A  98 pro CA  1 1 
       245  1 1 1 1  68 PRO CB  A  68 pro CB  1 1 
       245  1 2 1 1  69 LEU CB  A  69 leu CB  1 1 
       246  1 1 1 1  68 PRO CB  A  68 pro CB  1 1 
       246  1 2 1 1  70 ARG C   A  70 arg C   1 1 
       247  2 1 1 1  68 PRO CB  A  68 pro CB  1 1 
       247  2 2 1 1  70 ARG C   A  70 arg C   1 1 
       247  3 1 1 1 151 ILE C   A 151 ile C   1 1 
       247  3 2 1 1 155 ILE CG1 A 155 ile CG1 1 1 
       248  1 1 1 1  68 PRO CB  A  68 pro CB  1 1 
       248  1 2 1 1  70 ARG CA  A  70 arg CA  1 1 
       249  2 1 1 1  69 LEU C   A  69 leu C   1 1 
       249  2 1 1 1  70 ARG C   A  70 arg C   1 1 
       249  2 2 1 1  70 ARG CG  A  70 arg CG  1 1 
       249  3 1 1 1 146 LEU C   A 146 leu C   1 1 
       249  3 2 1 1 147 LEU CG  A 147 leu CG  1 1 
       249  4 1 1 1 154 LEU C   A 154 leu C   1 1 
       249  4 2 1 1 154 LEU CG  A 154 leu CG  1 1 
       250  2 1 1 1  69 LEU C   A  69 leu C   1 1 
       250  2 2 1 1  71 TYR CA  A  71 tyr CA  1 1 
       250  3 1 1 1  96 LEU C   A  96 leu C   1 1 
       250  3 2 1 1  97 TYR CA  A  97 tyr CA  1 1 
       250  4 1 1 1 117 ASP C   A 117 asp C   1 1 
       250  4 2 1 1 118 LYS CA  A 118 lys CA  1 1 
       251  1 1 1 1  69 LEU CB  A  69 leu CB  1 1 
       251  1 2 1 1  70 ARG CA  A  70 arg CA  1 1 
       252  2 1 1 1  69 LEU CB  A  69 leu CB  1 1 
       252  2 2 1 1  71 TYR CA  A  71 tyr CA  1 1 
       252  3 1 1 1  91 HIS CA  A  91 his CA  1 1 
       252  3 2 1 1  94 LEU CB  A  94 leu CB  1 1 
       253  1 1 1 1  70 ARG C   A  70 arg C   1 1 
       253  1 2 1 1  70 ARG CD  A  70 arg CD  1 1 
       254  1 1 1 1  70 ARG C   A  70 arg C   1 1 
       254  1 2 1 1  70 ARG CG  A  70 arg CG  1 1 
       255  2 1 1 1  70 ARG C   A  70 arg C   1 1 
       255  2 2 1 1  72 VAL CB  A  72 val CB  1 1 
       255  3 1 1 1 154 LEU C   A 154 leu C   1 1 
       255  3 2 1 1 155 ILE CG1 A 155 ile CG1 1 1 
       255  3 2 1 1 156 VAL CB  A 156 val CB  1 1 
       255  3 2 1 1 158 VAL CB  A 158 val CB  1 1 
       256  1 1 1 1  70 ARG C   A  70 arg C   1 1 
       256  1 2 1 1  74 MET CA  A  74 met CA  1 1 
       257  1 1 1 1  70 ARG CA  A  70 arg CA  1 1 
       257  1 1 1 1  71 TYR CA  A  71 tyr CA  1 1 
       257  1 2 1 1  72 VAL CB  A  72 val CB  1 1 
       258  2 1 1 1  70 ARG CA  A  70 arg CA  1 1 
       258  2 1 1 1  71 TYR CA  A  71 tyr CA  1 1 
       258  2 2 1 1  74 MET CB  A  74 met CB  1 1 
       258  3 1 1 1  91 HIS CA  A  91 his CA  1 1 
       258  3 2 1 1  93 MET CB  A  93 met CB  1 1 
       259  2 1 1 1  70 ARG CA  A  70 arg CA  1 1 
       259  2 2 1 1  72 VAL CA  A  72 val CA  1 1 
       259  3 1 1 1  76 ILE CA  A  76 ile CA  1 1 
       259  3 2 1 1  77 TRP CA  A  77 trp CA  1 1 
       260  2 1 1 1  70 ARG CA  A  70 arg CA  1 1 
       260  2 2 1 1  72 VAL CB  A  72 val CB  1 1 
       260  3 1 1 1 121 PRO CB  A 121 pro CB  1 1 
       260  3 2 1 1 122 GLN CA  A 122 gln CA  1 1 
       261  1 1 1 1  71 TYR CA  A  71 tyr CA  1 1 
       261  1 2 1 1  74 MET CA  A  74 met CA  1 1 
       262  1 1 1 1  71 TYR CA  A  71 tyr CA  1 1 
       262  1 2 1 1  74 MET CG  A  74 met CG  1 1 
       263  1 1 1 1  72 VAL C   A  72 val C   1 1 
       263  1 1 1 1  75 VAL C   A  75 val C   1 1 
       263  1 1 1 1  77 TRP C   A  77 trp C   1 1 
       263  1 2 1 1  74 MET CA  A  74 met CA  1 1 
       264  2 1 1 1  72 VAL CA  A  72 val CA  1 1 
       264  2 2 1 1  73 ALA CA  A  73 ala CA  1 1 
       264  3 1 1 1 151 ILE CA  A 151 ile CA  1 1 
       264  3 2 1 1 152 ALA CA  A 152 ala CA  1 1 
       265  1 1 1 1  72 VAL CG1 A  72 val CG1 1 1 
       265  1 2 1 1  73 ALA CB  A  73 ala CB  1 1 
       266  1 1 1 1  73 ALA CA  A  73 ala CA  1 1 
       266  1 2 1 1  74 MET CB  A  74 met CB  1 1 
       267  1 1 1 1  74 MET CA  A  74 met CA  1 1 
       267  1 2 1 1  76 ILE C   A  76 ile C   1 1 
       268  1 1 1 1  74 MET CG  A  74 met CG  1 1 
       268  1 2 1 1  75 VAL CB  A  75 val CB  1 1 
       269  1 1 1 1  74 MET CG  A  74 met CG  1 1 
       269  1 2 1 1  77 TRP CA  A  77 trp CA  1 1 
       270  2 1 1 1  75 VAL CA  A  75 val CA  1 1 
       270  2 2 1 1  76 ILE C   A  76 ile C   1 1 
       270  3 1 1 1  92 THR CA  A  92 thr CA  1 1 
       270  3 2 1 1  93 MET C   A  93 met C   1 1 
       270  4 1 1 1 158 VAL CA  A 158 val CA  1 1 
       270  4 1 1 1 160 VAL CA  A 160 val CA  1 1 
       270  4 1 1 1 161 VAL CA  A 161 val CA  1 1 
       270  4 2 1 1 159 LEU C   A 159 leu C   1 1 
       271  2 1 1 1  75 VAL CA  A  75 val CA  1 1 
       271  2 2 1 1  79 TYR CA  A  79 tyr CA  1 1 
       271  3 1 1 1  92 THR CB  A  92 thr CB  1 1 
       271  3 2 1 1  93 MET CA  A  93 met CA  1 1 
       272  2 1 1 1  75 VAL CG1 A  75 val CG1 1 1 
       272  2 2 1 1  76 ILE CG1 A  76 ile CG1 1 1 
       272  3 1 1 1 155 ILE CG1 A 155 ile CG1 1 1 
       272  3 2 1 1 156 VAL CG1 A 156 val CG1 1 1 
       272  4 1 1 1 158 VAL CG1 A 158 val CG1 1 1 
       272  4 2 1 1 162 ILE CG1 A 162 ile CG1 1 1 
       273  2 1 1 1  76 ILE C   A  76 ile C   1 1 
       273  2 1 1 1  78 LEU C   A  78 leu C   1 1 
       273  2 2 1 1  80 SER CA  A  80 ser CA  1 1 
       273  3 1 1 1 147 LEU C   A 147 leu C   1 1 
       273  3 2 1 1 150 PHE CA  A 150 phe CA  1 1 
       273  4 1 1 1 159 LEU C   A 159 leu C   1 1 
       273  4 2 1 1 162 ILE CA  A 162 ile CA  1 1 
       274  1 1 1 1  76 ILE CB  A  76 ile CB  1 1 
       274  1 2 1 1  77 TRP CA  A  77 trp CA  1 1 
       275  1 1 1 1  77 TRP CA  A  77 trp CA  1 1 
       275  1 2 1 1  78 LEU CB  A  78 leu CB  1 1 
       276  1 1 1 1  77 TRP CA  A  77 trp CA  1 1 
       276  1 2 1 1  79 TYR CA  A  79 tyr CA  1 1 
       277  2 1 1 1  77 TRP CA  A  77 trp CA  1 1 
       277  2 2 1 1  79 TYR CA  A  79 tyr CA  1 1 
       277  3 1 1 1 120 VAL CA  A 120 val CA  1 1 
       277  3 1 1 1 122 GLN CA  A 122 gln CA  1 1 
       277  3 2 1 1 123 VAL CA  A 123 val CA  1 1 
       278  2 1 1 1  78 LEU C   A  78 leu C   1 1 
       278  2 2 1 1  80 SER CA  A  80 ser CA  1 1 
       278  3 1 1 1 149 ILE C   A 149 ile C   1 1 
       278  3 2 1 1 150 PHE CA  A 150 phe CA  1 1 
       279  1 1 1 1  78 LEU CB  A  78 leu CB  1 1 
       279  1 2 1 1  81 ALA CA  A  81 ala CA  1 1 
       280  1 1 1 1  80 SER C   A  80 ser C   1 1 
       280  1 2 1 1  81 ALA CB  A  81 ala CB  1 1 
       281  1 1 1 1  80 SER CA  A  80 ser CA  1 1 
       281  1 2 1 1  81 ALA CA  A  81 ala CA  1 1 
       282  1 1 1 1  80 SER CA  A  80 ser CA  1 1 
       282  1 2 1 1  82 PHE CA  A  82 phe CA  1 1 
       283  1 1 1 1  81 ALA CA  A  81 ala CA  1 1 
       283  1 2 1 1  82 PHE CA  A  82 phe CA  1 1 
       284  1 1 1 1  81 ALA CB  A  81 ala CB  1 1 
       284  1 2 1 1  82 PHE CB  A  82 phe CB  1 1 
       285  2 1 1 1  81 ALA CB  A  81 ala CB  1 1 
       285  2 2 1 1  82 PHE CB  A  82 phe CB  1 1 
       285  3 1 1 1 149 ILE CG2 A 149 ile CG2 1 1 
       285  3 1 1 1 151 ILE CG2 A 151 ile CG2 1 1 
       285  3 2 1 1 150 PHE CB  A 150 phe CB  1 1 
       286  1 1 1 1  83 ARG CA  A  83 arg CA  1 1 
       286  1 2 1 1  85 VAL CA  A  85 val CA  1 1 
       287  1 1 1 1  83 ARG CD  A  83 arg CD  1 1 
       287  1 2 1 1  84 GLY CA  A  84 gly CA  1 1 
       288  1 1 1 1  83 ARG CD  A  83 arg CD  1 1 
       288  1 2 1 1  86 GLN CB  A  86 gln CB  1 1 
       289  1 1 1 1  83 ARG CG  A  83 arg CG  1 1 
       289  1 2 1 1  84 GLY CA  A  84 gly CA  1 1 
       290  2 1 1 1  84 GLY C   A  84 gly C   1 1 
       290  2 1 1 1  85 VAL C   A  85 val C   1 1 
       290  2 2 1 1  85 VAL CG1 A  85 val CG1 1 1 
       290  3 1 1 1 160 VAL CG1 A 160 val CG1 1 1 
       290  3 2 1 1 161 VAL C   A 161 val C   1 1 
       291  2 1 1 1  84 GLY C   A  84 gly C   1 1 
       291  2 2 1 1  85 VAL CG1 A  85 val CG1 1 1 
       291  3 1 1 1 160 VAL C   A 160 val C   1 1 
       291  3 2 1 1 160 VAL CG1 A 160 val CG1 1 1 
       292  2 1 1 1  84 GLY C   A  84 gly C   1 1 
       292  2 2 1 1  85 VAL CG2 A  85 val CG2 1 1 
       292  3 1 1 1  93 MET C   A  93 met C   1 1 
       292  3 2 1 1  94 LEU CD1 A  94 LEU CD* 1 1 
       292  3 2 1 1  94 LEU CD2 A  94 LEU CD* 1 1 
       292  4 1 1 1 158 VAL C   A 158 val C   1 1 
       292  4 2 1 1 158 VAL CG2 A 158 val CG2 1 1 
       292  5 1 1 1 160 VAL C   A 160 val C   1 1 
       292  5 2 1 1 161 VAL CG2 A 161 val CG2 1 1 
       293  1 1 1 1  84 GLY CA  A  84 gly CA  1 1 
       293  1 2 1 1  85 VAL CA  A  85 val CA  1 1 
       294  1 1 1 1  84 GLY CA  A  84 gly CA  1 1 
       294  1 2 1 1  85 VAL CB  A  85 val CB  1 1 
       295  1 1 1 1  84 GLY CA  A  84 gly CA  1 1 
       295  1 2 1 1  86 GLN CB  A  86 gln CB  1 1 
       296  1 1 1 1  84 GLY CA  A  84 gly CA  1 1 
       296  1 2 1 1  87 LEU C   A  87 leu C   1 1 
       297  1 1 1 1  84 GLY CA  A  84 gly CA  1 1 
       297  1 2 1 1  87 LEU CB  A  87 leu CB  1 1 
       298  1 1 1 1  85 VAL C   A  85 val C   1 1 
       298  1 2 1 1  86 GLN CB  A  86 gln CB  1 1 
       299  1 1 1 1  85 VAL C   A  85 val C   1 1 
       299  1 2 1 1  86 GLN CG  A  86 gln CG  1 1 
       300  1 1 1 1  85 VAL CB  A  85 val CB  1 1 
       300  1 2 1 1  86 GLN CB  A  86 gln CB  1 1 
       301  2 1 1 1  85 VAL CB  A  85 val CB  1 1 
       301  2 2 1 1  88 THR CA  A  88 thr CA  1 1 
       301  3 1 1 1 115 PRO CB  A 115 pro CB  1 1 
       301  3 2 1 1 121 PRO CA  A 121 pro CA  1 1 
       302  1 1 1 1  87 LEU CB  A  87 leu CB  1 1 
       302  1 2 1 1  88 THR CG2 A  88 thr CG2 1 1 
       303  1 1 1 1  87 LEU CG  A  87 leu CG  1 1 
       303  1 2 1 1  88 THR CA  A  88 thr CA  1 1 
       304  1 1 1 1  90 GLU C   A  90 glu C   1 1 
       304  1 2 1 1  91 HIS CA  A  91 his CA  1 1 
       305  1 1 1 1  91 HIS CA  A  91 his CA  1 1 
       305  1 2 1 1  92 THR C   A  92 thr C   1 1 
       306  1 1 1 1  92 THR C   A  92 thr C   1 1 
       306  1 2 1 1  95 GLN CB  A  95 gln CB  1 1 
       307  1 1 1 1  92 THR CB  A  92 thr CB  1 1 
       307  1 2 1 1  93 MET CA  A  93 met CA  1 1 
       308  1 1 1 1  93 MET CB  A  93 met CB  1 1 
       308  1 2 1 1  94 LEU CG  A  94 leu CG  1 1 
       309  1 1 1 1  96 LEU C   A  96 leu C   1 1 
       309  1 2 1 1  98 PRO CD  A  98 pro CD  1 1 
       310  1 1 1 1  96 LEU CB  A  96 leu CB  1 1 
       310  1 2 1 1  97 TYR CA  A  97 tyr CA  1 1 
       311  2 1 1 1  96 LEU CB  A  96 leu CB  1 1 
       311  2 2 1 1  97 TYR CA  A  97 tyr CA  1 1 
       311  3 1 1 1 117 ASP CB  A 117 asp CB  1 1 
       311  3 2 1 1 118 LYS CA  A 118 lys CA  1 1 
       312  1 1 1 1  97 TYR CA  A  97 tyr CA  1 1 
       312  1 2 1 1  98 PRO CD  A  98 pro CD  1 1 
       313  1 1 1 1  98 PRO CA  A  98 pro CA  1 1 
       313  1 2 1 1 100 PRO CD  A 100 pro CD  1 1 
       314  1 1 1 1  98 PRO CD  A  98 pro CD  1 1 
       314  1 1 1 1 100 PRO CD  A 100 pro CD  1 1 
       314  1 2 1 1  99 SER CA  A  99 ser CA  1 1 
       315  2 1 1 1  98 PRO CD  A  98 pro CD  1 1 
       315  2 1 1 1 100 PRO CD  A 100 pro CD  1 1 
       315  2 2 1 1  99 SER CA  A  99 ser CA  1 1 
       315  3 1 1 1 120 VAL CA  A 120 val CA  1 1 
       315  3 1 1 1 122 GLN CA  A 122 gln CA  1 1 
       315  3 2 1 1 121 PRO CD  A 121 pro CD  1 1 
       316  2 1 1 1  98 PRO CD  A  98 pro CD  1 1 
       316  2 1 1 1 100 PRO CD  A 100 pro CD  1 1 
       316  2 2 1 1  99 SER CA  A  99 ser CA  1 1 
       316  3 1 1 1 121 PRO CD  A 121 pro CD  1 1 
       316  3 2 1 1 122 GLN CA  A 122 gln CA  1 1 
       317  2 1 1 1  99 SER CA  A  99 ser CA  1 1 
       317  2 2 1 1 100 PRO CD  A 100 pro CD  1 1 
       317  3 1 1 1 120 VAL CA  A 120 val CA  1 1 
       317  3 1 1 1 122 GLN CA  A 122 gln CA  1 1 
       317  3 2 1 1 121 PRO CD  A 121 pro CD  1 1 
       318  1 1 1 1 100 PRO CD  A 100 pro CD  1 1 
       318  1 2 1 1 102 ALA CA  A 102 ala CA  1 1 
       319  1 1 1 1 102 ALA C   A 102 ala C   1 1 
       319  1 2 1 1 104 CYS CA  A 104 cys CA  1 1 
       320  1 1 1 1 102 ALA CA  A 102 ala CA  1 1 
       320  1 2 1 1 103 THR C   A 103 thr C   1 1 
       321  1 1 1 1 103 THR C   A 103 thr C   1 1 
       321  1 2 1 1 104 CYS CA  A 104 cys CA  1 1 
       322  1 1 1 1 104 CYS C   A 104 cys C   1 1 
       322  1 2 1 1 105 ASP CA  A 105 asp CA  1 1 
       323  2 1 1 1 104 CYS C   A 104 cys C   1 1 
       323  2 2 1 1 108 VAL CB  A 108 val CB  1 1 
       323  3 1 1 1 120 VAL CB  A 120 val CB  1 1 
       323  3 2 1 1 122 GLN C   A 122 gln C   1 1 
       324  1 1 1 1 104 CYS C   A 104 cys C   1 1 
       324  1 2 1 1 108 VAL CG2 A 108 val CG2 1 1 
       325  1 1 1 1 104 CYS CA  A 104 cys CA  1 1 
       325  1 2 1 1 105 ASP CA  A 105 asp CA  1 1 
       326  1 1 1 1 105 ASP CA  A 105 asp CA  1 1 
       326  1 2 1 1 108 VAL CB  A 108 val CB  1 1 
       327  1 1 1 1 115 PRO CB  A 115 pro CB  1 1 
       327  1 2 1 1 121 PRO CD  A 121 pro CD  1 1 
       328  1 1 1 1 117 ASP CB  A 117 asp CB  1 1 
       328  1 2 1 1 118 LYS CA  A 118 lys CA  1 1 
       329  1 1 1 1 117 ASP CB  A 117 asp CB  1 1 
       329  1 2 1 1 118 LYS CD  A 118 lys CD  1 1 
       330  1 1 1 1 117 ASP CB  A 117 asp CB  1 1 
       330  1 2 1 1 120 VAL CA  A 120 val CA  1 1 
       331  1 1 1 1 120 VAL CA  A 120 val CA  1 1 
       331  1 1 1 1 122 GLN CA  A 122 gln CA  1 1 
       331  1 2 1 1 121 PRO CA  A 121 pro CA  1 1 
       332  1 1 1 1 120 VAL CA  A 120 val CA  1 1 
       332  1 1 1 1 122 GLN CA  A 122 gln CA  1 1 
       332  1 2 1 1 121 PRO CD  A 121 pro CD  1 1 
       333  1 1 1 1 120 VAL CB  A 120 val CB  1 1 
       333  1 2 1 1 123 VAL CA  A 123 val CA  1 1 
       334  1 1 1 1 121 PRO CA  A 121 pro CA  1 1 
       334  1 2 1 1 123 VAL CA  A 123 val CA  1 1 
       335  1 1 1 1 122 GLN C   A 122 gln C   1 1 
       335  1 2 1 1 123 VAL CA  A 123 val CA  1 1 
       336  1 1 1 1 122 GLN CA  A 122 gln CA  1 1 
       336  1 2 1 1 124 PHE C   A 124 phe C   1 1 
       337  1 1 1 1 124 PHE C   A 124 phe C   1 1 
       337  1 2 1 1 125 VAL C   A 125 val C   1 1 
       338  1 1 1 1 125 VAL C   A 125 val C   1 1 
       338  1 2 1 1 126 ALA CB  A 126 ala CB  1 1 
       339  1 1 1 1 143 PRO CA  A 143 pro CA  1 1 
       339  1 2 1 1 145 TRP CA  A 145 trp CA  1 1 
       340  1 1 1 1 145 TRP C   A 145 trp C   1 1 
       340  1 2 1 1 147 LEU CD1 A 147 LEU CD* 1 1 
       340  1 2 1 1 147 LEU CD2 A 147 LEU CD* 1 1 
       341  2 1 1 1 145 TRP C   A 145 trp C   1 1 
       341  2 2 1 1 147 LEU CD1 A 147 LEU CD* 1 1 
       341  2 2 1 1 147 LEU CD2 A 147 LEU CD* 1 1 
       341  3 1 1 1 157 ALA C   A 157 ala C   1 1 
       341  3 2 1 1 158 VAL CG1 A 158 val CG1 1 1 
       341  3 2 1 1 160 VAL CG1 A 160 val CG1 1 1 
       342  1 1 1 1 145 TRP CB  A 145 trp CB  1 1 
       342  1 2 1 1 147 LEU CD1 A 147 LEU CD* 1 1 
       342  1 2 1 1 147 LEU CD2 A 147 LEU CD* 1 1 
       343  1 1 1 1 146 LEU C   A 146 leu C   1 1 
       343  1 2 1 1 146 LEU CG  A 146 leu CG  1 1 
       344  1 1 1 1 146 LEU C   A 146 leu C   1 1 
       344  1 2 1 1 148 GLY CA  A 148 gly CA  1 1 
       345  1 1 1 1 146 LEU CB  A 146 leu CB  1 1 
       345  1 1 1 1 147 LEU CB  A 147 leu CB  1 1 
       345  1 2 1 1 149 ILE CB  A 149 ile CB  1 1 
       346  2 1 1 1 146 LEU CB  A 146 leu CB  1 1 
       346  2 2 1 1 149 ILE CB  A 149 ile CB  1 1 
       346  3 1 1 1 154 LEU CB  A 154 leu CB  1 1 
       346  3 2 1 1 155 ILE CB  A 155 ile CB  1 1 
       347  1 1 1 1 146 LEU CB  A 146 leu CB  1 1 
       347  1 2 1 1 149 ILE CG1 A 149 ile CG1 1 1 
       348  1 1 1 1 147 LEU C   A 147 leu C   1 1 
       348  1 2 1 1 148 GLY CA  A 148 gly CA  1 1 
       349  1 1 1 1 147 LEU C   A 147 leu C   1 1 
       349  1 2 1 1 149 ILE CA  A 149 ile CA  1 1 
       349  1 2 1 1 151 ILE CA  A 151 ile CA  1 1 
       350  1 1 1 1 147 LEU C   A 147 leu C   1 1 
       350  1 2 1 1 150 PHE CA  A 150 phe CA  1 1 
       351  1 1 1 1 147 LEU C   A 147 leu C   1 1 
       351  1 2 1 1 151 ILE CB  A 151 ile CB  1 1 
       352  1 1 1 1 147 LEU CA  A 147 leu CA  1 1 
       352  1 2 1 1 147 LEU CD1 A 147 LEU CD* 1 1 
       352  1 2 1 1 147 LEU CD2 A 147 LEU CD* 1 1 
       353  1 1 1 1 147 LEU CB  A 147 leu CB  1 1 
       353  1 2 1 1 148 GLY CA  A 148 gly CA  1 1 
       354  1 1 1 1 147 LEU CB  A 147 leu CB  1 1 
       354  1 2 1 1 149 ILE CB  A 149 ile CB  1 1 
       355  1 1 1 1 147 LEU CB  A 147 leu CB  1 1 
       355  1 2 1 1 151 ILE CA  A 151 ile CA  1 1 
       356  1 1 1 1 147 LEU CG  A 147 leu CG  1 1 
       356  1 2 1 1 148 GLY CA  A 148 gly CA  1 1 
       357  1 1 1 1 148 GLY C   A 148 gly C   1 1 
       357  1 2 1 1 149 ILE CG1 A 149 ile CG1 1 1 
       358  1 1 1 1 148 GLY CA  A 148 gly CA  1 1 
       358  1 2 1 1 149 ILE CB  A 149 ile CB  1 1 
       359  1 1 1 1 148 GLY CA  A 148 gly CA  1 1 
       359  1 2 1 1 149 ILE CG1 A 149 ile CG1 1 1 
       359  1 2 1 1 151 ILE CG1 A 151 ile CG1 1 1 
       360  2 1 1 1 149 ILE C   A 149 ile C   1 1 
       360  2 2 1 1 149 ILE CG1 A 149 ile CG1 1 1 
       360  3 1 1 1 151 ILE C   A 151 ile C   1 1 
       360  3 2 1 1 151 ILE CG1 A 151 ile CG1 1 1 
       361  1 1 1 1 149 ILE CA  A 149 ile CA  1 1 
       361  1 2 1 1 149 ILE CD1 A 149 ile CD1 1 1 
       362  1 1 1 1 149 ILE CB  A 149 ile CB  1 1 
       362  1 2 1 1 150 PHE CA  A 150 phe CA  1 1 
       363  1 1 1 1 149 ILE CB  A 149 ile CB  1 1 
       363  1 1 1 1 155 ILE CB  A 155 ile CB  1 1 
       363  1 2 1 1 152 ALA CA  A 152 ala CA  1 1 
       364  2 1 1 1 149 ILE CD1 A 149 ile CD1 1 1 
       364  2 2 1 1 149 ILE CG2 A 149 ile CG2 1 1 
       364  3 1 1 1 151 ILE CD1 A 151 ile CD1 1 1 
       364  3 2 1 1 151 ILE CG2 A 151 ile CG2 1 1 
       365  1 1 1 1 151 ILE C   A 151 ile C   1 1 
       365  1 2 1 1 151 ILE CD1 A 151 ile CD1 1 1 
       366  1 1 1 1 151 ILE C   A 151 ile C   1 1 
       366  1 2 1 1 152 ALA CA  A 152 ala CA  1 1 
       367  1 1 1 1 151 ILE C   A 151 ile C   1 1 
       367  1 1 1 1 155 ILE C   A 155 ile C   1 1 
       367  1 2 1 1 153 TYR CB  A 153 tyr CB  1 1 
       368  1 1 1 1 151 ILE CB  A 151 ile CB  1 1 
       368  1 2 1 1 152 ALA CA  A 152 ala CA  1 1 
       369  1 1 1 1 153 TYR CA  A 153 tyr CA  1 1 
       369  1 2 1 1 154 LEU CG  A 154 leu CG  1 1 
       370  1 1 1 1 153 TYR CA  A 153 tyr CA  1 1 
       370  1 2 1 1 155 ILE CA  A 155 ile CA  1 1 
       370  1 2 1 1 156 VAL CA  A 156 val CA  1 1 
       371  1 1 1 1 153 TYR CA  A 153 tyr CA  1 1 
       371  1 2 1 1 155 ILE CB  A 155 ile CB  1 1 
       372  1 1 1 1 153 TYR CB  A 153 tyr CB  1 1 
       372  1 2 1 1 154 LEU CA  A 154 leu CA  1 1 
       373  1 1 1 1 153 TYR CB  A 153 tyr CB  1 1 
       373  1 2 1 1 156 VAL C   A 156 val C   1 1 
       374  1 1 1 1 154 LEU C   A 154 leu C   1 1 
       374  1 2 1 1 157 ALA CA  A 157 ala CA  1 1 
       375  1 1 1 1 154 LEU CB  A 154 leu CB  1 1 
       375  1 2 1 1 155 ILE CB  A 155 ile CB  1 1 
       376  1 1 1 1 154 LEU CB  A 154 leu CB  1 1 
       376  1 2 1 1 157 ALA CA  A 157 ala CA  1 1 
       377  1 1 1 1 154 LEU CG  A 154 leu CG  1 1 
       377  1 2 1 1 155 ILE CA  A 155 ile CA  1 1 
       378  1 1 1 1 155 ILE C   A 155 ile C   1 1 
       378  1 2 1 1 155 ILE CG1 A 155 ile CG1 1 1 
       378  1 2 1 1 156 VAL CB  A 156 val CB  1 1 
       378  1 2 1 1 158 VAL CB  A 158 val CB  1 1 
       379  1 1 1 1 155 ILE C   A 155 ile C   1 1 
       379  1 1 1 1 158 VAL C   A 158 val C   1 1 
       379  1 2 1 1 157 ALA CB  A 157 ala CB  1 1 
       380  1 1 1 1 155 ILE CA  A 155 ile CA  1 1 
       380  1 2 1 1 156 VAL CA  A 156 val CA  1 1 
       380  1 2 1 1 158 VAL CA  A 158 val CA  1 1 
       381  2 1 1 1 155 ILE CG1 A 155 ile CG1 1 1 
       381  2 1 1 1 162 ILE CG1 A 162 ile CG1 1 1 
       381  2 2 1 1 158 VAL CG2 A 158 val CG2 1 1 
       381  3 1 1 1 161 VAL CG2 A 161 val CG2 1 1 
       381  3 2 1 1 162 ILE CG1 A 162 ile CG1 1 1 
       382  1 1 1 1 156 VAL C   A 156 val C   1 1 
       382  1 2 1 1 157 ALA CB  A 157 ala CB  1 1 
       383  1 1 1 1 156 VAL CA  A 156 val CA  1 1 
       383  1 1 1 1 158 VAL CA  A 158 val CA  1 1 
       383  1 2 1 1 157 ALA CA  A 157 ala CA  1 1 
       384  1 1 1 1 157 ALA C   A 157 ala C   1 1 
       384  1 2 1 1 160 VAL CG1 A 160 val CG1 1 1 
       385  1 1 1 1 159 LEU CB  A 159 leu CB  1 1 
       385  1 2 1 1 162 ILE CB  A 162 ile CB  1 1 
       386  1 1 1 1 161 VAL CG2 A 161 val CG2 1 1 
       386  1 2 1 1 162 ILE CG1 A 162 ile CG1 1 1 
       387  2 1 4 1  14 ALA C   D  14 ala C   1 1 
       387  2 1 4 1  15 TRP C   D  15 trp C   1 1 
       387  2 1 4 1  22 ALA C   D  22 ala C   1 1 
       387  2 2 4 1  18 MET CA  D  18 met CA  1 1 
       387  3 1 4 1  48 ARG CA  D  48 arg CA  1 1 
       387  3 2 4 1  50 ALA C   D  50 ala C   1 1 
       387  4 1 4 1  73 ALA C   D  73 ala C   1 1 
       387  4 2 4 1  74 MET CA  D  74 met CA  1 1 
       388  1 1 4 1  14 ALA CA  D  14 ala CA  1 1 
       388  1 2 4 1  15 TRP CA  D  15 trp CA  1 1 
       389  2 1 4 1  14 ALA CA  D  14 ala CA  1 1 
       389  2 2 4 1  17 LEU CB  D  17 leu CB  1 1 
       389  3 1 4 1  22 ALA CA  D  22 ala CA  1 1 
       389  3 1 4 1  24 ALA CA  D  24 ala CA  1 1 
       389  3 2 4 1  23 LEU CB  D  23 leu CB  1 1 
       389  4 1 4 1  24 ALA CA  D  24 ala CA  1 1 
       389  4 2 4 1  27 LEU CB  D  27 leu CB  1 1 
       389  5 1 4 1  58 ALA CA  D  58 ala CA  1 1 
       389  5 2 4 1  59 LEU CB  D  59 leu CB  1 1 
       389  6 1 4 1 157 ALA CA  D 157 ala CA  1 1 
       389  6 2 4 1 159 LEU CB  D 159 leu CB  1 1 
       390  2 1 4 1  15 TRP C   D  15 trp C   1 1 
       390  2 2 4 1  16 LEU CA  D  16 leu CA  1 1 
       390  2 2 4 1  17 LEU CA  D  17 leu CA  1 1 
       390  3 1 4 1  22 ALA C   D  22 ala C   1 1 
       390  3 2 4 1  23 LEU CA  D  23 leu CA  1 1 
       390  4 1 4 1  25 LEU CA  D  25 leu CA  1 1 
       390  4 1 4 1  27 LEU CA  D  27 leu CA  1 1 
       390  4 2 4 1  26 GLU C   D  26 glu C   1 1 
       390  5 1 4 1  29 ALA C   D  29 ala C   1 1 
       390  5 2 4 1  30 LEU CA  D  30 leu CA  1 1 
       390  6 1 4 1  50 ALA C   D  50 ala C   1 1 
       390  6 1 4 1  52 PHE C   D  52 phe C   1 1 
       390  6 2 4 1  51 LEU CA  D  51 leu CA  1 1 
       390  7 1 4 1  57 ALA C   D  57 ala C   1 1 
       390  7 1 4 1  58 ALA C   D  58 ala C   1 1 
       390  7 2 4 1  59 LEU CA  D  59 leu CA  1 1 
       390  8 1 4 1 145 TRP C   D 145 trp C   1 1 
       390  8 2 4 1 146 LEU CA  D 146 leu CA  1 1 
       390  8 2 4 1 147 LEU CA  D 147 leu CA  1 1 
       390  9 1 4 1 152 ALA C   D 152 ala C   1 1 
       390  9 1 4 1 153 TYR C   D 153 tyr C   1 1 
       390  9 2 4 1 154 LEU CA  D 154 leu CA  1 1 
       390 10 1 4 1 157 ALA C   D 157 ala C   1 1 
       390 10 2 4 1 159 LEU CA  D 159 leu CA  1 1 
       391  2 1 4 1  15 TRP C   D  15 trp C   1 1 
       391  2 1 4 1  19 ALA C   D  19 ala C   1 1 
       391  2 2 4 1  18 MET CG  D  18 met CG  1 1 
       391  3 1 4 1  74 MET CB  D  74 met CB  1 1 
       391  3 2 4 1  76 ILE C   D  76 ile C   1 1 
       392  2 1 4 1  15 TRP CA  D  15 trp CA  1 1 
       392  2 2 4 1  16 LEU CB  D  16 leu CB  1 1 
       392  3 1 4 1  23 LEU CB  D  23 leu CB  1 1 
       392  3 1 4 1  27 LEU CB  D  27 leu CB  1 1 
       392  3 2 4 1  26 GLU CA  D  26 glu CA  1 1 
       392  4 1 4 1  30 LEU CB  D  30 leu CB  1 1 
       392  4 2 4 1  31 TRP CA  D  31 trp CA  1 1 
       393  2 1 4 1  15 TRP CA  D  15 trp CA  1 1 
       393  2 2 4 1  16 LEU CB  D  16 leu CB  1 1 
       393  3 1 4 1  30 LEU CB  D  30 leu CB  1 1 
       393  3 2 4 1  31 TRP CA  D  31 trp CA  1 1 
       394  1 1 4 1  15 TRP CA  D  15 trp CA  1 1 
       394  1 2 4 1  18 MET C   D  18 met C   1 1 
       395  1 1 4 1  15 TRP CB  D  15 trp CB  1 1 
       395  1 2 4 1  16 LEU CA  D  16 leu CA  1 1 
       396  2 1 4 1  15 TRP CB  D  15 trp CB  1 1 
       396  2 2 4 1  16 LEU CA  D  16 leu CA  1 1 
       396  3 1 4 1  86 GLN CB  D  86 gln CB  1 1 
       396  3 2 4 1  87 LEU CA  D  87 leu CA  1 1 
       396  4 1 4 1 145 TRP CB  D 145 trp CB  1 1 
       396  4 2 4 1 146 LEU CA  D 146 leu CA  1 1 
       397  2 1 4 1  16 LEU CA  D  16 leu CA  1 1 
       397  2 1 4 1  17 LEU CA  D  17 leu CA  1 1 
       397  2 2 4 1  18 MET CB  D  18 met CB  1 1 
       397  3 1 4 1 121 PRO CB  D 121 pro CB  1 1 
       397  3 2 4 1 122 GLN CA  D 122 gln CA  1 1 
       397  4 1 4 1 154 LEU CA  D 154 leu CA  1 1 
       397  4 2 4 1 155 ILE CG1 D 155 ile CG1 1 1 
       398  1 1 4 1  16 LEU CB  D  16 leu CB  1 1 
       398  1 1 4 1  17 LEU CB  D  17 leu CB  1 1 
       398  1 2 4 1  18 MET CA  D  18 met CA  1 1 
       399  2 1 4 1  17 LEU C   D  17 leu C   1 1 
       399  2 2 4 1  18 MET CA  D  18 met CA  1 1 
       399  3 1 4 1  45 ILE C   D  45 ile C   1 1 
       399  3 2 4 1  48 ARG CA  D  48 arg CA  1 1 
       400  1 1 4 1  17 LEU C   D  17 leu C   1 1 
       400  1 2 4 1  19 ALA CA  D  19 ala CA  1 1 
       401  2 1 4 1  17 LEU CA  D  17 leu CA  1 1 
       401  2 2 4 1  18 MET C   D  18 met C   1 1 
       401  3 1 4 1  24 ALA C   D  24 ala C   1 1 
       401  3 2 4 1  25 LEU CA  D  25 leu CA  1 1 
       401  3 2 4 1  27 LEU CA  D  27 leu CA  1 1 
       402  1 1 4 1  17 LEU CB  D  17 leu CB  1 1 
       402  1 2 4 1  18 MET C   D  18 met C   1 1 
       403  1 1 4 1  17 LEU CB  D  17 leu CB  1 1 
       403  1 2 4 1  18 MET CA  D  18 met CA  1 1 
       404  1 1 4 1  17 LEU CB  D  17 leu CB  1 1 
       404  1 2 4 1  18 MET CG  D  18 met CG  1 1 
       405  2 1 4 1  18 MET C   D  18 met C   1 1 
       405  2 2 4 1  19 ALA CA  D  19 ala CA  1 1 
       405  3 1 4 1  47 GLU C   D  47 glu C   1 1 
       405  3 2 4 1  50 ALA CA  D  50 ala CA  1 1 
       406  2 1 4 1  18 MET C   D  18 met C   1 1 
       406  2 1 4 1  24 ALA C   D  24 ala C   1 1 
       406  2 2 4 1  21 THR C   D  21 thr C   1 1 
       406  3 1 4 1  60 ILE C   D  60 ile C   1 1 
       406  3 2 4 1  61 GLY C   D  61 gly C   1 1 
       407  2 1 4 1  18 MET C   D  18 met C   1 1 
       407  2 2 4 1  22 ALA CA  D  22 ala CA  1 1 
       407  3 1 4 1  58 ALA CA  D  58 ala CA  1 1 
       407  3 2 4 1  60 ILE C   D  60 ile C   1 1 
       408  2 1 4 1  18 MET CA  D  18 met CA  1 1 
       408  2 2 4 1  19 ALA CA  D  19 ala CA  1 1 
       408  3 1 4 1  48 ARG CA  D  48 arg CA  1 1 
       408  3 2 4 1  50 ALA CA  D  50 ala CA  1 1 
       408  4 1 4 1  73 ALA CA  D  73 ala CA  1 1 
       408  4 2 4 1  74 MET CA  D  74 met CA  1 1 
       408  5 1 4 1 103 THR CA  D 103 thr CA  1 1 
       408  5 2 4 1 104 CYS CA  D 104 cys CA  1 1 
       409  2 1 4 1  18 MET CA  D  18 met CA  1 1 
       409  2 2 4 1  19 ALA CA  D  19 ala CA  1 1 
       409  3 1 4 1  73 ALA CA  D  73 ala CA  1 1 
       409  3 2 4 1  74 MET CA  D  74 met CA  1 1 
       410  2 1 4 1  18 MET CA  D  18 met CA  1 1 
       410  2 2 4 1  19 ALA CB  D  19 ala CB  1 1 
       410  2 2 4 1  22 ALA CB  D  22 ala CB  1 1 
       410  3 1 4 1  81 ALA CB  D  81 ala CB  1 1 
       410  3 2 4 1  83 ARG CA  D  83 arg CA  1 1 
       411  2 1 4 1  18 MET CA  D  18 met CA  1 1 
       411  2 2 4 1  20 PHE C   D  20 phe C   1 1 
       411  3 1 4 1  70 ARG C   D  70 arg C   1 1 
       411  3 2 4 1  74 MET CA  D  74 met CA  1 1 
       411  4 1 4 1  80 SER C   D  80 ser C   1 1 
       411  4 1 4 1  85 VAL C   D  85 val C   1 1 
       411  4 2 4 1  83 ARG CA  D  83 arg CA  1 1 
       412  2 1 4 1  18 MET CA  D  18 met CA  1 1 
       412  2 2 4 1  20 PHE C   D  20 phe C   1 1 
       412  3 1 4 1  83 ARG CA  D  83 arg CA  1 1 
       412  3 2 4 1  85 VAL C   D  85 val C   1 1 
       413  1 1 4 1  18 MET CA  D  18 met CA  1 1 
       413  1 2 4 1  21 THR C   D  21 thr C   1 1 
       414  2 1 4 1  18 MET CB  D  18 met CB  1 1 
       414  2 2 4 1  19 ALA CA  D  19 ala CA  1 1 
       414  3 1 4 1  49 VAL CB  D  49 val CB  1 1 
       414  3 2 4 1  50 ALA CA  D  50 ala CA  1 1 
       414  4 1 4 1  72 VAL CB  D  72 val CB  1 1 
       414  4 2 4 1  73 ALA CA  D  73 ala CA  1 1 
       415  2 1 4 1  18 MET CB  D  18 met CB  1 1 
       415  2 2 4 1  19 ALA CA  D  19 ala CA  1 1 
       415  3 1 4 1 156 VAL CB  D 156 val CB  1 1 
       415  3 1 4 1 158 VAL CB  D 158 val CB  1 1 
       415  3 2 4 1 157 ALA CA  D 157 ala CA  1 1 
       416  2 1 4 1  18 MET CB  D  18 met CB  1 1 
       416  2 2 4 1  20 PHE CA  D  20 phe CA  1 1 
       416  3 1 4 1  52 PHE CA  D  52 phe CA  1 1 
       416  3 2 4 1  54 VAL CB  D  54 val CB  1 1 
       417  2 1 4 1  18 MET CB  D  18 met CB  1 1 
       417  2 2 4 1  21 THR C   D  21 thr C   1 1 
       417  3 1 4 1 121 PRO CB  D 121 pro CB  1 1 
       417  3 2 4 1 122 GLN C   D 122 gln C   1 1 
       418  1 1 4 1  18 MET CB  D  18 met CB  1 1 
       418  1 2 4 1  21 THR CG2 D  21 thr CG2 1 1 
       419  1 1 4 1  18 MET CG  D  18 met CG  1 1 
       419  1 2 4 1  19 ALA CB  D  19 ala CB  1 1 
       419  1 2 4 1  22 ALA CB  D  22 ala CB  1 1 
       420  1 1 4 1  19 ALA C   D  19 ala C   1 1 
       420  1 1 4 1  22 ALA C   D  22 ala C   1 1 
       420  1 2 4 1  23 LEU CD1 D  23 LEU CD* 1 1 
       420  1 2 4 1  23 LEU CD2 D  23 LEU CD* 1 1 
       421  2 1 4 1  19 ALA C   D  19 ala C   1 1 
       421  2 2 4 1  23 LEU CD1 D  23 LEU CD* 1 1 
       421  2 2 4 1  23 LEU CD2 D  23 LEU CD* 1 1 
       421  3 1 4 1 157 ALA C   D 157 ala C   1 1 
       421  3 2 4 1 158 VAL CG2 D 158 val CG2 1 1 
       422  1 1 4 1  19 ALA CA  D  19 ala CA  1 1 
       422  1 2 4 1  20 PHE CA  D  20 phe CA  1 1 
       423  2 1 4 1  19 ALA CA  D  19 ala CA  1 1 
       423  2 2 4 1  20 PHE CA  D  20 phe CA  1 1 
       423  3 1 4 1  79 TYR CA  D  79 tyr CA  1 1 
       423  3 2 4 1  81 ALA CA  D  81 ala CA  1 1 
       424  2 1 4 1  19 ALA CB  D  19 ala CB  1 1 
       424  2 1 4 1  22 ALA CB  D  22 ala CB  1 1 
       424  2 2 4 1  23 LEU CD1 D  23 LEU CD* 1 1 
       424  2 2 4 1  23 LEU CD2 D  23 LEU CD* 1 1 
       424  3 1 4 1 155 ILE CG2 D 155 ile CG2 1 1 
       424  3 2 4 1 156 VAL CG1 D 156 val CG1 1 1 
       424  3 2 4 1 158 VAL CG1 D 158 val CG1 1 1 
       425  2 1 4 1  20 PHE C   D  20 phe C   1 1 
       425  2 2 4 1  21 THR C   D  21 thr C   1 1 
       425  3 1 4 1  54 VAL C   D  54 val C   1 1 
       425  3 2 4 1  56 GLY C   D  56 gly C   1 1 
       426  2 1 4 1  20 PHE C   D  20 phe C   1 1 
       426  2 2 4 1  21 THR CB  D  21 thr CB  1 1 
       426  3 1 4 1  84 GLY C   D  84 gly C   1 1 
       426  3 1 4 1  85 VAL C   D  85 val C   1 1 
       426  3 2 4 1  88 THR CB  D  88 thr CB  1 1 
       427  2 1 4 1  20 PHE C   D  20 phe C   1 1 
       427  2 2 4 1  21 THR CG2 D  21 thr CG2 1 1 
       427  2 2 4 1  23 LEU CD1 D  23 LEU CD* 1 1 
       427  2 2 4 1  23 LEU CD2 D  23 LEU CD* 1 1 
       427  3 1 4 1 156 VAL C   D 156 val C   1 1 
       427  3 2 4 1 156 VAL CG1 D 156 val CG1 1 1 
       428  2 1 4 1  20 PHE C   D  20 phe C   1 1 
       428  2 2 4 1  21 THR CG2 D  21 thr CG2 1 1 
       428  3 1 4 1  54 VAL C   D  54 val C   1 1 
       428  3 2 4 1  54 VAL CG1 D  54 val CG1 1 1 
       428  4 1 4 1  93 MET C   D  93 met C   1 1 
       428  4 2 4 1  94 LEU CD1 D  94 LEU CD* 1 1 
       428  4 2 4 1  94 LEU CD2 D  94 LEU CD* 1 1 
       428  5 1 4 1 155 ILE C   D 155 ile C   1 1 
       428  5 2 4 1 156 VAL CG1 D 156 val CG1 1 1 
       429  2 1 4 1  20 PHE C   D  20 phe C   1 1 
       429  2 2 4 1  22 ALA C   D  22 ala C   1 1 
       429  3 1 4 1 156 VAL C   D 156 val C   1 1 
       429  3 2 4 1 157 ALA C   D 157 ala C   1 1 
       430  1 1 4 1  20 PHE CA  D  20 phe CA  1 1 
       430  1 2 4 1  21 THR CA  D  21 thr CA  1 1 
       431  2 1 4 1  20 PHE CA  D  20 phe CA  1 1 
       431  2 2 4 1  21 THR CA  D  21 thr CA  1 1 
       431  3 1 4 1  76 ILE CA  D  76 ile CA  1 1 
       431  3 2 4 1  79 TYR CA  D  79 tyr CA  1 1 
       432  2 1 4 1  20 PHE CA  D  20 phe CA  1 1 
       432  2 2 4 1  23 LEU CB  D  23 leu CB  1 1 
       432  3 1 4 1  51 LEU CB  D  51 leu CB  1 1 
       432  3 2 4 1  52 PHE CA  D  52 phe CA  1 1 
       433  1 1 4 1  21 THR C   D  21 thr C   1 1 
       433  1 2 4 1  22 ALA CA  D  22 ala CA  1 1 
       434  1 1 4 1  21 THR C   D  21 thr C   1 1 
       434  1 2 4 1  22 ALA CA  D  22 ala CA  1 1 
       434  1 2 4 1  24 ALA CA  D  24 ala CA  1 1 
       435  2 1 4 1  21 THR C   D  21 thr C   1 1 
       435  2 2 4 1  22 ALA CB  D  22 ala CB  1 1 
       435  3 1 4 1  56 GLY C   D  56 gly C   1 1 
       435  3 2 4 1  57 ALA CB  D  57 ala CB  1 1 
       435  3 2 4 1  58 ALA CB  D  58 ala CB  1 1 
       436  2 1 4 1  21 THR C   D  21 thr C   1 1 
       436  2 2 4 1  23 LEU CA  D  23 leu CA  1 1 
       436  3 1 4 1  55 LEU CA  D  55 leu CA  1 1 
       436  3 1 4 1  59 LEU CA  D  59 leu CA  1 1 
       436  3 2 4 1  56 GLY C   D  56 gly C   1 1 
       437  2 1 4 1  21 THR C   D  21 thr C   1 1 
       437  2 2 4 1  23 LEU CB  D  23 leu CB  1 1 
       437  3 1 4 1 104 CYS C   D 104 cys C   1 1 
       437  3 2 4 1 105 ASP CB  D 105 asp CB  1 1 
       438  1 1 4 1  21 THR C   D  21 thr C   1 1 
       438  1 2 4 1  26 GLU CA  D  26 glu CA  1 1 
       439  1 1 4 1  21 THR CA  D  21 thr CA  1 1 
       439  1 2 4 1  22 ALA CA  D  22 ala CA  1 1 
       440  2 1 4 1  21 THR CA  D  21 thr CA  1 1 
       440  2 2 4 1  23 LEU CB  D  23 leu CB  1 1 
       440  3 1 4 1 146 LEU CB  D 146 leu CB  1 1 
       440  3 2 4 1 149 ILE CA  D 149 ile CA  1 1 
       440  4 1 4 1 154 LEU CB  D 154 leu CB  1 1 
       440  4 2 4 1 155 ILE CA  D 155 ile CA  1 1 
       441  1 1 4 1  21 THR CB  D  21 thr CB  1 1 
       441  1 2 4 1  22 ALA C   D  22 ala C   1 1 
       442  2 1 4 1  21 THR CG2 D  21 thr CG2 1 1 
       442  2 2 4 1  22 ALA CB  D  22 ala CB  1 1 
       442  2 2 4 1  24 ALA CB  D  24 ala CB  1 1 
       442  3 1 4 1  54 VAL CG1 D  54 val CG1 1 1 
       442  3 2 4 1  57 ALA CB  D  57 ala CB  1 1 
       443  2 1 4 1  22 ALA C   D  22 ala C   1 1 
       443  2 2 4 1  23 LEU CD1 D  23 LEU CD* 1 1 
       443  2 2 4 1  23 LEU CD2 D  23 LEU CD* 1 1 
       443  3 1 4 1 157 ALA C   D 157 ala C   1 1 
       443  3 2 4 1 158 VAL CG2 D 158 val CG2 1 1 
       444  1 1 4 1  22 ALA CA  D  22 ala CA  1 1 
       444  1 2 4 1  25 LEU CB  D  25 leu CB  1 1 
       445  1 1 4 1  22 ALA CA  D  22 ala CA  1 1 
       445  1 2 4 1  26 GLU CA  D  26 glu CA  1 1 
       446  1 1 4 1  22 ALA CA  D  22 ala CA  1 1 
       446  1 2 4 1  26 GLU CB  D  26 glu CB  1 1 
       447  2 1 4 1  22 ALA CB  D  22 ala CB  1 1 
       447  2 1 4 1  24 ALA CB  D  24 ala CB  1 1 
       447  2 2 4 1  23 LEU CA  D  23 leu CA  1 1 
       447  3 1 4 1  58 ALA CB  D  58 ala CB  1 1 
       447  3 2 4 1  59 LEU CA  D  59 leu CA  1 1 
       448  1 1 4 1  22 ALA CB  D  22 ala CB  1 1 
       448  1 1 4 1  24 ALA CB  D  24 ala CB  1 1 
       448  1 2 4 1  26 GLU CA  D  26 glu CA  1 1 
       449  1 1 4 1  22 ALA CB  D  22 ala CB  1 1 
       449  1 1 4 1  24 ALA CB  D  24 ala CB  1 1 
       449  1 2 4 1  26 GLU CB  D  26 glu CB  1 1 
       450  1 1 4 1  22 ALA CB  D  22 ala CB  1 1 
       450  1 2 4 1  26 GLU CB  D  26 glu CB  1 1 
       451  2 1 4 1  23 LEU C   D  23 leu C   1 1 
       451  2 2 4 1  24 ALA CA  D  24 ala CA  1 1 
       451  3 1 4 1  55 LEU C   D  55 leu C   1 1 
       451  3 2 4 1  57 ALA CA  D  57 ala CA  1 1 
       452  2 1 4 1  23 LEU C   D  23 leu C   1 1 
       452  2 2 4 1  26 GLU CA  D  26 glu CA  1 1 
       452  3 1 4 1 145 TRP CA  D 145 trp CA  1 1 
       452  3 2 4 1 147 LEU C   D 147 leu C   1 1 
       453  1 1 4 1  23 LEU CA  D  23 leu CA  1 1 
       453  1 2 4 1  23 LEU CD1 D  23 LEU CD* 1 1 
       453  1 2 4 1  23 LEU CD2 D  23 LEU CD* 1 1 
       454  1 1 4 1  23 LEU CA  D  23 leu CA  1 1 
       454  1 1 4 1  25 LEU CA  D  25 leu CA  1 1 
       454  1 1 4 1  27 LEU CA  D  27 leu CA  1 1 
       454  1 2 4 1  26 GLU CB  D  26 glu CB  1 1 
       455  2 1 4 1  23 LEU CB  D  23 leu CB  1 1 
       455  2 2 4 1  24 ALA CA  D  24 ala CA  1 1 
       455  3 1 4 1  29 ALA CA  D  29 ala CA  1 1 
       455  3 2 4 1  30 LEU CB  D  30 leu CB  1 1 
       455  4 1 4 1  50 ALA CA  D  50 ala CA  1 1 
       455  4 2 4 1  51 LEU CB  D  51 leu CB  1 1 
       455  5 1 4 1 104 CYS CA  D 104 cys CA  1 1 
       455  5 2 4 1 105 ASP CB  D 105 asp CB  1 1 
       456  2 1 4 1  23 LEU CB  D  23 leu CB  1 1 
       456  2 2 4 1  24 ALA CA  D  24 ala CA  1 1 
       456  3 1 4 1  50 ALA CA  D  50 ala CA  1 1 
       456  3 2 4 1  51 LEU CB  D  51 leu CB  1 1 
       457  2 1 4 1  23 LEU CB  D  23 leu CB  1 1 
       457  2 1 4 1  27 LEU CB  D  27 leu CB  1 1 
       457  2 2 4 1  26 GLU CA  D  26 glu CA  1 1 
       457  3 1 4 1  48 ARG CA  D  48 arg CA  1 1 
       457  3 2 4 1  51 LEU CB  D  51 leu CB  1 1 
       457  4 1 4 1 145 TRP CA  D 145 trp CA  1 1 
       457  4 2 4 1 146 LEU CB  D 146 leu CB  1 1 
       458  2 1 4 1  23 LEU CB  D  23 leu CB  1 1 
       458  2 1 4 1  27 LEU CB  D  27 leu CB  1 1 
       458  2 2 4 1  26 GLU CA  D  26 glu CA  1 1 
       458  3 1 4 1  48 ARG CA  D  48 arg CA  1 1 
       458  3 2 4 1  51 LEU CB  D  51 leu CB  1 1 
       458  4 1 4 1 145 TRP CA  D 145 trp CA  1 1 
       458  4 2 4 1 146 LEU CB  D 146 leu CB  1 1 
       458  4 2 4 1 147 LEU CB  D 147 leu CB  1 1 
       459  1 1 4 1  24 ALA CA  D  24 ala CA  1 1 
       459  1 2 4 1  26 GLU C   D  26 glu C   1 1 
       460  1 1 4 1  25 LEU CB  D  25 leu CB  1 1 
       460  1 2 4 1  26 GLU C   D  26 glu C   1 1 
       461  2 1 4 1  25 LEU CB  D  25 leu CB  1 1 
       461  2 2 4 1  28 THR C   D  28 thr C   1 1 
       461  3 1 4 1  92 THR C   D  92 thr C   1 1 
       461  3 2 4 1  94 LEU CB  D  94 leu CB  1 1 
       462  1 1 4 1  26 GLU C   D  26 glu C   1 1 
       462  1 2 4 1  28 THR CA  D  28 thr CA  1 1 
       463  1 1 4 1  26 GLU C   D  26 glu C   1 1 
       463  1 2 4 1  28 THR CB  D  28 thr CB  1 1 
       464  1 1 4 1  26 GLU C   D  26 glu C   1 1 
       464  1 2 4 1  29 ALA CA  D  29 ala CA  1 1 
       465  2 1 4 1  26 GLU C   D  26 glu C   1 1 
       465  2 2 4 1  29 ALA CA  D  29 ala CA  1 1 
       465  3 1 4 1  47 GLU C   D  47 glu C   1 1 
       465  3 2 4 1  50 ALA CA  D  50 ala CA  1 1 
       466  2 1 4 1  26 GLU CA  D  26 glu CA  1 1 
       466  2 2 4 1  27 LEU CB  D  27 leu CB  1 1 
       466  3 1 4 1 145 TRP CA  D 145 trp CA  1 1 
       466  3 2 4 1 146 LEU CB  D 146 leu CB  1 1 
       467  1 1 4 1  26 GLU CB  D  26 glu CB  1 1 
       467  1 1 4 1  27 LEU CG  D  27 leu CG  1 1 
       467  1 2 4 1  28 THR C   D  28 thr C   1 1 
       468  1 1 4 1  26 GLU CB  D  26 glu CB  1 1 
       468  1 2 4 1  28 THR C   D  28 thr C   1 1 
       469  2 1 4 1  26 GLU CB  D  26 glu CB  1 1 
       469  2 2 4 1  28 THR C   D  28 thr C   1 1 
       469  3 1 4 1  92 THR C   D  92 thr C   1 1 
       469  3 2 4 1  95 GLN CB  D  95 gln CB  1 1 
       470  2 1 4 1  26 GLU CB  D  26 glu CB  1 1 
       470  2 2 4 1  29 ALA CB  D  29 ala CB  1 1 
       470  3 1 4 1  48 ARG CG  D  48 arg CG  1 1 
       470  3 2 4 1  50 ALA CB  D  50 ala CB  1 1 
       471  2 1 4 1  27 LEU CA  D  27 leu CA  1 1 
       471  2 1 4 1  30 LEU CA  D  30 leu CA  1 1 
       471  2 2 4 1  28 THR C   D  28 thr C   1 1 
       471  3 1 4 1  51 LEU CA  D  51 leu CA  1 1 
       471  3 1 4 1  55 LEU CA  D  55 leu CA  1 1 
       471  3 2 4 1  53 GLY C   D  53 gly C   1 1 
       471  4 1 4 1  91 HIS CA  D  91 his CA  1 1 
       471  4 1 4 1  94 LEU CA  D  94 leu CA  1 1 
       471  4 2 4 1  92 THR C   D  92 thr C   1 1 
       471  5 1 4 1 146 LEU CA  D 146 leu CA  1 1 
       471  5 1 4 1 147 LEU CA  D 147 leu CA  1 1 
       471  5 2 4 1 148 GLY C   D 148 gly C   1 1 
       472  1 1 4 1  27 LEU CB  D  27 leu CB  1 1 
       472  1 1 4 1  30 LEU CB  D  30 leu CB  1 1 
       472  1 2 4 1  28 THR C   D  28 thr C   1 1 
       473  2 1 4 1  27 LEU CB  D  27 leu CB  1 1 
       473  2 2 4 1  28 THR CA  D  28 thr CA  1 1 
       473  2 2 4 1  28 THR CB  D  28 thr CB  1 1 
       473  3 1 4 1 154 LEU CB  D 154 leu CB  1 1 
       473  3 2 4 1 155 ILE CA  D 155 ile CA  1 1 
       473  4 1 4 1 158 VAL CA  D 158 val CA  1 1 
       473  4 1 4 1 160 VAL CA  D 160 val CA  1 1 
       473  4 2 4 1 159 LEU CB  D 159 leu CB  1 1 
       474  2 1 4 1  27 LEU CB  D  27 leu CB  1 1 
       474  2 2 4 1  28 THR CA  D  28 thr CA  1 1 
       474  3 1 4 1  49 VAL CA  D  49 val CA  1 1 
       474  3 1 4 1  54 VAL CA  D  54 val CA  1 1 
       474  3 2 4 1  51 LEU CB  D  51 leu CB  1 1 
       474  4 1 4 1 147 LEU CB  D 147 leu CB  1 1 
       474  4 2 4 1 151 ILE CA  D 151 ile CA  1 1 
       474  5 1 4 1 159 LEU CB  D 159 leu CB  1 1 
       474  5 2 4 1 160 VAL CA  D 160 val CA  1 1 
       475  1 1 4 1  27 LEU CG  D  27 leu CG  1 1 
       475  1 2 4 1  28 THR C   D  28 thr C   1 1 
       476  2 1 4 1  27 LEU CG  D  27 leu CG  1 1 
       476  2 2 4 1  28 THR C   D  28 thr C   1 1 
       476  3 1 4 1  92 THR C   D  92 thr C   1 1 
       476  3 2 4 1  95 GLN CB  D  95 gln CB  1 1 
       477  1 1 4 1  27 LEU CG  D  27 leu CG  1 1 
       477  1 2 4 1  28 THR CA  D  28 thr CA  1 1 
       478  2 1 4 1  28 THR C   D  28 thr C   1 1 
       478  2 2 4 1  31 TRP CA  D  31 trp CA  1 1 
       478  3 1 4 1  34 HIS CA  D  34 his CA  1 1 
       478  3 2 4 1  36 MET C   D  36 met C   1 1 
       479  1 1 4 1  28 THR C   D  28 thr C   1 1 
       479  1 2 4 1  31 TRP CB  D  31 trp CB  1 1 
       480  2 1 4 1  28 THR CA  D  28 thr CA  1 1 
       480  2 1 4 1  28 THR CB  D  28 thr CB  1 1 
       480  2 2 4 1  29 ALA CA  D  29 ala CA  1 1 
       480  3 1 4 1  49 VAL CA  D  49 val CA  1 1 
       480  3 2 4 1  50 ALA CA  D  50 ala CA  1 1 
       481  2 1 4 1  28 THR CA  D  28 thr CA  1 1 
       481  2 2 4 1  29 ALA CA  D  29 ala CA  1 1 
       481  3 1 4 1  49 VAL CA  D  49 val CA  1 1 
       481  3 2 4 1  50 ALA CA  D  50 ala CA  1 1 
       481  4 1 4 1 151 ILE CA  D 151 ile CA  1 1 
       481  4 2 4 1 152 ALA CA  D 152 ala CA  1 1 
       482  1 1 4 1  28 THR CA  D  28 thr CA  1 1 
       482  1 2 4 1  30 LEU CD1 D  30 LEU CD* 1 1 
       482  1 2 4 1  30 LEU CD2 D  30 LEU CD* 1 1 
       483  1 1 4 1  28 THR CB  D  28 thr CB  1 1 
       483  1 2 4 1  29 ALA CA  D  29 ala CA  1 1 
       484  2 1 4 1  28 THR CG2 D  28 thr CG2 1 1 
       484  2 2 4 1  29 ALA CB  D  29 ala CB  1 1 
       484  3 1 4 1  49 VAL CG1 D  49 val CG1 1 1 
       484  3 2 4 1  50 ALA CB  D  50 ala CB  1 1 
       484  4 1 4 1  75 VAL CG1 D  75 val CG1 1 1 
       484  4 2 4 1  76 ILE CG2 D  76 ile CG2 1 1 
       485  1 1 4 1  29 ALA C   D  29 ala C   1 1 
       485  1 2 4 1  30 LEU CD1 D  30 LEU CD* 1 1 
       485  1 2 4 1  30 LEU CD2 D  30 LEU CD* 1 1 
       486  2 1 4 1  29 ALA C   D  29 ala C   1 1 
       486  2 2 4 1  30 LEU CD1 D  30 LEU CD* 1 1 
       486  2 2 4 1  30 LEU CD2 D  30 LEU CD* 1 1 
       486  3 1 4 1 157 ALA C   D 157 ala C   1 1 
       486  3 2 4 1 158 VAL CG2 D 158 val CG2 1 1 
       487  2 1 4 1  29 ALA CB  D  29 ala CB  1 1 
       487  2 2 4 1  30 LEU CA  D  30 leu CA  1 1 
       487  3 1 4 1  50 ALA CB  D  50 ala CB  1 1 
       487  3 2 4 1  51 LEU CA  D  51 leu CA  1 1 
       488  1 1 4 1  30 LEU CA  D  30 leu CA  1 1 
       488  1 2 4 1  30 LEU CD1 D  30 LEU CD* 1 1 
       488  1 2 4 1  30 LEU CD2 D  30 LEU CD* 1 1 
       489  1 1 4 1  30 LEU CB  D  30 leu CB  1 1 
       489  1 2 4 1  31 TRP CA  D  31 trp CA  1 1 
       490  1 1 4 1  31 TRP CA  D  31 trp CA  1 1 
       490  1 2 4 1  32 PHE CA  D  32 phe CA  1 1 
       491  2 1 4 1  31 TRP CA  D  31 trp CA  1 1 
       491  2 2 4 1  32 PHE CA  D  32 phe CA  1 1 
       491  3 1 4 1  44 CYS CA  D  44 cys CA  1 1 
       491  3 1 4 1  46 TYR CA  D  46 tyr CA  1 1 
       491  3 1 4 1  47 GLU CA  D  47 glu CA  1 1 
       491  3 2 4 1  45 ILE CA  D  45 ile CA  1 1 
       491  4 1 4 1 122 GLN CA  D 122 gln CA  1 1 
       491  4 2 4 1 123 VAL CA  D 123 val CA  1 1 
       492  2 1 4 1  31 TRP CB  D  31 trp CB  1 1 
       492  2 2 4 1  32 PHE CB  D  32 phe CB  1 1 
       492  3 1 4 1  40 PRO CB  D  40 pro CB  1 1 
       492  3 2 4 1  44 CYS CB  D  44 cys CB  1 1 
       493  1 1 4 1  32 PHE CA  D  32 phe CA  1 1 
       493  1 2 4 1  35 VAL CB  D  35 val CB  1 1 
       494  2 1 4 1  32 PHE CB  D  32 phe CB  1 1 
       494  2 2 4 1  33 GLN C   D  33 gln C   1 1 
       494  3 1 4 1  81 ALA C   D  81 ala C   1 1 
       494  3 2 4 1  82 PHE CB  D  82 phe CB  1 1 
       494  4 1 4 1 149 ILE C   D 149 ile C   1 1 
       494  4 2 4 1 150 PHE CB  D 150 phe CB  1 1 
       495  1 1 4 1  32 PHE CB  D  32 phe CB  1 1 
       495  1 2 4 1  33 GLN CB  D  33 gln CB  1 1 
       496  2 1 4 1  33 GLN C   D  33 gln C   1 1 
       496  2 1 4 1  35 VAL C   D  35 val C   1 1 
       496  2 2 4 1  34 HIS CA  D  34 his CA  1 1 
       496  3 1 4 1  44 CYS CA  D  44 cys CA  1 1 
       496  3 1 4 1  47 GLU CA  D  47 glu CA  1 1 
       496  3 2 4 1  46 TYR C   D  46 tyr C   1 1 
       497  2 1 4 1  33 GLN C   D  33 gln C   1 1 
       497  2 1 4 1  35 VAL C   D  35 val C   1 1 
       497  2 2 4 1  36 MET CA  D  36 met CA  1 1 
       497  3 1 4 1  35 VAL C   D  35 val C   1 1 
       497  3 2 4 1  37 LEU CA  D  37 leu CA  1 1 
       498  2 1 4 1  33 GLN C   D  33 gln C   1 1 
       498  2 2 4 1  35 VAL CA  D  35 val CA  1 1 
       498  3 1 4 1  59 LEU C   D  59 leu C   1 1 
       498  3 2 4 1  60 ILE CA  D  60 ile CA  1 1 
       498  4 1 4 1 115 PRO CA  D 115 pro CA  1 1 
       498  4 2 4 1 117 ASP C   D 117 asp C   1 1 
       498  5 1 4 1 149 ILE C   D 149 ile C   1 1 
       498  5 1 4 1 151 ILE C   D 151 ile C   1 1 
       498  5 1 4 1 155 ILE C   D 155 ile C   1 1 
       498  5 2 4 1 153 TYR CA  D 153 tyr CA  1 1 
       499  2 1 4 1  33 GLN C   D  33 gln C   1 1 
       499  2 2 4 1  35 VAL CA  D  35 val CA  1 1 
       499  3 1 4 1  59 LEU C   D  59 leu C   1 1 
       499  3 2 4 1  60 ILE CA  D  60 ile CA  1 1 
       499  4 1 4 1 149 ILE C   D 149 ile C   1 1 
       499  4 1 4 1 151 ILE C   D 151 ile C   1 1 
       499  4 1 4 1 155 ILE C   D 155 ile C   1 1 
       499  4 2 4 1 153 TYR CA  D 153 tyr CA  1 1 
       500  2 1 4 1  33 GLN C   D  33 gln C   1 1 
       500  2 2 4 1  35 VAL CG2 D  35 val CG2 1 1 
       500  3 1 4 1  52 PHE C   D  52 phe C   1 1 
       500  3 2 4 1  54 VAL CG2 D  54 val CG2 1 1 
       500  4 1 4 1 120 VAL CG2 D 120 val CG2 1 1 
       500  4 1 4 1 123 VAL CG2 D 123 val CG2 1 1 
       500  4 2 4 1 121 PRO C   D 121 pro C   1 1 
       501  1 1 4 1  33 GLN CB  D  33 gln CB  1 1 
       501  1 2 4 1  34 HIS CB  D  34 his CB  1 1 
       502  2 1 4 1  33 GLN CB  D  33 gln CB  1 1 
       502  2 2 4 1  36 MET CA  D  36 met CA  1 1 
       502  3 1 4 1  48 ARG CB  D  48 arg CB  1 1 
       502  3 2 4 1  50 ALA CA  D  50 ala CA  1 1 
       503  2 1 4 1  33 GLN CB  D  33 gln CB  1 1 
       503  2 2 4 1  36 MET CA  D  36 met CA  1 1 
       503  3 1 4 1  48 ARG CB  D  48 arg CB  1 1 
       503  3 2 4 1  50 ALA CA  D  50 ala CA  1 1 
       503  4 1 4 1  57 ALA CA  D  57 ala CA  1 1 
       503  4 2 4 1  60 ILE CG1 D  60 ile CG1 1 1 
       504  1 1 4 1  34 HIS CA  D  34 his CA  1 1 
       504  1 2 4 1  35 VAL CA  D  35 val CA  1 1 
       505  1 1 4 1  34 HIS CB  D  34 his CB  1 1 
       505  1 2 4 1  36 MET C   D  36 met C   1 1 
       506  2 1 4 1  35 VAL C   D  35 val C   1 1 
       506  2 2 4 1  36 MET C   D  36 met C   1 1 
       506  3 1 4 1  80 SER C   D  80 ser C   1 1 
       506  3 2 4 1  81 ALA C   D  81 ala C   1 1 
       506  4 1 4 1  92 THR C   D  92 thr C   1 1 
       506  4 2 4 1  93 MET C   D  93 met C   1 1 
       506  5 1 4 1 148 GLY C   D 148 gly C   1 1 
       506  5 2 4 1 149 ILE C   D 149 ile C   1 1 
       507  2 1 4 1  35 VAL CA  D  35 val CA  1 1 
       507  2 2 4 1  36 MET CA  D  36 met CA  1 1 
       507  3 1 4 1 152 ALA CA  D 152 ala CA  1 1 
       507  3 2 4 1 153 TYR CA  D 153 tyr CA  1 1 
       508  2 1 4 1  35 VAL CB  D  35 val CB  1 1 
       508  2 2 4 1  36 MET CA  D  36 met CA  1 1 
       508  3 1 4 1  49 VAL CB  D  49 val CB  1 1 
       508  3 2 4 1  50 ALA CA  D  50 ala CA  1 1 
       508  4 1 4 1  72 VAL CB  D  72 val CB  1 1 
       508  4 2 4 1  73 ALA CA  D  73 ala CA  1 1 
       509  1 1 4 1  38 LEU C   D  38 leu C   1 1 
       509  1 2 4 1  39 LYS CA  D  39 lys CA  1 1 
       510  2 1 4 1  38 LEU C   D  38 leu C   1 1 
       510  2 2 4 1  39 LYS CA  D  39 lys CA  1 1 
       510  3 1 4 1 103 THR C   D 103 thr C   1 1 
       510  3 2 4 1 105 ASP CA  D 105 asp CA  1 1 
       511  1 1 4 1  38 LEU C   D  38 leu C   1 1 
       511  1 2 4 1  40 PRO CD  D  40 pro CD  1 1 
       512  2 1 4 1  39 LYS CA  D  39 lys CA  1 1 
       512  2 2 4 1  40 PRO CB  D  40 pro CB  1 1 
       512  3 1 4 1  62 ALA CA  D  62 ala CA  1 1 
       512  3 1 4 1  64 ALA CA  D  64 ala CA  1 1 
       512  3 2 4 1  63 ILE CB  D  63 ile CB  1 1 
       513  1 1 4 1  39 LYS CA  D  39 lys CA  1 1 
       513  1 2 4 1  40 PRO CD  D  40 pro CD  1 1 
       514  2 1 4 1  39 LYS CA  D  39 lys CA  1 1 
       514  2 2 4 1  40 PRO CD  D  40 pro CD  1 1 
       514  3 1 4 1  62 ALA CA  D  62 ala CA  1 1 
       514  3 1 4 1  64 ALA CA  D  64 ala CA  1 1 
       514  3 2 4 1  65 PRO CD  D  65 pro CD  1 1 
       515  2 1 4 1  39 LYS CA  D  39 lys CA  1 1 
       515  2 2 4 1  40 PRO CD  D  40 pro CD  1 1 
       515  3 1 4 1  64 ALA CA  D  64 ala CA  1 1 
       515  3 2 4 1  65 PRO CD  D  65 pro CD  1 1 
       516  2 1 4 1  40 PRO CA  D  40 pro CA  1 1 
       516  2 2 4 1  42 VAL CA  D  42 val CA  1 1 
       516  3 1 4 1  48 ARG CA  D  48 arg CA  1 1 
       516  3 2 4 1  49 VAL CA  D  49 val CA  1 1 
       516  4 1 4 1  83 ARG CA  D  83 arg CA  1 1 
       516  4 2 4 1  85 VAL CA  D  85 val CA  1 1 
       517  2 1 4 1  40 PRO CB  D  40 pro CB  1 1 
       517  2 2 4 1  44 CYS CB  D  44 cys CB  1 1 
       517  3 1 4 1  82 PHE CB  D  82 phe CB  1 1 
       517  3 2 4 1  83 ARG CG  D  83 arg CG  1 1 
       518  2 1 4 1  43 LEU C   D  43 leu C   1 1 
       518  2 1 4 1  45 ILE C   D  45 ile C   1 1 
       518  2 2 4 1  44 CYS CA  D  44 cys CA  1 1 
       518  2 2 4 1  46 TYR CA  D  46 tyr CA  1 1 
       518  3 1 4 1  45 ILE C   D  45 ile C   1 1 
       518  3 2 4 1  47 GLU CA  D  47 glu CA  1 1 
       518  4 1 4 1  76 ILE C   D  76 ile C   1 1 
       518  4 1 4 1  78 LEU C   D  78 leu C   1 1 
       518  4 2 4 1  77 TRP CA  D  77 trp CA  1 1 
       518  5 1 4 1 120 VAL CA  D 120 val CA  1 1 
       518  5 1 4 1 122 GLN CA  D 122 gln CA  1 1 
       518  5 2 4 1 121 PRO C   D 121 pro C   1 1 
       519  1 1 4 1  43 LEU CA  D  43 leu CA  1 1 
       519  1 2 4 1  44 CYS C   D  44 cys C   1 1 
       520  2 1 4 1  43 LEU CA  D  43 leu CA  1 1 
       520  2 2 4 1  44 CYS CB  D  44 cys CB  1 1 
       520  3 1 4 1  65 PRO CG  D  65 pro CG  1 1 
       520  3 2 4 1  66 LYS CA  D  66 lys CA  1 1 
       520  4 1 4 1  94 LEU CA  D  94 leu CA  1 1 
       520  4 2 4 1  95 GLN CB  D  95 gln CB  1 1 
       521  1 1 4 1  43 LEU CA  D  43 leu CA  1 1 
       521  1 2 4 1  45 ILE C   D  45 ile C   1 1 
       522  2 1 4 1  44 CYS C   D  44 cys C   1 1 
       522  2 2 4 1  45 ILE C   D  45 ile C   1 1 
       522  2 2 4 1  46 TYR C   D  46 tyr C   1 1 
       522  3 1 4 1  52 PHE C   D  52 phe C   1 1 
       522  3 2 4 1  54 VAL C   D  54 val C   1 1 
       522  4 1 4 1  74 MET C   D  74 met C   1 1 
       522  4 1 4 1  77 TRP C   D  77 trp C   1 1 
       522  4 2 4 1  76 ILE C   D  76 ile C   1 1 
       522  5 1 4 1 150 PHE C   D 150 phe C   1 1 
       522  5 1 4 1 152 ALA C   D 152 ala C   1 1 
       522  5 2 4 1 151 ILE C   D 151 ile C   1 1 
       522  6 1 4 1 155 ILE C   D 155 ile C   1 1 
       522  6 1 4 1 158 VAL C   D 158 val C   1 1 
       522  6 2 4 1 157 ALA C   D 157 ala C   1 1 
       523  1 1 4 1  44 CYS C   D  44 cys C   1 1 
       523  1 2 4 1  45 ILE CG1 D  45 ile CG1 1 1 
       524  2 1 4 1  44 CYS C   D  44 cys C   1 1 
       524  2 2 4 1  45 ILE CG2 D  45 ile CG2 1 1 
       524  3 1 4 1  73 ALA CB  D  73 ala CB  1 1 
       524  3 2 4 1  74 MET C   D  74 met C   1 1 
       524  4 1 4 1 102 ALA C   D 102 ala C   1 1 
       524  4 2 4 1 103 THR CG2 D 103 thr CG2 1 1 
       525  2 1 4 1  44 CYS C   D  44 cys C   1 1 
       525  2 2 4 1  48 ARG CA  D  48 arg CA  1 1 
       525  3 1 4 1  67 THR CA  D  67 thr CA  1 1 
       525  3 2 4 1  68 PRO C   D  68 pro C   1 1 
       525  3 2 4 1  69 LEU C   D  69 leu C   1 1 
       526  1 1 4 1  44 CYS CA  D  44 cys CA  1 1 
       526  1 1 4 1  46 TYR CA  D  46 tyr CA  1 1 
       526  1 1 4 1  47 GLU CA  D  47 glu CA  1 1 
       526  1 2 4 1  45 ILE CA  D  45 ile CA  1 1 
       527  1 1 4 1  44 CYS CA  D  44 cys CA  1 1 
       527  1 1 4 1  46 TYR CA  D  46 tyr CA  1 1 
       527  1 2 4 1  45 ILE CB  D  45 ile CB  1 1 
       528  1 1 4 1  44 CYS CB  D  44 cys CB  1 1 
       528  1 1 4 1  48 ARG CG  D  48 arg CG  1 1 
       528  1 2 4 1  45 ILE C   D  45 ile C   1 1 
       529  1 1 4 1  44 CYS CB  D  44 cys CB  1 1 
       529  1 2 4 1  45 ILE CA  D  45 ile CA  1 1 
       530  1 1 4 1  44 CYS CB  D  44 cys CB  1 1 
       530  1 2 4 1  45 ILE CB  D  45 ile CB  1 1 
       531  1 1 4 1  44 CYS CB  D  44 cys CB  1 1 
       531  1 1 4 1  48 ARG CG  D  48 arg CG  1 1 
       531  1 2 4 1  45 ILE CB  D  45 ile CB  1 1 
       532  2 1 4 1  45 ILE C   D  45 ile C   1 1 
       532  2 1 4 1  46 TYR C   D  46 tyr C   1 1 
       532  2 2 4 1  48 ARG CB  D  48 arg CB  1 1 
       532  3 1 4 1  76 ILE C   D  76 ile C   1 1 
       532  3 2 4 1  77 TRP CB  D  77 trp CB  1 1 
       532  4 1 4 1 150 PHE C   D 150 phe C   1 1 
       532  4 2 4 1 151 ILE CG1 D 151 ile CG1 1 1 
       533  2 1 4 1  45 ILE C   D  45 ile C   1 1 
       533  2 1 4 1  46 TYR C   D  46 tyr C   1 1 
       533  2 2 4 1  48 ARG CB  D  48 arg CB  1 1 
       533  3 1 4 1 150 PHE C   D 150 phe C   1 1 
       533  3 2 4 1 151 ILE CG1 D 151 ile CG1 1 1 
       534  1 1 4 1  45 ILE C   D  45 ile C   1 1 
       534  1 2 4 1  48 ARG CB  D  48 arg CB  1 1 
       535  2 1 4 1  45 ILE C   D  45 ile C   1 1 
       535  2 2 4 1  48 ARG CB  D  48 arg CB  1 1 
       535  3 1 4 1 147 LEU C   D 147 leu C   1 1 
       535  3 2 4 1 149 ILE CG1 D 149 ile CG1 1 1 
       536  1 1 4 1  45 ILE C   D  45 ile C   1 1 
       536  1 2 4 1  48 ARG CD  D  48 arg CD  1 1 
       537  1 1 4 1  45 ILE CA  D  45 ile CA  1 1 
       537  1 2 4 1  45 ILE CD1 D  45 ile CD1 1 1 
       538  1 1 4 1  45 ILE CA  D  45 ile CA  1 1 
       538  1 2 4 1  47 GLU C   D  47 glu C   1 1 
       539  1 1 4 1  45 ILE CA  D  45 ile CA  1 1 
       539  1 2 4 1  48 ARG CD  D  48 arg CD  1 1 
       540  2 1 4 1  45 ILE CA  D  45 ile CA  1 1 
       540  2 1 4 1  52 PHE CA  D  52 phe CA  1 1 
       540  2 2 4 1  49 VAL CA  D  49 val CA  1 1 
       540  3 1 4 1  92 THR CA  D  92 thr CA  1 1 
       540  3 2 4 1  93 MET CA  D  93 met CA  1 1 
       541  1 1 4 1  45 ILE CB  D  45 ile CB  1 1 
       541  1 2 4 1  47 GLU C   D  47 glu C   1 1 
       542  1 1 4 1  45 ILE CB  D  45 ile CB  1 1 
       542  1 2 4 1  48 ARG CA  D  48 arg CA  1 1 
       543  1 1 4 1  45 ILE CB  D  45 ile CB  1 1 
       543  1 2 4 1  48 ARG CB  D  48 arg CB  1 1 
       544  1 1 4 1  45 ILE CG1 D  45 ile CG1 1 1 
       544  1 2 4 1  48 ARG CB  D  48 arg CB  1 1 
       545  1 1 4 1  45 ILE CG2 D  45 ile CG2 1 1 
       545  1 2 4 1  48 ARG CB  D  48 arg CB  1 1 
       546  1 1 4 1  46 TYR C   D  46 tyr C   1 1 
       546  1 2 4 1  47 GLU C   D  47 glu C   1 1 
       547  1 1 4 1  46 TYR C   D  46 tyr C   1 1 
       547  1 1 4 1  49 VAL C   D  49 val C   1 1 
       547  1 2 4 1  50 ALA CB  D  50 ala CB  1 1 
       548  1 1 4 1  46 TYR CA  D  46 tyr CA  1 1 
       548  1 1 4 1  47 GLU CA  D  47 glu CA  1 1 
       548  1 2 4 1  49 VAL CA  D  49 val CA  1 1 
       549  1 1 4 1  47 GLU C   D  47 glu C   1 1 
       549  1 2 4 1  48 ARG CA  D  48 arg CA  1 1 
       550  1 1 4 1  47 GLU C   D  47 glu C   1 1 
       550  1 2 4 1  49 VAL CA  D  49 val CA  1 1 
       551  2 1 4 1  47 GLU CA  D  47 glu CA  1 1 
       551  2 2 4 1  48 ARG CB  D  48 arg CB  1 1 
       551  3 1 4 1  77 TRP CB  D  77 trp CB  1 1 
       551  3 2 4 1  78 LEU CA  D  78 leu CA  1 1 
       552  1 1 4 1  48 ARG CA  D  48 arg CA  1 1 
       552  1 2 4 1  48 ARG CD  D  48 arg CD  1 1 
       553  1 1 4 1  48 ARG CA  D  48 arg CA  1 1 
       553  1 2 4 1  49 VAL CB  D  49 val CB  1 1 
       554  2 1 4 1  48 ARG CA  D  48 arg CA  1 1 
       554  2 2 4 1  50 ALA CA  D  50 ala CA  1 1 
       554  3 1 4 1 103 THR CA  D 103 thr CA  1 1 
       554  3 2 4 1 104 CYS CA  D 104 cys CA  1 1 
       555  2 1 4 1  48 ARG CB  D  48 arg CB  1 1 
       555  2 2 4 1  49 VAL C   D  49 val C   1 1 
       555  3 1 4 1 151 ILE C   D 151 ile C   1 1 
       555  3 2 4 1 151 ILE CG1 D 151 ile CG1 1 1 
       556  1 1 4 1  48 ARG CD  D  48 arg CD  1 1 
       556  1 2 4 1  49 VAL CB  D  49 val CB  1 1 
       557  2 1 4 1  49 VAL CA  D  49 val CA  1 1 
       557  2 2 4 1  50 ALA CA  D  50 ala CA  1 1 
       557  3 1 4 1  54 VAL CA  D  54 val CA  1 1 
       557  3 2 4 1  57 ALA CA  D  57 ala CA  1 1 
       558  2 1 4 1  50 ALA CA  D  50 ala CA  1 1 
       558  2 2 4 1  53 GLY CA  D  53 gly CA  1 1 
       558  3 1 4 1 148 GLY CA  D 148 gly CA  1 1 
       558  3 2 4 1 152 ALA CA  D 152 ala CA  1 1 
       559  2 1 4 1  51 LEU C   D  51 leu C   1 1 
       559  2 2 4 1  53 GLY CA  D  53 gly CA  1 1 
       559  3 1 4 1  55 LEU C   D  55 leu C   1 1 
       559  3 2 4 1  56 GLY CA  D  56 gly CA  1 1 
       559  4 1 4 1 147 LEU C   D 147 leu C   1 1 
       559  4 1 4 1 149 ILE C   D 149 ile C   1 1 
       559  4 2 4 1 148 GLY CA  D 148 gly CA  1 1 
       560  2 1 4 1  51 LEU CB  D  51 leu CB  1 1 
       560  2 2 4 1  52 PHE CA  D  52 phe CA  1 1 
       560  3 1 4 1 115 PRO CA  D 115 pro CA  1 1 
       560  3 2 4 1 116 LEU CB  D 116 leu CB  1 1 
       561  1 1 4 1  52 PHE CA  D  52 phe CA  1 1 
       561  1 2 4 1  53 GLY CA  D  53 gly CA  1 1 
       562  1 1 4 1  52 PHE CA  D  52 phe CA  1 1 
       562  1 2 4 1  54 VAL CA  D  54 val CA  1 1 
       563  2 1 4 1  52 PHE CA  D  52 phe CA  1 1 
       563  2 2 4 1  54 VAL CA  D  54 val CA  1 1 
       563  3 1 4 1  92 THR CA  D  92 thr CA  1 1 
       563  3 2 4 1  93 MET CA  D  93 met CA  1 1 
       564  2 1 4 1  53 GLY C   D  53 gly C   1 1 
       564  2 2 4 1  54 VAL C   D  54 val C   1 1 
       564  3 1 4 1 102 ALA C   D 102 ala C   1 1 
       564  3 2 4 1 103 THR C   D 103 thr C   1 1 
       565  1 1 4 1  53 GLY C   D  53 gly C   1 1 
       565  1 2 4 1  54 VAL CG2 D  54 val CG2 1 1 
       566  1 1 4 1  53 GLY CA  D  53 gly CA  1 1 
       566  1 1 4 1  56 GLY CA  D  56 gly CA  1 1 
       566  1 2 4 1  54 VAL CA  D  54 val CA  1 1 
       567  1 1 4 1  53 GLY CA  D  53 gly CA  1 1 
       567  1 2 4 1  54 VAL CB  D  54 val CB  1 1 
       568  2 1 4 1  54 VAL C   D  54 val C   1 1 
       568  2 2 4 1  57 ALA CB  D  57 ala CB  1 1 
       568  3 1 4 1 151 ILE C   D 151 ile C   1 1 
       568  3 2 4 1 151 ILE CG2 D 151 ile CG2 1 1 
       568  3 2 4 1 152 ALA CB  D 152 ala CB  1 1 
       568  4 1 4 1 155 ILE C   D 155 ile C   1 1 
       568  4 2 4 1 155 ILE CG2 D 155 ile CG2 1 1 
       569  2 1 4 1  54 VAL CA  D  54 val CA  1 1 
       569  2 2 4 1  57 ALA CA  D  57 ala CA  1 1 
       569  3 1 4 1 155 ILE CA  D 155 ile CA  1 1 
       569  3 1 4 1 160 VAL CA  D 160 val CA  1 1 
       569  3 2 4 1 157 ALA CA  D 157 ala CA  1 1 
       570  1 1 4 1  54 VAL CB  D  54 val CB  1 1 
       570  1 2 4 1  55 LEU CB  D  55 leu CB  1 1 
       571  1 1 4 1  54 VAL CG1 D  54 val CG1 1 1 
       571  1 2 4 1  57 ALA CB  D  57 ala CB  1 1 
       572  2 1 4 1  54 VAL CG2 D  54 val CG2 1 1 
       572  2 2 4 1  56 GLY C   D  56 gly C   1 1 
       572  3 1 4 1 120 VAL CG2 D 120 val CG2 1 1 
       572  3 2 4 1 122 GLN C   D 122 gln C   1 1 
       573  1 1 4 1  54 VAL CG2 D  54 val CG2 1 1 
       573  1 2 4 1  57 ALA CB  D  57 ala CB  1 1 
       574  1 1 4 1  55 LEU C   D  55 leu C   1 1 
       574  1 2 4 1  56 GLY CA  D  56 gly CA  1 1 
       575  1 1 4 1  55 LEU CB  D  55 leu CB  1 1 
       575  1 2 4 1  56 GLY CA  D  56 gly CA  1 1 
       576  2 1 4 1  56 GLY C   D  56 gly C   1 1 
       576  2 2 4 1  57 ALA C   D  57 ala C   1 1 
       576  2 2 4 1  58 ALA C   D  58 ala C   1 1 
       576  3 1 4 1 121 PRO C   D 121 pro C   1 1 
       576  3 2 4 1 122 GLN C   D 122 gln C   1 1 
       577  1 1 4 1  56 GLY C   D  56 gly C   1 1 
       577  1 2 4 1  60 ILE CA  D  60 ile CA  1 1 
       578  1 1 4 1  56 GLY CA  D  56 gly CA  1 1 
       578  1 2 4 1  57 ALA CA  D  57 ala CA  1 1 
       579  1 1 4 1  56 GLY CA  D  56 gly CA  1 1 
       579  1 2 4 1  58 ALA CA  D  58 ala CA  1 1 
       580  1 1 4 1  56 GLY CA  D  56 gly CA  1 1 
       580  1 2 4 1  59 LEU CB  D  59 leu CB  1 1 
       581  1 1 4 1  56 GLY CA  D  56 gly CA  1 1 
       581  1 2 4 1  60 ILE C   D  60 ile C   1 1 
       582  2 1 4 1  56 GLY CA  D  56 gly CA  1 1 
       582  2 2 4 1  60 ILE CB  D  60 ile CB  1 1 
       582  3 1 4 1 148 GLY CA  D 148 gly CA  1 1 
       582  3 2 4 1 151 ILE CB  D 151 ile CB  1 1 
       583  2 1 4 1  57 ALA CA  D  57 ala CA  1 1 
       583  2 2 4 1  60 ILE CB  D  60 ile CB  1 1 
       583  3 1 4 1 151 ILE CB  D 151 ile CB  1 1 
       583  3 2 4 1 152 ALA CA  D 152 ala CA  1 1 
       584  1 1 4 1  57 ALA CA  D  57 ala CA  1 1 
       584  1 2 4 1  61 GLY CA  D  61 gly CA  1 1 
       585  2 1 4 1  59 LEU C   D  59 leu C   1 1 
       585  2 2 4 1  60 ILE CA  D  60 ile CA  1 1 
       585  3 1 4 1 149 ILE C   D 149 ile C   1 1 
       585  3 2 4 1 153 TYR CA  D 153 tyr CA  1 1 
       586  1 1 4 1  59 LEU C   D  59 leu C   1 1 
       586  1 2 4 1  60 ILE CG1 D  60 ile CG1 1 1 
       587  1 1 4 1  59 LEU C   D  59 leu C   1 1 
       587  1 2 4 1  61 GLY CA  D  61 gly CA  1 1 
       588  2 1 4 1  59 LEU C   D  59 leu C   1 1 
       588  2 2 4 1  61 GLY CA  D  61 gly CA  1 1 
       588  3 1 4 1  84 GLY CA  D  84 gly CA  1 1 
       588  3 2 4 1  87 LEU C   D  87 leu C   1 1 
       589  1 1 4 1  59 LEU C   D  59 leu C   1 1 
       589  1 2 4 1  62 ALA CA  D  62 ala CA  1 1 
       590  1 1 4 1  59 LEU CA  D  59 leu CA  1 1 
       590  1 2 4 1  61 GLY C   D  61 gly C   1 1 
       591  1 1 4 1  59 LEU CA  D  59 leu CA  1 1 
       591  1 2 4 1  62 ALA CB  D  62 ala CB  1 1 
       592  1 1 4 1  59 LEU CB  D  59 leu CB  1 1 
       592  1 2 4 1  60 ILE CB  D  60 ile CB  1 1 
       593  1 1 4 1  60 ILE C   D  60 ile C   1 1 
       593  1 2 4 1  60 ILE CG1 D  60 ile CG1 1 1 
       594  1 1 4 1  60 ILE C   D  60 ile C   1 1 
       594  1 2 4 1  61 GLY C   D  61 gly C   1 1 
       595  1 1 4 1  60 ILE C   D  60 ile C   1 1 
       595  1 2 4 1  62 ALA CA  D  62 ala CA  1 1 
       596  1 1 4 1  60 ILE C   D  60 ile C   1 1 
       596  1 2 4 1  63 ILE CG1 D  63 ile CG1 1 1 
       597  2 1 4 1  60 ILE CA  D  60 ile CA  1 1 
       597  2 1 4 1  65 PRO CA  D  65 pro CA  1 1 
       597  2 2 4 1  62 ALA C   D  62 ala C   1 1 
       597  3 1 4 1  85 VAL C   D  85 val C   1 1 
       597  3 2 4 1  88 THR CA  D  88 thr CA  1 1 
       598  1 1 4 1  60 ILE CB  D  60 ile CB  1 1 
       598  1 2 4 1  61 GLY CA  D  61 gly CA  1 1 
       599  1 1 4 1  60 ILE CD1 D  60 ile CD1 1 1 
       599  1 2 4 1  60 ILE CG2 D  60 ile CG2 1 1 
       600  1 1 4 1  60 ILE CG1 D  60 ile CG1 1 1 
       600  1 2 4 1  61 GLY C   D  61 gly C   1 1 
       601  2 1 4 1  60 ILE CG2 D  60 ile CG2 1 1 
       601  2 1 4 1  63 ILE CG2 D  63 ile CG2 1 1 
       601  2 2 4 1  61 GLY C   D  61 gly C   1 1 
       601  3 1 4 1 124 PHE C   D 124 phe C   1 1 
       601  3 2 4 1 126 ALA CB  D 126 ala CB  1 1 
       602  2 1 4 1  61 GLY C   D  61 gly C   1 1 
       602  2 2 4 1  62 ALA C   D  62 ala C   1 1 
       602  3 1 4 1 124 PHE C   D 124 phe C   1 1 
       602  3 2 4 1 125 VAL C   D 125 val C   1 1 
       603  1 1 4 1  61 GLY C   D  61 gly C   1 1 
       603  1 2 4 1  62 ALA CB  D  62 ala CB  1 1 
       604  1 1 4 1  61 GLY C   D  61 gly C   1 1 
       604  1 2 4 1  63 ILE CA  D  63 ile CA  1 1 
       605  1 1 4 1  61 GLY CA  D  61 gly CA  1 1 
       605  1 2 4 1  62 ALA CA  D  62 ala CA  1 1 
       606  2 1 4 1  62 ALA C   D  62 ala C   1 1 
       606  2 2 4 1  63 ILE CA  D  63 ile CA  1 1 
       606  3 1 4 1 155 ILE CA  D 155 ile CA  1 1 
       606  3 2 4 1 156 VAL C   D 156 val C   1 1 
       607  2 1 4 1  62 ALA C   D  62 ala C   1 1 
       607  2 2 4 1  63 ILE CG1 D  63 ile CG1 1 1 
       607  3 1 4 1  68 PRO CG  D  68 pro CG  1 1 
       607  3 2 4 1  70 ARG C   D  70 arg C   1 1 
       607  4 1 4 1  85 VAL C   D  85 val C   1 1 
       607  4 2 4 1  86 GLN CB  D  86 gln CB  1 1 
       608  1 1 4 1  62 ALA CA  D  62 ala CA  1 1 
       608  1 2 4 1  63 ILE CG1 D  63 ile CG1 1 1 
       609  1 1 4 1  63 ILE CA  D  63 ile CA  1 1 
       609  1 2 4 1  65 PRO CD  D  65 pro CD  1 1 
       610  1 1 4 1  63 ILE CD1 D  63 ile CD1 1 1 
       610  1 2 4 1  63 ILE CG2 D  63 ile CG2 1 1 
       611  1 1 4 1  64 ALA CA  D  64 ala CA  1 1 
       611  1 2 4 1  66 LYS CA  D  66 lys CA  1 1 
       612  1 1 4 1  65 PRO CA  D  65 pro CA  1 1 
       612  1 2 4 1  66 LYS CA  D  66 lys CA  1 1 
       613  1 1 4 1  65 PRO CA  D  65 pro CA  1 1 
       613  1 2 4 1  68 PRO CA  D  68 pro CA  1 1 
       614  2 1 4 1  65 PRO CA  D  65 pro CA  1 1 
       614  2 2 4 1  68 PRO CB  D  68 pro CB  1 1 
       614  3 1 4 1 153 TYR CA  D 153 tyr CA  1 1 
       614  3 2 4 1 156 VAL CB  D 156 val CB  1 1 
       615  1 1 4 1  65 PRO CD  D  65 pro CD  1 1 
       615  1 2 4 1  68 PRO CD  D  68 pro CD  1 1 
       616  2 1 4 1  66 LYS CA  D  66 lys CA  1 1 
       616  2 2 4 1  67 THR CA  D  67 thr CA  1 1 
       616  3 1 4 1  71 TYR CA  D  71 tyr CA  1 1 
       616  3 2 4 1  74 MET CA  D  74 met CA  1 1 
       617  2 1 4 1  66 LYS CA  D  66 lys CA  1 1 
       617  2 2 4 1  68 PRO CA  D  68 pro CA  1 1 
       617  3 1 4 1 142 MET CA  D 142 met CA  1 1 
       617  3 2 4 1 143 PRO CA  D 143 pro CA  1 1 
       618  2 1 4 1  66 LYS CA  D  66 lys CA  1 1 
       618  2 2 4 1  68 PRO CA  D  68 pro CA  1 1 
       618  3 1 4 1 142 MET CA  D 142 met CA  1 1 
       618  3 2 4 1 143 PRO CA  D 143 pro CA  1 1 
       618  4 1 4 1 150 PHE CA  D 150 phe CA  1 1 
       618  4 2 4 1 152 ALA CA  D 152 ala CA  1 1 
       619  1 1 4 1  66 LYS CE  D  66 lys CE  1 1 
       619  1 2 4 1  67 THR CA  D  67 thr CA  1 1 
       620  1 1 4 1  67 THR CA  D  67 thr CA  1 1 
       620  1 2 4 1  68 PRO CA  D  68 pro CA  1 1 
       621  2 1 4 1  67 THR CA  D  67 thr CA  1 1 
       621  2 2 4 1  68 PRO CA  D  68 pro CA  1 1 
       621  3 1 4 1 143 PRO CA  D 143 pro CA  1 1 
       621  3 2 4 1 145 TRP CA  D 145 trp CA  1 1 
       622  1 1 4 1  67 THR CA  D  67 thr CA  1 1 
       622  1 2 4 1  68 PRO CB  D  68 pro CB  1 1 
       623  2 1 4 1  68 PRO C   D  68 pro C   1 1 
       623  2 2 4 1  68 PRO CD  D  68 pro CD  1 1 
       623  3 1 4 1  96 LEU C   D  96 leu C   1 1 
       623  3 2 4 1  98 PRO CD  D  98 pro CD  1 1 
       624  2 1 4 1  68 PRO C   D  68 pro C   1 1 
       624  2 2 4 1  69 LEU CA  D  69 leu CA  1 1 
       624  2 2 4 1  70 ARG CA  D  70 arg CA  1 1 
       624  3 1 4 1  77 TRP C   D  77 trp C   1 1 
       624  3 2 4 1  78 LEU CA  D  78 leu CA  1 1 
       624  4 1 4 1  84 GLY C   D  84 gly C   1 1 
       624  4 2 4 1  87 LEU CA  D  87 leu CA  1 1 
       624  5 1 4 1 117 ASP C   D 117 asp C   1 1 
       624  5 1 4 1 119 TRP C   D 119 trp C   1 1 
       624  5 2 4 1 118 LYS CA  D 118 lys CA  1 1 
       624  6 1 4 1 154 LEU CA  D 154 leu CA  1 1 
       624  6 2 4 1 155 ILE C   D 155 ile C   1 1 
       624  7 1 4 1 158 VAL C   D 158 val C   1 1 
       624  7 1 4 1 160 VAL C   D 160 val C   1 1 
       624  7 2 4 1 159 LEU CA  D 159 leu CA  1 1 
       625  2 1 4 1  68 PRO C   D  68 pro C   1 1 
       625  2 1 4 1  70 ARG C   D  70 arg C   1 1 
       625  2 2 4 1  69 LEU CB  D  69 leu CB  1 1 
       625  3 1 4 1 103 THR C   D 103 thr C   1 1 
       625  3 2 4 1 104 CYS CB  D 104 cys CB  1 1 
       626  1 1 4 1  68 PRO C   D  68 pro C   1 1 
       626  1 1 4 1  70 ARG C   D  70 arg C   1 1 
       626  1 2 4 1  70 ARG CD  D  70 arg CD  1 1 
       627  1 1 4 1  68 PRO CA  D  68 pro CA  1 1 
       627  1 2 4 1  69 LEU CB  D  69 leu CB  1 1 
       628  2 1 4 1  68 PRO CA  D  68 pro CA  1 1 
       628  2 2 4 1  70 ARG C   D  70 arg C   1 1 
       628  3 1 4 1 158 VAL C   D 158 val C   1 1 
       628  3 1 4 1 161 VAL C   D 161 val C   1 1 
       628  3 2 4 1 162 ILE CA  D 162 ile CA  1 1 
       629  1 1 4 1  68 PRO CA  D  68 pro CA  1 1 
       629  1 2 4 1  70 ARG CG  D  70 arg CG  1 1 
       630  2 1 4 1  68 PRO CA  D  68 pro CA  1 1 
       630  2 2 4 1  71 TYR CA  D  71 tyr CA  1 1 
       630  3 1 4 1  97 TYR CA  D  97 tyr CA  1 1 
       630  3 2 4 1  98 PRO CA  D  98 pro CA  1 1 
       631  1 1 4 1  68 PRO CB  D  68 pro CB  1 1 
       631  1 2 4 1  69 LEU CB  D  69 leu CB  1 1 
       632  1 1 4 1  68 PRO CB  D  68 pro CB  1 1 
       632  1 2 4 1  70 ARG C   D  70 arg C   1 1 
       633  2 1 4 1  68 PRO CB  D  68 pro CB  1 1 
       633  2 2 4 1  70 ARG C   D  70 arg C   1 1 
       633  3 1 4 1 151 ILE C   D 151 ile C   1 1 
       633  3 2 4 1 155 ILE CG1 D 155 ile CG1 1 1 
       634  1 1 4 1  68 PRO CB  D  68 pro CB  1 1 
       634  1 2 4 1  70 ARG CA  D  70 arg CA  1 1 
       635  2 1 4 1  69 LEU C   D  69 leu C   1 1 
       635  2 1 4 1  70 ARG C   D  70 arg C   1 1 
       635  2 2 4 1  70 ARG CG  D  70 arg CG  1 1 
       635  3 1 4 1 146 LEU C   D 146 leu C   1 1 
       635  3 2 4 1 147 LEU CG  D 147 leu CG  1 1 
       635  4 1 4 1 154 LEU C   D 154 leu C   1 1 
       635  4 2 4 1 154 LEU CG  D 154 leu CG  1 1 
       636  2 1 4 1  69 LEU C   D  69 leu C   1 1 
       636  2 2 4 1  71 TYR CA  D  71 tyr CA  1 1 
       636  3 1 4 1  96 LEU C   D  96 leu C   1 1 
       636  3 2 4 1  97 TYR CA  D  97 tyr CA  1 1 
       636  4 1 4 1 117 ASP C   D 117 asp C   1 1 
       636  4 2 4 1 118 LYS CA  D 118 lys CA  1 1 
       637  1 1 4 1  69 LEU CB  D  69 leu CB  1 1 
       637  1 2 4 1  70 ARG CA  D  70 arg CA  1 1 
       638  2 1 4 1  69 LEU CB  D  69 leu CB  1 1 
       638  2 2 4 1  71 TYR CA  D  71 tyr CA  1 1 
       638  3 1 4 1  91 HIS CA  D  91 his CA  1 1 
       638  3 2 4 1  94 LEU CB  D  94 leu CB  1 1 
       639  1 1 4 1  70 ARG C   D  70 arg C   1 1 
       639  1 2 4 1  70 ARG CD  D  70 arg CD  1 1 
       640  1 1 4 1  70 ARG C   D  70 arg C   1 1 
       640  1 2 4 1  70 ARG CG  D  70 arg CG  1 1 
       641  2 1 4 1  70 ARG C   D  70 arg C   1 1 
       641  2 2 4 1  72 VAL CB  D  72 val CB  1 1 
       641  3 1 4 1 154 LEU C   D 154 leu C   1 1 
       641  3 2 4 1 155 ILE CG1 D 155 ile CG1 1 1 
       641  3 2 4 1 156 VAL CB  D 156 val CB  1 1 
       641  3 2 4 1 158 VAL CB  D 158 val CB  1 1 
       642  1 1 4 1  70 ARG C   D  70 arg C   1 1 
       642  1 2 4 1  74 MET CA  D  74 met CA  1 1 
       643  1 1 4 1  70 ARG CA  D  70 arg CA  1 1 
       643  1 1 4 1  71 TYR CA  D  71 tyr CA  1 1 
       643  1 2 4 1  72 VAL CB  D  72 val CB  1 1 
       644  2 1 4 1  70 ARG CA  D  70 arg CA  1 1 
       644  2 1 4 1  71 TYR CA  D  71 tyr CA  1 1 
       644  2 2 4 1  74 MET CB  D  74 met CB  1 1 
       644  3 1 4 1  91 HIS CA  D  91 his CA  1 1 
       644  3 2 4 1  93 MET CB  D  93 met CB  1 1 
       645  2 1 4 1  70 ARG CA  D  70 arg CA  1 1 
       645  2 2 4 1  72 VAL CA  D  72 val CA  1 1 
       645  3 1 4 1  76 ILE CA  D  76 ile CA  1 1 
       645  3 2 4 1  77 TRP CA  D  77 trp CA  1 1 
       646  2 1 4 1  70 ARG CA  D  70 arg CA  1 1 
       646  2 2 4 1  72 VAL CB  D  72 val CB  1 1 
       646  3 1 4 1 121 PRO CB  D 121 pro CB  1 1 
       646  3 2 4 1 122 GLN CA  D 122 gln CA  1 1 
       647  1 1 4 1  71 TYR CA  D  71 tyr CA  1 1 
       647  1 2 4 1  74 MET CA  D  74 met CA  1 1 
       648  1 1 4 1  71 TYR CA  D  71 tyr CA  1 1 
       648  1 2 4 1  74 MET CG  D  74 met CG  1 1 
       649  1 1 4 1  72 VAL C   D  72 val C   1 1 
       649  1 1 4 1  75 VAL C   D  75 val C   1 1 
       649  1 1 4 1  77 TRP C   D  77 trp C   1 1 
       649  1 2 4 1  74 MET CA  D  74 met CA  1 1 
       650  2 1 4 1  72 VAL CA  D  72 val CA  1 1 
       650  2 2 4 1  73 ALA CA  D  73 ala CA  1 1 
       650  3 1 4 1 151 ILE CA  D 151 ile CA  1 1 
       650  3 2 4 1 152 ALA CA  D 152 ala CA  1 1 
       651  1 1 4 1  72 VAL CG1 D  72 val CG1 1 1 
       651  1 2 4 1  73 ALA CB  D  73 ala CB  1 1 
       652  1 1 4 1  73 ALA CA  D  73 ala CA  1 1 
       652  1 2 4 1  74 MET CB  D  74 met CB  1 1 
       653  1 1 4 1  74 MET CA  D  74 met CA  1 1 
       653  1 2 4 1  76 ILE C   D  76 ile C   1 1 
       654  1 1 4 1  74 MET CG  D  74 met CG  1 1 
       654  1 2 4 1  75 VAL CB  D  75 val CB  1 1 
       655  1 1 4 1  74 MET CG  D  74 met CG  1 1 
       655  1 2 4 1  77 TRP CA  D  77 trp CA  1 1 
       656  2 1 4 1  75 VAL CA  D  75 val CA  1 1 
       656  2 2 4 1  76 ILE C   D  76 ile C   1 1 
       656  3 1 4 1  92 THR CA  D  92 thr CA  1 1 
       656  3 2 4 1  93 MET C   D  93 met C   1 1 
       656  4 1 4 1 158 VAL CA  D 158 val CA  1 1 
       656  4 1 4 1 160 VAL CA  D 160 val CA  1 1 
       656  4 1 4 1 161 VAL CA  D 161 val CA  1 1 
       656  4 2 4 1 159 LEU C   D 159 leu C   1 1 
       657  2 1 4 1  75 VAL CA  D  75 val CA  1 1 
       657  2 2 4 1  79 TYR CA  D  79 tyr CA  1 1 
       657  3 1 4 1  92 THR CB  D  92 thr CB  1 1 
       657  3 2 4 1  93 MET CA  D  93 met CA  1 1 
       658  2 1 4 1  75 VAL CG1 D  75 val CG1 1 1 
       658  2 2 4 1  76 ILE CG1 D  76 ile CG1 1 1 
       658  3 1 4 1 155 ILE CG1 D 155 ile CG1 1 1 
       658  3 2 4 1 156 VAL CG1 D 156 val CG1 1 1 
       658  4 1 4 1 158 VAL CG1 D 158 val CG1 1 1 
       658  4 2 4 1 162 ILE CG1 D 162 ile CG1 1 1 
       659  2 1 4 1  76 ILE C   D  76 ile C   1 1 
       659  2 1 4 1  78 LEU C   D  78 leu C   1 1 
       659  2 2 4 1  80 SER CA  D  80 ser CA  1 1 
       659  3 1 4 1 147 LEU C   D 147 leu C   1 1 
       659  3 2 4 1 150 PHE CA  D 150 phe CA  1 1 
       659  4 1 4 1 159 LEU C   D 159 leu C   1 1 
       659  4 2 4 1 162 ILE CA  D 162 ile CA  1 1 
       660  1 1 4 1  76 ILE CB  D  76 ile CB  1 1 
       660  1 2 4 1  77 TRP CA  D  77 trp CA  1 1 
       661  1 1 4 1  77 TRP CA  D  77 trp CA  1 1 
       661  1 2 4 1  78 LEU CB  D  78 leu CB  1 1 
       662  1 1 4 1  77 TRP CA  D  77 trp CA  1 1 
       662  1 2 4 1  79 TYR CA  D  79 tyr CA  1 1 
       663  2 1 4 1  77 TRP CA  D  77 trp CA  1 1 
       663  2 2 4 1  79 TYR CA  D  79 tyr CA  1 1 
       663  3 1 4 1 120 VAL CA  D 120 val CA  1 1 
       663  3 1 4 1 122 GLN CA  D 122 gln CA  1 1 
       663  3 2 4 1 123 VAL CA  D 123 val CA  1 1 
       664  2 1 4 1  78 LEU C   D  78 leu C   1 1 
       664  2 2 4 1  80 SER CA  D  80 ser CA  1 1 
       664  3 1 4 1 149 ILE C   D 149 ile C   1 1 
       664  3 2 4 1 150 PHE CA  D 150 phe CA  1 1 
       665  1 1 4 1  78 LEU CB  D  78 leu CB  1 1 
       665  1 2 4 1  81 ALA CA  D  81 ala CA  1 1 
       666  1 1 4 1  80 SER C   D  80 ser C   1 1 
       666  1 2 4 1  81 ALA CB  D  81 ala CB  1 1 
       667  1 1 4 1  80 SER CA  D  80 ser CA  1 1 
       667  1 2 4 1  81 ALA CA  D  81 ala CA  1 1 
       668  1 1 4 1  80 SER CA  D  80 ser CA  1 1 
       668  1 2 4 1  82 PHE CA  D  82 phe CA  1 1 
       669  1 1 4 1  81 ALA CA  D  81 ala CA  1 1 
       669  1 2 4 1  82 PHE CA  D  82 phe CA  1 1 
       670  1 1 4 1  81 ALA CB  D  81 ala CB  1 1 
       670  1 2 4 1  82 PHE CB  D  82 phe CB  1 1 
       671  2 1 4 1  81 ALA CB  D  81 ala CB  1 1 
       671  2 2 4 1  82 PHE CB  D  82 phe CB  1 1 
       671  3 1 4 1 149 ILE CG2 D 149 ile CG2 1 1 
       671  3 1 4 1 151 ILE CG2 D 151 ile CG2 1 1 
       671  3 2 4 1 150 PHE CB  D 150 phe CB  1 1 
       672  1 1 4 1  83 ARG CA  D  83 arg CA  1 1 
       672  1 2 4 1  85 VAL CA  D  85 val CA  1 1 
       673  1 1 4 1  83 ARG CD  D  83 arg CD  1 1 
       673  1 2 4 1  84 GLY CA  D  84 gly CA  1 1 
       674  1 1 4 1  83 ARG CD  D  83 arg CD  1 1 
       674  1 2 4 1  86 GLN CB  D  86 gln CB  1 1 
       675  1 1 4 1  83 ARG CG  D  83 arg CG  1 1 
       675  1 2 4 1  84 GLY CA  D  84 gly CA  1 1 
       676  2 1 4 1  84 GLY C   D  84 gly C   1 1 
       676  2 1 4 1  85 VAL C   D  85 val C   1 1 
       676  2 2 4 1  85 VAL CG1 D  85 val CG1 1 1 
       676  3 1 4 1 160 VAL CG1 D 160 val CG1 1 1 
       676  3 2 4 1 161 VAL C   D 161 val C   1 1 
       677  2 1 4 1  84 GLY C   D  84 gly C   1 1 
       677  2 2 4 1  85 VAL CG1 D  85 val CG1 1 1 
       677  3 1 4 1 160 VAL C   D 160 val C   1 1 
       677  3 2 4 1 160 VAL CG1 D 160 val CG1 1 1 
       678  2 1 4 1  84 GLY C   D  84 gly C   1 1 
       678  2 2 4 1  85 VAL CG2 D  85 val CG2 1 1 
       678  3 1 4 1  93 MET C   D  93 met C   1 1 
       678  3 2 4 1  94 LEU CD1 D  94 LEU CD* 1 1 
       678  3 2 4 1  94 LEU CD2 D  94 LEU CD* 1 1 
       678  4 1 4 1 158 VAL C   D 158 val C   1 1 
       678  4 2 4 1 158 VAL CG2 D 158 val CG2 1 1 
       678  5 1 4 1 160 VAL C   D 160 val C   1 1 
       678  5 2 4 1 161 VAL CG2 D 161 val CG2 1 1 
       679  1 1 4 1  84 GLY CA  D  84 gly CA  1 1 
       679  1 2 4 1  85 VAL CA  D  85 val CA  1 1 
       680  1 1 4 1  84 GLY CA  D  84 gly CA  1 1 
       680  1 2 4 1  85 VAL CB  D  85 val CB  1 1 
       681  1 1 4 1  84 GLY CA  D  84 gly CA  1 1 
       681  1 2 4 1  86 GLN CB  D  86 gln CB  1 1 
       682  1 1 4 1  84 GLY CA  D  84 gly CA  1 1 
       682  1 2 4 1  87 LEU C   D  87 leu C   1 1 
       683  1 1 4 1  84 GLY CA  D  84 gly CA  1 1 
       683  1 2 4 1  87 LEU CB  D  87 leu CB  1 1 
       684  1 1 4 1  85 VAL C   D  85 val C   1 1 
       684  1 2 4 1  86 GLN CB  D  86 gln CB  1 1 
       685  1 1 4 1  85 VAL C   D  85 val C   1 1 
       685  1 2 4 1  86 GLN CG  D  86 gln CG  1 1 
       686  1 1 4 1  85 VAL CB  D  85 val CB  1 1 
       686  1 2 4 1  86 GLN CB  D  86 gln CB  1 1 
       687  2 1 4 1  85 VAL CB  D  85 val CB  1 1 
       687  2 2 4 1  88 THR CA  D  88 thr CA  1 1 
       687  3 1 4 1 115 PRO CB  D 115 pro CB  1 1 
       687  3 2 4 1 121 PRO CA  D 121 pro CA  1 1 
       688  1 1 4 1  87 LEU CB  D  87 leu CB  1 1 
       688  1 2 4 1  88 THR CG2 D  88 thr CG2 1 1 
       689  1 1 4 1  87 LEU CG  D  87 leu CG  1 1 
       689  1 2 4 1  88 THR CA  D  88 thr CA  1 1 
       690  1 1 4 1  90 GLU C   D  90 glu C   1 1 
       690  1 2 4 1  91 HIS CA  D  91 his CA  1 1 
       691  1 1 4 1  91 HIS CA  D  91 his CA  1 1 
       691  1 2 4 1  92 THR C   D  92 thr C   1 1 
       692  1 1 4 1  92 THR C   D  92 thr C   1 1 
       692  1 2 4 1  95 GLN CB  D  95 gln CB  1 1 
       693  1 1 4 1  92 THR CB  D  92 thr CB  1 1 
       693  1 2 4 1  93 MET CA  D  93 met CA  1 1 
       694  1 1 4 1  93 MET CB  D  93 met CB  1 1 
       694  1 2 4 1  94 LEU CG  D  94 leu CG  1 1 
       695  1 1 4 1  96 LEU C   D  96 leu C   1 1 
       695  1 2 4 1  98 PRO CD  D  98 pro CD  1 1 
       696  1 1 4 1  96 LEU CB  D  96 leu CB  1 1 
       696  1 2 4 1  97 TYR CA  D  97 tyr CA  1 1 
       697  2 1 4 1  96 LEU CB  D  96 leu CB  1 1 
       697  2 2 4 1  97 TYR CA  D  97 tyr CA  1 1 
       697  3 1 4 1 117 ASP CB  D 117 asp CB  1 1 
       697  3 2 4 1 118 LYS CA  D 118 lys CA  1 1 
       698  1 1 4 1  97 TYR CA  D  97 tyr CA  1 1 
       698  1 2 4 1  98 PRO CD  D  98 pro CD  1 1 
       699  1 1 4 1  98 PRO CA  D  98 pro CA  1 1 
       699  1 2 4 1 100 PRO CD  D 100 pro CD  1 1 
       700  1 1 4 1  98 PRO CD  D  98 pro CD  1 1 
       700  1 1 4 1 100 PRO CD  D 100 pro CD  1 1 
       700  1 2 4 1  99 SER CA  D  99 ser CA  1 1 
       701  2 1 4 1  98 PRO CD  D  98 pro CD  1 1 
       701  2 1 4 1 100 PRO CD  D 100 pro CD  1 1 
       701  2 2 4 1  99 SER CA  D  99 ser CA  1 1 
       701  3 1 4 1 120 VAL CA  D 120 val CA  1 1 
       701  3 1 4 1 122 GLN CA  D 122 gln CA  1 1 
       701  3 2 4 1 121 PRO CD  D 121 pro CD  1 1 
       702  2 1 4 1  98 PRO CD  D  98 pro CD  1 1 
       702  2 1 4 1 100 PRO CD  D 100 pro CD  1 1 
       702  2 2 4 1  99 SER CA  D  99 ser CA  1 1 
       702  3 1 4 1 121 PRO CD  D 121 pro CD  1 1 
       702  3 2 4 1 122 GLN CA  D 122 gln CA  1 1 
       703  2 1 4 1  99 SER CA  D  99 ser CA  1 1 
       703  2 2 4 1 100 PRO CD  D 100 pro CD  1 1 
       703  3 1 4 1 120 VAL CA  D 120 val CA  1 1 
       703  3 1 4 1 122 GLN CA  D 122 gln CA  1 1 
       703  3 2 4 1 121 PRO CD  D 121 pro CD  1 1 
       704  1 1 4 1 100 PRO CD  D 100 pro CD  1 1 
       704  1 2 4 1 102 ALA CA  D 102 ala CA  1 1 
       705  1 1 4 1 102 ALA C   D 102 ala C   1 1 
       705  1 2 4 1 104 CYS CA  D 104 cys CA  1 1 
       706  1 1 4 1 102 ALA CA  D 102 ala CA  1 1 
       706  1 2 4 1 103 THR C   D 103 thr C   1 1 
       707  1 1 4 1 103 THR C   D 103 thr C   1 1 
       707  1 2 4 1 104 CYS CA  D 104 cys CA  1 1 
       708  1 1 4 1 104 CYS C   D 104 cys C   1 1 
       708  1 2 4 1 105 ASP CA  D 105 asp CA  1 1 
       709  2 1 4 1 104 CYS C   D 104 cys C   1 1 
       709  2 2 4 1 108 VAL CB  D 108 val CB  1 1 
       709  3 1 4 1 120 VAL CB  D 120 val CB  1 1 
       709  3 2 4 1 122 GLN C   D 122 gln C   1 1 
       710  1 1 4 1 104 CYS C   D 104 cys C   1 1 
       710  1 2 4 1 108 VAL CG2 D 108 val CG2 1 1 
       711  1 1 4 1 104 CYS CA  D 104 cys CA  1 1 
       711  1 2 4 1 105 ASP CA  D 105 asp CA  1 1 
       712  1 1 4 1 105 ASP CA  D 105 asp CA  1 1 
       712  1 2 4 1 108 VAL CB  D 108 val CB  1 1 
       713  1 1 4 1 115 PRO CB  D 115 pro CB  1 1 
       713  1 2 4 1 121 PRO CD  D 121 pro CD  1 1 
       714  1 1 4 1 117 ASP CB  D 117 asp CB  1 1 
       714  1 2 4 1 118 LYS CA  D 118 lys CA  1 1 
       715  1 1 4 1 117 ASP CB  D 117 asp CB  1 1 
       715  1 2 4 1 118 LYS CD  D 118 lys CD  1 1 
       716  1 1 4 1 117 ASP CB  D 117 asp CB  1 1 
       716  1 2 4 1 120 VAL CA  D 120 val CA  1 1 
       717  1 1 4 1 120 VAL CA  D 120 val CA  1 1 
       717  1 1 4 1 122 GLN CA  D 122 gln CA  1 1 
       717  1 2 4 1 121 PRO CA  D 121 pro CA  1 1 
       718  1 1 4 1 120 VAL CA  D 120 val CA  1 1 
       718  1 1 4 1 122 GLN CA  D 122 gln CA  1 1 
       718  1 2 4 1 121 PRO CD  D 121 pro CD  1 1 
       719  1 1 4 1 120 VAL CB  D 120 val CB  1 1 
       719  1 2 4 1 123 VAL CA  D 123 val CA  1 1 
       720  1 1 4 1 121 PRO CA  D 121 pro CA  1 1 
       720  1 2 4 1 123 VAL CA  D 123 val CA  1 1 
       721  1 1 4 1 122 GLN C   D 122 gln C   1 1 
       721  1 2 4 1 123 VAL CA  D 123 val CA  1 1 
       722  1 1 4 1 122 GLN CA  D 122 gln CA  1 1 
       722  1 2 4 1 124 PHE C   D 124 phe C   1 1 
       723  1 1 4 1 124 PHE C   D 124 phe C   1 1 
       723  1 2 4 1 125 VAL C   D 125 val C   1 1 
       724  1 1 4 1 125 VAL C   D 125 val C   1 1 
       724  1 2 4 1 126 ALA CB  D 126 ala CB  1 1 
       725  1 1 4 1 143 PRO CA  D 143 pro CA  1 1 
       725  1 2 4 1 145 TRP CA  D 145 trp CA  1 1 
       726  1 1 4 1 145 TRP C   D 145 trp C   1 1 
       726  1 2 4 1 147 LEU CD1 D 147 LEU CD* 1 1 
       726  1 2 4 1 147 LEU CD2 D 147 LEU CD* 1 1 
       727  2 1 4 1 145 TRP C   D 145 trp C   1 1 
       727  2 2 4 1 147 LEU CD1 D 147 LEU CD* 1 1 
       727  2 2 4 1 147 LEU CD2 D 147 LEU CD* 1 1 
       727  3 1 4 1 157 ALA C   D 157 ala C   1 1 
       727  3 2 4 1 158 VAL CG1 D 158 val CG1 1 1 
       727  3 2 4 1 160 VAL CG1 D 160 val CG1 1 1 
       728  1 1 4 1 145 TRP CB  D 145 trp CB  1 1 
       728  1 2 4 1 147 LEU CD1 D 147 LEU CD* 1 1 
       728  1 2 4 1 147 LEU CD2 D 147 LEU CD* 1 1 
       729  1 1 4 1 146 LEU C   D 146 leu C   1 1 
       729  1 2 4 1 146 LEU CG  D 146 leu CG  1 1 
       730  1 1 4 1 146 LEU C   D 146 leu C   1 1 
       730  1 2 4 1 148 GLY CA  D 148 gly CA  1 1 
       731  1 1 4 1 146 LEU CB  D 146 leu CB  1 1 
       731  1 1 4 1 147 LEU CB  D 147 leu CB  1 1 
       731  1 2 4 1 149 ILE CB  D 149 ile CB  1 1 
       732  2 1 4 1 146 LEU CB  D 146 leu CB  1 1 
       732  2 2 4 1 149 ILE CB  D 149 ile CB  1 1 
       732  3 1 4 1 154 LEU CB  D 154 leu CB  1 1 
       732  3 2 4 1 155 ILE CB  D 155 ile CB  1 1 
       733  1 1 4 1 146 LEU CB  D 146 leu CB  1 1 
       733  1 2 4 1 149 ILE CG1 D 149 ile CG1 1 1 
       734  1 1 4 1 147 LEU C   D 147 leu C   1 1 
       734  1 2 4 1 148 GLY CA  D 148 gly CA  1 1 
       735  1 1 4 1 147 LEU C   D 147 leu C   1 1 
       735  1 2 4 1 149 ILE CA  D 149 ile CA  1 1 
       735  1 2 4 1 151 ILE CA  D 151 ile CA  1 1 
       736  1 1 4 1 147 LEU C   D 147 leu C   1 1 
       736  1 2 4 1 150 PHE CA  D 150 phe CA  1 1 
       737  1 1 4 1 147 LEU C   D 147 leu C   1 1 
       737  1 2 4 1 151 ILE CB  D 151 ile CB  1 1 
       738  1 1 4 1 147 LEU CA  D 147 leu CA  1 1 
       738  1 2 4 1 147 LEU CD1 D 147 LEU CD* 1 1 
       738  1 2 4 1 147 LEU CD2 D 147 LEU CD* 1 1 
       739  1 1 4 1 147 LEU CB  D 147 leu CB  1 1 
       739  1 2 4 1 148 GLY CA  D 148 gly CA  1 1 
       740  1 1 4 1 147 LEU CB  D 147 leu CB  1 1 
       740  1 2 4 1 149 ILE CB  D 149 ile CB  1 1 
       741  1 1 4 1 147 LEU CB  D 147 leu CB  1 1 
       741  1 2 4 1 151 ILE CA  D 151 ile CA  1 1 
       742  1 1 4 1 147 LEU CG  D 147 leu CG  1 1 
       742  1 2 4 1 148 GLY CA  D 148 gly CA  1 1 
       743  1 1 4 1 148 GLY C   D 148 gly C   1 1 
       743  1 2 4 1 149 ILE CG1 D 149 ile CG1 1 1 
       744  1 1 4 1 148 GLY CA  D 148 gly CA  1 1 
       744  1 2 4 1 149 ILE CB  D 149 ile CB  1 1 
       745  1 1 4 1 148 GLY CA  D 148 gly CA  1 1 
       745  1 2 4 1 149 ILE CG1 D 149 ile CG1 1 1 
       745  1 2 4 1 151 ILE CG1 D 151 ile CG1 1 1 
       746  2 1 4 1 149 ILE C   D 149 ile C   1 1 
       746  2 2 4 1 149 ILE CG1 D 149 ile CG1 1 1 
       746  3 1 4 1 151 ILE C   D 151 ile C   1 1 
       746  3 2 4 1 151 ILE CG1 D 151 ile CG1 1 1 
       747  1 1 4 1 149 ILE CA  D 149 ile CA  1 1 
       747  1 2 4 1 149 ILE CD1 D 149 ile CD1 1 1 
       748  1 1 4 1 149 ILE CB  D 149 ile CB  1 1 
       748  1 2 4 1 150 PHE CA  D 150 phe CA  1 1 
       749  1 1 4 1 149 ILE CB  D 149 ile CB  1 1 
       749  1 1 4 1 155 ILE CB  D 155 ile CB  1 1 
       749  1 2 4 1 152 ALA CA  D 152 ala CA  1 1 
       750  2 1 4 1 149 ILE CD1 D 149 ile CD1 1 1 
       750  2 2 4 1 149 ILE CG2 D 149 ile CG2 1 1 
       750  3 1 4 1 151 ILE CD1 D 151 ile CD1 1 1 
       750  3 2 4 1 151 ILE CG2 D 151 ile CG2 1 1 
       751  1 1 4 1 151 ILE C   D 151 ile C   1 1 
       751  1 2 4 1 151 ILE CD1 D 151 ile CD1 1 1 
       752  1 1 4 1 151 ILE C   D 151 ile C   1 1 
       752  1 2 4 1 152 ALA CA  D 152 ala CA  1 1 
       753  1 1 4 1 151 ILE C   D 151 ile C   1 1 
       753  1 1 4 1 155 ILE C   D 155 ile C   1 1 
       753  1 2 4 1 153 TYR CB  D 153 tyr CB  1 1 
       754  1 1 4 1 151 ILE CB  D 151 ile CB  1 1 
       754  1 2 4 1 152 ALA CA  D 152 ala CA  1 1 
       755  1 1 4 1 153 TYR CA  D 153 tyr CA  1 1 
       755  1 2 4 1 154 LEU CG  D 154 leu CG  1 1 
       756  1 1 4 1 153 TYR CA  D 153 tyr CA  1 1 
       756  1 2 4 1 155 ILE CA  D 155 ile CA  1 1 
       756  1 2 4 1 156 VAL CA  D 156 val CA  1 1 
       757  1 1 4 1 153 TYR CA  D 153 tyr CA  1 1 
       757  1 2 4 1 155 ILE CB  D 155 ile CB  1 1 
       758  1 1 4 1 153 TYR CB  D 153 tyr CB  1 1 
       758  1 2 4 1 154 LEU CA  D 154 leu CA  1 1 
       759  1 1 4 1 153 TYR CB  D 153 tyr CB  1 1 
       759  1 2 4 1 156 VAL C   D 156 val C   1 1 
       760  1 1 4 1 154 LEU C   D 154 leu C   1 1 
       760  1 2 4 1 157 ALA CA  D 157 ala CA  1 1 
       761  1 1 4 1 154 LEU CB  D 154 leu CB  1 1 
       761  1 2 4 1 155 ILE CB  D 155 ile CB  1 1 
       762  1 1 4 1 154 LEU CB  D 154 leu CB  1 1 
       762  1 2 4 1 157 ALA CA  D 157 ala CA  1 1 
       763  1 1 4 1 154 LEU CG  D 154 leu CG  1 1 
       763  1 2 4 1 155 ILE CA  D 155 ile CA  1 1 
       764  1 1 4 1 155 ILE C   D 155 ile C   1 1 
       764  1 2 4 1 155 ILE CG1 D 155 ile CG1 1 1 
       764  1 2 4 1 156 VAL CB  D 156 val CB  1 1 
       764  1 2 4 1 158 VAL CB  D 158 val CB  1 1 
       765  1 1 4 1 155 ILE C   D 155 ile C   1 1 
       765  1 1 4 1 158 VAL C   D 158 val C   1 1 
       765  1 2 4 1 157 ALA CB  D 157 ala CB  1 1 
       766  1 1 4 1 155 ILE CA  D 155 ile CA  1 1 
       766  1 2 4 1 156 VAL CA  D 156 val CA  1 1 
       766  1 2 4 1 158 VAL CA  D 158 val CA  1 1 
       767  2 1 4 1 155 ILE CG1 D 155 ile CG1 1 1 
       767  2 1 4 1 162 ILE CG1 D 162 ile CG1 1 1 
       767  2 2 4 1 158 VAL CG2 D 158 val CG2 1 1 
       767  3 1 4 1 161 VAL CG2 D 161 val CG2 1 1 
       767  3 2 4 1 162 ILE CG1 D 162 ile CG1 1 1 
       768  1 1 4 1 156 VAL C   D 156 val C   1 1 
       768  1 2 4 1 157 ALA CB  D 157 ala CB  1 1 
       769  1 1 4 1 156 VAL CA  D 156 val CA  1 1 
       769  1 1 4 1 158 VAL CA  D 158 val CA  1 1 
       769  1 2 4 1 157 ALA CA  D 157 ala CA  1 1 
       770  1 1 4 1 157 ALA C   D 157 ala C   1 1 
       770  1 2 4 1 160 VAL CG1 D 160 val CG1 1 1 
       771  1 1 4 1 159 LEU CB  D 159 leu CB  1 1 
       771  1 2 4 1 162 ILE CB  D 162 ile CB  1 1 
       772  1 1 4 1 161 VAL CG2 D 161 val CG2 1 1 
       772  1 2 4 1 162 ILE CG1 D 162 ile CG1 1 1 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

         1  2 . . . . . 4.65 1.8 7.5 1 1 
         1  3 . . . . . 4.65 1.8 7.5 1 1 
         1  4 . . . . . 4.65 1.8 7.5 1 1 
         2  1 . . . . .  3.4 1.8 5.0 1 1 
         3  2 . . . . .  3.9 1.8 6.0 1 1 
         3  3 . . . . .  3.9 1.8 6.0 1 1 
         3  4 . . . . .  3.9 1.8 6.0 1 1 
         3  5 . . . . .  3.9 1.8 6.0 1 1 
         3  6 . . . . .  3.9 1.8 6.0 1 1 
         4  2 . . . . .  3.4 1.8 5.0 1 1 
         4  3 . . . . .  3.4 1.8 5.0 1 1 
         4  4 . . . . .  3.4 1.8 5.0 1 1 
         4  5 . . . . .  3.4 1.8 5.0 1 1 
         4  6 . . . . .  3.4 1.8 5.0 1 1 
         4  7 . . . . .  3.4 1.8 5.0 1 1 
         4  8 . . . . .  3.4 1.8 5.0 1 1 
         4  9 . . . . .  3.4 1.8 5.0 1 1 
         4 10 . . . . .  3.4 1.8 5.0 1 1 
         5  2 . . . . .  4.9 1.8 8.0 1 1 
         5  3 . . . . .  4.9 1.8 8.0 1 1 
         6  2 . . . . . 4.65 1.8 7.5 1 1 
         6  3 . . . . . 4.65 1.8 7.5 1 1 
         6  4 . . . . . 4.65 1.8 7.5 1 1 
         7  2 . . . . .  3.9 1.8 6.0 1 1 
         7  3 . . . . .  3.9 1.8 6.0 1 1 
         8  1 . . . . . 4.65 1.8 7.5 1 1 
         9  1 . . . . .  3.4 1.8 5.0 1 1 
        10  2 . . . . .  3.9 1.8 6.0 1 1 
        10  3 . . . . .  3.9 1.8 6.0 1 1 
        10  4 . . . . .  3.9 1.8 6.0 1 1 
        11  2 . . . . . 4.65 1.8 7.5 1 1 
        11  3 . . . . . 4.65 1.8 7.5 1 1 
        11  4 . . . . . 4.65 1.8 7.5 1 1 
        12  1 . . . . .  4.9 1.8 8.0 1 1 
        13  2 . . . . .  3.4 1.8 5.0 1 1 
        13  3 . . . . .  3.4 1.8 5.0 1 1 
        14  1 . . . . .  3.4 1.8 5.0 1 1 
        15  2 . . . . .  3.4 1.8 5.0 1 1 
        15  3 . . . . .  3.4 1.8 5.0 1 1 
        16  1 . . . . .  3.9 1.8 6.0 1 1 
        17  1 . . . . .  3.9 1.8 6.0 1 1 
        18  1 . . . . .  4.9 1.8 8.0 1 1 
        19  2 . . . . .  3.4 1.8 5.0 1 1 
        19  3 . . . . .  3.4 1.8 5.0 1 1 
        20  2 . . . . . 4.65 1.8 7.5 1 1 
        20  3 . . . . . 4.65 1.8 7.5 1 1 
        21  2 . . . . . 4.65 1.8 7.5 1 1 
        21  3 . . . . . 4.65 1.8 7.5 1 1 
        22  2 . . . . .  3.4 1.8 5.0 1 1 
        22  3 . . . . .  3.4 1.8 5.0 1 1 
        22  4 . . . . .  3.4 1.8 5.0 1 1 
        22  5 . . . . .  3.4 1.8 5.0 1 1 
        23  2 . . . . .  3.4 1.8 5.0 1 1 
        23  3 . . . . .  3.4 1.8 5.0 1 1 
        24  2 . . . . . 4.65 1.8 7.5 1 1 
        24  3 . . . . . 4.65 1.8 7.5 1 1 
        25  2 . . . . .  4.9 1.8 8.0 1 1 
        25  3 . . . . .  4.9 1.8 8.0 1 1 
        25  4 . . . . .  4.9 1.8 8.0 1 1 
        26  2 . . . . . 4.65 1.8 7.5 1 1 
        26  3 . . . . . 4.65 1.8 7.5 1 1 
        27  1 . . . . .  4.9 1.8 8.0 1 1 
        28  2 . . . . .  3.4 1.8 5.0 1 1 
        28  3 . . . . .  3.4 1.8 5.0 1 1 
        28  4 . . . . .  3.4 1.8 5.0 1 1 
        29  2 . . . . .  3.4 1.8 5.0 1 1 
        29  3 . . . . .  3.4 1.8 5.0 1 1 
        30  2 . . . . . 4.65 1.8 7.5 1 1 
        30  3 . . . . . 4.65 1.8 7.5 1 1 
        31  2 . . . . . 4.65 1.8 7.5 1 1 
        31  3 . . . . . 4.65 1.8 7.5 1 1 
        32  1 . . . . . 4.65 1.8 7.5 1 1 
        33  1 . . . . . 4.65 1.8 7.5 1 1 
        34  1 . . . . .  3.9 1.8 6.0 1 1 
        35  2 . . . . .  3.9 1.8 6.0 1 1 
        35  3 . . . . .  3.9 1.8 6.0 1 1 
        36  1 . . . . .  3.4 1.8 5.0 1 1 
        37  2 . . . . .  3.9 1.8 6.0 1 1 
        37  3 . . . . .  3.9 1.8 6.0 1 1 
        38  2 . . . . .  4.9 1.8 8.0 1 1 
        38  3 . . . . .  4.9 1.8 8.0 1 1 
        39  2 . . . . .  3.4 1.8 5.0 1 1 
        39  3 . . . . .  3.4 1.8 5.0 1 1 
        40  2 . . . . . 4.65 1.8 7.5 1 1 
        40  3 . . . . . 4.65 1.8 7.5 1 1 
        41  2 . . . . .  3.9 1.8 6.0 1 1 
        41  3 . . . . .  3.9 1.8 6.0 1 1 
        42  2 . . . . .  3.4 1.8 5.0 1 1 
        42  3 . . . . .  3.4 1.8 5.0 1 1 
        42  4 . . . . .  3.4 1.8 5.0 1 1 
        42  5 . . . . .  3.4 1.8 5.0 1 1 
        43  2 . . . . .  3.4 1.8 5.0 1 1 
        43  3 . . . . .  3.4 1.8 5.0 1 1 
        44  1 . . . . . 4.65 1.8 6.0 1 1 
        45  2 . . . . . 4.65 1.8 7.5 1 1 
        45  3 . . . . . 4.65 1.8 7.5 1 1 
        46  2 . . . . .  3.4 1.8 5.0 1 1 
        46  3 . . . . .  3.4 1.8 5.0 1 1 
        47  1 . . . . . 4.65 1.8 7.5 1 1 
        48  1 . . . . .  3.4 1.8 5.0 1 1 
        49  2 . . . . .  3.4 1.8 5.0 1 1 
        49  3 . . . . .  3.4 1.8 5.0 1 1 
        50  2 . . . . .  3.9 1.8 6.0 1 1 
        50  3 . . . . .  3.9 1.8 6.0 1 1 
        51  2 . . . . .  4.9 1.8 8.0 1 1 
        51  3 . . . . .  4.9 1.8 8.0 1 1 
        52  1 . . . . .  4.9 1.8 8.0 1 1 
        53  1 . . . . .  3.4 1.8 5.0 1 1 
        54  2 . . . . . 4.65 1.8 7.5 1 1 
        54  3 . . . . . 4.65 1.8 7.5 1 1 
        54  4 . . . . . 4.65 1.8 7.5 1 1 
        55  1 . . . . .  4.9 1.8 8.0 1 1 
        56  2 . . . . . 4.65 1.8 7.5 1 1 
        56  3 . . . . . 4.65 1.8 7.5 1 1 
        57  2 . . . . .  3.9 1.8 6.0 1 1 
        57  3 . . . . .  3.9 1.8 6.0 1 1 
        58  1 . . . . . 4.65 1.8 7.5 1 1 
        59  1 . . . . .  3.4 1.8 5.0 1 1 
        60  1 . . . . .  3.9 1.8 6.0 1 1 
        61  2 . . . . .  3.4 1.8 5.0 1 1 
        61  3 . . . . .  3.4 1.8 5.0 1 1 
        62  1 . . . . . 4.65 1.8 7.5 1 1 
        63  1 . . . . . 4.65 1.8 7.5 1 1 
        64  1 . . . . . 4.65 1.8 7.5 1 1 
        65  2 . . . . .  3.4 1.8 5.0 1 1 
        65  3 . . . . .  3.4 1.8 5.0 1 1 
        66  2 . . . . .  3.9 1.8 6.0 1 1 
        66  3 . . . . .  3.9 1.8 6.0 1 1 
        67  1 . . . . .  3.4 1.8 5.0 1 1 
        68  1 . . . . .  3.4 1.8 5.0 1 1 
        69  2 . . . . .  3.4 1.8 5.0 1 1 
        69  3 . . . . .  3.4 1.8 5.0 1 1 
        69  4 . . . . .  3.4 1.8 5.0 1 1 
        69  5 . . . . .  3.4 1.8 5.0 1 1 
        70  2 . . . . .  3.4 1.8 5.0 1 1 
        70  3 . . . . .  3.4 1.8 5.0 1 1 
        71  2 . . . . . 4.65 1.8 7.5 1 1 
        71  3 . . . . . 4.65 1.8 7.5 1 1 
        71  4 . . . . . 4.65 1.8 7.5 1 1 
        72  2 . . . . . 4.65 1.8 7.5 1 1 
        72  3 . . . . . 4.65 1.8 7.5 1 1 
        72  4 . . . . . 4.65 1.8 7.5 1 1 
        73  1 . . . . .  3.9 1.8 6.0 1 1 
        74  1 . . . . .  4.9 1.8 6.0 1 1 
        75  2 . . . . .  4.9 1.8 8.0 1 1 
        75  3 . . . . .  4.9 1.8 8.0 1 1 
        76  1 . . . . .  3.9 1.8 6.0 1 1 
        77  1 . . . . . 4.65 1.8 7.5 1 1 
        78  1 . . . . .  3.9 1.8 6.0 1 1 
        79  2 . . . . .  3.4 1.8 5.0 1 1 
        79  3 . . . . .  3.4 1.8 5.0 1 1 
        80  2 . . . . .  3.9 1.8 6.0 1 1 
        80  3 . . . . .  3.9 1.8 6.0 1 1 
        81  1 . . . . .  4.9 1.8 8.0 1 1 
        82  1 . . . . . 4.65 1.8 7.5 1 1 
        83  2 . . . . . 4.65 1.8 7.5 1 1 
        83  3 . . . . . 4.65 1.8 7.5 1 1 
        84  2 . . . . .  4.9 1.8 8.0 1 1 
        84  3 . . . . .  4.9 1.8 8.0 1 1 
        85  2 . . . . .  3.9 1.8 6.0 1 1 
        85  3 . . . . .  3.9 1.8 6.0 1 1 
        85  4 . . . . .  3.9 1.8 6.0 1 1 
        85  5 . . . . .  3.9 1.8 6.0 1 1 
        86  1 . . . . . 4.65 1.8 7.5 1 1 
        87  2 . . . . .  3.4 1.8 5.0 1 1 
        87  3 . . . . .  3.4 1.8 5.0 1 1 
        87  4 . . . . .  3.4 1.8 5.0 1 1 
        88  2 . . . . .  4.9 1.8 8.0 1 1 
        88  3 . . . . .  4.9 1.8 8.0 1 1 
        88  4 . . . . .  4.9 1.8 8.0 1 1 
        88  5 . . . . .  4.9 1.8 8.0 1 1 
        89  1 . . . . .  3.9 1.8 6.0 1 1 
        90  2 . . . . .  3.9 1.8 6.0 1 1 
        90  3 . . . . .  3.9 1.8 6.0 1 1 
        91  1 . . . . .  3.4 1.8 5.0 1 1 
        92  2 . . . . . 4.65 1.8 7.5 1 1 
        92  3 . . . . . 4.65 1.8 7.5 1 1 
        93  1 . . . . . 4.65 1.8 7.5 1 1 
        94  2 . . . . .  3.4 1.8 5.0 1 1 
        94  3 . . . . .  3.4 1.8 5.0 1 1 
        95  2 . . . . .  4.9 1.8 8.0 1 1 
        95  3 . . . . .  4.9 1.8 8.0 1 1 
        95  4 . . . . .  4.9 1.8 8.0 1 1 
        96  1 . . . . .  4.9 1.8 8.0 1 1 
        97  1 . . . . .  3.4 1.8 5.0 1 1 
        98  2 . . . . .  4.9 1.8 8.0 1 1 
        98  3 . . . . .  4.9 1.8 8.0 1 1 
        98  4 . . . . .  4.9 1.8 8.0 1 1 
        99  1 . . . . .  3.9 1.8 6.0 1 1 
       100  2 . . . . .  3.9 1.8 6.0 1 1 
       100  3 . . . . .  3.9 1.8 6.0 1 1 
       101  2 . . . . .  3.4 1.8 5.0 1 1 
       101  3 . . . . .  3.4 1.8 5.0 1 1 
       102  1 . . . . .  3.4 1.8 5.0 1 1 
       103  1 . . . . . 4.65 1.8 7.5 1 1 
       104  1 . . . . .  3.4 1.8 5.0 1 1 
       105  2 . . . . .  3.9 1.8 6.0 1 1 
       105  3 . . . . .  3.9 1.8 6.0 1 1 
       105  4 . . . . .  3.9 1.8 6.0 1 1 
       106  2 . . . . . 4.65 1.8 7.5 1 1 
       106  3 . . . . . 4.65 1.8 7.5 1 1 
       107  1 . . . . .  4.9 1.8 8.0 1 1 
       108  2 . . . . .  3.9 1.8 6.0 1 1 
       108  3 . . . . .  3.9 1.8 6.0 1 1 
       108  4 . . . . .  3.9 1.8 6.0 1 1 
       109  1 . . . . .  4.9 1.8 8.0 1 1 
       110  2 . . . . . 4.65 1.8 7.5 1 1 
       110  3 . . . . . 4.65 1.8 7.5 1 1 
       111  2 . . . . .  3.9 1.8 6.0 1 1 
       111  3 . . . . .  3.9 1.8 6.0 1 1 
       112  2 . . . . . 4.65 1.8 7.5 1 1 
       112  3 . . . . . 4.65 1.8 7.5 1 1 
       112  4 . . . . . 4.65 1.8 7.5 1 1 
       112  5 . . . . . 4.65 1.8 7.5 1 1 
       113  2 . . . . . 4.65 1.8 7.5 1 1 
       113  3 . . . . . 4.65 1.8 7.5 1 1 
       113  4 . . . . . 4.65 1.8 7.5 1 1 
       114  2 . . . . . 4.65 1.8 7.5 1 1 
       114  3 . . . . . 4.65 1.8 7.5 1 1 
       114  4 . . . . . 4.65 1.8 7.5 1 1 
       115  1 . . . . . 4.65 1.8 7.5 1 1 
       116  2 . . . . .  4.9 1.8 8.0 1 1 
       116  3 . . . . .  4.9 1.8 8.0 1 1 
       117  2 . . . . .  4.9 1.8 8.0 1 1 
       117  3 . . . . .  4.9 1.8 8.0 1 1 
       117  4 . . . . .  4.9 1.8 8.0 1 1 
       118  1 . . . . .  3.9 1.8 6.0 1 1 
       119  1 . . . . . 4.65 1.8 7.5 1 1 
       120  2 . . . . .  3.4 1.8 5.0 1 1 
       120  3 . . . . .  3.4 1.8 5.0 1 1 
       120  4 . . . . .  3.4 1.8 5.0 1 1 
       120  5 . . . . .  3.4 1.8 5.0 1 1 
       121  2 . . . . .  3.9 1.8 6.0 1 1 
       121  3 . . . . .  3.9 1.8 6.0 1 1 
       122  2 . . . . .  3.4 1.8 5.0 1 1 
       122  3 . . . . .  3.4 1.8 5.0 1 1 
       122  4 . . . . .  3.4 1.8 5.0 1 1 
       123  1 . . . . .  3.9 1.8 6.0 1 1 
       124  2 . . . . .  3.9 1.8 6.0 1 1 
       124  3 . . . . .  3.9 1.8 6.0 1 1 
       125  1 . . . . .  3.9 1.8 6.0 1 1 
       126  2 . . . . . 4.65 1.8 7.5 1 1 
       126  3 . . . . . 4.65 1.8 7.5 1 1 
       127  1 . . . . .  3.9 1.8 6.0 1 1 
       128  2 . . . . .  4.9 1.8 8.0 1 1 
       128  3 . . . . .  4.9 1.8 8.0 1 1 
       129  2 . . . . .  3.9 1.8 6.0 1 1 
       129  3 . . . . .  3.9 1.8 6.0 1 1 
       130  2 . . . . .  4.9 1.8 8.0 1 1 
       130  3 . . . . .  4.9 1.8 8.0 1 1 
       130  4 . . . . .  4.9 1.8 8.0 1 1 
       131  2 . . . . . 4.65 1.8 7.5 1 1 
       131  3 . . . . . 4.65 1.8 7.5 1 1 
       132  2 . . . . .  3.4 1.8 5.0 1 1 
       132  3 . . . . .  3.4 1.8 5.0 1 1 
       132  4 . . . . .  3.4 1.8 5.0 1 1 
       132  5 . . . . .  3.4 1.8 5.0 1 1 
       133  1 . . . . .  3.9 1.8 6.0 1 1 
       134  2 . . . . .  3.9 1.8 6.0 1 1 
       134  3 . . . . .  3.9 1.8 6.0 1 1 
       134  4 . . . . .  3.9 1.8 6.0 1 1 
       135  1 . . . . .  3.9 1.8 6.0 1 1 
       136  2 . . . . .  3.4 1.8 5.0 1 1 
       136  3 . . . . .  3.4 1.8 5.0 1 1 
       136  4 . . . . .  3.4 1.8 5.0 1 1 
       136  5 . . . . .  3.4 1.8 5.0 1 1 
       136  6 . . . . .  3.4 1.8 5.0 1 1 
       137  1 . . . . .  3.9 1.8 6.0 1 1 
       138  2 . . . . .  3.9 1.8 6.0 1 1 
       138  3 . . . . .  3.9 1.8 6.0 1 1 
       138  4 . . . . .  3.9 1.8 6.0 1 1 
       139  2 . . . . . 4.65 1.8 7.5 1 1 
       139  3 . . . . . 4.65 1.8 7.5 1 1 
       140  1 . . . . .  3.9 1.8 6.0 1 1 
       141  1 . . . . .  3.9 1.8 6.0 1 1 
       142  1 . . . . .  3.9 1.8 6.0 1 1 
       143  1 . . . . . 4.65 1.8 7.5 1 1 
       144  1 . . . . .  3.9 1.8 6.0 1 1 
       145  1 . . . . . 4.65 1.8 7.5 1 1 
       146  2 . . . . .  3.9 1.8 6.0 1 1 
       146  3 . . . . .  3.9 1.8 6.0 1 1 
       146  4 . . . . .  3.9 1.8 6.0 1 1 
       147  2 . . . . .  3.9 1.8 6.0 1 1 
       147  3 . . . . .  3.9 1.8 6.0 1 1 
       148  1 . . . . .  3.9 1.8 6.0 1 1 
       149  2 . . . . .  3.9 1.8 6.0 1 1 
       149  3 . . . . .  3.9 1.8 6.0 1 1 
       150  1 . . . . .  4.9 1.8 8.0 1 1 
       151  1 . . . . .  3.9 1.8 6.0 1 1 
       152  1 . . . . .  3.9 1.8 6.0 1 1 
       153  1 . . . . . 4.65 1.8 7.5 1 1 
       154  2 . . . . .  4.9 1.8 7.5 1 1 
       154  3 . . . . .  4.9 1.8 7.5 1 1 
       155  1 . . . . . 4.65 1.8 7.5 1 1 
       156  1 . . . . .  4.9 1.8 8.0 1 1 
       157  1 . . . . . 4.65 1.8 7.5 1 1 
       158  1 . . . . .  4.9 1.8 8.0 1 1 
       159  1 . . . . . 4.65 1.8 7.5 1 1 
       160  1 . . . . .  3.9 1.8 6.0 1 1 
       161  1 . . . . .  4.9 1.8 8.0 1 1 
       162  1 . . . . .  3.9 1.8 6.0 1 1 
       163  1 . . . . .  3.4 1.8 5.0 1 1 
       164  1 . . . . . 4.65 1.8 7.5 1 1 
       165  2 . . . . .  3.9 1.8 6.0 1 1 
       165  3 . . . . .  3.9 1.8 6.0 1 1 
       166  1 . . . . .  3.9 1.8 6.0 1 1 
       167  1 . . . . .  3.9 1.8 6.0 1 1 
       168  2 . . . . .  3.4 1.8 5.0 1 1 
       168  3 . . . . .  3.4 1.8 5.0 1 1 
       169  2 . . . . .  3.9 1.8 6.0 1 1 
       169  3 . . . . .  3.9 1.8 6.0 1 1 
       170  1 . . . . .  4.9 1.8 7.5 1 1 
       171  2 . . . . .  3.9 1.8 6.0 1 1 
       171  3 . . . . .  3.9 1.8 6.0 1 1 
       172  2 . . . . .  4.9 1.8 8.0 1 1 
       172  3 . . . . .  4.9 1.8 8.0 1 1 
       173  2 . . . . .  3.4 1.8 5.0 1 1 
       173  3 . . . . .  3.4 1.8 5.0 1 1 
       173  4 . . . . .  3.4 1.8 5.0 1 1 
       174  2 . . . . .  3.4 1.8 5.0 1 1 
       174  3 . . . . .  3.4 1.8 5.0 1 1 
       175  1 . . . . . 4.65 1.8 7.5 1 1 
       176  1 . . . . .  3.9 1.8 6.0 1 1 
       177  2 . . . . .  3.9 1.8 6.0 1 1 
       177  3 . . . . .  3.9 1.8 6.0 1 1 
       178  2 . . . . .  3.4 1.8 5.0 1 1 
       178  3 . . . . .  3.4 1.8 5.0 1 1 
       179  1 . . . . .  3.9 1.8 6.0 1 1 
       180  1 . . . . .  3.9 1.8 6.0 1 1 
       181  1 . . . . .  3.4 1.8 5.0 1 1 
       182  2 . . . . .  3.4 1.8 5.0 1 1 
       182  3 . . . . .  3.4 1.8 5.0 1 1 
       182  4 . . . . .  3.4 1.8 5.0 1 1 
       183  2 . . . . . 4.65 1.8 7.5 1 1 
       183  3 . . . . . 4.65 1.8 7.5 1 1 
       184  1 . . . . .  3.9 1.8 6.0 1 1 
       185  1 . . . . . 4.65 1.8 7.5 1 1 
       186  2 . . . . .  4.9 1.8 8.0 1 1 
       186  3 . . . . .  4.9 1.8 8.0 1 1 
       187  1 . . . . .  4.9 1.8 8.0 1 1 
       188  1 . . . . .  3.4 1.8 5.0 1 1 
       189  1 . . . . .  3.4 1.8 5.0 1 1 
       190  2 . . . . .  3.4 1.8 5.0 1 1 
       190  3 . . . . .  3.4 1.8 5.0 1 1 
       191  1 . . . . .  4.9 1.8 7.5 1 1 
       192  1 . . . . .  3.4 1.8 5.0 1 1 
       193  1 . . . . . 4.65 1.8 7.5 1 1 
       194  1 . . . . . 4.65 1.8 7.5 1 1 
       195  1 . . . . .  4.9 1.8 8.0 1 1 
       196  2 . . . . . 4.65 1.8 7.5 1 1 
       196  3 . . . . . 4.65 1.8 7.5 1 1 
       197  2 . . . . .  3.9 1.8 6.0 1 1 
       197  3 . . . . .  3.9 1.8 6.0 1 1 
       198  1 . . . . .  4.9 1.8 7.5 1 1 
       199  2 . . . . . 4.65 1.8 7.5 1 1 
       199  3 . . . . . 4.65 1.8 7.5 1 1 
       200  1 . . . . .  3.9 1.8 6.0 1 1 
       201  1 . . . . .  4.9 1.8 7.5 1 1 
       202  2 . . . . .  4.9 1.8 8.0 1 1 
       202  3 . . . . .  4.9 1.8 8.0 1 1 
       203  1 . . . . . 4.65 1.8 6.0 1 1 
       204  1 . . . . .  3.9 1.8 6.0 1 1 
       205  1 . . . . . 4.65 1.8 7.5 1 1 
       206  1 . . . . . 4.65 1.8 6.0 1 1 
       207  1 . . . . .  3.9 1.8 6.0 1 1 
       208  1 . . . . .  3.9 1.8 6.0 1 1 
       209  1 . . . . . 4.65 1.8 7.5 1 1 
       210  1 . . . . . 4.65 1.8 7.5 1 1 
       211  2 . . . . .  4.9 1.8 8.0 1 1 
       211  3 . . . . .  4.9 1.8 8.0 1 1 
       212  1 . . . . .  3.9 1.8 6.0 1 1 
       213  1 . . . . .  3.9 1.8 6.0 1 1 
       214  1 . . . . . 4.65 1.8 7.5 1 1 
       215  2 . . . . . 4.65 1.8 7.5 1 1 
       215  3 . . . . . 4.65 1.8 7.5 1 1 
       216  2 . . . . .  3.9 1.8 6.0 1 1 
       216  3 . . . . .  3.9 1.8 6.0 1 1 
       217  1 . . . . . 4.65 1.8 7.5 1 1 
       218  1 . . . . .  4.9 1.8 8.0 1 1 
       219  1 . . . . .  3.9 1.8 6.0 1 1 
       220  2 . . . . .  4.9 1.8 8.0 1 1 
       220  3 . . . . .  4.9 1.8 8.0 1 1 
       221  2 . . . . . 4.65 1.8 7.5 1 1 
       221  3 . . . . . 4.65 1.8 7.5 1 1 
       221  4 . . . . . 4.65 1.8 7.5 1 1 
       222  1 . . . . . 4.65 1.8 7.5 1 1 
       223  1 . . . . .  4.9 1.8 8.0 1 1 
       224  1 . . . . .  3.9 1.8 5.0 1 1 
       225  1 . . . . . 4.65 1.8 7.5 1 1 
       226  1 . . . . . 4.65 1.8 7.5 1 1 
       227  1 . . . . . 4.65 1.8 7.5 1 1 
       228  2 . . . . . 4.65 1.8 7.5 1 1 
       228  3 . . . . . 4.65 1.8 7.5 1 1 
       229  1 . . . . .  4.9 1.8 8.0 1 1 
       230  2 . . . . . 4.65 1.8 7.5 1 1 
       230  3 . . . . . 4.65 1.8 7.5 1 1 
       231  2 . . . . . 4.65 1.8 7.5 1 1 
       231  3 . . . . . 4.65 1.8 7.5 1 1 
       232  2 . . . . . 4.65 1.8 7.5 1 1 
       232  3 . . . . . 4.65 1.8 7.5 1 1 
       232  4 . . . . . 4.65 1.8 7.5 1 1 
       233  1 . . . . .  4.9 1.8 8.0 1 1 
       234  1 . . . . . 4.65 1.8 7.5 1 1 
       235  2 . . . . . 4.65 1.8 7.5 1 1 
       235  3 . . . . . 4.65 1.8 7.5 1 1 
       236  1 . . . . .  3.9 1.8 6.0 1 1 
       237  2 . . . . .  3.9 1.8 6.0 1 1 
       237  3 . . . . .  3.9 1.8 6.0 1 1 
       238  2 . . . . .  3.4 1.8 5.0 1 1 
       238  3 . . . . .  3.4 1.8 5.0 1 1 
       238  4 . . . . .  3.4 1.8 5.0 1 1 
       238  5 . . . . .  3.4 1.8 5.0 1 1 
       238  6 . . . . .  3.4 1.8 5.0 1 1 
       238  7 . . . . .  3.4 1.8 5.0 1 1 
       239  2 . . . . . 4.65 1.8 7.5 1 1 
       239  3 . . . . . 4.65 1.8 7.5 1 1 
       240  1 . . . . . 4.65 1.8 7.5 1 1 
       241  1 . . . . . 4.65 1.8 7.5 1 1 
       242  2 . . . . .  3.9 1.8 6.0 1 1 
       242  3 . . . . .  3.9 1.8 6.0 1 1 
       243  1 . . . . .  4.9 1.8 8.0 1 1 
       244  2 . . . . . 4.65 1.8 7.5 1 1 
       244  3 . . . . . 4.65 1.8 7.5 1 1 
       245  1 . . . . . 4.65 1.8 7.5 1 1 
       246  1 . . . . .  3.9 1.8 6.0 1 1 
       247  2 . . . . .  3.9 1.8 6.0 1 1 
       247  3 . . . . .  3.9 1.8 6.0 1 1 
       248  1 . . . . .  3.9 1.8 6.0 1 1 
       249  2 . . . . .  3.4 1.8 5.0 1 1 
       249  3 . . . . .  3.4 1.8 5.0 1 1 
       249  4 . . . . .  3.4 1.8 5.0 1 1 
       250  2 . . . . .  3.4 1.8 5.0 1 1 
       250  3 . . . . .  3.4 1.8 5.0 1 1 
       250  4 . . . . .  3.4 1.8 5.0 1 1 
       251  1 . . . . .  3.9 1.8 6.0 1 1 
       252  2 . . . . . 4.65 1.8 7.5 1 1 
       252  3 . . . . . 4.65 1.8 7.5 1 1 
       253  1 . . . . . 4.65 1.8 7.5 1 1 
       254  1 . . . . .  3.9 1.8 6.0 1 1 
       255  2 . . . . .  3.9 1.8 6.0 1 1 
       255  3 . . . . .  3.9 1.8 6.0 1 1 
       256  1 . . . . . 4.65 1.8 7.5 1 1 
       257  1 . . . . . 4.65 1.8 7.5 1 1 
       258  2 . . . . . 4.65 1.8 7.5 1 1 
       258  3 . . . . . 4.65 1.8 7.5 1 1 
       259  2 . . . . .  3.9 1.8 6.0 1 1 
       259  3 . . . . .  3.9 1.8 6.0 1 1 
       260  2 . . . . .  4.9 1.8 8.0 1 1 
       260  3 . . . . .  4.9 1.8 8.0 1 1 
       261  1 . . . . .  3.9 1.8 6.0 1 1 
       262  1 . . . . .  3.9 1.8 6.0 1 1 
       263  1 . . . . .  4.9 1.8 8.0 1 1 
       264  2 . . . . .  3.4 1.8 5.0 1 1 
       264  3 . . . . .  3.4 1.8 5.0 1 1 
       265  1 . . . . .  4.9 1.8 8.0 1 1 
       266  1 . . . . .  3.9 1.8 6.0 1 1 
       267  1 . . . . . 4.65 1.8 7.5 1 1 
       268  1 . . . . . 4.65 1.8 7.5 1 1 
       269  1 . . . . .  4.9 1.8 8.0 1 1 
       270  2 . . . . .  3.4 1.8 5.0 1 1 
       270  3 . . . . .  3.4 1.8 5.0 1 1 
       270  4 . . . . .  3.4 1.8 5.0 1 1 
       271  2 . . . . .  4.9 1.8 8.0 1 1 
       271  3 . . . . .  4.9 1.8 8.0 1 1 
       272  2 . . . . . 4.65 1.8 7.5 1 1 
       272  3 . . . . . 4.65 1.8 7.5 1 1 
       272  4 . . . . . 4.65 1.8 7.5 1 1 
       273  2 . . . . . 4.65 1.8 7.5 1 1 
       273  3 . . . . . 4.65 1.8 7.5 1 1 
       273  4 . . . . . 4.65 1.8 7.5 1 1 
       274  1 . . . . .  3.4 1.8 5.0 1 1 
       275  1 . . . . .  3.4 1.8 5.0 1 1 
       276  1 . . . . .  3.9 1.8 6.0 1 1 
       277  2 . . . . . 4.65 1.8 7.5 1 1 
       277  3 . . . . . 4.65 1.8 7.5 1 1 
       278  2 . . . . .  3.4 1.8 5.0 1 1 
       278  3 . . . . .  3.4 1.8 5.0 1 1 
       279  1 . . . . . 4.65 1.8 7.5 1 1 
       280  1 . . . . .  3.9 1.8 6.0 1 1 
       281  1 . . . . .  3.4 1.8 5.0 1 1 
       282  1 . . . . .  3.9 1.8 6.0 1 1 
       283  1 . . . . .  3.9 1.8 6.0 1 1 
       284  1 . . . . . 4.65 1.8 7.5 1 1 
       285  2 . . . . . 4.65 1.8 7.5 1 1 
       285  3 . . . . . 4.65 1.8 7.5 1 1 
       286  1 . . . . .  3.9 1.8 6.0 1 1 
       287  1 . . . . . 4.65 1.8 7.5 1 1 
       288  1 . . . . . 4.65 1.8 7.5 1 1 
       289  1 . . . . .  3.9 1.8 6.0 1 1 
       290  2 . . . . .  3.9 1.8 6.0 1 1 
       290  3 . . . . .  3.9 1.8 6.0 1 1 
       291  2 . . . . .  3.9 1.8 6.0 1 1 
       291  3 . . . . .  3.9 1.8 6.0 1 1 
       292  2 . . . . .  3.4 1.8 5.0 1 1 
       292  3 . . . . .  3.4 1.8 5.0 1 1 
       292  4 . . . . .  3.4 1.8 5.0 1 1 
       292  5 . . . . .  3.4 1.8 5.0 1 1 
       293  1 . . . . .  4.9 1.8 8.0 1 1 
       294  1 . . . . .  4.9 1.8 8.0 1 1 
       295  1 . . . . .  4.9 1.8 8.0 1 1 
       296  1 . . . . . 4.65 1.8 7.5 1 1 
       297  1 . . . . . 4.65 1.8 7.5 1 1 
       298  1 . . . . .  3.4 1.8 5.0 1 1 
       299  1 . . . . .  4.9 1.8 8.0 1 1 
       300  1 . . . . .  3.9 1.8 6.0 1 1 
       301  2 . . . . .  4.9 1.8 8.0 1 1 
       301  3 . . . . .  4.9 1.8 8.0 1 1 
       302  1 . . . . . 4.65 1.8 7.5 1 1 
       303  1 . . . . . 4.65 1.8 7.5 1 1 
       304  1 . . . . .  3.4 1.8 5.0 1 1 
       305  1 . . . . . 4.65 1.8 7.5 1 1 
       306  1 . . . . . 4.65 1.8 6.0 1 1 
       307  1 . . . . .  3.9 1.8 6.0 1 1 
       308  1 . . . . . 4.65 1.8 7.5 1 1 
       309  1 . . . . .  3.9 1.8 5.0 1 1 
       310  1 . . . . .  3.9 1.8 5.0 1 1 
       311  2 . . . . .  3.9 1.8 6.0 1 1 
       311  3 . . . . .  3.9 1.8 6.0 1 1 
       312  1 . . . . .  3.9 1.8 5.0 1 1 
       313  1 . . . . .  4.9 1.8 8.0 1 1 
       314  1 . . . . .  4.9 1.8 8.0 1 1 
       315  2 . . . . .  3.9 1.8 6.0 1 1 
       315  3 . . . . .  3.9 1.8 6.0 1 1 
       316  2 . . . . . 4.65 1.8 7.5 1 1 
       316  3 . . . . . 4.65 1.8 7.5 1 1 
       317  2 . . . . . 4.65 1.8 7.5 1 1 
       317  3 . . . . . 4.65 1.8 7.5 1 1 
       318  1 . . . . .  4.9 1.8 7.5 1 1 
       319  1 . . . . . 4.65 1.8 6.0 1 1 
       320  1 . . . . .  4.9 1.8 8.0 1 1 
       321  1 . . . . .  3.9 1.8 6.0 1 1 
       322  1 . . . . . 4.65 1.8 7.5 1 1 
       323  2 . . . . . 4.65 1.8 7.5 1 1 
       323  3 . . . . . 4.65 1.8 7.5 1 1 
       324  1 . . . . . 4.65 1.8 7.5 1 1 
       325  1 . . . . .  3.9 1.8 6.0 1 1 
       326  1 . . . . . 4.65 1.8 7.5 1 1 
       327  1 . . . . .  4.9 1.8 8.0 1 1 
       328  1 . . . . .  3.9 1.8 6.0 1 1 
       329  1 . . . . . 4.65 1.8 7.5 1 1 
       330  1 . . . . .  4.9 1.8 8.0 1 1 
       331  1 . . . . . 4.65 1.8 7.5 1 1 
       332  1 . . . . .  3.4 1.8 5.0 1 1 
       333  1 . . . . . 4.65 1.8 7.5 1 1 
       334  1 . . . . .  4.9 1.8 8.0 1 1 
       335  1 . . . . . 4.65 1.8 7.5 1 1 
       336  1 . . . . . 4.65 1.8 7.5 1 1 
       337  1 . . . . .  3.9 1.8 6.0 1 1 
       338  1 . . . . .  3.4 1.8 5.0 1 1 
       339  1 . . . . . 4.65 1.8 7.5 1 1 
       340  1 . . . . . 4.65 1.8 7.5 1 1 
       341  2 . . . . .  3.9 1.8 6.0 1 1 
       341  3 . . . . .  3.9 1.8 6.0 1 1 
       342  1 . . . . . 4.65 1.8 7.5 1 1 
       343  1 . . . . .  3.4 1.8 5.0 1 1 
       344  1 . . . . . 4.65 1.8 7.5 1 1 
       345  1 . . . . . 4.65 1.8 7.5 1 1 
       346  2 . . . . . 4.65 1.8 7.5 1 1 
       346  3 . . . . . 4.65 1.8 7.5 1 1 
       347  1 . . . . . 4.65 1.8 7.5 1 1 
       348  1 . . . . .  3.9 1.8 6.0 1 1 
       349  1 . . . . .  3.9 1.8 6.0 1 1 
       350  1 . . . . .  3.9 1.8 6.0 1 1 
       351  1 . . . . . 4.65 1.8 7.5 1 1 
       352  1 . . . . .  3.4 1.8 5.0 1 1 
       353  1 . . . . .  3.9 1.8 6.0 1 1 
       354  1 . . . . . 4.65 1.8 7.5 1 1 
       355  1 . . . . .  4.9 1.8 8.0 1 1 
       356  1 . . . . .  3.9 1.8 6.0 1 1 
       357  1 . . . . .  3.9 1.8 6.0 1 1 
       358  1 . . . . .  4.9 1.8 8.0 1 1 
       359  1 . . . . .  4.9 1.8 8.0 1 1 
       360  2 . . . . .  3.4 1.8 5.0 1 1 
       360  3 . . . . .  3.4 1.8 5.0 1 1 
       361  1 . . . . .  3.4 1.8 5.0 1 1 
       362  1 . . . . .  3.9 1.8 6.0 1 1 
       363  1 . . . . .  4.9 1.8 8.0 1 1 
       364  2 . . . . .  3.4 1.8 5.0 1 1 
       364  3 . . . . .  3.4 1.8 5.0 1 1 
       365  1 . . . . . 4.65 1.8 7.5 1 1 
       366  1 . . . . .  3.4 1.8 5.0 1 1 
       367  1 . . . . . 4.65 1.8 7.5 1 1 
       368  1 . . . . .  3.9 1.8 6.0 1 1 
       369  1 . . . . . 4.65 1.8 7.5 1 1 
       370  1 . . . . . 4.65 1.8 7.5 1 1 
       371  1 . . . . .  3.9 1.8 6.0 1 1 
       372  1 . . . . . 4.65 1.8 7.5 1 1 
       373  1 . . . . . 4.65 1.8 7.5 1 1 
       374  1 . . . . .  3.9 1.8 6.0 1 1 
       375  1 . . . . .  3.9 1.8 6.0 1 1 
       376  1 . . . . . 4.65 1.8 7.5 1 1 
       377  1 . . . . .  3.9 1.8 6.0 1 1 
       378  1 . . . . .  3.4 1.8 5.0 1 1 
       379  1 . . . . . 4.65 1.8 7.5 1 1 
       380  1 . . . . .  3.9 1.8 6.0 1 1 
       381  2 . . . . .  4.9 1.8 8.0 1 1 
       381  3 . . . . .  4.9 1.8 8.0 1 1 
       382  1 . . . . .  4.9 1.8 8.0 1 1 
       383  1 . . . . .  3.4 1.8 5.0 1 1 
       384  1 . . . . .  3.9 1.8 6.0 1 1 
       385  1 . . . . .  4.9 1.8 8.0 1 1 
       386  1 . . . . .  4.9 1.8 8.0 1 1 
       387  2 . . . . . 4.65 1.8 7.5 1 1 
       387  3 . . . . . 4.65 1.8 7.5 1 1 
       387  4 . . . . . 4.65 1.8 7.5 1 1 
       388  1 . . . . .  3.4 1.8 5.0 1 1 
       389  2 . . . . .  3.9 1.8 6.0 1 1 
       389  3 . . . . .  3.9 1.8 6.0 1 1 
       389  4 . . . . .  3.9 1.8 6.0 1 1 
       389  5 . . . . .  3.9 1.8 6.0 1 1 
       389  6 . . . . .  3.9 1.8 6.0 1 1 
       390  2 . . . . .  3.4 1.8 5.0 1 1 
       390  3 . . . . .  3.4 1.8 5.0 1 1 
       390  4 . . . . .  3.4 1.8 5.0 1 1 
       390  5 . . . . .  3.4 1.8 5.0 1 1 
       390  6 . . . . .  3.4 1.8 5.0 1 1 
       390  7 . . . . .  3.4 1.8 5.0 1 1 
       390  8 . . . . .  3.4 1.8 5.0 1 1 
       390  9 . . . . .  3.4 1.8 5.0 1 1 
       390 10 . . . . .  3.4 1.8 5.0 1 1 
       391  2 . . . . .  4.9 1.8 8.0 1 1 
       391  3 . . . . .  4.9 1.8 8.0 1 1 
       392  2 . . . . . 4.65 1.8 7.5 1 1 
       392  3 . . . . . 4.65 1.8 7.5 1 1 
       392  4 . . . . . 4.65 1.8 7.5 1 1 
       393  2 . . . . .  3.9 1.8 6.0 1 1 
       393  3 . . . . .  3.9 1.8 6.0 1 1 
       394  1 . . . . . 4.65 1.8 7.5 1 1 
       395  1 . . . . .  3.4 1.8 5.0 1 1 
       396  2 . . . . .  3.9 1.8 6.0 1 1 
       396  3 . . . . .  3.9 1.8 6.0 1 1 
       396  4 . . . . .  3.9 1.8 6.0 1 1 
       397  2 . . . . . 4.65 1.8 7.5 1 1 
       397  3 . . . . . 4.65 1.8 7.5 1 1 
       397  4 . . . . . 4.65 1.8 7.5 1 1 
       398  1 . . . . .  4.9 1.8 8.0 1 1 
       399  2 . . . . .  3.4 1.8 5.0 1 1 
       399  3 . . . . .  3.4 1.8 5.0 1 1 
       400  1 . . . . .  3.4 1.8 5.0 1 1 
       401  2 . . . . .  3.4 1.8 5.0 1 1 
       401  3 . . . . .  3.4 1.8 5.0 1 1 
       402  1 . . . . .  3.9 1.8 6.0 1 1 
       403  1 . . . . .  3.9 1.8 6.0 1 1 
       404  1 . . . . .  4.9 1.8 8.0 1 1 
       405  2 . . . . .  3.4 1.8 5.0 1 1 
       405  3 . . . . .  3.4 1.8 5.0 1 1 
       406  2 . . . . . 4.65 1.8 7.5 1 1 
       406  3 . . . . . 4.65 1.8 7.5 1 1 
       407  2 . . . . . 4.65 1.8 7.5 1 1 
       407  3 . . . . . 4.65 1.8 7.5 1 1 
       408  2 . . . . .  3.4 1.8 5.0 1 1 
       408  3 . . . . .  3.4 1.8 5.0 1 1 
       408  4 . . . . .  3.4 1.8 5.0 1 1 
       408  5 . . . . .  3.4 1.8 5.0 1 1 
       409  2 . . . . .  3.4 1.8 5.0 1 1 
       409  3 . . . . .  3.4 1.8 5.0 1 1 
       410  2 . . . . . 4.65 1.8 7.5 1 1 
       410  3 . . . . . 4.65 1.8 7.5 1 1 
       411  2 . . . . .  4.9 1.8 8.0 1 1 
       411  3 . . . . .  4.9 1.8 8.0 1 1 
       411  4 . . . . .  4.9 1.8 8.0 1 1 
       412  2 . . . . . 4.65 1.8 7.5 1 1 
       412  3 . . . . . 4.65 1.8 7.5 1 1 
       413  1 . . . . .  4.9 1.8 8.0 1 1 
       414  2 . . . . .  3.4 1.8 5.0 1 1 
       414  3 . . . . .  3.4 1.8 5.0 1 1 
       414  4 . . . . .  3.4 1.8 5.0 1 1 
       415  2 . . . . .  3.4 1.8 5.0 1 1 
       415  3 . . . . .  3.4 1.8 5.0 1 1 
       416  2 . . . . . 4.65 1.8 7.5 1 1 
       416  3 . . . . . 4.65 1.8 7.5 1 1 
       417  2 . . . . . 4.65 1.8 7.5 1 1 
       417  3 . . . . . 4.65 1.8 7.5 1 1 
       418  1 . . . . . 4.65 1.8 7.5 1 1 
       419  1 . . . . . 4.65 1.8 7.5 1 1 
       420  1 . . . . .  3.9 1.8 6.0 1 1 
       421  2 . . . . .  3.9 1.8 6.0 1 1 
       421  3 . . . . .  3.9 1.8 6.0 1 1 
       422  1 . . . . .  3.4 1.8 5.0 1 1 
       423  2 . . . . .  3.9 1.8 6.0 1 1 
       423  3 . . . . .  3.9 1.8 6.0 1 1 
       424  2 . . . . .  4.9 1.8 8.0 1 1 
       424  3 . . . . .  4.9 1.8 8.0 1 1 
       425  2 . . . . .  3.4 1.8 5.0 1 1 
       425  3 . . . . .  3.4 1.8 5.0 1 1 
       426  2 . . . . . 4.65 1.8 7.5 1 1 
       426  3 . . . . . 4.65 1.8 7.5 1 1 
       427  2 . . . . .  3.9 1.8 6.0 1 1 
       427  3 . . . . .  3.9 1.8 6.0 1 1 
       428  2 . . . . .  3.4 1.8 5.0 1 1 
       428  3 . . . . .  3.4 1.8 5.0 1 1 
       428  4 . . . . .  3.4 1.8 5.0 1 1 
       428  5 . . . . .  3.4 1.8 5.0 1 1 
       429  2 . . . . .  3.4 1.8 5.0 1 1 
       429  3 . . . . .  3.4 1.8 5.0 1 1 
       430  1 . . . . . 4.65 1.8 6.0 1 1 
       431  2 . . . . . 4.65 1.8 7.5 1 1 
       431  3 . . . . . 4.65 1.8 7.5 1 1 
       432  2 . . . . .  3.4 1.8 5.0 1 1 
       432  3 . . . . .  3.4 1.8 5.0 1 1 
       433  1 . . . . . 4.65 1.8 7.5 1 1 
       434  1 . . . . .  3.4 1.8 5.0 1 1 
       435  2 . . . . .  3.4 1.8 5.0 1 1 
       435  3 . . . . .  3.4 1.8 5.0 1 1 
       436  2 . . . . .  3.9 1.8 6.0 1 1 
       436  3 . . . . .  3.9 1.8 6.0 1 1 
       437  2 . . . . .  4.9 1.8 8.0 1 1 
       437  3 . . . . .  4.9 1.8 8.0 1 1 
       438  1 . . . . .  4.9 1.8 8.0 1 1 
       439  1 . . . . .  3.4 1.8 5.0 1 1 
       440  2 . . . . . 4.65 1.8 7.5 1 1 
       440  3 . . . . . 4.65 1.8 7.5 1 1 
       440  4 . . . . . 4.65 1.8 7.5 1 1 
       441  1 . . . . .  4.9 1.8 8.0 1 1 
       442  2 . . . . . 4.65 1.8 7.5 1 1 
       442  3 . . . . . 4.65 1.8 7.5 1 1 
       443  2 . . . . .  3.9 1.8 6.0 1 1 
       443  3 . . . . .  3.9 1.8 6.0 1 1 
       444  1 . . . . . 4.65 1.8 7.5 1 1 
       445  1 . . . . .  3.4 1.8 5.0 1 1 
       446  1 . . . . .  3.9 1.8 6.0 1 1 
       447  2 . . . . .  3.4 1.8 5.0 1 1 
       447  3 . . . . .  3.4 1.8 5.0 1 1 
       448  1 . . . . . 4.65 1.8 7.5 1 1 
       449  1 . . . . . 4.65 1.8 7.5 1 1 
       450  1 . . . . . 4.65 1.8 7.5 1 1 
       451  2 . . . . .  3.4 1.8 5.0 1 1 
       451  3 . . . . .  3.4 1.8 5.0 1 1 
       452  2 . . . . .  3.9 1.8 6.0 1 1 
       452  3 . . . . .  3.9 1.8 6.0 1 1 
       453  1 . . . . .  3.4 1.8 5.0 1 1 
       454  1 . . . . .  3.4 1.8 5.0 1 1 
       455  2 . . . . .  3.4 1.8 5.0 1 1 
       455  3 . . . . .  3.4 1.8 5.0 1 1 
       455  4 . . . . .  3.4 1.8 5.0 1 1 
       455  5 . . . . .  3.4 1.8 5.0 1 1 
       456  2 . . . . .  3.4 1.8 5.0 1 1 
       456  3 . . . . .  3.4 1.8 5.0 1 1 
       457  2 . . . . . 4.65 1.8 7.5 1 1 
       457  3 . . . . . 4.65 1.8 7.5 1 1 
       457  4 . . . . . 4.65 1.8 7.5 1 1 
       458  2 . . . . . 4.65 1.8 7.5 1 1 
       458  3 . . . . . 4.65 1.8 7.5 1 1 
       458  4 . . . . . 4.65 1.8 7.5 1 1 
       459  1 . . . . .  3.9 1.8 6.0 1 1 
       460  1 . . . . .  4.9 1.8 6.0 1 1 
       461  2 . . . . .  4.9 1.8 8.0 1 1 
       461  3 . . . . .  4.9 1.8 8.0 1 1 
       462  1 . . . . .  3.9 1.8 6.0 1 1 
       463  1 . . . . . 4.65 1.8 7.5 1 1 
       464  1 . . . . .  3.9 1.8 6.0 1 1 
       465  2 . . . . .  3.4 1.8 5.0 1 1 
       465  3 . . . . .  3.4 1.8 5.0 1 1 
       466  2 . . . . .  3.9 1.8 6.0 1 1 
       466  3 . . . . .  3.9 1.8 6.0 1 1 
       467  1 . . . . .  4.9 1.8 8.0 1 1 
       468  1 . . . . . 4.65 1.8 7.5 1 1 
       469  2 . . . . . 4.65 1.8 7.5 1 1 
       469  3 . . . . . 4.65 1.8 7.5 1 1 
       470  2 . . . . .  4.9 1.8 8.0 1 1 
       470  3 . . . . .  4.9 1.8 8.0 1 1 
       471  2 . . . . .  3.9 1.8 6.0 1 1 
       471  3 . . . . .  3.9 1.8 6.0 1 1 
       471  4 . . . . .  3.9 1.8 6.0 1 1 
       471  5 . . . . .  3.9 1.8 6.0 1 1 
       472  1 . . . . . 4.65 1.8 7.5 1 1 
       473  2 . . . . .  3.4 1.8 5.0 1 1 
       473  3 . . . . .  3.4 1.8 5.0 1 1 
       473  4 . . . . .  3.4 1.8 5.0 1 1 
       474  2 . . . . .  4.9 1.8 8.0 1 1 
       474  3 . . . . .  4.9 1.8 8.0 1 1 
       474  4 . . . . .  4.9 1.8 8.0 1 1 
       474  5 . . . . .  4.9 1.8 8.0 1 1 
       475  1 . . . . .  3.9 1.8 6.0 1 1 
       476  2 . . . . .  3.9 1.8 6.0 1 1 
       476  3 . . . . .  3.9 1.8 6.0 1 1 
       477  1 . . . . .  3.4 1.8 5.0 1 1 
       478  2 . . . . . 4.65 1.8 7.5 1 1 
       478  3 . . . . . 4.65 1.8 7.5 1 1 
       479  1 . . . . . 4.65 1.8 7.5 1 1 
       480  2 . . . . .  3.4 1.8 5.0 1 1 
       480  3 . . . . .  3.4 1.8 5.0 1 1 
       481  2 . . . . .  4.9 1.8 8.0 1 1 
       481  3 . . . . .  4.9 1.8 8.0 1 1 
       481  4 . . . . .  4.9 1.8 8.0 1 1 
       482  1 . . . . .  4.9 1.8 8.0 1 1 
       483  1 . . . . .  3.4 1.8 5.0 1 1 
       484  2 . . . . .  4.9 1.8 8.0 1 1 
       484  3 . . . . .  4.9 1.8 8.0 1 1 
       484  4 . . . . .  4.9 1.8 8.0 1 1 
       485  1 . . . . .  3.9 1.8 6.0 1 1 
       486  2 . . . . .  3.9 1.8 6.0 1 1 
       486  3 . . . . .  3.9 1.8 6.0 1 1 
       487  2 . . . . .  3.4 1.8 5.0 1 1 
       487  3 . . . . .  3.4 1.8 5.0 1 1 
       488  1 . . . . .  3.4 1.8 5.0 1 1 
       489  1 . . . . . 4.65 1.8 7.5 1 1 
       490  1 . . . . .  3.4 1.8 5.0 1 1 
       491  2 . . . . .  3.9 1.8 6.0 1 1 
       491  3 . . . . .  3.9 1.8 6.0 1 1 
       491  4 . . . . .  3.9 1.8 6.0 1 1 
       492  2 . . . . . 4.65 1.8 7.5 1 1 
       492  3 . . . . . 4.65 1.8 7.5 1 1 
       493  1 . . . . .  4.9 1.8 8.0 1 1 
       494  2 . . . . .  3.9 1.8 6.0 1 1 
       494  3 . . . . .  3.9 1.8 6.0 1 1 
       494  4 . . . . .  3.9 1.8 6.0 1 1 
       495  1 . . . . .  4.9 1.8 8.0 1 1 
       496  2 . . . . . 4.65 1.8 7.5 1 1 
       496  3 . . . . . 4.65 1.8 7.5 1 1 
       497  2 . . . . .  3.9 1.8 6.0 1 1 
       497  3 . . . . .  3.9 1.8 6.0 1 1 
       498  2 . . . . . 4.65 1.8 7.5 1 1 
       498  3 . . . . . 4.65 1.8 7.5 1 1 
       498  4 . . . . . 4.65 1.8 7.5 1 1 
       498  5 . . . . . 4.65 1.8 7.5 1 1 
       499  2 . . . . . 4.65 1.8 7.5 1 1 
       499  3 . . . . . 4.65 1.8 7.5 1 1 
       499  4 . . . . . 4.65 1.8 7.5 1 1 
       500  2 . . . . . 4.65 1.8 7.5 1 1 
       500  3 . . . . . 4.65 1.8 7.5 1 1 
       500  4 . . . . . 4.65 1.8 7.5 1 1 
       501  1 . . . . . 4.65 1.8 7.5 1 1 
       502  2 . . . . .  4.9 1.8 8.0 1 1 
       502  3 . . . . .  4.9 1.8 8.0 1 1 
       503  2 . . . . .  4.9 1.8 8.0 1 1 
       503  3 . . . . .  4.9 1.8 8.0 1 1 
       503  4 . . . . .  4.9 1.8 8.0 1 1 
       504  1 . . . . .  3.9 1.8 6.0 1 1 
       505  1 . . . . . 4.65 1.8 7.5 1 1 
       506  2 . . . . .  3.4 1.8 5.0 1 1 
       506  3 . . . . .  3.4 1.8 5.0 1 1 
       506  4 . . . . .  3.4 1.8 5.0 1 1 
       506  5 . . . . .  3.4 1.8 5.0 1 1 
       507  2 . . . . .  3.9 1.8 6.0 1 1 
       507  3 . . . . .  3.9 1.8 6.0 1 1 
       508  2 . . . . .  3.4 1.8 5.0 1 1 
       508  3 . . . . .  3.4 1.8 5.0 1 1 
       508  4 . . . . .  3.4 1.8 5.0 1 1 
       509  1 . . . . .  3.9 1.8 6.0 1 1 
       510  2 . . . . .  3.9 1.8 6.0 1 1 
       510  3 . . . . .  3.9 1.8 6.0 1 1 
       511  1 . . . . .  3.9 1.8 6.0 1 1 
       512  2 . . . . . 4.65 1.8 7.5 1 1 
       512  3 . . . . . 4.65 1.8 7.5 1 1 
       513  1 . . . . .  3.9 1.8 6.0 1 1 
       514  2 . . . . .  4.9 1.8 8.0 1 1 
       514  3 . . . . .  4.9 1.8 8.0 1 1 
       515  2 . . . . .  3.9 1.8 6.0 1 1 
       515  3 . . . . .  3.9 1.8 6.0 1 1 
       516  2 . . . . .  4.9 1.8 8.0 1 1 
       516  3 . . . . .  4.9 1.8 8.0 1 1 
       516  4 . . . . .  4.9 1.8 8.0 1 1 
       517  2 . . . . . 4.65 1.8 7.5 1 1 
       517  3 . . . . . 4.65 1.8 7.5 1 1 
       518  2 . . . . .  3.4 1.8 5.0 1 1 
       518  3 . . . . .  3.4 1.8 5.0 1 1 
       518  4 . . . . .  3.4 1.8 5.0 1 1 
       518  5 . . . . .  3.4 1.8 5.0 1 1 
       519  1 . . . . .  3.9 1.8 6.0 1 1 
       520  2 . . . . .  3.9 1.8 6.0 1 1 
       520  3 . . . . .  3.9 1.8 6.0 1 1 
       520  4 . . . . .  3.9 1.8 6.0 1 1 
       521  1 . . . . .  3.9 1.8 6.0 1 1 
       522  2 . . . . .  3.4 1.8 5.0 1 1 
       522  3 . . . . .  3.4 1.8 5.0 1 1 
       522  4 . . . . .  3.4 1.8 5.0 1 1 
       522  5 . . . . .  3.4 1.8 5.0 1 1 
       522  6 . . . . .  3.4 1.8 5.0 1 1 
       523  1 . . . . .  3.9 1.8 6.0 1 1 
       524  2 . . . . .  3.9 1.8 6.0 1 1 
       524  3 . . . . .  3.9 1.8 6.0 1 1 
       524  4 . . . . .  3.9 1.8 6.0 1 1 
       525  2 . . . . . 4.65 1.8 7.5 1 1 
       525  3 . . . . . 4.65 1.8 7.5 1 1 
       526  1 . . . . .  3.9 1.8 6.0 1 1 
       527  1 . . . . .  3.9 1.8 6.0 1 1 
       528  1 . . . . .  3.9 1.8 6.0 1 1 
       529  1 . . . . . 4.65 1.8 7.5 1 1 
       530  1 . . . . .  3.9 1.8 6.0 1 1 
       531  1 . . . . . 4.65 1.8 7.5 1 1 
       532  2 . . . . .  3.9 1.8 6.0 1 1 
       532  3 . . . . .  3.9 1.8 6.0 1 1 
       532  4 . . . . .  3.9 1.8 6.0 1 1 
       533  2 . . . . .  3.9 1.8 6.0 1 1 
       533  3 . . . . .  3.9 1.8 6.0 1 1 
       534  1 . . . . .  3.9 1.8 6.0 1 1 
       535  2 . . . . .  3.9 1.8 6.0 1 1 
       535  3 . . . . .  3.9 1.8 6.0 1 1 
       536  1 . . . . .  4.9 1.8 8.0 1 1 
       537  1 . . . . .  3.9 1.8 6.0 1 1 
       538  1 . . . . .  3.9 1.8 6.0 1 1 
       539  1 . . . . . 4.65 1.8 7.5 1 1 
       540  2 . . . . .  4.9 1.8 7.5 1 1 
       540  3 . . . . .  4.9 1.8 7.5 1 1 
       541  1 . . . . . 4.65 1.8 7.5 1 1 
       542  1 . . . . .  4.9 1.8 8.0 1 1 
       543  1 . . . . . 4.65 1.8 7.5 1 1 
       544  1 . . . . .  4.9 1.8 8.0 1 1 
       545  1 . . . . . 4.65 1.8 7.5 1 1 
       546  1 . . . . .  3.9 1.8 6.0 1 1 
       547  1 . . . . .  4.9 1.8 8.0 1 1 
       548  1 . . . . .  3.9 1.8 6.0 1 1 
       549  1 . . . . .  3.4 1.8 5.0 1 1 
       550  1 . . . . . 4.65 1.8 7.5 1 1 
       551  2 . . . . .  3.9 1.8 6.0 1 1 
       551  3 . . . . .  3.9 1.8 6.0 1 1 
       552  1 . . . . .  3.9 1.8 6.0 1 1 
       553  1 . . . . .  3.9 1.8 6.0 1 1 
       554  2 . . . . .  3.4 1.8 5.0 1 1 
       554  3 . . . . .  3.4 1.8 5.0 1 1 
       555  2 . . . . .  3.9 1.8 6.0 1 1 
       555  3 . . . . .  3.9 1.8 6.0 1 1 
       556  1 . . . . .  4.9 1.8 7.5 1 1 
       557  2 . . . . .  3.9 1.8 6.0 1 1 
       557  3 . . . . .  3.9 1.8 6.0 1 1 
       558  2 . . . . .  4.9 1.8 8.0 1 1 
       558  3 . . . . .  4.9 1.8 8.0 1 1 
       559  2 . . . . .  3.4 1.8 5.0 1 1 
       559  3 . . . . .  3.4 1.8 5.0 1 1 
       559  4 . . . . .  3.4 1.8 5.0 1 1 
       560  2 . . . . .  3.4 1.8 5.0 1 1 
       560  3 . . . . .  3.4 1.8 5.0 1 1 
       561  1 . . . . . 4.65 1.8 7.5 1 1 
       562  1 . . . . .  3.9 1.8 6.0 1 1 
       563  2 . . . . .  3.9 1.8 6.0 1 1 
       563  3 . . . . .  3.9 1.8 6.0 1 1 
       564  2 . . . . .  3.4 1.8 5.0 1 1 
       564  3 . . . . .  3.4 1.8 5.0 1 1 
       565  1 . . . . .  3.9 1.8 6.0 1 1 
       566  1 . . . . .  3.9 1.8 6.0 1 1 
       567  1 . . . . .  3.4 1.8 5.0 1 1 
       568  2 . . . . .  3.4 1.8 5.0 1 1 
       568  3 . . . . .  3.4 1.8 5.0 1 1 
       568  4 . . . . .  3.4 1.8 5.0 1 1 
       569  2 . . . . . 4.65 1.8 7.5 1 1 
       569  3 . . . . . 4.65 1.8 7.5 1 1 
       570  1 . . . . .  3.9 1.8 6.0 1 1 
       571  1 . . . . . 4.65 1.8 7.5 1 1 
       572  2 . . . . .  4.9 1.8 8.0 1 1 
       572  3 . . . . .  4.9 1.8 8.0 1 1 
       573  1 . . . . .  4.9 1.8 8.0 1 1 
       574  1 . . . . .  3.4 1.8 5.0 1 1 
       575  1 . . . . .  3.4 1.8 5.0 1 1 
       576  2 . . . . .  3.4 1.8 5.0 1 1 
       576  3 . . . . .  3.4 1.8 5.0 1 1 
       577  1 . . . . .  4.9 1.8 7.5 1 1 
       578  1 . . . . .  3.4 1.8 5.0 1 1 
       579  1 . . . . . 4.65 1.8 7.5 1 1 
       580  1 . . . . . 4.65 1.8 7.5 1 1 
       581  1 . . . . .  4.9 1.8 8.0 1 1 
       582  2 . . . . . 4.65 1.8 7.5 1 1 
       582  3 . . . . . 4.65 1.8 7.5 1 1 
       583  2 . . . . .  3.9 1.8 6.0 1 1 
       583  3 . . . . .  3.9 1.8 6.0 1 1 
       584  1 . . . . .  4.9 1.8 7.5 1 1 
       585  2 . . . . . 4.65 1.8 7.5 1 1 
       585  3 . . . . . 4.65 1.8 7.5 1 1 
       586  1 . . . . .  3.9 1.8 6.0 1 1 
       587  1 . . . . .  4.9 1.8 7.5 1 1 
       588  2 . . . . .  4.9 1.8 8.0 1 1 
       588  3 . . . . .  4.9 1.8 8.0 1 1 
       589  1 . . . . . 4.65 1.8 6.0 1 1 
       590  1 . . . . .  3.9 1.8 6.0 1 1 
       591  1 . . . . . 4.65 1.8 7.5 1 1 
       592  1 . . . . . 4.65 1.8 6.0 1 1 
       593  1 . . . . .  3.9 1.8 6.0 1 1 
       594  1 . . . . .  3.9 1.8 6.0 1 1 
       595  1 . . . . . 4.65 1.8 7.5 1 1 
       596  1 . . . . . 4.65 1.8 7.5 1 1 
       597  2 . . . . .  4.9 1.8 8.0 1 1 
       597  3 . . . . .  4.9 1.8 8.0 1 1 
       598  1 . . . . .  3.9 1.8 6.0 1 1 
       599  1 . . . . .  3.9 1.8 6.0 1 1 
       600  1 . . . . . 4.65 1.8 7.5 1 1 
       601  2 . . . . . 4.65 1.8 7.5 1 1 
       601  3 . . . . . 4.65 1.8 7.5 1 1 
       602  2 . . . . .  3.9 1.8 6.0 1 1 
       602  3 . . . . .  3.9 1.8 6.0 1 1 
       603  1 . . . . . 4.65 1.8 7.5 1 1 
       604  1 . . . . .  4.9 1.8 8.0 1 1 
       605  1 . . . . .  3.9 1.8 6.0 1 1 
       606  2 . . . . .  4.9 1.8 8.0 1 1 
       606  3 . . . . .  4.9 1.8 8.0 1 1 
       607  2 . . . . . 4.65 1.8 7.5 1 1 
       607  3 . . . . . 4.65 1.8 7.5 1 1 
       607  4 . . . . . 4.65 1.8 7.5 1 1 
       608  1 . . . . . 4.65 1.8 7.5 1 1 
       609  1 . . . . .  4.9 1.8 8.0 1 1 
       610  1 . . . . .  3.9 1.8 5.0 1 1 
       611  1 . . . . . 4.65 1.8 7.5 1 1 
       612  1 . . . . . 4.65 1.8 7.5 1 1 
       613  1 . . . . . 4.65 1.8 7.5 1 1 
       614  2 . . . . . 4.65 1.8 7.5 1 1 
       614  3 . . . . . 4.65 1.8 7.5 1 1 
       615  1 . . . . .  4.9 1.8 8.0 1 1 
       616  2 . . . . . 4.65 1.8 7.5 1 1 
       616  3 . . . . . 4.65 1.8 7.5 1 1 
       617  2 . . . . . 4.65 1.8 7.5 1 1 
       617  3 . . . . . 4.65 1.8 7.5 1 1 
       618  2 . . . . . 4.65 1.8 7.5 1 1 
       618  3 . . . . . 4.65 1.8 7.5 1 1 
       618  4 . . . . . 4.65 1.8 7.5 1 1 
       619  1 . . . . .  4.9 1.8 8.0 1 1 
       620  1 . . . . . 4.65 1.8 7.5 1 1 
       621  2 . . . . . 4.65 1.8 7.5 1 1 
       621  3 . . . . . 4.65 1.8 7.5 1 1 
       622  1 . . . . .  3.9 1.8 6.0 1 1 
       623  2 . . . . .  3.9 1.8 6.0 1 1 
       623  3 . . . . .  3.9 1.8 6.0 1 1 
       624  2 . . . . .  3.4 1.8 5.0 1 1 
       624  3 . . . . .  3.4 1.8 5.0 1 1 
       624  4 . . . . .  3.4 1.8 5.0 1 1 
       624  5 . . . . .  3.4 1.8 5.0 1 1 
       624  6 . . . . .  3.4 1.8 5.0 1 1 
       624  7 . . . . .  3.4 1.8 5.0 1 1 
       625  2 . . . . . 4.65 1.8 7.5 1 1 
       625  3 . . . . . 4.65 1.8 7.5 1 1 
       626  1 . . . . . 4.65 1.8 7.5 1 1 
       627  1 . . . . . 4.65 1.8 7.5 1 1 
       628  2 . . . . .  3.9 1.8 6.0 1 1 
       628  3 . . . . .  3.9 1.8 6.0 1 1 
       629  1 . . . . .  4.9 1.8 8.0 1 1 
       630  2 . . . . . 4.65 1.8 7.5 1 1 
       630  3 . . . . . 4.65 1.8 7.5 1 1 
       631  1 . . . . . 4.65 1.8 7.5 1 1 
       632  1 . . . . .  3.9 1.8 6.0 1 1 
       633  2 . . . . .  3.9 1.8 6.0 1 1 
       633  3 . . . . .  3.9 1.8 6.0 1 1 
       634  1 . . . . .  3.9 1.8 6.0 1 1 
       635  2 . . . . .  3.4 1.8 5.0 1 1 
       635  3 . . . . .  3.4 1.8 5.0 1 1 
       635  4 . . . . .  3.4 1.8 5.0 1 1 
       636  2 . . . . .  3.4 1.8 5.0 1 1 
       636  3 . . . . .  3.4 1.8 5.0 1 1 
       636  4 . . . . .  3.4 1.8 5.0 1 1 
       637  1 . . . . .  3.9 1.8 6.0 1 1 
       638  2 . . . . . 4.65 1.8 7.5 1 1 
       638  3 . . . . . 4.65 1.8 7.5 1 1 
       639  1 . . . . . 4.65 1.8 7.5 1 1 
       640  1 . . . . .  3.9 1.8 6.0 1 1 
       641  2 . . . . .  3.9 1.8 6.0 1 1 
       641  3 . . . . .  3.9 1.8 6.0 1 1 
       642  1 . . . . . 4.65 1.8 7.5 1 1 
       643  1 . . . . . 4.65 1.8 7.5 1 1 
       644  2 . . . . . 4.65 1.8 7.5 1 1 
       644  3 . . . . . 4.65 1.8 7.5 1 1 
       645  2 . . . . .  3.9 1.8 6.0 1 1 
       645  3 . . . . .  3.9 1.8 6.0 1 1 
       646  2 . . . . .  4.9 1.8 8.0 1 1 
       646  3 . . . . .  4.9 1.8 8.0 1 1 
       647  1 . . . . .  3.9 1.8 6.0 1 1 
       648  1 . . . . .  3.9 1.8 6.0 1 1 
       649  1 . . . . .  4.9 1.8 8.0 1 1 
       650  2 . . . . .  3.4 1.8 5.0 1 1 
       650  3 . . . . .  3.4 1.8 5.0 1 1 
       651  1 . . . . .  4.9 1.8 8.0 1 1 
       652  1 . . . . .  3.9 1.8 6.0 1 1 
       653  1 . . . . . 4.65 1.8 7.5 1 1 
       654  1 . . . . . 4.65 1.8 7.5 1 1 
       655  1 . . . . .  4.9 1.8 8.0 1 1 
       656  2 . . . . .  3.4 1.8 5.0 1 1 
       656  3 . . . . .  3.4 1.8 5.0 1 1 
       656  4 . . . . .  3.4 1.8 5.0 1 1 
       657  2 . . . . .  4.9 1.8 8.0 1 1 
       657  3 . . . . .  4.9 1.8 8.0 1 1 
       658  2 . . . . . 4.65 1.8 7.5 1 1 
       658  3 . . . . . 4.65 1.8 7.5 1 1 
       658  4 . . . . . 4.65 1.8 7.5 1 1 
       659  2 . . . . . 4.65 1.8 7.5 1 1 
       659  3 . . . . . 4.65 1.8 7.5 1 1 
       659  4 . . . . . 4.65 1.8 7.5 1 1 
       660  1 . . . . .  3.4 1.8 5.0 1 1 
       661  1 . . . . .  3.4 1.8 5.0 1 1 
       662  1 . . . . .  3.9 1.8 6.0 1 1 
       663  2 . . . . . 4.65 1.8 7.5 1 1 
       663  3 . . . . . 4.65 1.8 7.5 1 1 
       664  2 . . . . .  3.4 1.8 5.0 1 1 
       664  3 . . . . .  3.4 1.8 5.0 1 1 
       665  1 . . . . . 4.65 1.8 7.5 1 1 
       666  1 . . . . .  3.9 1.8 6.0 1 1 
       667  1 . . . . .  3.4 1.8 5.0 1 1 
       668  1 . . . . .  3.9 1.8 6.0 1 1 
       669  1 . . . . .  3.9 1.8 6.0 1 1 
       670  1 . . . . . 4.65 1.8 7.5 1 1 
       671  2 . . . . . 4.65 1.8 7.5 1 1 
       671  3 . . . . . 4.65 1.8 7.5 1 1 
       672  1 . . . . .  3.9 1.8 6.0 1 1 
       673  1 . . . . . 4.65 1.8 7.5 1 1 
       674  1 . . . . . 4.65 1.8 7.5 1 1 
       675  1 . . . . .  3.9 1.8 6.0 1 1 
       676  2 . . . . .  3.9 1.8 6.0 1 1 
       676  3 . . . . .  3.9 1.8 6.0 1 1 
       677  2 . . . . .  3.9 1.8 6.0 1 1 
       677  3 . . . . .  3.9 1.8 6.0 1 1 
       678  2 . . . . .  3.4 1.8 5.0 1 1 
       678  3 . . . . .  3.4 1.8 5.0 1 1 
       678  4 . . . . .  3.4 1.8 5.0 1 1 
       678  5 . . . . .  3.4 1.8 5.0 1 1 
       679  1 . . . . .  4.9 1.8 8.0 1 1 
       680  1 . . . . .  4.9 1.8 8.0 1 1 
       681  1 . . . . .  4.9 1.8 8.0 1 1 
       682  1 . . . . . 4.65 1.8 7.5 1 1 
       683  1 . . . . . 4.65 1.8 7.5 1 1 
       684  1 . . . . .  3.4 1.8 5.0 1 1 
       685  1 . . . . .  4.9 1.8 8.0 1 1 
       686  1 . . . . .  3.9 1.8 6.0 1 1 
       687  2 . . . . .  4.9 1.8 8.0 1 1 
       687  3 . . . . .  4.9 1.8 8.0 1 1 
       688  1 . . . . . 4.65 1.8 7.5 1 1 
       689  1 . . . . . 4.65 1.8 7.5 1 1 
       690  1 . . . . .  3.4 1.8 5.0 1 1 
       691  1 . . . . . 4.65 1.8 7.5 1 1 
       692  1 . . . . . 4.65 1.8 6.0 1 1 
       693  1 . . . . .  3.9 1.8 6.0 1 1 
       694  1 . . . . . 4.65 1.8 7.5 1 1 
       695  1 . . . . .  3.9 1.8 5.0 1 1 
       696  1 . . . . .  3.9 1.8 5.0 1 1 
       697  2 . . . . .  3.9 1.8 6.0 1 1 
       697  3 . . . . .  3.9 1.8 6.0 1 1 
       698  1 . . . . .  3.9 1.8 5.0 1 1 
       699  1 . . . . .  4.9 1.8 8.0 1 1 
       700  1 . . . . .  4.9 1.8 8.0 1 1 
       701  2 . . . . .  3.9 1.8 6.0 1 1 
       701  3 . . . . .  3.9 1.8 6.0 1 1 
       702  2 . . . . . 4.65 1.8 7.5 1 1 
       702  3 . . . . . 4.65 1.8 7.5 1 1 
       703  2 . . . . . 4.65 1.8 7.5 1 1 
       703  3 . . . . . 4.65 1.8 7.5 1 1 
       704  1 . . . . .  4.9 1.8 7.5 1 1 
       705  1 . . . . . 4.65 1.8 6.0 1 1 
       706  1 . . . . .  4.9 1.8 8.0 1 1 
       707  1 . . . . .  3.9 1.8 6.0 1 1 
       708  1 . . . . . 4.65 1.8 7.5 1 1 
       709  2 . . . . . 4.65 1.8 7.5 1 1 
       709  3 . . . . . 4.65 1.8 7.5 1 1 
       710  1 . . . . . 4.65 1.8 7.5 1 1 
       711  1 . . . . .  3.9 1.8 6.0 1 1 
       712  1 . . . . . 4.65 1.8 7.5 1 1 
       713  1 . . . . .  4.9 1.8 8.0 1 1 
       714  1 . . . . .  3.9 1.8 6.0 1 1 
       715  1 . . . . . 4.65 1.8 7.5 1 1 
       716  1 . . . . .  4.9 1.8 8.0 1 1 
       717  1 . . . . . 4.65 1.8 7.5 1 1 
       718  1 . . . . .  3.4 1.8 5.0 1 1 
       719  1 . . . . . 4.65 1.8 7.5 1 1 
       720  1 . . . . .  4.9 1.8 8.0 1 1 
       721  1 . . . . . 4.65 1.8 7.5 1 1 
       722  1 . . . . . 4.65 1.8 7.5 1 1 
       723  1 . . . . .  3.9 1.8 6.0 1 1 
       724  1 . . . . .  3.4 1.8 5.0 1 1 
       725  1 . . . . . 4.65 1.8 7.5 1 1 
       726  1 . . . . . 4.65 1.8 7.5 1 1 
       727  2 . . . . .  3.9 1.8 6.0 1 1 
       727  3 . . . . .  3.9 1.8 6.0 1 1 
       728  1 . . . . . 4.65 1.8 7.5 1 1 
       729  1 . . . . .  3.4 1.8 5.0 1 1 
       730  1 . . . . . 4.65 1.8 7.5 1 1 
       731  1 . . . . . 4.65 1.8 7.5 1 1 
       732  2 . . . . . 4.65 1.8 7.5 1 1 
       732  3 . . . . . 4.65 1.8 7.5 1 1 
       733  1 . . . . . 4.65 1.8 7.5 1 1 
       734  1 . . . . .  3.9 1.8 6.0 1 1 
       735  1 . . . . .  3.9 1.8 6.0 1 1 
       736  1 . . . . .  3.9 1.8 6.0 1 1 
       737  1 . . . . . 4.65 1.8 7.5 1 1 
       738  1 . . . . .  3.4 1.8 5.0 1 1 
       739  1 . . . . .  3.9 1.8 6.0 1 1 
       740  1 . . . . . 4.65 1.8 7.5 1 1 
       741  1 . . . . .  4.9 1.8 8.0 1 1 
       742  1 . . . . .  3.9 1.8 6.0 1 1 
       743  1 . . . . .  3.9 1.8 6.0 1 1 
       744  1 . . . . .  4.9 1.8 8.0 1 1 
       745  1 . . . . .  4.9 1.8 8.0 1 1 
       746  2 . . . . .  3.4 1.8 5.0 1 1 
       746  3 . . . . .  3.4 1.8 5.0 1 1 
       747  1 . . . . .  3.4 1.8 5.0 1 1 
       748  1 . . . . .  3.9 1.8 6.0 1 1 
       749  1 . . . . .  4.9 1.8 8.0 1 1 
       750  2 . . . . .  3.4 1.8 5.0 1 1 
       750  3 . . . . .  3.4 1.8 5.0 1 1 
       751  1 . . . . . 4.65 1.8 7.5 1 1 
       752  1 . . . . .  3.4 1.8 5.0 1 1 
       753  1 . . . . . 4.65 1.8 7.5 1 1 
       754  1 . . . . .  3.9 1.8 6.0 1 1 
       755  1 . . . . . 4.65 1.8 7.5 1 1 
       756  1 . . . . . 4.65 1.8 7.5 1 1 
       757  1 . . . . .  3.9 1.8 6.0 1 1 
       758  1 . . . . . 4.65 1.8 7.5 1 1 
       759  1 . . . . . 4.65 1.8 7.5 1 1 
       760  1 . . . . .  3.9 1.8 6.0 1 1 
       761  1 . . . . .  3.9 1.8 6.0 1 1 
       762  1 . . . . . 4.65 1.8 7.5 1 1 
       763  1 . . . . .  3.9 1.8 6.0 1 1 
       764  1 . . . . .  3.4 1.8 5.0 1 1 
       765  1 . . . . . 4.65 1.8 7.5 1 1 
       766  1 . . . . .  3.9 1.8 6.0 1 1 
       767  2 . . . . .  4.9 1.8 8.0 1 1 
       767  3 . . . . .  4.9 1.8 8.0 1 1 
       768  1 . . . . .  4.9 1.8 8.0 1 1 
       769  1 . . . . .  3.4 1.8 5.0 1 1 
       770  1 . . . . .  3.9 1.8 6.0 1 1 
       771  1 . . . . .  4.9 1.8 8.0 1 1 
       772  1 . . . . .  4.9 1.8 8.0 1 1 
    stop_

save_


save_CNS/XPLOR_dihedral_2
    _Torsion_angle_constraint_list.Sf_category         torsion_angle_constraints
    _Torsion_angle_constraint_list.Entry_ID            1
    _Torsion_angle_constraint_list.ID                  1
    _Torsion_angle_constraint_list.Constraint_file_ID  .
    _Torsion_angle_constraint_list.Block_ID            .

    loop_
       _Torsion_angle_constraint.ID
       _Torsion_angle_constraint.Torsion_angle_name
       _Torsion_angle_constraint.Entity_assembly_ID_1
       _Torsion_angle_constraint.Entity_ID_1
       _Torsion_angle_constraint.Comp_index_ID_1
       _Torsion_angle_constraint.Comp_ID_1
       _Torsion_angle_constraint.Atom_ID_1
       _Torsion_angle_constraint.Entity_assembly_ID_2
       _Torsion_angle_constraint.Entity_ID_2
       _Torsion_angle_constraint.Comp_index_ID_2
       _Torsion_angle_constraint.Comp_ID_2
       _Torsion_angle_constraint.Atom_ID_2
       _Torsion_angle_constraint.Entity_assembly_ID_3
       _Torsion_angle_constraint.Entity_ID_3
       _Torsion_angle_constraint.Comp_index_ID_3
       _Torsion_angle_constraint.Comp_ID_3
       _Torsion_angle_constraint.Atom_ID_3
       _Torsion_angle_constraint.Entity_assembly_ID_4
       _Torsion_angle_constraint.Entity_ID_4
       _Torsion_angle_constraint.Comp_index_ID_4
       _Torsion_angle_constraint.Comp_ID_4
       _Torsion_angle_constraint.Atom_ID_4
       _Torsion_angle_constraint.Angle_lower_bound_val
       _Torsion_angle_constraint.Angle_upper_bound_val
       _Torsion_angle_constraint.Auth_asym_ID_1
       _Torsion_angle_constraint.Auth_seq_ID_1
       _Torsion_angle_constraint.Auth_comp_ID_1
       _Torsion_angle_constraint.Auth_atom_ID_1
       _Torsion_angle_constraint.Auth_asym_ID_2
       _Torsion_angle_constraint.Auth_seq_ID_2
       _Torsion_angle_constraint.Auth_comp_ID_2
       _Torsion_angle_constraint.Auth_atom_ID_2
       _Torsion_angle_constraint.Auth_asym_ID_3
       _Torsion_angle_constraint.Auth_seq_ID_3
       _Torsion_angle_constraint.Auth_comp_ID_3
       _Torsion_angle_constraint.Auth_atom_ID_3
       _Torsion_angle_constraint.Auth_asym_ID_4
       _Torsion_angle_constraint.Auth_seq_ID_4
       _Torsion_angle_constraint.Auth_comp_ID_4
       _Torsion_angle_constraint.Auth_atom_ID_4
       _Torsion_angle_constraint.Entry_ID
       _Torsion_angle_constraint.Torsion_angle_constraint_list_ID

         1 . 1 1  10 GLN N 1 1  10 GLN CA 1 1  10 GLN C  1 1  11 GLY N       -37.4       26.8 A  10 . N A  10 . CA A  10 . C  A  11 . N 1 1 
         2 . 1 1  10 GLN C 1 1  11 GLY N  1 1  11 GLY CA 1 1  11 GLY C        68.3      208.3 A  10 . C A  11 . N  A  11 . CA A  11 . C 1 1 
         3 . 1 1  11 GLY N 1 1  11 GLY CA 1 1  11 GLY C  1 1  12 ARG N       128.3      228.9 A  11 . N A  11 . CA A  11 . C  A  12 . N 1 1 
         4 . 1 1  11 GLY C 1 1  12 ARG N  1 1  12 ARG CA 1 1  12 ARG C       -81.3      -41.3 A  11 . C A  12 . N  A  12 . CA A  12 . C 1 1 
         5 . 1 1  12 ARG N 1 1  12 ARG CA 1 1  12 ARG C  1 1  13 GLY N       -47.2 -3.8000002 A  12 . N A  12 . CA A  12 . C  A  13 . N 1 1 
         6 . 1 1  12 ARG C 1 1  13 GLY N  1 1  13 GLY CA 1 1  13 GLY C      -137.6      -22.4 A  12 . C A  13 . N  A  13 . CA A  13 . C 1 1 
         7 . 1 1  13 GLY N 1 1  13 GLY CA 1 1  13 GLY C  1 1  14 ALA N       -84.9       42.5 A  13 . N A  13 . CA A  13 . C  A  14 . N 1 1 
         8 . 1 1  13 GLY C 1 1  14 ALA N  1 1  14 ALA CA 1 1  14 ALA C       -80.4      -40.4 A  13 . C A  14 . N  A  14 . CA A  14 . C 1 1 
         9 . 1 1  14 ALA N 1 1  14 ALA CA 1 1  14 ALA C  1 1  15 TRP N       -59.6      -19.6 A  14 . N A  14 . CA A  14 . C  A  15 . N 1 1 
        10 . 1 1  14 ALA C 1 1  15 TRP N  1 1  15 TRP CA 1 1  15 TRP C       -89.2      -49.2 A  14 . C A  15 . N  A  15 . CA A  15 . C 1 1 
        11 . 1 1  15 TRP N 1 1  15 TRP CA 1 1  15 TRP C  1 1  16 LEU N       -55.2 -11.999999 A  15 . N A  15 . CA A  15 . C  A  16 . N 1 1 
        12 . 1 1  15 TRP C 1 1  16 LEU N  1 1  16 LEU CA 1 1  16 LEU C       -83.5      -43.5 A  15 . C A  16 . N  A  16 . CA A  16 . C 1 1 
        13 . 1 1  16 LEU N 1 1  16 LEU CA 1 1  16 LEU C  1 1  17 LEU N  -59.099995      -19.1 A  16 . N A  16 . CA A  16 . C  A  17 . N 1 1 
        14 . 1 1  16 LEU C 1 1  17 LEU N  1 1  17 LEU CA 1 1  17 LEU C       -84.6      -44.6 A  16 . C A  17 . N  A  17 . CA A  17 . C 1 1 
        15 . 1 1  17 LEU N 1 1  17 LEU CA 1 1  17 LEU C  1 1  18 MET N       -59.0      -19.0 A  17 . N A  17 . CA A  17 . C  A  18 . N 1 1 
        16 . 1 1  17 LEU C 1 1  18 MET N  1 1  18 MET CA 1 1  18 MET C       -87.6      -47.6 A  17 . C A  18 . N  A  18 . CA A  18 . C 1 1 
        17 . 1 1  18 MET N 1 1  18 MET CA 1 1  18 MET C  1 1  19 ALA N       -58.0      -18.0 A  18 . N A  18 . CA A  18 . C  A  19 . N 1 1 
        18 . 1 1  18 MET C 1 1  19 ALA N  1 1  19 ALA CA 1 1  19 ALA C       -84.4      -44.4 A  18 . C A  19 . N  A  19 . CA A  19 . C 1 1 
        19 . 1 1  19 ALA N 1 1  19 ALA CA 1 1  19 ALA C  1 1  20 PHE N       -66.6 -26.599998 A  19 . N A  19 . CA A  19 . C  A  20 . N 1 1 
        20 . 1 1  19 ALA C 1 1  20 PHE N  1 1  20 PHE CA 1 1  20 PHE C       -84.0      -44.0 A  19 . C A  20 . N  A  20 . CA A  20 . C 1 1 
        21 . 1 1  20 PHE N 1 1  20 PHE CA 1 1  20 PHE C  1 1  21 THR N       -67.7      -27.7 A  20 . N A  20 . CA A  20 . C  A  21 . N 1 1 
        22 . 1 1  20 PHE C 1 1  21 THR N  1 1  21 THR CA 1 1  21 THR C       -83.0      -43.0 A  20 . C A  21 . N  A  21 . CA A  21 . C 1 1 
        23 . 1 1  21 THR N 1 1  21 THR CA 1 1  21 THR C  1 1  22 ALA N       -55.0      -14.8 A  21 . N A  21 . CA A  21 . C  A  22 . N 1 1 
        24 . 1 1  21 THR C 1 1  22 ALA N  1 1  22 ALA CA 1 1  22 ALA C       -86.6      -46.6 A  21 . C A  22 . N  A  22 . CA A  22 . C 1 1 
        25 . 1 1  22 ALA N 1 1  22 ALA CA 1 1  22 ALA C  1 1  23 LEU N  -60.399998      -20.4 A  22 . N A  22 . CA A  22 . C  A  23 . N 1 1 
        26 . 1 1  22 ALA C 1 1  23 LEU N  1 1  23 LEU CA 1 1  23 LEU C       -83.1 -43.099995 A  22 . C A  23 . N  A  23 . CA A  23 . C 1 1 
        27 . 1 1  23 LEU N 1 1  23 LEU CA 1 1  23 LEU C  1 1  24 ALA N       -66.9      -26.9 A  23 . N A  23 . CA A  23 . C  A  24 . N 1 1 
        28 . 1 1  23 LEU C 1 1  24 ALA N  1 1  24 ALA CA 1 1  24 ALA C       -84.4      -44.4 A  23 . C A  24 . N  A  24 . CA A  24 . C 1 1 
        29 . 1 1  24 ALA N 1 1  24 ALA CA 1 1  24 ALA C  1 1  25 LEU N  -59.299995      -19.3 A  24 . N A  24 . CA A  24 . C  A  25 . N 1 1 
        30 . 1 1  24 ALA C 1 1  25 LEU N  1 1  25 LEU CA 1 1  25 LEU C       -85.1      -45.1 A  24 . C A  25 . N  A  25 . CA A  25 . C 1 1 
        31 . 1 1  25 LEU N 1 1  25 LEU CA 1 1  25 LEU C  1 1  26 GLU N       -61.1      -21.1 A  25 . N A  25 . CA A  25 . C  A  26 . N 1 1 
        32 . 1 1  25 LEU C 1 1  26 GLU N  1 1  26 GLU CA 1 1  26 GLU C       -82.4      -42.4 A  25 . C A  26 . N  A  26 . CA A  26 . C 1 1 
        33 . 1 1  26 GLU N 1 1  26 GLU CA 1 1  26 GLU C  1 1  27 LEU N  -59.499996      -19.5 A  26 . N A  26 . CA A  26 . C  A  27 . N 1 1 
        34 . 1 1  26 GLU C 1 1  27 LEU N  1 1  27 LEU CA 1 1  27 LEU C       -85.4      -45.4 A  26 . C A  27 . N  A  27 . CA A  27 . C 1 1 
        35 . 1 1  27 LEU N 1 1  27 LEU CA 1 1  27 LEU C  1 1  28 THR N  -60.200005      -20.2 A  27 . N A  27 . CA A  27 . C  A  28 . N 1 1 
        36 . 1 1  27 LEU C 1 1  28 THR N  1 1  28 THR CA 1 1  28 THR C       -83.3      -43.3 A  27 . C A  28 . N  A  28 . CA A  28 . C 1 1 
        37 . 1 1  28 THR N 1 1  28 THR CA 1 1  28 THR C  1 1  29 ALA N  -62.700005      -22.7 A  28 . N A  28 . CA A  28 . C  A  29 . N 1 1 
        38 . 1 1  28 THR C 1 1  29 ALA N  1 1  29 ALA CA 1 1  29 ALA C       -81.4      -41.4 A  28 . C A  29 . N  A  29 . CA A  29 . C 1 1 
        39 . 1 1  29 ALA N 1 1  29 ALA CA 1 1  29 ALA C  1 1  30 LEU N       -61.7      -21.7 A  29 . N A  29 . CA A  29 . C  A  30 . N 1 1 
        40 . 1 1  29 ALA C 1 1  30 LEU N  1 1  30 LEU CA 1 1  30 LEU C      -107.5 -30.899998 A  29 . C A  30 . N  A  30 . CA A  30 . C 1 1 
        41 . 1 1  30 LEU N 1 1  30 LEU CA 1 1  30 LEU C  1 1  31 TRP N       -66.3       -9.7 A  30 . N A  30 . CA A  30 . C  A  31 . N 1 1 
        42 . 1 1  33 GLN C 1 1  34 HIS N  1 1  34 HIS CA 1 1  34 HIS C       -83.3      -43.3 A  33 . C A  34 . N  A  34 . CA A  34 . C 1 1 
        43 . 1 1  34 HIS N 1 1  34 HIS CA 1 1  34 HIS C  1 1  35 VAL N       -62.5 -22.499998 A  34 . N A  34 . CA A  34 . C  A  35 . N 1 1 
        44 . 1 1  34 HIS C 1 1  35 VAL N  1 1  35 VAL CA 1 1  35 VAL C  -91.899994      -46.7 A  34 . C A  35 . N  A  35 . CA A  35 . C 1 1 
        45 . 1 1  35 VAL N 1 1  35 VAL CA 1 1  35 VAL C  1 1  36 MET N  -61.600002       -8.2 A  35 . N A  35 . CA A  35 . C  A  36 . N 1 1 
        46 . 1 1  35 VAL C 1 1  36 MET N  1 1  36 MET CA 1 1  36 MET C  -121.49999      -41.1 A  35 . C A  36 . N  A  36 . CA A  36 . C 1 1 
        47 . 1 1  36 MET N 1 1  36 MET CA 1 1  36 MET C  1 1  37 LEU N       -55.7       16.1 A  36 . N A  36 . CA A  36 . C  A  37 . N 1 1 
        48 . 1 1  43 LEU C 1 1  44 CYS N  1 1  44 CYS CA 1 1  44 CYS C      -111.0      -42.0 A  43 . C A  44 . N  A  44 . CA A  44 . C 1 1 
        49 . 1 1  44 CYS N 1 1  44 CYS CA 1 1  44 CYS C  1 1  45 ILE N       -52.7      -12.7 A  44 . N A  44 . CA A  44 . C  A  45 . N 1 1 
        50 . 1 1  44 CYS C 1 1  45 ILE N  1 1  45 ILE CA 1 1  45 ILE C       -92.3      -45.9 A  44 . C A  45 . N  A  45 . CA A  45 . C 1 1 
        51 . 1 1  45 ILE N 1 1  45 ILE CA 1 1  45 ILE C  1 1  46 TYR N       -53.4       -8.0 A  45 . N A  45 . CA A  45 . C  A  46 . N 1 1 
        52 . 1 1  45 ILE C 1 1  46 TYR N  1 1  46 TYR CA 1 1  46 TYR C       -84.5      -44.5 A  45 . C A  46 . N  A  46 . CA A  46 . C 1 1 
        53 . 1 1  46 TYR N 1 1  46 TYR CA 1 1  46 TYR C  1 1  47 GLU N       -57.1      -17.1 A  46 . N A  46 . CA A  46 . C  A  47 . N 1 1 
        54 . 1 1  46 TYR C 1 1  47 GLU N  1 1  47 GLU CA 1 1  47 GLU C       -82.3      -42.3 A  46 . C A  47 . N  A  47 . CA A  47 . C 1 1 
        55 . 1 1  47 GLU N 1 1  47 GLU CA 1 1  47 GLU C  1 1  48 ARG N       -64.9      -24.9 A  47 . N A  47 . CA A  47 . C  A  48 . N 1 1 
        56 . 1 1  47 GLU C 1 1  48 ARG N  1 1  48 ARG CA 1 1  48 ARG C   -85.59999      -45.6 A  47 . C A  48 . N  A  48 . CA A  48 . C 1 1 
        57 . 1 1  48 ARG N 1 1  48 ARG CA 1 1  48 ARG C  1 1  49 VAL N  -59.099995      -19.1 A  48 . N A  48 . CA A  48 . C  A  49 . N 1 1 
        58 . 1 1  48 ARG C 1 1  49 VAL N  1 1  49 VAL CA 1 1  49 VAL C       -85.4      -45.4 A  48 . C A  49 . N  A  49 . CA A  49 . C 1 1 
        59 . 1 1  49 VAL N 1 1  49 VAL CA 1 1  49 VAL C  1 1  50 ALA N       -64.6      -24.6 A  49 . N A  49 . CA A  49 . C  A  50 . N 1 1 
        60 . 1 1  49 VAL C 1 1  50 ALA N  1 1  50 ALA CA 1 1  50 ALA C       -81.6      -41.6 A  49 . C A  50 . N  A  50 . CA A  50 . C 1 1 
        61 . 1 1  50 ALA N 1 1  50 ALA CA 1 1  50 ALA C  1 1  51 LEU N       -58.9      -18.9 A  50 . N A  50 . CA A  50 . C  A  51 . N 1 1 
        62 . 1 1  50 ALA C 1 1  51 LEU N  1 1  51 LEU CA 1 1  51 LEU C       -84.0      -44.0 A  50 . C A  51 . N  A  51 . CA A  51 . C 1 1 
        63 . 1 1  51 LEU N 1 1  51 LEU CA 1 1  51 LEU C  1 1  52 PHE N       -62.1      -22.1 A  51 . N A  51 . CA A  51 . C  A  52 . N 1 1 
        64 . 1 1  51 LEU C 1 1  52 PHE N  1 1  52 PHE CA 1 1  52 PHE C       -85.5      -45.5 A  51 . C A  52 . N  A  52 . CA A  52 . C 1 1 
        65 . 1 1  52 PHE N 1 1  52 PHE CA 1 1  52 PHE C  1 1  53 GLY N  -62.199997      -22.2 A  52 . N A  52 . CA A  52 . C  A  53 . N 1 1 
        66 . 1 1  52 PHE C 1 1  53 GLY N  1 1  53 GLY CA 1 1  53 GLY C       -85.8      -45.8 A  52 . C A  53 . N  A  53 . CA A  53 . C 1 1 
        67 . 1 1  53 GLY N 1 1  53 GLY CA 1 1  53 GLY C  1 1  54 VAL N  -60.299995      -20.3 A  53 . N A  53 . CA A  53 . C  A  54 . N 1 1 
        68 . 1 1  53 GLY C 1 1  54 VAL N  1 1  54 VAL CA 1 1  54 VAL C       -82.6      -42.6 A  53 . C A  54 . N  A  54 . CA A  54 . C 1 1 
        69 . 1 1  54 VAL N 1 1  54 VAL CA 1 1  54 VAL C  1 1  55 LEU N       -63.8      -23.8 A  54 . N A  54 . CA A  54 . C  A  55 . N 1 1 
        70 . 1 1  54 VAL C 1 1  55 LEU N  1 1  55 LEU CA 1 1  55 LEU C   -83.69999      -43.7 A  54 . C A  55 . N  A  55 . CA A  55 . C 1 1 
        71 . 1 1  55 LEU N 1 1  55 LEU CA 1 1  55 LEU C  1 1  56 GLY N       -67.1 -13.299999 A  55 . N A  55 . CA A  55 . C  A  56 . N 1 1 
        72 . 1 1  55 LEU C 1 1  56 GLY N  1 1  56 GLY CA 1 1  56 GLY C       -82.9      -42.9 A  55 . C A  56 . N  A  56 . CA A  56 . C 1 1 
        73 . 1 1  56 GLY N 1 1  56 GLY CA 1 1  56 GLY C  1 1  57 ALA N  -61.199997      -15.8 A  56 . N A  56 . CA A  56 . C  A  57 . N 1 1 
        74 . 1 1  56 GLY C 1 1  57 ALA N  1 1  57 ALA CA 1 1  57 ALA C       -80.8      -40.8 A  56 . C A  57 . N  A  57 . CA A  57 . C 1 1 
        75 . 1 1  57 ALA N 1 1  57 ALA CA 1 1  57 ALA C  1 1  58 ALA N       -62.1      -22.1 A  57 . N A  57 . CA A  57 . C  A  58 . N 1 1 
        76 . 1 1  57 ALA C 1 1  58 ALA N  1 1  58 ALA CA 1 1  58 ALA C       -83.2      -43.2 A  57 . C A  58 . N  A  58 . CA A  58 . C 1 1 
        77 . 1 1  58 ALA N 1 1  58 ALA CA 1 1  58 ALA C  1 1  59 LEU N       -58.8      -18.8 A  58 . N A  58 . CA A  58 . C  A  59 . N 1 1 
        78 . 1 1  58 ALA C 1 1  59 LEU N  1 1  59 LEU CA 1 1  59 LEU C       -86.7      -46.7 A  58 . C A  59 . N  A  59 . CA A  59 . C 1 1 
        79 . 1 1  59 LEU N 1 1  59 LEU CA 1 1  59 LEU C  1 1  60 ILE N       -60.6      -20.6 A  59 . N A  59 . CA A  59 . C  A  60 . N 1 1 
        80 . 1 1  59 LEU C 1 1  60 ILE N  1 1  60 ILE CA 1 1  60 ILE C -115.799995      -34.0 A  59 . C A  60 . N  A  60 . CA A  60 . C 1 1 
        81 . 1 1  60 ILE N 1 1  60 ILE CA 1 1  60 ILE C  1 1  61 GLY N       -60.9       -6.3 A  60 . N A  60 . CA A  60 . C  A  61 . N 1 1 
        82 . 1 1  60 ILE C 1 1  61 GLY N  1 1  61 GLY CA 1 1  61 GLY C      -108.8      -36.4 A  60 . C A  61 . N  A  61 . CA A  61 . C 1 1 
        83 . 1 1  61 GLY N 1 1  61 GLY CA 1 1  61 GLY C  1 1  62 ALA N       -41.6        3.2 A  61 . N A  61 . CA A  61 . C  A  62 . N 1 1 
        84 . 1 1  61 GLY C 1 1  62 ALA N  1 1  62 ALA CA 1 1  62 ALA C      -118.5 -31.299997 A  61 . C A  62 . N  A  62 . CA A  62 . C 1 1 
        85 . 1 1  62 ALA N 1 1  62 ALA CA 1 1  62 ALA C  1 1  63 ILE N       -75.4       37.6 A  62 . N A  62 . CA A  62 . C  A  63 . N 1 1 
        86 . 1 1  62 ALA C 1 1  63 ILE N  1 1  63 ILE CA 1 1  63 ILE C  -106.69999      -29.3 A  62 . C A  63 . N  A  63 . CA A  63 . C 1 1 
        87 . 1 1  63 ILE N 1 1  63 ILE CA 1 1  63 ILE C  1 1  64 ALA N       -61.9      -19.7 A  63 . N A  63 . CA A  63 . C  A  64 . N 1 1 
        88 . 1 1  68 PRO C 1 1  69 LEU N  1 1  69 LEU CA 1 1  69 LEU C       -78.1      -38.1 A  68 . C A  69 . N  A  69 . CA A  69 . C 1 1 
        89 . 1 1  69 LEU N 1 1  69 LEU CA 1 1  69 LEU C  1 1  70 ARG N       -59.2       -8.6 A  69 . N A  69 . CA A  69 . C  A  70 . N 1 1 
        90 . 1 1  69 LEU C 1 1  70 ARG N  1 1  70 ARG CA 1 1  70 ARG C       -97.6      -57.0 A  69 . C A  70 . N  A  70 . CA A  70 . C 1 1 
        91 . 1 1  70 ARG N 1 1  70 ARG CA 1 1  70 ARG C  1 1  71 TYR N  -30.199999       15.0 A  70 . N A  70 . CA A  70 . C  A  71 . N 1 1 
        92 . 1 1  70 ARG C 1 1  71 TYR N  1 1  71 TYR CA 1 1  71 TYR C -125.299995      -36.3 A  70 . C A  71 . N  A  71 . CA A  71 . C 1 1 
        93 . 1 1  71 TYR N 1 1  71 TYR CA 1 1  71 TYR C  1 1  72 VAL N  -83.399994       26.4 A  71 . N A  71 . CA A  71 . C  A  72 . N 1 1 
        94 . 1 1  71 TYR C 1 1  72 VAL N  1 1  72 VAL CA 1 1  72 VAL C       -81.3      -41.3 A  71 . C A  72 . N  A  72 . CA A  72 . C 1 1 
        95 . 1 1  72 VAL N 1 1  72 VAL CA 1 1  72 VAL C  1 1  73 ALA N       -64.2      -24.2 A  72 . N A  72 . CA A  72 . C  A  73 . N 1 1 
        96 . 1 1  72 VAL C 1 1  73 ALA N  1 1  73 ALA CA 1 1  73 ALA C       -79.8 -39.799995 A  72 . C A  73 . N  A  73 . CA A  73 . C 1 1 
        97 . 1 1  73 ALA N 1 1  73 ALA CA 1 1  73 ALA C  1 1  74 MET N       -60.7      -20.7 A  73 . N A  73 . CA A  73 . C  A  74 . N 1 1 
        98 . 1 1  73 ALA C 1 1  74 MET N  1 1  74 MET CA 1 1  74 MET C       -85.5      -45.5 A  73 . C A  74 . N  A  74 . CA A  74 . C 1 1 
        99 . 1 1  74 MET N 1 1  74 MET CA 1 1  74 MET C  1 1  75 VAL N  -62.599995      -22.6 A  74 . N A  74 . CA A  74 . C  A  75 . N 1 1 
       100 . 1 1  74 MET C 1 1  75 VAL N  1 1  75 VAL CA 1 1  75 VAL C       -85.7      -45.7 A  74 . C A  75 . N  A  75 . CA A  75 . C 1 1 
       101 . 1 1  75 VAL N 1 1  75 VAL CA 1 1  75 VAL C  1 1  76 ILE N       -65.3      -25.3 A  75 . N A  75 . CA A  75 . C  A  76 . N 1 1 
       102 . 1 1  75 VAL C 1 1  76 ILE N  1 1  76 ILE CA 1 1  76 ILE C       -86.0      -46.0 A  75 . C A  76 . N  A  76 . CA A  76 . C 1 1 
       103 . 1 1  76 ILE N 1 1  76 ILE CA 1 1  76 ILE C  1 1  77 TRP N  -59.099995      -19.1 A  76 . N A  76 . CA A  76 . C  A  77 . N 1 1 
       104 . 1 1  76 ILE C 1 1  77 TRP N  1 1  77 TRP CA 1 1  77 TRP C       -81.1      -41.1 A  76 . C A  77 . N  A  77 . CA A  77 . C 1 1 
       105 . 1 1  77 TRP N 1 1  77 TRP CA 1 1  77 TRP C  1 1  78 LEU N       -63.0      -23.0 A  77 . N A  77 . CA A  77 . C  A  78 . N 1 1 
       106 . 1 1  77 TRP C 1 1  78 LEU N  1 1  78 LEU CA 1 1  78 LEU C       -84.7 -44.699997 A  77 . C A  78 . N  A  78 . CA A  78 . C 1 1 
       107 . 1 1  78 LEU N 1 1  78 LEU CA 1 1  78 LEU C  1 1  79 TYR N       -59.6      -19.6 A  78 . N A  78 . CA A  78 . C  A  79 . N 1 1 
       108 . 1 1  78 LEU C 1 1  79 TYR N  1 1  79 TYR CA 1 1  79 TYR C       -83.1 -43.099995 A  78 . C A  79 . N  A  79 . CA A  79 . C 1 1 
       109 . 1 1  79 TYR N 1 1  79 TYR CA 1 1  79 TYR C  1 1  80 SER N  -60.800003      -20.8 A  79 . N A  79 . CA A  79 . C  A  80 . N 1 1 
       110 . 1 1  79 TYR C 1 1  80 SER N  1 1  80 SER CA 1 1  80 SER C       -78.9      -38.9 A  79 . C A  80 . N  A  80 . CA A  80 . C 1 1 
       111 . 1 1  80 SER N 1 1  80 SER CA 1 1  80 SER C  1 1  81 ALA N       -60.0      -20.0 A  80 . N A  80 . CA A  80 . C  A  81 . N 1 1 
       112 . 1 1  80 SER C 1 1  81 ALA N  1 1  81 ALA CA 1 1  81 ALA C  -106.69999 -30.100002 A  80 . C A  81 . N  A  81 . CA A  81 . C 1 1 
       113 . 1 1  81 ALA N 1 1  81 ALA CA 1 1  81 ALA C  1 1  82 PHE N       -62.4 -15.400001 A  81 . N A  81 . CA A  81 . C  A  82 . N 1 1 
       114 . 1 1  83 ARG C 1 1  84 GLY N  1 1  84 GLY CA 1 1  84 GLY C       -80.8      -40.8 A  83 . C A  84 . N  A  84 . CA A  84 . C 1 1 
       115 . 1 1  84 GLY N 1 1  84 GLY CA 1 1  84 GLY C  1 1  85 VAL N       -63.2      -23.2 A  84 . N A  84 . CA A  84 . C  A  85 . N 1 1 
       116 . 1 1  84 GLY C 1 1  85 VAL N  1 1  85 VAL CA 1 1  85 VAL C       -82.7      -42.7 A  84 . C A  85 . N  A  85 . CA A  85 . C 1 1 
       117 . 1 1  85 VAL N 1 1  85 VAL CA 1 1  85 VAL C  1 1  86 GLN N       -62.3      -22.3 A  85 . N A  85 . CA A  85 . C  A  86 . N 1 1 
       118 . 1 1  85 VAL C 1 1  86 GLN N  1 1  86 GLN CA 1 1  86 GLN C       -85.2      -45.2 A  85 . C A  86 . N  A  86 . CA A  86 . C 1 1 
       119 . 1 1  86 GLN N 1 1  86 GLN CA 1 1  86 GLN C  1 1  87 LEU N  -59.499996      -19.5 A  86 . N A  86 . CA A  86 . C  A  87 . N 1 1 
       120 . 1 1  86 GLN C 1 1  87 LEU N  1 1  87 LEU CA 1 1  87 LEU C       -82.7      -42.7 A  86 . C A  87 . N  A  87 . CA A  87 . C 1 1 
       121 . 1 1  87 LEU N 1 1  87 LEU CA 1 1  87 LEU C  1 1  88 THR N       -61.3      -21.3 A  87 . N A  87 . CA A  87 . C  A  88 . N 1 1 
       122 . 1 1  87 LEU C 1 1  88 THR N  1 1  88 THR CA 1 1  88 THR C      -113.6      -34.0 A  87 . C A  88 . N  A  88 . CA A  88 . C 1 1 
       123 . 1 1  88 THR N 1 1  88 THR CA 1 1  88 THR C  1 1  89 TYR N       -82.9       17.7 A  88 . N A  88 . CA A  88 . C  A  89 . N 1 1 
       124 . 1 1  91 HIS C 1 1  92 THR N  1 1  92 THR CA 1 1  92 THR C       -83.8      -43.8 A  91 . C A  92 . N  A  92 . CA A  92 . C 1 1 
       125 . 1 1  92 THR N 1 1  92 THR CA 1 1  92 THR C  1 1  93 MET N  -61.999996      -22.0 A  92 . N A  92 . CA A  92 . C  A  93 . N 1 1 
       126 . 1 1  92 THR C 1 1  93 MET N  1 1  93 MET CA 1 1  93 MET C       -79.0      -39.0 A  92 . C A  93 . N  A  93 . CA A  93 . C 1 1 
       127 . 1 1  93 MET N 1 1  93 MET CA 1 1  93 MET C  1 1  94 LEU N  -61.600002      -21.6 A  93 . N A  93 . CA A  93 . C  A  94 . N 1 1 
       128 . 1 1  93 MET C 1 1  94 LEU N  1 1  94 LEU CA 1 1  94 LEU C      -112.1      -29.5 A  93 . C A  94 . N  A  94 . CA A  94 . C 1 1 
       129 . 1 1  94 LEU N 1 1  94 LEU CA 1 1  94 LEU C  1 1  95 GLN N       -67.1       -4.1 A  94 . N A  94 . CA A  94 . C  A  95 . N 1 1 
       130 . 1 1 102 ALA C 1 1 103 THR N  1 1 103 THR CA 1 1 103 THR C      -154.5      -64.3 A 102 . C A 103 . N  A 103 . CA A 103 . C 1 1 
       131 . 1 1 103 THR N 1 1 103 THR CA 1 1 103 THR C  1 1 104 CYS N  115.399994      165.6 A 103 . N A 103 . CA A 103 . C  A 104 . N 1 1 
       132 . 1 1 103 THR C 1 1 104 CYS N  1 1 104 CYS CA 1 1 104 CYS C  -152.29999     -112.3 A 103 . C A 104 . N  A 104 . CA A 104 . C 1 1 
       133 . 1 1 104 CYS N 1 1 104 CYS CA 1 1 104 CYS C  1 1 105 ASP N  127.799995      173.6 A 104 . N A 104 . CA A 104 . C  A 105 . N 1 1 
       134 . 1 1 104 CYS C 1 1 105 ASP N  1 1 105 ASP CA 1 1 105 ASP C      -126.8      -43.8 A 104 . C A 105 . N  A 105 . CA A 105 . C 1 1 
       135 . 1 1 105 ASP N 1 1 105 ASP CA 1 1 105 ASP C  1 1 106 PHE N  106.399994      172.0 A 105 . N A 105 . CA A 105 . C  A 106 . N 1 1 
       136 . 1 1 119 TRP C 1 1 120 VAL N  1 1 120 VAL CA 1 1 120 VAL C      -174.1  -83.69999 A 119 . C A 120 . N  A 120 . CA A 120 . C 1 1 
       137 . 1 1 120 VAL N 1 1 120 VAL CA 1 1 120 VAL C  1 1 121 PRO N       142.6  205.19998 A 120 . N A 120 . CA A 120 . C  A 121 . N 1 1 
       138 . 1 1 120 VAL C 1 1 121 PRO N  1 1 121 PRO CA 1 1 121 PRO C       -78.2      -38.2 A 120 . C A 121 . N  A 121 . CA A 121 . C 1 1 
       139 . 1 1 121 PRO N 1 1 121 PRO CA 1 1 121 PRO C  1 1 122 GLN N  -44.999996       -5.0 A 121 . N A 121 . CA A 121 . C  A 122 . N 1 1 
       140 . 1 1 121 PRO C 1 1 122 GLN N  1 1 122 GLN CA 1 1 122 GLN C      -107.6      -35.2 A 121 . C A 122 . N  A 122 . CA A 122 . C 1 1 
       141 . 1 1 122 GLN N 1 1 122 GLN CA 1 1 122 GLN C  1 1 123 VAL N  -61.600002        2.6 A 122 . N A 122 . CA A 122 . C  A 123 . N 1 1 
       142 . 1 1 123 VAL C 1 1 124 PHE N  1 1 124 PHE CA 1 1 124 PHE C      -184.8      -44.8 A 123 . C A 124 . N  A 124 . CA A 124 . C 1 1 
       143 . 1 1 124 PHE N 1 1 124 PHE CA 1 1 124 PHE C  1 1 125 VAL N       137.0      187.8 A 124 . N A 124 . CA A 124 . C  A 125 . N 1 1 
       144 . 1 1 124 PHE C 1 1 125 VAL N  1 1 125 VAL CA 1 1 125 VAL C      -165.6      -72.8 A 124 . C A 125 . N  A 125 . CA A 125 . C 1 1 
       145 . 1 1 125 VAL N 1 1 125 VAL CA 1 1 125 VAL C  1 1 126 ALA N       109.1      169.5 A 125 . N A 125 . CA A 125 . C  A 126 . N 1 1 
       146 . 1 1 129 ASP C 1 1 130 CYS N  1 1 130 CYS CA 1 1 130 CYS C      -161.5      -90.5 A 129 . C A 130 . N  A 130 . CA A 130 . C 1 1 
       147 . 1 1 130 CYS N 1 1 130 CYS CA 1 1 130 CYS C  1 1 131 ALA N       146.4      202.4 A 130 . N A 130 . CA A 130 . C  A 131 . N 1 1 
       148 . 1 1 130 CYS C 1 1 131 ALA N  1 1 131 ALA CA 1 1 131 ALA C      -109.6      -44.0 A 130 . C A 131 . N  A 131 . CA A 131 . C 1 1 
       149 . 1 1 131 ALA N 1 1 131 ALA CA 1 1 131 ALA C  1 1 132 GLU N        81.0      181.4 A 131 . N A 131 . CA A 131 . C  A 132 . N 1 1 
       150 . 1 1 144 GLN C 1 1 145 TRP N  1 1 145 TRP CA 1 1 145 TRP C       -83.3      -43.3 A 144 . C A 145 . N  A 145 . CA A 145 . C 1 1 
       151 . 1 1 145 TRP N 1 1 145 TRP CA 1 1 145 TRP C  1 1 146 LEU N  -61.199997      -21.2 A 145 . N A 145 . CA A 145 . C  A 146 . N 1 1 
       152 . 1 1 145 TRP C 1 1 146 LEU N  1 1 146 LEU CA 1 1 146 LEU C  -85.299995      -45.3 A 145 . C A 146 . N  A 146 . CA A 146 . C 1 1 
       153 . 1 1 146 LEU N 1 1 146 LEU CA 1 1 146 LEU C  1 1 147 LEU N  -61.799995      -21.8 A 146 . N A 146 . CA A 146 . C  A 147 . N 1 1 
       154 . 1 1 146 LEU C 1 1 147 LEU N  1 1 147 LEU CA 1 1 147 LEU C       -84.1      -44.1 A 146 . C A 147 . N  A 147 . CA A 147 . C 1 1 
       155 . 1 1 147 LEU N 1 1 147 LEU CA 1 1 147 LEU C  1 1 148 GLY N  -61.600002      -21.6 A 147 . N A 147 . CA A 147 . C  A 148 . N 1 1 
       156 . 1 1 147 LEU C 1 1 148 GLY N  1 1 148 GLY CA 1 1 148 GLY C       -80.2      -40.2 A 147 . C A 148 . N  A 148 . CA A 148 . C 1 1 
       157 . 1 1 148 GLY N 1 1 148 GLY CA 1 1 148 GLY C  1 1 149 ILE N  -62.700005      -22.7 A 148 . N A 148 . CA A 148 . C  A 149 . N 1 1 
       158 . 1 1 148 GLY C 1 1 149 ILE N  1 1 149 ILE CA 1 1 149 ILE C       -84.6      -44.6 A 148 . C A 149 . N  A 149 . CA A 149 . C 1 1 
       159 . 1 1 149 ILE N 1 1 149 ILE CA 1 1 149 ILE C  1 1 150 PHE N  -61.399998 -21.399998 A 149 . N A 149 . CA A 149 . C  A 150 . N 1 1 
       160 . 1 1 149 ILE C 1 1 150 PHE N  1 1 150 PHE CA 1 1 150 PHE C       -83.2      -43.2 A 149 . C A 150 . N  A 150 . CA A 150 . C 1 1 
       161 . 1 1 150 PHE N 1 1 150 PHE CA 1 1 150 PHE C  1 1 151 ILE N  -57.599995      -17.6 A 150 . N A 150 . CA A 150 . C  A 151 . N 1 1 
       162 . 1 1 150 PHE C 1 1 151 ILE N  1 1 151 ILE CA 1 1 151 ILE C       -85.5      -45.5 A 150 . C A 151 . N  A 151 . CA A 151 . C 1 1 
       163 . 1 1 151 ILE N 1 1 151 ILE CA 1 1 151 ILE C  1 1 152 ALA N       -62.5 -22.499998 A 151 . N A 151 . CA A 151 . C  A 152 . N 1 1 
       164 . 1 1 151 ILE C 1 1 152 ALA N  1 1 152 ALA CA 1 1 152 ALA C       -79.4      -39.4 A 151 . C A 152 . N  A 152 . CA A 152 . C 1 1 
       165 . 1 1 152 ALA N 1 1 152 ALA CA 1 1 152 ALA C  1 1 153 TYR N       -65.2      -25.2 A 152 . N A 152 . CA A 152 . C  A 153 . N 1 1 
       166 . 1 1 152 ALA C 1 1 153 TYR N  1 1 153 TYR CA 1 1 153 TYR C   -86.19999      -46.2 A 152 . C A 153 . N  A 153 . CA A 153 . C 1 1 
       167 . 1 1 153 TYR N 1 1 153 TYR CA 1 1 153 TYR C  1 1 154 LEU N  -59.299995      -19.3 A 153 . N A 153 . CA A 153 . C  A 154 . N 1 1 
       168 . 1 1 153 TYR C 1 1 154 LEU N  1 1 154 LEU CA 1 1 154 LEU C       -84.6      -44.6 A 153 . C A 154 . N  A 154 . CA A 154 . C 1 1 
       169 . 1 1 154 LEU N 1 1 154 LEU CA 1 1 154 LEU C  1 1 155 ILE N       -66.1      -26.1 A 154 . N A 154 . CA A 154 . C  A 155 . N 1 1 
       170 . 1 1 154 LEU C 1 1 155 ILE N  1 1 155 ILE CA 1 1 155 ILE C       -82.0      -42.0 A 154 . C A 155 . N  A 155 . CA A 155 . C 1 1 
       171 . 1 1 155 ILE N 1 1 155 ILE CA 1 1 155 ILE C  1 1 156 VAL N  -63.899998      -23.9 A 155 . N A 155 . CA A 155 . C  A 156 . N 1 1 
       172 . 1 1 155 ILE C 1 1 156 VAL N  1 1 156 VAL CA 1 1 156 VAL C       -85.4      -45.4 A 155 . C A 156 . N  A 156 . CA A 156 . C 1 1 
       173 . 1 1 156 VAL N 1 1 156 VAL CA 1 1 156 VAL C  1 1 157 ALA N       -63.3      -23.3 A 156 . N A 156 . CA A 156 . C  A 157 . N 1 1 
       174 . 1 1 156 VAL C 1 1 157 ALA N  1 1 157 ALA CA 1 1 157 ALA C       -84.4      -44.4 A 156 . C A 157 . N  A 157 . CA A 157 . C 1 1 
       175 . 1 1 157 ALA N 1 1 157 ALA CA 1 1 157 ALA C  1 1 158 VAL N       -56.4      -16.4 A 157 . N A 157 . CA A 157 . C  A 158 . N 1 1 
       176 . 1 1 157 ALA C 1 1 158 VAL N  1 1 158 VAL CA 1 1 158 VAL C       -85.0 -44.999996 A 157 . C A 158 . N  A 158 . CA A 158 . C 1 1 
       177 . 1 1 158 VAL N 1 1 158 VAL CA 1 1 158 VAL C  1 1 159 LEU N       -63.1      -23.1 A 158 . N A 158 . CA A 158 . C  A 159 . N 1 1 
       178 . 1 1 158 VAL C 1 1 159 LEU N  1 1 159 LEU CA 1 1 159 LEU C       -82.4      -42.4 A 158 . C A 159 . N  A 159 . CA A 159 . C 1 1 
       179 . 1 1 159 LEU N 1 1 159 LEU CA 1 1 159 LEU C  1 1 160 VAL N       -59.8      -19.8 A 159 . N A 159 . CA A 159 . C  A 160 . N 1 1 
       180 . 1 1 159 LEU C 1 1 160 VAL N  1 1 160 VAL CA 1 1 160 VAL C       -84.7 -43.099995 A 159 . C A 160 . N  A 160 . CA A 160 . C 1 1 
       181 . 1 1 160 VAL N 1 1 160 VAL CA 1 1 160 VAL C  1 1 161 VAL N       -66.2      -26.2 A 160 . N A 160 . CA A 160 . C  A 161 . N 1 1 
       182 . 1 1 160 VAL C 1 1 161 VAL N  1 1 161 VAL CA 1 1 161 VAL C      -106.5      -22.1 A 160 . C A 161 . N  A 161 . CA A 161 . C 1 1 
       183 . 1 1 161 VAL N 1 1 161 VAL CA 1 1 161 VAL C  1 1 162 ILE N       -66.5      -13.7 A 161 . N A 161 . CA A 161 . C  A 162 . N 1 1 
       184 . 4 1  10 GLN N 4 1  10 GLN CA 4 1  10 GLN C  4 1  11 GLY N       -37.4       26.8 D  10 . N D  10 . CA D  10 . C  D  11 . N 1 1 
       185 . 4 1  10 GLN C 4 1  11 GLY N  4 1  11 GLY CA 4 1  11 GLY C        68.3      208.3 D  10 . C D  11 . N  D  11 . CA D  11 . C 1 1 
       186 . 4 1  11 GLY N 4 1  11 GLY CA 4 1  11 GLY C  4 1  12 ARG N       128.3      228.9 D  11 . N D  11 . CA D  11 . C  D  12 . N 1 1 
       187 . 4 1  11 GLY C 4 1  12 ARG N  4 1  12 ARG CA 4 1  12 ARG C       -81.3      -41.3 D  11 . C D  12 . N  D  12 . CA D  12 . C 1 1 
       188 . 4 1  12 ARG N 4 1  12 ARG CA 4 1  12 ARG C  4 1  13 GLY N       -47.2 -3.8000002 D  12 . N D  12 . CA D  12 . C  D  13 . N 1 1 
       189 . 4 1  12 ARG C 4 1  13 GLY N  4 1  13 GLY CA 4 1  13 GLY C      -137.6      -22.4 D  12 . C D  13 . N  D  13 . CA D  13 . C 1 1 
       190 . 4 1  13 GLY N 4 1  13 GLY CA 4 1  13 GLY C  4 1  14 ALA N       -84.9       42.5 D  13 . N D  13 . CA D  13 . C  D  14 . N 1 1 
       191 . 4 1  13 GLY C 4 1  14 ALA N  4 1  14 ALA CA 4 1  14 ALA C       -80.4      -40.4 D  13 . C D  14 . N  D  14 . CA D  14 . C 1 1 
       192 . 4 1  14 ALA N 4 1  14 ALA CA 4 1  14 ALA C  4 1  15 TRP N       -59.6      -19.6 D  14 . N D  14 . CA D  14 . C  D  15 . N 1 1 
       193 . 4 1  14 ALA C 4 1  15 TRP N  4 1  15 TRP CA 4 1  15 TRP C       -89.2      -49.2 D  14 . C D  15 . N  D  15 . CA D  15 . C 1 1 
       194 . 4 1  15 TRP N 4 1  15 TRP CA 4 1  15 TRP C  4 1  16 LEU N       -55.2 -11.999999 D  15 . N D  15 . CA D  15 . C  D  16 . N 1 1 
       195 . 4 1  15 TRP C 4 1  16 LEU N  4 1  16 LEU CA 4 1  16 LEU C       -83.5      -43.5 D  15 . C D  16 . N  D  16 . CA D  16 . C 1 1 
       196 . 4 1  16 LEU N 4 1  16 LEU CA 4 1  16 LEU C  4 1  17 LEU N  -59.099995      -19.1 D  16 . N D  16 . CA D  16 . C  D  17 . N 1 1 
       197 . 4 1  16 LEU C 4 1  17 LEU N  4 1  17 LEU CA 4 1  17 LEU C       -84.6      -44.6 D  16 . C D  17 . N  D  17 . CA D  17 . C 1 1 
       198 . 4 1  17 LEU N 4 1  17 LEU CA 4 1  17 LEU C  4 1  18 MET N       -59.0      -19.0 D  17 . N D  17 . CA D  17 . C  D  18 . N 1 1 
       199 . 4 1  17 LEU C 4 1  18 MET N  4 1  18 MET CA 4 1  18 MET C       -87.6      -47.6 D  17 . C D  18 . N  D  18 . CA D  18 . C 1 1 
       200 . 4 1  18 MET N 4 1  18 MET CA 4 1  18 MET C  4 1  19 ALA N       -58.0      -18.0 D  18 . N D  18 . CA D  18 . C  D  19 . N 1 1 
       201 . 4 1  18 MET C 4 1  19 ALA N  4 1  19 ALA CA 4 1  19 ALA C       -84.4      -44.4 D  18 . C D  19 . N  D  19 . CA D  19 . C 1 1 
       202 . 4 1  19 ALA N 4 1  19 ALA CA 4 1  19 ALA C  4 1  20 PHE N       -66.6 -26.599998 D  19 . N D  19 . CA D  19 . C  D  20 . N 1 1 
       203 . 4 1  19 ALA C 4 1  20 PHE N  4 1  20 PHE CA 4 1  20 PHE C       -84.0      -44.0 D  19 . C D  20 . N  D  20 . CA D  20 . C 1 1 
       204 . 4 1  20 PHE N 4 1  20 PHE CA 4 1  20 PHE C  4 1  21 THR N       -67.7      -27.7 D  20 . N D  20 . CA D  20 . C  D  21 . N 1 1 
       205 . 4 1  20 PHE C 4 1  21 THR N  4 1  21 THR CA 4 1  21 THR C       -83.0      -43.0 D  20 . C D  21 . N  D  21 . CA D  21 . C 1 1 
       206 . 4 1  21 THR N 4 1  21 THR CA 4 1  21 THR C  4 1  22 ALA N       -55.0      -14.8 D  21 . N D  21 . CA D  21 . C  D  22 . N 1 1 
       207 . 4 1  21 THR C 4 1  22 ALA N  4 1  22 ALA CA 4 1  22 ALA C       -86.6      -46.6 D  21 . C D  22 . N  D  22 . CA D  22 . C 1 1 
       208 . 4 1  22 ALA N 4 1  22 ALA CA 4 1  22 ALA C  4 1  23 LEU N  -60.399998      -20.4 D  22 . N D  22 . CA D  22 . C  D  23 . N 1 1 
       209 . 4 1  22 ALA C 4 1  23 LEU N  4 1  23 LEU CA 4 1  23 LEU C       -83.1 -43.099995 D  22 . C D  23 . N  D  23 . CA D  23 . C 1 1 
       210 . 4 1  23 LEU N 4 1  23 LEU CA 4 1  23 LEU C  4 1  24 ALA N       -66.9      -26.9 D  23 . N D  23 . CA D  23 . C  D  24 . N 1 1 
       211 . 4 1  23 LEU C 4 1  24 ALA N  4 1  24 ALA CA 4 1  24 ALA C       -84.4      -44.4 D  23 . C D  24 . N  D  24 . CA D  24 . C 1 1 
       212 . 4 1  24 ALA N 4 1  24 ALA CA 4 1  24 ALA C  4 1  25 LEU N  -59.299995      -19.3 D  24 . N D  24 . CA D  24 . C  D  25 . N 1 1 
       213 . 4 1  24 ALA C 4 1  25 LEU N  4 1  25 LEU CA 4 1  25 LEU C       -85.1      -45.1 D  24 . C D  25 . N  D  25 . CA D  25 . C 1 1 
       214 . 4 1  25 LEU N 4 1  25 LEU CA 4 1  25 LEU C  4 1  26 GLU N       -61.1      -21.1 D  25 . N D  25 . CA D  25 . C  D  26 . N 1 1 
       215 . 4 1  25 LEU C 4 1  26 GLU N  4 1  26 GLU CA 4 1  26 GLU C       -82.4      -42.4 D  25 . C D  26 . N  D  26 . CA D  26 . C 1 1 
       216 . 4 1  26 GLU N 4 1  26 GLU CA 4 1  26 GLU C  4 1  27 LEU N  -59.499996      -19.5 D  26 . N D  26 . CA D  26 . C  D  27 . N 1 1 
       217 . 4 1  26 GLU C 4 1  27 LEU N  4 1  27 LEU CA 4 1  27 LEU C       -85.4      -45.4 D  26 . C D  27 . N  D  27 . CA D  27 . C 1 1 
       218 . 4 1  27 LEU N 4 1  27 LEU CA 4 1  27 LEU C  4 1  28 THR N  -60.200005      -20.2 D  27 . N D  27 . CA D  27 . C  D  28 . N 1 1 
       219 . 4 1  27 LEU C 4 1  28 THR N  4 1  28 THR CA 4 1  28 THR C       -83.3      -43.3 D  27 . C D  28 . N  D  28 . CA D  28 . C 1 1 
       220 . 4 1  28 THR N 4 1  28 THR CA 4 1  28 THR C  4 1  29 ALA N  -62.700005      -22.7 D  28 . N D  28 . CA D  28 . C  D  29 . N 1 1 
       221 . 4 1  28 THR C 4 1  29 ALA N  4 1  29 ALA CA 4 1  29 ALA C       -81.4      -41.4 D  28 . C D  29 . N  D  29 . CA D  29 . C 1 1 
       222 . 4 1  29 ALA N 4 1  29 ALA CA 4 1  29 ALA C  4 1  30 LEU N       -61.7      -21.7 D  29 . N D  29 . CA D  29 . C  D  30 . N 1 1 
       223 . 4 1  29 ALA C 4 1  30 LEU N  4 1  30 LEU CA 4 1  30 LEU C      -107.5 -30.899998 D  29 . C D  30 . N  D  30 . CA D  30 . C 1 1 
       224 . 4 1  30 LEU N 4 1  30 LEU CA 4 1  30 LEU C  4 1  31 TRP N       -66.3       -9.7 D  30 . N D  30 . CA D  30 . C  D  31 . N 1 1 
       225 . 4 1  33 GLN C 4 1  34 HIS N  4 1  34 HIS CA 4 1  34 HIS C       -83.3      -43.3 D  33 . C D  34 . N  D  34 . CA D  34 . C 1 1 
       226 . 4 1  34 HIS N 4 1  34 HIS CA 4 1  34 HIS C  4 1  35 VAL N       -62.5 -22.499998 D  34 . N D  34 . CA D  34 . C  D  35 . N 1 1 
       227 . 4 1  34 HIS C 4 1  35 VAL N  4 1  35 VAL CA 4 1  35 VAL C  -91.899994      -46.7 D  34 . C D  35 . N  D  35 . CA D  35 . C 1 1 
       228 . 4 1  35 VAL N 4 1  35 VAL CA 4 1  35 VAL C  4 1  36 MET N  -61.600002       -8.2 D  35 . N D  35 . CA D  35 . C  D  36 . N 1 1 
       229 . 4 1  35 VAL C 4 1  36 MET N  4 1  36 MET CA 4 1  36 MET C  -121.49999      -41.1 D  35 . C D  36 . N  D  36 . CA D  36 . C 1 1 
       230 . 4 1  36 MET N 4 1  36 MET CA 4 1  36 MET C  4 1  37 LEU N       -55.7       16.1 D  36 . N D  36 . CA D  36 . C  D  37 . N 1 1 
       231 . 4 1  43 LEU C 4 1  44 CYS N  4 1  44 CYS CA 4 1  44 CYS C      -111.0      -42.0 D  43 . C D  44 . N  D  44 . CA D  44 . C 1 1 
       232 . 4 1  44 CYS N 4 1  44 CYS CA 4 1  44 CYS C  4 1  45 ILE N       -52.7      -12.7 D  44 . N D  44 . CA D  44 . C  D  45 . N 1 1 
       233 . 4 1  44 CYS C 4 1  45 ILE N  4 1  45 ILE CA 4 1  45 ILE C       -92.3      -45.9 D  44 . C D  45 . N  D  45 . CA D  45 . C 1 1 
       234 . 4 1  45 ILE N 4 1  45 ILE CA 4 1  45 ILE C  4 1  46 TYR N       -53.4       -8.0 D  45 . N D  45 . CA D  45 . C  D  46 . N 1 1 
       235 . 4 1  45 ILE C 4 1  46 TYR N  4 1  46 TYR CA 4 1  46 TYR C       -84.5      -44.5 D  45 . C D  46 . N  D  46 . CA D  46 . C 1 1 
       236 . 4 1  46 TYR N 4 1  46 TYR CA 4 1  46 TYR C  4 1  47 GLU N       -57.1      -17.1 D  46 . N D  46 . CA D  46 . C  D  47 . N 1 1 
       237 . 4 1  46 TYR C 4 1  47 GLU N  4 1  47 GLU CA 4 1  47 GLU C       -82.3      -42.3 D  46 . C D  47 . N  D  47 . CA D  47 . C 1 1 
       238 . 4 1  47 GLU N 4 1  47 GLU CA 4 1  47 GLU C  4 1  48 ARG N       -64.9      -24.9 D  47 . N D  47 . CA D  47 . C  D  48 . N 1 1 
       239 . 4 1  47 GLU C 4 1  48 ARG N  4 1  48 ARG CA 4 1  48 ARG C   -85.59999      -45.6 D  47 . C D  48 . N  D  48 . CA D  48 . C 1 1 
       240 . 4 1  48 ARG N 4 1  48 ARG CA 4 1  48 ARG C  4 1  49 VAL N  -59.099995      -19.1 D  48 . N D  48 . CA D  48 . C  D  49 . N 1 1 
       241 . 4 1  48 ARG C 4 1  49 VAL N  4 1  49 VAL CA 4 1  49 VAL C       -85.4      -45.4 D  48 . C D  49 . N  D  49 . CA D  49 . C 1 1 
       242 . 4 1  49 VAL N 4 1  49 VAL CA 4 1  49 VAL C  4 1  50 ALA N       -64.6      -24.6 D  49 . N D  49 . CA D  49 . C  D  50 . N 1 1 
       243 . 4 1  49 VAL C 4 1  50 ALA N  4 1  50 ALA CA 4 1  50 ALA C       -81.6      -41.6 D  49 . C D  50 . N  D  50 . CA D  50 . C 1 1 
       244 . 4 1  50 ALA N 4 1  50 ALA CA 4 1  50 ALA C  4 1  51 LEU N       -58.9      -18.9 D  50 . N D  50 . CA D  50 . C  D  51 . N 1 1 
       245 . 4 1  50 ALA C 4 1  51 LEU N  4 1  51 LEU CA 4 1  51 LEU C       -84.0      -44.0 D  50 . C D  51 . N  D  51 . CA D  51 . C 1 1 
       246 . 4 1  51 LEU N 4 1  51 LEU CA 4 1  51 LEU C  4 1  52 PHE N       -62.1      -22.1 D  51 . N D  51 . CA D  51 . C  D  52 . N 1 1 
       247 . 4 1  51 LEU C 4 1  52 PHE N  4 1  52 PHE CA 4 1  52 PHE C       -85.5      -45.5 D  51 . C D  52 . N  D  52 . CA D  52 . C 1 1 
       248 . 4 1  52 PHE N 4 1  52 PHE CA 4 1  52 PHE C  4 1  53 GLY N  -62.199997      -22.2 D  52 . N D  52 . CA D  52 . C  D  53 . N 1 1 
       249 . 4 1  52 PHE C 4 1  53 GLY N  4 1  53 GLY CA 4 1  53 GLY C       -85.8      -45.8 D  52 . C D  53 . N  D  53 . CA D  53 . C 1 1 
       250 . 4 1  53 GLY N 4 1  53 GLY CA 4 1  53 GLY C  4 1  54 VAL N  -60.299995      -20.3 D  53 . N D  53 . CA D  53 . C  D  54 . N 1 1 
       251 . 4 1  53 GLY C 4 1  54 VAL N  4 1  54 VAL CA 4 1  54 VAL C       -82.6      -42.6 D  53 . C D  54 . N  D  54 . CA D  54 . C 1 1 
       252 . 4 1  54 VAL N 4 1  54 VAL CA 4 1  54 VAL C  4 1  55 LEU N       -63.8      -23.8 D  54 . N D  54 . CA D  54 . C  D  55 . N 1 1 
       253 . 4 1  54 VAL C 4 1  55 LEU N  4 1  55 LEU CA 4 1  55 LEU C   -83.69999      -43.7 D  54 . C D  55 . N  D  55 . CA D  55 . C 1 1 
       254 . 4 1  55 LEU N 4 1  55 LEU CA 4 1  55 LEU C  4 1  56 GLY N       -67.1 -13.299999 D  55 . N D  55 . CA D  55 . C  D  56 . N 1 1 
       255 . 4 1  55 LEU C 4 1  56 GLY N  4 1  56 GLY CA 4 1  56 GLY C       -82.9      -42.9 D  55 . C D  56 . N  D  56 . CA D  56 . C 1 1 
       256 . 4 1  56 GLY N 4 1  56 GLY CA 4 1  56 GLY C  4 1  57 ALA N  -61.199997      -15.8 D  56 . N D  56 . CA D  56 . C  D  57 . N 1 1 
       257 . 4 1  56 GLY C 4 1  57 ALA N  4 1  57 ALA CA 4 1  57 ALA C       -80.8      -40.8 D  56 . C D  57 . N  D  57 . CA D  57 . C 1 1 
       258 . 4 1  57 ALA N 4 1  57 ALA CA 4 1  57 ALA C  4 1  58 ALA N       -62.1      -22.1 D  57 . N D  57 . CA D  57 . C  D  58 . N 1 1 
       259 . 4 1  57 ALA C 4 1  58 ALA N  4 1  58 ALA CA 4 1  58 ALA C       -83.2      -43.2 D  57 . C D  58 . N  D  58 . CA D  58 . C 1 1 
       260 . 4 1  58 ALA N 4 1  58 ALA CA 4 1  58 ALA C  4 1  59 LEU N       -58.8      -18.8 D  58 . N D  58 . CA D  58 . C  D  59 . N 1 1 
       261 . 4 1  58 ALA C 4 1  59 LEU N  4 1  59 LEU CA 4 1  59 LEU C       -86.7      -46.7 D  58 . C D  59 . N  D  59 . CA D  59 . C 1 1 
       262 . 4 1  59 LEU N 4 1  59 LEU CA 4 1  59 LEU C  4 1  60 ILE N       -60.6      -20.6 D  59 . N D  59 . CA D  59 . C  D  60 . N 1 1 
       263 . 4 1  59 LEU C 4 1  60 ILE N  4 1  60 ILE CA 4 1  60 ILE C -115.799995      -34.0 D  59 . C D  60 . N  D  60 . CA D  60 . C 1 1 
       264 . 4 1  60 ILE N 4 1  60 ILE CA 4 1  60 ILE C  4 1  61 GLY N       -60.9       -6.3 D  60 . N D  60 . CA D  60 . C  D  61 . N 1 1 
       265 . 4 1  60 ILE C 4 1  61 GLY N  4 1  61 GLY CA 4 1  61 GLY C      -108.8      -36.4 D  60 . C D  61 . N  D  61 . CA D  61 . C 1 1 
       266 . 4 1  61 GLY N 4 1  61 GLY CA 4 1  61 GLY C  4 1  62 ALA N       -41.6        3.2 D  61 . N D  61 . CA D  61 . C  D  62 . N 1 1 
       267 . 4 1  61 GLY C 4 1  62 ALA N  4 1  62 ALA CA 4 1  62 ALA C      -118.5 -31.299997 D  61 . C D  62 . N  D  62 . CA D  62 . C 1 1 
       268 . 4 1  62 ALA N 4 1  62 ALA CA 4 1  62 ALA C  4 1  63 ILE N       -75.4       37.6 D  62 . N D  62 . CA D  62 . C  D  63 . N 1 1 
       269 . 4 1  62 ALA C 4 1  63 ILE N  4 1  63 ILE CA 4 1  63 ILE C  -106.69999      -29.3 D  62 . C D  63 . N  D  63 . CA D  63 . C 1 1 
       270 . 4 1  63 ILE N 4 1  63 ILE CA 4 1  63 ILE C  4 1  64 ALA N       -61.9      -19.7 D  63 . N D  63 . CA D  63 . C  D  64 . N 1 1 
       271 . 4 1  68 PRO C 4 1  69 LEU N  4 1  69 LEU CA 4 1  69 LEU C       -78.1      -38.1 D  68 . C D  69 . N  D  69 . CA D  69 . C 1 1 
       272 . 4 1  69 LEU N 4 1  69 LEU CA 4 1  69 LEU C  4 1  70 ARG N       -59.2       -8.6 D  69 . N D  69 . CA D  69 . C  D  70 . N 1 1 
       273 . 4 1  69 LEU C 4 1  70 ARG N  4 1  70 ARG CA 4 1  70 ARG C       -97.6      -57.0 D  69 . C D  70 . N  D  70 . CA D  70 . C 1 1 
       274 . 4 1  70 ARG N 4 1  70 ARG CA 4 1  70 ARG C  4 1  71 TYR N  -30.199999       15.0 D  70 . N D  70 . CA D  70 . C  D  71 . N 1 1 
       275 . 4 1  70 ARG C 4 1  71 TYR N  4 1  71 TYR CA 4 1  71 TYR C -125.299995      -36.3 D  70 . C D  71 . N  D  71 . CA D  71 . C 1 1 
       276 . 4 1  71 TYR N 4 1  71 TYR CA 4 1  71 TYR C  4 1  72 VAL N  -83.399994       26.4 D  71 . N D  71 . CA D  71 . C  D  72 . N 1 1 
       277 . 4 1  71 TYR C 4 1  72 VAL N  4 1  72 VAL CA 4 1  72 VAL C       -81.3      -41.3 D  71 . C D  72 . N  D  72 . CA D  72 . C 1 1 
       278 . 4 1  72 VAL N 4 1  72 VAL CA 4 1  72 VAL C  4 1  73 ALA N       -64.2      -24.2 D  72 . N D  72 . CA D  72 . C  D  73 . N 1 1 
       279 . 4 1  72 VAL C 4 1  73 ALA N  4 1  73 ALA CA 4 1  73 ALA C       -79.8 -39.799995 D  72 . C D  73 . N  D  73 . CA D  73 . C 1 1 
       280 . 4 1  73 ALA N 4 1  73 ALA CA 4 1  73 ALA C  4 1  74 MET N       -60.7      -20.7 D  73 . N D  73 . CA D  73 . C  D  74 . N 1 1 
       281 . 4 1  73 ALA C 4 1  74 MET N  4 1  74 MET CA 4 1  74 MET C       -85.5      -45.5 D  73 . C D  74 . N  D  74 . CA D  74 . C 1 1 
       282 . 4 1  74 MET N 4 1  74 MET CA 4 1  74 MET C  4 1  75 VAL N  -62.599995      -22.6 D  74 . N D  74 . CA D  74 . C  D  75 . N 1 1 
       283 . 4 1  74 MET C 4 1  75 VAL N  4 1  75 VAL CA 4 1  75 VAL C       -85.7      -45.7 D  74 . C D  75 . N  D  75 . CA D  75 . C 1 1 
       284 . 4 1  75 VAL N 4 1  75 VAL CA 4 1  75 VAL C  4 1  76 ILE N       -65.3      -25.3 D  75 . N D  75 . CA D  75 . C  D  76 . N 1 1 
       285 . 4 1  75 VAL C 4 1  76 ILE N  4 1  76 ILE CA 4 1  76 ILE C       -86.0      -46.0 D  75 . C D  76 . N  D  76 . CA D  76 . C 1 1 
       286 . 4 1  76 ILE N 4 1  76 ILE CA 4 1  76 ILE C  4 1  77 TRP N  -59.099995      -19.1 D  76 . N D  76 . CA D  76 . C  D  77 . N 1 1 
       287 . 4 1  76 ILE C 4 1  77 TRP N  4 1  77 TRP CA 4 1  77 TRP C       -81.1      -41.1 D  76 . C D  77 . N  D  77 . CA D  77 . C 1 1 
       288 . 4 1  77 TRP N 4 1  77 TRP CA 4 1  77 TRP C  4 1  78 LEU N       -63.0      -23.0 D  77 . N D  77 . CA D  77 . C  D  78 . N 1 1 
       289 . 4 1  77 TRP C 4 1  78 LEU N  4 1  78 LEU CA 4 1  78 LEU C       -84.7 -44.699997 D  77 . C D  78 . N  D  78 . CA D  78 . C 1 1 
       290 . 4 1  78 LEU N 4 1  78 LEU CA 4 1  78 LEU C  4 1  79 TYR N       -59.6      -19.6 D  78 . N D  78 . CA D  78 . C  D  79 . N 1 1 
       291 . 4 1  78 LEU C 4 1  79 TYR N  4 1  79 TYR CA 4 1  79 TYR C       -83.1 -43.099995 D  78 . C D  79 . N  D  79 . CA D  79 . C 1 1 
       292 . 4 1  79 TYR N 4 1  79 TYR CA 4 1  79 TYR C  4 1  80 SER N  -60.800003      -20.8 D  79 . N D  79 . CA D  79 . C  D  80 . N 1 1 
       293 . 4 1  79 TYR C 4 1  80 SER N  4 1  80 SER CA 4 1  80 SER C       -78.9      -38.9 D  79 . C D  80 . N  D  80 . CA D  80 . C 1 1 
       294 . 4 1  80 SER N 4 1  80 SER CA 4 1  80 SER C  4 1  81 ALA N       -60.0      -20.0 D  80 . N D  80 . CA D  80 . C  D  81 . N 1 1 
       295 . 4 1  80 SER C 4 1  81 ALA N  4 1  81 ALA CA 4 1  81 ALA C  -106.69999 -30.100002 D  80 . C D  81 . N  D  81 . CA D  81 . C 1 1 
       296 . 4 1  81 ALA N 4 1  81 ALA CA 4 1  81 ALA C  4 1  82 PHE N       -62.4 -15.400001 D  81 . N D  81 . CA D  81 . C  D  82 . N 1 1 
       297 . 4 1  83 ARG C 4 1  84 GLY N  4 1  84 GLY CA 4 1  84 GLY C       -80.8      -40.8 D  83 . C D  84 . N  D  84 . CA D  84 . C 1 1 
       298 . 4 1  84 GLY N 4 1  84 GLY CA 4 1  84 GLY C  4 1  85 VAL N       -63.2      -23.2 D  84 . N D  84 . CA D  84 . C  D  85 . N 1 1 
       299 . 4 1  84 GLY C 4 1  85 VAL N  4 1  85 VAL CA 4 1  85 VAL C       -82.7      -42.7 D  84 . C D  85 . N  D  85 . CA D  85 . C 1 1 
       300 . 4 1  85 VAL N 4 1  85 VAL CA 4 1  85 VAL C  4 1  86 GLN N       -62.3      -22.3 D  85 . N D  85 . CA D  85 . C  D  86 . N 1 1 
       301 . 4 1  85 VAL C 4 1  86 GLN N  4 1  86 GLN CA 4 1  86 GLN C       -85.2      -45.2 D  85 . C D  86 . N  D  86 . CA D  86 . C 1 1 
       302 . 4 1  86 GLN N 4 1  86 GLN CA 4 1  86 GLN C  4 1  87 LEU N  -59.499996      -19.5 D  86 . N D  86 . CA D  86 . C  D  87 . N 1 1 
       303 . 4 1  86 GLN C 4 1  87 LEU N  4 1  87 LEU CA 4 1  87 LEU C       -82.7      -42.7 D  86 . C D  87 . N  D  87 . CA D  87 . C 1 1 
       304 . 4 1  87 LEU N 4 1  87 LEU CA 4 1  87 LEU C  4 1  88 THR N       -61.3      -21.3 D  87 . N D  87 . CA D  87 . C  D  88 . N 1 1 
       305 . 4 1  87 LEU C 4 1  88 THR N  4 1  88 THR CA 4 1  88 THR C      -113.6      -34.0 D  87 . C D  88 . N  D  88 . CA D  88 . C 1 1 
       306 . 4 1  88 THR N 4 1  88 THR CA 4 1  88 THR C  4 1  89 TYR N       -82.9       17.7 D  88 . N D  88 . CA D  88 . C  D  89 . N 1 1 
       307 . 4 1  91 HIS C 4 1  92 THR N  4 1  92 THR CA 4 1  92 THR C       -83.8      -43.8 D  91 . C D  92 . N  D  92 . CA D  92 . C 1 1 
       308 . 4 1  92 THR N 4 1  92 THR CA 4 1  92 THR C  4 1  93 MET N  -61.999996      -22.0 D  92 . N D  92 . CA D  92 . C  D  93 . N 1 1 
       309 . 4 1  92 THR C 4 1  93 MET N  4 1  93 MET CA 4 1  93 MET C       -79.0      -39.0 D  92 . C D  93 . N  D  93 . CA D  93 . C 1 1 
       310 . 4 1  93 MET N 4 1  93 MET CA 4 1  93 MET C  4 1  94 LEU N  -61.600002      -21.6 D  93 . N D  93 . CA D  93 . C  D  94 . N 1 1 
       311 . 4 1  93 MET C 4 1  94 LEU N  4 1  94 LEU CA 4 1  94 LEU C      -112.1      -29.5 D  93 . C D  94 . N  D  94 . CA D  94 . C 1 1 
       312 . 4 1  94 LEU N 4 1  94 LEU CA 4 1  94 LEU C  4 1  95 GLN N       -67.1       -4.1 D  94 . N D  94 . CA D  94 . C  D  95 . N 1 1 
       313 . 4 1 102 ALA C 4 1 103 THR N  4 1 103 THR CA 4 1 103 THR C      -154.5      -64.3 D 102 . C D 103 . N  D 103 . CA D 103 . C 1 1 
       314 . 4 1 103 THR N 4 1 103 THR CA 4 1 103 THR C  4 1 104 CYS N  115.399994      165.6 D 103 . N D 103 . CA D 103 . C  D 104 . N 1 1 
       315 . 4 1 103 THR C 4 1 104 CYS N  4 1 104 CYS CA 4 1 104 CYS C  -152.29999     -112.3 D 103 . C D 104 . N  D 104 . CA D 104 . C 1 1 
       316 . 4 1 104 CYS N 4 1 104 CYS CA 4 1 104 CYS C  4 1 105 ASP N  127.799995      173.6 D 104 . N D 104 . CA D 104 . C  D 105 . N 1 1 
       317 . 4 1 104 CYS C 4 1 105 ASP N  4 1 105 ASP CA 4 1 105 ASP C      -126.8      -43.8 D 104 . C D 105 . N  D 105 . CA D 105 . C 1 1 
       318 . 4 1 105 ASP N 4 1 105 ASP CA 4 1 105 ASP C  4 1 106 PHE N  106.399994      172.0 D 105 . N D 105 . CA D 105 . C  D 106 . N 1 1 
       319 . 4 1 119 TRP C 4 1 120 VAL N  4 1 120 VAL CA 4 1 120 VAL C      -174.1  -83.69999 D 119 . C D 120 . N  D 120 . CA D 120 . C 1 1 
       320 . 4 1 120 VAL N 4 1 120 VAL CA 4 1 120 VAL C  4 1 121 PRO N       142.6  205.19998 D 120 . N D 120 . CA D 120 . C  D 121 . N 1 1 
       321 . 4 1 120 VAL C 4 1 121 PRO N  4 1 121 PRO CA 4 1 121 PRO C       -78.2      -38.2 D 120 . C D 121 . N  D 121 . CA D 121 . C 1 1 
       322 . 4 1 121 PRO N 4 1 121 PRO CA 4 1 121 PRO C  4 1 122 GLN N  -44.999996       -5.0 D 121 . N D 121 . CA D 121 . C  D 122 . N 1 1 
       323 . 4 1 121 PRO C 4 1 122 GLN N  4 1 122 GLN CA 4 1 122 GLN C      -107.6      -35.2 D 121 . C D 122 . N  D 122 . CA D 122 . C 1 1 
       324 . 4 1 122 GLN N 4 1 122 GLN CA 4 1 122 GLN C  4 1 123 VAL N  -61.600002        2.6 D 122 . N D 122 . CA D 122 . C  D 123 . N 1 1 
       325 . 4 1 123 VAL C 4 1 124 PHE N  4 1 124 PHE CA 4 1 124 PHE C      -184.8      -44.8 D 123 . C D 124 . N  D 124 . CA D 124 . C 1 1 
       326 . 4 1 124 PHE N 4 1 124 PHE CA 4 1 124 PHE C  4 1 125 VAL N       137.0      187.8 D 124 . N D 124 . CA D 124 . C  D 125 . N 1 1 
       327 . 4 1 124 PHE C 4 1 125 VAL N  4 1 125 VAL CA 4 1 125 VAL C      -165.6      -72.8 D 124 . C D 125 . N  D 125 . CA D 125 . C 1 1 
       328 . 4 1 125 VAL N 4 1 125 VAL CA 4 1 125 VAL C  4 1 126 ALA N       109.1      169.5 D 125 . N D 125 . CA D 125 . C  D 126 . N 1 1 
       329 . 4 1 129 ASP C 4 1 130 CYS N  4 1 130 CYS CA 4 1 130 CYS C      -161.5      -90.5 D 129 . C D 130 . N  D 130 . CA D 130 . C 1 1 
       330 . 4 1 130 CYS N 4 1 130 CYS CA 4 1 130 CYS C  4 1 131 ALA N       146.4      202.4 D 130 . N D 130 . CA D 130 . C  D 131 . N 1 1 
       331 . 4 1 130 CYS C 4 1 131 ALA N  4 1 131 ALA CA 4 1 131 ALA C      -109.6      -44.0 D 130 . C D 131 . N  D 131 . CA D 131 . C 1 1 
       332 . 4 1 131 ALA N 4 1 131 ALA CA 4 1 131 ALA C  4 1 132 GLU N        81.0      181.4 D 131 . N D 131 . CA D 131 . C  D 132 . N 1 1 
       333 . 4 1 144 GLN C 4 1 145 TRP N  4 1 145 TRP CA 4 1 145 TRP C       -83.3      -43.3 D 144 . C D 145 . N  D 145 . CA D 145 . C 1 1 
       334 . 4 1 145 TRP N 4 1 145 TRP CA 4 1 145 TRP C  4 1 146 LEU N  -61.199997      -21.2 D 145 . N D 145 . CA D 145 . C  D 146 . N 1 1 
       335 . 4 1 145 TRP C 4 1 146 LEU N  4 1 146 LEU CA 4 1 146 LEU C  -85.299995      -45.3 D 145 . C D 146 . N  D 146 . CA D 146 . C 1 1 
       336 . 4 1 146 LEU N 4 1 146 LEU CA 4 1 146 LEU C  4 1 147 LEU N  -61.799995      -21.8 D 146 . N D 146 . CA D 146 . C  D 147 . N 1 1 
       337 . 4 1 146 LEU C 4 1 147 LEU N  4 1 147 LEU CA 4 1 147 LEU C       -84.1      -44.1 D 146 . C D 147 . N  D 147 . CA D 147 . C 1 1 
       338 . 4 1 147 LEU N 4 1 147 LEU CA 4 1 147 LEU C  4 1 148 GLY N  -61.600002      -21.6 D 147 . N D 147 . CA D 147 . C  D 148 . N 1 1 
       339 . 4 1 147 LEU C 4 1 148 GLY N  4 1 148 GLY CA 4 1 148 GLY C       -80.2      -40.2 D 147 . C D 148 . N  D 148 . CA D 148 . C 1 1 
       340 . 4 1 148 GLY N 4 1 148 GLY CA 4 1 148 GLY C  4 1 149 ILE N  -62.700005      -22.7 D 148 . N D 148 . CA D 148 . C  D 149 . N 1 1 
       341 . 4 1 148 GLY C 4 1 149 ILE N  4 1 149 ILE CA 4 1 149 ILE C       -84.6      -44.6 D 148 . C D 149 . N  D 149 . CA D 149 . C 1 1 
       342 . 4 1 149 ILE N 4 1 149 ILE CA 4 1 149 ILE C  4 1 150 PHE N  -61.399998 -21.399998 D 149 . N D 149 . CA D 149 . C  D 150 . N 1 1 
       343 . 4 1 149 ILE C 4 1 150 PHE N  4 1 150 PHE CA 4 1 150 PHE C       -83.2      -43.2 D 149 . C D 150 . N  D 150 . CA D 150 . C 1 1 
       344 . 4 1 150 PHE N 4 1 150 PHE CA 4 1 150 PHE C  4 1 151 ILE N  -57.599995      -17.6 D 150 . N D 150 . CA D 150 . C  D 151 . N 1 1 
       345 . 4 1 150 PHE C 4 1 151 ILE N  4 1 151 ILE CA 4 1 151 ILE C       -85.5      -45.5 D 150 . C D 151 . N  D 151 . CA D 151 . C 1 1 
       346 . 4 1 151 ILE N 4 1 151 ILE CA 4 1 151 ILE C  4 1 152 ALA N       -62.5 -22.499998 D 151 . N D 151 . CA D 151 . C  D 152 . N 1 1 
       347 . 4 1 151 ILE C 4 1 152 ALA N  4 1 152 ALA CA 4 1 152 ALA C       -79.4      -39.4 D 151 . C D 152 . N  D 152 . CA D 152 . C 1 1 
       348 . 4 1 152 ALA N 4 1 152 ALA CA 4 1 152 ALA C  4 1 153 TYR N       -65.2      -25.2 D 152 . N D 152 . CA D 152 . C  D 153 . N 1 1 
       349 . 4 1 152 ALA C 4 1 153 TYR N  4 1 153 TYR CA 4 1 153 TYR C   -86.19999      -46.2 D 152 . C D 153 . N  D 153 . CA D 153 . C 1 1 
       350 . 4 1 153 TYR N 4 1 153 TYR CA 4 1 153 TYR C  4 1 154 LEU N  -59.299995      -19.3 D 153 . N D 153 . CA D 153 . C  D 154 . N 1 1 
       351 . 4 1 153 TYR C 4 1 154 LEU N  4 1 154 LEU CA 4 1 154 LEU C       -84.6      -44.6 D 153 . C D 154 . N  D 154 . CA D 154 . C 1 1 
       352 . 4 1 154 LEU N 4 1 154 LEU CA 4 1 154 LEU C  4 1 155 ILE N       -66.1      -26.1 D 154 . N D 154 . CA D 154 . C  D 155 . N 1 1 
       353 . 4 1 154 LEU C 4 1 155 ILE N  4 1 155 ILE CA 4 1 155 ILE C       -82.0      -42.0 D 154 . C D 155 . N  D 155 . CA D 155 . C 1 1 
       354 . 4 1 155 ILE N 4 1 155 ILE CA 4 1 155 ILE C  4 1 156 VAL N  -63.899998      -23.9 D 155 . N D 155 . CA D 155 . C  D 156 . N 1 1 
       355 . 4 1 155 ILE C 4 1 156 VAL N  4 1 156 VAL CA 4 1 156 VAL C       -85.4      -45.4 D 155 . C D 156 . N  D 156 . CA D 156 . C 1 1 
       356 . 4 1 156 VAL N 4 1 156 VAL CA 4 1 156 VAL C  4 1 157 ALA N       -63.3      -23.3 D 156 . N D 156 . CA D 156 . C  D 157 . N 1 1 
       357 . 4 1 156 VAL C 4 1 157 ALA N  4 1 157 ALA CA 4 1 157 ALA C       -84.4      -44.4 D 156 . C D 157 . N  D 157 . CA D 157 . C 1 1 
       358 . 4 1 157 ALA N 4 1 157 ALA CA 4 1 157 ALA C  4 1 158 VAL N       -56.4      -16.4 D 157 . N D 157 . CA D 157 . C  D 158 . N 1 1 
       359 . 4 1 157 ALA C 4 1 158 VAL N  4 1 158 VAL CA 4 1 158 VAL C       -85.0 -44.999996 D 157 . C D 158 . N  D 158 . CA D 158 . C 1 1 
       360 . 4 1 158 VAL N 4 1 158 VAL CA 4 1 158 VAL C  4 1 159 LEU N       -63.1      -23.1 D 158 . N D 158 . CA D 158 . C  D 159 . N 1 1 
       361 . 4 1 158 VAL C 4 1 159 LEU N  4 1 159 LEU CA 4 1 159 LEU C       -82.4      -42.4 D 158 . C D 159 . N  D 159 . CA D 159 . C 1 1 
       362 . 4 1 159 LEU N 4 1 159 LEU CA 4 1 159 LEU C  4 1 160 VAL N       -59.8      -19.8 D 159 . N D 159 . CA D 159 . C  D 160 . N 1 1 
       363 . 4 1 159 LEU C 4 1 160 VAL N  4 1 160 VAL CA 4 1 160 VAL C       -84.7 -43.099995 D 159 . C D 160 . N  D 160 . CA D 160 . C 1 1 
       364 . 4 1 160 VAL N 4 1 160 VAL CA 4 1 160 VAL C  4 1 161 VAL N       -66.2      -26.2 D 160 . N D 160 . CA D 160 . C  D 161 . N 1 1 
       365 . 4 1 160 VAL C 4 1 161 VAL N  4 1 161 VAL CA 4 1 161 VAL C      -106.5      -22.1 D 160 . C D 161 . N  D 161 . CA D 161 . C 1 1 
       366 . 4 1 161 VAL N 4 1 161 VAL CA 4 1 161 VAL C  4 1 162 ILE N       -66.5      -13.7 D 161 . N D 161 . CA D 161 . C  D 162 . N 1 1 
    stop_

save_


save_conformer_family_coord_set_1
    _Conformer_family_coord_set.Sf_category  conformer_family_coord_set
    _Conformer_family_coord_set.Entry_ID     1
    _Conformer_family_coord_set.ID           1

    loop_
       _Atom_site.Model_ID
       _Atom_site.ID
       _Atom_site.Label_entity_assembly_ID
       _Atom_site.Label_entity_ID
       _Atom_site.Label_comp_index_ID
       _Atom_site.Label_comp_ID
       _Atom_site.Label_atom_ID
       _Atom_site.Type_symbol
       _Atom_site.Cartn_x
       _Atom_site.Cartn_y
       _Atom_site.Cartn_z
       _Atom_site.Occupancy
       _Atom_site.Uncertainty
       _Atom_site.PDBX_label_asym_ID
       _Atom_site.PDB_strand_ID
       _Atom_site.PDB_ins_code
       _Atom_site.PDB_residue_no
       _Atom_site.PDB_residue_name
       _Atom_site.PDB_atom_name
       _Atom_site.Entry_ID
       _Atom_site.Conformer_family_coord_set_ID

        1      1 1 1  10 GLN C    C  -72.085  -8.285 -113.386 1.00 . A A .  10 GLN C    1 1 
        1      2 1 1  10 GLN CA   C  -72.879  -8.022 -112.106 1.00 . A A .  10 GLN CA   1 1 
        1      3 1 1  10 GLN CB   C  -74.370  -7.898 -112.427 1.00 . A A .  10 GLN CB   1 1 
        1      4 1 1  10 GLN CD   C  -74.321 -10.374 -112.947 1.00 . A A .  10 GLN CD   1 1 
        1      5 1 1  10 GLN CG   C  -75.111  -9.236 -112.337 1.00 . A A .  10 GLN CG   1 1 
        1      6 1 1  10 GLN H    H  -73.182  -6.054 -111.457 1.00 . A A .  10 GLN H    1 1 
        1      7 1 1  10 GLN HA   H  -72.719  -8.829 -111.421 1.00 . A A .  10 GLN HA   1 1 
        1      8 1 1  10 GLN HB2  H  -74.821  -7.226 -111.722 1.00 . A A .  10 GLN HB2  1 1 
        1      9 1 1  10 GLN HB3  H  -74.485  -7.504 -113.418 1.00 . A A .  10 GLN HB3  1 1 
        1     10 1 1  10 GLN HE21 H  -75.428 -10.366 -114.614 1.00 . A A .  10 GLN HE21 1 1 
        1     11 1 1  10 GLN HE22 H  -74.199 -11.538 -114.579 1.00 . A A .  10 GLN HE22 1 1 
        1     12 1 1  10 GLN HG2  H  -75.323  -9.454 -111.310 1.00 . A A .  10 GLN HG2  1 1 
        1     13 1 1  10 GLN HG3  H  -76.045  -9.137 -112.880 1.00 . A A .  10 GLN HG3  1 1 
        1     14 1 1  10 GLN N    N  -72.408  -6.752 -111.461 1.00 . A A .  10 GLN N    1 1 
        1     15 1 1  10 GLN NE2  N  -74.672 -10.799 -114.146 1.00 . A A .  10 GLN NE2  1 1 
        1     16 1 1  10 GLN O    O  -72.582  -8.950 -114.302 1.00 . A A .  10 GLN O    1 1 
        1     17 1 1  10 GLN OE1  O  -73.379 -10.888 -112.321 1.00 . A A .  10 GLN OE1  1 1 
        1     18 1 1  11 GLY C    C  -68.496  -7.931 -114.171 1.00 . A A .  11 GLY C    1 1 
        1     19 1 1  11 GLY CA   C  -69.972  -7.940 -114.580 1.00 . A A .  11 GLY CA   1 1 
        1     20 1 1  11 GLY H    H  -70.537  -7.265 -112.650 1.00 . A A .  11 GLY H    1 1 
        1     21 1 1  11 GLY HA2  H  -70.185  -8.878 -115.055 1.00 . A A .  11 GLY HA2  1 1 
        1     22 1 1  11 GLY HA3  H  -70.148  -7.137 -115.280 1.00 . A A .  11 GLY HA3  1 1 
        1     23 1 1  11 GLY N    N  -70.854  -7.769 -113.421 1.00 . A A .  11 GLY N    1 1 
        1     24 1 1  11 GLY O    O  -68.162  -7.718 -113.006 1.00 . A A .  11 GLY O    1 1 
        1     25 1 1  12 ARG C    C  -65.765  -6.761 -114.247 1.00 . A A .  12 ARG C    1 1 
        1     26 1 1  12 ARG CA   C  -66.168  -8.092 -114.935 1.00 . A A .  12 ARG CA   1 1 
        1     27 1 1  12 ARG CB   C  -65.395  -8.242 -116.284 1.00 . A A .  12 ARG CB   1 1 
        1     28 1 1  12 ARG CD   C  -64.978  -9.768 -118.314 1.00 . A A .  12 ARG CD   1 1 
        1     29 1 1  12 ARG CG   C  -65.305  -9.709 -116.785 1.00 . A A .  12 ARG CG   1 1 
        1     30 1 1  12 ARG CZ   C  -63.020  -9.449 -119.830 1.00 . A A .  12 ARG CZ   1 1 
        1     31 1 1  12 ARG H    H  -67.958  -8.217 -116.076 1.00 . A A .  12 ARG H    1 1 
        1     32 1 1  12 ARG HA   H  -65.900  -8.894 -114.290 1.00 . A A .  12 ARG HA   1 1 
        1     33 1 1  12 ARG HB2  H  -65.889  -7.661 -117.029 1.00 . A A .  12 ARG HB2  1 1 
        1     34 1 1  12 ARG HB3  H  -64.399  -7.869 -116.137 1.00 . A A .  12 ARG HB3  1 1 
        1     35 1 1  12 ARG HD2  H  -65.213 -10.756 -118.670 1.00 . A A .  12 ARG HD2  1 1 
        1     36 1 1  12 ARG HD3  H  -65.597  -9.052 -118.825 1.00 . A A .  12 ARG HD3  1 1 
        1     37 1 1  12 ARG HE   H  -62.969  -9.313 -117.840 1.00 . A A .  12 ARG HE   1 1 
        1     38 1 1  12 ARG HG2  H  -64.519 -10.215 -116.247 1.00 . A A .  12 ARG HG2  1 1 
        1     39 1 1  12 ARG HG3  H  -66.238 -10.208 -116.610 1.00 . A A .  12 ARG HG3  1 1 
        1     40 1 1  12 ARG HH11 H  -64.727  -9.882 -120.817 1.00 . A A .  12 ARG HH11 1 1 
        1     41 1 1  12 ARG HH12 H  -63.329  -9.643 -121.813 1.00 . A A .  12 ARG HH12 1 1 
        1     42 1 1  12 ARG HH21 H  -61.161  -9.011 -119.147 1.00 . A A .  12 ARG HH21 1 1 
        1     43 1 1  12 ARG HH22 H  -61.310  -9.150 -120.867 1.00 . A A .  12 ARG HH22 1 1 
        1     44 1 1  12 ARG N    N  -67.620  -8.100 -115.171 1.00 . A A .  12 ARG N    1 1 
        1     45 1 1  12 ARG NE   N  -63.555  -9.483 -118.588 1.00 . A A .  12 ARG NE   1 1 
        1     46 1 1  12 ARG NH1  N  -63.751  -9.676 -120.902 1.00 . A A .  12 ARG NH1  1 1 
        1     47 1 1  12 ARG NH2  N  -61.729  -9.182 -119.957 1.00 . A A .  12 ARG NH2  1 1 
        1     48 1 1  12 ARG O    O  -64.974  -6.764 -113.302 1.00 . A A .  12 ARG O    1 1 
        1     49 1 1  13 GLY C    C  -66.471  -4.209 -112.722 1.00 . A A .  13 GLY C    1 1 
        1     50 1 1  13 GLY CA   C  -66.012  -4.325 -114.167 1.00 . A A .  13 GLY CA   1 1 
        1     51 1 1  13 GLY H    H  -66.925  -5.703 -115.485 1.00 . A A .  13 GLY H    1 1 
        1     52 1 1  13 GLY HA2  H  -64.951  -4.154 -114.213 1.00 . A A .  13 GLY HA2  1 1 
        1     53 1 1  13 GLY HA3  H  -66.519  -3.571 -114.755 1.00 . A A .  13 GLY HA3  1 1 
        1     54 1 1  13 GLY N    N  -66.312  -5.641 -114.731 1.00 . A A .  13 GLY N    1 1 
        1     55 1 1  13 GLY O    O  -65.688  -3.834 -111.854 1.00 . A A .  13 GLY O    1 1 
        1     56 1 1  14 ALA C    C  -67.550  -5.295 -110.093 1.00 . A A .  14 ALA C    1 1 
        1     57 1 1  14 ALA CA   C  -68.329  -4.480 -111.141 1.00 . A A .  14 ALA CA   1 1 
        1     58 1 1  14 ALA CB   C  -69.779  -4.971 -111.204 1.00 . A A .  14 ALA CB   1 1 
        1     59 1 1  14 ALA H    H  -68.291  -4.848 -113.232 1.00 . A A .  14 ALA H    1 1 
        1     60 1 1  14 ALA HA   H  -68.344  -3.455 -110.833 1.00 . A A .  14 ALA HA   1 1 
        1     61 1 1  14 ALA HB1  H  -69.800  -6.032 -111.397 1.00 . A A .  14 ALA HB1  1 1 
        1     62 1 1  14 ALA HB2  H  -70.299  -4.450 -111.997 1.00 . A A .  14 ALA HB2  1 1 
        1     63 1 1  14 ALA HB3  H  -70.266  -4.764 -110.262 1.00 . A A .  14 ALA HB3  1 1 
        1     64 1 1  14 ALA N    N  -67.737  -4.550 -112.485 1.00 . A A .  14 ALA N    1 1 
        1     65 1 1  14 ALA O    O  -67.253  -4.794 -108.997 1.00 . A A .  14 ALA O    1 1 
        1     66 1 1  15 TRP C    C  -64.957  -6.809 -109.486 1.00 . A A .  15 TRP C    1 1 
        1     67 1 1  15 TRP CA   C  -66.374  -7.390 -109.615 1.00 . A A .  15 TRP CA   1 1 
        1     68 1 1  15 TRP CB   C  -66.310  -8.825 -110.190 1.00 . A A .  15 TRP CB   1 1 
        1     69 1 1  15 TRP CD1  C  -67.105 -11.070 -109.282 1.00 . A A .  15 TRP CD1  1 1 
        1     70 1 1  15 TRP CD2  C  -68.640  -9.448 -109.124 1.00 . A A .  15 TRP CD2  1 1 
        1     71 1 1  15 TRP CE2  C  -69.211 -10.647 -108.590 1.00 . A A .  15 TRP CE2  1 1 
        1     72 1 1  15 TRP CE3  C  -69.421  -8.285 -109.132 1.00 . A A .  15 TRP CE3  1 1 
        1     73 1 1  15 TRP CG   C  -67.313  -9.742 -109.553 1.00 . A A .  15 TRP CG   1 1 
        1     74 1 1  15 TRP CH2  C  -71.252  -9.538 -108.107 1.00 . A A .  15 TRP CH2  1 1 
        1     75 1 1  15 TRP CZ2  C  -70.489 -10.687 -108.094 1.00 . A A .  15 TRP CZ2  1 1 
        1     76 1 1  15 TRP CZ3  C  -70.723  -8.336 -108.624 1.00 . A A .  15 TRP CZ3  1 1 
        1     77 1 1  15 TRP H    H  -67.373  -6.800 -111.377 1.00 . A A .  15 TRP H    1 1 
        1     78 1 1  15 TRP HA   H  -66.811  -7.423 -108.639 1.00 . A A .  15 TRP HA   1 1 
        1     79 1 1  15 TRP HB2  H  -66.510  -8.785 -111.239 1.00 . A A .  15 TRP HB2  1 1 
        1     80 1 1  15 TRP HB3  H  -65.328  -9.216 -110.021 1.00 . A A .  15 TRP HB3  1 1 
        1     81 1 1  15 TRP HD1  H  -66.207 -11.612 -109.480 1.00 . A A .  15 TRP HD1  1 1 
        1     82 1 1  15 TRP HE1  H  -68.362 -12.531 -108.411 1.00 . A A .  15 TRP HE1  1 1 
        1     83 1 1  15 TRP HE3  H  -69.029  -7.355 -109.524 1.00 . A A .  15 TRP HE3  1 1 
        1     84 1 1  15 TRP HH2  H  -72.251  -9.561 -107.722 1.00 . A A .  15 TRP HH2  1 1 
        1     85 1 1  15 TRP HZ2  H  -70.898 -11.617 -107.696 1.00 . A A .  15 TRP HZ2  1 1 
        1     86 1 1  15 TRP HZ3  H  -71.332  -7.450 -108.626 1.00 . A A .  15 TRP HZ3  1 1 
        1     87 1 1  15 TRP N    N  -67.155  -6.510 -110.480 1.00 . A A .  15 TRP N    1 1 
        1     88 1 1  15 TRP NE1  N  -68.237 -11.590 -108.709 1.00 . A A .  15 TRP NE1  1 1 
        1     89 1 1  15 TRP O    O  -64.444  -6.712 -108.380 1.00 . A A .  15 TRP O    1 1 
        1     90 1 1  16 LEU C    C  -62.876  -4.551 -109.732 1.00 . A A .  16 LEU C    1 1 
        1     91 1 1  16 LEU CA   C  -62.956  -5.862 -110.563 1.00 . A A .  16 LEU CA   1 1 
        1     92 1 1  16 LEU CB   C  -62.413  -5.577 -111.986 1.00 . A A .  16 LEU CB   1 1 
        1     93 1 1  16 LEU CD1  C  -60.338  -7.023 -111.906 1.00 . A A .  16 LEU CD1  1 1 
        1     94 1 1  16 LEU CD2  C  -62.463  -7.988 -112.799 1.00 . A A .  16 LEU CD2  1 1 
        1     95 1 1  16 LEU CG   C  -61.621  -6.727 -112.666 1.00 . A A .  16 LEU CG   1 1 
        1     96 1 1  16 LEU H    H  -64.775  -6.534 -111.475 1.00 . A A .  16 LEU H    1 1 
        1     97 1 1  16 LEU HA   H  -62.334  -6.572 -110.090 1.00 . A A .  16 LEU HA   1 1 
        1     98 1 1  16 LEU HB2  H  -63.231  -5.352 -112.619 1.00 . A A .  16 LEU HB2  1 1 
        1     99 1 1  16 LEU HB3  H  -61.762  -4.728 -111.927 1.00 . A A .  16 LEU HB3  1 1 
        1    100 1 1  16 LEU HD11 H  -60.559  -7.667 -111.071 1.00 . A A .  16 LEU HD11 1 1 
        1    101 1 1  16 LEU HD12 H  -59.906  -6.101 -111.553 1.00 . A A .  16 LEU HD12 1 1 
        1    102 1 1  16 LEU HD13 H  -59.640  -7.518 -112.567 1.00 . A A .  16 LEU HD13 1 1 
        1    103 1 1  16 LEU HD21 H  -63.050  -7.933 -113.705 1.00 . A A .  16 LEU HD21 1 1 
        1    104 1 1  16 LEU HD22 H  -63.114  -8.078 -111.948 1.00 . A A .  16 LEU HD22 1 1 
        1    105 1 1  16 LEU HD23 H  -61.812  -8.847 -112.854 1.00 . A A .  16 LEU HD23 1 1 
        1    106 1 1  16 LEU HG   H  -61.351  -6.382 -113.660 1.00 . A A .  16 LEU HG   1 1 
        1    107 1 1  16 LEU N    N  -64.328  -6.423 -110.611 1.00 . A A .  16 LEU N    1 1 
        1    108 1 1  16 LEU O    O  -61.895  -4.345 -109.001 1.00 . A A .  16 LEU O    1 1 
        1    109 1 1  17 LEU C    C  -63.875  -2.862 -107.543 1.00 . A A .  17 LEU C    1 1 
        1    110 1 1  17 LEU CA   C  -63.961  -2.491 -109.010 1.00 . A A .  17 LEU CA   1 1 
        1    111 1 1  17 LEU CB   C  -65.287  -1.746 -109.299 1.00 . A A .  17 LEU CB   1 1 
        1    112 1 1  17 LEU CD1  C  -66.039  -0.827 -107.047 1.00 . A A .  17 LEU CD1  1 1 
        1    113 1 1  17 LEU CD2  C  -64.303   0.421 -108.379 1.00 . A A .  17 LEU CD2  1 1 
        1    114 1 1  17 LEU CG   C  -65.543  -0.469 -108.451 1.00 . A A .  17 LEU CG   1 1 
        1    115 1 1  17 LEU H    H  -64.685  -3.981 -110.343 1.00 . A A .  17 LEU H    1 1 
        1    116 1 1  17 LEU HA   H  -63.136  -1.866 -109.278 1.00 . A A .  17 LEU HA   1 1 
        1    117 1 1  17 LEU HB2  H  -65.284  -1.447 -110.324 1.00 . A A .  17 LEU HB2  1 1 
        1    118 1 1  17 LEU HB3  H  -66.098  -2.426 -109.134 1.00 . A A .  17 LEU HB3  1 1 
        1    119 1 1  17 LEU HD11 H  -66.662  -1.708 -107.095 1.00 . A A .  17 LEU HD11 1 1 
        1    120 1 1  17 LEU HD12 H  -66.624  -0.003 -106.656 1.00 . A A .  17 LEU HD12 1 1 
        1    121 1 1  17 LEU HD13 H  -65.201  -1.011 -106.400 1.00 . A A .  17 LEU HD13 1 1 
        1    122 1 1  17 LEU HD21 H  -64.009   0.707 -109.380 1.00 . A A .  17 LEU HD21 1 1 
        1    123 1 1  17 LEU HD22 H  -63.501  -0.111 -107.904 1.00 . A A .  17 LEU HD22 1 1 
        1    124 1 1  17 LEU HD23 H  -64.537   1.311 -107.809 1.00 . A A .  17 LEU HD23 1 1 
        1    125 1 1  17 LEU HG   H  -66.331   0.083 -108.945 1.00 . A A .  17 LEU HG   1 1 
        1    126 1 1  17 LEU N    N  -63.922  -3.730 -109.796 1.00 . A A .  17 LEU N    1 1 
        1    127 1 1  17 LEU O    O  -63.006  -2.358 -106.834 1.00 . A A .  17 LEU O    1 1 
        1    128 1 1  18 MET C    C  -63.441  -4.884 -105.293 1.00 . A A .  18 MET C    1 1 
        1    129 1 1  18 MET CA   C  -64.745  -4.190 -105.705 1.00 . A A .  18 MET CA   1 1 
        1    130 1 1  18 MET CB   C  -65.968  -5.193 -105.429 1.00 . A A .  18 MET CB   1 1 
        1    131 1 1  18 MET CE   C  -68.419  -2.155 -104.376 1.00 . A A .  18 MET CE   1 1 
        1    132 1 1  18 MET CG   C  -67.324  -4.464 -105.441 1.00 . A A .  18 MET CG   1 1 
        1    133 1 1  18 MET H    H  -65.402  -4.151 -107.730 1.00 . A A .  18 MET H    1 1 
        1    134 1 1  18 MET HA   H  -64.896  -3.351 -105.084 1.00 . A A .  18 MET HA   1 1 
        1    135 1 1  18 MET HB2  H  -65.960  -5.923 -106.206 1.00 . A A .  18 MET HB2  1 1 
        1    136 1 1  18 MET HB3  H  -65.793  -5.642 -104.485 1.00 . A A .  18 MET HB3  1 1 
        1    137 1 1  18 MET HE1  H  -69.254  -2.309 -105.042 1.00 . A A .  18 MET HE1  1 1 
        1    138 1 1  18 MET HE2  H  -67.644  -1.611 -104.886 1.00 . A A .  18 MET HE2  1 1 
        1    139 1 1  18 MET HE3  H  -68.743  -1.591 -103.509 1.00 . A A .  18 MET HE3  1 1 
        1    140 1 1  18 MET HG2  H  -67.311  -3.687 -106.165 1.00 . A A .  18 MET HG2  1 1 
        1    141 1 1  18 MET HG3  H  -68.066  -5.197 -105.712 1.00 . A A .  18 MET HG3  1 1 
        1    142 1 1  18 MET N    N  -64.747  -3.773 -107.104 1.00 . A A .  18 MET N    1 1 
        1    143 1 1  18 MET O    O  -62.903  -4.576 -104.229 1.00 . A A .  18 MET O    1 1 
        1    144 1 1  18 MET SD   S  -67.772  -3.757 -103.827 1.00 . A A .  18 MET SD   1 1 
        1    145 1 1  19 ALA C    C  -60.485  -5.349 -105.842 1.00 . A A .  19 ALA C    1 1 
        1    146 1 1  19 ALA CA   C  -61.618  -6.391 -105.872 1.00 . A A .  19 ALA CA   1 1 
        1    147 1 1  19 ALA CB   C  -61.316  -7.461 -106.929 1.00 . A A .  19 ALA CB   1 1 
        1    148 1 1  19 ALA H    H  -63.354  -5.921 -106.999 1.00 . A A .  19 ALA H    1 1 
        1    149 1 1  19 ALA HA   H  -61.665  -6.865 -104.915 1.00 . A A .  19 ALA HA   1 1 
        1    150 1 1  19 ALA HB1  H  -60.537  -8.115 -106.562 1.00 . A A .  19 ALA HB1  1 1 
        1    151 1 1  19 ALA HB2  H  -60.991  -6.994 -107.845 1.00 . A A .  19 ALA HB2  1 1 
        1    152 1 1  19 ALA HB3  H  -62.209  -8.040 -107.116 1.00 . A A .  19 ALA HB3  1 1 
        1    153 1 1  19 ALA N    N  -62.902  -5.745 -106.154 1.00 . A A .  19 ALA N    1 1 
        1    154 1 1  19 ALA O    O  -59.638  -5.379 -104.948 1.00 . A A .  19 ALA O    1 1 
        1    155 1 1  20 PHE C    C  -59.668  -2.472 -105.558 1.00 . A A .  20 PHE C    1 1 
        1    156 1 1  20 PHE CA   C  -59.508  -3.324 -106.810 1.00 . A A .  20 PHE CA   1 1 
        1    157 1 1  20 PHE CB   C  -59.669  -2.462 -108.092 1.00 . A A .  20 PHE CB   1 1 
        1    158 1 1  20 PHE CD1  C  -57.347  -1.837 -108.947 1.00 . A A .  20 PHE CD1  1 1 
        1    159 1 1  20 PHE CD2  C  -58.663  -0.140 -107.835 1.00 . A A .  20 PHE CD2  1 1 
        1    160 1 1  20 PHE CE1  C  -56.309  -0.908 -109.143 1.00 . A A .  20 PHE CE1  1 1 
        1    161 1 1  20 PHE CE2  C  -57.624   0.788 -108.030 1.00 . A A .  20 PHE CE2  1 1 
        1    162 1 1  20 PHE CG   C  -58.526  -1.456 -108.287 1.00 . A A .  20 PHE CG   1 1 
        1    163 1 1  20 PHE CZ   C  -56.446   0.403 -108.684 1.00 . A A .  20 PHE CZ   1 1 
        1    164 1 1  20 PHE H    H  -61.249  -4.385 -107.424 1.00 . A A .  20 PHE H    1 1 
        1    165 1 1  20 PHE HA   H  -58.531  -3.763 -106.807 1.00 . A A .  20 PHE HA   1 1 
        1    166 1 1  20 PHE HB2  H  -59.689  -3.118 -108.942 1.00 . A A .  20 PHE HB2  1 1 
        1    167 1 1  20 PHE HB3  H  -60.598  -1.925 -108.035 1.00 . A A .  20 PHE HB3  1 1 
        1    168 1 1  20 PHE HD1  H  -57.235  -2.844 -109.303 1.00 . A A .  20 PHE HD1  1 1 
        1    169 1 1  20 PHE HD2  H  -59.564   0.164 -107.333 1.00 . A A .  20 PHE HD2  1 1 
        1    170 1 1  20 PHE HE1  H  -55.403  -1.212 -109.651 1.00 . A A .  20 PHE HE1  1 1 
        1    171 1 1  20 PHE HE2  H  -57.737   1.802 -107.673 1.00 . A A .  20 PHE HE2  1 1 
        1    172 1 1  20 PHE HZ   H  -55.647   1.117 -108.831 1.00 . A A .  20 PHE HZ   1 1 
        1    173 1 1  20 PHE N    N  -60.521  -4.388 -106.776 1.00 . A A .  20 PHE N    1 1 
        1    174 1 1  20 PHE O    O  -58.728  -2.349 -104.775 1.00 . A A .  20 PHE O    1 1 
        1    175 1 1  21 THR C    C  -60.572  -1.571 -102.899 1.00 . A A .  21 THR C    1 1 
        1    176 1 1  21 THR CA   C  -61.118  -0.979 -104.255 1.00 . A A .  21 THR CA   1 1 
        1    177 1 1  21 THR CB   C  -62.615  -0.591 -104.148 1.00 . A A .  21 THR CB   1 1 
        1    178 1 1  21 THR CG2  C  -62.900   0.655 -104.980 1.00 . A A .  21 THR CG2  1 1 
        1    179 1 1  21 THR H    H  -61.546  -1.991 -106.064 1.00 . A A .  21 THR H    1 1 
        1    180 1 1  21 THR HA   H  -60.550  -0.099 -104.432 1.00 . A A .  21 THR HA   1 1 
        1    181 1 1  21 THR HB   H  -62.862  -0.373 -103.122 1.00 . A A .  21 THR HB   1 1 
        1    182 1 1  21 THR HG1  H  -63.291  -2.402 -104.081 1.00 . A A .  21 THR HG1  1 1 
        1    183 1 1  21 THR HG21 H  -63.966   0.830 -104.992 1.00 . A A .  21 THR HG21 1 1 
        1    184 1 1  21 THR HG22 H  -62.545   0.498 -105.982 1.00 . A A .  21 THR HG22 1 1 
        1    185 1 1  21 THR HG23 H  -62.399   1.501 -104.542 1.00 . A A .  21 THR HG23 1 1 
        1    186 1 1  21 THR N    N  -60.854  -1.868 -105.391 1.00 . A A .  21 THR N    1 1 
        1    187 1 1  21 THR O    O  -59.919  -0.846 -102.151 1.00 . A A .  21 THR O    1 1 
        1    188 1 1  21 THR OG1  O  -63.437  -1.633 -104.632 1.00 . A A .  21 THR OG1  1 1 
        1    189 1 1  22 ALA C    C  -58.789  -3.773 -101.512 1.00 . A A .  22 ALA C    1 1 
        1    190 1 1  22 ALA CA   C  -60.308  -3.516 -101.473 1.00 . A A .  22 ALA CA   1 1 
        1    191 1 1  22 ALA CB   C  -61.036  -4.840 -101.296 1.00 . A A .  22 ALA CB   1 1 
        1    192 1 1  22 ALA H    H  -61.330  -3.358 -103.327 1.00 . A A .  22 ALA H    1 1 
        1    193 1 1  22 ALA HA   H  -60.522  -2.905 -100.630 1.00 . A A .  22 ALA HA   1 1 
        1    194 1 1  22 ALA HB1  H  -61.015  -5.108 -100.255 1.00 . A A .  22 ALA HB1  1 1 
        1    195 1 1  22 ALA HB2  H  -60.552  -5.608 -101.876 1.00 . A A .  22 ALA HB2  1 1 
        1    196 1 1  22 ALA HB3  H  -62.059  -4.729 -101.620 1.00 . A A .  22 ALA HB3  1 1 
        1    197 1 1  22 ALA N    N  -60.813  -2.848 -102.675 1.00 . A A .  22 ALA N    1 1 
        1    198 1 1  22 ALA O    O  -58.087  -3.421 -100.569 1.00 . A A .  22 ALA O    1 1 
        1    199 1 1  23 LEU C    C  -56.131  -3.163 -102.518 1.00 . A A .  23 LEU C    1 1 
        1    200 1 1  23 LEU CA   C  -56.818  -4.499 -102.750 1.00 . A A .  23 LEU CA   1 1 
        1    201 1 1  23 LEU CB   C  -56.505  -5.039 -104.170 1.00 . A A .  23 LEU CB   1 1 
        1    202 1 1  23 LEU CD1  C  -54.318  -3.933 -104.688 1.00 . A A .  23 LEU CD1  1 1 
        1    203 1 1  23 LEU CD2  C  -54.296  -6.103 -103.455 1.00 . A A .  23 LEU CD2  1 1 
        1    204 1 1  23 LEU CG   C  -55.010  -5.266 -104.511 1.00 . A A .  23 LEU CG   1 1 
        1    205 1 1  23 LEU H    H  -58.858  -4.465 -103.389 1.00 . A A .  23 LEU H    1 1 
        1    206 1 1  23 LEU HA   H  -56.492  -5.209 -102.022 1.00 . A A .  23 LEU HA   1 1 
        1    207 1 1  23 LEU HB2  H  -56.994  -5.968 -104.286 1.00 . A A .  23 LEU HB2  1 1 
        1    208 1 1  23 LEU HB3  H  -56.896  -4.337 -104.881 1.00 . A A .  23 LEU HB3  1 1 
        1    209 1 1  23 LEU HD11 H  -53.609  -4.005 -105.498 1.00 . A A .  23 LEU HD11 1 1 
        1    210 1 1  23 LEU HD12 H  -53.808  -3.669 -103.778 1.00 . A A .  23 LEU HD12 1 1 
        1    211 1 1  23 LEU HD13 H  -55.050  -3.174 -104.924 1.00 . A A .  23 LEU HD13 1 1 
        1    212 1 1  23 LEU HD21 H  -54.166  -5.514 -102.563 1.00 . A A .  23 LEU HD21 1 1 
        1    213 1 1  23 LEU HD22 H  -53.327  -6.400 -103.836 1.00 . A A .  23 LEU HD22 1 1 
        1    214 1 1  23 LEU HD23 H  -54.880  -6.979 -103.234 1.00 . A A .  23 LEU HD23 1 1 
        1    215 1 1  23 LEU HG   H  -54.973  -5.797 -105.457 1.00 . A A .  23 LEU HG   1 1 
        1    216 1 1  23 LEU N    N  -58.270  -4.277 -102.633 1.00 . A A .  23 LEU N    1 1 
        1    217 1 1  23 LEU O    O  -55.074  -3.105 -101.902 1.00 . A A .  23 LEU O    1 1 
        1    218 1 1  24 ALA C    C  -56.447  -0.174 -101.500 1.00 . A A .  24 ALA C    1 1 
        1    219 1 1  24 ALA CA   C  -56.211  -0.750 -102.885 1.00 . A A .  24 ALA CA   1 1 
        1    220 1 1  24 ALA CB   C  -56.850   0.178 -103.943 1.00 . A A .  24 ALA CB   1 1 
        1    221 1 1  24 ALA H    H  -57.617  -2.218 -103.460 1.00 . A A .  24 ALA H    1 1 
        1    222 1 1  24 ALA HA   H  -55.153  -0.781 -103.075 1.00 . A A .  24 ALA HA   1 1 
        1    223 1 1  24 ALA HB1  H  -56.649   1.211 -103.691 1.00 . A A .  24 ALA HB1  1 1 
        1    224 1 1  24 ALA HB2  H  -57.917   0.017 -103.972 1.00 . A A .  24 ALA HB2  1 1 
        1    225 1 1  24 ALA HB3  H  -56.428  -0.039 -104.916 1.00 . A A .  24 ALA HB3  1 1 
        1    226 1 1  24 ALA N    N  -56.761  -2.095 -103.013 1.00 . A A .  24 ALA N    1 1 
        1    227 1 1  24 ALA O    O  -55.496   0.168 -100.793 1.00 . A A .  24 ALA O    1 1 
        1    228 1 1  25 LEU C    C  -57.508  -0.354  -98.713 1.00 . A A .  25 LEU C    1 1 
        1    229 1 1  25 LEU CA   C  -58.142   0.439  -99.826 1.00 . A A .  25 LEU CA   1 1 
        1    230 1 1  25 LEU CB   C  -59.688   0.371  -99.746 1.00 . A A .  25 LEU CB   1 1 
        1    231 1 1  25 LEU CD1  C  -60.372   2.482  -98.606 1.00 . A A .  25 LEU CD1  1 1 
        1    232 1 1  25 LEU CD2  C  -61.722   0.422  -98.206 1.00 . A A .  25 LEU CD2  1 1 
        1    233 1 1  25 LEU CG   C  -60.304   0.985  -98.437 1.00 . A A .  25 LEU CG   1 1 
        1    234 1 1  25 LEU H    H  -58.401  -0.451 -101.734 1.00 . A A .  25 LEU H    1 1 
        1    235 1 1  25 LEU HA   H  -57.827   1.464  -99.770 1.00 . A A .  25 LEU HA   1 1 
        1    236 1 1  25 LEU HB2  H  -60.089   0.916 -100.562 1.00 . A A .  25 LEU HB2  1 1 
        1    237 1 1  25 LEU HB3  H  -59.978  -0.645  -99.798 1.00 . A A .  25 LEU HB3  1 1 
        1    238 1 1  25 LEU HD11 H  -61.099   2.735  -99.363 1.00 . A A .  25 LEU HD11 1 1 
        1    239 1 1  25 LEU HD12 H  -59.400   2.838  -98.906 1.00 . A A .  25 LEU HD12 1 1 
        1    240 1 1  25 LEU HD13 H  -60.651   2.922  -97.669 1.00 . A A .  25 LEU HD13 1 1 
        1    241 1 1  25 LEU HD21 H  -62.225   0.263  -99.146 1.00 . A A .  25 LEU HD21 1 1 
        1    242 1 1  25 LEU HD22 H  -62.287   1.123  -97.607 1.00 . A A .  25 LEU HD22 1 1 
        1    243 1 1  25 LEU HD23 H  -61.645  -0.517  -97.674 1.00 . A A .  25 LEU HD23 1 1 
        1    244 1 1  25 LEU HG   H  -59.691   0.742  -97.610 1.00 . A A .  25 LEU HG   1 1 
        1    245 1 1  25 LEU N    N  -57.725  -0.111 -101.124 1.00 . A A .  25 LEU N    1 1 
        1    246 1 1  25 LEU O    O  -57.077   0.213  -97.716 1.00 . A A .  25 LEU O    1 1 
        1    247 1 1  26 GLU C    C  -55.348  -2.651  -97.862 1.00 . A A .  26 GLU C    1 1 
        1    248 1 1  26 GLU CA   C  -56.902  -2.526  -97.848 1.00 . A A .  26 GLU CA   1 1 
        1    249 1 1  26 GLU CB   C  -57.460  -3.962  -97.975 1.00 . A A .  26 GLU CB   1 1 
        1    250 1 1  26 GLU CD   C  -59.547  -5.238  -98.225 1.00 . A A .  26 GLU CD   1 1 
        1    251 1 1  26 GLU CG   C  -58.956  -3.886  -97.902 1.00 . A A .  26 GLU CG   1 1 
        1    252 1 1  26 GLU H    H  -57.808  -2.068  -99.699 1.00 . A A .  26 GLU H    1 1 
        1    253 1 1  26 GLU HA   H  -57.179  -2.154  -96.894 1.00 . A A .  26 GLU HA   1 1 
        1    254 1 1  26 GLU HB2  H  -57.153  -4.377  -98.901 1.00 . A A .  26 GLU HB2  1 1 
        1    255 1 1  26 GLU HB3  H  -57.086  -4.540  -97.155 1.00 . A A .  26 GLU HB3  1 1 
        1    256 1 1  26 GLU HG2  H  -59.247  -3.603  -96.912 1.00 . A A .  26 GLU HG2  1 1 
        1    257 1 1  26 GLU HG3  H  -59.308  -3.168  -98.614 1.00 . A A .  26 GLU HG3  1 1 
        1    258 1 1  26 GLU N    N  -57.459  -1.670  -98.877 1.00 . A A .  26 GLU N    1 1 
        1    259 1 1  26 GLU O    O  -54.760  -2.897  -96.816 1.00 . A A .  26 GLU O    1 1 
        1    260 1 1  26 GLU OE1  O  -59.041  -5.869  -99.149 1.00 . A A .  26 GLU OE1  1 1 
        1    261 1 1  26 GLU OE2  O  -60.499  -5.630  -97.541 1.00 . A A .  26 GLU OE2  1 1 
        1    262 1 1  27 LEU C    C  -52.739  -1.163  -98.509 1.00 . A A .  27 LEU C    1 1 
        1    263 1 1  27 LEU CA   C  -53.294  -2.458  -99.100 1.00 . A A .  27 LEU CA   1 1 
        1    264 1 1  27 LEU CB   C  -52.860  -2.654 -100.581 1.00 . A A .  27 LEU CB   1 1 
        1    265 1 1  27 LEU CD1  C  -50.687  -3.949 -100.435 1.00 . A A .  27 LEU CD1  1 1 
        1    266 1 1  27 LEU CD2  C  -51.026  -2.330 -102.327 1.00 . A A .  27 LEU CD2  1 1 
        1    267 1 1  27 LEU CG   C  -51.324  -2.621 -100.832 1.00 . A A .  27 LEU CG   1 1 
        1    268 1 1  27 LEU H    H  -55.284  -2.173  -99.798 1.00 . A A .  27 LEU H    1 1 
        1    269 1 1  27 LEU HA   H  -52.939  -3.284  -98.519 1.00 . A A .  27 LEU HA   1 1 
        1    270 1 1  27 LEU HB2  H  -53.214  -3.608 -100.890 1.00 . A A .  27 LEU HB2  1 1 
        1    271 1 1  27 LEU HB3  H  -53.314  -1.887 -101.158 1.00 . A A .  27 LEU HB3  1 1 
        1    272 1 1  27 LEU HD11 H  -51.033  -4.221  -99.449 1.00 . A A .  27 LEU HD11 1 1 
        1    273 1 1  27 LEU HD12 H  -49.613  -3.833 -100.420 1.00 . A A .  27 LEU HD12 1 1 
        1    274 1 1  27 LEU HD13 H  -50.956  -4.722 -101.138 1.00 . A A .  27 LEU HD13 1 1 
        1    275 1 1  27 LEU HD21 H  -49.953  -2.354 -102.483 1.00 . A A .  27 LEU HD21 1 1 
        1    276 1 1  27 LEU HD22 H  -51.397  -1.346 -102.581 1.00 . A A .  27 LEU HD22 1 1 
        1    277 1 1  27 LEU HD23 H  -51.496  -3.066 -102.957 1.00 . A A .  27 LEU HD23 1 1 
        1    278 1 1  27 LEU HG   H  -50.896  -1.845 -100.249 1.00 . A A .  27 LEU HG   1 1 
        1    279 1 1  27 LEU N    N  -54.750  -2.417  -99.011 1.00 . A A .  27 LEU N    1 1 
        1    280 1 1  27 LEU O    O  -51.731  -1.193  -97.806 1.00 . A A .  27 LEU O    1 1 
        1    281 1 1  28 THR C    C  -52.657   1.084  -96.730 1.00 . A A .  28 THR C    1 1 
        1    282 1 1  28 THR CA   C  -53.008   1.261  -98.194 1.00 . A A .  28 THR CA   1 1 
        1    283 1 1  28 THR CB   C  -54.118   2.325  -98.300 1.00 . A A .  28 THR CB   1 1 
        1    284 1 1  28 THR CG2  C  -54.150   2.968  -99.694 1.00 . A A .  28 THR CG2  1 1 
        1    285 1 1  28 THR H    H  -54.275  -0.089  -99.238 1.00 . A A .  28 THR H    1 1 
        1    286 1 1  28 THR HA   H  -52.129   1.606  -98.734 1.00 . A A .  28 THR HA   1 1 
        1    287 1 1  28 THR HB   H  -53.928   3.097  -97.572 1.00 . A A .  28 THR HB   1 1 
        1    288 1 1  28 THR HG1  H  -55.211   0.856  -97.634 1.00 . A A .  28 THR HG1  1 1 
        1    289 1 1  28 THR HG21 H  -55.132   3.384  -99.875 1.00 . A A .  28 THR HG21 1 1 
        1    290 1 1  28 THR HG22 H  -53.930   2.225 -100.443 1.00 . A A .  28 THR HG22 1 1 
        1    291 1 1  28 THR HG23 H  -53.414   3.760  -99.745 1.00 . A A .  28 THR HG23 1 1 
        1    292 1 1  28 THR N    N  -53.440  -0.036  -98.736 1.00 . A A .  28 THR N    1 1 
        1    293 1 1  28 THR O    O  -51.894   1.859  -96.163 1.00 . A A .  28 THR O    1 1 
        1    294 1 1  28 THR OG1  O  -55.374   1.725  -98.014 1.00 . A A .  28 THR OG1  1 1 
        1    295 1 1  29 ALA C    C  -51.526  -0.240  -94.384 1.00 . A A .  29 ALA C    1 1 
        1    296 1 1  29 ALA CA   C  -53.012  -0.296  -94.743 1.00 . A A .  29 ALA CA   1 1 
        1    297 1 1  29 ALA CB   C  -53.573  -1.697  -94.469 1.00 . A A .  29 ALA CB   1 1 
        1    298 1 1  29 ALA H    H  -53.788  -0.557  -96.683 1.00 . A A .  29 ALA H    1 1 
        1    299 1 1  29 ALA HA   H  -53.545   0.404  -94.128 1.00 . A A .  29 ALA HA   1 1 
        1    300 1 1  29 ALA HB1  H  -52.948  -2.437  -94.943 1.00 . A A .  29 ALA HB1  1 1 
        1    301 1 1  29 ALA HB2  H  -54.574  -1.764  -94.865 1.00 . A A .  29 ALA HB2  1 1 
        1    302 1 1  29 ALA HB3  H  -53.597  -1.870  -93.404 1.00 . A A .  29 ALA HB3  1 1 
        1    303 1 1  29 ALA N    N  -53.226   0.030  -96.145 1.00 . A A .  29 ALA N    1 1 
        1    304 1 1  29 ALA O    O  -51.173   0.128  -93.259 1.00 . A A .  29 ALA O    1 1 
        1    305 1 1  30 LEU C    C  -48.558   0.686  -95.244 1.00 . A A .  30 LEU C    1 1 
        1    306 1 1  30 LEU CA   C  -49.225  -0.684  -95.129 1.00 . A A .  30 LEU CA   1 1 
        1    307 1 1  30 LEU CB   C  -48.557  -1.613  -96.161 1.00 . A A .  30 LEU CB   1 1 
        1    308 1 1  30 LEU CD1  C  -48.246  -3.917  -97.061 1.00 . A A .  30 LEU CD1  1 1 
        1    309 1 1  30 LEU CD2  C  -49.016  -3.603  -94.705 1.00 . A A .  30 LEU CD2  1 1 
        1    310 1 1  30 LEU CG   C  -49.088  -3.053  -96.119 1.00 . A A .  30 LEU CG   1 1 
        1    311 1 1  30 LEU H    H  -51.034  -0.929  -96.196 1.00 . A A .  30 LEU H    1 1 
        1    312 1 1  30 LEU HA   H  -49.033  -1.066  -94.154 1.00 . A A .  30 LEU HA   1 1 
        1    313 1 1  30 LEU HB2  H  -48.736  -1.228  -97.139 1.00 . A A .  30 LEU HB2  1 1 
        1    314 1 1  30 LEU HB3  H  -47.503  -1.628  -95.964 1.00 . A A .  30 LEU HB3  1 1 
        1    315 1 1  30 LEU HD11 H  -48.446  -3.624  -98.082 1.00 . A A .  30 LEU HD11 1 1 
        1    316 1 1  30 LEU HD12 H  -48.512  -4.953  -96.924 1.00 . A A .  30 LEU HD12 1 1 
        1    317 1 1  30 LEU HD13 H  -47.199  -3.778  -96.844 1.00 . A A .  30 LEU HD13 1 1 
        1    318 1 1  30 LEU HD21 H  -48.089  -3.305  -94.243 1.00 . A A .  30 LEU HD21 1 1 
        1    319 1 1  30 LEU HD22 H  -49.081  -4.679  -94.732 1.00 . A A .  30 LEU HD22 1 1 
        1    320 1 1  30 LEU HD23 H  -49.847  -3.207  -94.139 1.00 . A A .  30 LEU HD23 1 1 
        1    321 1 1  30 LEU HG   H  -50.100  -3.068  -96.463 1.00 . A A .  30 LEU HG   1 1 
        1    322 1 1  30 LEU N    N  -50.674  -0.640  -95.340 1.00 . A A .  30 LEU N    1 1 
        1    323 1 1  30 LEU O    O  -47.477   0.891  -94.688 1.00 . A A .  30 LEU O    1 1 
        1    324 1 1  31 TRP C    C  -48.899   3.786  -94.815 1.00 . A A .  31 TRP C    1 1 
        1    325 1 1  31 TRP CA   C  -48.750   2.988  -96.103 1.00 . A A .  31 TRP CA   1 1 
        1    326 1 1  31 TRP CB   C  -49.550   3.648  -97.248 1.00 . A A .  31 TRP CB   1 1 
        1    327 1 1  31 TRP CD1  C  -48.593   6.023  -97.285 1.00 . A A .  31 TRP CD1  1 1 
        1    328 1 1  31 TRP CD2  C  -50.811   5.938  -96.939 1.00 . A A .  31 TRP CD2  1 1 
        1    329 1 1  31 TRP CE2  C  -50.424   7.313  -96.941 1.00 . A A .  31 TRP CE2  1 1 
        1    330 1 1  31 TRP CE3  C  -52.169   5.630  -96.742 1.00 . A A .  31 TRP CE3  1 1 
        1    331 1 1  31 TRP CG   C  -49.631   5.144  -97.146 1.00 . A A .  31 TRP CG   1 1 
        1    332 1 1  31 TRP CH2  C  -52.666   8.017  -96.565 1.00 . A A .  31 TRP CH2  1 1 
        1    333 1 1  31 TRP CZ2  C  -51.334   8.329  -96.757 1.00 . A A .  31 TRP CZ2  1 1 
        1    334 1 1  31 TRP CZ3  C  -53.087   6.673  -96.556 1.00 . A A .  31 TRP CZ3  1 1 
        1    335 1 1  31 TRP H    H  -50.115   1.372  -96.276 1.00 . A A .  31 TRP H    1 1 
        1    336 1 1  31 TRP HA   H  -47.710   2.959  -96.387 1.00 . A A .  31 TRP HA   1 1 
        1    337 1 1  31 TRP HB2  H  -49.088   3.401  -98.181 1.00 . A A .  31 TRP HB2  1 1 
        1    338 1 1  31 TRP HB3  H  -50.550   3.253  -97.236 1.00 . A A .  31 TRP HB3  1 1 
        1    339 1 1  31 TRP HD1  H  -47.571   5.760  -97.457 1.00 . A A .  31 TRP HD1  1 1 
        1    340 1 1  31 TRP HE1  H  -48.535   8.136  -97.205 1.00 . A A .  31 TRP HE1  1 1 
        1    341 1 1  31 TRP HE3  H  -52.505   4.599  -96.732 1.00 . A A .  31 TRP HE3  1 1 
        1    342 1 1  31 TRP HH2  H  -53.381   8.803  -96.423 1.00 . A A .  31 TRP HH2  1 1 
        1    343 1 1  31 TRP HZ2  H  -51.009   9.369  -96.762 1.00 . A A .  31 TRP HZ2  1 1 
        1    344 1 1  31 TRP HZ3  H  -54.130   6.451  -96.406 1.00 . A A .  31 TRP HZ3  1 1 
        1    345 1 1  31 TRP N    N  -49.241   1.613  -95.915 1.00 . A A .  31 TRP N    1 1 
        1    346 1 1  31 TRP NE1  N  -49.074   7.304  -97.155 1.00 . A A .  31 TRP NE1  1 1 
        1    347 1 1  31 TRP O    O  -49.703   3.444  -93.948 1.00 . A A .  31 TRP O    1 1 
        1    348 1 1  32 PHE C    C  -47.843   5.087  -92.252 1.00 . A A .  32 PHE C    1 1 
        1    349 1 1  32 PHE CA   C  -48.128   5.787  -93.583 1.00 . A A .  32 PHE CA   1 1 
        1    350 1 1  32 PHE CB   C  -49.475   6.508  -93.513 1.00 . A A .  32 PHE CB   1 1 
        1    351 1 1  32 PHE CD1  C  -48.770   8.905  -93.841 1.00 . A A .  32 PHE CD1  1 1 
        1    352 1 1  32 PHE CD2  C  -49.796   8.283  -91.760 1.00 . A A .  32 PHE CD2  1 1 
        1    353 1 1  32 PHE CE1  C  -48.656  10.219  -93.392 1.00 . A A .  32 PHE CE1  1 1 
        1    354 1 1  32 PHE CE2  C  -49.682   9.596  -91.314 1.00 . A A .  32 PHE CE2  1 1 
        1    355 1 1  32 PHE CG   C  -49.337   7.936  -93.024 1.00 . A A .  32 PHE CG   1 1 
        1    356 1 1  32 PHE CZ   C  -49.110  10.564  -92.129 1.00 . A A .  32 PHE CZ   1 1 
        1    357 1 1  32 PHE H    H  -47.533   5.072  -95.480 1.00 . A A .  32 PHE H    1 1 
        1    358 1 1  32 PHE HA   H  -47.353   6.513  -93.750 1.00 . A A .  32 PHE HA   1 1 
        1    359 1 1  32 PHE HB2  H  -49.911   6.524  -94.490 1.00 . A A .  32 PHE HB2  1 1 
        1    360 1 1  32 PHE HB3  H  -50.120   5.971  -92.841 1.00 . A A .  32 PHE HB3  1 1 
        1    361 1 1  32 PHE HD1  H  -48.417   8.645  -94.819 1.00 . A A .  32 PHE HD1  1 1 
        1    362 1 1  32 PHE HD2  H  -50.239   7.539  -91.126 1.00 . A A .  32 PHE HD2  1 1 
        1    363 1 1  32 PHE HE1  H  -48.211  10.966  -94.028 1.00 . A A .  32 PHE HE1  1 1 
        1    364 1 1  32 PHE HE2  H  -50.036   9.861  -90.332 1.00 . A A .  32 PHE HE2  1 1 
        1    365 1 1  32 PHE HZ   H  -49.021  11.578  -91.783 1.00 . A A .  32 PHE HZ   1 1 
        1    366 1 1  32 PHE N    N  -48.122   4.866  -94.730 1.00 . A A .  32 PHE N    1 1 
        1    367 1 1  32 PHE O    O  -47.444   5.751  -91.295 1.00 . A A .  32 PHE O    1 1 
        1    368 1 1  33 GLN C    C  -46.547   3.505  -90.258 1.00 . A A .  33 GLN C    1 1 
        1    369 1 1  33 GLN CA   C  -47.771   2.995  -90.977 1.00 . A A .  33 GLN CA   1 1 
        1    370 1 1  33 GLN CB   C  -47.593   1.506  -91.287 1.00 . A A .  33 GLN CB   1 1 
        1    371 1 1  33 GLN CD   C  -46.265  -0.236  -92.445 1.00 . A A .  33 GLN CD   1 1 
        1    372 1 1  33 GLN CG   C  -46.256   1.199  -91.955 1.00 . A A .  33 GLN CG   1 1 
        1    373 1 1  33 GLN H    H  -48.362   3.301  -92.994 1.00 . A A .  33 GLN H    1 1 
        1    374 1 1  33 GLN HA   H  -48.613   3.095  -90.314 1.00 . A A .  33 GLN HA   1 1 
        1    375 1 1  33 GLN HB2  H  -47.635   0.965  -90.364 1.00 . A A .  33 GLN HB2  1 1 
        1    376 1 1  33 GLN HB3  H  -48.384   1.195  -91.930 1.00 . A A .  33 GLN HB3  1 1 
        1    377 1 1  33 GLN HE21 H  -47.831  -0.723  -91.296 1.00 . A A .  33 GLN HE21 1 1 
        1    378 1 1  33 GLN HE22 H  -47.220  -1.992  -92.244 1.00 . A A .  33 GLN HE22 1 1 
        1    379 1 1  33 GLN HG2  H  -46.114   1.853  -92.783 1.00 . A A .  33 GLN HG2  1 1 
        1    380 1 1  33 GLN HG3  H  -45.466   1.316  -91.239 1.00 . A A .  33 GLN HG3  1 1 
        1    381 1 1  33 GLN N    N  -48.034   3.765  -92.202 1.00 . A A .  33 GLN N    1 1 
        1    382 1 1  33 GLN NE2  N  -47.178  -1.058  -91.959 1.00 . A A .  33 GLN NE2  1 1 
        1    383 1 1  33 GLN O    O  -46.480   3.438  -89.030 1.00 . A A .  33 GLN O    1 1 
        1    384 1 1  33 GLN OE1  O  -45.430  -0.600  -93.295 1.00 . A A .  33 GLN OE1  1 1 
        1    385 1 1  34 HIS C    C  -44.204   5.691  -89.817 1.00 . A A .  34 HIS C    1 1 
        1    386 1 1  34 HIS CA   C  -44.254   4.282  -90.452 1.00 . A A .  34 HIS CA   1 1 
        1    387 1 1  34 HIS CB   C  -43.149   4.123  -91.498 1.00 . A A .  34 HIS CB   1 1 
        1    388 1 1  34 HIS CD2  C  -43.397   1.849  -92.752 1.00 . A A .  34 HIS CD2  1 1 
        1    389 1 1  34 HIS CE1  C  -44.422   2.573  -94.521 1.00 . A A .  34 HIS CE1  1 1 
        1    390 1 1  34 HIS CG   C  -43.555   3.179  -92.597 1.00 . A A .  34 HIS CG   1 1 
        1    391 1 1  34 HIS H    H  -45.601   3.767  -91.998 1.00 . A A .  34 HIS H    1 1 
        1    392 1 1  34 HIS HA   H  -44.055   3.595  -89.665 1.00 . A A .  34 HIS HA   1 1 
        1    393 1 1  34 HIS HB2  H  -42.913   5.070  -91.926 1.00 . A A .  34 HIS HB2  1 1 
        1    394 1 1  34 HIS HB3  H  -42.279   3.718  -91.005 1.00 . A A .  34 HIS HB3  1 1 
        1    395 1 1  34 HIS HD1  H  -44.474   4.534  -93.929 1.00 . A A .  34 HIS HD1  1 1 
        1    396 1 1  34 HIS HD2  H  -42.922   1.177  -92.038 1.00 . A A .  34 HIS HD2  1 1 
        1    397 1 1  34 HIS HE1  H  -44.921   2.609  -95.493 1.00 . A A .  34 HIS HE1  1 1 
        1    398 1 1  34 HIS HE2  H  -43.977   0.582  -94.323 1.00 . A A .  34 HIS HE2  1 1 
        1    399 1 1  34 HIS N    N  -45.523   3.867  -91.028 1.00 . A A .  34 HIS N    1 1 
        1    400 1 1  34 HIS ND1  N  -44.212   3.625  -93.743 1.00 . A A .  34 HIS ND1  1 1 
        1    401 1 1  34 HIS NE2  N  -43.947   1.465  -93.964 1.00 . A A .  34 HIS NE2  1 1 
        1    402 1 1  34 HIS O    O  -43.800   5.810  -88.651 1.00 . A A .  34 HIS O    1 1 
        1    403 1 1  35 VAL C    C  -45.669   8.154  -88.828 1.00 . A A .  35 VAL C    1 1 
        1    404 1 1  35 VAL CA   C  -44.648   8.076  -89.955 1.00 . A A .  35 VAL CA   1 1 
        1    405 1 1  35 VAL CB   C  -44.894   9.213  -91.047 1.00 . A A .  35 VAL CB   1 1 
        1    406 1 1  35 VAL CG1  C  -46.123   8.916  -91.897 1.00 . A A .  35 VAL CG1  1 1 
        1    407 1 1  35 VAL CG2  C  -45.025  10.587  -90.363 1.00 . A A .  35 VAL CG2  1 1 
        1    408 1 1  35 VAL H    H  -44.976   6.569  -91.441 1.00 . A A .  35 VAL H    1 1 
        1    409 1 1  35 VAL HA   H  -43.682   8.255  -89.531 1.00 . A A .  35 VAL HA   1 1 
        1    410 1 1  35 VAL HB   H  -44.040   9.237  -91.682 1.00 . A A .  35 VAL HB   1 1 
        1    411 1 1  35 VAL HG11 H  -46.010   7.934  -92.340 1.00 . A A .  35 VAL HG11 1 1 
        1    412 1 1  35 VAL HG12 H  -46.191   9.654  -92.685 1.00 . A A .  35 VAL HG12 1 1 
        1    413 1 1  35 VAL HG13 H  -47.013   8.942  -91.296 1.00 . A A .  35 VAL HG13 1 1 
        1    414 1 1  35 VAL HG21 H  -45.879  10.601  -89.710 1.00 . A A .  35 VAL HG21 1 1 
        1    415 1 1  35 VAL HG22 H  -45.137  11.346  -91.125 1.00 . A A .  35 VAL HG22 1 1 
        1    416 1 1  35 VAL HG23 H  -44.127  10.788  -89.792 1.00 . A A .  35 VAL HG23 1 1 
        1    417 1 1  35 VAL N    N  -44.640   6.724  -90.538 1.00 . A A .  35 VAL N    1 1 
        1    418 1 1  35 VAL O    O  -45.551   9.004  -87.942 1.00 . A A .  35 VAL O    1 1 
        1    419 1 1  36 MET C    C  -47.131   7.009  -86.393 1.00 . A A .  36 MET C    1 1 
        1    420 1 1  36 MET CA   C  -47.725   7.256  -87.864 1.00 . A A .  36 MET CA   1 1 
        1    421 1 1  36 MET CB   C  -48.793   6.208  -88.197 1.00 . A A .  36 MET CB   1 1 
        1    422 1 1  36 MET CE   C  -52.160   5.913  -89.300 1.00 . A A .  36 MET CE   1 1 
        1    423 1 1  36 MET CG   C  -50.107   6.477  -87.435 1.00 . A A .  36 MET CG   1 1 
        1    424 1 1  36 MET H    H  -46.708   6.625  -89.602 1.00 . A A .  36 MET H    1 1 
        1    425 1 1  36 MET HA   H  -48.174   8.210  -87.839 1.00 . A A .  36 MET HA   1 1 
        1    426 1 1  36 MET HB2  H  -48.977   6.245  -89.246 1.00 . A A .  36 MET HB2  1 1 
        1    427 1 1  36 MET HB3  H  -48.436   5.228  -87.923 1.00 . A A .  36 MET HB3  1 1 
        1    428 1 1  36 MET HE1  H  -52.753   5.343  -88.602 1.00 . A A .  36 MET HE1  1 1 
        1    429 1 1  36 MET HE2  H  -51.404   5.287  -89.734 1.00 . A A .  36 MET HE2  1 1 
        1    430 1 1  36 MET HE3  H  -52.800   6.300  -90.089 1.00 . A A .  36 MET HE3  1 1 
        1    431 1 1  36 MET HG2  H  -50.503   5.543  -87.103 1.00 . A A .  36 MET HG2  1 1 
        1    432 1 1  36 MET HG3  H  -49.892   7.096  -86.584 1.00 . A A .  36 MET HG3  1 1 
        1    433 1 1  36 MET N    N  -46.671   7.269  -88.870 1.00 . A A .  36 MET N    1 1 
        1    434 1 1  36 MET O    O  -47.748   7.446  -85.441 1.00 . A A .  36 MET O    1 1 
        1    435 1 1  36 MET SD   S  -51.380   7.310  -88.447 1.00 . A A .  36 MET SD   1 1 
        1    436 1 1  37 LEU C    C  -45.740   4.871  -84.096 1.00 . A A .  37 LEU C    1 1 
        1    437 1 1  37 LEU CA   C  -45.175   6.023  -85.157 1.00 . A A .  37 LEU CA   1 1 
        1    438 1 1  37 LEU CB   C  -45.402   7.257  -84.163 1.00 . A A .  37 LEU CB   1 1 
        1    439 1 1  37 LEU CD1  C  -44.450   8.982  -82.584 1.00 . A A .  37 LEU CD1  1 1 
        1    440 1 1  37 LEU CD2  C  -44.518   6.588  -81.839 1.00 . A A .  37 LEU CD2  1 1 
        1    441 1 1  37 LEU CG   C  -44.334   7.510  -83.051 1.00 . A A .  37 LEU CG   1 1 
        1    442 1 1  37 LEU H    H  -45.574   6.102  -87.222 1.00 . A A .  37 LEU H    1 1 
        1    443 1 1  37 LEU HA   H  -44.167   5.985  -85.408 1.00 . A A .  37 LEU HA   1 1 
        1    444 1 1  37 LEU HB2  H  -45.430   8.135  -84.742 1.00 . A A .  37 LEU HB2  1 1 
        1    445 1 1  37 LEU HB3  H  -46.346   7.116  -83.682 1.00 . A A .  37 LEU HB3  1 1 
        1    446 1 1  37 LEU HD11 H  -43.754   9.158  -81.778 1.00 . A A .  37 LEU HD11 1 1 
        1    447 1 1  37 LEU HD12 H  -45.453   9.194  -82.250 1.00 . A A .  37 LEU HD12 1 1 
        1    448 1 1  37 LEU HD13 H  -44.205   9.630  -83.416 1.00 . A A .  37 LEU HD13 1 1 
        1    449 1 1  37 LEU HD21 H  -45.526   6.653  -81.465 1.00 . A A .  37 LEU HD21 1 1 
        1    450 1 1  37 LEU HD22 H  -43.825   6.883  -81.061 1.00 . A A .  37 LEU HD22 1 1 
        1    451 1 1  37 LEU HD23 H  -44.304   5.577  -82.142 1.00 . A A .  37 LEU HD23 1 1 
        1    452 1 1  37 LEU HG   H  -43.371   7.378  -83.456 1.00 . A A .  37 LEU HG   1 1 
        1    453 1 1  37 LEU N    N  -45.965   6.355  -86.379 1.00 . A A .  37 LEU N    1 1 
        1    454 1 1  37 LEU O    O  -44.800   4.037  -83.906 1.00 . A A .  37 LEU O    1 1 
        1    455 1 1  38 LEU C    C  -46.492   2.206  -85.976 1.00 . A A .  38 LEU C    1 1 
        1    456 1 1  38 LEU CA   C  -47.486   2.988  -84.962 1.00 . A A .  38 LEU CA   1 1 
        1    457 1 1  38 LEU CB   C  -48.868   3.153  -85.677 1.00 . A A .  38 LEU CB   1 1 
        1    458 1 1  38 LEU CD1  C  -49.281   0.738  -86.342 1.00 . A A .  38 LEU CD1  1 1 
        1    459 1 1  38 LEU CD2  C  -50.437   2.584  -87.558 1.00 . A A .  38 LEU CD2  1 1 
        1    460 1 1  38 LEU CG   C  -49.148   2.168  -86.845 1.00 . A A .  38 LEU CG   1 1 
        1    461 1 1  38 LEU H    H  -46.268   4.024  -85.376 1.00 . A A .  38 LEU H    1 1 
        1    462 1 1  38 LEU HA   H  -47.533   2.439  -84.205 1.00 . A A .  38 LEU HA   1 1 
        1    463 1 1  38 LEU HB2  H  -49.566   2.949  -84.900 1.00 . A A .  38 LEU HB2  1 1 
        1    464 1 1  38 LEU HB3  H  -49.018   4.150  -86.040 1.00 . A A .  38 LEU HB3  1 1 
        1    465 1 1  38 LEU HD11 H  -48.604   0.113  -86.907 1.00 . A A .  38 LEU HD11 1 1 
        1    466 1 1  38 LEU HD12 H  -50.293   0.388  -86.483 1.00 . A A .  38 LEU HD12 1 1 
        1    467 1 1  38 LEU HD13 H  -49.026   0.695  -85.298 1.00 . A A .  38 LEU HD13 1 1 
        1    468 1 1  38 LEU HD21 H  -50.744   1.789  -88.221 1.00 . A A .  38 LEU HD21 1 1 
        1    469 1 1  38 LEU HD22 H  -50.246   3.477  -88.127 1.00 . A A .  38 LEU HD22 1 1 
        1    470 1 1  38 LEU HD23 H  -51.212   2.769  -86.832 1.00 . A A .  38 LEU HD23 1 1 
        1    471 1 1  38 LEU HG   H  -48.351   2.212  -87.546 1.00 . A A .  38 LEU HG   1 1 
        1    472 1 1  38 LEU N    N  -46.850   4.351  -84.814 1.00 . A A .  38 LEU N    1 1 
        1    473 1 1  38 LEU O    O  -45.719   2.729  -86.809 1.00 . A A .  38 LEU O    1 1 
        1    474 1 1  39 LYS C    C  -46.490  -1.471  -86.385 1.00 . A A .  39 LYS C    1 1 
        1    475 1 1  39 LYS CA   C  -45.891  -0.079  -86.617 1.00 . A A .  39 LYS CA   1 1 
        1    476 1 1  39 LYS CB   C  -44.383  -0.041  -86.255 1.00 . A A .  39 LYS CB   1 1 
        1    477 1 1  39 LYS CD   C  -42.290  -1.318  -85.650 1.00 . A A .  39 LYS CD   1 1 
        1    478 1 1  39 LYS CE   C  -41.748  -2.579  -84.949 1.00 . A A .  39 LYS CE   1 1 
        1    479 1 1  39 LYS CG   C  -43.809  -1.427  -85.868 1.00 . A A .  39 LYS CG   1 1 
        1    480 1 1  39 LYS H    H  -47.312   0.584  -85.210 1.00 . A A .  39 LYS H    1 1 
        1    481 1 1  39 LYS HA   H  -46.003   0.179  -87.660 1.00 . A A .  39 LYS HA   1 1 
        1    482 1 1  39 LYS HB2  H  -43.841   0.322  -87.103 1.00 . A A .  39 LYS HB2  1 1 
        1    483 1 1  39 LYS HB3  H  -44.248   0.632  -85.432 1.00 . A A .  39 LYS HB3  1 1 
        1    484 1 1  39 LYS HD2  H  -41.801  -1.197  -86.598 1.00 . A A .  39 LYS HD2  1 1 
        1    485 1 1  39 LYS HD3  H  -42.084  -0.458  -85.026 1.00 . A A .  39 LYS HD3  1 1 
        1    486 1 1  39 LYS HE2  H  -40.821  -2.327  -84.462 1.00 . A A .  39 LYS HE2  1 1 
        1    487 1 1  39 LYS HE3  H  -42.458  -2.904  -84.211 1.00 . A A .  39 LYS HE3  1 1 
        1    488 1 1  39 LYS HG2  H  -44.274  -1.762  -84.961 1.00 . A A .  39 LYS HG2  1 1 
        1    489 1 1  39 LYS HG3  H  -43.999  -2.129  -86.659 1.00 . A A .  39 LYS HG3  1 1 
        1    490 1 1  39 LYS HZ1  H  -40.751  -4.326  -85.533 1.00 . A A .  39 LYS HZ1  1 1 
        1    491 1 1  39 LYS HZ2  H  -41.177  -3.317  -86.832 1.00 . A A .  39 LYS HZ2  1 1 
        1    492 1 1  39 LYS HZ3  H  -42.364  -4.251  -86.053 1.00 . A A .  39 LYS HZ3  1 1 
        1    493 1 1  39 LYS N    N  -46.643   0.903  -85.851 1.00 . A A .  39 LYS N    1 1 
        1    494 1 1  39 LYS NZ   N  -41.493  -3.699  -85.919 1.00 . A A .  39 LYS NZ   1 1 
        1    495 1 1  39 LYS O    O  -46.773  -2.174  -87.359 1.00 . A A .  39 LYS O    1 1 
        1    496 1 1  40 PRO C    C  -48.684  -3.505  -85.065 1.00 . A A .  40 PRO C    1 1 
        1    497 1 1  40 PRO CA   C  -47.234  -3.166  -84.656 1.00 . A A .  40 PRO CA   1 1 
        1    498 1 1  40 PRO CB   C  -47.096  -3.092  -83.116 1.00 . A A .  40 PRO CB   1 1 
        1    499 1 1  40 PRO CD   C  -46.551  -0.929  -83.961 1.00 . A A .  40 PRO CD   1 1 
        1    500 1 1  40 PRO CG   C  -46.291  -1.862  -82.813 1.00 . A A .  40 PRO CG   1 1 
        1    501 1 1  40 PRO HA   H  -46.587  -3.935  -85.010 1.00 . A A .  40 PRO HA   1 1 
        1    502 1 1  40 PRO HB2  H  -48.076  -3.021  -82.656 1.00 . A A .  40 PRO HB2  1 1 
        1    503 1 1  40 PRO HB3  H  -46.581  -3.967  -82.754 1.00 . A A .  40 PRO HB3  1 1 
        1    504 1 1  40 PRO HD2  H  -47.478  -0.378  -83.799 1.00 . A A .  40 PRO HD2  1 1 
        1    505 1 1  40 PRO HD3  H  -45.733  -0.263  -84.096 1.00 . A A .  40 PRO HD3  1 1 
        1    506 1 1  40 PRO HG2  H  -46.612  -1.408  -81.883 1.00 . A A .  40 PRO HG2  1 1 
        1    507 1 1  40 PRO HG3  H  -45.235  -2.091  -82.774 1.00 . A A .  40 PRO HG3  1 1 
        1    508 1 1  40 PRO N    N  -46.709  -1.828  -85.113 1.00 . A A .  40 PRO N    1 1 
        1    509 1 1  40 PRO O    O  -49.661  -2.922  -84.574 1.00 . A A .  40 PRO O    1 1 
        1    510 1 1  41 SER C    C  -50.778  -5.694  -85.163 1.00 . A A .  41 SER C    1 1 
        1    511 1 1  41 SER CA   C  -50.100  -5.004  -86.342 1.00 . A A .  41 SER CA   1 1 
        1    512 1 1  41 SER CB   C  -49.961  -5.977  -87.513 1.00 . A A .  41 SER CB   1 1 
        1    513 1 1  41 SER H    H  -47.992  -4.970  -86.237 1.00 . A A .  41 SER H    1 1 
        1    514 1 1  41 SER HA   H  -50.709  -4.176  -86.641 1.00 . A A .  41 SER HA   1 1 
        1    515 1 1  41 SER HB2  H  -49.548  -6.902  -87.169 1.00 . A A .  41 SER HB2  1 1 
        1    516 1 1  41 SER HB3  H  -50.935  -6.155  -87.937 1.00 . A A .  41 SER HB3  1 1 
        1    517 1 1  41 SER HG   H  -49.596  -4.755  -88.984 1.00 . A A .  41 SER HG   1 1 
        1    518 1 1  41 SER N    N  -48.800  -4.525  -85.916 1.00 . A A .  41 SER N    1 1 
        1    519 1 1  41 SER O    O  -51.978  -5.554  -84.964 1.00 . A A .  41 SER O    1 1 
        1    520 1 1  41 SER OG   O  -49.105  -5.425  -88.505 1.00 . A A .  41 SER OG   1 1 
        1    521 1 1  42 VAL C    C  -51.695  -8.205  -83.924 1.00 . A A .  42 VAL C    1 1 
        1    522 1 1  42 VAL CA   C  -50.539  -7.327  -83.357 1.00 . A A .  42 VAL CA   1 1 
        1    523 1 1  42 VAL CB   C  -50.945  -6.516  -82.048 1.00 . A A .  42 VAL CB   1 1 
        1    524 1 1  42 VAL CG1  C  -49.708  -5.838  -81.390 1.00 . A A .  42 VAL CG1  1 1 
        1    525 1 1  42 VAL CG2  C  -52.029  -5.457  -82.326 1.00 . A A .  42 VAL CG2  1 1 
        1    526 1 1  42 VAL H    H  -49.094  -6.676  -84.754 1.00 . A A .  42 VAL H    1 1 
        1    527 1 1  42 VAL HA   H  -49.745  -8.014  -83.079 1.00 . A A .  42 VAL HA   1 1 
        1    528 1 1  42 VAL HB   H  -51.338  -7.224  -81.329 1.00 . A A .  42 VAL HB   1 1 
        1    529 1 1  42 VAL HG11 H  -49.226  -5.180  -82.097 1.00 . A A .  42 VAL HG11 1 1 
        1    530 1 1  42 VAL HG12 H  -49.003  -6.596  -81.070 1.00 . A A .  42 VAL HG12 1 1 
        1    531 1 1  42 VAL HG13 H  -50.020  -5.263  -80.523 1.00 . A A .  42 VAL HG13 1 1 
        1    532 1 1  42 VAL HG21 H  -51.621  -4.660  -82.922 1.00 . A A .  42 VAL HG21 1 1 
        1    533 1 1  42 VAL HG22 H  -52.388  -5.050  -81.384 1.00 . A A .  42 VAL HG22 1 1 
        1    534 1 1  42 VAL HG23 H  -52.856  -5.919  -82.845 1.00 . A A .  42 VAL HG23 1 1 
        1    535 1 1  42 VAL N    N  -50.018  -6.535  -84.466 1.00 . A A .  42 VAL N    1 1 
        1    536 1 1  42 VAL O    O  -51.610  -8.688  -85.072 1.00 . A A .  42 VAL O    1 1 
        1    537 1 1  43 LEU C    C  -54.285  -8.926  -84.982 1.00 . A A .  43 LEU C    1 1 
        1    538 1 1  43 LEU CA   C  -53.932  -9.201  -83.538 1.00 . A A .  43 LEU CA   1 1 
        1    539 1 1  43 LEU CB   C  -55.124  -8.858  -82.587 1.00 . A A .  43 LEU CB   1 1 
        1    540 1 1  43 LEU CD1  C  -56.819 -10.527  -83.430 1.00 . A A .  43 LEU CD1  1 1 
        1    541 1 1  43 LEU CD2  C  -57.581  -8.575  -82.127 1.00 . A A .  43 LEU CD2  1 1 
        1    542 1 1  43 LEU CG   C  -56.553  -9.071  -83.155 1.00 . A A .  43 LEU CG   1 1 
        1    543 1 1  43 LEU H    H  -52.765  -7.945  -82.264 1.00 . A A .  43 LEU H    1 1 
        1    544 1 1  43 LEU HA   H  -53.680 -10.243  -83.412 1.00 . A A .  43 LEU HA   1 1 
        1    545 1 1  43 LEU HB2  H  -55.034  -9.460  -81.719 1.00 . A A .  43 LEU HB2  1 1 
        1    546 1 1  43 LEU HB3  H  -55.029  -7.831  -82.323 1.00 . A A .  43 LEU HB3  1 1 
        1    547 1 1  43 LEU HD11 H  -57.770 -10.622  -83.930 1.00 . A A .  43 LEU HD11 1 1 
        1    548 1 1  43 LEU HD12 H  -56.839 -11.080  -82.503 1.00 . A A .  43 LEU HD12 1 1 
        1    549 1 1  43 LEU HD13 H  -56.036 -10.903  -84.064 1.00 . A A .  43 LEU HD13 1 1 
        1    550 1 1  43 LEU HD21 H  -57.473  -7.509  -82.005 1.00 . A A .  43 LEU HD21 1 1 
        1    551 1 1  43 LEU HD22 H  -57.423  -9.068  -81.182 1.00 . A A .  43 LEU HD22 1 1 
        1    552 1 1  43 LEU HD23 H  -58.575  -8.797  -82.490 1.00 . A A .  43 LEU HD23 1 1 
        1    553 1 1  43 LEU HG   H  -56.676  -8.510  -84.048 1.00 . A A .  43 LEU HG   1 1 
        1    554 1 1  43 LEU N    N  -52.760  -8.382  -83.135 1.00 . A A .  43 LEU N    1 1 
        1    555 1 1  43 LEU O    O  -54.733  -9.818  -85.693 1.00 . A A .  43 LEU O    1 1 
        1    556 1 1  44 CYS C    C  -53.957  -8.248  -87.887 1.00 . A A .  44 CYS C    1 1 
        1    557 1 1  44 CYS CA   C  -54.424  -7.240  -86.741 1.00 . A A .  44 CYS CA   1 1 
        1    558 1 1  44 CYS CB   C  -53.760  -5.794  -86.957 1.00 . A A .  44 CYS CB   1 1 
        1    559 1 1  44 CYS H    H  -53.725  -7.026  -84.767 1.00 . A A .  44 CYS H    1 1 
        1    560 1 1  44 CYS HA   H  -55.464  -7.131  -86.820 1.00 . A A .  44 CYS HA   1 1 
        1    561 1 1  44 CYS HB2  H  -54.067  -5.221  -86.123 1.00 . A A .  44 CYS HB2  1 1 
        1    562 1 1  44 CYS HB3  H  -52.718  -5.927  -86.958 1.00 . A A .  44 CYS HB3  1 1 
        1    563 1 1  44 CYS HG   H  -54.394  -5.555  -89.164 1.00 . A A .  44 CYS HG   1 1 
        1    564 1 1  44 CYS N    N  -54.088  -7.680  -85.395 1.00 . A A .  44 CYS N    1 1 
        1    565 1 1  44 CYS O    O  -54.727  -8.443  -88.807 1.00 . A A .  44 CYS O    1 1 
        1    566 1 1  44 CYS SG   S  -54.274  -4.927  -88.460 1.00 . A A .  44 CYS SG   1 1 
        1    567 1 1  45 ILE C    C  -53.494 -10.885  -88.991 1.00 . A A .  45 ILE C    1 1 
        1    568 1 1  45 ILE CA   C  -52.370  -9.818  -88.778 1.00 . A A .  45 ILE CA   1 1 
        1    569 1 1  45 ILE CB   C  -51.017 -10.520  -88.519 1.00 . A A .  45 ILE CB   1 1 
        1    570 1 1  45 ILE CD1  C  -51.718 -11.452  -86.188 1.00 . A A .  45 ILE CD1  1 1 
        1    571 1 1  45 ILE CG1  C  -51.164 -11.807  -87.557 1.00 . A A .  45 ILE CG1  1 1 
        1    572 1 1  45 ILE CG2  C  -49.985  -9.566  -87.965 1.00 . A A .  45 ILE CG2  1 1 
        1    573 1 1  45 ILE H    H  -52.231  -8.704  -86.966 1.00 . A A .  45 ILE H    1 1 
        1    574 1 1  45 ILE HA   H  -52.278  -9.296  -89.699 1.00 . A A .  45 ILE HA   1 1 
        1    575 1 1  45 ILE HB   H  -50.647 -10.903  -89.453 1.00 . A A .  45 ILE HB   1 1 
        1    576 1 1  45 ILE HD11 H  -52.339 -12.274  -85.855 1.00 . A A .  45 ILE HD11 1 1 
        1    577 1 1  45 ILE HD12 H  -52.304 -10.554  -86.234 1.00 . A A .  45 ILE HD12 1 1 
        1    578 1 1  45 ILE HD13 H  -50.901 -11.320  -85.496 1.00 . A A .  45 ILE HD13 1 1 
        1    579 1 1  45 ILE HG12 H  -51.817 -12.487  -88.049 1.00 . A A .  45 ILE HG12 1 1 
        1    580 1 1  45 ILE HG13 H  -50.188 -12.236  -87.462 1.00 . A A .  45 ILE HG13 1 1 
        1    581 1 1  45 ILE HG21 H  -49.044 -10.080  -87.828 1.00 . A A .  45 ILE HG21 1 1 
        1    582 1 1  45 ILE HG22 H  -50.322  -9.164  -87.027 1.00 . A A .  45 ILE HG22 1 1 
        1    583 1 1  45 ILE HG23 H  -49.856  -8.768  -88.681 1.00 . A A .  45 ILE HG23 1 1 
        1    584 1 1  45 ILE N    N  -52.790  -8.867  -87.748 1.00 . A A .  45 ILE N    1 1 
        1    585 1 1  45 ILE O    O  -53.893 -11.118  -90.123 1.00 . A A .  45 ILE O    1 1 
        1    586 1 1  46 TYR C    C  -56.237 -11.797  -88.767 1.00 . A A .  46 TYR C    1 1 
        1    587 1 1  46 TYR CA   C  -55.080 -12.399  -87.959 1.00 . A A .  46 TYR CA   1 1 
        1    588 1 1  46 TYR CB   C  -55.539 -12.721  -86.518 1.00 . A A .  46 TYR CB   1 1 
        1    589 1 1  46 TYR CD1  C  -56.839 -14.906  -86.786 1.00 . A A .  46 TYR CD1  1 1 
        1    590 1 1  46 TYR CD2  C  -54.838 -14.891  -85.426 1.00 . A A .  46 TYR CD2  1 1 
        1    591 1 1  46 TYR CE1  C  -57.009 -16.279  -86.506 1.00 . A A .  46 TYR CE1  1 1 
        1    592 1 1  46 TYR CE2  C  -55.009 -16.247  -85.148 1.00 . A A .  46 TYR CE2  1 1 
        1    593 1 1  46 TYR CG   C  -55.749 -14.213  -86.245 1.00 . A A .  46 TYR CG   1 1 
        1    594 1 1  46 TYR CZ   C  -56.078 -16.946  -85.683 1.00 . A A .  46 TYR CZ   1 1 
        1    595 1 1  46 TYR H    H  -53.675 -11.124  -87.021 1.00 . A A .  46 TYR H    1 1 
        1    596 1 1  46 TYR HA   H  -54.735 -13.293  -88.441 1.00 . A A .  46 TYR HA   1 1 
        1    597 1 1  46 TYR HB2  H  -54.788 -12.364  -85.843 1.00 . A A .  46 TYR HB2  1 1 
        1    598 1 1  46 TYR HB3  H  -56.456 -12.201  -86.331 1.00 . A A .  46 TYR HB3  1 1 
        1    599 1 1  46 TYR HD1  H  -57.549 -14.393  -87.407 1.00 . A A .  46 TYR HD1  1 1 
        1    600 1 1  46 TYR HD2  H  -54.003 -14.367  -85.007 1.00 . A A .  46 TYR HD2  1 1 
        1    601 1 1  46 TYR HE1  H  -57.845 -16.819  -86.935 1.00 . A A .  46 TYR HE1  1 1 
        1    602 1 1  46 TYR HE2  H  -54.297 -16.762  -84.515 1.00 . A A .  46 TYR HE2  1 1 
        1    603 1 1  46 TYR HH   H  -55.484 -18.513  -84.778 1.00 . A A .  46 TYR HH   1 1 
        1    604 1 1  46 TYR N    N  -54.003 -11.416  -87.894 1.00 . A A .  46 TYR N    1 1 
        1    605 1 1  46 TYR O    O  -56.890 -12.492  -89.530 1.00 . A A .  46 TYR O    1 1 
        1    606 1 1  46 TYR OH   O  -56.206 -18.285  -85.381 1.00 . A A .  46 TYR OH   1 1 
        1    607 1 1  47 GLU C    C  -57.178  -9.349  -90.687 1.00 . A A .  47 GLU C    1 1 
        1    608 1 1  47 GLU CA   C  -57.539  -9.773  -89.276 1.00 . A A .  47 GLU CA   1 1 
        1    609 1 1  47 GLU CB   C  -57.926  -8.540  -88.472 1.00 . A A .  47 GLU CB   1 1 
        1    610 1 1  47 GLU CD   C  -57.804  -6.055  -88.276 1.00 . A A .  47 GLU CD   1 1 
        1    611 1 1  47 GLU CG   C  -57.565  -7.244  -89.192 1.00 . A A .  47 GLU CG   1 1 
        1    612 1 1  47 GLU H    H  -55.897 -10.000  -87.964 1.00 . A A .  47 GLU H    1 1 
        1    613 1 1  47 GLU HA   H  -58.403 -10.425  -89.321 1.00 . A A .  47 GLU HA   1 1 
        1    614 1 1  47 GLU HB2  H  -58.983  -8.547  -88.318 1.00 . A A .  47 GLU HB2  1 1 
        1    615 1 1  47 GLU HB3  H  -57.417  -8.565  -87.534 1.00 . A A .  47 GLU HB3  1 1 
        1    616 1 1  47 GLU HG2  H  -56.531  -7.267  -89.470 1.00 . A A .  47 GLU HG2  1 1 
        1    617 1 1  47 GLU HG3  H  -58.181  -7.143  -90.066 1.00 . A A .  47 GLU HG3  1 1 
        1    618 1 1  47 GLU N    N  -56.466 -10.497  -88.583 1.00 . A A .  47 GLU N    1 1 
        1    619 1 1  47 GLU O    O  -58.076  -9.148  -91.505 1.00 . A A .  47 GLU O    1 1 
        1    620 1 1  47 GLU OE1  O  -58.973  -5.735  -88.022 1.00 . A A .  47 GLU OE1  1 1 
        1    621 1 1  47 GLU OE2  O  -56.807  -5.472  -87.851 1.00 . A A .  47 GLU OE2  1 1 
        1    622 1 1  48 ARG C    C  -56.019  -9.865  -93.226 1.00 . A A .  48 ARG C    1 1 
        1    623 1 1  48 ARG CA   C  -55.485  -8.800  -92.301 1.00 . A A .  48 ARG CA   1 1 
        1    624 1 1  48 ARG CB   C  -53.923  -8.791  -92.429 1.00 . A A .  48 ARG CB   1 1 
        1    625 1 1  48 ARG CD   C  -53.436  -6.687  -90.995 1.00 . A A .  48 ARG CD   1 1 
        1    626 1 1  48 ARG CG   C  -53.351  -7.305  -92.425 1.00 . A A .  48 ARG CG   1 1 
        1    627 1 1  48 ARG CZ   C  -52.222  -4.524  -90.697 1.00 . A A .  48 ARG CZ   1 1 
        1    628 1 1  48 ARG H    H  -55.216  -9.376  -90.280 1.00 . A A .  48 ARG H    1 1 
        1    629 1 1  48 ARG HA   H  -55.885  -7.841  -92.571 1.00 . A A .  48 ARG HA   1 1 
        1    630 1 1  48 ARG HB2  H  -53.497  -9.304  -91.616 1.00 . A A .  48 ARG HB2  1 1 
        1    631 1 1  48 ARG HB3  H  -53.637  -9.219  -93.359 1.00 . A A .  48 ARG HB3  1 1 
        1    632 1 1  48 ARG HD2  H  -54.301  -6.064  -90.956 1.00 . A A .  48 ARG HD2  1 1 
        1    633 1 1  48 ARG HD3  H  -53.501  -7.462  -90.271 1.00 . A A .  48 ARG HD3  1 1 
        1    634 1 1  48 ARG HE   H  -51.393  -6.340  -90.570 1.00 . A A .  48 ARG HE   1 1 
        1    635 1 1  48 ARG HG2  H  -52.341  -7.375  -92.727 1.00 . A A .  48 ARG HG2  1 1 
        1    636 1 1  48 ARG HG3  H  -53.930  -6.734  -93.100 1.00 . A A .  48 ARG HG3  1 1 
        1    637 1 1  48 ARG HH11 H  -54.187  -4.261  -91.077 1.00 . A A .  48 ARG HH11 1 1 
        1    638 1 1  48 ARG HH12 H  -53.268  -2.810  -90.856 1.00 . A A .  48 ARG HH12 1 1 
        1    639 1 1  48 ARG HH21 H  -50.247  -4.418  -90.291 1.00 . A A .  48 ARG HH21 1 1 
        1    640 1 1  48 ARG HH22 H  -51.070  -2.899  -90.417 1.00 . A A .  48 ARG HH22 1 1 
        1    641 1 1  48 ARG N    N  -55.885  -9.193  -90.965 1.00 . A A .  48 ARG N    1 1 
        1    642 1 1  48 ARG NE   N  -52.229  -5.877  -90.736 1.00 . A A .  48 ARG NE   1 1 
        1    643 1 1  48 ARG NH1  N  -53.314  -3.815  -90.891 1.00 . A A .  48 ARG NH1  1 1 
        1    644 1 1  48 ARG NH2  N  -51.090  -3.900  -90.447 1.00 . A A .  48 ARG NH2  1 1 
        1    645 1 1  48 ARG O    O  -56.529  -9.564  -94.286 1.00 . A A .  48 ARG O    1 1 
        1    646 1 1  49 VAL C    C  -57.864 -12.045  -94.091 1.00 . A A .  49 VAL C    1 1 
        1    647 1 1  49 VAL CA   C  -56.456 -12.280  -93.497 1.00 . A A .  49 VAL CA   1 1 
        1    648 1 1  49 VAL CB   C  -56.412 -13.519  -92.570 1.00 . A A .  49 VAL CB   1 1 
        1    649 1 1  49 VAL CG1  C  -57.031 -14.757  -93.260 1.00 . A A .  49 VAL CG1  1 1 
        1    650 1 1  49 VAL CG2  C  -54.957 -13.815  -92.157 1.00 . A A .  49 VAL CG2  1 1 
        1    651 1 1  49 VAL H    H  -55.584 -11.256  -91.856 1.00 . A A .  49 VAL H    1 1 
        1    652 1 1  49 VAL HA   H  -55.789 -12.445  -94.313 1.00 . A A .  49 VAL HA   1 1 
        1    653 1 1  49 VAL HB   H  -56.982 -13.324  -91.691 1.00 . A A .  49 VAL HB   1 1 
        1    654 1 1  49 VAL HG11 H  -58.103 -14.621  -93.330 1.00 . A A .  49 VAL HG11 1 1 
        1    655 1 1  49 VAL HG12 H  -56.826 -15.642  -92.669 1.00 . A A .  49 VAL HG12 1 1 
        1    656 1 1  49 VAL HG13 H  -56.618 -14.880  -94.246 1.00 . A A .  49 VAL HG13 1 1 
        1    657 1 1  49 VAL HG21 H  -54.480 -12.888  -91.866 1.00 . A A .  49 VAL HG21 1 1 
        1    658 1 1  49 VAL HG22 H  -54.415 -14.255  -92.978 1.00 . A A .  49 VAL HG22 1 1 
        1    659 1 1  49 VAL HG23 H  -54.952 -14.496  -91.316 1.00 . A A .  49 VAL HG23 1 1 
        1    660 1 1  49 VAL N    N  -55.957 -11.114  -92.749 1.00 . A A .  49 VAL N    1 1 
        1    661 1 1  49 VAL O    O  -58.091 -12.355  -95.262 1.00 . A A .  49 VAL O    1 1 
        1    662 1 1  50 ALA C    C  -60.115 -10.423  -95.160 1.00 . A A .  50 ALA C    1 1 
        1    663 1 1  50 ALA CA   C  -60.133 -11.195  -93.824 1.00 . A A .  50 ALA CA   1 1 
        1    664 1 1  50 ALA CB   C  -60.934 -10.425  -92.781 1.00 . A A .  50 ALA CB   1 1 
        1    665 1 1  50 ALA H    H  -58.558 -11.244  -92.397 1.00 . A A .  50 ALA H    1 1 
        1    666 1 1  50 ALA HA   H  -60.626 -12.127  -93.997 1.00 . A A .  50 ALA HA   1 1 
        1    667 1 1  50 ALA HB1  H  -60.566  -9.417  -92.704 1.00 . A A .  50 ALA HB1  1 1 
        1    668 1 1  50 ALA HB2  H  -60.837 -10.920  -91.825 1.00 . A A .  50 ALA HB2  1 1 
        1    669 1 1  50 ALA HB3  H  -61.974 -10.412  -93.073 1.00 . A A .  50 ALA HB3  1 1 
        1    670 1 1  50 ALA N    N  -58.783 -11.478  -93.318 1.00 . A A .  50 ALA N    1 1 
        1    671 1 1  50 ALA O    O  -61.002 -10.628  -95.985 1.00 . A A .  50 ALA O    1 1 
        1    672 1 1  51 LEU C    C  -58.787  -9.746  -97.901 1.00 . A A .  51 LEU C    1 1 
        1    673 1 1  51 LEU CA   C  -58.994  -8.846  -96.677 1.00 . A A .  51 LEU CA   1 1 
        1    674 1 1  51 LEU CB   C  -57.894  -7.747  -96.598 1.00 . A A .  51 LEU CB   1 1 
        1    675 1 1  51 LEU CD1  C  -56.525  -7.701  -98.699 1.00 . A A .  51 LEU CD1  1 1 
        1    676 1 1  51 LEU CD2  C  -55.390  -7.288  -96.528 1.00 . A A .  51 LEU CD2  1 1 
        1    677 1 1  51 LEU CG   C  -56.515  -8.084  -97.231 1.00 . A A .  51 LEU CG   1 1 
        1    678 1 1  51 LEU H    H  -58.415  -9.461  -94.708 1.00 . A A .  51 LEU H    1 1 
        1    679 1 1  51 LEU HA   H  -59.929  -8.327  -96.817 1.00 . A A .  51 LEU HA   1 1 
        1    680 1 1  51 LEU HB2  H  -58.269  -6.902  -97.116 1.00 . A A .  51 LEU HB2  1 1 
        1    681 1 1  51 LEU HB3  H  -57.754  -7.509  -95.578 1.00 . A A .  51 LEU HB3  1 1 
        1    682 1 1  51 LEU HD11 H  -57.479  -7.974  -99.121 1.00 . A A .  51 LEU HD11 1 1 
        1    683 1 1  51 LEU HD12 H  -55.738  -8.232  -99.202 1.00 . A A .  51 LEU HD12 1 1 
        1    684 1 1  51 LEU HD13 H  -56.378  -6.636  -98.808 1.00 . A A .  51 LEU HD13 1 1 
        1    685 1 1  51 LEU HD21 H  -55.651  -6.245  -96.468 1.00 . A A .  51 LEU HD21 1 1 
        1    686 1 1  51 LEU HD22 H  -54.476  -7.399  -97.097 1.00 . A A .  51 LEU HD22 1 1 
        1    687 1 1  51 LEU HD23 H  -55.244  -7.685  -95.536 1.00 . A A .  51 LEU HD23 1 1 
        1    688 1 1  51 LEU HG   H  -56.312  -9.116  -97.133 1.00 . A A .  51 LEU HG   1 1 
        1    689 1 1  51 LEU N    N  -59.099  -9.583  -95.393 1.00 . A A .  51 LEU N    1 1 
        1    690 1 1  51 LEU O    O  -59.492  -9.584  -98.899 1.00 . A A .  51 LEU O    1 1 
        1    691 1 1  52 PHE C    C  -58.748 -12.657  -98.992 1.00 . A A .  52 PHE C    1 1 
        1    692 1 1  52 PHE CA   C  -57.622 -11.627  -98.937 1.00 . A A .  52 PHE CA   1 1 
        1    693 1 1  52 PHE CB   C  -56.274 -12.359  -98.825 1.00 . A A .  52 PHE CB   1 1 
        1    694 1 1  52 PHE CD1  C  -54.506 -10.981 -100.009 1.00 . A A .  52 PHE CD1  1 1 
        1    695 1 1  52 PHE CD2  C  -54.556 -10.964  -97.595 1.00 . A A .  52 PHE CD2  1 1 
        1    696 1 1  52 PHE CE1  C  -53.397 -10.114  -99.993 1.00 . A A .  52 PHE CE1  1 1 
        1    697 1 1  52 PHE CE2  C  -53.449 -10.096  -97.580 1.00 . A A .  52 PHE CE2  1 1 
        1    698 1 1  52 PHE CG   C  -55.087 -11.405  -98.811 1.00 . A A .  52 PHE CG   1 1 
        1    699 1 1  52 PHE CZ   C  -52.871  -9.670  -98.779 1.00 . A A .  52 PHE CZ   1 1 
        1    700 1 1  52 PHE H    H  -57.380 -10.836  -96.984 1.00 . A A .  52 PHE H    1 1 
        1    701 1 1  52 PHE HA   H  -57.637 -11.065  -99.855 1.00 . A A .  52 PHE HA   1 1 
        1    702 1 1  52 PHE HB2  H  -56.264 -12.933  -97.924 1.00 . A A .  52 PHE HB2  1 1 
        1    703 1 1  52 PHE HB3  H  -56.174 -13.021  -99.673 1.00 . A A .  52 PHE HB3  1 1 
        1    704 1 1  52 PHE HD1  H  -54.907 -11.321 -100.946 1.00 . A A .  52 PHE HD1  1 1 
        1    705 1 1  52 PHE HD2  H  -54.998 -11.284  -96.668 1.00 . A A .  52 PHE HD2  1 1 
        1    706 1 1  52 PHE HE1  H  -52.958  -9.780 -100.925 1.00 . A A .  52 PHE HE1  1 1 
        1    707 1 1  52 PHE HE2  H  -53.046  -9.755  -96.637 1.00 . A A .  52 PHE HE2  1 1 
        1    708 1 1  52 PHE HZ   H  -52.016  -9.009  -98.767 1.00 . A A .  52 PHE HZ   1 1 
        1    709 1 1  52 PHE N    N  -57.876 -10.715  -97.819 1.00 . A A .  52 PHE N    1 1 
        1    710 1 1  52 PHE O    O  -59.027 -13.220 -100.035 1.00 . A A .  52 PHE O    1 1 
        1    711 1 1  53 GLY C    C  -61.619 -13.192  -98.762 1.00 . A A .  53 GLY C    1 1 
        1    712 1 1  53 GLY CA   C  -60.561 -13.750  -97.824 1.00 . A A .  53 GLY CA   1 1 
        1    713 1 1  53 GLY H    H  -59.210 -12.319  -97.079 1.00 . A A .  53 GLY H    1 1 
        1    714 1 1  53 GLY HA2  H  -60.277 -14.743  -98.138 1.00 . A A .  53 GLY HA2  1 1 
        1    715 1 1  53 GLY HA3  H  -60.960 -13.784  -96.821 1.00 . A A .  53 GLY HA3  1 1 
        1    716 1 1  53 GLY N    N  -59.432 -12.843  -97.865 1.00 . A A .  53 GLY N    1 1 
        1    717 1 1  53 GLY O    O  -61.993 -13.840  -99.729 1.00 . A A .  53 GLY O    1 1 
        1    718 1 1  54 VAL C    C  -62.515 -10.838 -100.666 1.00 . A A .  54 VAL C    1 1 
        1    719 1 1  54 VAL CA   C  -63.071 -11.286  -99.315 1.00 . A A .  54 VAL CA   1 1 
        1    720 1 1  54 VAL CB   C  -63.650 -10.058  -98.595 1.00 . A A .  54 VAL CB   1 1 
        1    721 1 1  54 VAL CG1  C  -62.580  -8.999  -98.437 1.00 . A A .  54 VAL CG1  1 1 
        1    722 1 1  54 VAL CG2  C  -64.804  -9.491  -99.402 1.00 . A A .  54 VAL CG2  1 1 
        1    723 1 1  54 VAL H    H  -61.706 -11.495  -97.700 1.00 . A A .  54 VAL H    1 1 
        1    724 1 1  54 VAL HA   H  -63.873 -11.975  -99.490 1.00 . A A .  54 VAL HA   1 1 
        1    725 1 1  54 VAL HB   H  -64.007 -10.346  -97.627 1.00 . A A .  54 VAL HB   1 1 
        1    726 1 1  54 VAL HG11 H  -61.664  -9.473  -98.134 1.00 . A A .  54 VAL HG11 1 1 
        1    727 1 1  54 VAL HG12 H  -62.894  -8.292  -97.686 1.00 . A A .  54 VAL HG12 1 1 
        1    728 1 1  54 VAL HG13 H  -62.434  -8.489  -99.378 1.00 . A A .  54 VAL HG13 1 1 
        1    729 1 1  54 VAL HG21 H  -65.522  -9.056  -98.726 1.00 . A A .  54 VAL HG21 1 1 
        1    730 1 1  54 VAL HG22 H  -65.270 -10.284  -99.963 1.00 . A A .  54 VAL HG22 1 1 
        1    731 1 1  54 VAL HG23 H  -64.437  -8.736 -100.077 1.00 . A A .  54 VAL HG23 1 1 
        1    732 1 1  54 VAL N    N  -62.064 -11.958  -98.478 1.00 . A A .  54 VAL N    1 1 
        1    733 1 1  54 VAL O    O  -63.144 -11.078 -101.696 1.00 . A A .  54 VAL O    1 1 
        1    734 1 1  55 LEU C    C  -60.406 -11.103 -102.733 1.00 . A A .  55 LEU C    1 1 
        1    735 1 1  55 LEU CA   C  -60.664  -9.847 -101.927 1.00 . A A .  55 LEU CA   1 1 
        1    736 1 1  55 LEU CB   C  -59.340  -9.132 -101.606 1.00 . A A .  55 LEU CB   1 1 
        1    737 1 1  55 LEU CD1  C  -57.686  -9.766 -103.368 1.00 . A A .  55 LEU CD1  1 1 
        1    738 1 1  55 LEU CD2  C  -59.364  -7.998 -103.872 1.00 . A A .  55 LEU CD2  1 1 
        1    739 1 1  55 LEU CG   C  -58.504  -8.620 -102.796 1.00 . A A .  55 LEU CG   1 1 
        1    740 1 1  55 LEU H    H  -60.833 -10.145  -99.823 1.00 . A A .  55 LEU H    1 1 
        1    741 1 1  55 LEU HA   H  -61.319  -9.192 -102.464 1.00 . A A .  55 LEU HA   1 1 
        1    742 1 1  55 LEU HB2  H  -59.558  -8.298 -101.000 1.00 . A A .  55 LEU HB2  1 1 
        1    743 1 1  55 LEU HB3  H  -58.738  -9.819 -101.064 1.00 . A A .  55 LEU HB3  1 1 
        1    744 1 1  55 LEU HD11 H  -57.232 -10.322 -102.557 1.00 . A A .  55 LEU HD11 1 1 
        1    745 1 1  55 LEU HD12 H  -56.914  -9.375 -104.007 1.00 . A A .  55 LEU HD12 1 1 
        1    746 1 1  55 LEU HD13 H  -58.330 -10.416 -103.928 1.00 . A A .  55 LEU HD13 1 1 
        1    747 1 1  55 LEU HD21 H  -58.725  -7.517 -104.601 1.00 . A A .  55 LEU HD21 1 1 
        1    748 1 1  55 LEU HD22 H  -60.017  -7.266 -103.426 1.00 . A A .  55 LEU HD22 1 1 
        1    749 1 1  55 LEU HD23 H  -59.941  -8.768 -104.349 1.00 . A A .  55 LEU HD23 1 1 
        1    750 1 1  55 LEU HG   H  -57.818  -7.864 -102.410 1.00 . A A .  55 LEU HG   1 1 
        1    751 1 1  55 LEU N    N  -61.308 -10.261 -100.668 1.00 . A A .  55 LEU N    1 1 
        1    752 1 1  55 LEU O    O  -60.599 -11.101 -103.941 1.00 . A A .  55 LEU O    1 1 
        1    753 1 1  56 GLY C    C  -60.868 -13.871 -103.562 1.00 . A A .  56 GLY C    1 1 
        1    754 1 1  56 GLY CA   C  -59.680 -13.455 -102.709 1.00 . A A .  56 GLY CA   1 1 
        1    755 1 1  56 GLY H    H  -59.826 -12.097 -101.089 1.00 . A A .  56 GLY H    1 1 
        1    756 1 1  56 GLY HA2  H  -58.809 -13.352 -103.333 1.00 . A A .  56 GLY HA2  1 1 
        1    757 1 1  56 GLY HA3  H  -59.501 -14.206 -101.957 1.00 . A A .  56 GLY HA3  1 1 
        1    758 1 1  56 GLY N    N  -59.963 -12.172 -102.051 1.00 . A A .  56 GLY N    1 1 
        1    759 1 1  56 GLY O    O  -60.715 -14.146 -104.745 1.00 . A A .  56 GLY O    1 1 
        1    760 1 1  57 ALA C    C  -63.610 -13.320 -104.814 1.00 . A A .  57 ALA C    1 1 
        1    761 1 1  57 ALA CA   C  -63.312 -14.220 -103.604 1.00 . A A .  57 ALA CA   1 1 
        1    762 1 1  57 ALA CB   C  -64.442 -14.110 -102.594 1.00 . A A .  57 ALA CB   1 1 
        1    763 1 1  57 ALA H    H  -62.063 -13.653 -101.988 1.00 . A A .  57 ALA H    1 1 
        1    764 1 1  57 ALA HA   H  -63.259 -15.226 -103.941 1.00 . A A .  57 ALA HA   1 1 
        1    765 1 1  57 ALA HB1  H  -64.472 -13.115 -102.181 1.00 . A A .  57 ALA HB1  1 1 
        1    766 1 1  57 ALA HB2  H  -64.272 -14.824 -101.804 1.00 . A A .  57 ALA HB2  1 1 
        1    767 1 1  57 ALA HB3  H  -65.375 -14.329 -103.085 1.00 . A A .  57 ALA HB3  1 1 
        1    768 1 1  57 ALA N    N  -62.043 -13.881 -102.935 1.00 . A A .  57 ALA N    1 1 
        1    769 1 1  57 ALA O    O  -63.920 -13.833 -105.898 1.00 . A A .  57 ALA O    1 1 
        1    770 1 1  58 ALA C    C  -62.773 -11.138 -106.798 1.00 . A A .  58 ALA C    1 1 
        1    771 1 1  58 ALA CA   C  -63.795 -11.017 -105.667 1.00 . A A .  58 ALA CA   1 1 
        1    772 1 1  58 ALA CB   C  -63.768  -9.601 -105.085 1.00 . A A .  58 ALA CB   1 1 
        1    773 1 1  58 ALA H    H  -63.347 -11.683 -103.704 1.00 . A A .  58 ALA H    1 1 
        1    774 1 1  58 ALA HA   H  -64.765 -11.196 -106.073 1.00 . A A .  58 ALA HA   1 1 
        1    775 1 1  58 ALA HB1  H  -62.797  -9.392 -104.665 1.00 . A A .  58 ALA HB1  1 1 
        1    776 1 1  58 ALA HB2  H  -64.520  -9.524 -104.312 1.00 . A A .  58 ALA HB2  1 1 
        1    777 1 1  58 ALA HB3  H  -63.985  -8.890 -105.868 1.00 . A A .  58 ALA HB3  1 1 
        1    778 1 1  58 ALA N    N  -63.545 -12.001 -104.603 1.00 . A A .  58 ALA N    1 1 
        1    779 1 1  58 ALA O    O  -63.151 -11.208 -107.967 1.00 . A A .  58 ALA O    1 1 
        1    780 1 1  59 LEU C    C  -60.423 -12.755 -108.063 1.00 . A A .  59 LEU C    1 1 
        1    781 1 1  59 LEU CA   C  -60.385 -11.366 -107.392 1.00 . A A .  59 LEU CA   1 1 
        1    782 1 1  59 LEU CB   C  -59.068 -11.121 -106.634 1.00 . A A .  59 LEU CB   1 1 
        1    783 1 1  59 LEU CD1  C  -57.452 -11.834 -108.417 1.00 . A A .  59 LEU CD1  1 1 
        1    784 1 1  59 LEU CD2  C  -58.017  -9.405 -108.203 1.00 . A A .  59 LEU CD2  1 1 
        1    785 1 1  59 LEU CG   C  -57.820 -10.726 -107.458 1.00 . A A .  59 LEU CG   1 1 
        1    786 1 1  59 LEU H    H  -61.288 -11.179 -105.473 1.00 . A A .  59 LEU H    1 1 
        1    787 1 1  59 LEU HA   H  -60.510 -10.628 -108.143 1.00 . A A .  59 LEU HA   1 1 
        1    788 1 1  59 LEU HB2  H  -59.237 -10.337 -105.952 1.00 . A A .  59 LEU HB2  1 1 
        1    789 1 1  59 LEU HB3  H  -58.833 -12.017 -106.104 1.00 . A A .  59 LEU HB3  1 1 
        1    790 1 1  59 LEU HD11 H  -58.002 -11.709 -109.331 1.00 . A A .  59 LEU HD11 1 1 
        1    791 1 1  59 LEU HD12 H  -57.694 -12.787 -107.971 1.00 . A A .  59 LEU HD12 1 1 
        1    792 1 1  59 LEU HD13 H  -56.392 -11.792 -108.619 1.00 . A A .  59 LEU HD13 1 1 
        1    793 1 1  59 LEU HD21 H  -57.051  -9.003 -108.482 1.00 . A A .  59 LEU HD21 1 1 
        1    794 1 1  59 LEU HD22 H  -58.525  -8.702 -107.563 1.00 . A A .  59 LEU HD22 1 1 
        1    795 1 1  59 LEU HD23 H  -58.602  -9.581 -109.090 1.00 . A A .  59 LEU HD23 1 1 
        1    796 1 1  59 LEU HG   H  -57.001 -10.604 -106.750 1.00 . A A .  59 LEU HG   1 1 
        1    797 1 1  59 LEU N    N  -61.497 -11.212 -106.425 1.00 . A A .  59 LEU N    1 1 
        1    798 1 1  59 LEU O    O  -60.139 -12.849 -109.252 1.00 . A A .  59 LEU O    1 1 
        1    799 1 1  60 ILE C    C  -62.164 -15.288 -108.779 1.00 . A A .  60 ILE C    1 1 
        1    800 1 1  60 ILE CA   C  -60.878 -15.153 -107.946 1.00 . A A .  60 ILE CA   1 1 
        1    801 1 1  60 ILE CB   C  -60.847 -16.294 -106.854 1.00 . A A .  60 ILE CB   1 1 
        1    802 1 1  60 ILE CD1  C  -59.285 -17.308 -105.071 1.00 . A A .  60 ILE CD1  1 1 
        1    803 1 1  60 ILE CG1  C  -59.378 -16.381 -106.318 1.00 . A A .  60 ILE CG1  1 1 
        1    804 1 1  60 ILE CG2  C  -61.238 -17.627 -107.468 1.00 . A A .  60 ILE CG2  1 1 
        1    805 1 1  60 ILE H    H  -60.973 -13.703 -106.381 1.00 . A A .  60 ILE H    1 1 
        1    806 1 1  60 ILE HA   H  -60.047 -15.295 -108.599 1.00 . A A .  60 ILE HA   1 1 
        1    807 1 1  60 ILE HB   H  -61.506 -16.041 -106.061 1.00 . A A .  60 ILE HB   1 1 
        1    808 1 1  60 ILE HD11 H  -58.262 -17.643 -104.991 1.00 . A A .  60 ILE HD11 1 1 
        1    809 1 1  60 ILE HD12 H  -59.940 -18.148 -105.193 1.00 . A A .  60 ILE HD12 1 1 
        1    810 1 1  60 ILE HD13 H  -59.554 -16.744 -104.198 1.00 . A A .  60 ILE HD13 1 1 
        1    811 1 1  60 ILE HG12 H  -58.759 -16.784 -107.082 1.00 . A A .  60 ILE HG12 1 1 
        1    812 1 1  60 ILE HG13 H  -59.061 -15.404 -106.045 1.00 . A A .  60 ILE HG13 1 1 
        1    813 1 1  60 ILE HG21 H  -60.790 -17.732 -108.445 1.00 . A A .  60 ILE HG21 1 1 
        1    814 1 1  60 ILE HG22 H  -62.312 -17.666 -107.555 1.00 . A A .  60 ILE HG22 1 1 
        1    815 1 1  60 ILE HG23 H  -60.897 -18.425 -106.826 1.00 . A A .  60 ILE HG23 1 1 
        1    816 1 1  60 ILE N    N  -60.770 -13.818 -107.327 1.00 . A A .  60 ILE N    1 1 
        1    817 1 1  60 ILE O    O  -62.120 -15.734 -109.933 1.00 . A A .  60 ILE O    1 1 
        1    818 1 1  61 GLY C    C  -64.562 -13.764 -110.003 1.00 . A A .  61 GLY C    1 1 
        1    819 1 1  61 GLY CA   C  -64.566 -14.822 -108.909 1.00 . A A .  61 GLY CA   1 1 
        1    820 1 1  61 GLY H    H  -63.225 -14.411 -107.328 1.00 . A A .  61 GLY H    1 1 
        1    821 1 1  61 GLY HA2  H  -64.761 -15.790 -109.338 1.00 . A A .  61 GLY HA2  1 1 
        1    822 1 1  61 GLY HA3  H  -65.353 -14.576 -108.205 1.00 . A A .  61 GLY HA3  1 1 
        1    823 1 1  61 GLY N    N  -63.280 -14.813 -108.215 1.00 . A A .  61 GLY N    1 1 
        1    824 1 1  61 GLY O    O  -65.313 -13.854 -110.974 1.00 . A A .  61 GLY O    1 1 
        1    825 1 1  62 ALA C    C  -63.397 -12.258 -112.258 1.00 . A A .  62 ALA C    1 1 
        1    826 1 1  62 ALA CA   C  -63.485 -11.717 -110.825 1.00 . A A .  62 ALA CA   1 1 
        1    827 1 1  62 ALA CB   C  -62.256 -10.860 -110.470 1.00 . A A .  62 ALA CB   1 1 
        1    828 1 1  62 ALA H    H  -63.032 -12.853 -109.100 1.00 . A A .  62 ALA H    1 1 
        1    829 1 1  62 ALA HA   H  -64.351 -11.085 -110.773 1.00 . A A .  62 ALA HA   1 1 
        1    830 1 1  62 ALA HB1  H  -62.566 -10.025 -109.851 1.00 . A A .  62 ALA HB1  1 1 
        1    831 1 1  62 ALA HB2  H  -61.804 -10.482 -111.371 1.00 . A A .  62 ALA HB2  1 1 
        1    832 1 1  62 ALA HB3  H  -61.545 -11.452 -109.936 1.00 . A A .  62 ALA HB3  1 1 
        1    833 1 1  62 ALA N    N  -63.637 -12.806 -109.861 1.00 . A A .  62 ALA N    1 1 
        1    834 1 1  62 ALA O    O  -63.753 -11.544 -113.187 1.00 . A A .  62 ALA O    1 1 
        1    835 1 1  63 ILE C    C  -63.866 -13.554 -114.716 1.00 . A A .  63 ILE C    1 1 
        1    836 1 1  63 ILE CA   C  -62.772 -14.082 -113.788 1.00 . A A .  63 ILE CA   1 1 
        1    837 1 1  63 ILE CB   C  -62.727 -15.682 -113.781 1.00 . A A .  63 ILE CB   1 1 
        1    838 1 1  63 ILE CD1  C  -63.767 -17.744 -112.647 1.00 . A A .  63 ILE CD1  1 1 
        1    839 1 1  63 ILE CG1  C  -63.870 -16.235 -112.815 1.00 . A A .  63 ILE CG1  1 1 
        1    840 1 1  63 ILE CG2  C  -61.395 -16.204 -113.270 1.00 . A A .  63 ILE CG2  1 1 
        1    841 1 1  63 ILE H    H  -62.594 -14.002 -111.661 1.00 . A A .  63 ILE H    1 1 
        1    842 1 1  63 ILE HA   H  -61.842 -13.761 -114.184 1.00 . A A .  63 ILE HA   1 1 
        1    843 1 1  63 ILE HB   H  -62.914 -16.040 -114.765 1.00 . A A .  63 ILE HB   1 1 
        1    844 1 1  63 ILE HD11 H  -63.317 -17.960 -111.689 1.00 . A A .  63 ILE HD11 1 1 
        1    845 1 1  63 ILE HD12 H  -63.178 -18.184 -113.433 1.00 . A A .  63 ILE HD12 1 1 
        1    846 1 1  63 ILE HD13 H  -64.768 -18.149 -112.670 1.00 . A A .  63 ILE HD13 1 1 
        1    847 1 1  63 ILE HG12 H  -63.743 -15.766 -111.874 1.00 . A A .  63 ILE HG12 1 1 
        1    848 1 1  63 ILE HG13 H  -64.799 -15.981 -113.255 1.00 . A A .  63 ILE HG13 1 1 
        1    849 1 1  63 ILE HG21 H  -60.599 -15.628 -113.704 1.00 . A A .  63 ILE HG21 1 1 
        1    850 1 1  63 ILE HG22 H  -61.293 -17.242 -113.561 1.00 . A A .  63 ILE HG22 1 1 
        1    851 1 1  63 ILE HG23 H  -61.353 -16.132 -112.191 1.00 . A A .  63 ILE HG23 1 1 
        1    852 1 1  63 ILE N    N  -62.900 -13.500 -112.437 1.00 . A A .  63 ILE N    1 1 
        1    853 1 1  63 ILE O    O  -63.648 -13.421 -115.928 1.00 . A A .  63 ILE O    1 1 
        1    854 1 1  64 ALA C    C  -67.488 -13.369 -114.126 1.00 . A A .  64 ALA C    1 1 
        1    855 1 1  64 ALA CA   C  -66.225 -12.824 -114.828 1.00 . A A .  64 ALA CA   1 1 
        1    856 1 1  64 ALA CB   C  -66.182 -13.226 -116.315 1.00 . A A .  64 ALA CB   1 1 
        1    857 1 1  64 ALA H    H  -65.135 -13.550 -113.184 1.00 . A A .  64 ALA H    1 1 
        1    858 1 1  64 ALA HA   H  -66.243 -11.755 -114.777 1.00 . A A .  64 ALA HA   1 1 
        1    859 1 1  64 ALA HB1  H  -67.181 -13.258 -116.716 1.00 . A A .  64 ALA HB1  1 1 
        1    860 1 1  64 ALA HB2  H  -65.718 -14.193 -116.419 1.00 . A A .  64 ALA HB2  1 1 
        1    861 1 1  64 ALA HB3  H  -65.598 -12.493 -116.864 1.00 . A A .  64 ALA HB3  1 1 
        1    862 1 1  64 ALA N    N  -65.048 -13.329 -114.129 1.00 . A A .  64 ALA N    1 1 
        1    863 1 1  64 ALA O    O  -67.731 -14.580 -114.128 1.00 . A A .  64 ALA O    1 1 
        1    864 1 1  65 PRO C    C  -70.948 -13.038 -113.516 1.00 . A A .  65 PRO C    1 1 
        1    865 1 1  65 PRO CA   C  -69.521 -12.775 -112.822 1.00 . A A .  65 PRO CA   1 1 
        1    866 1 1  65 PRO CB   C  -69.651 -11.623 -111.825 1.00 . A A .  65 PRO CB   1 1 
        1    867 1 1  65 PRO CD   C  -67.999 -11.017 -113.462 1.00 . A A .  65 PRO CD   1 1 
        1    868 1 1  65 PRO CG   C  -69.112 -10.461 -112.573 1.00 . A A .  65 PRO CG   1 1 
        1    869 1 1  65 PRO HA   H  -69.381 -13.679 -112.238 1.00 . A A .  65 PRO HA   1 1 
        1    870 1 1  65 PRO HB2  H  -70.692 -11.465 -111.554 1.00 . A A .  65 PRO HB2  1 1 
        1    871 1 1  65 PRO HB3  H  -69.058 -11.808 -110.938 1.00 . A A .  65 PRO HB3  1 1 
        1    872 1 1  65 PRO HD2  H  -68.043 -10.586 -114.459 1.00 . A A .  65 PRO HD2  1 1 
        1    873 1 1  65 PRO HD3  H  -67.029 -10.839 -113.014 1.00 . A A .  65 PRO HD3  1 1 
        1    874 1 1  65 PRO HG2  H  -69.891 -10.026 -113.177 1.00 . A A .  65 PRO HG2  1 1 
        1    875 1 1  65 PRO HG3  H  -68.709  -9.731 -111.893 1.00 . A A .  65 PRO HG3  1 1 
        1    876 1 1  65 PRO N    N  -68.269 -12.463 -113.540 1.00 . A A .  65 PRO N    1 1 
        1    877 1 1  65 PRO O    O  -71.562 -12.004 -113.795 1.00 . A A .  65 PRO O    1 1 
        1    878 1 1  66 LYS C    C  -71.170 -15.630 -116.209 1.00 . A A .  66 LYS C    1 1 
        1    879 1 1  66 LYS CA   C  -71.466 -14.196 -115.780 1.00 . A A .  66 LYS CA   1 1 
        1    880 1 1  66 LYS CB   C  -70.508 -13.248 -116.723 1.00 . A A .  66 LYS CB   1 1 
        1    881 1 1  66 LYS CD   C  -70.143 -12.332 -119.104 1.00 . A A .  66 LYS CD   1 1 
        1    882 1 1  66 LYS CE   C  -69.825 -10.832 -118.840 1.00 . A A .  66 LYS CE   1 1 
        1    883 1 1  66 LYS CG   C  -71.156 -12.920 -118.080 1.00 . A A .  66 LYS CG   1 1 
        1    884 1 1  66 LYS H    H  -70.094 -13.659 -114.896 1.00 . A A .  66 LYS H    1 1 
        1    885 1 1  66 LYS HA   H  -72.404 -13.906 -115.883 1.00 . A A .  66 LYS HA   1 1 
        1    886 1 1  66 LYS HB2  H  -70.319 -12.319 -116.205 1.00 . A A .  66 LYS HB2  1 1 
        1    887 1 1  66 LYS HB3  H  -69.554 -13.733 -116.897 1.00 . A A .  66 LYS HB3  1 1 
        1    888 1 1  66 LYS HD2  H  -69.215 -12.888 -119.041 1.00 . A A .  66 LYS HD2  1 1 
        1    889 1 1  66 LYS HD3  H  -70.546 -12.445 -120.097 1.00 . A A .  66 LYS HD3  1 1 
        1    890 1 1  66 LYS HE2  H  -69.638 -10.705 -117.798 1.00 . A A .  66 LYS HE2  1 1 
        1    891 1 1  66 LYS HE3  H  -68.931 -10.583 -119.391 1.00 . A A .  66 LYS HE3  1 1 
        1    892 1 1  66 LYS HG2  H  -71.567 -13.823 -118.492 1.00 . A A .  66 LYS HG2  1 1 
        1    893 1 1  66 LYS HG3  H  -71.941 -12.208 -117.924 1.00 . A A .  66 LYS HG3  1 1 
        1    894 1 1  66 LYS HZ1  H  -71.495  -9.627 -118.411 1.00 . A A .  66 LYS HZ1  1 1 
        1    895 1 1  66 LYS HZ2  H  -71.525 -10.293 -119.973 1.00 . A A .  66 LYS HZ2  1 1 
        1    896 1 1  66 LYS HZ3  H  -70.487  -8.995 -119.620 1.00 . A A .  66 LYS HZ3  1 1 
        1    897 1 1  66 LYS N    N  -70.843 -13.833 -114.685 1.00 . A A .  66 LYS N    1 1 
        1    898 1 1  66 LYS NZ   N  -70.922  -9.873 -119.246 1.00 . A A .  66 LYS NZ   1 1 
        1    899 1 1  66 LYS O    O  -71.302 -16.527 -115.392 1.00 . A A .  66 LYS O    1 1 
        1    900 1 1  67 THR C    C  -69.892 -18.074 -116.934 1.00 . A A .  67 THR C    1 1 
        1    901 1 1  67 THR CA   C  -70.399 -17.141 -118.042 1.00 . A A .  67 THR CA   1 1 
        1    902 1 1  67 THR CB   C  -69.376 -17.022 -119.240 1.00 . A A .  67 THR CB   1 1 
        1    903 1 1  67 THR CG2  C  -69.958 -17.629 -120.543 1.00 . A A .  67 THR CG2  1 1 
        1    904 1 1  67 THR H    H  -70.529 -15.025 -118.001 1.00 . A A .  67 THR H    1 1 
        1    905 1 1  67 THR HA   H  -71.312 -17.556 -118.429 1.00 . A A .  67 THR HA   1 1 
        1    906 1 1  67 THR HB   H  -68.473 -17.555 -118.993 1.00 . A A .  67 THR HB   1 1 
        1    907 1 1  67 THR HG1  H  -68.478 -15.602 -120.246 1.00 . A A .  67 THR HG1  1 1 
        1    908 1 1  67 THR HG21 H  -70.102 -18.693 -120.415 1.00 . A A .  67 THR HG21 1 1 
        1    909 1 1  67 THR HG22 H  -69.270 -17.458 -121.360 1.00 . A A .  67 THR HG22 1 1 
        1    910 1 1  67 THR HG23 H  -70.905 -17.163 -120.770 1.00 . A A .  67 THR HG23 1 1 
        1    911 1 1  67 THR N    N  -70.686 -15.806 -117.466 1.00 . A A .  67 THR N    1 1 
        1    912 1 1  67 THR O    O  -70.395 -19.212 -116.797 1.00 . A A .  67 THR O    1 1 
        1    913 1 1  67 THR OG1  O  -69.062 -15.649 -119.482 1.00 . A A .  67 THR OG1  1 1 
        1    914 1 1  68 PRO C    C  -69.500 -18.665 -113.833 1.00 . A A .  68 PRO C    1 1 
        1    915 1 1  68 PRO CA   C  -68.442 -18.515 -115.061 1.00 . A A .  68 PRO CA   1 1 
        1    916 1 1  68 PRO CB   C  -67.147 -17.791 -114.516 1.00 . A A .  68 PRO CB   1 1 
        1    917 1 1  68 PRO CD   C  -68.147 -16.390 -116.235 1.00 . A A .  68 PRO CD   1 1 
        1    918 1 1  68 PRO CG   C  -66.800 -16.816 -115.686 1.00 . A A .  68 PRO CG   1 1 
        1    919 1 1  68 PRO HA   H  -68.177 -19.473 -115.421 1.00 . A A .  68 PRO HA   1 1 
        1    920 1 1  68 PRO HB2  H  -67.367 -17.238 -113.636 1.00 . A A .  68 PRO HB2  1 1 
        1    921 1 1  68 PRO HB3  H  -66.369 -18.494 -114.397 1.00 . A A .  68 PRO HB3  1 1 
        1    922 1 1  68 PRO HD2  H  -68.579 -15.599 -115.650 1.00 . A A .  68 PRO HD2  1 1 
        1    923 1 1  68 PRO HD3  H  -68.032 -16.100 -117.261 1.00 . A A .  68 PRO HD3  1 1 
        1    924 1 1  68 PRO HG2  H  -66.248 -16.009 -115.281 1.00 . A A .  68 PRO HG2  1 1 
        1    925 1 1  68 PRO HG3  H  -66.251 -17.359 -116.428 1.00 . A A .  68 PRO HG3  1 1 
        1    926 1 1  68 PRO N    N  -68.917 -17.659 -116.143 1.00 . A A .  68 PRO N    1 1 
        1    927 1 1  68 PRO O    O  -69.824 -17.683 -113.190 1.00 . A A .  68 PRO O    1 1 
        1    928 1 1  69 LEU C    C  -70.284 -20.305 -111.251 1.00 . A A .  69 LEU C    1 1 
        1    929 1 1  69 LEU CA   C  -70.915 -20.287 -112.646 1.00 . A A .  69 LEU CA   1 1 
        1    930 1 1  69 LEU CB   C  -71.419 -21.693 -113.038 1.00 . A A .  69 LEU CB   1 1 
        1    931 1 1  69 LEU CD1  C  -73.113 -22.011 -111.132 1.00 . A A .  69 LEU CD1  1 1 
        1    932 1 1  69 LEU CD2  C  -73.870 -21.421 -113.432 1.00 . A A .  69 LEU CD2  1 1 
        1    933 1 1  69 LEU CG   C  -72.835 -22.162 -112.617 1.00 . A A .  69 LEU CG   1 1 
        1    934 1 1  69 LEU H    H  -69.604 -20.602 -114.283 1.00 . A A .  69 LEU H    1 1 
        1    935 1 1  69 LEU HA   H  -71.701 -19.582 -112.663 1.00 . A A .  69 LEU HA   1 1 
        1    936 1 1  69 LEU HB2  H  -71.424 -21.723 -114.097 1.00 . A A .  69 LEU HB2  1 1 
        1    937 1 1  69 LEU HB3  H  -70.720 -22.393 -112.669 1.00 . A A .  69 LEU HB3  1 1 
        1    938 1 1  69 LEU HD11 H  -72.263 -22.347 -110.568 1.00 . A A .  69 LEU HD11 1 1 
        1    939 1 1  69 LEU HD12 H  -73.978 -22.613 -110.872 1.00 . A A .  69 LEU HD12 1 1 
        1    940 1 1  69 LEU HD13 H  -73.318 -20.979 -110.919 1.00 . A A .  69 LEU HD13 1 1 
        1    941 1 1  69 LEU HD21 H  -73.967 -21.891 -114.401 1.00 . A A .  69 LEU HD21 1 1 
        1    942 1 1  69 LEU HD22 H  -73.553 -20.401 -113.560 1.00 . A A .  69 LEU HD22 1 1 
        1    943 1 1  69 LEU HD23 H  -74.816 -21.449 -112.922 1.00 . A A .  69 LEU HD23 1 1 
        1    944 1 1  69 LEU HG   H  -72.897 -23.223 -112.869 1.00 . A A .  69 LEU HG   1 1 
        1    945 1 1  69 LEU N    N  -69.932 -19.901 -113.675 1.00 . A A .  69 LEU N    1 1 
        1    946 1 1  69 LEU O    O  -70.995 -20.466 -110.262 1.00 . A A .  69 LEU O    1 1 
        1    947 1 1  70 ARG C    C  -68.726 -19.056 -108.920 1.00 . A A .  70 ARG C    1 1 
        1    948 1 1  70 ARG CA   C  -68.191 -20.162 -109.945 1.00 . A A .  70 ARG CA   1 1 
        1    949 1 1  70 ARG CB   C  -66.695 -19.959 -110.214 1.00 . A A .  70 ARG CB   1 1 
        1    950 1 1  70 ARG CD   C  -64.373 -20.389 -109.164 1.00 . A A .  70 ARG CD   1 1 
        1    951 1 1  70 ARG CG   C  -65.859 -19.907 -108.910 1.00 . A A .  70 ARG CG   1 1 
        1    952 1 1  70 ARG CZ   C  -62.450 -20.959 -107.699 1.00 . A A .  70 ARG CZ   1 1 
        1    953 1 1  70 ARG H    H  -68.471 -20.012 -112.028 1.00 . A A .  70 ARG H    1 1 
        1    954 1 1  70 ARG HA   H  -68.340 -21.107 -109.463 1.00 . A A .  70 ARG HA   1 1 
        1    955 1 1  70 ARG HB2  H  -66.360 -20.774 -110.814 1.00 . A A .  70 ARG HB2  1 1 
        1    956 1 1  70 ARG HB3  H  -66.564 -19.035 -110.747 1.00 . A A .  70 ARG HB3  1 1 
        1    957 1 1  70 ARG HD2  H  -64.397 -21.403 -109.498 1.00 . A A .  70 ARG HD2  1 1 
        1    958 1 1  70 ARG HD3  H  -63.932 -19.759 -109.912 1.00 . A A .  70 ARG HD3  1 1 
        1    959 1 1  70 ARG HE   H  -63.934 -19.722 -107.203 1.00 . A A .  70 ARG HE   1 1 
        1    960 1 1  70 ARG HG2  H  -65.816 -18.897 -108.556 1.00 . A A .  70 ARG HG2  1 1 
        1    961 1 1  70 ARG HG3  H  -66.296 -20.541 -108.173 1.00 . A A .  70 ARG HG3  1 1 
        1    962 1 1  70 ARG HH11 H  -62.401 -21.882 -109.489 1.00 . A A .  70 ARG HH11 1 1 
        1    963 1 1  70 ARG HH12 H  -61.079 -22.239 -108.427 1.00 . A A .  70 ARG HH12 1 1 
        1    964 1 1  70 ARG HH21 H  -62.208 -20.204 -105.839 1.00 . A A .  70 ARG HH21 1 1 
        1    965 1 1  70 ARG HH22 H  -60.971 -21.294 -106.372 1.00 . A A .  70 ARG HH22 1 1 
        1    966 1 1  70 ARG N    N  -68.960 -20.157 -111.194 1.00 . A A .  70 ARG N    1 1 
        1    967 1 1  70 ARG NE   N  -63.602 -20.294 -107.910 1.00 . A A .  70 ARG NE   1 1 
        1    968 1 1  70 ARG NH1  N  -61.939 -21.754 -108.611 1.00 . A A .  70 ARG NH1  1 1 
        1    969 1 1  70 ARG NH2  N  -61.828 -20.806 -106.546 1.00 . A A .  70 ARG NH2  1 1 
        1    970 1 1  70 ARG O    O  -68.029 -18.738 -107.982 1.00 . A A .  70 ARG O    1 1 
        1    971 1 1  71 TYR C    C  -70.302 -17.817 -106.854 1.00 . A A .  71 TYR C    1 1 
        1    972 1 1  71 TYR CA   C  -70.563 -17.564 -108.346 1.00 . A A .  71 TYR CA   1 1 
        1    973 1 1  71 TYR CB   C  -72.096 -17.597 -108.564 1.00 . A A .  71 TYR CB   1 1 
        1    974 1 1  71 TYR CD1  C  -71.822 -16.847 -110.979 1.00 . A A .  71 TYR CD1  1 1 
        1    975 1 1  71 TYR CD2  C  -73.561 -18.447 -110.460 1.00 . A A .  71 TYR CD2  1 1 
        1    976 1 1  71 TYR CE1  C  -72.202 -16.877 -112.325 1.00 . A A .  71 TYR CE1  1 1 
        1    977 1 1  71 TYR CE2  C  -73.937 -18.474 -111.807 1.00 . A A .  71 TYR CE2  1 1 
        1    978 1 1  71 TYR CG   C  -72.494 -17.628 -110.042 1.00 . A A .  71 TYR CG   1 1 
        1    979 1 1  71 TYR CZ   C  -73.257 -17.688 -112.739 1.00 . A A .  71 TYR CZ   1 1 
        1    980 1 1  71 TYR H    H  -70.418 -18.919 -109.957 1.00 . A A .  71 TYR H    1 1 
        1    981 1 1  71 TYR HA   H  -70.198 -16.594 -108.599 1.00 . A A .  71 TYR HA   1 1 
        1    982 1 1  71 TYR HB2  H  -72.489 -18.473 -108.094 1.00 . A A .  71 TYR HB2  1 1 
        1    983 1 1  71 TYR HB3  H  -72.527 -16.723 -108.108 1.00 . A A .  71 TYR HB3  1 1 
        1    984 1 1  71 TYR HD1  H  -71.012 -16.219 -110.671 1.00 . A A .  71 TYR HD1  1 1 
        1    985 1 1  71 TYR HD2  H  -74.091 -19.050 -109.748 1.00 . A A .  71 TYR HD2  1 1 
        1    986 1 1  71 TYR HE1  H  -71.674 -16.267 -113.047 1.00 . A A .  71 TYR HE1  1 1 
        1    987 1 1  71 TYR HE2  H  -74.756 -19.105 -112.126 1.00 . A A .  71 TYR HE2  1 1 
        1    988 1 1  71 TYR HH   H  -72.842 -17.940 -114.579 1.00 . A A .  71 TYR HH   1 1 
        1    989 1 1  71 TYR N    N  -69.924 -18.572 -109.190 1.00 . A A .  71 TYR N    1 1 
        1    990 1 1  71 TYR O    O  -70.408 -16.901 -106.032 1.00 . A A .  71 TYR O    1 1 
        1    991 1 1  71 TYR OH   O  -73.620 -17.721 -114.063 1.00 . A A .  71 TYR OH   1 1 
        1    992 1 1  72 VAL C    C  -68.883 -18.272 -104.501 1.00 . A A .  72 VAL C    1 1 
        1    993 1 1  72 VAL CA   C  -69.629 -19.408 -105.147 1.00 . A A .  72 VAL CA   1 1 
        1    994 1 1  72 VAL CB   C  -68.795 -20.731 -105.060 1.00 . A A .  72 VAL CB   1 1 
        1    995 1 1  72 VAL CG1  C  -69.317 -21.752 -106.057 1.00 . A A .  72 VAL CG1  1 1 
        1    996 1 1  72 VAL CG2  C  -67.337 -20.419 -105.341 1.00 . A A .  72 VAL CG2  1 1 
        1    997 1 1  72 VAL H    H  -69.774 -19.706 -107.228 1.00 . A A .  72 VAL H    1 1 
        1    998 1 1  72 VAL HA   H  -70.562 -19.566 -104.615 1.00 . A A .  72 VAL HA   1 1 
        1    999 1 1  72 VAL HB   H  -68.893 -21.124 -104.069 1.00 . A A .  72 VAL HB   1 1 
        1   1000 1 1  72 VAL HG11 H  -69.019 -21.474 -107.054 1.00 . A A .  72 VAL HG11 1 1 
        1   1001 1 1  72 VAL HG12 H  -70.393 -21.797 -105.996 1.00 . A A .  72 VAL HG12 1 1 
        1   1002 1 1  72 VAL HG13 H  -68.900 -22.717 -105.811 1.00 . A A .  72 VAL HG13 1 1 
        1   1003 1 1  72 VAL HG21 H  -66.889 -20.010 -104.446 1.00 . A A .  72 VAL HG21 1 1 
        1   1004 1 1  72 VAL HG22 H  -67.265 -19.700 -106.138 1.00 . A A .  72 VAL HG22 1 1 
        1   1005 1 1  72 VAL HG23 H  -66.831 -21.325 -105.618 1.00 . A A .  72 VAL HG23 1 1 
        1   1006 1 1  72 VAL N    N  -69.903 -19.049 -106.523 1.00 . A A .  72 VAL N    1 1 
        1   1007 1 1  72 VAL O    O  -68.910 -18.114 -103.293 1.00 . A A .  72 VAL O    1 1 
        1   1008 1 1  73 ALA C    C  -68.235 -15.506 -103.839 1.00 . A A .  73 ALA C    1 1 
        1   1009 1 1  73 ALA CA   C  -67.456 -16.313 -104.886 1.00 . A A .  73 ALA CA   1 1 
        1   1010 1 1  73 ALA CB   C  -67.077 -15.426 -106.074 1.00 . A A .  73 ALA CB   1 1 
        1   1011 1 1  73 ALA H    H  -68.214 -17.697 -106.305 1.00 . A A .  73 ALA H    1 1 
        1   1012 1 1  73 ALA HA   H  -66.557 -16.657 -104.434 1.00 . A A .  73 ALA HA   1 1 
        1   1013 1 1  73 ALA HB1  H  -66.488 -14.593 -105.722 1.00 . A A .  73 ALA HB1  1 1 
        1   1014 1 1  73 ALA HB2  H  -67.966 -15.063 -106.562 1.00 . A A .  73 ALA HB2  1 1 
        1   1015 1 1  73 ALA HB3  H  -66.492 -16.008 -106.773 1.00 . A A .  73 ALA HB3  1 1 
        1   1016 1 1  73 ALA N    N  -68.202 -17.486 -105.347 1.00 . A A .  73 ALA N    1 1 
        1   1017 1 1  73 ALA O    O  -67.634 -14.879 -102.973 1.00 . A A .  73 ALA O    1 1 
        1   1018 1 1  74 MET C    C  -70.271 -15.413 -101.493 1.00 . A A .  74 MET C    1 1 
        1   1019 1 1  74 MET CA   C  -70.396 -14.832 -103.007 1.00 . A A .  74 MET CA   1 1 
        1   1020 1 1  74 MET CB   C  -71.978 -14.995 -103.380 1.00 . A A .  74 MET CB   1 1 
        1   1021 1 1  74 MET CE   C  -74.544 -16.594 -105.352 1.00 . A A .  74 MET CE   1 1 
        1   1022 1 1  74 MET CG   C  -72.220 -15.061 -104.926 1.00 . A A .  74 MET CG   1 1 
        1   1023 1 1  74 MET H    H  -69.969 -16.066 -104.639 1.00 . A A .  74 MET H    1 1 
        1   1024 1 1  74 MET HA   H  -70.170 -13.812 -102.962 1.00 . A A .  74 MET HA   1 1 
        1   1025 1 1  74 MET HB2  H  -72.332 -15.864 -102.919 1.00 . A A .  74 MET HB2  1 1 
        1   1026 1 1  74 MET HB3  H  -72.448 -14.123 -102.984 1.00 . A A .  74 MET HB3  1 1 
        1   1027 1 1  74 MET HE1  H  -74.968 -16.170 -106.250 1.00 . A A .  74 MET HE1  1 1 
        1   1028 1 1  74 MET HE2  H  -74.788 -15.978 -104.508 1.00 . A A .  74 MET HE2  1 1 
        1   1029 1 1  74 MET HE3  H  -74.941 -17.591 -105.199 1.00 . A A .  74 MET HE3  1 1 
        1   1030 1 1  74 MET HG2  H  -72.998 -14.363 -105.142 1.00 . A A .  74 MET HG2  1 1 
        1   1031 1 1  74 MET HG3  H  -71.329 -14.781 -105.434 1.00 . A A .  74 MET HG3  1 1 
        1   1032 1 1  74 MET N    N  -69.559 -15.543 -103.930 1.00 . A A .  74 MET N    1 1 
        1   1033 1 1  74 MET O    O  -70.121 -14.629 -100.589 1.00 . A A .  74 MET O    1 1 
        1   1034 1 1  74 MET SD   S  -72.752 -16.707 -105.517 1.00 . A A .  74 MET SD   1 1 
        1   1035 1 1  75 VAL C    C  -68.982 -17.141  -99.448 1.00 . A A .  75 VAL C    1 1 
        1   1036 1 1  75 VAL CA   C  -70.351 -17.356 -100.096 1.00 . A A .  75 VAL CA   1 1 
        1   1037 1 1  75 VAL CB   C  -70.646 -18.903 -100.266 1.00 . A A .  75 VAL CB   1 1 
        1   1038 1 1  75 VAL CG1  C  -70.998 -19.514  -98.919 1.00 . A A .  75 VAL CG1  1 1 
        1   1039 1 1  75 VAL CG2  C  -71.790 -19.117 -101.257 1.00 . A A .  75 VAL CG2  1 1 
        1   1040 1 1  75 VAL H    H  -70.630 -17.240 -102.186 1.00 . A A .  75 VAL H    1 1 
        1   1041 1 1  75 VAL HA   H  -71.102 -16.934  -99.471 1.00 . A A .  75 VAL HA   1 1 
        1   1042 1 1  75 VAL HB   H  -69.767 -19.375 -100.636 1.00 . A A .  75 VAL HB   1 1 
        1   1043 1 1  75 VAL HG11 H  -71.872 -19.032  -98.512 1.00 . A A .  75 VAL HG11 1 1 
        1   1044 1 1  75 VAL HG12 H  -70.165 -19.389  -98.248 1.00 . A A .  75 VAL HG12 1 1 
        1   1045 1 1  75 VAL HG13 H  -71.198 -20.567  -99.058 1.00 . A A .  75 VAL HG13 1 1 
        1   1046 1 1  75 VAL HG21 H  -72.452 -18.267 -101.253 1.00 . A A .  75 VAL HG21 1 1 
        1   1047 1 1  75 VAL HG22 H  -72.339 -20.003 -100.982 1.00 . A A .  75 VAL HG22 1 1 
        1   1048 1 1  75 VAL HG23 H  -71.375 -19.247 -102.247 1.00 . A A .  75 VAL HG23 1 1 
        1   1049 1 1  75 VAL N    N  -70.423 -16.712 -101.390 1.00 . A A .  75 VAL N    1 1 
        1   1050 1 1  75 VAL O    O  -68.902 -16.706  -98.303 1.00 . A A .  75 VAL O    1 1 
        1   1051 1 1  76 ILE C    C  -66.368 -15.654  -99.325 1.00 . A A .  76 ILE C    1 1 
        1   1052 1 1  76 ILE CA   C  -66.583 -17.180  -99.671 1.00 . A A .  76 ILE CA   1 1 
        1   1053 1 1  76 ILE CB   C  -65.498 -17.773 -100.678 1.00 . A A .  76 ILE CB   1 1 
        1   1054 1 1  76 ILE CD1  C  -63.001 -18.017 -101.121 1.00 . A A .  76 ILE CD1  1 1 
        1   1055 1 1  76 ILE CG1  C  -64.058 -17.416 -100.186 1.00 . A A .  76 ILE CG1  1 1 
        1   1056 1 1  76 ILE CG2  C  -65.708 -17.298 -102.097 1.00 . A A .  76 ILE CG2  1 1 
        1   1057 1 1  76 ILE H    H  -68.036 -17.729 -101.106 1.00 . A A .  76 ILE H    1 1 
        1   1058 1 1  76 ILE HA   H  -66.492 -17.711  -98.757 1.00 . A A .  76 ILE HA   1 1 
        1   1059 1 1  76 ILE HB   H  -65.606 -18.832 -100.643 1.00 . A A .  76 ILE HB   1 1 
        1   1060 1 1  76 ILE HD11 H  -62.878 -17.373 -101.982 1.00 . A A .  76 ILE HD11 1 1 
        1   1061 1 1  76 ILE HD12 H  -63.305 -18.998 -101.447 1.00 . A A .  76 ILE HD12 1 1 
        1   1062 1 1  76 ILE HD13 H  -62.067 -18.083 -100.587 1.00 . A A .  76 ILE HD13 1 1 
        1   1063 1 1  76 ILE HG12 H  -63.954 -16.358 -100.169 1.00 . A A .  76 ILE HG12 1 1 
        1   1064 1 1  76 ILE HG13 H  -63.931 -17.823  -99.205 1.00 . A A .  76 ILE HG13 1 1 
        1   1065 1 1  76 ILE HG21 H  -66.363 -17.998 -102.599 1.00 . A A .  76 ILE HG21 1 1 
        1   1066 1 1  76 ILE HG22 H  -64.761 -17.269 -102.616 1.00 . A A .  76 ILE HG22 1 1 
        1   1067 1 1  76 ILE HG23 H  -66.149 -16.321 -102.103 1.00 . A A .  76 ILE HG23 1 1 
        1   1068 1 1  76 ILE N    N  -67.917 -17.396 -100.195 1.00 . A A .  76 ILE N    1 1 
        1   1069 1 1  76 ILE O    O  -65.783 -15.360  -98.298 1.00 . A A .  76 ILE O    1 1 
        1   1070 1 1  77 TRP C    C  -67.774 -13.027  -98.658 1.00 . A A .  77 TRP C    1 1 
        1   1071 1 1  77 TRP CA   C  -66.946 -13.300  -99.905 1.00 . A A .  77 TRP CA   1 1 
        1   1072 1 1  77 TRP CB   C  -67.552 -12.595 -101.171 1.00 . A A .  77 TRP CB   1 1 
        1   1073 1 1  77 TRP CD1  C  -68.700 -10.521 -100.050 1.00 . A A .  77 TRP CD1  1 1 
        1   1074 1 1  77 TRP CD2  C  -67.802 -10.077 -102.058 1.00 . A A .  77 TRP CD2  1 1 
        1   1075 1 1  77 TRP CE2  C  -68.405  -8.870 -101.570 1.00 . A A .  77 TRP CE2  1 1 
        1   1076 1 1  77 TRP CE3  C  -67.172 -10.041 -103.312 1.00 . A A .  77 TRP CE3  1 1 
        1   1077 1 1  77 TRP CG   C  -67.982 -11.114 -101.059 1.00 . A A .  77 TRP CG   1 1 
        1   1078 1 1  77 TRP CH2  C  -67.761  -7.684 -103.516 1.00 . A A .  77 TRP CH2  1 1 
        1   1079 1 1  77 TRP CZ2  C  -68.384  -7.705 -102.289 1.00 . A A .  77 TRP CZ2  1 1 
        1   1080 1 1  77 TRP CZ3  C  -67.156  -8.845 -104.030 1.00 . A A .  77 TRP CZ3  1 1 
        1   1081 1 1  77 TRP H    H  -67.451 -15.119 -100.906 1.00 . A A .  77 TRP H    1 1 
        1   1082 1 1  77 TRP HA   H  -65.941 -12.964  -99.754 1.00 . A A .  77 TRP HA   1 1 
        1   1083 1 1  77 TRP HB2  H  -66.814 -12.653 -101.943 1.00 . A A .  77 TRP HB2  1 1 
        1   1084 1 1  77 TRP HB3  H  -68.407 -13.169 -101.477 1.00 . A A .  77 TRP HB3  1 1 
        1   1085 1 1  77 TRP HD1  H  -69.020 -11.002  -99.157 1.00 . A A .  77 TRP HD1  1 1 
        1   1086 1 1  77 TRP HE1  H  -69.419  -8.540  -99.787 1.00 . A A .  77 TRP HE1  1 1 
        1   1087 1 1  77 TRP HE3  H  -66.702 -10.930 -103.724 1.00 . A A .  77 TRP HE3  1 1 
        1   1088 1 1  77 TRP HH2  H  -67.736  -6.779 -104.080 1.00 . A A .  77 TRP HH2  1 1 
        1   1089 1 1  77 TRP HZ2  H  -68.850  -6.802 -101.892 1.00 . A A .  77 TRP HZ2  1 1 
        1   1090 1 1  77 TRP HZ3  H  -66.674  -8.803 -104.990 1.00 . A A .  77 TRP HZ3  1 1 
        1   1091 1 1  77 TRP N    N  -66.955 -14.775 -100.146 1.00 . A A .  77 TRP N    1 1 
        1   1092 1 1  77 TRP NE1  N  -68.934  -9.198 -100.359 1.00 . A A .  77 TRP NE1  1 1 
        1   1093 1 1  77 TRP O    O  -67.385 -12.244  -97.791 1.00 . A A .  77 TRP O    1 1 
        1   1094 1 1  78 LEU C    C  -69.048 -14.000  -96.197 1.00 . A A .  78 LEU C    1 1 
        1   1095 1 1  78 LEU CA   C  -69.802 -13.531  -97.416 1.00 . A A .  78 LEU CA   1 1 
        1   1096 1 1  78 LEU CB   C  -71.076 -14.379  -97.648 1.00 . A A .  78 LEU CB   1 1 
        1   1097 1 1  78 LEU CD1  C  -71.776 -14.464  -95.239 1.00 . A A .  78 LEU CD1  1 1 
        1   1098 1 1  78 LEU CD2  C  -72.917 -12.840  -96.708 1.00 . A A .  78 LEU CD2  1 1 
        1   1099 1 1  78 LEU CG   C  -72.271 -14.213  -96.629 1.00 . A A .  78 LEU CG   1 1 
        1   1100 1 1  78 LEU H    H  -69.173 -14.301  -99.291 1.00 . A A .  78 LEU H    1 1 
        1   1101 1 1  78 LEU HA   H  -70.052 -12.502  -97.315 1.00 . A A .  78 LEU HA   1 1 
        1   1102 1 1  78 LEU HB2  H  -71.460 -14.146  -98.592 1.00 . A A .  78 LEU HB2  1 1 
        1   1103 1 1  78 LEU HB3  H  -70.789 -15.407  -97.608 1.00 . A A .  78 LEU HB3  1 1 
        1   1104 1 1  78 LEU HD11 H  -72.615 -14.672  -94.599 1.00 . A A .  78 LEU HD11 1 1 
        1   1105 1 1  78 LEU HD12 H  -71.256 -13.588  -94.888 1.00 . A A .  78 LEU HD12 1 1 
        1   1106 1 1  78 LEU HD13 H  -71.105 -15.310  -95.245 1.00 . A A .  78 LEU HD13 1 1 
        1   1107 1 1  78 LEU HD21 H  -73.861 -12.868  -96.179 1.00 . A A .  78 LEU HD21 1 1 
        1   1108 1 1  78 LEU HD22 H  -73.088 -12.569  -97.735 1.00 . A A .  78 LEU HD22 1 1 
        1   1109 1 1  78 LEU HD23 H  -72.266 -12.120  -96.241 1.00 . A A .  78 LEU HD23 1 1 
        1   1110 1 1  78 LEU HG   H  -73.011 -14.969  -96.892 1.00 . A A .  78 LEU HG   1 1 
        1   1111 1 1  78 LEU N    N  -68.922 -13.695  -98.573 1.00 . A A .  78 LEU N    1 1 
        1   1112 1 1  78 LEU O    O  -69.007 -13.287  -95.200 1.00 . A A .  78 LEU O    1 1 
        1   1113 1 1  79 TYR C    C  -66.641 -14.887  -94.632 1.00 . A A .  79 TYR C    1 1 
        1   1114 1 1  79 TYR CA   C  -67.744 -15.799  -95.135 1.00 . A A .  79 TYR CA   1 1 
        1   1115 1 1  79 TYR CB   C  -67.162 -17.159  -95.542 1.00 . A A .  79 TYR CB   1 1 
        1   1116 1 1  79 TYR CD1  C  -66.641 -18.454  -93.422 1.00 . A A .  79 TYR CD1  1 1 
        1   1117 1 1  79 TYR CD2  C  -64.814 -17.469  -94.660 1.00 . A A .  79 TYR CD2  1 1 
        1   1118 1 1  79 TYR CE1  C  -65.735 -18.957  -92.490 1.00 . A A .  79 TYR CE1  1 1 
        1   1119 1 1  79 TYR CE2  C  -63.911 -17.974  -93.727 1.00 . A A .  79 TYR CE2  1 1 
        1   1120 1 1  79 TYR CG   C  -66.184 -17.705  -94.507 1.00 . A A .  79 TYR CG   1 1 
        1   1121 1 1  79 TYR CZ   C  -64.370 -18.717  -92.641 1.00 . A A .  79 TYR CZ   1 1 
        1   1122 1 1  79 TYR H    H  -68.585 -15.733  -97.091 1.00 . A A .  79 TYR H    1 1 
        1   1123 1 1  79 TYR HA   H  -68.451 -15.949  -94.347 1.00 . A A .  79 TYR HA   1 1 
        1   1124 1 1  79 TYR HB2  H  -67.971 -17.857  -95.655 1.00 . A A .  79 TYR HB2  1 1 
        1   1125 1 1  79 TYR HB3  H  -66.653 -17.046  -96.474 1.00 . A A .  79 TYR HB3  1 1 
        1   1126 1 1  79 TYR HD1  H  -67.689 -18.641  -93.298 1.00 . A A .  79 TYR HD1  1 1 
        1   1127 1 1  79 TYR HD2  H  -64.453 -16.902  -95.495 1.00 . A A .  79 TYR HD2  1 1 
        1   1128 1 1  79 TYR HE1  H  -66.095 -19.537  -91.651 1.00 . A A .  79 TYR HE1  1 1 
        1   1129 1 1  79 TYR HE2  H  -62.852 -17.784  -93.843 1.00 . A A .  79 TYR HE2  1 1 
        1   1130 1 1  79 TYR HH   H  -63.873 -19.138  -90.849 1.00 . A A .  79 TYR HH   1 1 
        1   1131 1 1  79 TYR N    N  -68.479 -15.213  -96.273 1.00 . A A .  79 TYR N    1 1 
        1   1132 1 1  79 TYR O    O  -66.631 -14.539  -93.460 1.00 . A A .  79 TYR O    1 1 
        1   1133 1 1  79 TYR OH   O  -63.475 -19.211  -91.719 1.00 . A A .  79 TYR OH   1 1 
        1   1134 1 1  80 SER C    C  -64.980 -12.268  -94.638 1.00 . A A .  80 SER C    1 1 
        1   1135 1 1  80 SER CA   C  -64.582 -13.675  -95.137 1.00 . A A .  80 SER CA   1 1 
        1   1136 1 1  80 SER CB   C  -63.587 -13.575  -96.302 1.00 . A A .  80 SER CB   1 1 
        1   1137 1 1  80 SER H    H  -65.757 -14.895  -96.415 1.00 . A A .  80 SER H    1 1 
        1   1138 1 1  80 SER HA   H  -64.076 -14.159  -94.328 1.00 . A A .  80 SER HA   1 1 
        1   1139 1 1  80 SER HB2  H  -62.861 -12.817  -96.077 1.00 . A A .  80 SER HB2  1 1 
        1   1140 1 1  80 SER HB3  H  -63.086 -14.528  -96.402 1.00 . A A .  80 SER HB3  1 1 
        1   1141 1 1  80 SER HG   H  -63.593 -13.371  -98.239 1.00 . A A .  80 SER HG   1 1 
        1   1142 1 1  80 SER N    N  -65.710 -14.538  -95.507 1.00 . A A .  80 SER N    1 1 
        1   1143 1 1  80 SER O    O  -64.334 -11.733  -93.728 1.00 . A A .  80 SER O    1 1 
        1   1144 1 1  80 SER OG   O  -64.232 -13.239  -97.527 1.00 . A A .  80 SER OG   1 1 
        1   1145 1 1  81 ALA C    C  -67.010 -10.527  -93.256 1.00 . A A .  81 ALA C    1 1 
        1   1146 1 1  81 ALA CA   C  -66.525 -10.404  -94.701 1.00 . A A .  81 ALA CA   1 1 
        1   1147 1 1  81 ALA CB   C  -67.661  -9.877  -95.584 1.00 . A A .  81 ALA CB   1 1 
        1   1148 1 1  81 ALA H    H  -66.565 -12.186  -95.851 1.00 . A A .  81 ALA H    1 1 
        1   1149 1 1  81 ALA HA   H  -65.716  -9.704  -94.729 1.00 . A A .  81 ALA HA   1 1 
        1   1150 1 1  81 ALA HB1  H  -68.577 -10.398  -95.354 1.00 . A A .  81 ALA HB1  1 1 
        1   1151 1 1  81 ALA HB2  H  -67.408 -10.032  -96.622 1.00 . A A .  81 ALA HB2  1 1 
        1   1152 1 1  81 ALA HB3  H  -67.793  -8.819  -95.401 1.00 . A A .  81 ALA HB3  1 1 
        1   1153 1 1  81 ALA N    N  -66.061 -11.708  -95.167 1.00 . A A .  81 ALA N    1 1 
        1   1154 1 1  81 ALA O    O  -66.621  -9.731  -92.396 1.00 . A A .  81 ALA O    1 1 
        1   1155 1 1  82 PHE C    C  -67.196 -12.178  -90.685 1.00 . A A .  82 PHE C    1 1 
        1   1156 1 1  82 PHE CA   C  -68.327 -11.825  -91.636 1.00 . A A .  82 PHE CA   1 1 
        1   1157 1 1  82 PHE CB   C  -69.330 -12.990  -91.688 1.00 . A A .  82 PHE CB   1 1 
        1   1158 1 1  82 PHE CD1  C  -70.206 -12.941  -89.323 1.00 . A A .  82 PHE CD1  1 1 
        1   1159 1 1  82 PHE CD2  C  -69.081 -14.932  -90.106 1.00 . A A .  82 PHE CD2  1 1 
        1   1160 1 1  82 PHE CE1  C  -70.407 -13.541  -88.086 1.00 . A A .  82 PHE CE1  1 1 
        1   1161 1 1  82 PHE CE2  C  -69.281 -15.532  -88.870 1.00 . A A .  82 PHE CE2  1 1 
        1   1162 1 1  82 PHE CG   C  -69.543 -13.634  -90.332 1.00 . A A .  82 PHE CG   1 1 
        1   1163 1 1  82 PHE CZ   C  -69.943 -14.837  -87.858 1.00 . A A .  82 PHE CZ   1 1 
        1   1164 1 1  82 PHE H    H  -68.047 -12.177  -93.714 1.00 . A A .  82 PHE H    1 1 
        1   1165 1 1  82 PHE HA   H  -68.838 -10.950  -91.273 1.00 . A A .  82 PHE HA   1 1 
        1   1166 1 1  82 PHE HB2  H  -70.274 -12.613  -92.027 1.00 . A A .  82 PHE HB2  1 1 
        1   1167 1 1  82 PHE HB3  H  -68.970 -13.731  -92.378 1.00 . A A .  82 PHE HB3  1 1 
        1   1168 1 1  82 PHE HD1  H  -70.567 -11.946  -89.497 1.00 . A A .  82 PHE HD1  1 1 
        1   1169 1 1  82 PHE HD2  H  -68.573 -15.470  -90.886 1.00 . A A .  82 PHE HD2  1 1 
        1   1170 1 1  82 PHE HE1  H  -70.922 -12.999  -87.305 1.00 . A A .  82 PHE HE1  1 1 
        1   1171 1 1  82 PHE HE2  H  -68.923 -16.536  -88.696 1.00 . A A .  82 PHE HE2  1 1 
        1   1172 1 1  82 PHE HZ   H  -70.093 -15.301  -86.898 1.00 . A A .  82 PHE HZ   1 1 
        1   1173 1 1  82 PHE N    N  -67.814 -11.565  -92.990 1.00 . A A .  82 PHE N    1 1 
        1   1174 1 1  82 PHE O    O  -67.017 -11.524  -89.664 1.00 . A A .  82 PHE O    1 1 
        1   1175 1 1  83 ARG C    C  -64.441 -12.365  -89.897 1.00 . A A .  83 ARG C    1 1 
        1   1176 1 1  83 ARG CA   C  -65.254 -13.599  -90.285 1.00 . A A .  83 ARG CA   1 1 
        1   1177 1 1  83 ARG CB   C  -64.391 -14.598  -91.098 1.00 . A A .  83 ARG CB   1 1 
        1   1178 1 1  83 ARG CD   C  -63.050 -15.813  -89.305 1.00 . A A .  83 ARG CD   1 1 
        1   1179 1 1  83 ARG CG   C  -64.204 -15.946  -90.370 1.00 . A A .  83 ARG CG   1 1 
        1   1180 1 1  83 ARG CZ   C  -61.808 -17.601  -88.118 1.00 . A A .  83 ARG CZ   1 1 
        1   1181 1 1  83 ARG H    H  -66.567 -13.600  -91.937 1.00 . A A .  83 ARG H    1 1 
        1   1182 1 1  83 ARG HA   H  -65.594 -14.073  -89.396 1.00 . A A .  83 ARG HA   1 1 
        1   1183 1 1  83 ARG HB2  H  -64.873 -14.794  -92.034 1.00 . A A .  83 ARG HB2  1 1 
        1   1184 1 1  83 ARG HB3  H  -63.425 -14.164  -91.278 1.00 . A A .  83 ARG HB3  1 1 
        1   1185 1 1  83 ARG HD2  H  -62.126 -15.690  -89.821 1.00 . A A .  83 ARG HD2  1 1 
        1   1186 1 1  83 ARG HD3  H  -63.255 -14.944  -88.709 1.00 . A A .  83 ARG HD3  1 1 
        1   1187 1 1  83 ARG HE   H  -63.790 -17.341  -88.052 1.00 . A A .  83 ARG HE   1 1 
        1   1188 1 1  83 ARG HG2  H  -65.116 -16.226  -89.884 1.00 . A A .  83 ARG HG2  1 1 
        1   1189 1 1  83 ARG HG3  H  -63.925 -16.694  -91.093 1.00 . A A .  83 ARG HG3  1 1 
        1   1190 1 1  83 ARG HH11 H  -60.618 -16.408  -89.239 1.00 . A A .  83 ARG HH11 1 1 
        1   1191 1 1  83 ARG HH12 H  -59.804 -17.660  -88.362 1.00 . A A .  83 ARG HH12 1 1 
        1   1192 1 1  83 ARG HH21 H  -62.709 -18.975  -86.932 1.00 . A A .  83 ARG HH21 1 1 
        1   1193 1 1  83 ARG HH22 H  -60.987 -19.111  -87.059 1.00 . A A .  83 ARG HH22 1 1 
        1   1194 1 1  83 ARG N    N  -66.393 -13.168  -91.083 1.00 . A A .  83 ARG N    1 1 
        1   1195 1 1  83 ARG NE   N  -62.973 -16.993  -88.434 1.00 . A A .  83 ARG NE   1 1 
        1   1196 1 1  83 ARG NH1  N  -60.654 -17.187  -88.613 1.00 . A A .  83 ARG NH1  1 1 
        1   1197 1 1  83 ARG NH2  N  -61.837 -18.643  -87.304 1.00 . A A .  83 ARG NH2  1 1 
        1   1198 1 1  83 ARG O    O  -63.950 -12.267  -88.778 1.00 . A A .  83 ARG O    1 1 
        1   1199 1 1  84 GLY C    C  -64.280  -9.403  -89.365 1.00 . A A .  84 GLY C    1 1 
        1   1200 1 1  84 GLY CA   C  -63.608 -10.185  -90.487 1.00 . A A .  84 GLY CA   1 1 
        1   1201 1 1  84 GLY H    H  -64.791 -11.488  -91.663 1.00 . A A .  84 GLY H    1 1 
        1   1202 1 1  84 GLY HA2  H  -62.606 -10.443  -90.179 1.00 . A A .  84 GLY HA2  1 1 
        1   1203 1 1  84 GLY HA3  H  -63.559  -9.568  -91.370 1.00 . A A .  84 GLY HA3  1 1 
        1   1204 1 1  84 GLY N    N  -64.343 -11.399  -90.797 1.00 . A A .  84 GLY N    1 1 
        1   1205 1 1  84 GLY O    O  -63.600  -8.889  -88.477 1.00 . A A .  84 GLY O    1 1 
        1   1206 1 1  85 VAL C    C  -66.132  -9.101  -87.021 1.00 . A A .  85 VAL C    1 1 
        1   1207 1 1  85 VAL CA   C  -66.341  -8.530  -88.413 1.00 . A A .  85 VAL CA   1 1 
        1   1208 1 1  85 VAL CB   C  -67.848  -8.400  -88.769 1.00 . A A .  85 VAL CB   1 1 
        1   1209 1 1  85 VAL CG1  C  -68.698  -9.425  -88.015 1.00 . A A .  85 VAL CG1  1 1 
        1   1210 1 1  85 VAL CG2  C  -68.321  -6.990  -88.419 1.00 . A A .  85 VAL CG2  1 1 
        1   1211 1 1  85 VAL H    H  -66.094  -9.721  -90.158 1.00 . A A .  85 VAL H    1 1 
        1   1212 1 1  85 VAL HA   H  -65.920  -7.543  -88.414 1.00 . A A .  85 VAL HA   1 1 
        1   1213 1 1  85 VAL HB   H  -67.974  -8.552  -89.824 1.00 . A A .  85 VAL HB   1 1 
        1   1214 1 1  85 VAL HG11 H  -68.238 -10.395  -88.096 1.00 . A A .  85 VAL HG11 1 1 
        1   1215 1 1  85 VAL HG12 H  -69.686  -9.458  -88.447 1.00 . A A .  85 VAL HG12 1 1 
        1   1216 1 1  85 VAL HG13 H  -68.769  -9.145  -86.974 1.00 . A A .  85 VAL HG13 1 1 
        1   1217 1 1  85 VAL HG21 H  -68.000  -6.741  -87.420 1.00 . A A .  85 VAL HG21 1 1 
        1   1218 1 1  85 VAL HG22 H  -69.394  -6.948  -88.480 1.00 . A A .  85 VAL HG22 1 1 
        1   1219 1 1  85 VAL HG23 H  -67.889  -6.290  -89.121 1.00 . A A .  85 VAL HG23 1 1 
        1   1220 1 1  85 VAL N    N  -65.612  -9.297  -89.423 1.00 . A A .  85 VAL N    1 1 
        1   1221 1 1  85 VAL O    O  -65.874  -8.341  -86.096 1.00 . A A .  85 VAL O    1 1 
        1   1222 1 1  86 GLN C    C  -64.741 -10.823  -84.908 1.00 . A A .  86 GLN C    1 1 
        1   1223 1 1  86 GLN CA   C  -66.111 -11.074  -85.563 1.00 . A A .  86 GLN CA   1 1 
        1   1224 1 1  86 GLN CB   C  -66.473 -12.582  -85.608 1.00 . A A .  86 GLN CB   1 1 
        1   1225 1 1  86 GLN CD   C  -66.387 -14.723  -87.020 1.00 . A A .  86 GLN CD   1 1 
        1   1226 1 1  86 GLN CG   C  -65.688 -13.400  -86.698 1.00 . A A .  86 GLN CG   1 1 
        1   1227 1 1  86 GLN H    H  -66.503 -10.966  -87.654 1.00 . A A .  86 GLN H    1 1 
        1   1228 1 1  86 GLN HA   H  -66.844 -10.621  -84.920 1.00 . A A .  86 GLN HA   1 1 
        1   1229 1 1  86 GLN HB2  H  -66.253 -13.014  -84.662 1.00 . A A .  86 GLN HB2  1 1 
        1   1230 1 1  86 GLN HB3  H  -67.516 -12.672  -85.821 1.00 . A A .  86 GLN HB3  1 1 
        1   1231 1 1  86 GLN HE21 H  -64.713 -15.459  -87.819 1.00 . A A .  86 GLN HE21 1 1 
        1   1232 1 1  86 GLN HE22 H  -66.046 -16.509  -87.866 1.00 . A A .  86 GLN HE22 1 1 
        1   1233 1 1  86 GLN HG2  H  -65.646 -12.818  -87.575 1.00 . A A .  86 GLN HG2  1 1 
        1   1234 1 1  86 GLN HG3  H  -64.700 -13.607  -86.328 1.00 . A A .  86 GLN HG3  1 1 
        1   1235 1 1  86 GLN N    N  -66.269 -10.426  -86.875 1.00 . A A .  86 GLN N    1 1 
        1   1236 1 1  86 GLN NE2  N  -65.662 -15.648  -87.616 1.00 . A A .  86 GLN NE2  1 1 
        1   1237 1 1  86 GLN O    O  -64.684 -10.373  -83.746 1.00 . A A .  86 GLN O    1 1 
        1   1238 1 1  86 GLN OE1  O  -67.589 -14.913  -86.746 1.00 . A A .  86 GLN OE1  1 1 
        1   1239 1 1  87 LEU C    C  -62.071  -9.192  -85.000 1.00 . A A .  87 LEU C    1 1 
        1   1240 1 1  87 LEU CA   C  -62.310 -10.722  -85.205 1.00 . A A .  87 LEU CA   1 1 
        1   1241 1 1  87 LEU CB   C  -61.226 -11.283  -86.150 1.00 . A A .  87 LEU CB   1 1 
        1   1242 1 1  87 LEU CD1  C  -59.979 -13.269  -87.018 1.00 . A A .  87 LEU CD1  1 1 
        1   1243 1 1  87 LEU CD2  C  -61.714 -13.646  -85.245 1.00 . A A .  87 LEU CD2  1 1 
        1   1244 1 1  87 LEU CG   C  -61.334 -12.800  -86.466 1.00 . A A .  87 LEU CG   1 1 
        1   1245 1 1  87 LEU H    H  -63.803 -11.268  -86.615 1.00 . A A .  87 LEU H    1 1 
        1   1246 1 1  87 LEU HA   H  -62.184 -11.176  -84.252 1.00 . A A .  87 LEU HA   1 1 
        1   1247 1 1  87 LEU HB2  H  -61.284 -10.766  -87.082 1.00 . A A .  87 LEU HB2  1 1 
        1   1248 1 1  87 LEU HB3  H  -60.273 -11.096  -85.700 1.00 . A A .  87 LEU HB3  1 1 
        1   1249 1 1  87 LEU HD11 H  -59.614 -12.543  -87.735 1.00 . A A .  87 LEU HD11 1 1 
        1   1250 1 1  87 LEU HD12 H  -60.105 -14.221  -87.506 1.00 . A A .  87 LEU HD12 1 1 
        1   1251 1 1  87 LEU HD13 H  -59.269 -13.363  -86.212 1.00 . A A .  87 LEU HD13 1 1 
        1   1252 1 1  87 LEU HD21 H  -62.716 -13.391  -84.936 1.00 . A A .  87 LEU HD21 1 1 
        1   1253 1 1  87 LEU HD22 H  -61.026 -13.467  -84.438 1.00 . A A .  87 LEU HD22 1 1 
        1   1254 1 1  87 LEU HD23 H  -61.684 -14.697  -85.517 1.00 . A A .  87 LEU HD23 1 1 
        1   1255 1 1  87 LEU HG   H  -62.067 -12.935  -87.237 1.00 . A A .  87 LEU HG   1 1 
        1   1256 1 1  87 LEU N    N  -63.667 -10.997  -85.687 1.00 . A A .  87 LEU N    1 1 
        1   1257 1 1  87 LEU O    O  -61.527  -8.798  -83.965 1.00 . A A .  87 LEU O    1 1 
        1   1258 1 1  88 THR C    C  -63.161  -6.330  -84.606 1.00 . A A .  88 THR C    1 1 
        1   1259 1 1  88 THR CA   C  -62.341  -6.859  -85.766 1.00 . A A .  88 THR CA   1 1 
        1   1260 1 1  88 THR CB   C  -62.707  -6.046  -87.020 1.00 . A A .  88 THR CB   1 1 
        1   1261 1 1  88 THR CG2  C  -64.183  -5.594  -86.991 1.00 . A A .  88 THR CG2  1 1 
        1   1262 1 1  88 THR H    H  -62.960  -8.678  -86.733 1.00 . A A .  88 THR H    1 1 
        1   1263 1 1  88 THR HA   H  -61.304  -6.683  -85.539 1.00 . A A .  88 THR HA   1 1 
        1   1264 1 1  88 THR HB   H  -62.558  -6.648  -87.884 1.00 . A A .  88 THR HB   1 1 
        1   1265 1 1  88 THR HG1  H  -60.952  -5.191  -86.925 1.00 . A A .  88 THR HG1  1 1 
        1   1266 1 1  88 THR HG21 H  -64.800  -6.425  -86.690 1.00 . A A .  88 THR HG21 1 1 
        1   1267 1 1  88 THR HG22 H  -64.472  -5.274  -87.979 1.00 . A A .  88 THR HG22 1 1 
        1   1268 1 1  88 THR HG23 H  -64.308  -4.779  -86.295 1.00 . A A .  88 THR HG23 1 1 
        1   1269 1 1  88 THR N    N  -62.512  -8.331  -85.940 1.00 . A A .  88 THR N    1 1 
        1   1270 1 1  88 THR O    O  -62.719  -5.422  -83.917 1.00 . A A .  88 THR O    1 1 
        1   1271 1 1  88 THR OG1  O  -61.852  -4.898  -87.104 1.00 . A A .  88 THR OG1  1 1 
        1   1272 1 1  89 TYR C    C  -64.594  -6.587  -81.976 1.00 . A A .  89 TYR C    1 1 
        1   1273 1 1  89 TYR CA   C  -65.247  -6.393  -83.351 1.00 . A A .  89 TYR CA   1 1 
        1   1274 1 1  89 TYR CB   C  -66.561  -7.167  -83.424 1.00 . A A .  89 TYR CB   1 1 
        1   1275 1 1  89 TYR CD1  C  -68.170  -5.948  -81.901 1.00 . A A .  89 TYR CD1  1 1 
        1   1276 1 1  89 TYR CD2  C  -67.338  -8.113  -81.217 1.00 . A A .  89 TYR CD2  1 1 
        1   1277 1 1  89 TYR CE1  C  -68.936  -5.872  -80.730 1.00 . A A .  89 TYR CE1  1 1 
        1   1278 1 1  89 TYR CE2  C  -68.101  -8.038  -80.046 1.00 . A A .  89 TYR CE2  1 1 
        1   1279 1 1  89 TYR CG   C  -67.372  -7.064  -82.143 1.00 . A A .  89 TYR CG   1 1 
        1   1280 1 1  89 TYR CZ   C  -68.901  -6.916  -79.799 1.00 . A A .  89 TYR CZ   1 1 
        1   1281 1 1  89 TYR H    H  -64.692  -7.531  -85.061 1.00 . A A .  89 TYR H    1 1 
        1   1282 1 1  89 TYR HA   H  -65.444  -5.355  -83.496 1.00 . A A .  89 TYR HA   1 1 
        1   1283 1 1  89 TYR HB2  H  -67.148  -6.765  -84.229 1.00 . A A .  89 TYR HB2  1 1 
        1   1284 1 1  89 TYR HB3  H  -66.347  -8.199  -83.619 1.00 . A A .  89 TYR HB3  1 1 
        1   1285 1 1  89 TYR HD1  H  -68.199  -5.145  -82.612 1.00 . A A .  89 TYR HD1  1 1 
        1   1286 1 1  89 TYR HD2  H  -66.725  -8.975  -81.400 1.00 . A A .  89 TYR HD2  1 1 
        1   1287 1 1  89 TYR HE1  H  -69.551  -5.000  -80.544 1.00 . A A .  89 TYR HE1  1 1 
        1   1288 1 1  89 TYR HE2  H  -68.070  -8.850  -79.332 1.00 . A A .  89 TYR HE2  1 1 
        1   1289 1 1  89 TYR HH   H  -69.082  -6.506  -77.942 1.00 . A A .  89 TYR HH   1 1 
        1   1290 1 1  89 TYR N    N  -64.369  -6.851  -84.435 1.00 . A A .  89 TYR N    1 1 
        1   1291 1 1  89 TYR O    O  -64.527  -5.636  -81.185 1.00 . A A .  89 TYR O    1 1 
        1   1292 1 1  89 TYR OH   O  -69.651  -6.839  -78.642 1.00 . A A .  89 TYR OH   1 1 
        1   1293 1 1  90 GLU C    C  -62.281  -7.085  -80.256 1.00 . A A .  90 GLU C    1 1 
        1   1294 1 1  90 GLU CA   C  -63.428  -8.058  -80.430 1.00 . A A .  90 GLU CA   1 1 
        1   1295 1 1  90 GLU CB   C  -62.943  -9.518  -80.279 1.00 . A A .  90 GLU CB   1 1 
        1   1296 1 1  90 GLU CD   C  -61.901 -11.591  -81.264 1.00 . A A .  90 GLU CD   1 1 
        1   1297 1 1  90 GLU CG   C  -62.230 -10.094  -81.505 1.00 . A A .  90 GLU CG   1 1 
        1   1298 1 1  90 GLU H    H  -64.182  -8.518  -82.363 1.00 . A A .  90 GLU H    1 1 
        1   1299 1 1  90 GLU HA   H  -64.130  -7.869  -79.632 1.00 . A A .  90 GLU HA   1 1 
        1   1300 1 1  90 GLU HB2  H  -62.262  -9.560  -79.459 1.00 . A A .  90 GLU HB2  1 1 
        1   1301 1 1  90 GLU HB3  H  -63.799 -10.124  -80.065 1.00 . A A .  90 GLU HB3  1 1 
        1   1302 1 1  90 GLU HG2  H  -62.867 -10.012  -82.360 1.00 . A A .  90 GLU HG2  1 1 
        1   1303 1 1  90 GLU HG3  H  -61.315  -9.559  -81.669 1.00 . A A .  90 GLU HG3  1 1 
        1   1304 1 1  90 GLU N    N  -64.095  -7.800  -81.703 1.00 . A A .  90 GLU N    1 1 
        1   1305 1 1  90 GLU O    O  -62.099  -6.529  -79.178 1.00 . A A .  90 GLU O    1 1 
        1   1306 1 1  90 GLU OE1  O  -61.469 -11.927  -80.148 1.00 . A A .  90 GLU OE1  1 1 
        1   1307 1 1  90 GLU OE2  O  -62.090 -12.379  -82.209 1.00 . A A .  90 GLU OE2  1 1 
        1   1308 1 1  91 HIS C    C  -61.029  -4.437  -80.920 1.00 . A A .  91 HIS C    1 1 
        1   1309 1 1  91 HIS CA   C  -60.501  -5.826  -81.301 1.00 . A A .  91 HIS CA   1 1 
        1   1310 1 1  91 HIS CB   C  -59.811  -5.756  -82.658 1.00 . A A .  91 HIS CB   1 1 
        1   1311 1 1  91 HIS CD2  C  -57.766  -4.613  -81.526 1.00 . A A .  91 HIS CD2  1 1 
        1   1312 1 1  91 HIS CE1  C  -56.703  -4.039  -83.327 1.00 . A A .  91 HIS CE1  1 1 
        1   1313 1 1  91 HIS CG   C  -58.509  -5.028  -82.567 1.00 . A A .  91 HIS CG   1 1 
        1   1314 1 1  91 HIS H    H  -61.814  -7.238  -82.191 1.00 . A A .  91 HIS H    1 1 
        1   1315 1 1  91 HIS HA   H  -59.794  -6.132  -80.567 1.00 . A A .  91 HIS HA   1 1 
        1   1316 1 1  91 HIS HB2  H  -59.616  -6.751  -82.997 1.00 . A A .  91 HIS HB2  1 1 
        1   1317 1 1  91 HIS HB3  H  -60.450  -5.249  -83.355 1.00 . A A .  91 HIS HB3  1 1 
        1   1318 1 1  91 HIS HD1  H  -58.079  -4.824  -84.627 1.00 . A A .  91 HIS HD1  1 1 
        1   1319 1 1  91 HIS HD2  H  -58.006  -4.759  -80.474 1.00 . A A .  91 HIS HD2  1 1 
        1   1320 1 1  91 HIS HE1  H  -55.953  -3.621  -84.005 1.00 . A A .  91 HIS HE1  1 1 
        1   1321 1 1  91 HIS HE2  H  -55.928  -3.598  -81.480 1.00 . A A .  91 HIS HE2  1 1 
        1   1322 1 1  91 HIS N    N  -61.581  -6.806  -81.342 1.00 . A A .  91 HIS N    1 1 
        1   1323 1 1  91 HIS ND1  N  -57.811  -4.651  -83.715 1.00 . A A .  91 HIS ND1  1 1 
        1   1324 1 1  91 HIS NE2  N  -56.624  -3.989  -82.002 1.00 . A A .  91 HIS NE2  1 1 
        1   1325 1 1  91 HIS O    O  -60.337  -3.695  -80.218 1.00 . A A .  91 HIS O    1 1 
        1   1326 1 1  92 THR C    C  -63.151  -2.779  -79.599 1.00 . A A .  92 THR C    1 1 
        1   1327 1 1  92 THR CA   C  -62.785  -2.772  -81.062 1.00 . A A .  92 THR CA   1 1 
        1   1328 1 1  92 THR CB   C  -63.997  -2.431  -81.959 1.00 . A A .  92 THR CB   1 1 
        1   1329 1 1  92 THR CG2  C  -64.473  -1.000  -81.716 1.00 . A A .  92 THR CG2  1 1 
        1   1330 1 1  92 THR H    H  -62.730  -4.694  -81.954 1.00 . A A .  92 THR H    1 1 
        1   1331 1 1  92 THR HA   H  -62.026  -2.025  -81.216 1.00 . A A .  92 THR HA   1 1 
        1   1332 1 1  92 THR HB   H  -64.807  -3.111  -81.755 1.00 . A A .  92 THR HB   1 1 
        1   1333 1 1  92 THR HG1  H  -63.104  -3.354  -83.420 1.00 . A A .  92 THR HG1  1 1 
        1   1334 1 1  92 THR HG21 H  -63.830  -0.315  -82.248 1.00 . A A .  92 THR HG21 1 1 
        1   1335 1 1  92 THR HG22 H  -64.445  -0.783  -80.662 1.00 . A A .  92 THR HG22 1 1 
        1   1336 1 1  92 THR HG23 H  -65.486  -0.897  -82.082 1.00 . A A .  92 THR HG23 1 1 
        1   1337 1 1  92 THR N    N  -62.227  -4.077  -81.393 1.00 . A A .  92 THR N    1 1 
        1   1338 1 1  92 THR O    O  -62.784  -1.868  -78.863 1.00 . A A .  92 THR O    1 1 
        1   1339 1 1  92 THR OG1  O  -63.603  -2.542  -83.321 1.00 . A A .  92 THR OG1  1 1 
        1   1340 1 1  93 MET C    C  -62.934  -3.970  -76.847 1.00 . A A .  93 MET C    1 1 
        1   1341 1 1  93 MET CA   C  -64.174  -4.058  -77.792 1.00 . A A .  93 MET CA   1 1 
        1   1342 1 1  93 MET CB   C  -64.833  -5.467  -77.595 1.00 . A A .  93 MET CB   1 1 
        1   1343 1 1  93 MET CE   C  -67.576  -4.171  -76.341 1.00 . A A .  93 MET CE   1 1 
        1   1344 1 1  93 MET CG   C  -66.173  -5.547  -78.365 1.00 . A A .  93 MET CG   1 1 
        1   1345 1 1  93 MET H    H  -63.959  -4.590  -79.815 1.00 . A A .  93 MET H    1 1 
        1   1346 1 1  93 MET HA   H  -64.859  -3.312  -77.492 1.00 . A A .  93 MET HA   1 1 
        1   1347 1 1  93 MET HB2  H  -64.179  -6.214  -77.977 1.00 . A A .  93 MET HB2  1 1 
        1   1348 1 1  93 MET HB3  H  -65.023  -5.616  -76.561 1.00 . A A .  93 MET HB3  1 1 
        1   1349 1 1  93 MET HE1  H  -68.142  -3.288  -76.058 1.00 . A A .  93 MET HE1  1 1 
        1   1350 1 1  93 MET HE2  H  -66.688  -4.232  -75.739 1.00 . A A .  93 MET HE2  1 1 
        1   1351 1 1  93 MET HE3  H  -68.180  -5.051  -76.193 1.00 . A A .  93 MET HE3  1 1 
        1   1352 1 1  93 MET HG2  H  -65.968  -5.667  -79.415 1.00 . A A .  93 MET HG2  1 1 
        1   1353 1 1  93 MET HG3  H  -66.714  -6.403  -77.998 1.00 . A A .  93 MET HG3  1 1 
        1   1354 1 1  93 MET N    N  -63.783  -3.877  -79.177 1.00 . A A .  93 MET N    1 1 
        1   1355 1 1  93 MET O    O  -63.008  -3.305  -75.822 1.00 . A A .  93 MET O    1 1 
        1   1356 1 1  93 MET SD   S  -67.129  -4.033  -78.090 1.00 . A A .  93 MET SD   1 1 
        1   1357 1 1  94 LEU C    C  -60.081  -3.214  -76.179 1.00 . A A .  94 LEU C    1 1 
        1   1358 1 1  94 LEU CA   C  -60.641  -4.630  -76.447 1.00 . A A .  94 LEU CA   1 1 
        1   1359 1 1  94 LEU CB   C  -59.579  -5.464  -77.171 1.00 . A A .  94 LEU CB   1 1 
        1   1360 1 1  94 LEU CD1  C  -60.778  -7.671  -76.957 1.00 . A A .  94 LEU CD1  1 1 
        1   1361 1 1  94 LEU CD2  C  -58.273  -7.634  -77.313 1.00 . A A .  94 LEU CD2  1 1 
        1   1362 1 1  94 LEU CG   C  -59.487  -6.917  -76.659 1.00 . A A .  94 LEU CG   1 1 
        1   1363 1 1  94 LEU H    H  -61.888  -5.161  -78.055 1.00 . A A .  94 LEU H    1 1 
        1   1364 1 1  94 LEU HA   H  -60.857  -5.081  -75.505 1.00 . A A .  94 LEU HA   1 1 
        1   1365 1 1  94 LEU HB2  H  -59.828  -5.490  -78.208 1.00 . A A .  94 LEU HB2  1 1 
        1   1366 1 1  94 LEU HB3  H  -58.631  -4.997  -77.034 1.00 . A A .  94 LEU HB3  1 1 
        1   1367 1 1  94 LEU HD11 H  -61.617  -7.001  -76.826 1.00 . A A .  94 LEU HD11 1 1 
        1   1368 1 1  94 LEU HD12 H  -60.869  -8.496  -76.265 1.00 . A A .  94 LEU HD12 1 1 
        1   1369 1 1  94 LEU HD13 H  -60.769  -8.045  -77.967 1.00 . A A .  94 LEU HD13 1 1 
        1   1370 1 1  94 LEU HD21 H  -58.378  -8.703  -77.189 1.00 . A A .  94 LEU HD21 1 1 
        1   1371 1 1  94 LEU HD22 H  -57.361  -7.310  -76.823 1.00 . A A .  94 LEU HD22 1 1 
        1   1372 1 1  94 LEU HD23 H  -58.216  -7.396  -78.363 1.00 . A A .  94 LEU HD23 1 1 
        1   1373 1 1  94 LEU HG   H  -59.336  -6.898  -75.604 1.00 . A A .  94 LEU HG   1 1 
        1   1374 1 1  94 LEU N    N  -61.865  -4.637  -77.228 1.00 . A A .  94 LEU N    1 1 
        1   1375 1 1  94 LEU O    O  -59.168  -3.083  -75.378 1.00 . A A .  94 LEU O    1 1 
        1   1376 1 1  95 GLN C    C  -61.341  -0.089  -75.629 1.00 . A A .  95 GLN C    1 1 
        1   1377 1 1  95 GLN CA   C  -60.277  -0.784  -76.478 1.00 . A A .  95 GLN CA   1 1 
        1   1378 1 1  95 GLN CB   C  -60.099   0.073  -77.716 1.00 . A A .  95 GLN CB   1 1 
        1   1379 1 1  95 GLN CD   C  -58.527  -1.618  -78.550 1.00 . A A .  95 GLN CD   1 1 
        1   1380 1 1  95 GLN CG   C  -59.669  -0.731  -78.908 1.00 . A A .  95 GLN CG   1 1 
        1   1381 1 1  95 GLN H    H  -61.454  -2.340  -77.325 1.00 . A A .  95 GLN H    1 1 
        1   1382 1 1  95 GLN HA   H  -59.364  -0.789  -75.921 1.00 . A A .  95 GLN HA   1 1 
        1   1383 1 1  95 GLN HB2  H  -61.029   0.553  -77.959 1.00 . A A .  95 GLN HB2  1 1 
        1   1384 1 1  95 GLN HB3  H  -59.354   0.821  -77.507 1.00 . A A .  95 GLN HB3  1 1 
        1   1385 1 1  95 GLN HE21 H  -57.249  -0.097  -78.566 1.00 . A A .  95 GLN HE21 1 1 
        1   1386 1 1  95 GLN HE22 H  -56.568  -1.608  -78.198 1.00 . A A .  95 GLN HE22 1 1 
        1   1387 1 1  95 GLN HG2  H  -60.490  -1.315  -79.260 1.00 . A A .  95 GLN HG2  1 1 
        1   1388 1 1  95 GLN HG3  H  -59.344  -0.045  -79.678 1.00 . A A .  95 GLN HG3  1 1 
        1   1389 1 1  95 GLN N    N  -60.693  -2.174  -76.755 1.00 . A A .  95 GLN N    1 1 
        1   1390 1 1  95 GLN NE2  N  -57.348  -1.070  -78.424 1.00 . A A .  95 GLN NE2  1 1 
        1   1391 1 1  95 GLN O    O  -61.042   0.452  -74.574 1.00 . A A .  95 GLN O    1 1 
        1   1392 1 1  95 GLN OE1  O  -58.714  -2.830  -78.384 1.00 . A A .  95 GLN OE1  1 1 
        1   1393 1 1  96 LEU C    C  -64.037  -0.392  -74.174 1.00 . A A .  96 LEU C    1 1 
        1   1394 1 1  96 LEU CA   C  -63.672   0.514  -75.364 1.00 . A A .  96 LEU CA   1 1 
        1   1395 1 1  96 LEU CB   C  -64.899   0.685  -76.279 1.00 . A A .  96 LEU CB   1 1 
        1   1396 1 1  96 LEU CD1  C  -63.487   1.974  -77.870 1.00 . A A .  96 LEU CD1  1 1 
        1   1397 1 1  96 LEU CD2  C  -66.024   1.963  -78.129 1.00 . A A .  96 LEU CD2  1 1 
        1   1398 1 1  96 LEU CG   C  -64.826   1.946  -77.144 1.00 . A A .  96 LEU CG   1 1 
        1   1399 1 1  96 LEU H    H  -62.760  -0.549  -76.961 1.00 . A A .  96 LEU H    1 1 
        1   1400 1 1  96 LEU HA   H  -63.360   1.465  -74.976 1.00 . A A .  96 LEU HA   1 1 
        1   1401 1 1  96 LEU HB2  H  -64.963  -0.166  -76.918 1.00 . A A .  96 LEU HB2  1 1 
        1   1402 1 1  96 LEU HB3  H  -65.772   0.746  -75.663 1.00 . A A .  96 LEU HB3  1 1 
        1   1403 1 1  96 LEU HD11 H  -62.706   2.135  -77.134 1.00 . A A .  96 LEU HD11 1 1 
        1   1404 1 1  96 LEU HD12 H  -63.474   2.778  -78.585 1.00 . A A .  96 LEU HD12 1 1 
        1   1405 1 1  96 LEU HD13 H  -63.316   1.035  -78.369 1.00 . A A .  96 LEU HD13 1 1 
        1   1406 1 1  96 LEU HD21 H  -66.088   2.936  -78.599 1.00 . A A .  96 LEU HD21 1 1 
        1   1407 1 1  96 LEU HD22 H  -66.941   1.779  -77.577 1.00 . A A .  96 LEU HD22 1 1 
        1   1408 1 1  96 LEU HD23 H  -65.901   1.205  -78.881 1.00 . A A .  96 LEU HD23 1 1 
        1   1409 1 1  96 LEU HG   H  -64.897   2.807  -76.516 1.00 . A A .  96 LEU HG   1 1 
        1   1410 1 1  96 LEU N    N  -62.578  -0.111  -76.101 1.00 . A A .  96 LEU N    1 1 
        1   1411 1 1  96 LEU O    O  -65.105  -0.260  -73.561 1.00 . A A .  96 LEU O    1 1 
        1   1412 1 1  97 TYR C    C  -62.100  -3.240  -72.979 1.00 . A A .  97 TYR C    1 1 
        1   1413 1 1  97 TYR CA   C  -63.359  -2.380  -72.932 1.00 . A A .  97 TYR CA   1 1 
        1   1414 1 1  97 TYR CB   C  -64.578  -3.252  -73.364 1.00 . A A .  97 TYR CB   1 1 
        1   1415 1 1  97 TYR CD1  C  -65.567  -3.531  -71.000 1.00 . A A .  97 TYR CD1  1 1 
        1   1416 1 1  97 TYR CD2  C  -67.097  -3.175  -72.874 1.00 . A A .  97 TYR CD2  1 1 
        1   1417 1 1  97 TYR CE1  C  -66.668  -3.592  -70.121 1.00 . A A .  97 TYR CE1  1 1 
        1   1418 1 1  97 TYR CE2  C  -68.198  -3.241  -71.994 1.00 . A A .  97 TYR CE2  1 1 
        1   1419 1 1  97 TYR CG   C  -65.768  -3.321  -72.376 1.00 . A A .  97 TYR CG   1 1 
        1   1420 1 1  97 TYR CZ   C  -67.984  -3.440  -70.615 1.00 . A A .  97 TYR CZ   1 1 
        1   1421 1 1  97 TYR H    H  -62.411  -1.465  -74.554 1.00 . A A .  97 TYR H    1 1 
        1   1422 1 1  97 TYR HA   H  -63.498  -1.952  -71.961 1.00 . A A .  97 TYR HA   1 1 
        1   1423 1 1  97 TYR HB2  H  -64.951  -2.847  -74.281 1.00 . A A .  97 TYR HB2  1 1 
        1   1424 1 1  97 TYR HB3  H  -64.226  -4.249  -73.551 1.00 . A A .  97 TYR HB3  1 1 
        1   1425 1 1  97 TYR HD1  H  -64.572  -3.645  -70.614 1.00 . A A .  97 TYR HD1  1 1 
        1   1426 1 1  97 TYR HD2  H  -67.266  -3.020  -73.924 1.00 . A A .  97 TYR HD2  1 1 
        1   1427 1 1  97 TYR HE1  H  -66.496  -3.743  -69.059 1.00 . A A .  97 TYR HE1  1 1 
        1   1428 1 1  97 TYR HE2  H  -69.210  -3.117  -72.378 1.00 . A A .  97 TYR HE2  1 1 
        1   1429 1 1  97 TYR HH   H  -68.824  -4.032  -68.997 1.00 . A A .  97 TYR HH   1 1 
        1   1430 1 1  97 TYR N    N  -63.179  -1.377  -73.960 1.00 . A A .  97 TYR N    1 1 
        1   1431 1 1  97 TYR O    O  -62.106  -4.272  -73.681 1.00 . A A .  97 TYR O    1 1 
        1   1432 1 1  97 TYR OH   O  -69.063  -3.488  -69.749 1.00 . A A .  97 TYR OH   1 1 
        1   1433 1 1  98 PRO C    C  -59.848  -4.784  -71.337 1.00 . A A .  98 PRO C    1 1 
        1   1434 1 1  98 PRO CA   C  -59.801  -3.725  -72.410 1.00 . A A .  98 PRO CA   1 1 
        1   1435 1 1  98 PRO CB   C  -58.651  -2.758  -72.171 1.00 . A A .  98 PRO CB   1 1 
        1   1436 1 1  98 PRO CD   C  -60.776  -1.753  -71.395 1.00 . A A .  98 PRO CD   1 1 
        1   1437 1 1  98 PRO CG   C  -59.225  -1.626  -71.365 1.00 . A A .  98 PRO CG   1 1 
        1   1438 1 1  98 PRO HA   H  -59.728  -4.164  -73.402 1.00 . A A .  98 PRO HA   1 1 
        1   1439 1 1  98 PRO HB2  H  -57.861  -3.255  -71.616 1.00 . A A .  98 PRO HB2  1 1 
        1   1440 1 1  98 PRO HB3  H  -58.265  -2.387  -73.108 1.00 . A A .  98 PRO HB3  1 1 
        1   1441 1 1  98 PRO HD2  H  -61.152  -1.982  -70.397 1.00 . A A .  98 PRO HD2  1 1 
        1   1442 1 1  98 PRO HD3  H  -61.233  -0.856  -71.775 1.00 . A A .  98 PRO HD3  1 1 
        1   1443 1 1  98 PRO HG2  H  -58.857  -1.686  -70.347 1.00 . A A .  98 PRO HG2  1 1 
        1   1444 1 1  98 PRO HG3  H  -58.926  -0.685  -71.800 1.00 . A A .  98 PRO HG3  1 1 
        1   1445 1 1  98 PRO N    N  -61.008  -2.898  -72.318 1.00 . A A .  98 PRO N    1 1 
        1   1446 1 1  98 PRO O    O  -60.700  -4.710  -70.461 1.00 . A A .  98 PRO O    1 1 
        1   1447 1 1  99 SER C    C  -58.044  -6.811  -69.365 1.00 . A A .  99 SER C    1 1 
        1   1448 1 1  99 SER CA   C  -59.083  -6.924  -70.470 1.00 . A A .  99 SER CA   1 1 
        1   1449 1 1  99 SER CB   C  -58.911  -8.263  -71.202 1.00 . A A .  99 SER CB   1 1 
        1   1450 1 1  99 SER H    H  -58.435  -5.889  -72.225 1.00 . A A .  99 SER H    1 1 
        1   1451 1 1  99 SER HA   H  -60.061  -6.905  -70.021 1.00 . A A .  99 SER HA   1 1 
        1   1452 1 1  99 SER HB2  H  -59.875  -8.729  -71.321 1.00 . A A .  99 SER HB2  1 1 
        1   1453 1 1  99 SER HB3  H  -58.480  -8.086  -72.172 1.00 . A A .  99 SER HB3  1 1 
        1   1454 1 1  99 SER HG   H  -58.496 -10.004  -70.432 1.00 . A A .  99 SER HG   1 1 
        1   1455 1 1  99 SER N    N  -59.029  -5.828  -71.451 1.00 . A A .  99 SER N    1 1 
        1   1456 1 1  99 SER O    O  -57.060  -6.112  -69.531 1.00 . A A .  99 SER O    1 1 
        1   1457 1 1  99 SER OG   O  -58.074  -9.140  -70.452 1.00 . A A .  99 SER OG   1 1 
        1   1458 1 1 100 PRO C    C  -56.000  -8.060  -67.348 1.00 . A A . 100 PRO C    1 1 
        1   1459 1 1 100 PRO CA   C  -57.393  -7.541  -67.067 1.00 . A A . 100 PRO CA   1 1 
        1   1460 1 1 100 PRO CB   C  -58.127  -8.479  -66.134 1.00 . A A . 100 PRO CB   1 1 
        1   1461 1 1 100 PRO CD   C  -59.438  -8.363  -68.036 1.00 . A A . 100 PRO CD   1 1 
        1   1462 1 1 100 PRO CG   C  -58.894  -9.334  -67.035 1.00 . A A . 100 PRO CG   1 1 
        1   1463 1 1 100 PRO HA   H  -57.344  -6.569  -66.628 1.00 . A A . 100 PRO HA   1 1 
        1   1464 1 1 100 PRO HB2  H  -57.436  -9.070  -65.560 1.00 . A A . 100 PRO HB2  1 1 
        1   1465 1 1 100 PRO HB3  H  -58.799  -7.928  -65.494 1.00 . A A . 100 PRO HB3  1 1 
        1   1466 1 1 100 PRO HD2  H  -59.741  -8.874  -68.926 1.00 . A A . 100 PRO HD2  1 1 
        1   1467 1 1 100 PRO HD3  H  -60.253  -7.786  -67.616 1.00 . A A . 100 PRO HD3  1 1 
        1   1468 1 1 100 PRO HG2  H  -58.237 -10.043  -67.517 1.00 . A A . 100 PRO HG2  1 1 
        1   1469 1 1 100 PRO HG3  H  -59.682  -9.825  -66.513 1.00 . A A . 100 PRO HG3  1 1 
        1   1470 1 1 100 PRO N    N  -58.278  -7.511  -68.265 1.00 . A A . 100 PRO N    1 1 
        1   1471 1 1 100 PRO O    O  -55.106  -7.835  -66.540 1.00 . A A . 100 PRO O    1 1 
        1   1472 1 1 101 PHE C    C  -53.599  -8.367  -69.544 1.00 . A A . 101 PHE C    1 1 
        1   1473 1 1 101 PHE CA   C  -54.528  -9.348  -68.824 1.00 . A A . 101 PHE CA   1 1 
        1   1474 1 1 101 PHE CB   C  -54.741 -10.623  -69.643 1.00 . A A . 101 PHE CB   1 1 
        1   1475 1 1 101 PHE CD1  C  -55.236  -9.555  -71.833 1.00 . A A . 101 PHE CD1  1 1 
        1   1476 1 1 101 PHE CD2  C  -53.484 -11.183  -71.710 1.00 . A A . 101 PHE CD2  1 1 
        1   1477 1 1 101 PHE CE1  C  -55.004  -9.414  -73.191 1.00 . A A . 101 PHE CE1  1 1 
        1   1478 1 1 101 PHE CE2  C  -53.248 -11.038  -73.062 1.00 . A A . 101 PHE CE2  1 1 
        1   1479 1 1 101 PHE CG   C  -54.471 -10.438  -71.099 1.00 . A A . 101 PHE CG   1 1 
        1   1480 1 1 101 PHE CZ   C  -54.014 -10.160  -73.808 1.00 . A A . 101 PHE CZ   1 1 
        1   1481 1 1 101 PHE H    H  -56.611  -8.945  -69.029 1.00 . A A . 101 PHE H    1 1 
        1   1482 1 1 101 PHE HA   H  -54.036  -9.627  -67.923 1.00 . A A . 101 PHE HA   1 1 
        1   1483 1 1 101 PHE HB2  H  -54.085 -11.389  -69.266 1.00 . A A . 101 PHE HB2  1 1 
        1   1484 1 1 101 PHE HB3  H  -55.763 -10.945  -69.530 1.00 . A A . 101 PHE HB3  1 1 
        1   1485 1 1 101 PHE HD1  H  -55.989  -8.966  -71.356 1.00 . A A . 101 PHE HD1  1 1 
        1   1486 1 1 101 PHE HD2  H  -52.897 -11.873  -71.137 1.00 . A A . 101 PHE HD2  1 1 
        1   1487 1 1 101 PHE HE1  H  -55.614  -8.745  -73.770 1.00 . A A . 101 PHE HE1  1 1 
        1   1488 1 1 101 PHE HE2  H  -52.480 -11.621  -73.536 1.00 . A A . 101 PHE HE2  1 1 
        1   1489 1 1 101 PHE HZ   H  -53.830 -10.044  -74.861 1.00 . A A . 101 PHE HZ   1 1 
        1   1490 1 1 101 PHE N    N  -55.837  -8.778  -68.460 1.00 . A A . 101 PHE N    1 1 
        1   1491 1 1 101 PHE O    O  -53.242  -8.557  -70.706 1.00 . A A . 101 PHE O    1 1 
        1   1492 1 1 102 ALA C    C  -51.195  -7.088  -70.180 1.00 . A A . 102 ALA C    1 1 
        1   1493 1 1 102 ALA CA   C  -52.320  -6.340  -69.464 1.00 . A A . 102 ALA CA   1 1 
        1   1494 1 1 102 ALA CB   C  -51.748  -5.356  -68.415 1.00 . A A . 102 ALA CB   1 1 
        1   1495 1 1 102 ALA H    H  -53.494  -7.189  -67.923 1.00 . A A . 102 ALA H    1 1 
        1   1496 1 1 102 ALA HA   H  -52.890  -5.781  -70.197 1.00 . A A . 102 ALA HA   1 1 
        1   1497 1 1 102 ALA HB1  H  -51.128  -5.893  -67.715 1.00 . A A . 102 ALA HB1  1 1 
        1   1498 1 1 102 ALA HB2  H  -52.560  -4.879  -67.884 1.00 . A A . 102 ALA HB2  1 1 
        1   1499 1 1 102 ALA HB3  H  -51.156  -4.598  -68.912 1.00 . A A . 102 ALA HB3  1 1 
        1   1500 1 1 102 ALA N    N  -53.197  -7.309  -68.846 1.00 . A A . 102 ALA N    1 1 
        1   1501 1 1 102 ALA O    O  -50.617  -6.597  -71.144 1.00 . A A . 102 ALA O    1 1 
        1   1502 1 1 103 THR C    C  -50.383  -9.544  -71.687 1.00 . A A . 103 THR C    1 1 
        1   1503 1 1 103 THR CA   C  -49.867  -9.137  -70.170 1.00 . A A . 103 THR CA   1 1 
        1   1504 1 1 103 THR CB   C  -49.693 -10.462  -69.410 1.00 . A A . 103 THR CB   1 1 
        1   1505 1 1 103 THR CG2  C  -48.212 -10.879  -69.402 1.00 . A A . 103 THR CG2  1 1 
        1   1506 1 1 103 THR H    H  -51.417  -8.609  -68.901 1.00 . A A . 103 THR H    1 1 
        1   1507 1 1 103 THR HA   H  -48.950  -8.609  -70.291 1.00 . A A . 103 THR HA   1 1 
        1   1508 1 1 103 THR HB   H  -50.266 -11.253  -69.887 1.00 . A A . 103 THR HB   1 1 
        1   1509 1 1 103 THR HG1  H  -50.388  -9.370  -67.957 1.00 . A A . 103 THR HG1  1 1 
        1   1510 1 1 103 THR HG21 H  -47.601 -10.029  -69.139 1.00 . A A . 103 THR HG21 1 1 
        1   1511 1 1 103 THR HG22 H  -47.926 -11.240  -70.379 1.00 . A A . 103 THR HG22 1 1 
        1   1512 1 1 103 THR HG23 H  -48.067 -11.663  -68.673 1.00 . A A . 103 THR HG23 1 1 
        1   1513 1 1 103 THR N    N  -50.907  -8.291  -69.653 1.00 . A A . 103 THR N    1 1 
        1   1514 1 1 103 THR O    O  -51.535  -9.312  -71.961 1.00 . A A . 103 THR O    1 1 
        1   1515 1 1 103 THR OG1  O  -50.154 -10.293  -68.077 1.00 . A A . 103 THR OG1  1 1 
        1   1516 1 1 104 CYS C    C  -49.818 -12.002  -73.947 1.00 . A A . 104 CYS C    1 1 
        1   1517 1 1 104 CYS CA   C  -49.816 -10.385  -73.759 1.00 . A A . 104 CYS CA   1 1 
        1   1518 1 1 104 CYS CB   C  -48.713  -9.773  -74.794 1.00 . A A . 104 CYS CB   1 1 
        1   1519 1 1 104 CYS H    H  -48.537 -10.174  -72.107 1.00 . A A . 104 CYS H    1 1 
        1   1520 1 1 104 CYS HA   H  -50.765 -10.024  -74.036 1.00 . A A . 104 CYS HA   1 1 
        1   1521 1 1 104 CYS HB2  H  -47.840 -10.356  -74.710 1.00 . A A . 104 CYS HB2  1 1 
        1   1522 1 1 104 CYS HB3  H  -49.137  -9.837  -75.763 1.00 . A A . 104 CYS HB3  1 1 
        1   1523 1 1 104 CYS N    N  -49.465 -10.052  -72.440 1.00 . A A . 104 CYS N    1 1 
        1   1524 1 1 104 CYS O    O  -49.228 -12.694  -73.139 1.00 . A A . 104 CYS O    1 1 
        1   1525 1 1 104 CYS SG   S  -48.340  -8.070  -74.379 1.00 . A A . 104 CYS SG   1 1 
        1   1526 1 1 105 ASP C    C  -49.310 -14.597  -75.199 1.00 . A A . 105 ASP C    1 1 
        1   1527 1 1 105 ASP CA   C  -50.660 -13.865  -75.194 1.00 . A A . 105 ASP CA   1 1 
        1   1528 1 1 105 ASP CB   C  -51.440 -14.160  -76.539 1.00 . A A . 105 ASP CB   1 1 
        1   1529 1 1 105 ASP CG   C  -51.049 -13.195  -77.664 1.00 . A A . 105 ASP CG   1 1 
        1   1530 1 1 105 ASP H    H  -50.980 -11.795  -75.566 1.00 . A A . 105 ASP H    1 1 
        1   1531 1 1 105 ASP HA   H  -51.258 -14.270  -74.402 1.00 . A A . 105 ASP HA   1 1 
        1   1532 1 1 105 ASP HB2  H  -51.222 -15.166  -76.840 1.00 . A A . 105 ASP HB2  1 1 
        1   1533 1 1 105 ASP HB3  H  -52.493 -14.065  -76.335 1.00 . A A . 105 ASP HB3  1 1 
        1   1534 1 1 105 ASP N    N  -50.523 -12.434  -74.973 1.00 . A A . 105 ASP N    1 1 
        1   1535 1 1 105 ASP O    O  -48.251 -13.982  -75.340 1.00 . A A . 105 ASP O    1 1 
        1   1536 1 1 105 ASP OD1  O  -49.927 -12.685  -77.639 1.00 . A A . 105 ASP OD1  1 1 
        1   1537 1 1 105 ASP OD2  O  -51.888 -12.991  -78.552 1.00 . A A . 105 ASP OD2  1 1 
        1   1538 1 1 106 PHE C    C  -47.453 -16.336  -73.462 1.00 . A A . 106 PHE C    1 1 
        1   1539 1 1 106 PHE CA   C  -48.195 -16.740  -74.759 1.00 . A A . 106 PHE CA   1 1 
        1   1540 1 1 106 PHE CB   C  -47.277 -16.615  -75.990 1.00 . A A . 106 PHE CB   1 1 
        1   1541 1 1 106 PHE CD1  C  -49.190 -16.975  -77.625 1.00 . A A . 106 PHE CD1  1 1 
        1   1542 1 1 106 PHE CD2  C  -47.620 -15.197  -78.060 1.00 . A A . 106 PHE CD2  1 1 
        1   1543 1 1 106 PHE CE1  C  -49.882 -16.652  -78.802 1.00 . A A . 106 PHE CE1  1 1 
        1   1544 1 1 106 PHE CE2  C  -48.315 -14.874  -79.231 1.00 . A A . 106 PHE CE2  1 1 
        1   1545 1 1 106 PHE CG   C  -48.061 -16.247  -77.248 1.00 . A A . 106 PHE CG   1 1 
        1   1546 1 1 106 PHE CZ   C  -49.443 -15.602  -79.604 1.00 . A A . 106 PHE CZ   1 1 
        1   1547 1 1 106 PHE H    H  -50.241 -16.284  -74.670 1.00 . A A . 106 PHE H    1 1 
        1   1548 1 1 106 PHE HA   H  -48.507 -17.776  -74.665 1.00 . A A . 106 PHE HA   1 1 
        1   1549 1 1 106 PHE HB2  H  -46.543 -15.857  -75.807 1.00 . A A . 106 PHE HB2  1 1 
        1   1550 1 1 106 PHE HB3  H  -46.784 -17.559  -76.159 1.00 . A A . 106 PHE HB3  1 1 
        1   1551 1 1 106 PHE HD1  H  -49.537 -17.781  -77.007 1.00 . A A . 106 PHE HD1  1 1 
        1   1552 1 1 106 PHE HD2  H  -46.749 -14.632  -77.783 1.00 . A A . 106 PHE HD2  1 1 
        1   1553 1 1 106 PHE HE1  H  -50.752 -17.222  -79.091 1.00 . A A . 106 PHE HE1  1 1 
        1   1554 1 1 106 PHE HE2  H  -47.973 -14.059  -79.849 1.00 . A A . 106 PHE HE2  1 1 
        1   1555 1 1 106 PHE HZ   H  -49.975 -15.352  -80.508 1.00 . A A . 106 PHE HZ   1 1 
        1   1556 1 1 106 PHE N    N  -49.373 -15.904  -74.882 1.00 . A A . 106 PHE N    1 1 
        1   1557 1 1 106 PHE O    O  -46.233 -16.230  -73.440 1.00 . A A . 106 PHE O    1 1 
        1   1558 1 1 107 MET C    C  -48.409 -16.527  -69.768 1.00 . A A . 107 MET C    1 1 
        1   1559 1 1 107 MET CA   C  -47.607 -15.962  -71.004 1.00 . A A . 107 MET CA   1 1 
        1   1560 1 1 107 MET CB   C  -47.272 -14.463  -70.863 1.00 . A A . 107 MET CB   1 1 
        1   1561 1 1 107 MET CE   C  -45.933 -15.038  -66.967 1.00 . A A . 107 MET CE   1 1 
        1   1562 1 1 107 MET CG   C  -46.737 -14.032  -69.454 1.00 . A A . 107 MET CG   1 1 
        1   1563 1 1 107 MET H    H  -49.157 -16.451  -72.421 1.00 . A A . 107 MET H    1 1 
        1   1564 1 1 107 MET HA   H  -46.694 -16.494  -71.024 1.00 . A A . 107 MET HA   1 1 
        1   1565 1 1 107 MET HB2  H  -46.520 -14.228  -71.592 1.00 . A A . 107 MET HB2  1 1 
        1   1566 1 1 107 MET HB3  H  -48.154 -13.884  -71.078 1.00 . A A . 107 MET HB3  1 1 
        1   1567 1 1 107 MET HE1  H  -45.440 -15.832  -66.424 1.00 . A A . 107 MET HE1  1 1 
        1   1568 1 1 107 MET HE2  H  -46.994 -15.127  -66.832 1.00 . A A . 107 MET HE2  1 1 
        1   1569 1 1 107 MET HE3  H  -45.596 -14.082  -66.596 1.00 . A A . 107 MET HE3  1 1 
        1   1570 1 1 107 MET HG2  H  -46.250 -13.071  -69.571 1.00 . A A . 107 MET HG2  1 1 
        1   1571 1 1 107 MET HG3  H  -47.569 -13.917  -68.792 1.00 . A A . 107 MET HG3  1 1 
        1   1572 1 1 107 MET N    N  -48.221 -16.260  -72.340 1.00 . A A . 107 MET N    1 1 
        1   1573 1 1 107 MET O    O  -48.161 -16.123  -68.614 1.00 . A A . 107 MET O    1 1 
        1   1574 1 1 107 MET SD   S  -45.524 -15.186  -68.731 1.00 . A A . 107 MET SD   1 1 
        1   1575 1 1 108 VAL C    C  -49.821 -19.626  -68.875 1.00 . A A . 108 VAL C    1 1 
        1   1576 1 1 108 VAL CA   C  -50.160 -18.128  -68.997 1.00 . A A . 108 VAL CA   1 1 
        1   1577 1 1 108 VAL CB   C  -51.721 -17.995  -69.360 1.00 . A A . 108 VAL CB   1 1 
        1   1578 1 1 108 VAL CG1  C  -52.581 -18.849  -68.405 1.00 . A A . 108 VAL CG1  1 1 
        1   1579 1 1 108 VAL CG2  C  -52.168 -16.516  -69.329 1.00 . A A . 108 VAL CG2  1 1 
        1   1580 1 1 108 VAL H    H  -49.445 -17.730  -70.961 1.00 . A A . 108 VAL H    1 1 
        1   1581 1 1 108 VAL HA   H  -49.987 -17.660  -68.064 1.00 . A A . 108 VAL HA   1 1 
        1   1582 1 1 108 VAL HB   H  -51.863 -18.374  -70.346 1.00 . A A . 108 VAL HB   1 1 
        1   1583 1 1 108 VAL HG11 H  -52.299 -18.674  -67.381 1.00 . A A . 108 VAL HG11 1 1 
        1   1584 1 1 108 VAL HG12 H  -52.439 -19.897  -68.643 1.00 . A A . 108 VAL HG12 1 1 
        1   1585 1 1 108 VAL HG13 H  -53.625 -18.597  -68.542 1.00 . A A . 108 VAL HG13 1 1 
        1   1586 1 1 108 VAL HG21 H  -51.404 -15.899  -69.783 1.00 . A A . 108 VAL HG21 1 1 
        1   1587 1 1 108 VAL HG22 H  -52.339 -16.193  -68.317 1.00 . A A . 108 VAL HG22 1 1 
        1   1588 1 1 108 VAL HG23 H  -53.086 -16.416  -69.899 1.00 . A A . 108 VAL HG23 1 1 
        1   1589 1 1 108 VAL N    N  -49.327 -17.474  -70.037 1.00 . A A . 108 VAL N    1 1 
        1   1590 1 1 108 VAL O    O  -48.845 -19.972  -68.209 1.00 . A A . 108 VAL O    1 1 
        1   1591 1 1 114 LEU C    C  -48.119 -18.834  -91.981 1.00 . A A . 114 LEU C    1 1 
        1   1592 1 1 114 LEU CA   C  -48.801 -19.947  -91.155 1.00 . A A . 114 LEU CA   1 1 
        1   1593 1 1 114 LEU CB   C  -49.755 -20.759  -92.064 1.00 . A A . 114 LEU CB   1 1 
        1   1594 1 1 114 LEU CD1  C  -48.945 -23.190  -91.978 1.00 . A A . 114 LEU CD1  1 1 
        1   1595 1 1 114 LEU CD2  C  -50.385 -22.308  -90.140 1.00 . A A . 114 LEU CD2  1 1 
        1   1596 1 1 114 LEU CG   C  -50.070 -22.219  -91.624 1.00 . A A . 114 LEU CG   1 1 
        1   1597 1 1 114 LEU H    H  -50.367 -19.952  -89.809 1.00 . A A . 114 LEU H    1 1 
        1   1598 1 1 114 LEU HA   H  -48.048 -20.579  -90.771 1.00 . A A . 114 LEU HA   1 1 
        1   1599 1 1 114 LEU HB2  H  -50.686 -20.247  -92.113 1.00 . A A . 114 LEU HB2  1 1 
        1   1600 1 1 114 LEU HB3  H  -49.319 -20.795  -93.041 1.00 . A A . 114 LEU HB3  1 1 
        1   1601 1 1 114 LEU HD11 H  -49.106 -24.124  -91.454 1.00 . A A . 114 LEU HD11 1 1 
        1   1602 1 1 114 LEU HD12 H  -47.999 -22.771  -91.688 1.00 . A A . 114 LEU HD12 1 1 
        1   1603 1 1 114 LEU HD13 H  -48.953 -23.376  -93.043 1.00 . A A . 114 LEU HD13 1 1 
        1   1604 1 1 114 LEU HD21 H  -50.678 -23.323  -89.902 1.00 . A A . 114 LEU HD21 1 1 
        1   1605 1 1 114 LEU HD22 H  -51.198 -21.638  -89.909 1.00 . A A . 114 LEU HD22 1 1 
        1   1606 1 1 114 LEU HD23 H  -49.515 -22.041  -89.570 1.00 . A A . 114 LEU HD23 1 1 
        1   1607 1 1 114 LEU HG   H  -50.947 -22.527  -92.177 1.00 . A A . 114 LEU HG   1 1 
        1   1608 1 1 114 LEU N    N  -49.544 -19.357  -90.018 1.00 . A A . 114 LEU N    1 1 
        1   1609 1 1 114 LEU O    O  -48.518 -18.572  -93.129 1.00 . A A . 114 LEU O    1 1 
        1   1610 1 1 115 PRO C    C  -45.342 -17.637  -93.133 1.00 . A A . 115 PRO C    1 1 
        1   1611 1 1 115 PRO CA   C  -46.340 -17.132  -92.101 1.00 . A A . 115 PRO CA   1 1 
        1   1612 1 1 115 PRO CB   C  -45.597 -16.400  -90.949 1.00 . A A . 115 PRO CB   1 1 
        1   1613 1 1 115 PRO CD   C  -46.689 -18.347  -89.996 1.00 . A A . 115 PRO CD   1 1 
        1   1614 1 1 115 PRO CG   C  -45.435 -17.519  -89.872 1.00 . A A . 115 PRO CG   1 1 
        1   1615 1 1 115 PRO HA   H  -47.012 -16.436  -92.543 1.00 . A A . 115 PRO HA   1 1 
        1   1616 1 1 115 PRO HB2  H  -44.639 -16.073  -91.256 1.00 . A A . 115 PRO HB2  1 1 
        1   1617 1 1 115 PRO HB3  H  -46.198 -15.622  -90.544 1.00 . A A . 115 PRO HB3  1 1 
        1   1618 1 1 115 PRO HD2  H  -46.468 -19.365  -89.754 1.00 . A A . 115 PRO HD2  1 1 
        1   1619 1 1 115 PRO HD3  H  -47.465 -17.950  -89.350 1.00 . A A . 115 PRO HD3  1 1 
        1   1620 1 1 115 PRO HG2  H  -44.562 -18.092  -90.111 1.00 . A A . 115 PRO HG2  1 1 
        1   1621 1 1 115 PRO HG3  H  -45.366 -17.055  -88.917 1.00 . A A . 115 PRO HG3  1 1 
        1   1622 1 1 115 PRO N    N  -47.117 -18.188  -91.406 1.00 . A A . 115 PRO N    1 1 
        1   1623 1 1 115 PRO O    O  -45.500 -18.716  -93.690 1.00 . A A . 115 PRO O    1 1 
        1   1624 1 1 116 LEU C    C  -43.800 -17.368  -95.632 1.00 . A A . 116 LEU C    1 1 
        1   1625 1 1 116 LEU CA   C  -43.205 -17.238  -94.239 1.00 . A A . 116 LEU CA   1 1 
        1   1626 1 1 116 LEU CB   C  -42.594 -18.571  -93.714 1.00 . A A . 116 LEU CB   1 1 
        1   1627 1 1 116 LEU CD1  C  -40.192 -18.285  -94.575 1.00 . A A . 116 LEU CD1  1 1 
        1   1628 1 1 116 LEU CD2  C  -41.041 -20.492  -93.795 1.00 . A A . 116 LEU CD2  1 1 
        1   1629 1 1 116 LEU CG   C  -41.417 -19.190  -94.507 1.00 . A A . 116 LEU CG   1 1 
        1   1630 1 1 116 LEU H    H  -44.162 -16.062  -92.764 1.00 . A A . 116 LEU H    1 1 
        1   1631 1 1 116 LEU HA   H  -42.452 -16.469  -94.222 1.00 . A A . 116 LEU HA   1 1 
        1   1632 1 1 116 LEU HB2  H  -42.249 -18.404  -92.725 1.00 . A A . 116 LEU HB2  1 1 
        1   1633 1 1 116 LEU HB3  H  -43.378 -19.295  -93.694 1.00 . A A . 116 LEU HB3  1 1 
        1   1634 1 1 116 LEU HD11 H  -40.456 -17.387  -95.106 1.00 . A A . 116 LEU HD11 1 1 
        1   1635 1 1 116 LEU HD12 H  -39.402 -18.801  -95.109 1.00 . A A . 116 LEU HD12 1 1 
        1   1636 1 1 116 LEU HD13 H  -39.853 -18.040  -93.583 1.00 . A A . 116 LEU HD13 1 1 
        1   1637 1 1 116 LEU HD21 H  -41.868 -21.183  -93.874 1.00 . A A . 116 LEU HD21 1 1 
        1   1638 1 1 116 LEU HD22 H  -40.837 -20.293  -92.753 1.00 . A A . 116 LEU HD22 1 1 
        1   1639 1 1 116 LEU HD23 H  -40.170 -20.914  -94.264 1.00 . A A . 116 LEU HD23 1 1 
        1   1640 1 1 116 LEU HG   H  -41.733 -19.430  -95.491 1.00 . A A . 116 LEU HG   1 1 
        1   1641 1 1 116 LEU N    N  -44.259 -16.872  -93.303 1.00 . A A . 116 LEU N    1 1 
        1   1642 1 1 116 LEU O    O  -44.937 -17.829  -95.793 1.00 . A A . 116 LEU O    1 1 
        1   1643 1 1 117 ASP C    C  -42.323 -16.490  -99.038 1.00 . A A . 117 ASP C    1 1 
        1   1644 1 1 117 ASP CA   C  -43.400 -17.022  -98.050 1.00 . A A . 117 ASP CA   1 1 
        1   1645 1 1 117 ASP CB   C  -44.705 -16.241  -98.278 1.00 . A A . 117 ASP CB   1 1 
        1   1646 1 1 117 ASP CG   C  -44.793 -14.932  -97.447 1.00 . A A . 117 ASP CG   1 1 
        1   1647 1 1 117 ASP H    H  -42.112 -16.640  -96.401 1.00 . A A . 117 ASP H    1 1 
        1   1648 1 1 117 ASP HA   H  -43.579 -18.050  -98.292 1.00 . A A . 117 ASP HA   1 1 
        1   1649 1 1 117 ASP HB2  H  -44.782 -15.988  -99.325 1.00 . A A . 117 ASP HB2  1 1 
        1   1650 1 1 117 ASP HB3  H  -45.533 -16.879  -98.014 1.00 . A A . 117 ASP HB3  1 1 
        1   1651 1 1 117 ASP N    N  -42.995 -16.960  -96.629 1.00 . A A . 117 ASP N    1 1 
        1   1652 1 1 117 ASP O    O  -41.696 -15.464  -98.802 1.00 . A A . 117 ASP O    1 1 
        1   1653 1 1 117 ASP OD1  O  -44.934 -15.021  -96.225 1.00 . A A . 117 ASP OD1  1 1 
        1   1654 1 1 117 ASP OD2  O  -44.753 -13.857  -98.055 1.00 . A A . 117 ASP OD2  1 1 
        1   1655 1 1 118 LYS C    C  -40.805 -15.469 -101.377 1.00 . A A . 118 LYS C    1 1 
        1   1656 1 1 118 LYS CA   C  -40.997 -16.965 -101.070 1.00 . A A . 118 LYS CA   1 1 
        1   1657 1 1 118 LYS CB   C  -41.164 -17.777 -102.369 1.00 . A A . 118 LYS CB   1 1 
        1   1658 1 1 118 LYS CD   C  -41.212 -20.081 -101.331 1.00 . A A . 118 LYS CD   1 1 
        1   1659 1 1 118 LYS CE   C  -40.435 -21.393 -101.109 1.00 . A A . 118 LYS CE   1 1 
        1   1660 1 1 118 LYS CG   C  -40.466 -19.152 -102.289 1.00 . A A . 118 LYS CG   1 1 
        1   1661 1 1 118 LYS H    H  -42.523 -18.134 -100.168 1.00 . A A . 118 LYS H    1 1 
        1   1662 1 1 118 LYS HA   H  -40.097 -17.282 -100.600 1.00 . A A . 118 LYS HA   1 1 
        1   1663 1 1 118 LYS HB2  H  -42.198 -17.930 -102.565 1.00 . A A . 118 LYS HB2  1 1 
        1   1664 1 1 118 LYS HB3  H  -40.716 -17.225 -103.178 1.00 . A A . 118 LYS HB3  1 1 
        1   1665 1 1 118 LYS HD2  H  -41.317 -19.585 -100.378 1.00 . A A . 118 LYS HD2  1 1 
        1   1666 1 1 118 LYS HD3  H  -42.182 -20.304 -101.728 1.00 . A A . 118 LYS HD3  1 1 
        1   1667 1 1 118 LYS HE2  H  -39.460 -21.160 -100.734 1.00 . A A . 118 LYS HE2  1 1 
        1   1668 1 1 118 LYS HE3  H  -40.968 -21.977 -100.376 1.00 . A A . 118 LYS HE3  1 1 
        1   1669 1 1 118 LYS HG2  H  -40.475 -19.590 -103.276 1.00 . A A . 118 LYS HG2  1 1 
        1   1670 1 1 118 LYS HG3  H  -39.456 -19.024 -101.960 1.00 . A A . 118 LYS HG3  1 1 
        1   1671 1 1 118 LYS HZ1  H  -41.195 -22.258 -102.859 1.00 . A A . 118 LYS HZ1  1 1 
        1   1672 1 1 118 LYS HZ2  H  -39.975 -23.168 -102.104 1.00 . A A . 118 LYS HZ2  1 1 
        1   1673 1 1 118 LYS HZ3  H  -39.575 -21.767 -102.977 1.00 . A A . 118 LYS HZ3  1 1 
        1   1674 1 1 118 LYS N    N  -42.052 -17.283 -100.092 1.00 . A A . 118 LYS N    1 1 
        1   1675 1 1 118 LYS NZ   N  -40.288 -22.202 -102.361 1.00 . A A . 118 LYS NZ   1 1 
        1   1676 1 1 118 LYS O    O  -39.670 -15.064 -101.660 1.00 . A A . 118 LYS O    1 1 
        1   1677 1 1 119 TRP C    C  -41.317 -12.296 -100.677 1.00 . A A . 119 TRP C    1 1 
        1   1678 1 1 119 TRP CA   C  -41.820 -13.263 -101.797 1.00 . A A . 119 TRP CA   1 1 
        1   1679 1 1 119 TRP CB   C  -43.187 -12.771 -102.364 1.00 . A A . 119 TRP CB   1 1 
        1   1680 1 1 119 TRP CD1  C  -42.950 -14.332 -104.451 1.00 . A A . 119 TRP CD1  1 1 
        1   1681 1 1 119 TRP CD2  C  -44.240 -12.525 -104.827 1.00 . A A . 119 TRP CD2  1 1 
        1   1682 1 1 119 TRP CE2  C  -44.196 -13.295 -106.040 1.00 . A A . 119 TRP CE2  1 1 
        1   1683 1 1 119 TRP CE3  C  -44.996 -11.337 -104.826 1.00 . A A . 119 TRP CE3  1 1 
        1   1684 1 1 119 TRP CG   C  -43.436 -13.205 -103.824 1.00 . A A . 119 TRP CG   1 1 
        1   1685 1 1 119 TRP CH2  C  -45.601 -11.738 -107.164 1.00 . A A . 119 TRP CH2  1 1 
        1   1686 1 1 119 TRP CZ2  C  -44.864 -12.905 -107.180 1.00 . A A . 119 TRP CZ2  1 1 
        1   1687 1 1 119 TRP CZ3  C  -45.670 -10.952 -105.993 1.00 . A A . 119 TRP CZ3  1 1 
        1   1688 1 1 119 TRP H    H  -42.766 -15.116 -101.306 1.00 . A A . 119 TRP H    1 1 
        1   1689 1 1 119 TRP HA   H  -41.108 -13.196 -102.575 1.00 . A A . 119 TRP HA   1 1 
        1   1690 1 1 119 TRP HB2  H  -43.981 -13.149 -101.755 1.00 . A A . 119 TRP HB2  1 1 
        1   1691 1 1 119 TRP HB3  H  -43.199 -11.689 -102.322 1.00 . A A . 119 TRP HB3  1 1 
        1   1692 1 1 119 TRP HD1  H  -42.316 -15.065 -103.999 1.00 . A A . 119 TRP HD1  1 1 
        1   1693 1 1 119 TRP HE1  H  -43.202 -15.080 -106.422 1.00 . A A . 119 TRP HE1  1 1 
        1   1694 1 1 119 TRP HE3  H  -45.059 -10.721 -103.933 1.00 . A A . 119 TRP HE3  1 1 
        1   1695 1 1 119 TRP HH2  H  -46.123 -11.428 -108.047 1.00 . A A . 119 TRP HH2  1 1 
        1   1696 1 1 119 TRP HZ2  H  -44.812 -13.510 -108.087 1.00 . A A . 119 TRP HZ2  1 1 
        1   1697 1 1 119 TRP HZ3  H  -46.251 -10.045 -106.003 1.00 . A A . 119 TRP HZ3  1 1 
        1   1698 1 1 119 TRP N    N  -41.897 -14.698 -101.437 1.00 . A A . 119 TRP N    1 1 
        1   1699 1 1 119 TRP NE1  N  -43.406 -14.371 -105.753 1.00 . A A . 119 TRP NE1  1 1 
        1   1700 1 1 119 TRP O    O  -40.141 -11.938 -100.681 1.00 . A A . 119 TRP O    1 1 
        1   1701 1 1 120 VAL C    C  -42.891 -11.434  -97.410 1.00 . A A . 120 VAL C    1 1 
        1   1702 1 1 120 VAL CA   C  -41.794 -11.276  -98.468 1.00 . A A . 120 VAL CA   1 1 
        1   1703 1 1 120 VAL CB   C  -41.475  -9.729  -98.690 1.00 . A A . 120 VAL CB   1 1 
        1   1704 1 1 120 VAL CG1  C  -40.089  -9.563  -99.306 1.00 . A A . 120 VAL CG1  1 1 
        1   1705 1 1 120 VAL CG2  C  -42.515  -9.090  -99.584 1.00 . A A . 120 VAL CG2  1 1 
        1   1706 1 1 120 VAL H    H  -43.016 -12.493  -99.681 1.00 . A A . 120 VAL H    1 1 
        1   1707 1 1 120 VAL HA   H  -40.926 -11.729  -98.094 1.00 . A A . 120 VAL HA   1 1 
        1   1708 1 1 120 VAL HB   H  -41.482  -9.250  -97.725 1.00 . A A . 120 VAL HB   1 1 
        1   1709 1 1 120 VAL HG11 H  -39.411 -10.294  -98.895 1.00 . A A . 120 VAL HG11 1 1 
        1   1710 1 1 120 VAL HG12 H  -39.723  -8.570  -99.080 1.00 . A A . 120 VAL HG12 1 1 
        1   1711 1 1 120 VAL HG13 H  -40.152  -9.686 -100.375 1.00 . A A . 120 VAL HG13 1 1 
        1   1712 1 1 120 VAL HG21 H  -42.478  -9.544 -100.561 1.00 . A A . 120 VAL HG21 1 1 
        1   1713 1 1 120 VAL HG22 H  -42.302  -8.035  -99.665 1.00 . A A . 120 VAL HG22 1 1 
        1   1714 1 1 120 VAL HG23 H  -43.492  -9.231  -99.153 1.00 . A A . 120 VAL HG23 1 1 
        1   1715 1 1 120 VAL N    N  -42.166 -12.044  -99.666 1.00 . A A . 120 VAL N    1 1 
        1   1716 1 1 120 VAL O    O  -44.091 -11.456  -97.727 1.00 . A A . 120 VAL O    1 1 
        1   1717 1 1 121 PRO C    C  -44.170 -10.369  -94.684 1.00 . A A . 121 PRO C    1 1 
        1   1718 1 1 121 PRO CA   C  -43.487 -11.721  -95.077 1.00 . A A . 121 PRO CA   1 1 
        1   1719 1 1 121 PRO CB   C  -42.654 -12.291  -93.888 1.00 . A A . 121 PRO CB   1 1 
        1   1720 1 1 121 PRO CD   C  -41.122 -11.765  -95.658 1.00 . A A . 121 PRO CD   1 1 
        1   1721 1 1 121 PRO CG   C  -41.345 -12.693  -94.480 1.00 . A A . 121 PRO CG   1 1 
        1   1722 1 1 121 PRO HA   H  -44.237 -12.427  -95.357 1.00 . A A . 121 PRO HA   1 1 
        1   1723 1 1 121 PRO HB2  H  -42.523 -11.526  -93.142 1.00 . A A . 121 PRO HB2  1 1 
        1   1724 1 1 121 PRO HB3  H  -43.162 -13.144  -93.483 1.00 . A A . 121 PRO HB3  1 1 
        1   1725 1 1 121 PRO HD2  H  -40.670 -10.841  -95.344 1.00 . A A . 121 PRO HD2  1 1 
        1   1726 1 1 121 PRO HD3  H  -40.525 -12.264  -96.399 1.00 . A A . 121 PRO HD3  1 1 
        1   1727 1 1 121 PRO HG2  H  -40.559 -12.578  -93.756 1.00 . A A . 121 PRO HG2  1 1 
        1   1728 1 1 121 PRO HG3  H  -41.387 -13.716  -94.828 1.00 . A A . 121 PRO HG3  1 1 
        1   1729 1 1 121 PRO N    N  -42.509 -11.581  -96.155 1.00 . A A . 121 PRO N    1 1 
        1   1730 1 1 121 PRO O    O  -45.107 -10.379  -93.903 1.00 . A A . 121 PRO O    1 1 
        1   1731 1 1 122 GLN C    C  -45.588  -7.738  -94.580 1.00 . A A . 122 GLN C    1 1 
        1   1732 1 1 122 GLN CA   C  -44.045  -7.914  -94.868 1.00 . A A . 122 GLN CA   1 1 
        1   1733 1 1 122 GLN CB   C  -43.629  -6.969  -96.020 1.00 . A A . 122 GLN CB   1 1 
        1   1734 1 1 122 GLN CD   C  -44.334  -4.902  -94.694 1.00 . A A . 122 GLN CD   1 1 
        1   1735 1 1 122 GLN CG   C  -44.395  -5.637  -96.025 1.00 . A A . 122 GLN CG   1 1 
        1   1736 1 1 122 GLN H    H  -42.815  -9.383  -95.757 1.00 . A A . 122 GLN H    1 1 
        1   1737 1 1 122 GLN HA   H  -43.520  -7.625  -94.009 1.00 . A A . 122 GLN HA   1 1 
        1   1738 1 1 122 GLN HB2  H  -42.583  -6.759  -95.911 1.00 . A A . 122 GLN HB2  1 1 
        1   1739 1 1 122 GLN HB3  H  -43.795  -7.460  -96.965 1.00 . A A . 122 GLN HB3  1 1 
        1   1740 1 1 122 GLN HE21 H  -44.053  -3.134  -95.595 1.00 . A A . 122 GLN HE21 1 1 
        1   1741 1 1 122 GLN HE22 H  -44.112  -3.068  -93.899 1.00 . A A . 122 GLN HE22 1 1 
        1   1742 1 1 122 GLN HG2  H  -43.955  -5.000  -96.781 1.00 . A A . 122 GLN HG2  1 1 
        1   1743 1 1 122 GLN HG3  H  -45.420  -5.824  -96.281 1.00 . A A . 122 GLN HG3  1 1 
        1   1744 1 1 122 GLN N    N  -43.617  -9.278  -95.213 1.00 . A A . 122 GLN N    1 1 
        1   1745 1 1 122 GLN NE2  N  -44.150  -3.592  -94.724 1.00 . A A . 122 GLN NE2  1 1 
        1   1746 1 1 122 GLN O    O  -45.917  -7.350  -93.452 1.00 . A A . 122 GLN O    1 1 
        1   1747 1 1 122 GLN OE1  O  -44.472  -5.515  -93.623 1.00 . A A . 122 GLN OE1  1 1 
        1   1748 1 1 123 VAL C    C  -48.329  -8.322  -93.900 1.00 . A A . 123 VAL C    1 1 
        1   1749 1 1 123 VAL CA   C  -47.892  -7.896  -95.316 1.00 . A A . 123 VAL CA   1 1 
        1   1750 1 1 123 VAL CB   C  -48.703  -8.713  -96.447 1.00 . A A . 123 VAL CB   1 1 
        1   1751 1 1 123 VAL CG1  C  -50.192  -8.682  -96.147 1.00 . A A . 123 VAL CG1  1 1 
        1   1752 1 1 123 VAL CG2  C  -48.430  -8.088  -97.811 1.00 . A A . 123 VAL CG2  1 1 
        1   1753 1 1 123 VAL H    H  -46.106  -8.358  -96.397 1.00 . A A . 123 VAL H    1 1 
        1   1754 1 1 123 VAL HA   H  -48.142  -6.874  -95.435 1.00 . A A . 123 VAL HA   1 1 
        1   1755 1 1 123 VAL HB   H  -48.366  -9.717  -96.443 1.00 . A A . 123 VAL HB   1 1 
        1   1756 1 1 123 VAL HG11 H  -50.363  -9.044  -95.146 1.00 . A A . 123 VAL HG11 1 1 
        1   1757 1 1 123 VAL HG12 H  -50.694  -9.329  -96.851 1.00 . A A . 123 VAL HG12 1 1 
        1   1758 1 1 123 VAL HG13 H  -50.572  -7.679  -96.241 1.00 . A A . 123 VAL HG13 1 1 
        1   1759 1 1 123 VAL HG21 H  -47.364  -7.986  -97.950 1.00 . A A . 123 VAL HG21 1 1 
        1   1760 1 1 123 VAL HG22 H  -48.900  -7.121  -97.879 1.00 . A A . 123 VAL HG22 1 1 
        1   1761 1 1 123 VAL HG23 H  -48.830  -8.742  -98.571 1.00 . A A . 123 VAL HG23 1 1 
        1   1762 1 1 123 VAL N    N  -46.443  -8.045  -95.531 1.00 . A A . 123 VAL N    1 1 
        1   1763 1 1 123 VAL O    O  -49.282  -7.749  -93.350 1.00 . A A . 123 VAL O    1 1 
        1   1764 1 1 124 PHE C    C  -46.712  -9.559  -90.976 1.00 . A A . 124 PHE C    1 1 
        1   1765 1 1 124 PHE CA   C  -47.921  -9.725  -91.922 1.00 . A A . 124 PHE CA   1 1 
        1   1766 1 1 124 PHE CB   C  -48.445 -11.166  -91.897 1.00 . A A . 124 PHE CB   1 1 
        1   1767 1 1 124 PHE CD1  C  -46.371 -12.606  -91.744 1.00 . A A . 124 PHE CD1  1 1 
        1   1768 1 1 124 PHE CD2  C  -47.700 -12.695  -93.758 1.00 . A A . 124 PHE CD2  1 1 
        1   1769 1 1 124 PHE CE1  C  -45.489 -13.551  -92.282 1.00 . A A . 124 PHE CE1  1 1 
        1   1770 1 1 124 PHE CE2  C  -46.818 -13.639  -94.296 1.00 . A A . 124 PHE CE2  1 1 
        1   1771 1 1 124 PHE CG   C  -47.473 -12.173  -92.484 1.00 . A A . 124 PHE CG   1 1 
        1   1772 1 1 124 PHE CZ   C  -45.710 -14.066  -93.558 1.00 . A A . 124 PHE CZ   1 1 
        1   1773 1 1 124 PHE H    H  -46.880  -9.693  -93.783 1.00 . A A . 124 PHE H    1 1 
        1   1774 1 1 124 PHE HA   H  -48.700  -9.090  -91.541 1.00 . A A . 124 PHE HA   1 1 
        1   1775 1 1 124 PHE HB2  H  -48.646 -11.438  -90.880 1.00 . A A . 124 PHE HB2  1 1 
        1   1776 1 1 124 PHE HB3  H  -49.362 -11.195  -92.461 1.00 . A A . 124 PHE HB3  1 1 
        1   1777 1 1 124 PHE HD1  H  -46.194 -12.212  -90.763 1.00 . A A . 124 PHE HD1  1 1 
        1   1778 1 1 124 PHE HD2  H  -48.553 -12.373  -94.327 1.00 . A A . 124 PHE HD2  1 1 
        1   1779 1 1 124 PHE HE1  H  -44.637 -13.878  -91.704 1.00 . A A . 124 PHE HE1  1 1 
        1   1780 1 1 124 PHE HE2  H  -46.996 -14.036  -95.285 1.00 . A A . 124 PHE HE2  1 1 
        1   1781 1 1 124 PHE HZ   H  -45.030 -14.788  -93.972 1.00 . A A . 124 PHE HZ   1 1 
        1   1782 1 1 124 PHE N    N  -47.619  -9.289  -93.301 1.00 . A A . 124 PHE N    1 1 
        1   1783 1 1 124 PHE O    O  -45.589  -9.910  -91.318 1.00 . A A . 124 PHE O    1 1 
        1   1784 1 1 125 VAL C    C  -46.582  -8.714  -87.349 1.00 . A A . 125 VAL C    1 1 
        1   1785 1 1 125 VAL CA   C  -45.952  -8.905  -88.737 1.00 . A A . 125 VAL CA   1 1 
        1   1786 1 1 125 VAL CB   C  -44.982  -7.680  -89.054 1.00 . A A . 125 VAL CB   1 1 
        1   1787 1 1 125 VAL CG1  C  -43.854  -8.112  -90.013 1.00 . A A . 125 VAL CG1  1 1 
        1   1788 1 1 125 VAL CG2  C  -45.769  -6.500  -89.634 1.00 . A A . 125 VAL CG2  1 1 
        1   1789 1 1 125 VAL H    H  -47.918  -8.890  -89.517 1.00 . A A . 125 VAL H    1 1 
        1   1790 1 1 125 VAL HA   H  -45.356  -9.790  -88.714 1.00 . A A . 125 VAL HA   1 1 
        1   1791 1 1 125 VAL HB   H  -44.530  -7.378  -88.133 1.00 . A A . 125 VAL HB   1 1 
        1   1792 1 1 125 VAL HG11 H  -43.040  -7.401  -89.942 1.00 . A A . 125 VAL HG11 1 1 
        1   1793 1 1 125 VAL HG12 H  -44.215  -8.141  -91.026 1.00 . A A . 125 VAL HG12 1 1 
        1   1794 1 1 125 VAL HG13 H  -43.489  -9.092  -89.730 1.00 . A A . 125 VAL HG13 1 1 
        1   1795 1 1 125 VAL HG21 H  -46.368  -6.823  -90.467 1.00 . A A . 125 VAL HG21 1 1 
        1   1796 1 1 125 VAL HG22 H  -45.075  -5.737  -89.959 1.00 . A A . 125 VAL HG22 1 1 
        1   1797 1 1 125 VAL HG23 H  -46.410  -6.090  -88.863 1.00 . A A . 125 VAL HG23 1 1 
        1   1798 1 1 125 VAL N    N  -46.989  -9.083  -89.750 1.00 . A A . 125 VAL N    1 1 
        1   1799 1 1 125 VAL O    O  -47.743  -8.322  -87.227 1.00 . A A . 125 VAL O    1 1 
        1   1800 1 1 126 ALA C    C  -45.251  -8.604  -83.932 1.00 . A A . 126 ALA C    1 1 
        1   1801 1 1 126 ALA CA   C  -46.326  -9.012  -84.940 1.00 . A A . 126 ALA CA   1 1 
        1   1802 1 1 126 ALA CB   C  -46.885 -10.376  -84.559 1.00 . A A . 126 ALA CB   1 1 
        1   1803 1 1 126 ALA H    H  -44.945  -9.464  -86.479 1.00 . A A . 126 ALA H    1 1 
        1   1804 1 1 126 ALA HA   H  -47.123  -8.294  -84.887 1.00 . A A . 126 ALA HA   1 1 
        1   1805 1 1 126 ALA HB1  H  -46.101 -11.117  -84.616 1.00 . A A . 126 ALA HB1  1 1 
        1   1806 1 1 126 ALA HB2  H  -47.678 -10.637  -85.244 1.00 . A A . 126 ALA HB2  1 1 
        1   1807 1 1 126 ALA HB3  H  -47.273 -10.338  -83.554 1.00 . A A . 126 ALA HB3  1 1 
        1   1808 1 1 126 ALA N    N  -45.829  -9.092  -86.310 1.00 . A A . 126 ALA N    1 1 
        1   1809 1 1 126 ALA O    O  -45.584  -8.260  -82.798 1.00 . A A . 126 ALA O    1 1 
        1   1810 1 1 127 SER C    C  -42.757  -6.762  -83.169 1.00 . A A . 127 SER C    1 1 
        1   1811 1 1 127 SER CA   C  -42.892  -8.282  -83.379 1.00 . A A . 127 SER CA   1 1 
        1   1812 1 1 127 SER CB   C  -41.546  -8.937  -83.792 1.00 . A A . 127 SER CB   1 1 
        1   1813 1 1 127 SER H    H  -43.760  -8.925  -85.239 1.00 . A A . 127 SER H    1 1 
        1   1814 1 1 127 SER HA   H  -43.168  -8.695  -82.437 1.00 . A A . 127 SER HA   1 1 
        1   1815 1 1 127 SER HB2  H  -41.692  -9.999  -83.872 1.00 . A A . 127 SER HB2  1 1 
        1   1816 1 1 127 SER HB3  H  -41.229  -8.549  -84.741 1.00 . A A . 127 SER HB3  1 1 
        1   1817 1 1 127 SER HG   H  -40.357  -7.767  -82.776 1.00 . A A . 127 SER HG   1 1 
        1   1818 1 1 127 SER N    N  -43.972  -8.644  -84.326 1.00 . A A . 127 SER N    1 1 
        1   1819 1 1 127 SER O    O  -42.393  -5.999  -84.066 1.00 . A A . 127 SER O    1 1 
        1   1820 1 1 127 SER OG   O  -40.532  -8.708  -82.811 1.00 . A A . 127 SER OG   1 1 
        1   1821 1 1 128 GLY C    C  -43.298  -4.800  -80.065 1.00 . A A . 128 GLY C    1 1 
        1   1822 1 1 128 GLY CA   C  -42.915  -4.951  -81.531 1.00 . A A . 128 GLY CA   1 1 
        1   1823 1 1 128 GLY H    H  -43.277  -7.016  -81.250 1.00 . A A . 128 GLY H    1 1 
        1   1824 1 1 128 GLY HA2  H  -41.892  -4.628  -81.666 1.00 . A A . 128 GLY HA2  1 1 
        1   1825 1 1 128 GLY HA3  H  -43.567  -4.345  -82.136 1.00 . A A . 128 GLY HA3  1 1 
        1   1826 1 1 128 GLY N    N  -43.020  -6.352  -81.924 1.00 . A A . 128 GLY N    1 1 
        1   1827 1 1 128 GLY O    O  -42.429  -4.749  -79.205 1.00 . A A . 128 GLY O    1 1 
        1   1828 1 1 129 ASP C    C  -46.685  -4.727  -78.359 1.00 . A A . 129 ASP C    1 1 
        1   1829 1 1 129 ASP CA   C  -45.158  -4.493  -78.462 1.00 . A A . 129 ASP CA   1 1 
        1   1830 1 1 129 ASP CB   C  -44.796  -3.092  -77.951 1.00 . A A . 129 ASP CB   1 1 
        1   1831 1 1 129 ASP CG   C  -45.473  -1.981  -78.761 1.00 . A A . 129 ASP CG   1 1 
        1   1832 1 1 129 ASP H    H  -45.224  -4.672  -80.579 1.00 . A A . 129 ASP H    1 1 
        1   1833 1 1 129 ASP HA   H  -44.693  -5.204  -77.812 1.00 . A A . 129 ASP HA   1 1 
        1   1834 1 1 129 ASP HB2  H  -45.093  -3.009  -76.925 1.00 . A A . 129 ASP HB2  1 1 
        1   1835 1 1 129 ASP HB3  H  -43.725  -2.973  -78.024 1.00 . A A . 129 ASP HB3  1 1 
        1   1836 1 1 129 ASP N    N  -44.618  -4.668  -79.823 1.00 . A A . 129 ASP N    1 1 
        1   1837 1 1 129 ASP O    O  -47.364  -5.020  -79.343 1.00 . A A . 129 ASP O    1 1 
        1   1838 1 1 129 ASP OD1  O  -45.235  -1.931  -79.963 1.00 . A A . 129 ASP OD1  1 1 
        1   1839 1 1 129 ASP OD2  O  -46.208  -1.182  -78.158 1.00 . A A . 129 ASP OD2  1 1 
        1   1840 1 1 130 CYS C    C  -49.362  -3.336  -76.944 1.00 . A A . 130 CYS C    1 1 
        1   1841 1 1 130 CYS CA   C  -48.635  -4.673  -76.846 1.00 . A A . 130 CYS CA   1 1 
        1   1842 1 1 130 CYS CB   C  -48.865  -5.317  -75.467 1.00 . A A . 130 CYS CB   1 1 
        1   1843 1 1 130 CYS H    H  -46.604  -4.244  -76.423 1.00 . A A . 130 CYS H    1 1 
        1   1844 1 1 130 CYS HA   H  -49.069  -5.287  -77.587 1.00 . A A . 130 CYS HA   1 1 
        1   1845 1 1 130 CYS HB2  H  -47.937  -5.357  -74.940 1.00 . A A . 130 CYS HB2  1 1 
        1   1846 1 1 130 CYS HB3  H  -49.572  -4.729  -74.913 1.00 . A A . 130 CYS HB3  1 1 
        1   1847 1 1 130 CYS N    N  -47.202  -4.518  -77.131 1.00 . A A . 130 CYS N    1 1 
        1   1848 1 1 130 CYS O    O  -48.774  -2.288  -77.201 1.00 . A A . 130 CYS O    1 1 
        1   1849 1 1 130 CYS SG   S  -49.512  -7.007  -75.619 1.00 . A A . 130 CYS SG   1 1 
        1   1850 1 1 131 ALA C    C  -50.638  -1.404  -75.424 1.00 . A A . 131 ALA C    1 1 
        1   1851 1 1 131 ALA CA   C  -51.422  -2.191  -76.445 1.00 . A A . 131 ALA CA   1 1 
        1   1852 1 1 131 ALA CB   C  -52.810  -2.531  -75.910 1.00 . A A . 131 ALA CB   1 1 
        1   1853 1 1 131 ALA H    H  -50.969  -4.209  -76.173 1.00 . A A . 131 ALA H    1 1 
        1   1854 1 1 131 ALA HA   H  -51.495  -1.654  -77.381 1.00 . A A . 131 ALA HA   1 1 
        1   1855 1 1 131 ALA HB1  H  -53.142  -1.742  -75.253 1.00 . A A . 131 ALA HB1  1 1 
        1   1856 1 1 131 ALA HB2  H  -52.759  -3.461  -75.360 1.00 . A A . 131 ALA HB2  1 1 
        1   1857 1 1 131 ALA HB3  H  -53.499  -2.634  -76.731 1.00 . A A . 131 ALA HB3  1 1 
        1   1858 1 1 131 ALA N    N  -50.629  -3.376  -76.524 1.00 . A A . 131 ALA N    1 1 
        1   1859 1 1 131 ALA O    O  -50.535  -1.825  -74.263 1.00 . A A . 131 ALA O    1 1 
        1   1860 1 1 132 GLU C    C  -49.536   1.917  -75.036 1.00 . A A . 132 GLU C    1 1 
        1   1861 1 1 132 GLU CA   C  -49.175   0.436  -74.935 1.00 . A A . 132 GLU CA   1 1 
        1   1862 1 1 132 GLU CB   C  -47.654   0.209  -75.239 1.00 . A A . 132 GLU CB   1 1 
        1   1863 1 1 132 GLU CD   C  -46.369  -1.517  -73.738 1.00 . A A . 132 GLU CD   1 1 
        1   1864 1 1 132 GLU CG   C  -47.194  -1.275  -75.040 1.00 . A A . 132 GLU CG   1 1 
        1   1865 1 1 132 GLU H    H  -50.091  -0.047  -76.789 1.00 . A A . 132 GLU H    1 1 
        1   1866 1 1 132 GLU HA   H  -49.364   0.113  -73.932 1.00 . A A . 132 GLU HA   1 1 
        1   1867 1 1 132 GLU HB2  H  -47.470   0.482  -76.260 1.00 . A A . 132 GLU HB2  1 1 
        1   1868 1 1 132 GLU HB3  H  -47.084   0.838  -74.592 1.00 . A A . 132 GLU HB3  1 1 
        1   1869 1 1 132 GLU HG2  H  -48.047  -1.914  -75.020 1.00 . A A . 132 GLU HG2  1 1 
        1   1870 1 1 132 GLU HG3  H  -46.571  -1.547  -75.886 1.00 . A A . 132 GLU HG3  1 1 
        1   1871 1 1 132 GLU N    N  -50.007  -0.323  -75.850 1.00 . A A . 132 GLU N    1 1 
        1   1872 1 1 132 GLU O    O  -50.571   2.343  -74.519 1.00 . A A . 132 GLU O    1 1 
        1   1873 1 1 132 GLU OE1  O  -46.370  -0.653  -72.854 1.00 . A A . 132 GLU OE1  1 1 
        1   1874 1 1 132 GLU OE2  O  -45.772  -2.601  -73.635 1.00 . A A . 132 GLU OE2  1 1 
        1   1875 1 1 133 ARG C    C  -50.023   4.388  -76.836 1.00 . A A . 133 ARG C    1 1 
        1   1876 1 1 133 ARG CA   C  -48.908   4.125  -75.838 1.00 . A A . 133 ARG CA   1 1 
        1   1877 1 1 133 ARG CB   C  -47.588   4.811  -76.305 1.00 . A A . 133 ARG CB   1 1 
        1   1878 1 1 133 ARG CD   C  -45.827   6.657  -75.728 1.00 . A A . 133 ARG CD   1 1 
        1   1879 1 1 133 ARG CG   C  -47.344   6.221  -75.670 1.00 . A A . 133 ARG CG   1 1 
        1   1880 1 1 133 ARG CZ   C  -44.663   8.606  -76.799 1.00 . A A . 133 ARG CZ   1 1 
        1   1881 1 1 133 ARG H    H  -47.881   2.282  -76.070 1.00 . A A . 133 ARG H    1 1 
        1   1882 1 1 133 ARG HA   H  -49.199   4.512  -74.895 1.00 . A A . 133 ARG HA   1 1 
        1   1883 1 1 133 ARG HB2  H  -46.779   4.178  -76.044 1.00 . A A . 133 ARG HB2  1 1 
        1   1884 1 1 133 ARG HB3  H  -47.633   4.927  -77.368 1.00 . A A . 133 ARG HB3  1 1 
        1   1885 1 1 133 ARG HD2  H  -45.597   7.180  -74.823 1.00 . A A . 133 ARG HD2  1 1 
        1   1886 1 1 133 ARG HD3  H  -45.217   5.776  -75.790 1.00 . A A . 133 ARG HD3  1 1 
        1   1887 1 1 133 ARG HE   H  -45.898   7.348  -77.732 1.00 . A A . 133 ARG HE   1 1 
        1   1888 1 1 133 ARG HG2  H  -47.928   6.942  -76.193 1.00 . A A . 133 ARG HG2  1 1 
        1   1889 1 1 133 ARG HG3  H  -47.642   6.191  -74.636 1.00 . A A . 133 ARG HG3  1 1 
        1   1890 1 1 133 ARG HH11 H  -44.257   8.434  -74.832 1.00 . A A . 133 ARG HH11 1 1 
        1   1891 1 1 133 ARG HH12 H  -43.470   9.746  -75.644 1.00 . A A . 133 ARG HH12 1 1 
        1   1892 1 1 133 ARG HH21 H  -44.879   9.067  -78.761 1.00 . A A . 133 ARG HH21 1 1 
        1   1893 1 1 133 ARG HH22 H  -43.822  10.104  -77.863 1.00 . A A . 133 ARG HH22 1 1 
        1   1894 1 1 133 ARG N    N  -48.682   2.684  -75.691 1.00 . A A . 133 ARG N    1 1 
        1   1895 1 1 133 ARG NE   N  -45.504   7.543  -76.877 1.00 . A A . 133 ARG NE   1 1 
        1   1896 1 1 133 ARG NH1  N  -44.086   8.952  -75.669 1.00 . A A . 133 ARG NH1  1 1 
        1   1897 1 1 133 ARG NH2  N  -44.436   9.314  -77.895 1.00 . A A . 133 ARG NH2  1 1 
        1   1898 1 1 133 ARG O    O  -50.964   5.113  -76.525 1.00 . A A . 133 ARG O    1 1 
        1   1899 1 1 134 GLN C    C  -51.880   5.023  -78.700 1.00 . A A . 134 GLN C    1 1 
        1   1900 1 1 134 GLN CA   C  -50.941   3.876  -79.026 1.00 . A A . 134 GLN CA   1 1 
        1   1901 1 1 134 GLN CB   C  -51.761   2.567  -79.141 1.00 . A A . 134 GLN CB   1 1 
        1   1902 1 1 134 GLN CD   C  -52.203   2.015  -76.673 1.00 . A A . 134 GLN CD   1 1 
        1   1903 1 1 134 GLN CG   C  -51.531   1.587  -77.974 1.00 . A A . 134 GLN CG   1 1 
        1   1904 1 1 134 GLN H    H  -49.170   3.161  -78.155 1.00 . A A . 134 GLN H    1 1 
        1   1905 1 1 134 GLN HA   H  -50.473   4.068  -79.988 1.00 . A A . 134 GLN HA   1 1 
        1   1906 1 1 134 GLN HB2  H  -52.799   2.808  -79.182 1.00 . A A . 134 GLN HB2  1 1 
        1   1907 1 1 134 GLN HB3  H  -51.478   2.067  -80.056 1.00 . A A . 134 GLN HB3  1 1 
        1   1908 1 1 134 GLN HE21 H  -51.798   0.249  -75.825 1.00 . A A . 134 GLN HE21 1 1 
        1   1909 1 1 134 GLN HE22 H  -52.623   1.345  -74.826 1.00 . A A . 134 GLN HE22 1 1 
        1   1910 1 1 134 GLN HG2  H  -51.945   0.625  -78.259 1.00 . A A . 134 GLN HG2  1 1 
        1   1911 1 1 134 GLN HG3  H  -50.481   1.471  -77.803 1.00 . A A . 134 GLN HG3  1 1 
        1   1912 1 1 134 GLN N    N  -49.931   3.744  -78.000 1.00 . A A . 134 GLN N    1 1 
        1   1913 1 1 134 GLN NE2  N  -52.213   1.136  -75.687 1.00 . A A . 134 GLN NE2  1 1 
        1   1914 1 1 134 GLN O    O  -52.789   4.859  -77.881 1.00 . A A . 134 GLN O    1 1 
        1   1915 1 1 134 GLN OE1  O  -52.721   3.135  -76.545 1.00 . A A . 134 GLN OE1  1 1 
        1   1916 1 1 135 TRP C    C  -53.204   7.802  -80.402 1.00 . A A . 135 TRP C    1 1 
        1   1917 1 1 135 TRP CA   C  -52.551   7.322  -79.088 1.00 . A A . 135 TRP CA   1 1 
        1   1918 1 1 135 TRP CB   C  -51.872   8.468  -78.287 1.00 . A A . 135 TRP CB   1 1 
        1   1919 1 1 135 TRP CD1  C  -49.408   8.147  -78.978 1.00 . A A . 135 TRP CD1  1 1 
        1   1920 1 1 135 TRP CD2  C  -50.112  10.279  -79.073 1.00 . A A . 135 TRP CD2  1 1 
        1   1921 1 1 135 TRP CE2  C  -48.736  10.256  -79.476 1.00 . A A . 135 TRP CE2  1 1 
        1   1922 1 1 135 TRP CE3  C  -50.777  11.522  -79.051 1.00 . A A . 135 TRP CE3  1 1 
        1   1923 1 1 135 TRP CG   C  -50.519   8.924  -78.783 1.00 . A A . 135 TRP CG   1 1 
        1   1924 1 1 135 TRP CH2  C  -48.716  12.617  -79.809 1.00 . A A . 135 TRP CH2  1 1 
        1   1925 1 1 135 TRP CZ2  C  -48.056  11.402  -79.834 1.00 . A A . 135 TRP CZ2  1 1 
        1   1926 1 1 135 TRP CZ3  C  -50.073  12.684  -79.418 1.00 . A A . 135 TRP CZ3  1 1 
        1   1927 1 1 135 TRP H    H  -50.931   6.249  -79.969 1.00 . A A . 135 TRP H    1 1 
        1   1928 1 1 135 TRP HA   H  -53.362   6.960  -78.474 1.00 . A A . 135 TRP HA   1 1 
        1   1929 1 1 135 TRP HB2  H  -52.528   9.317  -78.304 1.00 . A A . 135 TRP HB2  1 1 
        1   1930 1 1 135 TRP HB3  H  -51.771   8.134  -77.267 1.00 . A A . 135 TRP HB3  1 1 
        1   1931 1 1 135 TRP HD1  H  -49.360   7.088  -78.843 1.00 . A A . 135 TRP HD1  1 1 
        1   1932 1 1 135 TRP HE1  H  -47.450   8.630  -79.625 1.00 . A A . 135 TRP HE1  1 1 
        1   1933 1 1 135 TRP HE3  H  -51.821  11.586  -78.751 1.00 . A A . 135 TRP HE3  1 1 
        1   1934 1 1 135 TRP HH2  H  -48.193  13.511  -80.087 1.00 . A A . 135 TRP HH2  1 1 
        1   1935 1 1 135 TRP HZ2  H  -47.009  11.352  -80.137 1.00 . A A . 135 TRP HZ2  1 1 
        1   1936 1 1 135 TRP HZ3  H  -50.570  13.640  -79.405 1.00 . A A . 135 TRP HZ3  1 1 
        1   1937 1 1 135 TRP N    N  -51.669   6.177  -79.331 1.00 . A A . 135 TRP N    1 1 
        1   1938 1 1 135 TRP NE1  N  -48.366   8.942  -79.399 1.00 . A A . 135 TRP NE1  1 1 
        1   1939 1 1 135 TRP O    O  -54.187   8.558  -80.400 1.00 . A A . 135 TRP O    1 1 
        1   1940 1 1 136 ASP C    C  -53.251   9.106  -82.998 1.00 . A A . 136 ASP C    1 1 
        1   1941 1 1 136 ASP CA   C  -53.177   7.592  -82.840 1.00 . A A . 136 ASP CA   1 1 
        1   1942 1 1 136 ASP CB   C  -54.561   6.925  -83.024 1.00 . A A . 136 ASP CB   1 1 
        1   1943 1 1 136 ASP CG   C  -55.154   7.166  -84.439 1.00 . A A . 136 ASP CG   1 1 
        1   1944 1 1 136 ASP H    H  -51.926   6.670  -81.422 1.00 . A A . 136 ASP H    1 1 
        1   1945 1 1 136 ASP HA   H  -52.496   7.185  -83.571 1.00 . A A . 136 ASP HA   1 1 
        1   1946 1 1 136 ASP HB2  H  -54.459   5.861  -82.858 1.00 . A A . 136 ASP HB2  1 1 
        1   1947 1 1 136 ASP HB3  H  -55.230   7.330  -82.287 1.00 . A A . 136 ASP HB3  1 1 
        1   1948 1 1 136 ASP N    N  -52.674   7.283  -81.510 1.00 . A A . 136 ASP N    1 1 
        1   1949 1 1 136 ASP O    O  -52.372   9.721  -83.603 1.00 . A A . 136 ASP O    1 1 
        1   1950 1 1 136 ASP OD1  O  -55.795   8.209  -84.625 1.00 . A A . 136 ASP OD1  1 1 
        1   1951 1 1 136 ASP OD2  O  -54.981   6.301  -85.311 1.00 . A A . 136 ASP OD2  1 1 
        1   1952 1 1 137 PHE C    C  -55.103  11.561  -84.070 1.00 . A A . 137 PHE C    1 1 
        1   1953 1 1 137 PHE CA   C  -54.688  11.115  -82.640 1.00 . A A . 137 PHE CA   1 1 
        1   1954 1 1 137 PHE CB   C  -53.507  11.972  -82.163 1.00 . A A . 137 PHE CB   1 1 
        1   1955 1 1 137 PHE CD1  C  -54.372  13.845  -80.665 1.00 . A A . 137 PHE CD1  1 1 
        1   1956 1 1 137 PHE CD2  C  -53.806  14.383  -82.953 1.00 . A A . 137 PHE CD2  1 1 
        1   1957 1 1 137 PHE CE1  C  -54.732  15.189  -80.441 1.00 . A A . 137 PHE CE1  1 1 
        1   1958 1 1 137 PHE CE2  C  -54.168  15.727  -82.728 1.00 . A A . 137 PHE CE2  1 1 
        1   1959 1 1 137 PHE CG   C  -53.909  13.437  -81.923 1.00 . A A . 137 PHE CG   1 1 
        1   1960 1 1 137 PHE CZ   C  -54.634  16.128  -81.474 1.00 . A A . 137 PHE CZ   1 1 
        1   1961 1 1 137 PHE H    H  -55.051   9.072  -82.174 1.00 . A A . 137 PHE H    1 1 
        1   1962 1 1 137 PHE HA   H  -55.514  11.283  -81.995 1.00 . A A . 137 PHE HA   1 1 
        1   1963 1 1 137 PHE HB2  H  -53.145  11.564  -81.243 1.00 . A A . 137 PHE HB2  1 1 
        1   1964 1 1 137 PHE HB3  H  -52.728  11.941  -82.902 1.00 . A A . 137 PHE HB3  1 1 
        1   1965 1 1 137 PHE HD1  H  -54.452  13.129  -79.867 1.00 . A A . 137 PHE HD1  1 1 
        1   1966 1 1 137 PHE HD2  H  -53.443  14.082  -83.919 1.00 . A A . 137 PHE HD2  1 1 
        1   1967 1 1 137 PHE HE1  H  -55.091  15.496  -79.468 1.00 . A A . 137 PHE HE1  1 1 
        1   1968 1 1 137 PHE HE2  H  -54.094  16.448  -83.531 1.00 . A A . 137 PHE HE2  1 1 
        1   1969 1 1 137 PHE HZ   H  -54.912  17.158  -81.302 1.00 . A A . 137 PHE HZ   1 1 
        1   1970 1 1 137 PHE N    N  -54.378   9.662  -82.554 1.00 . A A . 137 PHE N    1 1 
        1   1971 1 1 137 PHE O    O  -55.535  12.709  -84.257 1.00 . A A . 137 PHE O    1 1 
        1   1972 1 1 138 LEU C    C  -57.001  10.962  -86.612 1.00 . A A . 138 LEU C    1 1 
        1   1973 1 1 138 LEU CA   C  -55.481  10.831  -86.441 1.00 . A A . 138 LEU CA   1 1 
        1   1974 1 1 138 LEU CB   C  -54.884   9.658  -87.287 1.00 . A A . 138 LEU CB   1 1 
        1   1975 1 1 138 LEU CD1  C  -54.197  10.463  -89.664 1.00 . A A . 138 LEU CD1  1 1 
        1   1976 1 1 138 LEU CD2  C  -55.069   8.127  -89.227 1.00 . A A . 138 LEU CD2  1 1 
        1   1977 1 1 138 LEU CG   C  -55.176   9.613  -88.820 1.00 . A A . 138 LEU CG   1 1 
        1   1978 1 1 138 LEU H    H  -54.827   9.724  -84.728 1.00 . A A . 138 LEU H    1 1 
        1   1979 1 1 138 LEU HA   H  -55.042  11.723  -86.762 1.00 . A A . 138 LEU HA   1 1 
        1   1980 1 1 138 LEU HB2  H  -53.839   9.712  -87.180 1.00 . A A . 138 LEU HB2  1 1 
        1   1981 1 1 138 LEU HB3  H  -55.241   8.745  -86.866 1.00 . A A . 138 LEU HB3  1 1 
        1   1982 1 1 138 LEU HD11 H  -54.076  11.429  -89.201 1.00 . A A . 138 LEU HD11 1 1 
        1   1983 1 1 138 LEU HD12 H  -54.617  10.596  -90.658 1.00 . A A . 138 LEU HD12 1 1 
        1   1984 1 1 138 LEU HD13 H  -53.238   9.976  -89.750 1.00 . A A . 138 LEU HD13 1 1 
        1   1985 1 1 138 LEU HD21 H  -54.169   7.692  -88.815 1.00 . A A . 138 LEU HD21 1 1 
        1   1986 1 1 138 LEU HD22 H  -55.061   8.043  -90.296 1.00 . A A . 138 LEU HD22 1 1 
        1   1987 1 1 138 LEU HD23 H  -55.930   7.604  -88.826 1.00 . A A . 138 LEU HD23 1 1 
        1   1988 1 1 138 LEU HG   H  -56.158   9.937  -89.014 1.00 . A A . 138 LEU HG   1 1 
        1   1989 1 1 138 LEU N    N  -55.090  10.607  -85.010 1.00 . A A . 138 LEU N    1 1 
        1   1990 1 1 138 LEU O    O  -57.761   9.989  -86.618 1.00 . A A . 138 LEU O    1 1 
        1   1991 1 1 139 GLY C    C  -59.772  11.774  -86.081 1.00 . A A . 139 GLY C    1 1 
        1   1992 1 1 139 GLY CA   C  -58.836  12.529  -87.024 1.00 . A A . 139 GLY CA   1 1 
        1   1993 1 1 139 GLY H    H  -56.765  12.945  -86.813 1.00 . A A . 139 GLY H    1 1 
        1   1994 1 1 139 GLY HA2  H  -58.982  13.585  -86.876 1.00 . A A . 139 GLY HA2  1 1 
        1   1995 1 1 139 GLY HA3  H  -59.091  12.276  -88.039 1.00 . A A . 139 GLY HA3  1 1 
        1   1996 1 1 139 GLY N    N  -57.425  12.214  -86.798 1.00 . A A . 139 GLY N    1 1 
        1   1997 1 1 139 GLY O    O  -60.214  12.315  -85.067 1.00 . A A . 139 GLY O    1 1 
        1   1998 1 1 140 LEU C    C  -60.421   8.235  -85.710 1.00 . A A . 140 LEU C    1 1 
        1   1999 1 1 140 LEU CA   C  -60.939   9.673  -85.619 1.00 . A A . 140 LEU CA   1 1 
        1   2000 1 1 140 LEU CB   C  -62.388   9.734  -86.150 1.00 . A A . 140 LEU CB   1 1 
        1   2001 1 1 140 LEU CD1  C  -63.733   9.242  -83.997 1.00 . A A . 140 LEU CD1  1 1 
        1   2002 1 1 140 LEU CD2  C  -63.141  11.593  -84.607 1.00 . A A . 140 LEU CD2  1 1 
        1   2003 1 1 140 LEU CG   C  -63.479  10.218  -85.152 1.00 . A A . 140 LEU CG   1 1 
        1   2004 1 1 140 LEU H    H  -59.670  10.160  -87.249 1.00 . A A . 140 LEU H    1 1 
        1   2005 1 1 140 LEU HA   H  -60.897   9.994  -84.608 1.00 . A A . 140 LEU HA   1 1 
        1   2006 1 1 140 LEU HB2  H  -62.403  10.419  -86.970 1.00 . A A . 140 LEU HB2  1 1 
        1   2007 1 1 140 LEU HB3  H  -62.663   8.768  -86.496 1.00 . A A . 140 LEU HB3  1 1 
        1   2008 1 1 140 LEU HD11 H  -62.916   9.289  -83.299 1.00 . A A . 140 LEU HD11 1 1 
        1   2009 1 1 140 LEU HD12 H  -63.836   8.241  -84.378 1.00 . A A . 140 LEU HD12 1 1 
        1   2010 1 1 140 LEU HD13 H  -64.653   9.528  -83.492 1.00 . A A . 140 LEU HD13 1 1 
        1   2011 1 1 140 LEU HD21 H  -62.576  12.143  -85.343 1.00 . A A . 140 LEU HD21 1 1 
        1   2012 1 1 140 LEU HD22 H  -62.560  11.492  -83.705 1.00 . A A . 140 LEU HD22 1 1 
        1   2013 1 1 140 LEU HD23 H  -64.058  12.123  -84.390 1.00 . A A . 140 LEU HD23 1 1 
        1   2014 1 1 140 LEU HG   H  -64.398  10.295  -85.717 1.00 . A A . 140 LEU HG   1 1 
        1   2015 1 1 140 LEU N    N  -60.063  10.522  -86.432 1.00 . A A . 140 LEU N    1 1 
        1   2016 1 1 140 LEU O    O  -60.990   7.395  -86.414 1.00 . A A . 140 LEU O    1 1 
        1   2017 1 1 141 GLU C    C  -58.766   6.010  -86.328 1.00 . A A . 141 GLU C    1 1 
        1   2018 1 1 141 GLU CA   C  -58.751   6.633  -84.944 1.00 . A A . 141 GLU CA   1 1 
        1   2019 1 1 141 GLU CB   C  -59.462   5.714  -83.930 1.00 . A A . 141 GLU CB   1 1 
        1   2020 1 1 141 GLU CD   C  -61.300   4.865  -85.515 1.00 . A A . 141 GLU CD   1 1 
        1   2021 1 1 141 GLU CG   C  -60.980   5.572  -84.185 1.00 . A A . 141 GLU CG   1 1 
        1   2022 1 1 141 GLU H    H  -58.964   8.669  -84.415 1.00 . A A . 141 GLU H    1 1 
        1   2023 1 1 141 GLU HA   H  -57.719   6.733  -84.635 1.00 . A A . 141 GLU HA   1 1 
        1   2024 1 1 141 GLU HB2  H  -59.017   4.750  -83.965 1.00 . A A . 141 GLU HB2  1 1 
        1   2025 1 1 141 GLU HB3  H  -59.322   6.130  -82.942 1.00 . A A . 141 GLU HB3  1 1 
        1   2026 1 1 141 GLU HG2  H  -61.400   4.987  -83.378 1.00 . A A . 141 GLU HG2  1 1 
        1   2027 1 1 141 GLU HG3  H  -61.430   6.542  -84.181 1.00 . A A . 141 GLU HG3  1 1 
        1   2028 1 1 141 GLU N    N  -59.355   7.960  -84.965 1.00 . A A . 141 GLU N    1 1 
        1   2029 1 1 141 GLU O    O  -58.982   6.705  -87.320 1.00 . A A . 141 GLU O    1 1 
        1   2030 1 1 141 GLU OE1  O  -60.705   3.821  -85.781 1.00 . A A . 141 GLU OE1  1 1 
        1   2031 1 1 141 GLU OE2  O  -62.153   5.383  -86.248 1.00 . A A . 141 GLU OE2  1 1 
        1   2032 1 1 142 MET C    C  -58.627   2.504  -87.421 1.00 . A A . 142 MET C    1 1 
        1   2033 1 1 142 MET CA   C  -58.619   3.995  -87.650 1.00 . A A . 142 MET CA   1 1 
        1   2034 1 1 142 MET CB   C  -57.490   4.408  -88.589 1.00 . A A . 142 MET CB   1 1 
        1   2035 1 1 142 MET CE   C  -54.143   2.295  -88.822 1.00 . A A . 142 MET CE   1 1 
        1   2036 1 1 142 MET CG   C  -56.129   4.037  -88.026 1.00 . A A . 142 MET CG   1 1 
        1   2037 1 1 142 MET H    H  -58.444   4.196  -85.564 1.00 . A A . 142 MET H    1 1 
        1   2038 1 1 142 MET HA   H  -59.549   4.254  -88.128 1.00 . A A . 142 MET HA   1 1 
        1   2039 1 1 142 MET HB2  H  -57.625   3.930  -89.540 1.00 . A A . 142 MET HB2  1 1 
        1   2040 1 1 142 MET HB3  H  -57.525   5.480  -88.718 1.00 . A A . 142 MET HB3  1 1 
        1   2041 1 1 142 MET HE1  H  -53.605   1.419  -88.490 1.00 . A A . 142 MET HE1  1 1 
        1   2042 1 1 142 MET HE2  H  -53.624   3.176  -88.487 1.00 . A A . 142 MET HE2  1 1 
        1   2043 1 1 142 MET HE3  H  -54.200   2.299  -89.902 1.00 . A A . 142 MET HE3  1 1 
        1   2044 1 1 142 MET HG2  H  -55.383   4.553  -88.591 1.00 . A A . 142 MET HG2  1 1 
        1   2045 1 1 142 MET HG3  H  -56.087   4.346  -87.006 1.00 . A A . 142 MET HG3  1 1 
        1   2046 1 1 142 MET N    N  -58.582   4.701  -86.390 1.00 . A A . 142 MET N    1 1 
        1   2047 1 1 142 MET O    O  -59.273   1.778  -88.193 1.00 . A A . 142 MET O    1 1 
        1   2048 1 1 142 MET SD   S  -55.822   2.256  -88.136 1.00 . A A . 142 MET SD   1 1 
        1   2049 1 1 143 PRO C    C  -59.464   0.083  -85.776 1.00 . A A . 143 PRO C    1 1 
        1   2050 1 1 143 PRO CA   C  -58.052   0.541  -86.140 1.00 . A A . 143 PRO CA   1 1 
        1   2051 1 1 143 PRO CB   C  -57.085   0.306  -84.975 1.00 . A A . 143 PRO CB   1 1 
        1   2052 1 1 143 PRO CD   C  -57.235   2.675  -85.272 1.00 . A A . 143 PRO CD   1 1 
        1   2053 1 1 143 PRO CG   C  -57.057   1.587  -84.213 1.00 . A A . 143 PRO CG   1 1 
        1   2054 1 1 143 PRO HA   H  -57.707   0.022  -87.014 1.00 . A A . 143 PRO HA   1 1 
        1   2055 1 1 143 PRO HB2  H  -57.442  -0.499  -84.352 1.00 . A A . 143 PRO HB2  1 1 
        1   2056 1 1 143 PRO HB3  H  -56.098   0.083  -85.352 1.00 . A A . 143 PRO HB3  1 1 
        1   2057 1 1 143 PRO HD2  H  -57.797   3.477  -84.856 1.00 . A A . 143 PRO HD2  1 1 
        1   2058 1 1 143 PRO HD3  H  -56.278   3.000  -85.621 1.00 . A A . 143 PRO HD3  1 1 
        1   2059 1 1 143 PRO HG2  H  -57.867   1.616  -83.488 1.00 . A A . 143 PRO HG2  1 1 
        1   2060 1 1 143 PRO HG3  H  -56.107   1.713  -83.708 1.00 . A A . 143 PRO HG3  1 1 
        1   2061 1 1 143 PRO N    N  -58.008   1.986  -86.363 1.00 . A A . 143 PRO N    1 1 
        1   2062 1 1 143 PRO O    O  -59.648  -1.056  -85.353 1.00 . A A . 143 PRO O    1 1 
        1   2063 1 1 144 GLN C    C  -62.791   1.075  -86.715 1.00 . A A . 144 GLN C    1 1 
        1   2064 1 1 144 GLN CA   C  -61.838   0.647  -85.602 1.00 . A A . 144 GLN CA   1 1 
        1   2065 1 1 144 GLN CB   C  -62.196   1.335  -84.270 1.00 . A A . 144 GLN CB   1 1 
        1   2066 1 1 144 GLN CD   C  -63.816   3.187  -84.881 1.00 . A A . 144 GLN CD   1 1 
        1   2067 1 1 144 GLN CG   C  -63.652   1.826  -84.223 1.00 . A A . 144 GLN CG   1 1 
        1   2068 1 1 144 GLN H    H  -60.243   1.854  -86.297 1.00 . A A . 144 GLN H    1 1 
        1   2069 1 1 144 GLN HA   H  -61.915  -0.418  -85.465 1.00 . A A . 144 GLN HA   1 1 
        1   2070 1 1 144 GLN HB2  H  -62.063   0.620  -83.471 1.00 . A A . 144 GLN HB2  1 1 
        1   2071 1 1 144 GLN HB3  H  -61.536   2.164  -84.113 1.00 . A A . 144 GLN HB3  1 1 
        1   2072 1 1 144 GLN HE21 H  -63.594   4.146  -83.141 1.00 . A A . 144 GLN HE21 1 1 
        1   2073 1 1 144 GLN HE22 H  -63.863   5.154  -84.481 1.00 . A A . 144 GLN HE22 1 1 
        1   2074 1 1 144 GLN HG2  H  -64.285   1.118  -84.706 1.00 . A A . 144 GLN HG2  1 1 
        1   2075 1 1 144 GLN HG3  H  -63.944   1.916  -83.186 1.00 . A A . 144 GLN HG3  1 1 
        1   2076 1 1 144 GLN N    N  -60.451   0.972  -85.939 1.00 . A A . 144 GLN N    1 1 
        1   2077 1 1 144 GLN NE2  N  -63.752   4.256  -84.111 1.00 . A A . 144 GLN NE2  1 1 
        1   2078 1 1 144 GLN O    O  -63.894   0.526  -86.834 1.00 . A A . 144 GLN O    1 1 
        1   2079 1 1 144 GLN OE1  O  -64.022   3.275  -86.104 1.00 . A A . 144 GLN OE1  1 1 
        1   2080 1 1 145 TRP C    C  -63.442   1.183  -89.503 1.00 . A A . 145 TRP C    1 1 
        1   2081 1 1 145 TRP CA   C  -63.133   2.451  -88.708 1.00 . A A . 145 TRP CA   1 1 
        1   2082 1 1 145 TRP CB   C  -62.341   3.432  -89.618 1.00 . A A . 145 TRP CB   1 1 
        1   2083 1 1 145 TRP CD1  C  -64.092   5.323  -89.456 1.00 . A A . 145 TRP CD1  1 1 
        1   2084 1 1 145 TRP CD2  C  -61.985   6.066  -89.691 1.00 . A A . 145 TRP CD2  1 1 
        1   2085 1 1 145 TRP CE2  C  -62.845   7.210  -89.616 1.00 . A A . 145 TRP CE2  1 1 
        1   2086 1 1 145 TRP CE3  C  -60.604   6.290  -89.840 1.00 . A A . 145 TRP CE3  1 1 
        1   2087 1 1 145 TRP CG   C  -62.808   4.878  -89.582 1.00 . A A . 145 TRP CG   1 1 
        1   2088 1 1 145 TRP CH2  C  -61.004   8.706  -89.832 1.00 . A A . 145 TRP CH2  1 1 
        1   2089 1 1 145 TRP CZ2  C  -62.361   8.500  -89.686 1.00 . A A . 145 TRP CZ2  1 1 
        1   2090 1 1 145 TRP CZ3  C  -60.124   7.608  -89.910 1.00 . A A . 145 TRP CZ3  1 1 
        1   2091 1 1 145 TRP H    H  -61.428   2.345  -87.443 1.00 . A A . 145 TRP H    1 1 
        1   2092 1 1 145 TRP HA   H  -64.049   2.894  -88.376 1.00 . A A . 145 TRP HA   1 1 
        1   2093 1 1 145 TRP HB2  H  -61.319   3.413  -89.317 1.00 . A A . 145 TRP HB2  1 1 
        1   2094 1 1 145 TRP HB3  H  -62.414   3.075  -90.630 1.00 . A A . 145 TRP HB3  1 1 
        1   2095 1 1 145 TRP HD1  H  -64.955   4.701  -89.357 1.00 . A A . 145 TRP HD1  1 1 
        1   2096 1 1 145 TRP HE1  H  -64.912   7.274  -89.401 1.00 . A A . 145 TRP HE1  1 1 
        1   2097 1 1 145 TRP HE3  H  -59.913   5.455  -89.905 1.00 . A A . 145 TRP HE3  1 1 
        1   2098 1 1 145 TRP HH2  H  -60.621   9.706  -89.890 1.00 . A A . 145 TRP HH2  1 1 
        1   2099 1 1 145 TRP HZ2  H  -63.040   9.351  -89.624 1.00 . A A . 145 TRP HZ2  1 1 
        1   2100 1 1 145 TRP HZ3  H  -59.071   7.790  -90.027 1.00 . A A . 145 TRP HZ3  1 1 
        1   2101 1 1 145 TRP N    N  -62.329   2.000  -87.565 1.00 . A A . 145 TRP N    1 1 
        1   2102 1 1 145 TRP NE1  N  -64.104   6.698  -89.477 1.00 . A A . 145 TRP NE1  1 1 
        1   2103 1 1 145 TRP O    O  -64.504   1.063  -90.092 1.00 . A A . 145 TRP O    1 1 
        1   2104 1 1 146 LEU C    C  -63.829  -1.826  -89.954 1.00 . A A . 146 LEU C    1 1 
        1   2105 1 1 146 LEU CA   C  -62.540  -1.033  -90.201 1.00 . A A . 146 LEU CA   1 1 
        1   2106 1 1 146 LEU CB   C  -61.373  -1.925  -89.786 1.00 . A A . 146 LEU CB   1 1 
        1   2107 1 1 146 LEU CD1  C  -60.112  -2.449  -91.936 1.00 . A A . 146 LEU CD1  1 1 
        1   2108 1 1 146 LEU CD2  C  -59.753  -0.187  -90.821 1.00 . A A . 146 LEU CD2  1 1 
        1   2109 1 1 146 LEU CG   C  -60.049  -1.685  -90.618 1.00 . A A . 146 LEU CG   1 1 
        1   2110 1 1 146 LEU H    H  -61.646   0.462  -89.003 1.00 . A A . 146 LEU H    1 1 
        1   2111 1 1 146 LEU HA   H  -62.475  -0.845  -91.238 1.00 . A A . 146 LEU HA   1 1 
        1   2112 1 1 146 LEU HB2  H  -61.129  -1.751  -88.767 1.00 . A A . 146 LEU HB2  1 1 
        1   2113 1 1 146 LEU HB3  H  -61.649  -2.955  -89.922 1.00 . A A . 146 LEU HB3  1 1 
        1   2114 1 1 146 LEU HD11 H  -61.129  -2.735  -92.160 1.00 . A A . 146 LEU HD11 1 1 
        1   2115 1 1 146 LEU HD12 H  -59.504  -3.344  -91.846 1.00 . A A . 146 LEU HD12 1 1 
        1   2116 1 1 146 LEU HD13 H  -59.726  -1.833  -92.726 1.00 . A A . 146 LEU HD13 1 1 
        1   2117 1 1 146 LEU HD21 H  -59.949   0.355  -89.907 1.00 . A A . 146 LEU HD21 1 1 
        1   2118 1 1 146 LEU HD22 H  -60.359   0.211  -91.616 1.00 . A A . 146 LEU HD22 1 1 
        1   2119 1 1 146 LEU HD23 H  -58.704  -0.076  -91.080 1.00 . A A . 146 LEU HD23 1 1 
        1   2120 1 1 146 LEU HG   H  -59.261  -2.115  -90.034 1.00 . A A . 146 LEU HG   1 1 
        1   2121 1 1 146 LEU N    N  -62.464   0.259  -89.493 1.00 . A A . 146 LEU N    1 1 
        1   2122 1 1 146 LEU O    O  -64.255  -2.537  -90.857 1.00 . A A . 146 LEU O    1 1 
        1   2123 1 1 147 LEU C    C  -66.791  -1.887  -89.533 1.00 . A A . 147 LEU C    1 1 
        1   2124 1 1 147 LEU CA   C  -65.747  -2.347  -88.524 1.00 . A A . 147 LEU CA   1 1 
        1   2125 1 1 147 LEU CB   C  -66.128  -2.020  -87.060 1.00 . A A . 147 LEU CB   1 1 
        1   2126 1 1 147 LEU CD1  C  -68.072  -0.436  -86.736 1.00 . A A . 147 LEU CD1  1 1 
        1   2127 1 1 147 LEU CD2  C  -68.586  -2.828  -87.334 1.00 . A A . 147 LEU CD2  1 1 
        1   2128 1 1 147 LEU CG   C  -67.621  -1.903  -86.613 1.00 . A A . 147 LEU CG   1 1 
        1   2129 1 1 147 LEU H    H  -64.092  -1.040  -88.142 1.00 . A A . 147 LEU H    1 1 
        1   2130 1 1 147 LEU HA   H  -65.590  -3.395  -88.632 1.00 . A A . 147 LEU HA   1 1 
        1   2131 1 1 147 LEU HB2  H  -65.667  -2.735  -86.424 1.00 . A A . 147 LEU HB2  1 1 
        1   2132 1 1 147 LEU HB3  H  -65.697  -1.083  -86.875 1.00 . A A . 147 LEU HB3  1 1 
        1   2133 1 1 147 LEU HD11 H  -69.146  -0.395  -86.792 1.00 . A A . 147 LEU HD11 1 1 
        1   2134 1 1 147 LEU HD12 H  -67.641   0.001  -87.623 1.00 . A A . 147 LEU HD12 1 1 
        1   2135 1 1 147 LEU HD13 H  -67.735   0.116  -85.865 1.00 . A A . 147 LEU HD13 1 1 
        1   2136 1 1 147 LEU HD21 H  -69.096  -2.285  -88.111 1.00 . A A . 147 LEU HD21 1 1 
        1   2137 1 1 147 LEU HD22 H  -69.316  -3.195  -86.616 1.00 . A A . 147 LEU HD22 1 1 
        1   2138 1 1 147 LEU HD23 H  -68.047  -3.655  -87.751 1.00 . A A . 147 LEU HD23 1 1 
        1   2139 1 1 147 LEU HG   H  -67.641  -2.142  -85.554 1.00 . A A . 147 LEU HG   1 1 
        1   2140 1 1 147 LEU N    N  -64.463  -1.656  -88.803 1.00 . A A . 147 LEU N    1 1 
        1   2141 1 1 147 LEU O    O  -67.537  -2.710  -90.056 1.00 . A A . 147 LEU O    1 1 
        1   2142 1 1 148 GLY C    C  -67.480  -0.457  -92.206 1.00 . A A . 148 GLY C    1 1 
        1   2143 1 1 148 GLY CA   C  -67.797  -0.034  -90.777 1.00 . A A . 148 GLY CA   1 1 
        1   2144 1 1 148 GLY H    H  -66.220   0.024  -89.362 1.00 . A A . 148 GLY H    1 1 
        1   2145 1 1 148 GLY HA2  H  -68.784  -0.376  -90.528 1.00 . A A . 148 GLY HA2  1 1 
        1   2146 1 1 148 GLY HA3  H  -67.766   1.042  -90.722 1.00 . A A . 148 GLY HA3  1 1 
        1   2147 1 1 148 GLY N    N  -66.838  -0.583  -89.812 1.00 . A A . 148 GLY N    1 1 
        1   2148 1 1 148 GLY O    O  -68.381  -0.803  -92.968 1.00 . A A . 148 GLY O    1 1 
        1   2149 1 1 149 ILE C    C  -66.163  -2.297  -94.219 1.00 . A A . 149 ILE C    1 1 
        1   2150 1 1 149 ILE CA   C  -65.772  -0.799  -93.896 1.00 . A A . 149 ILE CA   1 1 
        1   2151 1 1 149 ILE CB   C  -64.189  -0.567  -94.081 1.00 . A A . 149 ILE CB   1 1 
        1   2152 1 1 149 ILE CD1  C  -62.365   1.296  -93.940 1.00 . A A . 149 ILE CD1  1 1 
        1   2153 1 1 149 ILE CG1  C  -63.916   0.979  -94.162 1.00 . A A . 149 ILE CG1  1 1 
        1   2154 1 1 149 ILE CG2  C  -63.678  -1.226  -95.350 1.00 . A A . 149 ILE CG2  1 1 
        1   2155 1 1 149 ILE H    H  -65.534  -0.150  -91.889 1.00 . A A . 149 ILE H    1 1 
        1   2156 1 1 149 ILE HA   H  -66.286  -0.185  -94.585 1.00 . A A . 149 ILE HA   1 1 
        1   2157 1 1 149 ILE HB   H  -63.683  -0.964  -93.245 1.00 . A A . 149 ILE HB   1 1 
        1   2158 1 1 149 ILE HD11 H  -61.786   0.434  -94.183 1.00 . A A . 149 ILE HD11 1 1 
        1   2159 1 1 149 ILE HD12 H  -62.229   1.575  -92.912 1.00 . A A . 149 ILE HD12 1 1 
        1   2160 1 1 149 ILE HD13 H  -62.114   2.120  -94.585 1.00 . A A . 149 ILE HD13 1 1 
        1   2161 1 1 149 ILE HG12 H  -64.178   1.335  -95.124 1.00 . A A . 149 ILE HG12 1 1 
        1   2162 1 1 149 ILE HG13 H  -64.462   1.466  -93.400 1.00 . A A . 149 ILE HG13 1 1 
        1   2163 1 1 149 ILE HG21 H  -64.344  -1.028  -96.175 1.00 . A A . 149 ILE HG21 1 1 
        1   2164 1 1 149 ILE HG22 H  -63.616  -2.288  -95.179 1.00 . A A . 149 ILE HG22 1 1 
        1   2165 1 1 149 ILE HG23 H  -62.694  -0.840  -95.580 1.00 . A A . 149 ILE HG23 1 1 
        1   2166 1 1 149 ILE N    N  -66.195  -0.430  -92.550 1.00 . A A . 149 ILE N    1 1 
        1   2167 1 1 149 ILE O    O  -66.685  -2.561  -95.304 1.00 . A A . 149 ILE O    1 1 
        1   2168 1 1 150 PHE C    C  -67.760  -4.793  -93.438 1.00 . A A . 150 PHE C    1 1 
        1   2169 1 1 150 PHE CA   C  -66.258  -4.620  -93.468 1.00 . A A . 150 PHE CA   1 1 
        1   2170 1 1 150 PHE CB   C  -65.638  -5.520  -92.382 1.00 . A A . 150 PHE CB   1 1 
        1   2171 1 1 150 PHE CD1  C  -64.102  -7.215  -93.468 1.00 . A A . 150 PHE CD1  1 1 
        1   2172 1 1 150 PHE CD2  C  -63.122  -5.319  -92.362 1.00 . A A . 150 PHE CD2  1 1 
        1   2173 1 1 150 PHE CE1  C  -62.820  -7.694  -93.792 1.00 . A A . 150 PHE CE1  1 1 
        1   2174 1 1 150 PHE CE2  C  -61.843  -5.795  -92.682 1.00 . A A . 150 PHE CE2  1 1 
        1   2175 1 1 150 PHE CG   C  -64.251  -6.025  -92.756 1.00 . A A . 150 PHE CG   1 1 
        1   2176 1 1 150 PHE CZ   C  -61.691  -6.982  -93.400 1.00 . A A . 150 PHE CZ   1 1 
        1   2177 1 1 150 PHE H    H  -65.492  -2.927  -92.442 1.00 . A A . 150 PHE H    1 1 
        1   2178 1 1 150 PHE HA   H  -65.902  -4.932  -94.431 1.00 . A A . 150 PHE HA   1 1 
        1   2179 1 1 150 PHE HB2  H  -65.561  -4.962  -91.472 1.00 . A A . 150 PHE HB2  1 1 
        1   2180 1 1 150 PHE HB3  H  -66.282  -6.371  -92.225 1.00 . A A . 150 PHE HB3  1 1 
        1   2181 1 1 150 PHE HD1  H  -64.970  -7.766  -93.770 1.00 . A A . 150 PHE HD1  1 1 
        1   2182 1 1 150 PHE HD2  H  -63.227  -4.405  -91.811 1.00 . A A . 150 PHE HD2  1 1 
        1   2183 1 1 150 PHE HE1  H  -62.713  -8.614  -94.349 1.00 . A A . 150 PHE HE1  1 1 
        1   2184 1 1 150 PHE HE2  H  -60.974  -5.236  -92.372 1.00 . A A . 150 PHE HE2  1 1 
        1   2185 1 1 150 PHE HZ   H  -60.704  -7.345  -93.648 1.00 . A A . 150 PHE HZ   1 1 
        1   2186 1 1 150 PHE N    N  -65.911  -3.206  -93.276 1.00 . A A . 150 PHE N    1 1 
        1   2187 1 1 150 PHE O    O  -68.292  -5.661  -94.118 1.00 . A A . 150 PHE O    1 1 
        1   2188 1 1 151 ILE C    C  -70.364  -3.724  -94.122 1.00 . A A . 151 ILE C    1 1 
        1   2189 1 1 151 ILE CA   C  -69.878  -4.002  -92.652 1.00 . A A . 151 ILE CA   1 1 
        1   2190 1 1 151 ILE CB   C  -70.494  -2.939  -91.673 1.00 . A A . 151 ILE CB   1 1 
        1   2191 1 1 151 ILE CD1  C  -70.844  -4.589  -89.666 1.00 . A A . 151 ILE CD1  1 1 
        1   2192 1 1 151 ILE CG1  C  -71.553  -3.671  -90.714 1.00 . A A . 151 ILE CG1  1 1 
        1   2193 1 1 151 ILE CG2  C  -71.259  -1.861  -92.435 1.00 . A A . 151 ILE CG2  1 1 
        1   2194 1 1 151 ILE H    H  -67.963  -3.226  -92.209 1.00 . A A . 151 ILE H    1 1 
        1   2195 1 1 151 ILE HA   H  -70.199  -4.978  -92.387 1.00 . A A . 151 ILE HA   1 1 
        1   2196 1 1 151 ILE HB   H  -69.731  -2.511  -91.085 1.00 . A A . 151 ILE HB   1 1 
        1   2197 1 1 151 ILE HD11 H  -69.918  -4.952  -90.059 1.00 . A A . 151 ILE HD11 1 1 
        1   2198 1 1 151 ILE HD12 H  -71.513  -5.411  -89.462 1.00 . A A . 151 ILE HD12 1 1 
        1   2199 1 1 151 ILE HD13 H  -70.680  -4.020  -88.770 1.00 . A A . 151 ILE HD13 1 1 
        1   2200 1 1 151 ILE HG12 H  -72.084  -2.918  -90.199 1.00 . A A . 151 ILE HG12 1 1 
        1   2201 1 1 151 ILE HG13 H  -72.193  -4.262  -91.316 1.00 . A A . 151 ILE HG13 1 1 
        1   2202 1 1 151 ILE HG21 H  -70.585  -1.393  -93.129 1.00 . A A . 151 ILE HG21 1 1 
        1   2203 1 1 151 ILE HG22 H  -71.631  -1.129  -91.742 1.00 . A A . 151 ILE HG22 1 1 
        1   2204 1 1 151 ILE HG23 H  -72.089  -2.299  -92.976 1.00 . A A . 151 ILE HG23 1 1 
        1   2205 1 1 151 ILE N    N  -68.439  -3.925  -92.694 1.00 . A A . 151 ILE N    1 1 
        1   2206 1 1 151 ILE O    O  -71.227  -4.416  -94.596 1.00 . A A . 151 ILE O    1 1 
        1   2207 1 1 152 ALA C    C  -69.918  -3.566  -97.149 1.00 . A A . 152 ALA C    1 1 
        1   2208 1 1 152 ALA CA   C  -70.035  -2.390  -96.144 1.00 . A A . 152 ALA CA   1 1 
        1   2209 1 1 152 ALA CB   C  -69.138  -1.228  -96.601 1.00 . A A . 152 ALA CB   1 1 
        1   2210 1 1 152 ALA H    H  -68.991  -2.275  -94.290 1.00 . A A . 152 ALA H    1 1 
        1   2211 1 1 152 ALA HA   H  -71.045  -2.046  -96.169 1.00 . A A . 152 ALA HA   1 1 
        1   2212 1 1 152 ALA HB1  H  -69.601  -0.734  -97.445 1.00 . A A . 152 ALA HB1  1 1 
        1   2213 1 1 152 ALA HB2  H  -68.168  -1.600  -96.891 1.00 . A A . 152 ALA HB2  1 1 
        1   2214 1 1 152 ALA HB3  H  -69.027  -0.520  -95.792 1.00 . A A . 152 ALA HB3  1 1 
        1   2215 1 1 152 ALA N    N  -69.713  -2.751  -94.754 1.00 . A A . 152 ALA N    1 1 
        1   2216 1 1 152 ALA O    O  -70.855  -3.817  -97.914 1.00 . A A . 152 ALA O    1 1 
        1   2217 1 1 153 TYR C    C  -69.654  -6.487  -97.653 1.00 . A A . 153 TYR C    1 1 
        1   2218 1 1 153 TYR CA   C  -68.612  -5.431  -98.011 1.00 . A A . 153 TYR CA   1 1 
        1   2219 1 1 153 TYR CB   C  -67.214  -6.052  -97.812 1.00 . A A . 153 TYR CB   1 1 
        1   2220 1 1 153 TYR CD1  C  -66.194  -3.915  -98.777 1.00 . A A . 153 TYR CD1  1 1 
        1   2221 1 1 153 TYR CD2  C  -64.831  -5.886  -98.598 1.00 . A A . 153 TYR CD2  1 1 
        1   2222 1 1 153 TYR CE1  C  -65.103  -3.215  -99.313 1.00 . A A . 153 TYR CE1  1 1 
        1   2223 1 1 153 TYR CE2  C  -63.751  -5.190  -99.133 1.00 . A A . 153 TYR CE2  1 1 
        1   2224 1 1 153 TYR CG   C  -66.061  -5.252  -98.422 1.00 . A A . 153 TYR CG   1 1 
        1   2225 1 1 153 TYR CZ   C  -63.880  -3.860  -99.488 1.00 . A A . 153 TYR CZ   1 1 
        1   2226 1 1 153 TYR H    H  -68.110  -4.072  -96.475 1.00 . A A . 153 TYR H    1 1 
        1   2227 1 1 153 TYR HA   H  -68.740  -5.139  -99.037 1.00 . A A . 153 TYR HA   1 1 
        1   2228 1 1 153 TYR HB2  H  -67.033  -6.132  -96.760 1.00 . A A . 153 TYR HB2  1 1 
        1   2229 1 1 153 TYR HB3  H  -67.219  -7.035  -98.245 1.00 . A A . 153 TYR HB3  1 1 
        1   2230 1 1 153 TYR HD1  H  -67.129  -3.418  -98.643 1.00 . A A . 153 TYR HD1  1 1 
        1   2231 1 1 153 TYR HD2  H  -64.712  -6.913  -98.322 1.00 . A A . 153 TYR HD2  1 1 
        1   2232 1 1 153 TYR HE1  H  -65.210  -2.174  -99.582 1.00 . A A . 153 TYR HE1  1 1 
        1   2233 1 1 153 TYR HE2  H  -62.807  -5.689  -99.262 1.00 . A A . 153 TYR HE2  1 1 
        1   2234 1 1 153 TYR HH   H  -62.638  -2.417  -99.479 1.00 . A A . 153 TYR HH   1 1 
        1   2235 1 1 153 TYR N    N  -68.802  -4.292  -97.120 1.00 . A A . 153 TYR N    1 1 
        1   2236 1 1 153 TYR O    O  -70.346  -7.003  -98.516 1.00 . A A . 153 TYR O    1 1 
        1   2237 1 1 153 TYR OH   O  -62.800  -3.193 -100.017 1.00 . A A . 153 TYR OH   1 1 
        1   2238 1 1 154 LEU C    C  -72.141  -7.266  -96.162 1.00 . A A . 154 LEU C    1 1 
        1   2239 1 1 154 LEU CA   C  -70.746  -7.737  -95.832 1.00 . A A . 154 LEU CA   1 1 
        1   2240 1 1 154 LEU CB   C  -70.551  -7.871  -94.303 1.00 . A A . 154 LEU CB   1 1 
        1   2241 1 1 154 LEU CD1  C  -71.334  -9.304  -92.383 1.00 . A A . 154 LEU CD1  1 1 
        1   2242 1 1 154 LEU CD2  C  -72.605  -7.223  -92.977 1.00 . A A . 154 LEU CD2  1 1 
        1   2243 1 1 154 LEU CG   C  -71.793  -8.397  -93.536 1.00 . A A . 154 LEU CG   1 1 
        1   2244 1 1 154 LEU H    H  -69.187  -6.294  -95.721 1.00 . A A . 154 LEU H    1 1 
        1   2245 1 1 154 LEU HA   H  -70.563  -8.691  -96.301 1.00 . A A . 154 LEU HA   1 1 
        1   2246 1 1 154 LEU HB2  H  -69.754  -8.558  -94.134 1.00 . A A . 154 LEU HB2  1 1 
        1   2247 1 1 154 LEU HB3  H  -70.284  -6.912  -93.919 1.00 . A A . 154 LEU HB3  1 1 
        1   2248 1 1 154 LEU HD11 H  -72.125  -9.398  -91.659 1.00 . A A . 154 LEU HD11 1 1 
        1   2249 1 1 154 LEU HD12 H  -70.456  -8.886  -91.911 1.00 . A A . 154 LEU HD12 1 1 
        1   2250 1 1 154 LEU HD13 H  -71.095 -10.277  -92.787 1.00 . A A . 154 LEU HD13 1 1 
        1   2251 1 1 154 LEU HD21 H  -72.263  -6.969  -91.985 1.00 . A A . 154 LEU HD21 1 1 
        1   2252 1 1 154 LEU HD22 H  -73.645  -7.508  -92.940 1.00 . A A . 154 LEU HD22 1 1 
        1   2253 1 1 154 LEU HD23 H  -72.486  -6.373  -93.627 1.00 . A A . 154 LEU HD23 1 1 
        1   2254 1 1 154 LEU HG   H  -72.405  -8.967  -94.186 1.00 . A A . 154 LEU HG   1 1 
        1   2255 1 1 154 LEU N    N  -69.767  -6.763  -96.350 1.00 . A A . 154 LEU N    1 1 
        1   2256 1 1 154 LEU O    O  -72.998  -8.058  -96.564 1.00 . A A . 154 LEU O    1 1 
        1   2257 1 1 155 ILE C    C  -74.020  -5.414  -97.846 1.00 . A A . 155 ILE C    1 1 
        1   2258 1 1 155 ILE CA   C  -73.689  -5.460  -96.191 1.00 . A A . 155 ILE CA   1 1 
        1   2259 1 1 155 ILE CB   C  -73.906  -4.000  -95.548 1.00 . A A . 155 ILE CB   1 1 
        1   2260 1 1 155 ILE CD1  C  -74.840  -2.953  -93.377 1.00 . A A . 155 ILE CD1  1 1 
        1   2261 1 1 155 ILE CG1  C  -74.653  -4.244  -94.181 1.00 . A A . 155 ILE CG1  1 1 
        1   2262 1 1 155 ILE CG2  C  -74.687  -3.082  -96.482 1.00 . A A . 155 ILE CG2  1 1 
        1   2263 1 1 155 ILE H    H  -71.685  -5.408  -95.581 1.00 . A A . 155 ILE H    1 1 
        1   2264 1 1 155 ILE HA   H  -74.406  -6.113  -95.810 1.00 . A A . 155 ILE HA   1 1 
        1   2265 1 1 155 ILE HB   H  -72.957  -3.603  -95.360 1.00 . A A . 155 ILE HB   1 1 
        1   2266 1 1 155 ILE HD11 H  -74.226  -2.997  -92.486 1.00 . A A . 155 ILE HD11 1 1 
        1   2267 1 1 155 ILE HD12 H  -75.881  -2.877  -93.081 1.00 . A A . 155 ILE HD12 1 1 
        1   2268 1 1 155 ILE HD13 H  -74.569  -2.095  -93.964 1.00 . A A . 155 ILE HD13 1 1 
        1   2269 1 1 155 ILE HG12 H  -75.610  -4.667  -94.384 1.00 . A A . 155 ILE HG12 1 1 
        1   2270 1 1 155 ILE HG13 H  -74.070  -4.933  -93.607 1.00 . A A . 155 ILE HG13 1 1 
        1   2271 1 1 155 ILE HG21 H  -74.078  -2.878  -97.356 1.00 . A A . 155 ILE HG21 1 1 
        1   2272 1 1 155 ILE HG22 H  -74.893  -2.160  -95.968 1.00 . A A . 155 ILE HG22 1 1 
        1   2273 1 1 155 ILE HG23 H  -75.613  -3.542  -96.795 1.00 . A A . 155 ILE HG23 1 1 
        1   2274 1 1 155 ILE N    N  -72.387  -5.983  -95.945 1.00 . A A . 155 ILE N    1 1 
        1   2275 1 1 155 ILE O    O  -75.144  -5.678  -98.178 1.00 . A A . 155 ILE O    1 1 
        1   2276 1 1 156 VAL C    C  -73.395  -6.801 -100.374 1.00 . A A . 156 VAL C    1 1 
        1   2277 1 1 156 VAL CA   C  -73.105  -5.329 -100.062 1.00 . A A . 156 VAL CA   1 1 
        1   2278 1 1 156 VAL CB   C  -71.800  -4.844 -100.791 1.00 . A A . 156 VAL CB   1 1 
        1   2279 1 1 156 VAL CG1  C  -71.646  -5.496 -102.186 1.00 . A A . 156 VAL CG1  1 1 
        1   2280 1 1 156 VAL CG2  C  -71.805  -3.310 -100.922 1.00 . A A . 156 VAL CG2  1 1 
        1   2281 1 1 156 VAL H    H  -72.080  -5.169  -98.214 1.00 . A A . 156 VAL H    1 1 
        1   2282 1 1 156 VAL HA   H  -73.940  -4.739 -100.388 1.00 . A A . 156 VAL HA   1 1 
        1   2283 1 1 156 VAL HB   H  -70.957  -5.129 -100.200 1.00 . A A . 156 VAL HB   1 1 
        1   2284 1 1 156 VAL HG11 H  -71.310  -6.519 -102.060 1.00 . A A . 156 VAL HG11 1 1 
        1   2285 1 1 156 VAL HG12 H  -70.912  -4.953 -102.765 1.00 . A A . 156 VAL HG12 1 1 
        1   2286 1 1 156 VAL HG13 H  -72.590  -5.492 -102.708 1.00 . A A . 156 VAL HG13 1 1 
        1   2287 1 1 156 VAL HG21 H  -70.784  -2.958 -100.989 1.00 . A A . 156 VAL HG21 1 1 
        1   2288 1 1 156 VAL HG22 H  -72.273  -2.879 -100.047 1.00 . A A . 156 VAL HG22 1 1 
        1   2289 1 1 156 VAL HG23 H  -72.347  -3.014 -101.804 1.00 . A A . 156 VAL HG23 1 1 
        1   2290 1 1 156 VAL N    N  -72.964  -5.251  -98.615 1.00 . A A . 156 VAL N    1 1 
        1   2291 1 1 156 VAL O    O  -74.384  -7.104 -101.025 1.00 . A A . 156 VAL O    1 1 
        1   2292 1 1 157 ALA C    C  -74.112  -9.673  -99.562 1.00 . A A . 157 ALA C    1 1 
        1   2293 1 1 157 ALA CA   C  -72.737  -9.155 -100.008 1.00 . A A . 157 ALA CA   1 1 
        1   2294 1 1 157 ALA CB   C  -71.633  -9.902  -99.256 1.00 . A A . 157 ALA CB   1 1 
        1   2295 1 1 157 ALA H    H  -71.839  -7.390  -99.257 1.00 . A A . 157 ALA H    1 1 
        1   2296 1 1 157 ALA HA   H  -72.626  -9.377 -101.046 1.00 . A A . 157 ALA HA   1 1 
        1   2297 1 1 157 ALA HB1  H  -70.853  -9.211  -98.985 1.00 . A A . 157 ALA HB1  1 1 
        1   2298 1 1 157 ALA HB2  H  -71.229 -10.672  -99.898 1.00 . A A . 157 ALA HB2  1 1 
        1   2299 1 1 157 ALA HB3  H  -72.037 -10.356  -98.365 1.00 . A A . 157 ALA HB3  1 1 
        1   2300 1 1 157 ALA N    N  -72.567  -7.706  -99.818 1.00 . A A . 157 ALA N    1 1 
        1   2301 1 1 157 ALA O    O  -74.786 -10.356 -100.334 1.00 . A A . 157 ALA O    1 1 
        1   2302 1 1 158 VAL C    C  -76.893  -9.330  -98.913 1.00 . A A . 158 VAL C    1 1 
        1   2303 1 1 158 VAL CA   C  -75.851  -9.839  -97.918 1.00 . A A . 158 VAL CA   1 1 
        1   2304 1 1 158 VAL CB   C  -76.162  -9.441  -96.436 1.00 . A A . 158 VAL CB   1 1 
        1   2305 1 1 158 VAL CG1  C  -77.646  -9.669  -96.098 1.00 . A A . 158 VAL CG1  1 1 
        1   2306 1 1 158 VAL CG2  C  -75.287 -10.286  -95.492 1.00 . A A . 158 VAL CG2  1 1 
        1   2307 1 1 158 VAL H    H  -74.004  -8.786  -97.761 1.00 . A A . 158 VAL H    1 1 
        1   2308 1 1 158 VAL HA   H  -75.839 -10.904  -97.987 1.00 . A A . 158 VAL HA   1 1 
        1   2309 1 1 158 VAL HB   H  -75.928  -8.408  -96.290 1.00 . A A . 158 VAL HB   1 1 
        1   2310 1 1 158 VAL HG11 H  -77.761  -9.789  -95.027 1.00 . A A . 158 VAL HG11 1 1 
        1   2311 1 1 158 VAL HG12 H  -78.010 -10.551  -96.598 1.00 . A A . 158 VAL HG12 1 1 
        1   2312 1 1 158 VAL HG13 H  -78.218  -8.808  -96.420 1.00 . A A . 158 VAL HG13 1 1 
        1   2313 1 1 158 VAL HG21 H  -75.651 -11.301  -95.462 1.00 . A A . 158 VAL HG21 1 1 
        1   2314 1 1 158 VAL HG22 H  -75.326  -9.860  -94.498 1.00 . A A . 158 VAL HG22 1 1 
        1   2315 1 1 158 VAL HG23 H  -74.267 -10.277  -95.845 1.00 . A A . 158 VAL HG23 1 1 
        1   2316 1 1 158 VAL N    N  -74.550  -9.344  -98.346 1.00 . A A . 158 VAL N    1 1 
        1   2317 1 1 158 VAL O    O  -77.751 -10.096  -99.339 1.00 . A A . 158 VAL O    1 1 
        1   2318 1 1 159 LEU C    C  -77.984  -7.961 -101.517 1.00 . A A . 159 LEU C    1 1 
        1   2319 1 1 159 LEU CA   C  -77.856  -7.380 -100.106 1.00 . A A . 159 LEU CA   1 1 
        1   2320 1 1 159 LEU CB   C  -77.623  -5.831 -100.116 1.00 . A A . 159 LEU CB   1 1 
        1   2321 1 1 159 LEU CD1  C  -79.009  -5.083 -102.126 1.00 . A A . 159 LEU CD1  1 1 
        1   2322 1 1 159 LEU CD2  C  -76.968  -3.734 -101.441 1.00 . A A . 159 LEU CD2  1 1 
        1   2323 1 1 159 LEU CG   C  -77.599  -5.158 -101.524 1.00 . A A . 159 LEU CG   1 1 
        1   2324 1 1 159 LEU H    H  -76.204  -7.466  -98.746 1.00 . A A . 159 LEU H    1 1 
        1   2325 1 1 159 LEU HA   H  -78.796  -7.546  -99.610 1.00 . A A . 159 LEU HA   1 1 
        1   2326 1 1 159 LEU HB2  H  -78.416  -5.386  -99.558 1.00 . A A . 159 LEU HB2  1 1 
        1   2327 1 1 159 LEU HB3  H  -76.698  -5.636  -99.636 1.00 . A A . 159 LEU HB3  1 1 
        1   2328 1 1 159 LEU HD11 H  -79.437  -4.103 -101.986 1.00 . A A . 159 LEU HD11 1 1 
        1   2329 1 1 159 LEU HD12 H  -79.642  -5.821 -101.658 1.00 . A A . 159 LEU HD12 1 1 
        1   2330 1 1 159 LEU HD13 H  -78.941  -5.296 -103.187 1.00 . A A . 159 LEU HD13 1 1 
        1   2331 1 1 159 LEU HD21 H  -75.907  -3.828 -101.244 1.00 . A A . 159 LEU HD21 1 1 
        1   2332 1 1 159 LEU HD22 H  -77.429  -3.156 -100.660 1.00 . A A . 159 LEU HD22 1 1 
        1   2333 1 1 159 LEU HD23 H  -77.106  -3.231 -102.392 1.00 . A A . 159 LEU HD23 1 1 
        1   2334 1 1 159 LEU HG   H  -76.992  -5.742 -102.163 1.00 . A A . 159 LEU HG   1 1 
        1   2335 1 1 159 LEU N    N  -76.865  -8.022  -99.202 1.00 . A A . 159 LEU N    1 1 
        1   2336 1 1 159 LEU O    O  -79.098  -8.013 -102.054 1.00 . A A . 159 LEU O    1 1 
        1   2337 1 1 160 VAL C    C  -77.461 -10.475 -103.370 1.00 . A A . 160 VAL C    1 1 
        1   2338 1 1 160 VAL CA   C  -76.889  -9.045 -103.430 1.00 . A A . 160 VAL CA   1 1 
        1   2339 1 1 160 VAL CB   C  -75.464  -9.023 -104.129 1.00 . A A . 160 VAL CB   1 1 
        1   2340 1 1 160 VAL CG1  C  -74.358  -9.530 -103.195 1.00 . A A . 160 VAL CG1  1 1 
        1   2341 1 1 160 VAL CG2  C  -75.457  -9.884 -105.414 1.00 . A A . 160 VAL CG2  1 1 
        1   2342 1 1 160 VAL H    H  -76.042  -8.401 -101.581 1.00 . A A . 160 VAL H    1 1 
        1   2343 1 1 160 VAL HA   H  -77.554  -8.456 -104.035 1.00 . A A . 160 VAL HA   1 1 
        1   2344 1 1 160 VAL HB   H  -75.237  -8.008 -104.410 1.00 . A A . 160 VAL HB   1 1 
        1   2345 1 1 160 VAL HG11 H  -73.460  -9.740 -103.767 1.00 . A A . 160 VAL HG11 1 1 
        1   2346 1 1 160 VAL HG12 H  -74.681 -10.429 -102.698 1.00 . A A . 160 VAL HG12 1 1 
        1   2347 1 1 160 VAL HG13 H  -74.143  -8.769 -102.467 1.00 . A A . 160 VAL HG13 1 1 
        1   2348 1 1 160 VAL HG21 H  -76.423  -9.839 -105.887 1.00 . A A . 160 VAL HG21 1 1 
        1   2349 1 1 160 VAL HG22 H  -75.219 -10.907 -105.167 1.00 . A A . 160 VAL HG22 1 1 
        1   2350 1 1 160 VAL HG23 H  -74.705  -9.499 -106.098 1.00 . A A . 160 VAL HG23 1 1 
        1   2351 1 1 160 VAL N    N  -76.871  -8.435 -102.084 1.00 . A A . 160 VAL N    1 1 
        1   2352 1 1 160 VAL O    O  -78.213 -10.885 -104.268 1.00 . A A . 160 VAL O    1 1 
        1   2353 1 1 161 VAL C    C  -78.983 -12.564 -101.208 1.00 . A A . 161 VAL C    1 1 
        1   2354 1 1 161 VAL CA   C  -77.766 -12.565 -102.143 1.00 . A A . 161 VAL CA   1 1 
        1   2355 1 1 161 VAL CB   C  -76.723 -13.652 -101.716 1.00 . A A . 161 VAL CB   1 1 
        1   2356 1 1 161 VAL CG1  C  -75.553 -13.642 -102.677 1.00 . A A . 161 VAL CG1  1 1 
        1   2357 1 1 161 VAL CG2  C  -76.201 -13.422 -100.312 1.00 . A A . 161 VAL CG2  1 1 
        1   2358 1 1 161 VAL H    H  -76.684 -10.816 -101.543 1.00 . A A . 161 VAL H    1 1 
        1   2359 1 1 161 VAL HA   H  -78.128 -12.852 -103.104 1.00 . A A . 161 VAL HA   1 1 
        1   2360 1 1 161 VAL HB   H  -77.196 -14.622 -101.767 1.00 . A A . 161 VAL HB   1 1 
        1   2361 1 1 161 VAL HG11 H  -75.919 -13.743 -103.685 1.00 . A A . 161 VAL HG11 1 1 
        1   2362 1 1 161 VAL HG12 H  -74.896 -14.467 -102.443 1.00 . A A . 161 VAL HG12 1 1 
        1   2363 1 1 161 VAL HG13 H  -75.018 -12.713 -102.575 1.00 . A A . 161 VAL HG13 1 1 
        1   2364 1 1 161 VAL HG21 H  -77.008 -13.542  -99.610 1.00 . A A . 161 VAL HG21 1 1 
        1   2365 1 1 161 VAL HG22 H  -75.795 -12.429 -100.240 1.00 . A A . 161 VAL HG22 1 1 
        1   2366 1 1 161 VAL HG23 H  -75.425 -14.147 -100.098 1.00 . A A . 161 VAL HG23 1 1 
        1   2367 1 1 161 VAL N    N  -77.205 -11.210 -102.268 1.00 . A A . 161 VAL N    1 1 
        1   2368 1 1 161 VAL O    O  -79.725 -13.546 -101.145 1.00 . A A . 161 VAL O    1 1 
        1   2369 1 1 162 ILE C    C  -80.627 -12.755  -98.900 1.00 . A A . 162 ILE C    1 1 
        1   2370 1 1 162 ILE CA   C  -80.311 -11.375  -99.536 1.00 . A A . 162 ILE CA   1 1 
        1   2371 1 1 162 ILE CB   C  -81.574 -10.763 -100.186 1.00 . A A . 162 ILE CB   1 1 
        1   2372 1 1 162 ILE CD1  C  -80.903 -10.561 -102.631 1.00 . A A . 162 ILE CD1  1 1 
        1   2373 1 1 162 ILE CG1  C  -81.788 -11.281 -101.613 1.00 . A A . 162 ILE CG1  1 1 
        1   2374 1 1 162 ILE CG2  C  -81.471  -9.240 -100.211 1.00 . A A . 162 ILE CG2  1 1 
        1   2375 1 1 162 ILE H    H  -78.571 -10.715 -100.559 1.00 . A A . 162 ILE H    1 1 
        1   2376 1 1 162 ILE HA   H  -79.994 -10.729  -98.746 1.00 . A A . 162 ILE HA   1 1 
        1   2377 1 1 162 ILE HB   H  -82.431 -11.035  -99.590 1.00 . A A . 162 ILE HB   1 1 
        1   2378 1 1 162 ILE HD11 H  -81.468  -9.766 -103.096 1.00 . A A . 162 ILE HD11 1 1 
        1   2379 1 1 162 ILE HD12 H  -80.596 -11.271 -103.386 1.00 . A A . 162 ILE HD12 1 1 
        1   2380 1 1 162 ILE HD13 H  -80.038 -10.154 -102.145 1.00 . A A . 162 ILE HD13 1 1 
        1   2381 1 1 162 ILE HG12 H  -81.566 -12.323 -101.639 1.00 . A A . 162 ILE HG12 1 1 
        1   2382 1 1 162 ILE HG13 H  -82.821 -11.124 -101.881 1.00 . A A . 162 ILE HG13 1 1 
        1   2383 1 1 162 ILE HG21 H  -80.499  -8.954 -100.571 1.00 . A A . 162 ILE HG21 1 1 
        1   2384 1 1 162 ILE HG22 H  -81.618  -8.857  -99.215 1.00 . A A . 162 ILE HG22 1 1 
        1   2385 1 1 162 ILE HG23 H  -82.232  -8.842 -100.868 1.00 . A A . 162 ILE HG23 1 1 
        1   2386 1 1 162 ILE N    N  -79.190 -11.475 -100.479 1.00 . A A . 162 ILE N    1 1 
        1   2387 1 1 162 ILE O    O  -81.218 -12.815  -97.817 1.00 . A A . 162 ILE O    1 1 
        1   2388 2 2  21 ASP C    C  -49.680  -6.214  -57.763 1.00 . B B .  21 ASP C    1 1 
        1   2389 2 2  21 ASP CA   C  -49.439  -7.656  -58.187 1.00 . B B .  21 ASP CA   1 1 
        1   2390 2 2  21 ASP CB   C  -50.676  -8.515  -57.862 1.00 . B B .  21 ASP CB   1 1 
        1   2391 2 2  21 ASP CG   C  -50.443 -10.020  -58.101 1.00 . B B .  21 ASP CG   1 1 
        1   2392 2 2  21 ASP H    H  -47.511  -7.440  -57.401 1.00 . B B .  21 ASP H    1 1 
        1   2393 2 2  21 ASP HA   H  -49.275  -7.675  -59.255 1.00 . B B .  21 ASP HA   1 1 
        1   2394 2 2  21 ASP HB2  H  -50.938  -8.366  -56.826 1.00 . B B .  21 ASP HB2  1 1 
        1   2395 2 2  21 ASP HB3  H  -51.499  -8.185  -58.479 1.00 . B B .  21 ASP HB3  1 1 
        1   2396 2 2  21 ASP N    N  -48.214  -8.199  -57.509 1.00 . B B .  21 ASP N    1 1 
        1   2397 2 2  21 ASP O    O  -48.797  -5.567  -57.195 1.00 . B B .  21 ASP O    1 1 
        1   2398 2 2  21 ASP OD1  O  -49.438 -10.404  -58.770 1.00 . B B .  21 ASP OD1  1 1 
        1   2399 2 2  21 ASP OD2  O  -51.286 -10.820  -57.617 1.00 . B B .  21 ASP OD2  1 1 
        1   2400 2 2  22 ILE C    C  -51.717  -4.766  -56.028 1.00 . B B .  22 ILE C    1 1 
        1   2401 2 2  22 ILE CA   C  -51.277  -4.450  -57.466 1.00 . B B .  22 ILE CA   1 1 
        1   2402 2 2  22 ILE CB   C  -52.395  -3.839  -58.305 1.00 . B B .  22 ILE CB   1 1 
        1   2403 2 2  22 ILE CD1  C  -52.869  -3.070  -60.658 1.00 . B B .  22 ILE CD1  1 1 
        1   2404 2 2  22 ILE CG1  C  -51.829  -3.364  -59.635 1.00 . B B .  22 ILE CG1  1 1 
        1   2405 2 2  22 ILE CG2  C  -53.068  -2.686  -57.586 1.00 . B B .  22 ILE CG2  1 1 
        1   2406 2 2  22 ILE H    H  -51.530  -6.257  -58.511 1.00 . B B .  22 ILE H    1 1 
        1   2407 2 2  22 ILE HA   H  -50.431  -3.776  -57.440 1.00 . B B .  22 ILE HA   1 1 
        1   2408 2 2  22 ILE HB   H  -53.135  -4.602  -58.498 1.00 . B B .  22 ILE HB   1 1 
        1   2409 2 2  22 ILE HD11 H  -52.773  -3.765  -61.479 1.00 . B B .  22 ILE HD11 1 1 
        1   2410 2 2  22 ILE HD12 H  -52.740  -2.061  -61.023 1.00 . B B .  22 ILE HD12 1 1 
        1   2411 2 2  22 ILE HD13 H  -53.849  -3.171  -60.216 1.00 . B B .  22 ILE HD13 1 1 
        1   2412 2 2  22 ILE HG12 H  -51.255  -2.466  -59.465 1.00 . B B .  22 ILE HG12 1 1 
        1   2413 2 2  22 ILE HG13 H  -51.166  -4.127  -60.019 1.00 . B B .  22 ILE HG13 1 1 
        1   2414 2 2  22 ILE HG21 H  -54.030  -3.006  -57.214 1.00 . B B .  22 ILE HG21 1 1 
        1   2415 2 2  22 ILE HG22 H  -53.203  -1.863  -58.272 1.00 . B B .  22 ILE HG22 1 1 
        1   2416 2 2  22 ILE HG23 H  -52.450  -2.368  -56.759 1.00 . B B .  22 ILE HG23 1 1 
        1   2417 2 2  22 ILE N    N  -50.867  -5.703  -58.048 1.00 . B B .  22 ILE N    1 1 
        1   2418 2 2  22 ILE O    O  -52.285  -5.831  -55.778 1.00 . B B .  22 ILE O    1 1 
        1   2419 2 2  23 VAL C    C  -52.959  -2.830  -53.388 1.00 . B B .  23 VAL C    1 1 
        1   2420 2 2  23 VAL CA   C  -51.980  -3.955  -53.730 1.00 . B B .  23 VAL CA   1 1 
        1   2421 2 2  23 VAL CB   C  -50.937  -4.119  -52.595 1.00 . B B .  23 VAL CB   1 1 
        1   2422 2 2  23 VAL CG1  C  -50.958  -5.524  -52.095 1.00 . B B .  23 VAL CG1  1 1 
        1   2423 2 2  23 VAL CG2  C  -49.535  -3.736  -53.043 1.00 . B B .  23 VAL CG2  1 1 
        1   2424 2 2  23 VAL H    H  -50.907  -3.073  -55.338 1.00 . B B .  23 VAL H    1 1 
        1   2425 2 2  23 VAL HA   H  -52.570  -4.862  -53.723 1.00 . B B .  23 VAL HA   1 1 
        1   2426 2 2  23 VAL HB   H  -51.227  -3.470  -51.779 1.00 . B B .  23 VAL HB   1 1 
        1   2427 2 2  23 VAL HG11 H  -50.677  -5.540  -51.053 1.00 . B B .  23 VAL HG11 1 1 
        1   2428 2 2  23 VAL HG12 H  -50.261  -6.120  -52.667 1.00 . B B .  23 VAL HG12 1 1 
        1   2429 2 2  23 VAL HG13 H  -51.953  -5.930  -52.204 1.00 . B B .  23 VAL HG13 1 1 
        1   2430 2 2  23 VAL HG21 H  -49.584  -2.851  -53.661 1.00 . B B .  23 VAL HG21 1 1 
        1   2431 2 2  23 VAL HG22 H  -49.104  -4.547  -53.611 1.00 . B B .  23 VAL HG22 1 1 
        1   2432 2 2  23 VAL HG23 H  -48.922  -3.536  -52.177 1.00 . B B .  23 VAL HG23 1 1 
        1   2433 2 2  23 VAL N    N  -51.403  -3.879  -55.082 1.00 . B B .  23 VAL N    1 1 
        1   2434 2 2  23 VAL O    O  -52.605  -1.642  -53.329 1.00 . B B .  23 VAL O    1 1 
        1   2435 2 2  24 MET C    C  -55.191  -2.422  -51.139 1.00 . B B .  24 MET C    1 1 
        1   2436 2 2  24 MET CA   C  -55.236  -2.357  -52.647 1.00 . B B .  24 MET CA   1 1 
        1   2437 2 2  24 MET CB   C  -56.631  -2.754  -53.136 1.00 . B B .  24 MET CB   1 1 
        1   2438 2 2  24 MET CE   C  -57.385  -0.587  -55.594 1.00 . B B .  24 MET CE   1 1 
        1   2439 2 2  24 MET CG   C  -56.729  -3.020  -54.641 1.00 . B B .  24 MET CG   1 1 
        1   2440 2 2  24 MET H    H  -54.405  -4.188  -53.259 1.00 . B B .  24 MET H    1 1 
        1   2441 2 2  24 MET HA   H  -55.030  -1.343  -52.959 1.00 . B B .  24 MET HA   1 1 
        1   2442 2 2  24 MET HB2  H  -56.934  -3.649  -52.615 1.00 . B B .  24 MET HB2  1 1 
        1   2443 2 2  24 MET HB3  H  -57.320  -1.962  -52.880 1.00 . B B .  24 MET HB3  1 1 
        1   2444 2 2  24 MET HE1  H  -58.084  -0.796  -56.392 1.00 . B B .  24 MET HE1  1 1 
        1   2445 2 2  24 MET HE2  H  -57.015   0.421  -55.698 1.00 . B B .  24 MET HE2  1 1 
        1   2446 2 2  24 MET HE3  H  -57.880  -0.690  -54.638 1.00 . B B .  24 MET HE3  1 1 
        1   2447 2 2  24 MET HG2  H  -56.206  -3.939  -54.851 1.00 . B B .  24 MET HG2  1 1 
        1   2448 2 2  24 MET HG3  H  -57.769  -3.155  -54.902 1.00 . B B .  24 MET HG3  1 1 
        1   2449 2 2  24 MET N    N  -54.206  -3.232  -53.179 1.00 . B B .  24 MET N    1 1 
        1   2450 2 2  24 MET O    O  -55.033  -3.490  -50.545 1.00 . B B .  24 MET O    1 1 
        1   2451 2 2  24 MET SD   S  -56.020  -1.738  -55.684 1.00 . B B .  24 MET SD   1 1 
        1   2452 2 2  25 SER C    C  -56.156   0.100  -48.771 1.00 . B B .  25 SER C    1 1 
        1   2453 2 2  25 SER CA   C  -55.232  -1.050  -49.126 1.00 . B B .  25 SER CA   1 1 
        1   2454 2 2  25 SER CB   C  -53.803  -0.661  -48.807 1.00 . B B .  25 SER CB   1 1 
        1   2455 2 2  25 SER H    H  -55.463  -0.458  -51.112 1.00 . B B .  25 SER H    1 1 
        1   2456 2 2  25 SER HA   H  -55.510  -1.945  -48.592 1.00 . B B .  25 SER HA   1 1 
        1   2457 2 2  25 SER HB2  H  -53.750  -0.275  -47.802 1.00 . B B .  25 SER HB2  1 1 
        1   2458 2 2  25 SER HB3  H  -53.167  -1.532  -48.889 1.00 . B B .  25 SER HB3  1 1 
        1   2459 2 2  25 SER HG   H  -52.790   0.932  -49.238 1.00 . B B .  25 SER HG   1 1 
        1   2460 2 2  25 SER N    N  -55.339  -1.248  -50.545 1.00 . B B .  25 SER N    1 1 
        1   2461 2 2  25 SER O    O  -55.932   1.233  -49.198 1.00 . B B .  25 SER O    1 1 
        1   2462 2 2  25 SER OG   O  -53.377   0.337  -49.709 1.00 . B B .  25 SER OG   1 1 
        1   2463 2 2  26 GLN C    C  -57.841   1.238  -46.087 1.00 . B B .  26 GLN C    1 1 
        1   2464 2 2  26 GLN CA   C  -58.146   0.814  -47.529 1.00 . B B .  26 GLN CA   1 1 
        1   2465 2 2  26 GLN CB   C  -59.571   0.272  -47.617 1.00 . B B .  26 GLN CB   1 1 
        1   2466 2 2  26 GLN CD   C  -60.906  -1.427  -48.940 1.00 . B B .  26 GLN CD   1 1 
        1   2467 2 2  26 GLN CG   C  -59.953  -0.239  -48.989 1.00 . B B .  26 GLN CG   1 1 
        1   2468 2 2  26 GLN H    H  -57.318  -1.124  -47.708 1.00 . B B .  26 GLN H    1 1 
        1   2469 2 2  26 GLN HA   H  -58.069   1.682  -48.166 1.00 . B B .  26 GLN HA   1 1 
        1   2470 2 2  26 GLN HB2  H  -59.648  -0.557  -46.929 1.00 . B B .  26 GLN HB2  1 1 
        1   2471 2 2  26 GLN HB3  H  -60.267   1.037  -47.310 1.00 . B B .  26 GLN HB3  1 1 
        1   2472 2 2  26 GLN HE21 H  -59.849  -2.274  -47.467 1.00 . B B .  26 GLN HE21 1 1 
        1   2473 2 2  26 GLN HE22 H  -61.207  -3.155  -47.978 1.00 . B B .  26 GLN HE22 1 1 
        1   2474 2 2  26 GLN HG2  H  -60.426   0.560  -49.539 1.00 . B B .  26 GLN HG2  1 1 
        1   2475 2 2  26 GLN HG3  H  -59.054  -0.534  -49.512 1.00 . B B .  26 GLN HG3  1 1 
        1   2476 2 2  26 GLN N    N  -57.200  -0.196  -48.001 1.00 . B B .  26 GLN N    1 1 
        1   2477 2 2  26 GLN NE2  N  -60.631  -2.366  -48.051 1.00 . B B .  26 GLN NE2  1 1 
        1   2478 2 2  26 GLN O    O  -57.317   0.456  -45.305 1.00 . B B .  26 GLN O    1 1 
        1   2479 2 2  26 GLN OE1  O  -61.866  -1.503  -49.705 1.00 . B B .  26 GLN OE1  1 1 
        1   2480 2 2  27 SER C    C  -59.504   3.630  -44.153 1.00 . B B .  27 SER C    1 1 
        1   2481 2 2  27 SER CA   C  -58.177   2.921  -44.358 1.00 . B B .  27 SER CA   1 1 
        1   2482 2 2  27 SER CB   C  -57.015   3.866  -44.024 1.00 . B B .  27 SER CB   1 1 
        1   2483 2 2  27 SER H    H  -58.531   3.071  -46.435 1.00 . B B .  27 SER H    1 1 
        1   2484 2 2  27 SER HA   H  -58.135   2.053  -43.714 1.00 . B B .  27 SER HA   1 1 
        1   2485 2 2  27 SER HB2  H  -56.790   3.790  -42.974 1.00 . B B .  27 SER HB2  1 1 
        1   2486 2 2  27 SER HB3  H  -56.143   3.558  -44.588 1.00 . B B .  27 SER HB3  1 1 
        1   2487 2 2  27 SER HG   H  -56.536   5.752  -44.167 1.00 . B B .  27 SER HG   1 1 
        1   2488 2 2  27 SER N    N  -58.140   2.486  -45.753 1.00 . B B .  27 SER N    1 1 
        1   2489 2 2  27 SER O    O  -59.998   4.264  -45.083 1.00 . B B .  27 SER O    1 1 
        1   2490 2 2  27 SER OG   O  -57.324   5.227  -44.323 1.00 . B B .  27 SER OG   1 1 
        1   2491 2 2  28 PRO C    C  -60.296   1.367  -41.834 1.00 . B B .  28 PRO C    1 1 
        1   2492 2 2  28 PRO CA   C  -59.671   2.754  -41.799 1.00 . B B .  28 PRO CA   1 1 
        1   2493 2 2  28 PRO CB   C  -60.302   3.526  -40.661 1.00 . B B .  28 PRO CB   1 1 
        1   2494 2 2  28 PRO CD   C  -61.372   4.231  -42.691 1.00 . B B .  28 PRO CD   1 1 
        1   2495 2 2  28 PRO CG   C  -61.639   3.949  -41.248 1.00 . B B .  28 PRO CG   1 1 
        1   2496 2 2  28 PRO HA   H  -58.600   2.724  -41.699 1.00 . B B .  28 PRO HA   1 1 
        1   2497 2 2  28 PRO HB2  H  -60.440   2.887  -39.798 1.00 . B B .  28 PRO HB2  1 1 
        1   2498 2 2  28 PRO HB3  H  -59.715   4.394  -40.411 1.00 . B B .  28 PRO HB3  1 1 
        1   2499 2 2  28 PRO HD2  H  -62.169   3.836  -43.307 1.00 . B B .  28 PRO HD2  1 1 
        1   2500 2 2  28 PRO HD3  H  -61.248   5.289  -42.856 1.00 . B B .  28 PRO HD3  1 1 
        1   2501 2 2  28 PRO HG2  H  -62.361   3.150  -41.147 1.00 . B B .  28 PRO HG2  1 1 
        1   2502 2 2  28 PRO HG3  H  -61.997   4.842  -40.759 1.00 . B B .  28 PRO HG3  1 1 
        1   2503 2 2  28 PRO N    N  -60.102   3.523  -42.954 1.00 . B B .  28 PRO N    1 1 
        1   2504 2 2  28 PRO O    O  -61.086   1.067  -42.739 1.00 . B B .  28 PRO O    1 1 
        1   2505 2 2  29 SER C    C  -62.137  -0.558  -40.400 1.00 . B B .  29 SER C    1 1 
        1   2506 2 2  29 SER CA   C  -60.649  -0.741  -40.681 1.00 . B B .  29 SER CA   1 1 
        1   2507 2 2  29 SER CB   C  -60.019  -1.496  -39.536 1.00 . B B .  29 SER CB   1 1 
        1   2508 2 2  29 SER H    H  -59.369   0.850  -40.140 1.00 . B B .  29 SER H    1 1 
        1   2509 2 2  29 SER HA   H  -60.529  -1.317  -41.586 1.00 . B B .  29 SER HA   1 1 
        1   2510 2 2  29 SER HB2  H  -60.392  -1.103  -38.605 1.00 . B B .  29 SER HB2  1 1 
        1   2511 2 2  29 SER HB3  H  -60.268  -2.546  -39.608 1.00 . B B .  29 SER HB3  1 1 
        1   2512 2 2  29 SER HG   H  -58.375  -0.725  -38.864 1.00 . B B .  29 SER HG   1 1 
        1   2513 2 2  29 SER N    N  -59.981   0.541  -40.841 1.00 . B B .  29 SER N    1 1 
        1   2514 2 2  29 SER O    O  -62.983  -1.219  -41.018 1.00 . B B .  29 SER O    1 1 
        1   2515 2 2  29 SER OG   O  -58.620  -1.320  -39.576 1.00 . B B .  29 SER OG   1 1 
        1   2516 2 2  30 SER C    C  -64.269   2.030  -38.989 1.00 . B B .  30 SER C    1 1 
        1   2517 2 2  30 SER CA   C  -63.835   0.569  -39.053 1.00 . B B .  30 SER CA   1 1 
        1   2518 2 2  30 SER CB   C  -64.048  -0.064  -37.685 1.00 . B B .  30 SER CB   1 1 
        1   2519 2 2  30 SER H    H  -61.733   0.858  -39.044 1.00 . B B .  30 SER H    1 1 
        1   2520 2 2  30 SER HA   H  -64.482   0.061  -39.751 1.00 . B B .  30 SER HA   1 1 
        1   2521 2 2  30 SER HB2  H  -64.945   0.332  -37.239 1.00 . B B .  30 SER HB2  1 1 
        1   2522 2 2  30 SER HB3  H  -64.151  -1.136  -37.799 1.00 . B B .  30 SER HB3  1 1 
        1   2523 2 2  30 SER HG   H  -63.283   0.455  -35.976 1.00 . B B .  30 SER HG   1 1 
        1   2524 2 2  30 SER N    N  -62.452   0.357  -39.484 1.00 . B B .  30 SER N    1 1 
        1   2525 2 2  30 SER O    O  -63.460   2.922  -38.732 1.00 . B B .  30 SER O    1 1 
        1   2526 2 2  30 SER OG   O  -62.944   0.230  -36.845 1.00 . B B .  30 SER OG   1 1 
        1   2527 2 2  31 LEU C    C  -67.523   3.431  -38.282 1.00 . B B .  31 LEU C    1 1 
        1   2528 2 2  31 LEU CA   C  -66.216   3.543  -39.051 1.00 . B B .  31 LEU CA   1 1 
        1   2529 2 2  31 LEU CB   C  -66.525   4.158  -40.408 1.00 . B B .  31 LEU CB   1 1 
        1   2530 2 2  31 LEU CD1  C  -66.081   5.439  -42.455 1.00 . B B .  31 LEU CD1  1 1 
        1   2531 2 2  31 LEU CD2  C  -64.507   5.697  -40.492 1.00 . B B .  31 LEU CD2  1 1 
        1   2532 2 2  31 LEU CG   C  -65.416   4.735  -41.274 1.00 . B B .  31 LEU CG   1 1 
        1   2533 2 2  31 LEU H    H  -66.134   1.468  -39.397 1.00 . B B .  31 LEU H    1 1 
        1   2534 2 2  31 LEU HA   H  -65.550   4.203  -38.517 1.00 . B B .  31 LEU HA   1 1 
        1   2535 2 2  31 LEU HB2  H  -67.009   3.400  -40.996 1.00 . B B .  31 LEU HB2  1 1 
        1   2536 2 2  31 LEU HB3  H  -67.253   4.942  -40.239 1.00 . B B .  31 LEU HB3  1 1 
        1   2537 2 2  31 LEU HD11 H  -66.904   4.840  -42.814 1.00 . B B .  31 LEU HD11 1 1 
        1   2538 2 2  31 LEU HD12 H  -65.359   5.572  -43.247 1.00 . B B .  31 LEU HD12 1 1 
        1   2539 2 2  31 LEU HD13 H  -66.448   6.404  -42.138 1.00 . B B .  31 LEU HD13 1 1 
        1   2540 2 2  31 LEU HD21 H  -63.786   6.137  -41.165 1.00 . B B .  31 LEU HD21 1 1 
        1   2541 2 2  31 LEU HD22 H  -63.990   5.153  -39.716 1.00 . B B .  31 LEU HD22 1 1 
        1   2542 2 2  31 LEU HD23 H  -65.107   6.477  -40.047 1.00 . B B .  31 LEU HD23 1 1 
        1   2543 2 2  31 LEU HG   H  -64.820   3.915  -41.656 1.00 . B B .  31 LEU HG   1 1 
        1   2544 2 2  31 LEU N    N  -65.566   2.244  -39.210 1.00 . B B .  31 LEU N    1 1 
        1   2545 2 2  31 LEU O    O  -68.359   2.568  -38.556 1.00 . B B .  31 LEU O    1 1 
        1   2546 2 2  32 ALA C    C  -69.640   5.749  -37.221 1.00 . B B .  32 ALA C    1 1 
        1   2547 2 2  32 ALA CA   C  -68.991   4.475  -36.686 1.00 . B B .  32 ALA CA   1 1 
        1   2548 2 2  32 ALA CB   C  -68.830   4.538  -35.176 1.00 . B B .  32 ALA CB   1 1 
        1   2549 2 2  32 ALA H    H  -67.002   4.984  -37.153 1.00 . B B .  32 ALA H    1 1 
        1   2550 2 2  32 ALA HA   H  -69.613   3.629  -36.941 1.00 . B B .  32 ALA HA   1 1 
        1   2551 2 2  32 ALA HB1  H  -69.422   5.352  -34.785 1.00 . B B .  32 ALA HB1  1 1 
        1   2552 2 2  32 ALA HB2  H  -67.791   4.698  -34.931 1.00 . B B .  32 ALA HB2  1 1 
        1   2553 2 2  32 ALA HB3  H  -69.164   3.608  -34.739 1.00 . B B .  32 ALA HB3  1 1 
        1   2554 2 2  32 ALA N    N  -67.700   4.318  -37.321 1.00 . B B .  32 ALA N    1 1 
        1   2555 2 2  32 ALA O    O  -68.944   6.699  -37.595 1.00 . B B .  32 ALA O    1 1 
        1   2556 2 2  33 VAL C    C  -73.214   6.878  -37.237 1.00 . B B .  33 VAL C    1 1 
        1   2557 2 2  33 VAL CA   C  -71.727   6.966  -37.652 1.00 . B B .  33 VAL CA   1 1 
        1   2558 2 2  33 VAL CB   C  -71.519   7.361  -39.164 1.00 . B B .  33 VAL CB   1 1 
        1   2559 2 2  33 VAL CG1  C  -72.837   7.401  -39.934 1.00 . B B .  33 VAL CG1  1 1 
        1   2560 2 2  33 VAL CG2  C  -70.785   8.698  -39.272 1.00 . B B .  33 VAL CG2  1 1 
        1   2561 2 2  33 VAL H    H  -71.461   4.967  -36.975 1.00 . B B .  33 VAL H    1 1 
        1   2562 2 2  33 VAL HA   H  -71.306   7.773  -37.064 1.00 . B B .  33 VAL HA   1 1 
        1   2563 2 2  33 VAL HB   H  -70.899   6.599  -39.618 1.00 . B B .  33 VAL HB   1 1 
        1   2564 2 2  33 VAL HG11 H  -73.660   7.274  -39.246 1.00 . B B .  33 VAL HG11 1 1 
        1   2565 2 2  33 VAL HG12 H  -72.851   6.605  -40.664 1.00 . B B .  33 VAL HG12 1 1 
        1   2566 2 2  33 VAL HG13 H  -72.931   8.352  -40.436 1.00 . B B .  33 VAL HG13 1 1 
        1   2567 2 2  33 VAL HG21 H  -70.073   8.653  -40.082 1.00 . B B .  33 VAL HG21 1 1 
        1   2568 2 2  33 VAL HG22 H  -70.265   8.899  -38.347 1.00 . B B .  33 VAL HG22 1 1 
        1   2569 2 2  33 VAL HG23 H  -71.498   9.486  -39.462 1.00 . B B .  33 VAL HG23 1 1 
        1   2570 2 2  33 VAL N    N  -70.969   5.760  -37.274 1.00 . B B .  33 VAL N    1 1 
        1   2571 2 2  33 VAL O    O  -73.822   5.797  -37.259 1.00 . B B .  33 VAL O    1 1 
        1   2572 2 2  34 SER C    C  -75.993   8.137  -37.733 1.00 . B B .  34 SER C    1 1 
        1   2573 2 2  34 SER CA   C  -75.175   8.074  -36.454 1.00 . B B .  34 SER CA   1 1 
        1   2574 2 2  34 SER CB   C  -75.435   9.274  -35.545 1.00 . B B .  34 SER CB   1 1 
        1   2575 2 2  34 SER H    H  -73.236   8.831  -36.801 1.00 . B B .  34 SER H    1 1 
        1   2576 2 2  34 SER HA   H  -75.433   7.168  -35.923 1.00 . B B .  34 SER HA   1 1 
        1   2577 2 2  34 SER HB2  H  -75.450  10.172  -36.138 1.00 . B B .  34 SER HB2  1 1 
        1   2578 2 2  34 SER HB3  H  -76.400   9.152  -35.069 1.00 . B B .  34 SER HB3  1 1 
        1   2579 2 2  34 SER HG   H  -74.236  10.333  -34.428 1.00 . B B .  34 SER HG   1 1 
        1   2580 2 2  34 SER N    N  -73.774   8.012  -36.824 1.00 . B B .  34 SER N    1 1 
        1   2581 2 2  34 SER O    O  -75.641   8.848  -38.677 1.00 . B B .  34 SER O    1 1 
        1   2582 2 2  34 SER OG   O  -74.419   9.398  -34.551 1.00 . B B .  34 SER OG   1 1 
        1   2583 2 2  35 ALA C    C  -78.332   8.293  -39.756 1.00 . B B .  35 ALA C    1 1 
        1   2584 2 2  35 ALA CA   C  -77.843   7.070  -38.975 1.00 . B B .  35 ALA CA   1 1 
        1   2585 2 2  35 ALA CB   C  -79.024   6.126  -38.663 1.00 . B B .  35 ALA CB   1 1 
        1   2586 2 2  35 ALA H    H  -77.270   6.830  -36.951 1.00 . B B .  35 ALA H    1 1 
        1   2587 2 2  35 ALA HA   H  -77.179   6.529  -39.631 1.00 . B B .  35 ALA HA   1 1 
        1   2588 2 2  35 ALA HB1  H  -78.908   5.209  -39.221 1.00 . B B .  35 ALA HB1  1 1 
        1   2589 2 2  35 ALA HB2  H  -79.951   6.604  -38.945 1.00 . B B .  35 ALA HB2  1 1 
        1   2590 2 2  35 ALA HB3  H  -79.039   5.906  -37.606 1.00 . B B .  35 ALA HB3  1 1 
        1   2591 2 2  35 ALA N    N  -77.078   7.366  -37.749 1.00 . B B .  35 ALA N    1 1 
        1   2592 2 2  35 ALA O    O  -79.401   8.827  -39.471 1.00 . B B .  35 ALA O    1 1 
        1   2593 2 2  36 GLY C    C  -76.879  10.750  -41.999 1.00 . B B .  36 GLY C    1 1 
        1   2594 2 2  36 GLY CA   C  -77.990   9.799  -41.632 1.00 . B B .  36 GLY CA   1 1 
        1   2595 2 2  36 GLY H    H  -76.706   8.271  -40.920 1.00 . B B .  36 GLY H    1 1 
        1   2596 2 2  36 GLY HA2  H  -78.379   9.355  -42.536 1.00 . B B .  36 GLY HA2  1 1 
        1   2597 2 2  36 GLY HA3  H  -78.781  10.355  -41.149 1.00 . B B .  36 GLY HA3  1 1 
        1   2598 2 2  36 GLY N    N  -77.550   8.734  -40.736 1.00 . B B .  36 GLY N    1 1 
        1   2599 2 2  36 GLY O    O  -77.126  11.835  -42.533 1.00 . B B .  36 GLY O    1 1 
        1   2600 2 2  37 GLU C    C  -73.739  10.956  -43.267 1.00 . B B .  37 GLU C    1 1 
        1   2601 2 2  37 GLU CA   C  -74.481  11.171  -41.942 1.00 . B B .  37 GLU CA   1 1 
        1   2602 2 2  37 GLU CB   C  -73.537  11.009  -40.759 1.00 . B B .  37 GLU CB   1 1 
        1   2603 2 2  37 GLU CD   C  -73.186  11.629  -38.362 1.00 . B B .  37 GLU CD   1 1 
        1   2604 2 2  37 GLU CG   C  -74.197  11.361  -39.439 1.00 . B B .  37 GLU CG   1 1 
        1   2605 2 2  37 GLU H    H  -75.529   9.437  -41.339 1.00 . B B .  37 GLU H    1 1 
        1   2606 2 2  37 GLU HA   H  -74.825  12.194  -41.934 1.00 . B B .  37 GLU HA   1 1 
        1   2607 2 2  37 GLU HB2  H  -73.202   9.984  -40.717 1.00 . B B .  37 GLU HB2  1 1 
        1   2608 2 2  37 GLU HB3  H  -72.680  11.651  -40.905 1.00 . B B .  37 GLU HB3  1 1 
        1   2609 2 2  37 GLU HG2  H  -74.807  12.241  -39.574 1.00 . B B .  37 GLU HG2  1 1 
        1   2610 2 2  37 GLU HG3  H  -74.829  10.539  -39.133 1.00 . B B .  37 GLU HG3  1 1 
        1   2611 2 2  37 GLU N    N  -75.649  10.322  -41.741 1.00 . B B .  37 GLU N    1 1 
        1   2612 2 2  37 GLU O    O  -74.119  10.104  -44.077 1.00 . B B .  37 GLU O    1 1 
        1   2613 2 2  37 GLU OE1  O  -72.505  12.681  -38.440 1.00 . B B .  37 GLU OE1  1 1 
        1   2614 2 2  37 GLU OE2  O  -73.065  10.782  -37.447 1.00 . B B .  37 GLU OE2  1 1 
        1   2615 2 2  38 LYS C    C  -70.525  10.851  -44.141 1.00 . B B .  38 LYS C    1 1 
        1   2616 2 2  38 LYS CA   C  -71.788  11.568  -44.616 1.00 . B B .  38 LYS CA   1 1 
        1   2617 2 2  38 LYS CB   C  -71.425  12.893  -45.274 1.00 . B B .  38 LYS CB   1 1 
        1   2618 2 2  38 LYS CD   C  -71.628  13.948  -47.524 1.00 . B B .  38 LYS CD   1 1 
        1   2619 2 2  38 LYS CE   C  -71.800  13.615  -49.024 1.00 . B B .  38 LYS CE   1 1 
        1   2620 2 2  38 LYS CG   C  -71.065  12.771  -46.730 1.00 . B B .  38 LYS CG   1 1 
        1   2621 2 2  38 LYS H    H  -72.478  12.437  -42.815 1.00 . B B .  38 LYS H    1 1 
        1   2622 2 2  38 LYS HA   H  -72.279  10.943  -45.349 1.00 . B B .  38 LYS HA   1 1 
        1   2623 2 2  38 LYS HB2  H  -72.265  13.564  -45.186 1.00 . B B .  38 LYS HB2  1 1 
        1   2624 2 2  38 LYS HB3  H  -70.586  13.321  -44.743 1.00 . B B .  38 LYS HB3  1 1 
        1   2625 2 2  38 LYS HD2  H  -72.589  14.220  -47.114 1.00 . B B .  38 LYS HD2  1 1 
        1   2626 2 2  38 LYS HD3  H  -70.956  14.788  -47.427 1.00 . B B .  38 LYS HD3  1 1 
        1   2627 2 2  38 LYS HE2  H  -70.842  13.724  -49.506 1.00 . B B .  38 LYS HE2  1 1 
        1   2628 2 2  38 LYS HE3  H  -72.099  12.579  -49.104 1.00 . B B .  38 LYS HE3  1 1 
        1   2629 2 2  38 LYS HG2  H  -69.990  12.756  -46.830 1.00 . B B .  38 LYS HG2  1 1 
        1   2630 2 2  38 LYS HG3  H  -71.472  11.851  -47.122 1.00 . B B .  38 LYS HG3  1 1 
        1   2631 2 2  38 LYS HZ1  H  -72.579  14.436  -50.796 1.00 . B B .  38 LYS HZ1  1 1 
        1   2632 2 2  38 LYS HZ2  H  -72.746  15.445  -49.440 1.00 . B B .  38 LYS HZ2  1 1 
        1   2633 2 2  38 LYS HZ3  H  -73.757  14.093  -49.624 1.00 . B B .  38 LYS HZ3  1 1 
        1   2634 2 2  38 LYS N    N  -72.703  11.764  -43.491 1.00 . B B .  38 LYS N    1 1 
        1   2635 2 2  38 LYS NZ   N  -72.798  14.463  -49.780 1.00 . B B .  38 LYS NZ   1 1 
        1   2636 2 2  38 LYS O    O  -69.926  11.222  -43.129 1.00 . B B .  38 LYS O    1 1 
        1   2637 2 2  39 VAL C    C  -68.212   8.862  -45.905 1.00 . B B .  39 VAL C    1 1 
        1   2638 2 2  39 VAL CA   C  -68.937   9.032  -44.602 1.00 . B B .  39 VAL CA   1 1 
        1   2639 2 2  39 VAL CB   C  -69.208   7.622  -44.047 1.00 . B B .  39 VAL CB   1 1 
        1   2640 2 2  39 VAL CG1  C  -69.158   7.635  -42.536 1.00 . B B .  39 VAL CG1  1 1 
        1   2641 2 2  39 VAL CG2  C  -70.542   7.032  -44.602 1.00 . B B .  39 VAL CG2  1 1 
        1   2642 2 2  39 VAL H    H  -70.704   9.546  -45.637 1.00 . B B .  39 VAL H    1 1 
        1   2643 2 2  39 VAL HA   H  -68.312   9.578  -43.911 1.00 . B B .  39 VAL HA   1 1 
        1   2644 2 2  39 VAL HB   H  -68.400   6.986  -44.385 1.00 . B B .  39 VAL HB   1 1 
        1   2645 2 2  39 VAL HG11 H  -69.361   6.643  -42.161 1.00 . B B .  39 VAL HG11 1 1 
        1   2646 2 2  39 VAL HG12 H  -69.900   8.323  -42.158 1.00 . B B .  39 VAL HG12 1 1 
        1   2647 2 2  39 VAL HG13 H  -68.177   7.949  -42.212 1.00 . B B .  39 VAL HG13 1 1 
        1   2648 2 2  39 VAL HG21 H  -70.945   6.323  -43.894 1.00 . B B .  39 VAL HG21 1 1 
        1   2649 2 2  39 VAL HG22 H  -70.352   6.533  -45.541 1.00 . B B .  39 VAL HG22 1 1 
        1   2650 2 2  39 VAL HG23 H  -71.253   7.830  -44.757 1.00 . B B .  39 VAL HG23 1 1 
        1   2651 2 2  39 VAL N    N  -70.156   9.795  -44.864 1.00 . B B .  39 VAL N    1 1 
        1   2652 2 2  39 VAL O    O  -68.838   8.593  -46.943 1.00 . B B .  39 VAL O    1 1 
        1   2653 2 2  40 THR C    C  -64.811   8.103  -46.662 1.00 . B B .  40 THR C    1 1 
        1   2654 2 2  40 THR CA   C  -66.051   8.921  -47.013 1.00 . B B .  40 THR CA   1 1 
        1   2655 2 2  40 THR CB   C  -65.616  10.322  -47.529 1.00 . B B .  40 THR CB   1 1 
        1   2656 2 2  40 THR CG2  C  -66.790  11.185  -47.938 1.00 . B B .  40 THR CG2  1 1 
        1   2657 2 2  40 THR H    H  -66.484   9.234  -44.978 1.00 . B B .  40 THR H    1 1 
        1   2658 2 2  40 THR HA   H  -66.596   8.414  -47.795 1.00 . B B .  40 THR HA   1 1 
        1   2659 2 2  40 THR HB   H  -64.954  10.199  -48.373 1.00 . B B .  40 THR HB   1 1 
        1   2660 2 2  40 THR HG1  H  -65.436  11.789  -46.261 1.00 . B B .  40 THR HG1  1 1 
        1   2661 2 2  40 THR HG21 H  -67.686  10.830  -47.450 1.00 . B B .  40 THR HG21 1 1 
        1   2662 2 2  40 THR HG22 H  -66.919  11.134  -49.009 1.00 . B B .  40 THR HG22 1 1 
        1   2663 2 2  40 THR HG23 H  -66.604  12.208  -47.646 1.00 . B B .  40 THR HG23 1 1 
        1   2664 2 2  40 THR N    N  -66.895   9.021  -45.842 1.00 . B B .  40 THR N    1 1 
        1   2665 2 2  40 THR O    O  -63.788   8.668  -46.259 1.00 . B B .  40 THR O    1 1 
        1   2666 2 2  40 THR OG1  O  -64.927  11.007  -46.488 1.00 . B B .  40 THR OG1  1 1 
        1   2667 2 2  41 MET C    C  -62.793   5.940  -47.872 1.00 . B B .  41 MET C    1 1 
        1   2668 2 2  41 MET CA   C  -63.670   5.977  -46.596 1.00 . B B .  41 MET CA   1 1 
        1   2669 2 2  41 MET CB   C  -63.962   4.584  -46.004 1.00 . B B .  41 MET CB   1 1 
        1   2670 2 2  41 MET CE   C  -66.840   4.379  -47.679 1.00 . B B .  41 MET CE   1 1 
        1   2671 2 2  41 MET CG   C  -64.335   3.477  -46.993 1.00 . B B .  41 MET CG   1 1 
        1   2672 2 2  41 MET H    H  -65.710   6.356  -47.104 1.00 . B B .  41 MET H    1 1 
        1   2673 2 2  41 MET HA   H  -63.085   6.509  -45.855 1.00 . B B .  41 MET HA   1 1 
        1   2674 2 2  41 MET HB2  H  -63.086   4.260  -45.466 1.00 . B B .  41 MET HB2  1 1 
        1   2675 2 2  41 MET HB3  H  -64.769   4.690  -45.291 1.00 . B B .  41 MET HB3  1 1 
        1   2676 2 2  41 MET HE1  H  -67.895   4.391  -47.445 1.00 . B B .  41 MET HE1  1 1 
        1   2677 2 2  41 MET HE2  H  -66.711   4.304  -48.747 1.00 . B B .  41 MET HE2  1 1 
        1   2678 2 2  41 MET HE3  H  -66.377   5.290  -47.326 1.00 . B B .  41 MET HE3  1 1 
        1   2679 2 2  41 MET HG2  H  -64.143   3.830  -47.994 1.00 . B B .  41 MET HG2  1 1 
        1   2680 2 2  41 MET HG3  H  -63.707   2.617  -46.804 1.00 . B B .  41 MET HG3  1 1 
        1   2681 2 2  41 MET N    N  -64.883   6.778  -46.792 1.00 . B B .  41 MET N    1 1 
        1   2682 2 2  41 MET O    O  -63.263   6.284  -48.978 1.00 . B B .  41 MET O    1 1 
        1   2683 2 2  41 MET SD   S  -66.072   2.977  -46.886 1.00 . B B .  41 MET SD   1 1 
        1   2684 2 2  42 SER C    C  -59.923   4.385  -49.221 1.00 . B B .  42 SER C    1 1 
        1   2685 2 2  42 SER CA   C  -60.565   5.678  -48.795 1.00 . B B .  42 SER CA   1 1 
        1   2686 2 2  42 SER CB   C  -59.455   6.649  -48.412 1.00 . B B .  42 SER CB   1 1 
        1   2687 2 2  42 SER H    H  -61.213   5.296  -46.821 1.00 . B B .  42 SER H    1 1 
        1   2688 2 2  42 SER HA   H  -61.078   6.092  -49.649 1.00 . B B .  42 SER HA   1 1 
        1   2689 2 2  42 SER HB2  H  -59.871   7.631  -48.263 1.00 . B B .  42 SER HB2  1 1 
        1   2690 2 2  42 SER HB3  H  -58.992   6.316  -47.492 1.00 . B B .  42 SER HB3  1 1 
        1   2691 2 2  42 SER HG   H  -57.678   7.085  -49.081 1.00 . B B .  42 SER HG   1 1 
        1   2692 2 2  42 SER N    N  -61.529   5.544  -47.715 1.00 . B B .  42 SER N    1 1 
        1   2693 2 2  42 SER O    O  -59.562   3.577  -48.384 1.00 . B B .  42 SER O    1 1 
        1   2694 2 2  42 SER OG   O  -58.482   6.710  -49.450 1.00 . B B .  42 SER OG   1 1 
        1   2695 2 2  43 CYS C    C  -57.863   3.638  -51.948 1.00 . B B .  43 CYS C    1 1 
        1   2696 2 2  43 CYS CA   C  -59.048   3.128  -51.149 1.00 . B B .  43 CYS CA   1 1 
        1   2697 2 2  43 CYS CB   C  -60.000   2.372  -52.071 1.00 . B B .  43 CYS CB   1 1 
        1   2698 2 2  43 CYS H    H  -60.042   4.975  -51.118 1.00 . B B .  43 CYS H    1 1 
        1   2699 2 2  43 CYS HA   H  -58.697   2.459  -50.377 1.00 . B B .  43 CYS HA   1 1 
        1   2700 2 2  43 CYS HB2  H  -60.724   1.857  -51.462 1.00 . B B .  43 CYS HB2  1 1 
        1   2701 2 2  43 CYS HB3  H  -60.526   3.096  -52.679 1.00 . B B .  43 CYS HB3  1 1 
        1   2702 2 2  43 CYS N    N  -59.746   4.245  -50.536 1.00 . B B .  43 CYS N    1 1 
        1   2703 2 2  43 CYS O    O  -58.029   4.437  -52.860 1.00 . B B .  43 CYS O    1 1 
        1   2704 2 2  43 CYS SG   S  -59.229   1.164  -53.151 1.00 . B B .  43 CYS SG   1 1 
        1   2705 2 2  44 LYS C    C  -54.770   2.286  -52.951 1.00 . B B .  44 LYS C    1 1 
        1   2706 2 2  44 LYS CA   C  -55.455   3.509  -52.341 1.00 . B B .  44 LYS CA   1 1 
        1   2707 2 2  44 LYS CB   C  -54.497   4.301  -51.453 1.00 . B B .  44 LYS CB   1 1 
        1   2708 2 2  44 LYS CD   C  -53.969   6.670  -50.504 1.00 . B B .  44 LYS CD   1 1 
        1   2709 2 2  44 LYS CE   C  -52.628   6.862  -51.276 1.00 . B B .  44 LYS CE   1 1 
        1   2710 2 2  44 LYS CG   C  -54.984   5.748  -51.231 1.00 . B B .  44 LYS CG   1 1 
        1   2711 2 2  44 LYS H    H  -56.609   2.529  -50.865 1.00 . B B .  44 LYS H    1 1 
        1   2712 2 2  44 LYS HA   H  -55.745   4.153  -53.158 1.00 . B B .  44 LYS HA   1 1 
        1   2713 2 2  44 LYS HB2  H  -54.416   3.807  -50.496 1.00 . B B .  44 LYS HB2  1 1 
        1   2714 2 2  44 LYS HB3  H  -53.524   4.325  -51.920 1.00 . B B .  44 LYS HB3  1 1 
        1   2715 2 2  44 LYS HD2  H  -54.423   7.638  -50.362 1.00 . B B .  44 LYS HD2  1 1 
        1   2716 2 2  44 LYS HD3  H  -53.753   6.245  -49.533 1.00 . B B .  44 LYS HD3  1 1 
        1   2717 2 2  44 LYS HE2  H  -52.138   7.738  -50.885 1.00 . B B .  44 LYS HE2  1 1 
        1   2718 2 2  44 LYS HE3  H  -51.998   6.006  -51.070 1.00 . B B .  44 LYS HE3  1 1 
        1   2719 2 2  44 LYS HG2  H  -55.207   6.184  -52.192 1.00 . B B .  44 LYS HG2  1 1 
        1   2720 2 2  44 LYS HG3  H  -55.896   5.715  -50.652 1.00 . B B .  44 LYS HG3  1 1 
        1   2721 2 2  44 LYS HZ1  H  -53.567   6.500  -53.122 1.00 . B B .  44 LYS HZ1  1 1 
        1   2722 2 2  44 LYS HZ2  H  -51.879   6.660  -53.230 1.00 . B B .  44 LYS HZ2  1 1 
        1   2723 2 2  44 LYS HZ3  H  -52.852   8.034  -53.007 1.00 . B B .  44 LYS HZ3  1 1 
        1   2724 2 2  44 LYS N    N  -56.669   3.169  -51.605 1.00 . B B .  44 LYS N    1 1 
        1   2725 2 2  44 LYS NZ   N  -52.740   7.027  -52.776 1.00 . B B .  44 LYS NZ   1 1 
        1   2726 2 2  44 LYS O    O  -54.537   1.286  -52.273 1.00 . B B .  44 LYS O    1 1 
        1   2727 2 2  45 SER C    C  -52.318   1.530  -55.176 1.00 . B B .  45 SER C    1 1 
        1   2728 2 2  45 SER CA   C  -53.799   1.252  -54.917 1.00 . B B .  45 SER CA   1 1 
        1   2729 2 2  45 SER CB   C  -54.536   0.888  -56.213 1.00 . B B .  45 SER CB   1 1 
        1   2730 2 2  45 SER H    H  -54.678   3.174  -54.742 1.00 . B B .  45 SER H    1 1 
        1   2731 2 2  45 SER HA   H  -53.855   0.395  -54.261 1.00 . B B .  45 SER HA   1 1 
        1   2732 2 2  45 SER HB2  H  -54.441  -0.169  -56.383 1.00 . B B .  45 SER HB2  1 1 
        1   2733 2 2  45 SER HB3  H  -55.587   1.120  -56.087 1.00 . B B .  45 SER HB3  1 1 
        1   2734 2 2  45 SER HG   H  -53.102   1.737  -57.208 1.00 . B B .  45 SER HG   1 1 
        1   2735 2 2  45 SER N    N  -54.462   2.360  -54.240 1.00 . B B .  45 SER N    1 1 
        1   2736 2 2  45 SER O    O  -51.917   2.676  -55.362 1.00 . B B .  45 SER O    1 1 
        1   2737 2 2  45 SER OG   O  -54.036   1.566  -57.351 1.00 . B B .  45 SER OG   1 1 
        1   2738 2 2  46 SER C    C  -49.648   1.060  -56.723 1.00 . B B .  46 SER C    1 1 
        1   2739 2 2  46 SER CA   C  -50.072   0.577  -55.342 1.00 . B B .  46 SER CA   1 1 
        1   2740 2 2  46 SER CB   C  -49.393  -0.758  -55.033 1.00 . B B .  46 SER CB   1 1 
        1   2741 2 2  46 SER H    H  -51.910  -0.418  -55.025 1.00 . B B .  46 SER H    1 1 
        1   2742 2 2  46 SER HA   H  -49.718   1.297  -54.621 1.00 . B B .  46 SER HA   1 1 
        1   2743 2 2  46 SER HB2  H  -48.334  -0.657  -55.192 1.00 . B B .  46 SER HB2  1 1 
        1   2744 2 2  46 SER HB3  H  -49.564  -1.001  -53.991 1.00 . B B .  46 SER HB3  1 1 
        1   2745 2 2  46 SER HG   H  -49.392  -1.782  -56.684 1.00 . B B .  46 SER HG   1 1 
        1   2746 2 2  46 SER N    N  -51.519   0.466  -55.182 1.00 . B B .  46 SER N    1 1 
        1   2747 2 2  46 SER O    O  -48.568   1.643  -56.883 1.00 . B B .  46 SER O    1 1 
        1   2748 2 2  46 SER OG   O  -49.871  -1.812  -55.853 1.00 . B B .  46 SER OG   1 1 
        1   2749 2 2  47 GLN C    C  -51.280   1.999  -59.637 1.00 . B B .  47 GLN C    1 1 
        1   2750 2 2  47 GLN CA   C  -50.238   1.069  -59.106 1.00 . B B .  47 GLN CA   1 1 
        1   2751 2 2  47 GLN CB   C  -50.412  -0.220  -59.863 1.00 . B B .  47 GLN CB   1 1 
        1   2752 2 2  47 GLN CD   C  -49.337  -1.236  -61.793 1.00 . B B .  47 GLN CD   1 1 
        1   2753 2 2  47 GLN CG   C  -49.168  -0.828  -60.360 1.00 . B B .  47 GLN CG   1 1 
        1   2754 2 2  47 GLN H    H  -51.350   0.359  -57.475 1.00 . B B .  47 GLN H    1 1 
        1   2755 2 2  47 GLN HA   H  -49.246   1.464  -59.249 1.00 . B B .  47 GLN HA   1 1 
        1   2756 2 2  47 GLN HB2  H  -50.900  -0.932  -59.218 1.00 . B B .  47 GLN HB2  1 1 
        1   2757 2 2  47 GLN HB3  H  -51.062  -0.027  -60.706 1.00 . B B .  47 GLN HB3  1 1 
        1   2758 2 2  47 GLN HE21 H  -48.247  -2.908  -61.509 1.00 . B B .  47 GLN HE21 1 1 
        1   2759 2 2  47 GLN HE22 H  -48.832  -2.696  -63.088 1.00 . B B .  47 GLN HE22 1 1 
        1   2760 2 2  47 GLN HG2  H  -48.363  -0.111  -60.283 1.00 . B B .  47 GLN HG2  1 1 
        1   2761 2 2  47 GLN HG3  H  -48.932  -1.698  -59.767 1.00 . B B .  47 GLN HG3  1 1 
        1   2762 2 2  47 GLN N    N  -50.515   0.819  -57.703 1.00 . B B .  47 GLN N    1 1 
        1   2763 2 2  47 GLN NE2  N  -48.753  -2.383  -62.163 1.00 . B B .  47 GLN NE2  1 1 
        1   2764 2 2  47 GLN O    O  -52.460   1.826  -59.326 1.00 . B B .  47 GLN O    1 1 
        1   2765 2 2  47 GLN OE1  O  -50.006  -0.530  -62.574 1.00 . B B .  47 GLN OE1  1 1 
        1   2766 2 2  48 SER C    C  -52.923   3.066  -61.822 1.00 . B B .  48 SER C    1 1 
        1   2767 2 2  48 SER CA   C  -51.918   3.855  -61.004 1.00 . B B .  48 SER CA   1 1 
        1   2768 2 2  48 SER CB   C  -51.347   4.973  -61.846 1.00 . B B .  48 SER CB   1 1 
        1   2769 2 2  48 SER H    H  -49.951   3.072  -60.713 1.00 . B B .  48 SER H    1 1 
        1   2770 2 2  48 SER HA   H  -52.446   4.298  -60.170 1.00 . B B .  48 SER HA   1 1 
        1   2771 2 2  48 SER HB2  H  -50.648   5.551  -61.262 1.00 . B B .  48 SER HB2  1 1 
        1   2772 2 2  48 SER HB3  H  -50.842   4.558  -62.708 1.00 . B B .  48 SER HB3  1 1 
        1   2773 2 2  48 SER HG   H  -52.760   6.263  -61.487 1.00 . B B .  48 SER HG   1 1 
        1   2774 2 2  48 SER N    N  -50.892   2.969  -60.461 1.00 . B B .  48 SER N    1 1 
        1   2775 2 2  48 SER O    O  -52.559   2.107  -62.493 1.00 . B B .  48 SER O    1 1 
        1   2776 2 2  48 SER OG   O  -52.422   5.807  -62.261 1.00 . B B .  48 SER OG   1 1 
        1   2777 2 2  49 LEU C    C  -55.832   3.416  -63.684 1.00 . B B .  49 LEU C    1 1 
        1   2778 2 2  49 LEU CA   C  -55.253   2.731  -62.423 1.00 . B B .  49 LEU CA   1 1 
        1   2779 2 2  49 LEU CB   C  -56.354   2.429  -61.399 1.00 . B B .  49 LEU CB   1 1 
        1   2780 2 2  49 LEU CD1  C  -55.035   0.462  -60.367 1.00 . B B .  49 LEU CD1  1 1 
        1   2781 2 2  49 LEU CD2  C  -56.980   1.496  -59.207 1.00 . B B .  49 LEU CD2  1 1 
        1   2782 2 2  49 LEU CG   C  -56.374   1.156  -60.547 1.00 . B B .  49 LEU CG   1 1 
        1   2783 2 2  49 LEU H    H  -54.406   4.253  -61.215 1.00 . B B .  49 LEU H    1 1 
        1   2784 2 2  49 LEU HA   H  -54.840   1.784  -62.736 1.00 . B B .  49 LEU HA   1 1 
        1   2785 2 2  49 LEU HB2  H  -56.366   3.250  -60.706 1.00 . B B .  49 LEU HB2  1 1 
        1   2786 2 2  49 LEU HB3  H  -57.292   2.468  -61.943 1.00 . B B .  49 LEU HB3  1 1 
        1   2787 2 2  49 LEU HD11 H  -54.852  -0.191  -61.208 1.00 . B B .  49 LEU HD11 1 1 
        1   2788 2 2  49 LEU HD12 H  -55.049  -0.119  -59.457 1.00 . B B .  49 LEU HD12 1 1 
        1   2789 2 2  49 LEU HD13 H  -54.250   1.202  -60.309 1.00 . B B .  49 LEU HD13 1 1 
        1   2790 2 2  49 LEU HD21 H  -57.094   0.595  -58.623 1.00 . B B .  49 LEU HD21 1 1 
        1   2791 2 2  49 LEU HD22 H  -57.948   1.954  -59.355 1.00 . B B .  49 LEU HD22 1 1 
        1   2792 2 2  49 LEU HD23 H  -56.333   2.184  -58.683 1.00 . B B .  49 LEU HD23 1 1 
        1   2793 2 2  49 LEU HG   H  -57.037   0.455  -61.031 1.00 . B B .  49 LEU HG   1 1 
        1   2794 2 2  49 LEU N    N  -54.180   3.475  -61.767 1.00 . B B .  49 LEU N    1 1 
        1   2795 2 2  49 LEU O    O  -56.931   3.080  -64.133 1.00 . B B .  49 LEU O    1 1 
        1   2796 2 2  50 LEU C    C  -55.034   4.519  -66.751 1.00 . B B .  50 LEU C    1 1 
        1   2797 2 2  50 LEU CA   C  -55.548   5.115  -65.435 1.00 . B B .  50 LEU CA   1 1 
        1   2798 2 2  50 LEU CB   C  -55.097   6.583  -65.356 1.00 . B B .  50 LEU CB   1 1 
        1   2799 2 2  50 LEU CD1  C  -55.444   8.820  -66.450 1.00 . B B .  50 LEU CD1  1 1 
        1   2800 2 2  50 LEU CD2  C  -57.389   7.311  -66.225 1.00 . B B .  50 LEU CD2  1 1 
        1   2801 2 2  50 LEU CG   C  -56.083   7.743  -65.594 1.00 . B B .  50 LEU CG   1 1 
        1   2802 2 2  50 LEU H    H  -54.224   4.593  -63.856 1.00 . B B .  50 LEU H    1 1 
        1   2803 2 2  50 LEU HA   H  -56.627   5.095  -65.452 1.00 . B B .  50 LEU HA   1 1 
        1   2804 2 2  50 LEU HB2  H  -54.686   6.732  -64.374 1.00 . B B .  50 LEU HB2  1 1 
        1   2805 2 2  50 LEU HB3  H  -54.281   6.696  -66.060 1.00 . B B .  50 LEU HB3  1 1 
        1   2806 2 2  50 LEU HD11 H  -54.434   8.998  -66.110 1.00 . B B .  50 LEU HD11 1 1 
        1   2807 2 2  50 LEU HD12 H  -56.018   9.731  -66.369 1.00 . B B .  50 LEU HD12 1 1 
        1   2808 2 2  50 LEU HD13 H  -55.425   8.496  -67.480 1.00 . B B .  50 LEU HD13 1 1 
        1   2809 2 2  50 LEU HD21 H  -57.521   6.248  -66.089 1.00 . B B .  50 LEU HD21 1 1 
        1   2810 2 2  50 LEU HD22 H  -57.372   7.540  -67.280 1.00 . B B .  50 LEU HD22 1 1 
        1   2811 2 2  50 LEU HD23 H  -58.207   7.837  -65.755 1.00 . B B .  50 LEU HD23 1 1 
        1   2812 2 2  50 LEU HG   H  -56.304   8.183  -64.630 1.00 . B B .  50 LEU HG   1 1 
        1   2813 2 2  50 LEU N    N  -55.091   4.368  -64.252 1.00 . B B .  50 LEU N    1 1 
        1   2814 2 2  50 LEU O    O  -53.858   4.150  -66.869 1.00 . B B .  50 LEU O    1 1 
        1   2815 2 2  51 ASN C    C  -55.095   5.521  -69.774 1.00 . B B .  51 ASN C    1 1 
        1   2816 2 2  51 ASN CA   C  -55.479   4.205  -69.108 1.00 . B B .  51 ASN CA   1 1 
        1   2817 2 2  51 ASN CB   C  -56.575   3.514  -69.925 1.00 . B B .  51 ASN CB   1 1 
        1   2818 2 2  51 ASN CG   C  -56.360   2.025  -70.035 1.00 . B B .  51 ASN CG   1 1 
        1   2819 2 2  51 ASN H    H  -56.832   4.741  -67.582 1.00 . B B .  51 ASN H    1 1 
        1   2820 2 2  51 ASN HA   H  -54.610   3.564  -69.089 1.00 . B B .  51 ASN HA   1 1 
        1   2821 2 2  51 ASN HB2  H  -57.528   3.693  -69.453 1.00 . B B .  51 ASN HB2  1 1 
        1   2822 2 2  51 ASN HB3  H  -56.592   3.942  -70.918 1.00 . B B .  51 ASN HB3  1 1 
        1   2823 2 2  51 ASN HD21 H  -54.566   2.305  -70.895 1.00 . B B .  51 ASN HD21 1 1 
        1   2824 2 2  51 ASN HD22 H  -55.015   0.682  -70.684 1.00 . B B .  51 ASN HD22 1 1 
        1   2825 2 2  51 ASN N    N  -55.915   4.432  -67.739 1.00 . B B .  51 ASN N    1 1 
        1   2826 2 2  51 ASN ND2  N  -55.213   1.636  -70.587 1.00 . B B .  51 ASN ND2  1 1 
        1   2827 2 2  51 ASN O    O  -55.619   6.586  -69.432 1.00 . B B .  51 ASN O    1 1 
        1   2828 2 2  51 ASN OD1  O  -57.203   1.225  -69.613 1.00 . B B .  51 ASN OD1  1 1 
        1   2829 2 2  52 SER C    C  -55.249   6.875  -72.377 1.00 . B B .  52 SER C    1 1 
        1   2830 2 2  52 SER CA   C  -53.953   6.601  -71.598 1.00 . B B .  52 SER CA   1 1 
        1   2831 2 2  52 SER CB   C  -52.739   6.395  -72.526 1.00 . B B .  52 SER CB   1 1 
        1   2832 2 2  52 SER H    H  -53.778   4.589  -70.954 1.00 . B B .  52 SER H    1 1 
        1   2833 2 2  52 SER HA   H  -53.758   7.462  -70.971 1.00 . B B .  52 SER HA   1 1 
        1   2834 2 2  52 SER HB2  H  -52.837   7.038  -73.383 1.00 . B B .  52 SER HB2  1 1 
        1   2835 2 2  52 SER HB3  H  -51.839   6.668  -71.988 1.00 . B B .  52 SER HB3  1 1 
        1   2836 2 2  52 SER HG   H  -52.467   4.493  -72.215 1.00 . B B .  52 SER HG   1 1 
        1   2837 2 2  52 SER N    N  -54.172   5.456  -70.722 1.00 . B B .  52 SER N    1 1 
        1   2838 2 2  52 SER O    O  -55.805   7.960  -72.250 1.00 . B B .  52 SER O    1 1 
        1   2839 2 2  52 SER OG   O  -52.638   5.051  -72.978 1.00 . B B .  52 SER OG   1 1 
        1   2840 2 2  53 ARG C    C  -58.243   5.898  -72.941 1.00 . B B .  53 ARG C    1 1 
        1   2841 2 2  53 ARG CA   C  -57.012   6.032  -73.849 1.00 . B B .  53 ARG CA   1 1 
        1   2842 2 2  53 ARG CB   C  -57.083   5.129  -75.088 1.00 . B B .  53 ARG CB   1 1 
        1   2843 2 2  53 ARG CD   C  -56.426   2.946  -76.154 1.00 . B B .  53 ARG CD   1 1 
        1   2844 2 2  53 ARG CG   C  -56.155   3.935  -75.052 1.00 . B B .  53 ARG CG   1 1 
        1   2845 2 2  53 ARG CZ   C  -54.903   1.170  -76.979 1.00 . B B .  53 ARG CZ   1 1 
        1   2846 2 2  53 ARG H    H  -55.275   5.028  -73.160 1.00 . B B .  53 ARG H    1 1 
        1   2847 2 2  53 ARG HA   H  -57.027   7.051  -74.214 1.00 . B B .  53 ARG HA   1 1 
        1   2848 2 2  53 ARG HB2  H  -58.094   4.768  -75.191 1.00 . B B .  53 ARG HB2  1 1 
        1   2849 2 2  53 ARG HB3  H  -56.845   5.726  -75.957 1.00 . B B .  53 ARG HB3  1 1 
        1   2850 2 2  53 ARG HD2  H  -57.453   2.616  -76.100 1.00 . B B .  53 ARG HD2  1 1 
        1   2851 2 2  53 ARG HD3  H  -56.245   3.412  -77.111 1.00 . B B .  53 ARG HD3  1 1 
        1   2852 2 2  53 ARG HE   H  -55.389   1.476  -75.078 1.00 . B B .  53 ARG HE   1 1 
        1   2853 2 2  53 ARG HG2  H  -55.138   4.284  -75.144 1.00 . B B .  53 ARG HG2  1 1 
        1   2854 2 2  53 ARG HG3  H  -56.266   3.438  -74.099 1.00 . B B .  53 ARG HG3  1 1 
        1   2855 2 2  53 ARG HH11 H  -55.643   2.322  -78.476 1.00 . B B .  53 ARG HH11 1 1 
        1   2856 2 2  53 ARG HH12 H  -54.565   1.061  -78.976 1.00 . B B .  53 ARG HH12 1 1 
        1   2857 2 2  53 ARG HH21 H  -53.988  -0.148  -75.742 1.00 . B B .  53 ARG HH21 1 1 
        1   2858 2 2  53 ARG HH22 H  -53.626  -0.338  -77.425 1.00 . B B .  53 ARG HH22 1 1 
        1   2859 2 2  53 ARG N    N  -55.746   5.887  -73.128 1.00 . B B .  53 ARG N    1 1 
        1   2860 2 2  53 ARG NE   N  -55.537   1.803  -75.990 1.00 . B B .  53 ARG NE   1 1 
        1   2861 2 2  53 ARG NH1  N  -55.049   1.549  -78.250 1.00 . B B .  53 ARG NH1  1 1 
        1   2862 2 2  53 ARG NH2  N  -54.106   0.143  -76.692 1.00 . B B .  53 ARG NH2  1 1 
        1   2863 2 2  53 ARG O    O  -58.504   4.850  -72.317 1.00 . B B .  53 ARG O    1 1 
        1   2864 2 2  54 THR C    C  -59.593   7.379  -70.516 1.00 . B B .  54 THR C    1 1 
        1   2865 2 2  54 THR CA   C  -60.071   7.302  -71.940 1.00 . B B .  54 THR CA   1 1 
        1   2866 2 2  54 THR CB   C  -61.281   6.304  -71.969 1.00 . B B .  54 THR CB   1 1 
        1   2867 2 2  54 THR CG2  C  -62.437   6.848  -71.117 1.00 . B B .  54 THR CG2  1 1 
        1   2868 2 2  54 THR H    H  -58.678   7.751  -73.456 1.00 . B B .  54 THR H    1 1 
        1   2869 2 2  54 THR HA   H  -60.458   8.277  -72.198 1.00 . B B .  54 THR HA   1 1 
        1   2870 2 2  54 THR HB   H  -60.964   5.355  -71.564 1.00 . B B .  54 THR HB   1 1 
        1   2871 2 2  54 THR HG1  H  -62.693   5.980  -73.291 1.00 . B B .  54 THR HG1  1 1 
        1   2872 2 2  54 THR HG21 H  -63.246   6.133  -71.110 1.00 . B B .  54 THR HG21 1 1 
        1   2873 2 2  54 THR HG22 H  -62.784   7.781  -71.535 1.00 . B B .  54 THR HG22 1 1 
        1   2874 2 2  54 THR HG23 H  -62.093   7.012  -70.106 1.00 . B B .  54 THR HG23 1 1 
        1   2875 2 2  54 THR N    N  -58.987   7.001  -72.905 1.00 . B B .  54 THR N    1 1 
        1   2876 2 2  54 THR O    O  -58.973   6.440  -70.012 1.00 . B B .  54 THR O    1 1 
        1   2877 2 2  54 THR OG1  O  -61.742   6.109  -73.318 1.00 . B B .  54 THR OG1  1 1 
        1   2878 2 2  55 ARG C    C  -60.878   7.391  -68.008 1.00 . B B .  55 ARG C    1 1 
        1   2879 2 2  55 ARG CA   C  -59.935   8.516  -68.403 1.00 . B B .  55 ARG CA   1 1 
        1   2880 2 2  55 ARG CB   C  -60.438   9.855  -67.831 1.00 . B B .  55 ARG CB   1 1 
        1   2881 2 2  55 ARG CD   C  -59.939  12.189  -66.945 1.00 . B B .  55 ARG CD   1 1 
        1   2882 2 2  55 ARG CG   C  -59.347  10.824  -67.312 1.00 . B B .  55 ARG CG   1 1 
        1   2883 2 2  55 ARG CZ   C  -61.483  13.840  -67.991 1.00 . B B .  55 ARG CZ   1 1 
        1   2884 2 2  55 ARG H    H  -60.408   9.185  -70.349 1.00 . B B .  55 ARG H    1 1 
        1   2885 2 2  55 ARG HA   H  -58.945   8.303  -68.022 1.00 . B B .  55 ARG HA   1 1 
        1   2886 2 2  55 ARG HB2  H  -60.990  10.363  -68.606 1.00 . B B .  55 ARG HB2  1 1 
        1   2887 2 2  55 ARG HB3  H  -61.120   9.639  -67.020 1.00 . B B .  55 ARG HB3  1 1 
        1   2888 2 2  55 ARG HD2  H  -60.392  12.126  -65.968 1.00 . B B .  55 ARG HD2  1 1 
        1   2889 2 2  55 ARG HD3  H  -59.144  12.921  -66.917 1.00 . B B .  55 ARG HD3  1 1 
        1   2890 2 2  55 ARG HE   H  -61.275  11.947  -68.556 1.00 . B B .  55 ARG HE   1 1 
        1   2891 2 2  55 ARG HG2  H  -58.882  10.396  -66.438 1.00 . B B .  55 ARG HG2  1 1 
        1   2892 2 2  55 ARG HG3  H  -58.600  10.958  -68.081 1.00 . B B .  55 ARG HG3  1 1 
        1   2893 2 2  55 ARG HH11 H  -60.396  14.607  -66.460 1.00 . B B .  55 ARG HH11 1 1 
        1   2894 2 2  55 ARG HH12 H  -61.491  15.715  -67.217 1.00 . B B .  55 ARG HH12 1 1 
        1   2895 2 2  55 ARG HH21 H  -62.707  13.394  -69.548 1.00 . B B .  55 ARG HH21 1 1 
        1   2896 2 2  55 ARG HH22 H  -62.806  15.025  -68.974 1.00 . B B .  55 ARG HH22 1 1 
        1   2897 2 2  55 ARG N    N  -59.906   8.495  -69.868 1.00 . B B .  55 ARG N    1 1 
        1   2898 2 2  55 ARG NE   N  -60.956  12.616  -67.915 1.00 . B B .  55 ARG NE   1 1 
        1   2899 2 2  55 ARG NH1  N  -61.091  14.801  -67.153 1.00 . B B .  55 ARG NH1  1 1 
        1   2900 2 2  55 ARG NH2  N  -62.410  14.109  -68.915 1.00 . B B .  55 ARG NH2  1 1 
        1   2901 2 2  55 ARG O    O  -62.105   7.513  -68.131 1.00 . B B .  55 ARG O    1 1 
        1   2902 2 2  56 LYS C    C  -60.262   4.504  -66.080 1.00 . B B .  56 LYS C    1 1 
        1   2903 2 2  56 LYS CA   C  -61.020   5.080  -67.243 1.00 . B B .  56 LYS CA   1 1 
        1   2904 2 2  56 LYS CB   C  -61.041   4.101  -68.425 1.00 . B B .  56 LYS CB   1 1 
        1   2905 2 2  56 LYS CD   C  -63.531   3.865  -68.252 1.00 . B B .  56 LYS CD   1 1 
        1   2906 2 2  56 LYS CE   C  -64.855   4.080  -68.973 1.00 . B B .  56 LYS CE   1 1 
        1   2907 2 2  56 LYS CG   C  -62.346   4.079  -69.184 1.00 . B B .  56 LYS CG   1 1 
        1   2908 2 2  56 LYS H    H  -59.306   6.253  -67.571 1.00 . B B .  56 LYS H    1 1 
        1   2909 2 2  56 LYS HA   H  -62.027   5.333  -66.944 1.00 . B B .  56 LYS HA   1 1 
        1   2910 2 2  56 LYS HB2  H  -60.254   4.372  -69.111 1.00 . B B .  56 LYS HB2  1 1 
        1   2911 2 2  56 LYS HB3  H  -60.839   3.107  -68.050 1.00 . B B .  56 LYS HB3  1 1 
        1   2912 2 2  56 LYS HD2  H  -63.500   2.857  -67.867 1.00 . B B .  56 LYS HD2  1 1 
        1   2913 2 2  56 LYS HD3  H  -63.461   4.560  -67.428 1.00 . B B .  56 LYS HD3  1 1 
        1   2914 2 2  56 LYS HE2  H  -64.837   3.538  -69.905 1.00 . B B .  56 LYS HE2  1 1 
        1   2915 2 2  56 LYS HE3  H  -65.653   3.690  -68.358 1.00 . B B .  56 LYS HE3  1 1 
        1   2916 2 2  56 LYS HG2  H  -62.469   5.019  -69.700 1.00 . B B .  56 LYS HG2  1 1 
        1   2917 2 2  56 LYS HG3  H  -62.319   3.279  -69.910 1.00 . B B .  56 LYS HG3  1 1 
        1   2918 2 2  56 LYS HZ1  H  -64.365   6.115  -68.856 1.00 . B B .  56 LYS HZ1  1 1 
        1   2919 2 2  56 LYS HZ2  H  -66.035   5.807  -68.841 1.00 . B B .  56 LYS HZ2  1 1 
        1   2920 2 2  56 LYS HZ3  H  -65.159   5.681  -70.291 1.00 . B B .  56 LYS HZ3  1 1 
        1   2921 2 2  56 LYS N    N  -60.286   6.279  -67.596 1.00 . B B .  56 LYS N    1 1 
        1   2922 2 2  56 LYS NZ   N  -65.124   5.533  -69.262 1.00 . B B .  56 LYS NZ   1 1 
        1   2923 2 2  56 LYS O    O  -59.134   4.013  -66.250 1.00 . B B .  56 LYS O    1 1 
        1   2924 2 2  57 ASN C    C  -60.093   2.930  -63.098 1.00 . B B .  57 ASN C    1 1 
        1   2925 2 2  57 ASN CA   C  -60.016   4.304  -63.724 1.00 . B B .  57 ASN CA   1 1 
        1   2926 2 2  57 ASN CB   C  -60.002   5.441  -62.699 1.00 . B B .  57 ASN CB   1 1 
        1   2927 2 2  57 ASN CG   C  -58.694   6.229  -62.743 1.00 . B B .  57 ASN CG   1 1 
        1   2928 2 2  57 ASN H    H  -61.716   5.015  -64.787 1.00 . B B .  57 ASN H    1 1 
        1   2929 2 2  57 ASN HA   H  -59.015   4.320  -64.134 1.00 . B B .  57 ASN HA   1 1 
        1   2930 2 2  57 ASN HB2  H  -60.822   6.112  -62.905 1.00 . B B .  57 ASN HB2  1 1 
        1   2931 2 2  57 ASN HB3  H  -60.129   5.024  -61.711 1.00 . B B .  57 ASN HB3  1 1 
        1   2932 2 2  57 ASN HD21 H  -57.621   4.535  -62.738 1.00 . B B .  57 ASN HD21 1 1 
        1   2933 2 2  57 ASN HD22 H  -56.707   5.965  -62.784 1.00 . B B .  57 ASN HD22 1 1 
        1   2934 2 2  57 ASN N    N  -60.838   4.591  -64.887 1.00 . B B .  57 ASN N    1 1 
        1   2935 2 2  57 ASN ND2  N  -57.576   5.514  -62.756 1.00 . B B .  57 ASN ND2  1 1 
        1   2936 2 2  57 ASN O    O  -59.531   2.708  -62.023 1.00 . B B .  57 ASN O    1 1 
        1   2937 2 2  57 ASN OD1  O  -58.691   7.458  -62.786 1.00 . B B .  57 ASN OD1  1 1 
        1   2938 2 2  58 TYR C    C  -60.588   0.050  -62.073 1.00 . B B .  58 TYR C    1 1 
        1   2939 2 2  58 TYR CA   C  -60.602   0.549  -63.543 1.00 . B B .  58 TYR CA   1 1 
        1   2940 2 2  58 TYR CB   C  -59.465   0.012  -64.423 1.00 . B B .  58 TYR CB   1 1 
        1   2941 2 2  58 TYR CD1  C  -61.181  -0.193  -66.261 1.00 . B B .  58 TYR CD1  1 1 
        1   2942 2 2  58 TYR CD2  C  -59.018   0.688  -66.834 1.00 . B B .  58 TYR CD2  1 1 
        1   2943 2 2  58 TYR CE1  C  -61.605  -0.055  -67.566 1.00 . B B .  58 TYR CE1  1 1 
        1   2944 2 2  58 TYR CE2  C  -59.431   0.832  -68.157 1.00 . B B .  58 TYR CE2  1 1 
        1   2945 2 2  58 TYR CG   C  -59.878   0.157  -65.870 1.00 . B B .  58 TYR CG   1 1 
        1   2946 2 2  58 TYR CZ   C  -60.730   0.459  -68.515 1.00 . B B .  58 TYR CZ   1 1 
        1   2947 2 2  58 TYR H    H  -61.151   2.272  -64.643 1.00 . B B .  58 TYR H    1 1 
        1   2948 2 2  58 TYR HA   H  -61.501   0.114  -63.956 1.00 . B B .  58 TYR HA   1 1 
        1   2949 2 2  58 TYR HB2  H  -58.565   0.581  -64.241 1.00 . B B .  58 TYR HB2  1 1 
        1   2950 2 2  58 TYR HB3  H  -59.290  -1.029  -64.199 1.00 . B B .  58 TYR HB3  1 1 
        1   2951 2 2  58 TYR HD1  H  -61.863  -0.593  -65.525 1.00 . B B .  58 TYR HD1  1 1 
        1   2952 2 2  58 TYR HD2  H  -58.012   0.965  -66.556 1.00 . B B .  58 TYR HD2  1 1 
        1   2953 2 2  58 TYR HE1  H  -62.608  -0.341  -67.847 1.00 . B B .  58 TYR HE1  1 1 
        1   2954 2 2  58 TYR HE2  H  -58.759   1.244  -68.895 1.00 . B B .  58 TYR HE2  1 1 
        1   2955 2 2  58 TYR HH   H  -60.655   1.241  -70.255 1.00 . B B .  58 TYR HH   1 1 
        1   2956 2 2  58 TYR N    N  -60.754   2.001  -63.789 1.00 . B B .  58 TYR N    1 1 
        1   2957 2 2  58 TYR O    O  -59.969  -0.960  -61.722 1.00 . B B .  58 TYR O    1 1 
        1   2958 2 2  58 TYR OH   O  -61.196   0.587  -69.807 1.00 . B B .  58 TYR OH   1 1 
        1   2959 2 2  59 LEU C    C  -62.963   0.230  -59.618 1.00 . B B .  59 LEU C    1 1 
        1   2960 2 2  59 LEU CA   C  -61.486   0.393  -59.864 1.00 . B B .  59 LEU CA   1 1 
        1   2961 2 2  59 LEU CB   C  -60.931   1.469  -58.937 1.00 . B B .  59 LEU CB   1 1 
        1   2962 2 2  59 LEU CD1  C  -59.987   1.711  -56.660 1.00 . B B .  59 LEU CD1  1 1 
        1   2963 2 2  59 LEU CD2  C  -62.447   1.741  -56.891 1.00 . B B .  59 LEU CD2  1 1 
        1   2964 2 2  59 LEU CG   C  -61.140   1.181  -57.443 1.00 . B B .  59 LEU CG   1 1 
        1   2965 2 2  59 LEU H    H  -61.811   1.549  -61.577 1.00 . B B .  59 LEU H    1 1 
        1   2966 2 2  59 LEU HA   H  -60.980  -0.542  -59.681 1.00 . B B .  59 LEU HA   1 1 
        1   2967 2 2  59 LEU HB2  H  -59.872   1.566  -59.119 1.00 . B B .  59 LEU HB2  1 1 
        1   2968 2 2  59 LEU HB3  H  -61.407   2.409  -59.178 1.00 . B B .  59 LEU HB3  1 1 
        1   2969 2 2  59 LEU HD11 H  -60.254   1.764  -55.616 1.00 . B B .  59 LEU HD11 1 1 
        1   2970 2 2  59 LEU HD12 H  -59.733   2.699  -57.018 1.00 . B B .  59 LEU HD12 1 1 
        1   2971 2 2  59 LEU HD13 H  -59.138   1.055  -56.781 1.00 . B B .  59 LEU HD13 1 1 
        1   2972 2 2  59 LEU HD21 H  -62.231   2.517  -56.172 1.00 . B B .  59 LEU HD21 1 1 
        1   2973 2 2  59 LEU HD22 H  -63.003   0.950  -56.410 1.00 . B B .  59 LEU HD22 1 1 
        1   2974 2 2  59 LEU HD23 H  -63.033   2.152  -57.700 1.00 . B B .  59 LEU HD23 1 1 
        1   2975 2 2  59 LEU HG   H  -61.153   0.106  -57.317 1.00 . B B .  59 LEU HG   1 1 
        1   2976 2 2  59 LEU N    N  -61.321   0.772  -61.235 1.00 . B B .  59 LEU N    1 1 
        1   2977 2 2  59 LEU O    O  -63.758   1.050  -60.079 1.00 . B B .  59 LEU O    1 1 
        1   2978 2 2  60 ALA C    C  -64.766  -0.954  -56.849 1.00 . B B .  60 ALA C    1 1 
        1   2979 2 2  60 ALA CA   C  -64.674  -0.968  -58.389 1.00 . B B .  60 ALA CA   1 1 
        1   2980 2 2  60 ALA CB   C  -65.286  -2.215  -58.952 1.00 . B B .  60 ALA CB   1 1 
        1   2981 2 2  60 ALA H    H  -62.625  -1.422  -58.543 1.00 . B B .  60 ALA H    1 1 
        1   2982 2 2  60 ALA HA   H  -65.247  -0.129  -58.756 1.00 . B B .  60 ALA HA   1 1 
        1   2983 2 2  60 ALA HB1  H  -65.833  -2.730  -58.176 1.00 . B B .  60 ALA HB1  1 1 
        1   2984 2 2  60 ALA HB2  H  -64.505  -2.859  -59.330 1.00 . B B .  60 ALA HB2  1 1 
        1   2985 2 2  60 ALA HB3  H  -65.960  -1.955  -59.754 1.00 . B B .  60 ALA HB3  1 1 
        1   2986 2 2  60 ALA N    N  -63.321  -0.819  -58.880 1.00 . B B .  60 ALA N    1 1 
        1   2987 2 2  60 ALA O    O  -63.779  -1.234  -56.145 1.00 . B B .  60 ALA O    1 1 
        1   2988 2 2  61 TRP C    C  -67.421  -1.664  -54.765 1.00 . B B .  61 TRP C    1 1 
        1   2989 2 2  61 TRP CA   C  -66.312  -0.660  -54.939 1.00 . B B .  61 TRP CA   1 1 
        1   2990 2 2  61 TRP CB   C  -66.856   0.682  -54.476 1.00 . B B .  61 TRP CB   1 1 
        1   2991 2 2  61 TRP CD1  C  -65.464   2.651  -55.171 1.00 . B B .  61 TRP CD1  1 1 
        1   2992 2 2  61 TRP CD2  C  -65.012   1.891  -53.136 1.00 . B B .  61 TRP CD2  1 1 
        1   2993 2 2  61 TRP CE2  C  -64.173   2.973  -53.396 1.00 . B B .  61 TRP CE2  1 1 
        1   2994 2 2  61 TRP CE3  C  -64.903   1.234  -51.914 1.00 . B B .  61 TRP CE3  1 1 
        1   2995 2 2  61 TRP CG   C  -65.828   1.705  -54.286 1.00 . B B .  61 TRP CG   1 1 
        1   2996 2 2  61 TRP CH2  C  -63.150   2.768  -51.289 1.00 . B B .  61 TRP CH2  1 1 
        1   2997 2 2  61 TRP CZ2  C  -63.234   3.426  -52.480 1.00 . B B .  61 TRP CZ2  1 1 
        1   2998 2 2  61 TRP CZ3  C  -63.974   1.684  -51.002 1.00 . B B .  61 TRP CZ3  1 1 
        1   2999 2 2  61 TRP H    H  -66.670  -0.378  -56.992 1.00 . B B .  61 TRP H    1 1 
        1   3000 2 2  61 TRP HA   H  -65.454  -0.937  -54.347 1.00 . B B .  61 TRP HA   1 1 
        1   3001 2 2  61 TRP HB2  H  -67.559   1.041  -55.210 1.00 . B B .  61 TRP HB2  1 1 
        1   3002 2 2  61 TRP HB3  H  -67.380   0.535  -53.542 1.00 . B B .  61 TRP HB3  1 1 
        1   3003 2 2  61 TRP HD1  H  -65.898   2.781  -56.151 1.00 . B B .  61 TRP HD1  1 1 
        1   3004 2 2  61 TRP HE1  H  -64.026   4.181  -55.087 1.00 . B B .  61 TRP HE1  1 1 
        1   3005 2 2  61 TRP HE3  H  -65.538   0.392  -51.682 1.00 . B B .  61 TRP HE3  1 1 
        1   3006 2 2  61 TRP HH2  H  -62.432   3.096  -50.553 1.00 . B B .  61 TRP HH2  1 1 
        1   3007 2 2  61 TRP HZ2  H  -62.594   4.267  -52.702 1.00 . B B .  61 TRP HZ2  1 1 
        1   3008 2 2  61 TRP HZ3  H  -63.882   1.185  -50.049 1.00 . B B .  61 TRP HZ3  1 1 
        1   3009 2 2  61 TRP N    N  -65.959  -0.600  -56.354 1.00 . B B .  61 TRP N    1 1 
        1   3010 2 2  61 TRP NE1  N  -64.469   3.424  -54.650 1.00 . B B .  61 TRP NE1  1 1 
        1   3011 2 2  61 TRP O    O  -68.474  -1.513  -55.382 1.00 . B B .  61 TRP O    1 1 
        1   3012 2 2  62 TYR C    C  -68.655  -3.519  -52.171 1.00 . B B .  62 TYR C    1 1 
        1   3013 2 2  62 TYR CA   C  -68.263  -3.645  -53.622 1.00 . B B .  62 TYR CA   1 1 
        1   3014 2 2  62 TYR CB   C  -67.806  -5.092  -53.883 1.00 . B B .  62 TYR CB   1 1 
        1   3015 2 2  62 TYR CD1  C  -66.300  -4.904  -55.875 1.00 . B B .  62 TYR CD1  1 1 
        1   3016 2 2  62 TYR CD2  C  -68.280  -6.195  -56.091 1.00 . B B .  62 TYR CD2  1 1 
        1   3017 2 2  62 TYR CE1  C  -65.968  -5.168  -57.186 1.00 . B B .  62 TYR CE1  1 1 
        1   3018 2 2  62 TYR CE2  C  -67.956  -6.479  -57.431 1.00 . B B .  62 TYR CE2  1 1 
        1   3019 2 2  62 TYR CG   C  -67.457  -5.402  -55.310 1.00 . B B .  62 TYR CG   1 1 
        1   3020 2 2  62 TYR CZ   C  -66.788  -5.961  -57.973 1.00 . B B .  62 TYR CZ   1 1 
        1   3021 2 2  62 TYR H    H  -66.353  -2.728  -53.453 1.00 . B B .  62 TYR H    1 1 
        1   3022 2 2  62 TYR HA   H  -69.125  -3.432  -54.238 1.00 . B B .  62 TYR HA   1 1 
        1   3023 2 2  62 TYR HB2  H  -66.937  -5.289  -53.277 1.00 . B B .  62 TYR HB2  1 1 
        1   3024 2 2  62 TYR HB3  H  -68.597  -5.759  -53.567 1.00 . B B .  62 TYR HB3  1 1 
        1   3025 2 2  62 TYR HD1  H  -65.647  -4.284  -55.280 1.00 . B B .  62 TYR HD1  1 1 
        1   3026 2 2  62 TYR HD2  H  -69.188  -6.597  -55.667 1.00 . B B .  62 TYR HD2  1 1 
        1   3027 2 2  62 TYR HE1  H  -65.056  -4.764  -57.600 1.00 . B B .  62 TYR HE1  1 1 
        1   3028 2 2  62 TYR HE2  H  -68.607  -7.099  -58.030 1.00 . B B .  62 TYR HE2  1 1 
        1   3029 2 2  62 TYR HH   H  -65.724  -5.606  -59.524 1.00 . B B .  62 TYR HH   1 1 
        1   3030 2 2  62 TYR N    N  -67.210  -2.670  -53.925 1.00 . B B .  62 TYR N    1 1 
        1   3031 2 2  62 TYR O    O  -67.793  -3.481  -51.291 1.00 . B B .  62 TYR O    1 1 
        1   3032 2 2  62 TYR OH   O  -66.424  -6.218  -59.285 1.00 . B B .  62 TYR OH   1 1 
        1   3033 2 2  63 GLN C    C  -70.783  -4.960  -50.261 1.00 . B B .  63 GLN C    1 1 
        1   3034 2 2  63 GLN CA   C  -70.421  -3.518  -50.548 1.00 . B B .  63 GLN CA   1 1 
        1   3035 2 2  63 GLN CB   C  -71.624  -2.613  -50.329 1.00 . B B .  63 GLN CB   1 1 
        1   3036 2 2  63 GLN CD   C  -74.073  -2.933  -49.802 1.00 . B B .  63 GLN CD   1 1 
        1   3037 2 2  63 GLN CG   C  -72.962  -3.152  -50.824 1.00 . B B .  63 GLN CG   1 1 
        1   3038 2 2  63 GLN H    H  -70.596  -3.483  -52.653 1.00 . B B .  63 GLN H    1 1 
        1   3039 2 2  63 GLN HA   H  -69.622  -3.216  -49.886 1.00 . B B .  63 GLN HA   1 1 
        1   3040 2 2  63 GLN HB2  H  -71.714  -2.423  -49.272 1.00 . B B .  63 GLN HB2  1 1 
        1   3041 2 2  63 GLN HB3  H  -71.429  -1.672  -50.825 1.00 . B B .  63 GLN HB3  1 1 
        1   3042 2 2  63 GLN HE21 H  -72.816  -3.336  -48.280 1.00 . B B .  63 GLN HE21 1 1 
        1   3043 2 2  63 GLN HE22 H  -74.406  -2.966  -47.815 1.00 . B B .  63 GLN HE22 1 1 
        1   3044 2 2  63 GLN HG2  H  -73.226  -2.649  -51.742 1.00 . B B .  63 GLN HG2  1 1 
        1   3045 2 2  63 GLN HG3  H  -72.865  -4.210  -51.019 1.00 . B B .  63 GLN HG3  1 1 
        1   3046 2 2  63 GLN N    N  -69.952  -3.451  -51.915 1.00 . B B .  63 GLN N    1 1 
        1   3047 2 2  63 GLN NE2  N  -73.735  -3.092  -48.518 1.00 . B B .  63 GLN NE2  1 1 
        1   3048 2 2  63 GLN O    O  -71.218  -5.681  -51.170 1.00 . B B .  63 GLN O    1 1 
        1   3049 2 2  63 GLN OE1  O  -75.217  -2.613  -50.156 1.00 . B B .  63 GLN OE1  1 1 
        1   3050 2 2  64 GLN C    C  -71.575  -6.768  -47.265 1.00 . B B .  64 GLN C    1 1 
        1   3051 2 2  64 GLN CA   C  -70.924  -6.757  -48.611 1.00 . B B .  64 GLN CA   1 1 
        1   3052 2 2  64 GLN CB   C  -69.666  -7.616  -48.551 1.00 . B B .  64 GLN CB   1 1 
        1   3053 2 2  64 GLN CD   C  -68.726  -9.832  -47.800 1.00 . B B .  64 GLN CD   1 1 
        1   3054 2 2  64 GLN CG   C  -69.939  -9.091  -48.322 1.00 . B B .  64 GLN CG   1 1 
        1   3055 2 2  64 GLN H    H  -70.256  -4.759  -48.336 1.00 . B B .  64 GLN H    1 1 
        1   3056 2 2  64 GLN HA   H  -71.603  -7.182  -49.334 1.00 . B B .  64 GLN HA   1 1 
        1   3057 2 2  64 GLN HB2  H  -69.131  -7.509  -49.481 1.00 . B B .  64 GLN HB2  1 1 
        1   3058 2 2  64 GLN HB3  H  -69.039  -7.250  -47.750 1.00 . B B .  64 GLN HB3  1 1 
        1   3059 2 2  64 GLN HE21 H  -69.061 -11.351  -49.064 1.00 . B B .  64 GLN HE21 1 1 
        1   3060 2 2  64 GLN HE22 H  -67.703 -11.535  -48.062 1.00 . B B .  64 GLN HE22 1 1 
        1   3061 2 2  64 GLN HG2  H  -70.744  -9.194  -47.611 1.00 . B B .  64 GLN HG2  1 1 
        1   3062 2 2  64 GLN HG3  H  -70.243  -9.535  -49.259 1.00 . B B .  64 GLN HG3  1 1 
        1   3063 2 2  64 GLN N    N  -70.606  -5.382  -49.007 1.00 . B B .  64 GLN N    1 1 
        1   3064 2 2  64 GLN NE2  N  -68.475 -11.008  -48.357 1.00 . B B .  64 GLN NE2  1 1 
        1   3065 2 2  64 GLN O    O  -70.913  -6.494  -46.274 1.00 . B B .  64 GLN O    1 1 
        1   3066 2 2  64 GLN OE1  O  -68.017  -9.354  -46.908 1.00 . B B .  64 GLN OE1  1 1 
        1   3067 2 2  65 LYS C    C  -73.290  -8.308  -45.085 1.00 . B B .  65 LYS C    1 1 
        1   3068 2 2  65 LYS CA   C  -73.629  -7.108  -45.981 1.00 . B B .  65 LYS CA   1 1 
        1   3069 2 2  65 LYS CB   C  -75.118  -7.002  -46.282 1.00 . B B .  65 LYS CB   1 1 
        1   3070 2 2  65 LYS CD   C  -76.597  -5.478  -47.644 1.00 . B B .  65 LYS CD   1 1 
        1   3071 2 2  65 LYS CE   C  -77.299  -4.116  -47.657 1.00 . B B .  65 LYS CE   1 1 
        1   3072 2 2  65 LYS CG   C  -75.568  -5.570  -46.506 1.00 . B B .  65 LYS CG   1 1 
        1   3073 2 2  65 LYS H    H  -73.318  -7.332  -48.068 1.00 . B B .  65 LYS H    1 1 
        1   3074 2 2  65 LYS HA   H  -73.345  -6.218  -45.436 1.00 . B B .  65 LYS HA   1 1 
        1   3075 2 2  65 LYS HB2  H  -75.340  -7.580  -47.165 1.00 . B B .  65 LYS HB2  1 1 
        1   3076 2 2  65 LYS HB3  H  -75.668  -7.414  -45.448 1.00 . B B .  65 LYS HB3  1 1 
        1   3077 2 2  65 LYS HD2  H  -76.090  -5.619  -48.587 1.00 . B B .  65 LYS HD2  1 1 
        1   3078 2 2  65 LYS HD3  H  -77.335  -6.257  -47.520 1.00 . B B .  65 LYS HD3  1 1 
        1   3079 2 2  65 LYS HE2  H  -78.015  -4.086  -46.851 1.00 . B B .  65 LYS HE2  1 1 
        1   3080 2 2  65 LYS HE3  H  -76.559  -3.345  -47.492 1.00 . B B .  65 LYS HE3  1 1 
        1   3081 2 2  65 LYS HG2  H  -76.003  -5.183  -45.597 1.00 . B B .  65 LYS HG2  1 1 
        1   3082 2 2  65 LYS HG3  H  -74.707  -4.973  -46.768 1.00 . B B .  65 LYS HG3  1 1 
        1   3083 2 2  65 LYS HZ1  H  -78.949  -4.285  -48.914 1.00 . B B .  65 LYS HZ1  1 1 
        1   3084 2 2  65 LYS HZ2  H  -77.460  -4.225  -49.730 1.00 . B B .  65 LYS HZ2  1 1 
        1   3085 2 2  65 LYS HZ3  H  -78.121  -2.812  -49.057 1.00 . B B .  65 LYS HZ3  1 1 
        1   3086 2 2  65 LYS N    N  -72.862  -7.109  -47.230 1.00 . B B .  65 LYS N    1 1 
        1   3087 2 2  65 LYS NZ   N  -78.011  -3.839  -48.936 1.00 . B B .  65 LYS NZ   1 1 
        1   3088 2 2  65 LYS O    O  -72.755  -9.298  -45.572 1.00 . B B .  65 LYS O    1 1 
        1   3089 2 2  66 PRO C    C  -73.733 -10.670  -43.340 1.00 . B B .  66 PRO C    1 1 
        1   3090 2 2  66 PRO CA   C  -73.184  -9.312  -42.875 1.00 . B B .  66 PRO CA   1 1 
        1   3091 2 2  66 PRO CB   C  -73.799  -8.902  -41.529 1.00 . B B .  66 PRO CB   1 1 
        1   3092 2 2  66 PRO CD   C  -74.276  -7.158  -43.027 1.00 . B B .  66 PRO CD   1 1 
        1   3093 2 2  66 PRO CG   C  -74.853  -7.906  -41.873 1.00 . B B .  66 PRO CG   1 1 
        1   3094 2 2  66 PRO HA   H  -72.113  -9.358  -42.777 1.00 . B B .  66 PRO HA   1 1 
        1   3095 2 2  66 PRO HB2  H  -74.235  -9.761  -41.038 1.00 . B B .  66 PRO HB2  1 1 
        1   3096 2 2  66 PRO HB3  H  -73.052  -8.446  -40.898 1.00 . B B .  66 PRO HB3  1 1 
        1   3097 2 2  66 PRO HD2  H  -75.061  -6.721  -43.631 1.00 . B B .  66 PRO HD2  1 1 
        1   3098 2 2  66 PRO HD3  H  -73.581  -6.405  -42.691 1.00 . B B .  66 PRO HD3  1 1 
        1   3099 2 2  66 PRO HG2  H  -75.768  -8.407  -42.158 1.00 . B B .  66 PRO HG2  1 1 
        1   3100 2 2  66 PRO HG3  H  -75.026  -7.234  -41.047 1.00 . B B .  66 PRO HG3  1 1 
        1   3101 2 2  66 PRO N    N  -73.565  -8.215  -43.766 1.00 . B B .  66 PRO N    1 1 
        1   3102 2 2  66 PRO O    O  -74.959 -10.861  -43.416 1.00 . B B .  66 PRO O    1 1 
        1   3103 2 2  67 GLY C    C  -73.960 -12.753  -45.420 1.00 . B B .  67 GLY C    1 1 
        1   3104 2 2  67 GLY CA   C  -73.152 -12.910  -44.158 1.00 . B B .  67 GLY CA   1 1 
        1   3105 2 2  67 GLY H    H  -71.865 -11.346  -43.581 1.00 . B B .  67 GLY H    1 1 
        1   3106 2 2  67 GLY HA2  H  -72.247 -13.462  -44.368 1.00 . B B .  67 GLY HA2  1 1 
        1   3107 2 2  67 GLY HA3  H  -73.737 -13.436  -43.420 1.00 . B B .  67 GLY HA3  1 1 
        1   3108 2 2  67 GLY N    N  -72.812 -11.586  -43.660 1.00 . B B .  67 GLY N    1 1 
        1   3109 2 2  67 GLY O    O  -75.142 -13.083  -45.460 1.00 . B B .  67 GLY O    1 1 
        1   3110 2 2  68 GLN C    C  -72.785 -11.998  -48.845 1.00 . B B .  68 GLN C    1 1 
        1   3111 2 2  68 GLN CA   C  -73.865 -12.081  -47.792 1.00 . B B .  68 GLN CA   1 1 
        1   3112 2 2  68 GLN CB   C  -74.732 -10.847  -47.938 1.00 . B B .  68 GLN CB   1 1 
        1   3113 2 2  68 GLN CD   C  -76.862  -9.959  -47.125 1.00 . B B .  68 GLN CD   1 1 
        1   3114 2 2  68 GLN CG   C  -76.177 -11.120  -47.768 1.00 . B B .  68 GLN CG   1 1 
        1   3115 2 2  68 GLN H    H  -72.377 -11.932  -46.296 1.00 . B B .  68 GLN H    1 1 
        1   3116 2 2  68 GLN HA   H  -74.474 -12.950  -47.990 1.00 . B B .  68 GLN HA   1 1 
        1   3117 2 2  68 GLN HB2  H  -74.430 -10.119  -47.202 1.00 . B B .  68 GLN HB2  1 1 
        1   3118 2 2  68 GLN HB3  H  -74.569 -10.429  -48.922 1.00 . B B .  68 GLN HB3  1 1 
        1   3119 2 2  68 GLN HE21 H  -78.028  -9.706  -48.738 1.00 . B B .  68 GLN HE21 1 1 
        1   3120 2 2  68 GLN HE22 H  -78.299  -8.604  -47.476 1.00 . B B .  68 GLN HE22 1 1 
        1   3121 2 2  68 GLN HG2  H  -76.643 -11.382  -48.702 1.00 . B B .  68 GLN HG2  1 1 
        1   3122 2 2  68 GLN HG3  H  -76.257 -11.957  -47.092 1.00 . B B .  68 GLN HG3  1 1 
        1   3123 2 2  68 GLN N    N  -73.310 -12.197  -46.436 1.00 . B B .  68 GLN N    1 1 
        1   3124 2 2  68 GLN NE2  N  -77.813  -9.372  -47.842 1.00 . B B .  68 GLN NE2  1 1 
        1   3125 2 2  68 GLN O    O  -71.650 -11.578  -48.590 1.00 . B B .  68 GLN O    1 1 
        1   3126 2 2  68 GLN OE1  O  -76.537  -9.571  -45.991 1.00 . B B .  68 GLN OE1  1 1 
        1   3127 2 2  69 SER C    C  -72.119 -10.668  -51.389 1.00 . B B .  69 SER C    1 1 
        1   3128 2 2  69 SER CA   C  -72.268 -12.186  -51.165 1.00 . B B .  69 SER CA   1 1 
        1   3129 2 2  69 SER CB   C  -72.826 -12.905  -52.388 1.00 . B B .  69 SER CB   1 1 
        1   3130 2 2  69 SER H    H  -74.068 -12.703  -50.202 1.00 . B B .  69 SER H    1 1 
        1   3131 2 2  69 SER HA   H  -71.299 -12.600  -50.922 1.00 . B B .  69 SER HA   1 1 
        1   3132 2 2  69 SER HB2  H  -73.755 -12.447  -52.684 1.00 . B B .  69 SER HB2  1 1 
        1   3133 2 2  69 SER HB3  H  -72.116 -12.828  -53.202 1.00 . B B .  69 SER HB3  1 1 
        1   3134 2 2  69 SER HG   H  -72.222 -14.659  -51.809 1.00 . B B .  69 SER HG   1 1 
        1   3135 2 2  69 SER N    N  -73.152 -12.389  -50.049 1.00 . B B .  69 SER N    1 1 
        1   3136 2 2  69 SER O    O  -73.105  -9.917  -51.266 1.00 . B B .  69 SER O    1 1 
        1   3137 2 2  69 SER OG   O  -73.058 -14.269  -52.076 1.00 . B B .  69 SER OG   1 1 
        1   3138 2 2  70 PRO C    C  -71.678  -8.344  -53.101 1.00 . B B .  70 PRO C    1 1 
        1   3139 2 2  70 PRO CA   C  -70.699  -8.797  -52.005 1.00 . B B .  70 PRO CA   1 1 
        1   3140 2 2  70 PRO CB   C  -69.266  -8.769  -52.516 1.00 . B B .  70 PRO CB   1 1 
        1   3141 2 2  70 PRO CD   C  -69.600 -10.929  -51.614 1.00 . B B .  70 PRO CD   1 1 
        1   3142 2 2  70 PRO CG   C  -68.581  -9.852  -51.756 1.00 . B B .  70 PRO CG   1 1 
        1   3143 2 2  70 PRO HA   H  -70.788  -8.177  -51.129 1.00 . B B .  70 PRO HA   1 1 
        1   3144 2 2  70 PRO HB2  H  -69.240  -8.973  -53.578 1.00 . B B .  70 PRO HB2  1 1 
        1   3145 2 2  70 PRO HB3  H  -68.806  -7.817  -52.301 1.00 . B B .  70 PRO HB3  1 1 
        1   3146 2 2  70 PRO HD2  H  -69.522 -11.634  -52.431 1.00 . B B .  70 PRO HD2  1 1 
        1   3147 2 2  70 PRO HD3  H  -69.497 -11.429  -50.665 1.00 . B B .  70 PRO HD3  1 1 
        1   3148 2 2  70 PRO HG2  H  -67.723 -10.212  -52.307 1.00 . B B .  70 PRO HG2  1 1 
        1   3149 2 2  70 PRO HG3  H  -68.283  -9.498  -50.782 1.00 . B B .  70 PRO HG3  1 1 
        1   3150 2 2  70 PRO N    N  -70.883 -10.203  -51.668 1.00 . B B .  70 PRO N    1 1 
        1   3151 2 2  70 PRO O    O  -72.090  -9.163  -53.919 1.00 . B B .  70 PRO O    1 1 
        1   3152 2 2  71 LYS C    C  -72.079  -5.407  -54.928 1.00 . B B .  71 LYS C    1 1 
        1   3153 2 2  71 LYS CA   C  -72.885  -6.471  -54.170 1.00 . B B .  71 LYS CA   1 1 
        1   3154 2 2  71 LYS CB   C  -74.155  -5.796  -53.620 1.00 . B B .  71 LYS CB   1 1 
        1   3155 2 2  71 LYS CD   C  -75.995  -5.649  -51.825 1.00 . B B .  71 LYS CD   1 1 
        1   3156 2 2  71 LYS CE   C  -77.055  -5.072  -52.810 1.00 . B B .  71 LYS CE   1 1 
        1   3157 2 2  71 LYS CG   C  -74.952  -6.564  -52.537 1.00 . B B .  71 LYS CG   1 1 
        1   3158 2 2  71 LYS H    H  -71.720  -6.482  -52.387 1.00 . B B .  71 LYS H    1 1 
        1   3159 2 2  71 LYS HA   H  -73.175  -7.249  -54.862 1.00 . B B .  71 LYS HA   1 1 
        1   3160 2 2  71 LYS HB2  H  -73.868  -4.846  -53.199 1.00 . B B .  71 LYS HB2  1 1 
        1   3161 2 2  71 LYS HB3  H  -74.815  -5.603  -54.455 1.00 . B B .  71 LYS HB3  1 1 
        1   3162 2 2  71 LYS HD2  H  -76.498  -6.213  -51.054 1.00 . B B .  71 LYS HD2  1 1 
        1   3163 2 2  71 LYS HD3  H  -75.468  -4.825  -51.365 1.00 . B B .  71 LYS HD3  1 1 
        1   3164 2 2  71 LYS HE2  H  -76.543  -4.725  -53.692 1.00 . B B .  71 LYS HE2  1 1 
        1   3165 2 2  71 LYS HE3  H  -77.716  -5.878  -53.100 1.00 . B B .  71 LYS HE3  1 1 
        1   3166 2 2  71 LYS HG2  H  -75.469  -7.391  -53.001 1.00 . B B .  71 LYS HG2  1 1 
        1   3167 2 2  71 LYS HG3  H  -74.262  -6.949  -51.801 1.00 . B B .  71 LYS HG3  1 1 
        1   3168 2 2  71 LYS HZ1  H  -78.340  -3.427  -53.071 1.00 . B B .  71 LYS HZ1  1 1 
        1   3169 2 2  71 LYS HZ2  H  -77.284  -3.270  -51.750 1.00 . B B .  71 LYS HZ2  1 1 
        1   3170 2 2  71 LYS HZ3  H  -78.629  -4.302  -51.646 1.00 . B B .  71 LYS HZ3  1 1 
        1   3171 2 2  71 LYS N    N  -72.068  -7.070  -53.089 1.00 . B B .  71 LYS N    1 1 
        1   3172 2 2  71 LYS NZ   N  -77.892  -3.928  -52.277 1.00 . B B .  71 LYS NZ   1 1 
        1   3173 2 2  71 LYS O    O  -71.314  -4.651  -54.318 1.00 . B B .  71 LYS O    1 1 
        1   3174 2 2  72 LEU C    C  -72.207  -2.940  -56.719 1.00 . B B .  72 LEU C    1 1 
        1   3175 2 2  72 LEU CA   C  -71.572  -4.291  -57.018 1.00 . B B .  72 LEU CA   1 1 
        1   3176 2 2  72 LEU CB   C  -71.626  -4.601  -58.511 1.00 . B B .  72 LEU CB   1 1 
        1   3177 2 2  72 LEU CD1  C  -69.621  -3.167  -59.208 1.00 . B B .  72 LEU CD1  1 1 
        1   3178 2 2  72 LEU CD2  C  -71.263  -4.061  -60.912 1.00 . B B .  72 LEU CD2  1 1 
        1   3179 2 2  72 LEU CG   C  -71.082  -3.558  -59.492 1.00 . B B .  72 LEU CG   1 1 
        1   3180 2 2  72 LEU H    H  -72.871  -5.945  -56.689 1.00 . B B .  72 LEU H    1 1 
        1   3181 2 2  72 LEU HA   H  -70.537  -4.256  -56.710 1.00 . B B .  72 LEU HA   1 1 
        1   3182 2 2  72 LEU HB2  H  -71.075  -5.511  -58.676 1.00 . B B .  72 LEU HB2  1 1 
        1   3183 2 2  72 LEU HB3  H  -72.660  -4.794  -58.766 1.00 . B B .  72 LEU HB3  1 1 
        1   3184 2 2  72 LEU HD11 H  -69.598  -2.309  -58.552 1.00 . B B .  72 LEU HD11 1 1 
        1   3185 2 2  72 LEU HD12 H  -69.126  -2.923  -60.137 1.00 . B B .  72 LEU HD12 1 1 
        1   3186 2 2  72 LEU HD13 H  -69.112  -3.995  -58.736 1.00 . B B .  72 LEU HD13 1 1 
        1   3187 2 2  72 LEU HD21 H  -72.190  -3.680  -61.314 1.00 . B B .  72 LEU HD21 1 1 
        1   3188 2 2  72 LEU HD22 H  -71.288  -5.141  -60.911 1.00 . B B .  72 LEU HD22 1 1 
        1   3189 2 2  72 LEU HD23 H  -70.439  -3.721  -61.522 1.00 . B B .  72 LEU HD23 1 1 
        1   3190 2 2  72 LEU HG   H  -71.682  -2.666  -59.379 1.00 . B B .  72 LEU HG   1 1 
        1   3191 2 2  72 LEU N    N  -72.249  -5.332  -56.243 1.00 . B B .  72 LEU N    1 1 
        1   3192 2 2  72 LEU O    O  -73.423  -2.829  -56.588 1.00 . B B .  72 LEU O    1 1 
        1   3193 2 2  73 LEU C    C  -71.458   0.525  -56.997 1.00 . B B .  73 LEU C    1 1 
        1   3194 2 2  73 LEU CA   C  -71.812  -0.626  -56.073 1.00 . B B .  73 LEU CA   1 1 
        1   3195 2 2  73 LEU CB   C  -71.133  -0.419  -54.735 1.00 . B B .  73 LEU CB   1 1 
        1   3196 2 2  73 LEU CD1  C  -73.272  -0.133  -53.590 1.00 . B B .  73 LEU CD1  1 1 
        1   3197 2 2  73 LEU CD2  C  -71.138   0.115  -52.395 1.00 . B B .  73 LEU CD2  1 1 
        1   3198 2 2  73 LEU CG   C  -71.871   0.359  -53.681 1.00 . B B .  73 LEU CG   1 1 
        1   3199 2 2  73 LEU H    H  -70.416  -2.070  -56.735 1.00 . B B .  73 LEU H    1 1 
        1   3200 2 2  73 LEU HA   H  -72.880  -0.646  -55.923 1.00 . B B .  73 LEU HA   1 1 
        1   3201 2 2  73 LEU HB2  H  -70.916  -1.390  -54.323 1.00 . B B .  73 LEU HB2  1 1 
        1   3202 2 2  73 LEU HB3  H  -70.189   0.077  -54.922 1.00 . B B .  73 LEU HB3  1 1 
        1   3203 2 2  73 LEU HD11 H  -73.908   0.656  -53.219 1.00 . B B .  73 LEU HD11 1 1 
        1   3204 2 2  73 LEU HD12 H  -73.313  -0.977  -52.915 1.00 . B B .  73 LEU HD12 1 1 
        1   3205 2 2  73 LEU HD13 H  -73.612  -0.437  -54.568 1.00 . B B .  73 LEU HD13 1 1 
        1   3206 2 2  73 LEU HD21 H  -71.768  -0.450  -51.724 1.00 . B B .  73 LEU HD21 1 1 
        1   3207 2 2  73 LEU HD22 H  -70.884   1.061  -51.941 1.00 . B B .  73 LEU HD22 1 1 
        1   3208 2 2  73 LEU HD23 H  -70.236  -0.443  -52.595 1.00 . B B .  73 LEU HD23 1 1 
        1   3209 2 2  73 LEU HG   H  -71.859   1.412  -53.918 1.00 . B B .  73 LEU HG   1 1 
        1   3210 2 2  73 LEU N    N  -71.376  -1.913  -56.614 1.00 . B B .  73 LEU N    1 1 
        1   3211 2 2  73 LEU O    O  -72.300   1.347  -57.360 1.00 . B B .  73 LEU O    1 1 
        1   3212 2 2  74 ILE C    C  -68.669   0.853  -59.155 1.00 . B B .  74 ILE C    1 1 
        1   3213 2 2  74 ILE CA   C  -69.670   1.563  -58.274 1.00 . B B .  74 ILE CA   1 1 
        1   3214 2 2  74 ILE CB   C  -68.977   2.701  -57.474 1.00 . B B .  74 ILE CB   1 1 
        1   3215 2 2  74 ILE CD1  C  -69.575   4.455  -55.704 1.00 . B B .  74 ILE CD1  1 1 
        1   3216 2 2  74 ILE CG1  C  -70.027   3.670  -56.915 1.00 . B B .  74 ILE CG1  1 1 
        1   3217 2 2  74 ILE CG2  C  -67.967   3.466  -58.332 1.00 . B B .  74 ILE CG2  1 1 
        1   3218 2 2  74 ILE H    H  -69.578  -0.126  -57.037 1.00 . B B .  74 ILE H    1 1 
        1   3219 2 2  74 ILE HA   H  -70.470   1.967  -58.876 1.00 . B B .  74 ILE HA   1 1 
        1   3220 2 2  74 ILE HB   H  -68.446   2.256  -56.645 1.00 . B B .  74 ILE HB   1 1 
        1   3221 2 2  74 ILE HD11 H  -69.600   3.818  -54.832 1.00 . B B .  74 ILE HD11 1 1 
        1   3222 2 2  74 ILE HD12 H  -70.234   5.297  -55.554 1.00 . B B .  74 ILE HD12 1 1 
        1   3223 2 2  74 ILE HD13 H  -68.567   4.809  -55.860 1.00 . B B .  74 ILE HD13 1 1 
        1   3224 2 2  74 ILE HG12 H  -70.293   4.371  -57.690 1.00 . B B .  74 ILE HG12 1 1 
        1   3225 2 2  74 ILE HG13 H  -70.908   3.102  -56.651 1.00 . B B .  74 ILE HG13 1 1 
        1   3226 2 2  74 ILE HG21 H  -67.237   2.776  -58.729 1.00 . B B .  74 ILE HG21 1 1 
        1   3227 2 2  74 ILE HG22 H  -67.469   4.208  -57.726 1.00 . B B .  74 ILE HG22 1 1 
        1   3228 2 2  74 ILE HG23 H  -68.483   3.954  -59.146 1.00 . B B .  74 ILE HG23 1 1 
        1   3229 2 2  74 ILE N    N  -70.187   0.565  -57.370 1.00 . B B .  74 ILE N    1 1 
        1   3230 2 2  74 ILE O    O  -67.805   0.139  -58.640 1.00 . B B .  74 ILE O    1 1 
        1   3231 2 2  75 TYR C    C  -66.909   1.787  -61.950 1.00 . B B .  75 TYR C    1 1 
        1   3232 2 2  75 TYR CA   C  -67.669   0.624  -61.314 1.00 . B B .  75 TYR CA   1 1 
        1   3233 2 2  75 TYR CB   C  -68.035  -0.444  -62.330 1.00 . B B .  75 TYR CB   1 1 
        1   3234 2 2  75 TYR CD1  C  -68.990   0.690  -64.368 1.00 . B B .  75 TYR CD1  1 1 
        1   3235 2 2  75 TYR CD2  C  -70.398  -0.759  -63.113 1.00 . B B .  75 TYR CD2  1 1 
        1   3236 2 2  75 TYR CE1  C  -70.033   0.932  -65.260 1.00 . B B .  75 TYR CE1  1 1 
        1   3237 2 2  75 TYR CE2  C  -71.446  -0.535  -63.991 1.00 . B B .  75 TYR CE2  1 1 
        1   3238 2 2  75 TYR CG   C  -69.166  -0.143  -63.274 1.00 . B B .  75 TYR CG   1 1 
        1   3239 2 2  75 TYR CZ   C  -71.260   0.314  -65.061 1.00 . B B .  75 TYR CZ   1 1 
        1   3240 2 2  75 TYR H    H  -69.504   1.575  -60.833 1.00 . B B .  75 TYR H    1 1 
        1   3241 2 2  75 TYR HA   H  -66.960   0.159  -60.643 1.00 . B B .  75 TYR HA   1 1 
        1   3242 2 2  75 TYR HB2  H  -67.161  -0.653  -62.924 1.00 . B B .  75 TYR HB2  1 1 
        1   3243 2 2  75 TYR HB3  H  -68.283  -1.343  -61.782 1.00 . B B .  75 TYR HB3  1 1 
        1   3244 2 2  75 TYR HD1  H  -68.039   1.181  -64.516 1.00 . B B .  75 TYR HD1  1 1 
        1   3245 2 2  75 TYR HD2  H  -70.547  -1.425  -62.275 1.00 . B B .  75 TYR HD2  1 1 
        1   3246 2 2  75 TYR HE1  H  -69.884   1.583  -66.108 1.00 . B B .  75 TYR HE1  1 1 
        1   3247 2 2  75 TYR HE2  H  -72.400  -1.017  -63.836 1.00 . B B .  75 TYR HE2  1 1 
        1   3248 2 2  75 TYR HH   H  -72.791   1.305  -65.617 1.00 . B B .  75 TYR HH   1 1 
        1   3249 2 2  75 TYR N    N  -68.787   1.014  -60.470 1.00 . B B .  75 TYR N    1 1 
        1   3250 2 2  75 TYR O    O  -67.246   2.963  -61.756 1.00 . B B .  75 TYR O    1 1 
        1   3251 2 2  75 TYR OH   O  -72.307   0.536  -65.927 1.00 . B B .  75 TYR OH   1 1 
        1   3252 2 2  76 TRP C    C  -64.301   3.429  -62.385 1.00 . B B .  76 TRP C    1 1 
        1   3253 2 2  76 TRP CA   C  -64.950   2.406  -63.309 1.00 . B B .  76 TRP CA   1 1 
        1   3254 2 2  76 TRP CB   C  -65.570   3.035  -64.548 1.00 . B B .  76 TRP CB   1 1 
        1   3255 2 2  76 TRP CD1  C  -64.647   1.086  -65.956 1.00 . B B .  76 TRP CD1  1 1 
        1   3256 2 2  76 TRP CD2  C  -66.556   1.973  -66.726 1.00 . B B .  76 TRP CD2  1 1 
        1   3257 2 2  76 TRP CE2  C  -66.158   0.921  -67.587 1.00 . B B .  76 TRP CE2  1 1 
        1   3258 2 2  76 TRP CE3  C  -67.728   2.679  -67.017 1.00 . B B .  76 TRP CE3  1 1 
        1   3259 2 2  76 TRP CG   C  -65.581   2.063  -65.689 1.00 . B B .  76 TRP CG   1 1 
        1   3260 2 2  76 TRP CH2  C  -68.036   1.262  -68.973 1.00 . B B .  76 TRP CH2  1 1 
        1   3261 2 2  76 TRP CZ2  C  -66.891   0.563  -68.714 1.00 . B B .  76 TRP CZ2  1 1 
        1   3262 2 2  76 TRP CZ3  C  -68.459   2.312  -68.138 1.00 . B B .  76 TRP CZ3  1 1 
        1   3263 2 2  76 TRP H    H  -65.648   0.486  -62.768 1.00 . B B .  76 TRP H    1 1 
        1   3264 2 2  76 TRP HA   H  -64.126   1.809  -63.676 1.00 . B B .  76 TRP HA   1 1 
        1   3265 2 2  76 TRP HB2  H  -66.584   3.332  -64.326 1.00 . B B .  76 TRP HB2  1 1 
        1   3266 2 2  76 TRP HB3  H  -64.998   3.907  -64.828 1.00 . B B .  76 TRP HB3  1 1 
        1   3267 2 2  76 TRP HD1  H  -63.772   0.888  -65.355 1.00 . B B .  76 TRP HD1  1 1 
        1   3268 2 2  76 TRP HE1  H  -64.500  -0.346  -67.499 1.00 . B B .  76 TRP HE1  1 1 
        1   3269 2 2  76 TRP HE3  H  -68.059   3.486  -66.381 1.00 . B B .  76 TRP HE3  1 1 
        1   3270 2 2  76 TRP HH2  H  -68.629   1.002  -69.837 1.00 . B B .  76 TRP HH2  1 1 
        1   3271 2 2  76 TRP HZ2  H  -66.570  -0.243  -69.358 1.00 . B B .  76 TRP HZ2  1 1 
        1   3272 2 2  76 TRP HZ3  H  -69.370   2.843  -68.374 1.00 . B B .  76 TRP HZ3  1 1 
        1   3273 2 2  76 TRP N    N  -65.858   1.439  -62.684 1.00 . B B .  76 TRP N    1 1 
        1   3274 2 2  76 TRP NE1  N  -64.992   0.397  -67.092 1.00 . B B .  76 TRP NE1  1 1 
        1   3275 2 2  76 TRP O    O  -63.107   3.679  -62.512 1.00 . B B .  76 TRP O    1 1 
        1   3276 2 2  77 ALA C    C  -65.600   5.641  -59.775 1.00 . B B .  77 ALA C    1 1 
        1   3277 2 2  77 ALA CA   C  -64.563   4.683  -60.267 1.00 . B B .  77 ALA CA   1 1 
        1   3278 2 2  77 ALA CB   C  -63.279   5.441  -60.527 1.00 . B B .  77 ALA CB   1 1 
        1   3279 2 2  77 ALA H    H  -66.024   3.762  -61.477 1.00 . B B .  77 ALA H    1 1 
        1   3280 2 2  77 ALA HA   H  -64.385   3.936  -59.505 1.00 . B B .  77 ALA HA   1 1 
        1   3281 2 2  77 ALA HB1  H  -63.059   6.079  -59.683 1.00 . B B .  77 ALA HB1  1 1 
        1   3282 2 2  77 ALA HB2  H  -63.392   6.046  -61.415 1.00 . B B .  77 ALA HB2  1 1 
        1   3283 2 2  77 ALA HB3  H  -62.469   4.741  -60.669 1.00 . B B .  77 ALA HB3  1 1 
        1   3284 2 2  77 ALA N    N  -65.078   4.017  -61.481 1.00 . B B .  77 ALA N    1 1 
        1   3285 2 2  77 ALA O    O  -65.756   5.842  -58.556 1.00 . B B .  77 ALA O    1 1 
        1   3286 2 2  78 SER C    C  -68.697   6.620  -60.769 1.00 . B B .  78 SER C    1 1 
        1   3287 2 2  78 SER CA   C  -67.324   7.240  -60.621 1.00 . B B .  78 SER CA   1 1 
        1   3288 2 2  78 SER CB   C  -67.166   8.331  -61.688 1.00 . B B .  78 SER CB   1 1 
        1   3289 2 2  78 SER H    H  -66.034   5.975  -61.687 1.00 . B B .  78 SER H    1 1 
        1   3290 2 2  78 SER HA   H  -67.242   7.691  -59.644 1.00 . B B .  78 SER HA   1 1 
        1   3291 2 2  78 SER HB2  H  -66.946   7.879  -62.638 1.00 . B B .  78 SER HB2  1 1 
        1   3292 2 2  78 SER HB3  H  -68.104   8.866  -61.767 1.00 . B B .  78 SER HB3  1 1 
        1   3293 2 2  78 SER HG   H  -65.309   8.902  -61.719 1.00 . B B .  78 SER HG   1 1 
        1   3294 2 2  78 SER N    N  -66.279   6.228  -60.772 1.00 . B B .  78 SER N    1 1 
        1   3295 2 2  78 SER O    O  -69.548   6.807  -59.903 1.00 . B B .  78 SER O    1 1 
        1   3296 2 2  78 SER OG   O  -66.131   9.244  -61.360 1.00 . B B .  78 SER OG   1 1 
        1   3297 2 2  79 THR C    C  -70.915   4.390  -61.397 1.00 . B B .  79 THR C    1 1 
        1   3298 2 2  79 THR CA   C  -70.221   5.417  -62.304 1.00 . B B .  79 THR CA   1 1 
        1   3299 2 2  79 THR CB   C  -70.240   4.922  -63.796 1.00 . B B .  79 THR CB   1 1 
        1   3300 2 2  79 THR CG2  C  -68.932   5.241  -64.540 1.00 . B B .  79 THR CG2  1 1 
        1   3301 2 2  79 THR H    H  -68.136   5.753  -62.474 1.00 . B B .  79 THR H    1 1 
        1   3302 2 2  79 THR HA   H  -70.845   6.299  -62.276 1.00 . B B .  79 THR HA   1 1 
        1   3303 2 2  79 THR HB   H  -71.044   5.442  -64.301 1.00 . B B .  79 THR HB   1 1 
        1   3304 2 2  79 THR HG1  H  -70.152   3.105  -63.078 1.00 . B B .  79 THR HG1  1 1 
        1   3305 2 2  79 THR HG21 H  -68.178   4.517  -64.269 1.00 . B B .  79 THR HG21 1 1 
        1   3306 2 2  79 THR HG22 H  -68.595   6.230  -64.267 1.00 . B B .  79 THR HG22 1 1 
        1   3307 2 2  79 THR HG23 H  -69.104   5.201  -65.606 1.00 . B B .  79 THR HG23 1 1 
        1   3308 2 2  79 THR N    N  -68.887   5.863  -61.855 1.00 . B B .  79 THR N    1 1 
        1   3309 2 2  79 THR O    O  -70.368   3.319  -61.115 1.00 . B B .  79 THR O    1 1 
        1   3310 2 2  79 THR OG1  O  -70.529   3.520  -63.858 1.00 . B B .  79 THR OG1  1 1 
        1   3311 2 2  80 ARG C    C  -73.687   2.836  -60.883 1.00 . B B .  80 ARG C    1 1 
        1   3312 2 2  80 ARG CA   C  -72.939   3.897  -60.095 1.00 . B B .  80 ARG CA   1 1 
        1   3313 2 2  80 ARG CB   C  -73.924   4.744  -59.308 1.00 . B B .  80 ARG CB   1 1 
        1   3314 2 2  80 ARG CD   C  -74.280   6.439  -57.541 1.00 . B B .  80 ARG CD   1 1 
        1   3315 2 2  80 ARG CG   C  -73.276   5.546  -58.221 1.00 . B B .  80 ARG CG   1 1 
        1   3316 2 2  80 ARG CZ   C  -73.844   8.793  -58.147 1.00 . B B .  80 ARG CZ   1 1 
        1   3317 2 2  80 ARG H    H  -72.493   5.604  -61.247 1.00 . B B .  80 ARG H    1 1 
        1   3318 2 2  80 ARG HA   H  -72.283   3.401  -59.395 1.00 . B B .  80 ARG HA   1 1 
        1   3319 2 2  80 ARG HB2  H  -74.419   5.421  -59.986 1.00 . B B .  80 ARG HB2  1 1 
        1   3320 2 2  80 ARG HB3  H  -74.666   4.092  -58.867 1.00 . B B .  80 ARG HB3  1 1 
        1   3321 2 2  80 ARG HD2  H  -75.157   6.533  -58.164 1.00 . B B .  80 ARG HD2  1 1 
        1   3322 2 2  80 ARG HD3  H  -74.560   6.006  -56.592 1.00 . B B .  80 ARG HD3  1 1 
        1   3323 2 2  80 ARG HE   H  -73.163   7.893  -56.512 1.00 . B B .  80 ARG HE   1 1 
        1   3324 2 2  80 ARG HG2  H  -72.846   4.875  -57.492 1.00 . B B .  80 ARG HG2  1 1 
        1   3325 2 2  80 ARG HG3  H  -72.492   6.155  -58.648 1.00 . B B .  80 ARG HG3  1 1 
        1   3326 2 2  80 ARG HH11 H  -75.019   7.811  -59.474 1.00 . B B .  80 ARG HH11 1 1 
        1   3327 2 2  80 ARG HH12 H  -74.674   9.461  -59.871 1.00 . B B .  80 ARG HH12 1 1 
        1   3328 2 2  80 ARG HH21 H  -72.710  10.035  -57.028 1.00 . B B .  80 ARG HH21 1 1 
        1   3329 2 2  80 ARG HH22 H  -73.360  10.727  -58.477 1.00 . B B .  80 ARG HH22 1 1 
        1   3330 2 2  80 ARG N    N  -72.129   4.738  -60.966 1.00 . B B .  80 ARG N    1 1 
        1   3331 2 2  80 ARG NE   N  -73.701   7.760  -57.321 1.00 . B B .  80 ARG NE   1 1 
        1   3332 2 2  80 ARG NH1  N  -74.573   8.679  -59.256 1.00 . B B .  80 ARG NH1  1 1 
        1   3333 2 2  80 ARG NH2  N  -73.257   9.946  -57.861 1.00 . B B .  80 ARG NH2  1 1 
        1   3334 2 2  80 ARG O    O  -73.821   2.929  -62.105 1.00 . B B .  80 ARG O    1 1 
        1   3335 2 2  81 GLU C    C  -76.268   0.491  -60.583 1.00 . B B .  81 GLU C    1 1 
        1   3336 2 2  81 GLU CA   C  -74.763   0.665  -60.847 1.00 . B B .  81 GLU CA   1 1 
        1   3337 2 2  81 GLU CB   C  -73.967  -0.578  -60.469 1.00 . B B .  81 GLU CB   1 1 
        1   3338 2 2  81 GLU CD   C  -74.890  -2.797  -61.166 1.00 . B B .  81 GLU CD   1 1 
        1   3339 2 2  81 GLU CG   C  -73.971  -1.649  -61.524 1.00 . B B .  81 GLU CG   1 1 
        1   3340 2 2  81 GLU H    H  -74.057   1.807  -59.207 1.00 . B B .  81 GLU H    1 1 
        1   3341 2 2  81 GLU HA   H  -74.641   0.814  -61.910 1.00 . B B .  81 GLU HA   1 1 
        1   3342 2 2  81 GLU HB2  H  -72.945  -0.289  -60.283 1.00 . B B .  81 GLU HB2  1 1 
        1   3343 2 2  81 GLU HB3  H  -74.380  -0.986  -59.557 1.00 . B B .  81 GLU HB3  1 1 
        1   3344 2 2  81 GLU HG2  H  -74.296  -1.219  -62.460 1.00 . B B .  81 GLU HG2  1 1 
        1   3345 2 2  81 GLU HG3  H  -72.966  -2.028  -61.643 1.00 . B B .  81 GLU HG3  1 1 
        1   3346 2 2  81 GLU N    N  -74.186   1.826  -60.178 1.00 . B B .  81 GLU N    1 1 
        1   3347 2 2  81 GLU O    O  -76.766   0.835  -59.509 1.00 . B B .  81 GLU O    1 1 
        1   3348 2 2  81 GLU OE1  O  -75.619  -2.698  -60.143 1.00 . B B .  81 GLU OE1  1 1 
        1   3349 2 2  81 GLU OE2  O  -74.878  -3.805  -61.910 1.00 . B B .  81 GLU OE2  1 1 
        1   3350 2 2  82 SER C    C  -79.050  -0.320  -60.186 1.00 . B B .  82 SER C    1 1 
        1   3351 2 2  82 SER CA   C  -78.439  -0.205  -61.579 1.00 . B B .  82 SER CA   1 1 
        1   3352 2 2  82 SER CB   C  -78.835  -1.426  -62.418 1.00 . B B .  82 SER CB   1 1 
        1   3353 2 2  82 SER H    H  -76.495  -0.267  -62.409 1.00 . B B .  82 SER H    1 1 
        1   3354 2 2  82 SER HA   H  -78.870   0.664  -62.051 1.00 . B B .  82 SER HA   1 1 
        1   3355 2 2  82 SER HB2  H  -78.419  -2.314  -61.975 1.00 . B B .  82 SER HB2  1 1 
        1   3356 2 2  82 SER HB3  H  -79.915  -1.511  -62.424 1.00 . B B .  82 SER HB3  1 1 
        1   3357 2 2  82 SER HG   H  -77.691  -0.619  -63.764 1.00 . B B .  82 SER HG   1 1 
        1   3358 2 2  82 SER N    N  -76.976  -0.033  -61.588 1.00 . B B .  82 SER N    1 1 
        1   3359 2 2  82 SER O    O  -78.981  -1.375  -59.548 1.00 . B B .  82 SER O    1 1 
        1   3360 2 2  82 SER OG   O  -78.356  -1.311  -63.747 1.00 . B B .  82 SER OG   1 1 
        1   3361 2 2  83 GLY C    C  -79.329   1.120  -57.257 1.00 . B B .  83 GLY C    1 1 
        1   3362 2 2  83 GLY CA   C  -80.276   0.797  -58.404 1.00 . B B .  83 GLY CA   1 1 
        1   3363 2 2  83 GLY H    H  -79.658   1.581  -60.272 1.00 . B B .  83 GLY H    1 1 
        1   3364 2 2  83 GLY HA2  H  -81.067   1.532  -58.414 1.00 . B B .  83 GLY HA2  1 1 
        1   3365 2 2  83 GLY HA3  H  -80.714  -0.174  -58.222 1.00 . B B .  83 GLY HA3  1 1 
        1   3366 2 2  83 GLY N    N  -79.641   0.773  -59.718 1.00 . B B .  83 GLY N    1 1 
        1   3367 2 2  83 GLY O    O  -79.538   0.682  -56.122 1.00 . B B .  83 GLY O    1 1 
        1   3368 2 2  84 VAL C    C  -78.034   3.834  -56.230 1.00 . B B .  84 VAL C    1 1 
        1   3369 2 2  84 VAL CA   C  -77.461   2.455  -56.500 1.00 . B B .  84 VAL CA   1 1 
        1   3370 2 2  84 VAL CB   C  -75.975   2.572  -56.900 1.00 . B B .  84 VAL CB   1 1 
        1   3371 2 2  84 VAL CG1  C  -75.214   3.479  -55.922 1.00 . B B .  84 VAL CG1  1 1 
        1   3372 2 2  84 VAL CG2  C  -75.341   1.206  -56.936 1.00 . B B .  84 VAL CG2  1 1 
        1   3373 2 2  84 VAL H    H  -78.149   2.177  -58.472 1.00 . B B .  84 VAL H    1 1 
        1   3374 2 2  84 VAL HA   H  -77.548   1.853  -55.607 1.00 . B B .  84 VAL HA   1 1 
        1   3375 2 2  84 VAL HB   H  -75.920   3.010  -57.887 1.00 . B B .  84 VAL HB   1 1 
        1   3376 2 2  84 VAL HG11 H  -75.267   4.502  -56.265 1.00 . B B .  84 VAL HG11 1 1 
        1   3377 2 2  84 VAL HG12 H  -74.181   3.169  -55.872 1.00 . B B .  84 VAL HG12 1 1 
        1   3378 2 2  84 VAL HG13 H  -75.660   3.405  -54.941 1.00 . B B .  84 VAL HG13 1 1 
        1   3379 2 2  84 VAL HG21 H  -76.099   0.453  -56.785 1.00 . B B .  84 VAL HG21 1 1 
        1   3380 2 2  84 VAL HG22 H  -74.599   1.133  -56.154 1.00 . B B .  84 VAL HG22 1 1 
        1   3381 2 2  84 VAL HG23 H  -74.869   1.053  -57.895 1.00 . B B .  84 VAL HG23 1 1 
        1   3382 2 2  84 VAL N    N  -78.273   1.871  -57.549 1.00 . B B .  84 VAL N    1 1 
        1   3383 2 2  84 VAL O    O  -78.106   4.663  -57.137 1.00 . B B .  84 VAL O    1 1 
        1   3384 2 2  85 PRO C    C  -77.740   6.439  -54.662 1.00 . B B .  85 PRO C    1 1 
        1   3385 2 2  85 PRO CA   C  -78.887   5.422  -54.586 1.00 . B B .  85 PRO CA   1 1 
        1   3386 2 2  85 PRO CB   C  -79.358   5.234  -53.138 1.00 . B B .  85 PRO CB   1 1 
        1   3387 2 2  85 PRO CD   C  -78.651   3.087  -53.912 1.00 . B B .  85 PRO CD   1 1 
        1   3388 2 2  85 PRO CG   C  -79.647   3.762  -53.010 1.00 . B B .  85 PRO CG   1 1 
        1   3389 2 2  85 PRO HA   H  -79.716   5.749  -55.191 1.00 . B B .  85 PRO HA   1 1 
        1   3390 2 2  85 PRO HB2  H  -78.576   5.528  -52.450 1.00 . B B .  85 PRO HB2  1 1 
        1   3391 2 2  85 PRO HB3  H  -80.255   5.804  -52.956 1.00 . B B .  85 PRO HB3  1 1 
        1   3392 2 2  85 PRO HD2  H  -77.722   2.907  -53.386 1.00 . B B .  85 PRO HD2  1 1 
        1   3393 2 2  85 PRO HD3  H  -79.053   2.170  -54.313 1.00 . B B .  85 PRO HD3  1 1 
        1   3394 2 2  85 PRO HG2  H  -79.511   3.442  -51.986 1.00 . B B .  85 PRO HG2  1 1 
        1   3395 2 2  85 PRO HG3  H  -80.650   3.546  -53.343 1.00 . B B .  85 PRO HG3  1 1 
        1   3396 2 2  85 PRO N    N  -78.465   4.077  -54.987 1.00 . B B .  85 PRO N    1 1 
        1   3397 2 2  85 PRO O    O  -76.627   6.177  -54.179 1.00 . B B .  85 PRO O    1 1 
        1   3398 2 2  86 ASP C    C  -76.080   8.884  -54.415 1.00 . B B .  86 ASP C    1 1 
        1   3399 2 2  86 ASP CA   C  -77.076   8.675  -55.552 1.00 . B B .  86 ASP CA   1 1 
        1   3400 2 2  86 ASP CB   C  -77.819   9.998  -55.833 1.00 . B B .  86 ASP CB   1 1 
        1   3401 2 2  86 ASP CG   C  -79.056   9.816  -56.734 1.00 . B B .  86 ASP CG   1 1 
        1   3402 2 2  86 ASP H    H  -78.948   7.689  -55.626 1.00 . B B .  86 ASP H    1 1 
        1   3403 2 2  86 ASP HA   H  -76.519   8.413  -56.439 1.00 . B B .  86 ASP HA   1 1 
        1   3404 2 2  86 ASP HB2  H  -78.137  10.423  -54.893 1.00 . B B .  86 ASP HB2  1 1 
        1   3405 2 2  86 ASP HB3  H  -77.136  10.685  -56.311 1.00 . B B .  86 ASP HB3  1 1 
        1   3406 2 2  86 ASP N    N  -78.037   7.586  -55.279 1.00 . B B .  86 ASP N    1 1 
        1   3407 2 2  86 ASP O    O  -74.956   9.340  -54.642 1.00 . B B .  86 ASP O    1 1 
        1   3408 2 2  86 ASP OD1  O  -79.902   8.918  -56.465 1.00 . B B .  86 ASP OD1  1 1 
        1   3409 2 2  86 ASP OD2  O  -79.184  10.589  -57.716 1.00 . B B .  86 ASP OD2  1 1 
        1   3410 2 2  87 ARG C    C  -74.414   8.162  -51.871 1.00 . B B .  87 ARG C    1 1 
        1   3411 2 2  87 ARG CA   C  -75.805   8.788  -51.954 1.00 . B B .  87 ARG CA   1 1 
        1   3412 2 2  87 ARG CB   C  -76.655   8.363  -50.758 1.00 . B B .  87 ARG CB   1 1 
        1   3413 2 2  87 ARG CD   C  -78.462   6.786  -50.062 1.00 . B B .  87 ARG CD   1 1 
        1   3414 2 2  87 ARG CG   C  -77.149   6.944  -50.822 1.00 . B B .  87 ARG CG   1 1 
        1   3415 2 2  87 ARG CZ   C  -78.142   4.748  -48.726 1.00 . B B .  87 ARG CZ   1 1 
        1   3416 2 2  87 ARG H    H  -77.422   8.153  -53.140 1.00 . B B .  87 ARG H    1 1 
        1   3417 2 2  87 ARG HA   H  -75.675   9.858  -51.886 1.00 . B B .  87 ARG HA   1 1 
        1   3418 2 2  87 ARG HB2  H  -76.066   8.476  -49.862 1.00 . B B .  87 ARG HB2  1 1 
        1   3419 2 2  87 ARG HB3  H  -77.507   9.025  -50.693 1.00 . B B .  87 ARG HB3  1 1 
        1   3420 2 2  87 ARG HD2  H  -78.411   7.351  -49.144 1.00 . B B .  87 ARG HD2  1 1 
        1   3421 2 2  87 ARG HD3  H  -79.272   7.166  -50.668 1.00 . B B .  87 ARG HD3  1 1 
        1   3422 2 2  87 ARG HE   H  -79.324   4.883  -50.320 1.00 . B B .  87 ARG HE   1 1 
        1   3423 2 2  87 ARG HG2  H  -77.301   6.667  -51.855 1.00 . B B .  87 ARG HG2  1 1 
        1   3424 2 2  87 ARG HG3  H  -76.407   6.291  -50.386 1.00 . B B .  87 ARG HG3  1 1 
        1   3425 2 2  87 ARG HH11 H  -77.095   6.347  -48.062 1.00 . B B .  87 ARG HH11 1 1 
        1   3426 2 2  87 ARG HH12 H  -76.883   4.890  -47.148 1.00 . B B .  87 ARG HH12 1 1 
        1   3427 2 2  87 ARG HH21 H  -79.035   2.984  -49.133 1.00 . B B .  87 ARG HH21 1 1 
        1   3428 2 2  87 ARG HH22 H  -77.983   2.985  -47.757 1.00 . B B .  87 ARG HH22 1 1 
        1   3429 2 2  87 ARG N    N  -76.516   8.521  -53.204 1.00 . B B .  87 ARG N    1 1 
        1   3430 2 2  87 ARG NE   N  -78.709   5.385  -49.745 1.00 . B B .  87 ARG NE   1 1 
        1   3431 2 2  87 ARG NH1  N  -77.304   5.380  -47.912 1.00 . B B .  87 ARG NH1  1 1 
        1   3432 2 2  87 ARG NH2  N  -78.408   3.468  -48.522 1.00 . B B .  87 ARG NH2  1 1 
        1   3433 2 2  87 ARG O    O  -73.484   8.758  -51.307 1.00 . B B .  87 ARG O    1 1 
        1   3434 2 2  88 PHE C    C  -72.337   7.119  -53.725 1.00 . B B .  88 PHE C    1 1 
        1   3435 2 2  88 PHE CA   C  -72.940   6.377  -52.563 1.00 . B B .  88 PHE CA   1 1 
        1   3436 2 2  88 PHE CB   C  -73.021   4.876  -52.860 1.00 . B B .  88 PHE CB   1 1 
        1   3437 2 2  88 PHE CD1  C  -73.445   3.794  -50.645 1.00 . B B .  88 PHE CD1  1 1 
        1   3438 2 2  88 PHE CD2  C  -75.194   3.790  -52.270 1.00 . B B .  88 PHE CD2  1 1 
        1   3439 2 2  88 PHE CE1  C  -74.248   3.122  -49.757 1.00 . B B .  88 PHE CE1  1 1 
        1   3440 2 2  88 PHE CE2  C  -76.009   3.118  -51.389 1.00 . B B .  88 PHE CE2  1 1 
        1   3441 2 2  88 PHE CG   C  -73.901   4.129  -51.910 1.00 . B B .  88 PHE CG   1 1 
        1   3442 2 2  88 PHE CZ   C  -75.531   2.783  -50.124 1.00 . B B .  88 PHE CZ   1 1 
        1   3443 2 2  88 PHE H    H  -75.035   6.524  -52.846 1.00 . B B .  88 PHE H    1 1 
        1   3444 2 2  88 PHE HA   H  -72.359   6.554  -51.669 1.00 . B B .  88 PHE HA   1 1 
        1   3445 2 2  88 PHE HB2  H  -73.404   4.741  -53.859 1.00 . B B .  88 PHE HB2  1 1 
        1   3446 2 2  88 PHE HB3  H  -72.024   4.462  -52.814 1.00 . B B .  88 PHE HB3  1 1 
        1   3447 2 2  88 PHE HD1  H  -72.439   4.060  -50.355 1.00 . B B .  88 PHE HD1  1 1 
        1   3448 2 2  88 PHE HD2  H  -75.562   4.044  -53.253 1.00 . B B .  88 PHE HD2  1 1 
        1   3449 2 2  88 PHE HE1  H  -73.877   2.863  -48.776 1.00 . B B .  88 PHE HE1  1 1 
        1   3450 2 2  88 PHE HE2  H  -77.017   2.856  -51.675 1.00 . B B .  88 PHE HE2  1 1 
        1   3451 2 2  88 PHE HZ   H  -76.168   2.255  -49.429 1.00 . B B .  88 PHE HZ   1 1 
        1   3452 2 2  88 PHE N    N  -74.267   6.959  -52.419 1.00 . B B .  88 PHE N    1 1 
        1   3453 2 2  88 PHE O    O  -72.962   7.196  -54.788 1.00 . B B .  88 PHE O    1 1 
        1   3454 2 2  89 THR C    C  -69.021   7.903  -54.713 1.00 . B B .  89 THR C    1 1 
        1   3455 2 2  89 THR CA   C  -70.456   8.382  -54.616 1.00 . B B .  89 THR CA   1 1 
        1   3456 2 2  89 THR CB   C  -70.459   9.922  -54.479 1.00 . B B .  89 THR CB   1 1 
        1   3457 2 2  89 THR CG2  C  -70.848  10.580  -55.818 1.00 . B B .  89 THR CG2  1 1 
        1   3458 2 2  89 THR H    H  -70.735   7.640  -52.640 1.00 . B B .  89 THR H    1 1 
        1   3459 2 2  89 THR HA   H  -70.956   8.126  -55.539 1.00 . B B .  89 THR HA   1 1 
        1   3460 2 2  89 THR HB   H  -69.463  10.245  -54.214 1.00 . B B .  89 THR HB   1 1 
        1   3461 2 2  89 THR HG1  H  -70.909  10.962  -52.879 1.00 . B B .  89 THR HG1  1 1 
        1   3462 2 2  89 THR HG21 H  -71.916  10.739  -55.843 1.00 . B B .  89 THR HG21 1 1 
        1   3463 2 2  89 THR HG22 H  -70.561   9.934  -56.634 1.00 . B B .  89 THR HG22 1 1 
        1   3464 2 2  89 THR HG23 H  -70.340  11.528  -55.914 1.00 . B B .  89 THR HG23 1 1 
        1   3465 2 2  89 THR N    N  -71.161   7.707  -53.520 1.00 . B B .  89 THR N    1 1 
        1   3466 2 2  89 THR O    O  -68.375   7.612  -53.697 1.00 . B B .  89 THR O    1 1 
        1   3467 2 2  89 THR OG1  O  -71.363  10.325  -53.435 1.00 . B B .  89 THR OG1  1 1 
        1   3468 2 2  90 GLY C    C  -66.339   8.473  -56.757 1.00 . B B .  90 GLY C    1 1 
        1   3469 2 2  90 GLY CA   C  -67.160   7.359  -56.172 1.00 . B B .  90 GLY CA   1 1 
        1   3470 2 2  90 GLY H    H  -69.089   8.051  -56.706 1.00 . B B .  90 GLY H    1 1 
        1   3471 2 2  90 GLY HA2  H  -66.724   7.046  -55.233 1.00 . B B .  90 GLY HA2  1 1 
        1   3472 2 2  90 GLY HA3  H  -67.170   6.526  -56.858 1.00 . B B .  90 GLY HA3  1 1 
        1   3473 2 2  90 GLY N    N  -68.525   7.813  -55.941 1.00 . B B .  90 GLY N    1 1 
        1   3474 2 2  90 GLY O    O  -66.594   8.911  -57.875 1.00 . B B .  90 GLY O    1 1 
        1   3475 2 2  91 SER C    C  -63.129   9.143  -56.558 1.00 . B B .  91 SER C    1 1 
        1   3476 2 2  91 SER CA   C  -64.424   9.908  -56.495 1.00 . B B .  91 SER CA   1 1 
        1   3477 2 2  91 SER CB   C  -64.290  11.105  -55.563 1.00 . B B .  91 SER CB   1 1 
        1   3478 2 2  91 SER H    H  -65.263   8.597  -55.082 1.00 . B B .  91 SER H    1 1 
        1   3479 2 2  91 SER HA   H  -64.712  10.233  -57.485 1.00 . B B .  91 SER HA   1 1 
        1   3480 2 2  91 SER HB2  H  -63.564  11.790  -55.967 1.00 . B B .  91 SER HB2  1 1 
        1   3481 2 2  91 SER HB3  H  -65.246  11.608  -55.499 1.00 . B B .  91 SER HB3  1 1 
        1   3482 2 2  91 SER HG   H  -62.989  11.065  -54.118 1.00 . B B .  91 SER HG   1 1 
        1   3483 2 2  91 SER N    N  -65.388   8.967  -55.981 1.00 . B B .  91 SER N    1 1 
        1   3484 2 2  91 SER O    O  -63.095   7.964  -56.195 1.00 . B B .  91 SER O    1 1 
        1   3485 2 2  91 SER OG   O  -63.868  10.709  -54.266 1.00 . B B .  91 SER OG   1 1 
        1   3486 2 2  92 GLY C    C  -60.207   9.099  -58.409 1.00 . B B .  92 GLY C    1 1 
        1   3487 2 2  92 GLY CA   C  -60.744   9.196  -57.006 1.00 . B B .  92 GLY CA   1 1 
        1   3488 2 2  92 GLY H    H  -62.165  10.736  -57.282 1.00 . B B .  92 GLY H    1 1 
        1   3489 2 2  92 GLY HA2  H  -60.079   9.803  -56.409 1.00 . B B .  92 GLY HA2  1 1 
        1   3490 2 2  92 GLY HA3  H  -60.804   8.206  -56.580 1.00 . B B .  92 GLY HA3  1 1 
        1   3491 2 2  92 GLY N    N  -62.068   9.799  -57.010 1.00 . B B .  92 GLY N    1 1 
        1   3492 2 2  92 GLY O    O  -60.958   9.192  -59.371 1.00 . B B .  92 GLY O    1 1 
        1   3493 2 2  93 SER C    C  -56.742   8.772  -59.653 1.00 . B B .  93 SER C    1 1 
        1   3494 2 2  93 SER CA   C  -58.240   8.924  -59.813 1.00 . B B .  93 SER CA   1 1 
        1   3495 2 2  93 SER CB   C  -58.533  10.242  -60.530 1.00 . B B .  93 SER CB   1 1 
        1   3496 2 2  93 SER H    H  -58.360   8.821  -57.713 1.00 . B B .  93 SER H    1 1 
        1   3497 2 2  93 SER HA   H  -58.613   8.111  -60.417 1.00 . B B .  93 SER HA   1 1 
        1   3498 2 2  93 SER HB2  H  -59.580  10.472  -60.441 1.00 . B B .  93 SER HB2  1 1 
        1   3499 2 2  93 SER HB3  H  -57.959  11.032  -60.062 1.00 . B B .  93 SER HB3  1 1 
        1   3500 2 2  93 SER HG   H  -57.380  10.640  -62.042 1.00 . B B .  93 SER HG   1 1 
        1   3501 2 2  93 SER N    N  -58.903   8.897  -58.525 1.00 . B B .  93 SER N    1 1 
        1   3502 2 2  93 SER O    O  -56.127   9.424  -58.819 1.00 . B B .  93 SER O    1 1 
        1   3503 2 2  93 SER OG   O  -58.198  10.158  -61.906 1.00 . B B .  93 SER OG   1 1 
        1   3504 2 2  94 GLY C    C  -54.684   6.446  -59.275 1.00 . B B .  94 GLY C    1 1 
        1   3505 2 2  94 GLY CA   C  -54.761   7.554  -60.307 1.00 . B B .  94 GLY CA   1 1 
        1   3506 2 2  94 GLY H    H  -56.691   7.453  -61.148 1.00 . B B .  94 GLY H    1 1 
        1   3507 2 2  94 GLY HA2  H  -54.357   7.208  -61.248 1.00 . B B .  94 GLY HA2  1 1 
        1   3508 2 2  94 GLY HA3  H  -54.197   8.405  -59.959 1.00 . B B .  94 GLY HA3  1 1 
        1   3509 2 2  94 GLY N    N  -56.150   7.928  -60.484 1.00 . B B .  94 GLY N    1 1 
        1   3510 2 2  94 GLY O    O  -55.231   5.357  -59.490 1.00 . B B .  94 GLY O    1 1 
        1   3511 2 2  95 THR C    C  -54.715   5.963  -55.904 1.00 . B B .  95 THR C    1 1 
        1   3512 2 2  95 THR CA   C  -53.818   5.709  -57.121 1.00 . B B .  95 THR CA   1 1 
        1   3513 2 2  95 THR CB   C  -52.316   5.624  -56.686 1.00 . B B .  95 THR CB   1 1 
        1   3514 2 2  95 THR CG2  C  -51.403   5.335  -57.856 1.00 . B B .  95 THR CG2  1 1 
        1   3515 2 2  95 THR H    H  -53.616   7.607  -58.041 1.00 . B B .  95 THR H    1 1 
        1   3516 2 2  95 THR HA   H  -54.091   4.797  -57.547 1.00 . B B .  95 THR HA   1 1 
        1   3517 2 2  95 THR HB   H  -52.204   4.843  -55.948 1.00 . B B .  95 THR HB   1 1 
        1   3518 2 2  95 THR HG1  H  -51.125   6.703  -55.586 1.00 . B B .  95 THR HG1  1 1 
        1   3519 2 2  95 THR HG21 H  -51.666   5.975  -58.685 1.00 . B B .  95 THR HG21 1 1 
        1   3520 2 2  95 THR HG22 H  -51.511   4.301  -58.150 1.00 . B B .  95 THR HG22 1 1 
        1   3521 2 2  95 THR HG23 H  -50.379   5.523  -57.568 1.00 . B B .  95 THR HG23 1 1 
        1   3522 2 2  95 THR N    N  -54.019   6.721  -58.154 1.00 . B B .  95 THR N    1 1 
        1   3523 2 2  95 THR O    O  -54.510   5.371  -54.859 1.00 . B B .  95 THR O    1 1 
        1   3524 2 2  95 THR OG1  O  -51.906   6.864  -56.120 1.00 . B B .  95 THR OG1  1 1 
        1   3525 2 2  96 ASP C    C  -57.870   7.564  -54.917 1.00 . B B .  96 ASP C    1 1 
        1   3526 2 2  96 ASP CA   C  -56.369   7.466  -54.897 1.00 . B B .  96 ASP CA   1 1 
        1   3527 2 2  96 ASP CB   C  -55.843   8.889  -54.750 1.00 . B B .  96 ASP CB   1 1 
        1   3528 2 2  96 ASP CG   C  -54.932   9.037  -53.580 1.00 . B B .  96 ASP CG   1 1 
        1   3529 2 2  96 ASP H    H  -55.856   7.224  -56.935 1.00 . B B .  96 ASP H    1 1 
        1   3530 2 2  96 ASP HA   H  -56.081   6.926  -54.011 1.00 . B B .  96 ASP HA   1 1 
        1   3531 2 2  96 ASP HB2  H  -55.304   9.157  -55.646 1.00 . B B .  96 ASP HB2  1 1 
        1   3532 2 2  96 ASP HB3  H  -56.681   9.560  -54.633 1.00 . B B .  96 ASP HB3  1 1 
        1   3533 2 2  96 ASP N    N  -55.730   6.813  -56.054 1.00 . B B .  96 ASP N    1 1 
        1   3534 2 2  96 ASP O    O  -58.436   8.597  -55.282 1.00 . B B .  96 ASP O    1 1 
        1   3535 2 2  96 ASP OD1  O  -54.028   8.184  -53.440 1.00 . B B .  96 ASP OD1  1 1 
        1   3536 2 2  96 ASP OD2  O  -55.125  10.007  -52.806 1.00 . B B .  96 ASP OD2  1 1 
        1   3537 2 2  97 PHE C    C  -60.638   6.648  -53.208 1.00 . B B .  97 PHE C    1 1 
        1   3538 2 2  97 PHE CA   C  -59.971   6.503  -54.559 1.00 . B B .  97 PHE CA   1 1 
        1   3539 2 2  97 PHE CB   C  -60.419   5.263  -55.326 1.00 . B B .  97 PHE CB   1 1 
        1   3540 2 2  97 PHE CD1  C  -58.377   4.785  -56.678 1.00 . B B .  97 PHE CD1  1 1 
        1   3541 2 2  97 PHE CD2  C  -60.383   5.383  -57.810 1.00 . B B .  97 PHE CD2  1 1 
        1   3542 2 2  97 PHE CE1  C  -57.716   4.678  -57.873 1.00 . B B .  97 PHE CE1  1 1 
        1   3543 2 2  97 PHE CE2  C  -59.725   5.277  -59.012 1.00 . B B .  97 PHE CE2  1 1 
        1   3544 2 2  97 PHE CG   C  -59.723   5.122  -56.632 1.00 . B B .  97 PHE CG   1 1 
        1   3545 2 2  97 PHE CZ   C  -58.388   4.917  -59.043 1.00 . B B .  97 PHE CZ   1 1 
        1   3546 2 2  97 PHE H    H  -58.044   5.732  -54.133 1.00 . B B .  97 PHE H    1 1 
        1   3547 2 2  97 PHE HA   H  -60.258   7.363  -55.146 1.00 . B B .  97 PHE HA   1 1 
        1   3548 2 2  97 PHE HB2  H  -60.222   4.387  -54.728 1.00 . B B .  97 PHE HB2  1 1 
        1   3549 2 2  97 PHE HB3  H  -61.484   5.332  -55.501 1.00 . B B .  97 PHE HB3  1 1 
        1   3550 2 2  97 PHE HD1  H  -57.849   4.578  -55.758 1.00 . B B .  97 PHE HD1  1 1 
        1   3551 2 2  97 PHE HD2  H  -61.426   5.664  -57.791 1.00 . B B .  97 PHE HD2  1 1 
        1   3552 2 2  97 PHE HE1  H  -56.669   4.415  -57.892 1.00 . B B .  97 PHE HE1  1 1 
        1   3553 2 2  97 PHE HE2  H  -60.254   5.465  -59.934 1.00 . B B .  97 PHE HE2  1 1 
        1   3554 2 2  97 PHE HZ   H  -57.873   4.834  -59.988 1.00 . B B .  97 PHE HZ   1 1 
        1   3555 2 2  97 PHE N    N  -58.528   6.518  -54.462 1.00 . B B .  97 PHE N    1 1 
        1   3556 2 2  97 PHE O    O  -60.053   6.315  -52.164 1.00 . B B .  97 PHE O    1 1 
        1   3557 2 2  98 THR C    C  -64.118   7.169  -52.290 1.00 . B B .  98 THR C    1 1 
        1   3558 2 2  98 THR CA   C  -62.633   7.477  -52.049 1.00 . B B .  98 THR CA   1 1 
        1   3559 2 2  98 THR CB   C  -62.436   8.958  -51.606 1.00 . B B .  98 THR CB   1 1 
        1   3560 2 2  98 THR CG2  C  -63.423   9.317  -50.518 1.00 . B B .  98 THR CG2  1 1 
        1   3561 2 2  98 THR H    H  -62.226   7.439  -54.117 1.00 . B B .  98 THR H    1 1 
        1   3562 2 2  98 THR HA   H  -62.281   6.835  -51.254 1.00 . B B .  98 THR HA   1 1 
        1   3563 2 2  98 THR HB   H  -62.599   9.603  -52.456 1.00 . B B .  98 THR HB   1 1 
        1   3564 2 2  98 THR HG1  H  -60.760   9.974  -51.498 1.00 . B B .  98 THR HG1  1 1 
        1   3565 2 2  98 THR HG21 H  -62.887   9.616  -49.630 1.00 . B B .  98 THR HG21 1 1 
        1   3566 2 2  98 THR HG22 H  -64.041   8.460  -50.296 1.00 . B B .  98 THR HG22 1 1 
        1   3567 2 2  98 THR HG23 H  -64.046  10.133  -50.853 1.00 . B B .  98 THR HG23 1 1 
        1   3568 2 2  98 THR N    N  -61.856   7.184  -53.246 1.00 . B B .  98 THR N    1 1 
        1   3569 2 2  98 THR O    O  -64.701   7.562  -53.312 1.00 . B B .  98 THR O    1 1 
        1   3570 2 2  98 THR OG1  O  -61.096   9.160  -51.115 1.00 . B B .  98 THR OG1  1 1 
        1   3571 2 2  99 LEU C    C  -66.842   6.980  -50.384 1.00 . B B .  99 LEU C    1 1 
        1   3572 2 2  99 LEU CA   C  -66.148   6.167  -51.431 1.00 . B B .  99 LEU CA   1 1 
        1   3573 2 2  99 LEU CB   C  -66.469   4.693  -51.197 1.00 . B B .  99 LEU CB   1 1 
        1   3574 2 2  99 LEU CD1  C  -68.572   4.310  -52.553 1.00 . B B .  99 LEU CD1  1 1 
        1   3575 2 2  99 LEU CD2  C  -68.175   3.058  -50.452 1.00 . B B .  99 LEU CD2  1 1 
        1   3576 2 2  99 LEU CG   C  -67.966   4.365  -51.158 1.00 . B B .  99 LEU CG   1 1 
        1   3577 2 2  99 LEU H    H  -64.205   6.132  -50.580 1.00 . B B .  99 LEU H    1 1 
        1   3578 2 2  99 LEU HA   H  -66.514   6.458  -52.405 1.00 . B B .  99 LEU HA   1 1 
        1   3579 2 2  99 LEU HB2  H  -66.016   4.114  -51.986 1.00 . B B .  99 LEU HB2  1 1 
        1   3580 2 2  99 LEU HB3  H  -66.025   4.394  -50.257 1.00 . B B .  99 LEU HB3  1 1 
        1   3581 2 2  99 LEU HD11 H  -68.533   5.292  -53.002 1.00 . B B .  99 LEU HD11 1 1 
        1   3582 2 2  99 LEU HD12 H  -69.600   3.986  -52.486 1.00 . B B .  99 LEU HD12 1 1 
        1   3583 2 2  99 LEU HD13 H  -68.014   3.614  -53.161 1.00 . B B .  99 LEU HD13 1 1 
        1   3584 2 2  99 LEU HD21 H  -67.421   2.353  -50.769 1.00 . B B .  99 LEU HD21 1 1 
        1   3585 2 2  99 LEU HD22 H  -69.154   2.671  -50.693 1.00 . B B .  99 LEU HD22 1 1 
        1   3586 2 2  99 LEU HD23 H  -68.100   3.208  -49.385 1.00 . B B .  99 LEU HD23 1 1 
        1   3587 2 2  99 LEU HG   H  -68.469   5.142  -50.599 1.00 . B B .  99 LEU HG   1 1 
        1   3588 2 2  99 LEU N    N  -64.717   6.437  -51.359 1.00 . B B .  99 LEU N    1 1 
        1   3589 2 2  99 LEU O    O  -66.366   7.061  -49.251 1.00 . B B .  99 LEU O    1 1 
        1   3590 2 2 100 THR C    C  -70.224   8.240  -49.879 1.00 . B B . 100 THR C    1 1 
        1   3591 2 2 100 THR CA   C  -68.702   8.511  -49.929 1.00 . B B . 100 THR CA   1 1 
        1   3592 2 2 100 THR CB   C  -68.319  10.001  -50.293 1.00 . B B . 100 THR CB   1 1 
        1   3593 2 2 100 THR CG2  C  -67.898  10.152  -51.746 1.00 . B B . 100 THR CG2  1 1 
        1   3594 2 2 100 THR H    H  -68.290   7.410  -51.684 1.00 . B B . 100 THR H    1 1 
        1   3595 2 2 100 THR HA   H  -68.344   8.345  -48.920 1.00 . B B . 100 THR HA   1 1 
        1   3596 2 2 100 THR HB   H  -67.490  10.297  -49.666 1.00 . B B . 100 THR HB   1 1 
        1   3597 2 2 100 THR HG1  H  -69.061  11.768  -49.920 1.00 . B B . 100 THR HG1  1 1 
        1   3598 2 2 100 THR HG21 H  -66.821  10.173  -51.809 1.00 . B B . 100 THR HG21 1 1 
        1   3599 2 2 100 THR HG22 H  -68.301  11.073  -52.143 1.00 . B B . 100 THR HG22 1 1 
        1   3600 2 2 100 THR HG23 H  -68.276   9.318  -52.318 1.00 . B B . 100 THR HG23 1 1 
        1   3601 2 2 100 THR N    N  -67.980   7.553  -50.765 1.00 . B B . 100 THR N    1 1 
        1   3602 2 2 100 THR O    O  -70.916   8.257  -50.907 1.00 . B B . 100 THR O    1 1 
        1   3603 2 2 100 THR OG1  O  -69.413  10.881  -50.028 1.00 . B B . 100 THR OG1  1 1 
        1   3604 2 2 101 ILE C    C  -72.795   8.630  -47.645 1.00 . B B . 101 ILE C    1 1 
        1   3605 2 2 101 ILE CA   C  -72.119   7.587  -48.490 1.00 . B B . 101 ILE CA   1 1 
        1   3606 2 2 101 ILE CB   C  -72.270   6.248  -47.729 1.00 . B B . 101 ILE CB   1 1 
        1   3607 2 2 101 ILE CD1  C  -71.416   3.830  -47.587 1.00 . B B . 101 ILE CD1  1 1 
        1   3608 2 2 101 ILE CG1  C  -71.483   5.118  -48.404 1.00 . B B . 101 ILE CG1  1 1 
        1   3609 2 2 101 ILE CG2  C  -73.753   5.879  -47.576 1.00 . B B . 101 ILE CG2  1 1 
        1   3610 2 2 101 ILE H    H  -70.119   7.943  -47.905 1.00 . B B . 101 ILE H    1 1 
        1   3611 2 2 101 ILE HA   H  -72.611   7.516  -49.447 1.00 . B B . 101 ILE HA   1 1 
        1   3612 2 2 101 ILE HB   H  -71.867   6.392  -46.735 1.00 . B B . 101 ILE HB   1 1 
        1   3613 2 2 101 ILE HD11 H  -72.406   3.407  -47.499 1.00 . B B . 101 ILE HD11 1 1 
        1   3614 2 2 101 ILE HD12 H  -71.029   4.048  -46.603 1.00 . B B . 101 ILE HD12 1 1 
        1   3615 2 2 101 ILE HD13 H  -70.765   3.124  -48.082 1.00 . B B . 101 ILE HD13 1 1 
        1   3616 2 2 101 ILE HG12 H  -71.946   4.895  -49.352 1.00 . B B . 101 ILE HG12 1 1 
        1   3617 2 2 101 ILE HG13 H  -70.476   5.465  -48.588 1.00 . B B . 101 ILE HG13 1 1 
        1   3618 2 2 101 ILE HG21 H  -73.888   4.831  -47.798 1.00 . B B . 101 ILE HG21 1 1 
        1   3619 2 2 101 ILE HG22 H  -74.343   6.471  -48.260 1.00 . B B . 101 ILE HG22 1 1 
        1   3620 2 2 101 ILE HG23 H  -74.070   6.077  -46.563 1.00 . B B . 101 ILE HG23 1 1 
        1   3621 2 2 101 ILE N    N  -70.723   7.961  -48.677 1.00 . B B . 101 ILE N    1 1 
        1   3622 2 2 101 ILE O    O  -72.575   8.680  -46.430 1.00 . B B . 101 ILE O    1 1 
        1   3623 2 2 102 SER C    C  -75.767   9.862  -47.108 1.00 . B B . 102 SER C    1 1 
        1   3624 2 2 102 SER CA   C  -74.425  10.448  -47.548 1.00 . B B . 102 SER CA   1 1 
        1   3625 2 2 102 SER CB   C  -74.643  11.720  -48.380 1.00 . B B . 102 SER CB   1 1 
        1   3626 2 2 102 SER H    H  -73.762   9.347  -49.243 1.00 . B B . 102 SER H    1 1 
        1   3627 2 2 102 SER HA   H  -73.877  10.721  -46.658 1.00 . B B . 102 SER HA   1 1 
        1   3628 2 2 102 SER HB2  H  -75.111  12.469  -47.767 1.00 . B B . 102 SER HB2  1 1 
        1   3629 2 2 102 SER HB3  H  -73.680  12.090  -48.711 1.00 . B B . 102 SER HB3  1 1 
        1   3630 2 2 102 SER HG   H  -75.904  12.293  -49.741 1.00 . B B . 102 SER HG   1 1 
        1   3631 2 2 102 SER N    N  -73.628   9.452  -48.278 1.00 . B B . 102 SER N    1 1 
        1   3632 2 2 102 SER O    O  -76.334   8.991  -47.792 1.00 . B B . 102 SER O    1 1 
        1   3633 2 2 102 SER OG   O  -75.471  11.470  -49.503 1.00 . B B . 102 SER OG   1 1 
        1   3634 2 2 103 SER C    C  -77.621   8.460  -45.085 1.00 . B B . 103 SER C    1 1 
        1   3635 2 2 103 SER CA   C  -77.567   9.949  -45.418 1.00 . B B . 103 SER CA   1 1 
        1   3636 2 2 103 SER CB   C  -78.702  10.341  -46.384 1.00 . B B . 103 SER CB   1 1 
        1   3637 2 2 103 SER H    H  -75.740  11.020  -45.481 1.00 . B B . 103 SER H    1 1 
        1   3638 2 2 103 SER HA   H  -77.715  10.495  -44.497 1.00 . B B . 103 SER HA   1 1 
        1   3639 2 2 103 SER HB2  H  -78.603   9.777  -47.295 1.00 . B B . 103 SER HB2  1 1 
        1   3640 2 2 103 SER HB3  H  -79.655  10.107  -45.927 1.00 . B B . 103 SER HB3  1 1 
        1   3641 2 2 103 SER HG   H  -78.491  12.206  -45.878 1.00 . B B . 103 SER HG   1 1 
        1   3642 2 2 103 SER N    N  -76.257  10.340  -45.960 1.00 . B B . 103 SER N    1 1 
        1   3643 2 2 103 SER O    O  -78.512   7.738  -45.555 1.00 . B B . 103 SER O    1 1 
        1   3644 2 2 103 SER OG   O  -78.640  11.724  -46.695 1.00 . B B . 103 SER OG   1 1 
        1   3645 2 2 104 VAL C    C  -77.768   5.995  -43.309 1.00 . B B . 104 VAL C    1 1 
        1   3646 2 2 104 VAL CA   C  -76.503   6.619  -43.893 1.00 . B B . 104 VAL CA   1 1 
        1   3647 2 2 104 VAL CB   C  -75.394   6.439  -42.846 1.00 . B B . 104 VAL CB   1 1 
        1   3648 2 2 104 VAL CG1  C  -75.098   4.939  -42.625 1.00 . B B . 104 VAL CG1  1 1 
        1   3649 2 2 104 VAL CG2  C  -74.150   7.209  -43.255 1.00 . B B . 104 VAL CG2  1 1 
        1   3650 2 2 104 VAL H    H  -75.997   8.667  -43.947 1.00 . B B . 104 VAL H    1 1 
        1   3651 2 2 104 VAL HA   H  -76.223   6.060  -44.772 1.00 . B B . 104 VAL HA   1 1 
        1   3652 2 2 104 VAL HB   H  -75.756   6.845  -41.910 1.00 . B B . 104 VAL HB   1 1 
        1   3653 2 2 104 VAL HG11 H  -74.420   4.825  -41.792 1.00 . B B . 104 VAL HG11 1 1 
        1   3654 2 2 104 VAL HG12 H  -74.646   4.526  -43.515 1.00 . B B . 104 VAL HG12 1 1 
        1   3655 2 2 104 VAL HG13 H  -76.020   4.417  -42.414 1.00 . B B . 104 VAL HG13 1 1 
        1   3656 2 2 104 VAL HG21 H  -74.344   7.746  -44.172 1.00 . B B . 104 VAL HG21 1 1 
        1   3657 2 2 104 VAL HG22 H  -73.334   6.518  -43.409 1.00 . B B . 104 VAL HG22 1 1 
        1   3658 2 2 104 VAL HG23 H  -73.888   7.909  -42.476 1.00 . B B . 104 VAL HG23 1 1 
        1   3659 2 2 104 VAL N    N  -76.660   8.022  -44.272 1.00 . B B . 104 VAL N    1 1 
        1   3660 2 2 104 VAL O    O  -78.088   6.190  -42.129 1.00 . B B . 104 VAL O    1 1 
        1   3661 2 2 105 GLN C    C  -79.066   3.301  -42.753 1.00 . B B . 105 GLN C    1 1 
        1   3662 2 2 105 GLN CA   C  -79.572   4.455  -43.599 1.00 . B B . 105 GLN CA   1 1 
        1   3663 2 2 105 GLN CB   C  -80.550   4.012  -44.683 1.00 . B B . 105 GLN CB   1 1 
        1   3664 2 2 105 GLN CD   C  -82.409   5.169  -43.280 1.00 . B B . 105 GLN CD   1 1 
        1   3665 2 2 105 GLN CG   C  -81.820   4.880  -44.701 1.00 . B B . 105 GLN CG   1 1 
        1   3666 2 2 105 GLN H    H  -78.186   5.095  -45.054 1.00 . B B . 105 GLN H    1 1 
        1   3667 2 2 105 GLN HA   H  -80.117   5.109  -42.931 1.00 . B B . 105 GLN HA   1 1 
        1   3668 2 2 105 GLN HB2  H  -80.066   4.065  -45.646 1.00 . B B . 105 GLN HB2  1 1 
        1   3669 2 2 105 GLN HB3  H  -80.834   2.987  -44.490 1.00 . B B . 105 GLN HB3  1 1 
        1   3670 2 2 105 GLN HE21 H  -82.312   3.216  -42.762 1.00 . B B . 105 GLN HE21 1 1 
        1   3671 2 2 105 GLN HE22 H  -82.930   4.242  -41.559 1.00 . B B . 105 GLN HE22 1 1 
        1   3672 2 2 105 GLN HG2  H  -81.586   5.822  -45.173 1.00 . B B . 105 GLN HG2  1 1 
        1   3673 2 2 105 GLN HG3  H  -82.572   4.377  -45.292 1.00 . B B . 105 GLN HG3  1 1 
        1   3674 2 2 105 GLN N    N  -78.481   5.232  -44.130 1.00 . B B . 105 GLN N    1 1 
        1   3675 2 2 105 GLN NE2  N  -82.564   4.113  -42.460 1.00 . B B . 105 GLN NE2  1 1 
        1   3676 2 2 105 GLN O    O  -77.862   3.048  -42.674 1.00 . B B . 105 GLN O    1 1 
        1   3677 2 2 105 GLN OE1  O  -82.720   6.324  -42.945 1.00 . B B . 105 GLN OE1  1 1 
        1   3678 2 2 106 ALA C    C  -79.209   0.340  -41.876 1.00 . B B . 106 ALA C    1 1 
        1   3679 2 2 106 ALA CA   C  -79.682   1.584  -41.132 1.00 . B B . 106 ALA CA   1 1 
        1   3680 2 2 106 ALA CB   C  -80.907   1.272  -40.269 1.00 . B B . 106 ALA CB   1 1 
        1   3681 2 2 106 ALA H    H  -80.933   2.926  -42.171 1.00 . B B . 106 ALA H    1 1 
        1   3682 2 2 106 ALA HA   H  -78.884   1.927  -40.489 1.00 . B B . 106 ALA HA   1 1 
        1   3683 2 2 106 ALA HB1  H  -81.790   1.685  -40.734 1.00 . B B . 106 ALA HB1  1 1 
        1   3684 2 2 106 ALA HB2  H  -80.779   1.710  -39.290 1.00 . B B . 106 ALA HB2  1 1 
        1   3685 2 2 106 ALA HB3  H  -81.018   0.202  -40.174 1.00 . B B . 106 ALA HB3  1 1 
        1   3686 2 2 106 ALA N    N  -80.000   2.640  -42.082 1.00 . B B . 106 ALA N    1 1 
        1   3687 2 2 106 ALA O    O  -78.337  -0.398  -41.391 1.00 . B B . 106 ALA O    1 1 
        1   3688 2 2 107 GLU C    C  -78.272  -0.574  -44.804 1.00 . B B . 107 GLU C    1 1 
        1   3689 2 2 107 GLU CA   C  -79.473  -0.965  -43.953 1.00 . B B . 107 GLU CA   1 1 
        1   3690 2 2 107 GLU CB   C  -80.686  -1.323  -44.831 1.00 . B B . 107 GLU CB   1 1 
        1   3691 2 2 107 GLU CD   C  -82.622  -1.222  -43.071 1.00 . B B . 107 GLU CD   1 1 
        1   3692 2 2 107 GLU CG   C  -81.830  -2.082  -44.102 1.00 . B B . 107 GLU CG   1 1 
        1   3693 2 2 107 GLU H    H  -80.465   0.789  -43.356 1.00 . B B . 107 GLU H    1 1 
        1   3694 2 2 107 GLU HA   H  -79.208  -1.827  -43.356 1.00 . B B . 107 GLU HA   1 1 
        1   3695 2 2 107 GLU HB2  H  -81.094  -0.409  -45.234 1.00 . B B . 107 GLU HB2  1 1 
        1   3696 2 2 107 GLU HB3  H  -80.340  -1.932  -45.654 1.00 . B B . 107 GLU HB3  1 1 
        1   3697 2 2 107 GLU HG2  H  -82.524  -2.445  -44.843 1.00 . B B . 107 GLU HG2  1 1 
        1   3698 2 2 107 GLU HG3  H  -81.402  -2.931  -43.588 1.00 . B B . 107 GLU HG3  1 1 
        1   3699 2 2 107 GLU N    N  -79.793   0.140  -43.060 1.00 . B B . 107 GLU N    1 1 
        1   3700 2 2 107 GLU O    O  -78.294  -0.673  -46.034 1.00 . B B . 107 GLU O    1 1 
        1   3701 2 2 107 GLU OE1  O  -82.521   0.040  -43.118 1.00 . B B . 107 GLU OE1  1 1 
        1   3702 2 2 107 GLU OE2  O  -83.349  -1.814  -42.219 1.00 . B B . 107 GLU OE2  1 1 
        1   3703 2 2 108 ASP C    C  -74.860  -0.316  -43.855 1.00 . B B . 108 ASP C    1 1 
        1   3704 2 2 108 ASP CA   C  -75.960   0.228  -44.739 1.00 . B B . 108 ASP CA   1 1 
        1   3705 2 2 108 ASP CB   C  -75.821   1.743  -44.913 1.00 . B B . 108 ASP CB   1 1 
        1   3706 2 2 108 ASP CG   C  -76.716   2.298  -46.020 1.00 . B B . 108 ASP CG   1 1 
        1   3707 2 2 108 ASP H    H  -77.304  -0.041  -43.148 1.00 . B B . 108 ASP H    1 1 
        1   3708 2 2 108 ASP HA   H  -75.902  -0.248  -45.708 1.00 . B B . 108 ASP HA   1 1 
        1   3709 2 2 108 ASP HB2  H  -76.081   2.225  -43.983 1.00 . B B . 108 ASP HB2  1 1 
        1   3710 2 2 108 ASP HB3  H  -74.791   1.972  -45.146 1.00 . B B . 108 ASP HB3  1 1 
        1   3711 2 2 108 ASP N    N  -77.230  -0.104  -44.123 1.00 . B B . 108 ASP N    1 1 
        1   3712 2 2 108 ASP O    O  -73.714   0.102  -43.937 1.00 . B B . 108 ASP O    1 1 
        1   3713 2 2 108 ASP OD1  O  -76.782   1.700  -47.120 1.00 . B B . 108 ASP OD1  1 1 
        1   3714 2 2 108 ASP OD2  O  -77.351   3.351  -45.795 1.00 . B B . 108 ASP OD2  1 1 
        1   3715 2 2 109 LEU C    C  -73.473  -2.923  -43.117 1.00 . B B . 109 LEU C    1 1 
        1   3716 2 2 109 LEU CA   C  -74.219  -1.955  -42.207 1.00 . B B . 109 LEU CA   1 1 
        1   3717 2 2 109 LEU CB   C  -74.853  -2.701  -41.032 1.00 . B B . 109 LEU CB   1 1 
        1   3718 2 2 109 LEU CD1  C  -74.887  -2.551  -38.538 1.00 . B B . 109 LEU CD1  1 1 
        1   3719 2 2 109 LEU CD2  C  -72.675  -3.050  -39.679 1.00 . B B . 109 LEU CD2  1 1 
        1   3720 2 2 109 LEU CG   C  -74.047  -2.343  -39.780 1.00 . B B . 109 LEU CG   1 1 
        1   3721 2 2 109 LEU H    H  -76.152  -1.556  -42.966 1.00 . B B . 109 LEU H    1 1 
        1   3722 2 2 109 LEU HA   H  -73.515  -1.230  -41.823 1.00 . B B . 109 LEU HA   1 1 
        1   3723 2 2 109 LEU HB2  H  -75.882  -2.390  -40.913 1.00 . B B . 109 LEU HB2  1 1 
        1   3724 2 2 109 LEU HB3  H  -74.806  -3.765  -41.202 1.00 . B B . 109 LEU HB3  1 1 
        1   3725 2 2 109 LEU HD11 H  -74.368  -2.150  -37.680 1.00 . B B . 109 LEU HD11 1 1 
        1   3726 2 2 109 LEU HD12 H  -75.060  -3.607  -38.393 1.00 . B B . 109 LEU HD12 1 1 
        1   3727 2 2 109 LEU HD13 H  -75.833  -2.044  -38.654 1.00 . B B . 109 LEU HD13 1 1 
        1   3728 2 2 109 LEU HD21 H  -72.338  -3.325  -40.668 1.00 . B B . 109 LEU HD21 1 1 
        1   3729 2 2 109 LEU HD22 H  -72.771  -3.939  -39.073 1.00 . B B . 109 LEU HD22 1 1 
        1   3730 2 2 109 LEU HD23 H  -71.957  -2.382  -39.226 1.00 . B B . 109 LEU HD23 1 1 
        1   3731 2 2 109 LEU HG   H  -73.853  -1.278  -39.840 1.00 . B B . 109 LEU HG   1 1 
        1   3732 2 2 109 LEU N    N  -75.219  -1.258  -42.995 1.00 . B B . 109 LEU N    1 1 
        1   3733 2 2 109 LEU O    O  -74.068  -3.875  -43.647 1.00 . B B . 109 LEU O    1 1 
        1   3734 2 2 110 ALA C    C  -69.951  -3.306  -44.194 1.00 . B B . 110 ALA C    1 1 
        1   3735 2 2 110 ALA CA   C  -71.451  -3.475  -44.281 1.00 . B B . 110 ALA CA   1 1 
        1   3736 2 2 110 ALA CB   C  -71.922  -3.124  -45.687 1.00 . B B . 110 ALA CB   1 1 
        1   3737 2 2 110 ALA H    H  -71.755  -1.910  -42.886 1.00 . B B . 110 ALA H    1 1 
        1   3738 2 2 110 ALA HA   H  -71.683  -4.514  -44.106 1.00 . B B . 110 ALA HA   1 1 
        1   3739 2 2 110 ALA HB1  H  -71.351  -2.287  -46.060 1.00 . B B . 110 ALA HB1  1 1 
        1   3740 2 2 110 ALA HB2  H  -72.970  -2.862  -45.661 1.00 . B B . 110 ALA HB2  1 1 
        1   3741 2 2 110 ALA HB3  H  -71.780  -3.975  -46.338 1.00 . B B . 110 ALA HB3  1 1 
        1   3742 2 2 110 ALA N    N  -72.183  -2.681  -43.315 1.00 . B B . 110 ALA N    1 1 
        1   3743 2 2 110 ALA O    O  -69.447  -2.379  -43.562 1.00 . B B . 110 ALA O    1 1 
        1   3744 2 2 111 VAL C    C  -67.843  -3.567  -46.688 1.00 . B B . 111 VAL C    1 1 
        1   3745 2 2 111 VAL CA   C  -67.865  -3.933  -45.196 1.00 . B B . 111 VAL CA   1 1 
        1   3746 2 2 111 VAL CB   C  -66.908  -5.058  -44.775 1.00 . B B . 111 VAL CB   1 1 
        1   3747 2 2 111 VAL CG1  C  -65.477  -4.778  -45.217 1.00 . B B . 111 VAL CG1  1 1 
        1   3748 2 2 111 VAL CG2  C  -66.937  -5.172  -43.281 1.00 . B B . 111 VAL CG2  1 1 
        1   3749 2 2 111 VAL H    H  -69.701  -4.930  -45.312 1.00 . B B . 111 VAL H    1 1 
        1   3750 2 2 111 VAL HA   H  -67.577  -3.039  -44.653 1.00 . B B . 111 VAL HA   1 1 
        1   3751 2 2 111 VAL HB   H  -67.240  -5.990  -45.209 1.00 . B B . 111 VAL HB   1 1 
        1   3752 2 2 111 VAL HG11 H  -64.954  -5.712  -45.359 1.00 . B B . 111 VAL HG11 1 1 
        1   3753 2 2 111 VAL HG12 H  -64.974  -4.195  -44.460 1.00 . B B . 111 VAL HG12 1 1 
        1   3754 2 2 111 VAL HG13 H  -65.489  -4.228  -46.146 1.00 . B B . 111 VAL HG13 1 1 
        1   3755 2 2 111 VAL HG21 H  -66.245  -4.463  -42.852 1.00 . B B . 111 VAL HG21 1 1 
        1   3756 2 2 111 VAL HG22 H  -66.655  -6.173  -42.990 1.00 . B B . 111 VAL HG22 1 1 
        1   3757 2 2 111 VAL HG23 H  -67.934  -4.960  -42.923 1.00 . B B . 111 VAL HG23 1 1 
        1   3758 2 2 111 VAL N    N  -69.232  -4.214  -44.835 1.00 . B B . 111 VAL N    1 1 
        1   3759 2 2 111 VAL O    O  -68.554  -4.162  -47.506 1.00 . B B . 111 VAL O    1 1 
        1   3760 2 2 112 TYR C    C  -65.578  -2.235  -48.890 1.00 . B B . 112 TYR C    1 1 
        1   3761 2 2 112 TYR CA   C  -66.960  -1.942  -48.325 1.00 . B B . 112 TYR CA   1 1 
        1   3762 2 2 112 TYR CB   C  -67.263  -0.439  -48.239 1.00 . B B . 112 TYR CB   1 1 
        1   3763 2 2 112 TYR CD1  C  -69.687  -0.129  -48.876 1.00 . B B . 112 TYR CD1  1 1 
        1   3764 2 2 112 TYR CD2  C  -69.127  -0.026  -46.549 1.00 . B B . 112 TYR CD2  1 1 
        1   3765 2 2 112 TYR CE1  C  -71.016   0.079  -48.577 1.00 . B B . 112 TYR CE1  1 1 
        1   3766 2 2 112 TYR CE2  C  -70.474   0.181  -46.235 1.00 . B B . 112 TYR CE2  1 1 
        1   3767 2 2 112 TYR CG   C  -68.717  -0.178  -47.880 1.00 . B B . 112 TYR CG   1 1 
        1   3768 2 2 112 TYR CZ   C  -71.414   0.231  -47.266 1.00 . B B . 112 TYR CZ   1 1 
        1   3769 2 2 112 TYR H    H  -66.569  -2.100  -46.268 1.00 . B B . 112 TYR H    1 1 
        1   3770 2 2 112 TYR HA   H  -67.697  -2.408  -48.964 1.00 . B B . 112 TYR HA   1 1 
        1   3771 2 2 112 TYR HB2  H  -66.629   0.008  -47.488 1.00 . B B . 112 TYR HB2  1 1 
        1   3772 2 2 112 TYR HB3  H  -67.049   0.017  -49.196 1.00 . B B . 112 TYR HB3  1 1 
        1   3773 2 2 112 TYR HD1  H  -69.391  -0.246  -49.908 1.00 . B B . 112 TYR HD1  1 1 
        1   3774 2 2 112 TYR HD2  H  -68.393  -0.061  -45.757 1.00 . B B . 112 TYR HD2  1 1 
        1   3775 2 2 112 TYR HE1  H  -71.747   0.119  -49.371 1.00 . B B . 112 TYR HE1  1 1 
        1   3776 2 2 112 TYR HE2  H  -70.784   0.298  -45.207 1.00 . B B . 112 TYR HE2  1 1 
        1   3777 2 2 112 TYR HH   H  -72.865   0.651  -46.099 1.00 . B B . 112 TYR HH   1 1 
        1   3778 2 2 112 TYR N    N  -67.060  -2.533  -46.997 1.00 . B B . 112 TYR N    1 1 
        1   3779 2 2 112 TYR O    O  -64.553  -1.889  -48.306 1.00 . B B . 112 TYR O    1 1 
        1   3780 2 2 112 TYR OH   O  -72.758   0.433  -47.028 1.00 . B B . 112 TYR OH   1 1 
        1   3781 2 2 113 TYR C    C  -64.064  -2.760  -51.853 1.00 . B B . 113 TYR C    1 1 
        1   3782 2 2 113 TYR CA   C  -64.334  -3.483  -50.557 1.00 . B B . 113 TYR CA   1 1 
        1   3783 2 2 113 TYR CB   C  -64.485  -4.988  -50.837 1.00 . B B . 113 TYR CB   1 1 
        1   3784 2 2 113 TYR CD1  C  -63.260  -6.174  -49.001 1.00 . B B . 113 TYR CD1  1 1 
        1   3785 2 2 113 TYR CD2  C  -65.634  -6.318  -49.028 1.00 . B B . 113 TYR CD2  1 1 
        1   3786 2 2 113 TYR CE1  C  -63.226  -6.949  -47.881 1.00 . B B . 113 TYR CE1  1 1 
        1   3787 2 2 113 TYR CE2  C  -65.618  -7.087  -47.891 1.00 . B B . 113 TYR CE2  1 1 
        1   3788 2 2 113 TYR CG   C  -64.458  -5.844  -49.598 1.00 . B B . 113 TYR CG   1 1 
        1   3789 2 2 113 TYR CZ   C  -64.408  -7.397  -47.319 1.00 . B B . 113 TYR CZ   1 1 
        1   3790 2 2 113 TYR H    H  -66.417  -3.221  -50.399 1.00 . B B . 113 TYR H    1 1 
        1   3791 2 2 113 TYR HA   H  -63.519  -3.318  -49.868 1.00 . B B . 113 TYR HA   1 1 
        1   3792 2 2 113 TYR HB2  H  -65.423  -5.151  -51.343 1.00 . B B . 113 TYR HB2  1 1 
        1   3793 2 2 113 TYR HB3  H  -63.683  -5.297  -51.493 1.00 . B B . 113 TYR HB3  1 1 
        1   3794 2 2 113 TYR HD1  H  -62.334  -5.827  -49.437 1.00 . B B . 113 TYR HD1  1 1 
        1   3795 2 2 113 TYR HD2  H  -66.580  -6.068  -49.484 1.00 . B B . 113 TYR HD2  1 1 
        1   3796 2 2 113 TYR HE1  H  -62.280  -7.198  -47.423 1.00 . B B . 113 TYR HE1  1 1 
        1   3797 2 2 113 TYR HE2  H  -66.540  -7.448  -47.458 1.00 . B B . 113 TYR HE2  1 1 
        1   3798 2 2 113 TYR HH   H  -64.131  -7.576  -45.438 1.00 . B B . 113 TYR HH   1 1 
        1   3799 2 2 113 TYR N    N  -65.563  -2.939  -50.009 1.00 . B B . 113 TYR N    1 1 
        1   3800 2 2 113 TYR O    O  -64.995  -2.523  -52.640 1.00 . B B . 113 TYR O    1 1 
        1   3801 2 2 113 TYR OH   O  -64.346  -8.159  -46.170 1.00 . B B . 113 TYR OH   1 1 
        1   3802 2 2 114 CYS C    C  -61.753  -2.925  -54.124 1.00 . B B . 114 CYS C    1 1 
        1   3803 2 2 114 CYS CA   C  -62.486  -1.842  -53.378 1.00 . B B . 114 CYS CA   1 1 
        1   3804 2 2 114 CYS CB   C  -61.703  -0.537  -53.277 1.00 . B B . 114 CYS CB   1 1 
        1   3805 2 2 114 CYS H    H  -62.108  -2.564  -51.427 1.00 . B B . 114 CYS H    1 1 
        1   3806 2 2 114 CYS HA   H  -63.413  -1.647  -53.901 1.00 . B B . 114 CYS HA   1 1 
        1   3807 2 2 114 CYS HB2  H  -61.625  -0.119  -54.267 1.00 . B B . 114 CYS HB2  1 1 
        1   3808 2 2 114 CYS HB3  H  -62.283   0.150  -52.674 1.00 . B B . 114 CYS HB3  1 1 
        1   3809 2 2 114 CYS N    N  -62.814  -2.377  -52.081 1.00 . B B . 114 CYS N    1 1 
        1   3810 2 2 114 CYS O    O  -61.069  -3.739  -53.506 1.00 . B B . 114 CYS O    1 1 
        1   3811 2 2 114 CYS SG   S  -60.048  -0.626  -52.602 1.00 . B B . 114 CYS SG   1 1 
        1   3812 2 2 115 LYS C    C  -60.618  -3.216  -57.443 1.00 . B B . 115 LYS C    1 1 
        1   3813 2 2 115 LYS CA   C  -61.286  -3.949  -56.305 1.00 . B B . 115 LYS CA   1 1 
        1   3814 2 2 115 LYS CB   C  -62.278  -4.899  -56.955 1.00 . B B . 115 LYS CB   1 1 
        1   3815 2 2 115 LYS CD   C  -63.381  -5.529  -59.264 1.00 . B B . 115 LYS CD   1 1 
        1   3816 2 2 115 LYS CE   C  -63.350  -6.896  -58.654 1.00 . B B . 115 LYS CE   1 1 
        1   3817 2 2 115 LYS CG   C  -62.487  -4.569  -58.472 1.00 . B B . 115 LYS CG   1 1 
        1   3818 2 2 115 LYS H    H  -62.555  -2.313  -55.848 1.00 . B B . 115 LYS H    1 1 
        1   3819 2 2 115 LYS HA   H  -60.555  -4.509  -55.742 1.00 . B B . 115 LYS HA   1 1 
        1   3820 2 2 115 LYS HB2  H  -61.911  -5.911  -56.861 1.00 . B B . 115 LYS HB2  1 1 
        1   3821 2 2 115 LYS HB3  H  -63.227  -4.820  -56.445 1.00 . B B . 115 LYS HB3  1 1 
        1   3822 2 2 115 LYS HD2  H  -64.390  -5.159  -59.332 1.00 . B B . 115 LYS HD2  1 1 
        1   3823 2 2 115 LYS HD3  H  -62.966  -5.603  -60.259 1.00 . B B . 115 LYS HD3  1 1 
        1   3824 2 2 115 LYS HE2  H  -64.264  -7.067  -58.104 1.00 . B B . 115 LYS HE2  1 1 
        1   3825 2 2 115 LYS HE3  H  -63.253  -7.637  -59.433 1.00 . B B . 115 LYS HE3  1 1 
        1   3826 2 2 115 LYS HG2  H  -62.919  -3.585  -58.544 1.00 . B B . 115 LYS HG2  1 1 
        1   3827 2 2 115 LYS HG3  H  -61.513  -4.541  -58.944 1.00 . B B . 115 LYS HG3  1 1 
        1   3828 2 2 115 LYS HZ1  H  -62.205  -6.215  -57.032 1.00 . B B . 115 LYS HZ1  1 1 
        1   3829 2 2 115 LYS HZ2  H  -61.288  -6.934  -58.268 1.00 . B B . 115 LYS HZ2  1 1 
        1   3830 2 2 115 LYS HZ3  H  -62.203  -7.902  -57.213 1.00 . B B . 115 LYS HZ3  1 1 
        1   3831 2 2 115 LYS N    N  -61.954  -2.971  -55.440 1.00 . B B . 115 LYS N    1 1 
        1   3832 2 2 115 LYS NZ   N  -62.170  -6.995  -57.719 1.00 . B B . 115 LYS NZ   1 1 
        1   3833 2 2 115 LYS O    O  -61.205  -2.296  -58.040 1.00 . B B . 115 LYS O    1 1 
        1   3834 2 2 116 GLN C    C  -59.062  -4.191  -60.077 1.00 . B B . 116 GLN C    1 1 
        1   3835 2 2 116 GLN CA   C  -58.819  -3.154  -59.008 1.00 . B B . 116 GLN CA   1 1 
        1   3836 2 2 116 GLN CB   C  -57.332  -2.908  -58.836 1.00 . B B . 116 GLN CB   1 1 
        1   3837 2 2 116 GLN CD   C  -56.055  -4.871  -59.679 1.00 . B B . 116 GLN CD   1 1 
        1   3838 2 2 116 GLN CG   C  -56.551  -4.133  -58.469 1.00 . B B . 116 GLN CG   1 1 
        1   3839 2 2 116 GLN H    H  -59.000  -4.388  -57.301 1.00 . B B . 116 GLN H    1 1 
        1   3840 2 2 116 GLN HA   H  -59.303  -2.231  -59.294 1.00 . B B . 116 GLN HA   1 1 
        1   3841 2 2 116 GLN HB2  H  -56.938  -2.518  -59.761 1.00 . B B . 116 GLN HB2  1 1 
        1   3842 2 2 116 GLN HB3  H  -57.196  -2.163  -58.064 1.00 . B B . 116 GLN HB3  1 1 
        1   3843 2 2 116 GLN HE21 H  -56.505  -3.329  -60.874 1.00 . B B . 116 GLN HE21 1 1 
        1   3844 2 2 116 GLN HE22 H  -55.827  -4.672  -61.658 1.00 . B B . 116 GLN HE22 1 1 
        1   3845 2 2 116 GLN HG2  H  -55.704  -3.840  -57.868 1.00 . B B . 116 GLN HG2  1 1 
        1   3846 2 2 116 GLN HG3  H  -57.182  -4.790  -57.889 1.00 . B B . 116 GLN HG3  1 1 
        1   3847 2 2 116 GLN N    N  -59.411  -3.639  -57.782 1.00 . B B . 116 GLN N    1 1 
        1   3848 2 2 116 GLN NE2  N  -56.136  -4.236  -60.837 1.00 . B B . 116 GLN NE2  1 1 
        1   3849 2 2 116 GLN O    O  -59.032  -5.401  -59.799 1.00 . B B . 116 GLN O    1 1 
        1   3850 2 2 116 GLN OE1  O  -55.602  -6.001  -59.575 1.00 . B B . 116 GLN OE1  1 1 
        1   3851 2 2 117 SER C    C  -58.549  -4.112  -63.597 1.00 . B B . 117 SER C    1 1 
        1   3852 2 2 117 SER CA   C  -59.423  -4.605  -62.442 1.00 . B B . 117 SER CA   1 1 
        1   3853 2 2 117 SER CB   C  -60.887  -4.777  -62.852 1.00 . B B . 117 SER CB   1 1 
        1   3854 2 2 117 SER H    H  -59.324  -2.749  -61.438 1.00 . B B . 117 SER H    1 1 
        1   3855 2 2 117 SER HA   H  -59.048  -5.574  -62.142 1.00 . B B . 117 SER HA   1 1 
        1   3856 2 2 117 SER HB2  H  -60.972  -5.615  -63.523 1.00 . B B . 117 SER HB2  1 1 
        1   3857 2 2 117 SER HB3  H  -61.479  -4.977  -61.967 1.00 . B B . 117 SER HB3  1 1 
        1   3858 2 2 117 SER HG   H  -61.011  -2.853  -63.063 1.00 . B B . 117 SER HG   1 1 
        1   3859 2 2 117 SER N    N  -59.310  -3.719  -61.295 1.00 . B B . 117 SER N    1 1 
        1   3860 2 2 117 SER O    O  -58.847  -4.347  -64.757 1.00 . B B . 117 SER O    1 1 
        1   3861 2 2 117 SER OG   O  -61.378  -3.622  -63.505 1.00 . B B . 117 SER OG   1 1 
        1   3862 2 2 118 TYR C    C  -55.553  -3.970  -64.664 1.00 . B B . 118 TYR C    1 1 
        1   3863 2 2 118 TYR CA   C  -56.534  -2.916  -64.266 1.00 . B B . 118 TYR CA   1 1 
        1   3864 2 2 118 TYR CB   C  -55.755  -1.706  -63.748 1.00 . B B . 118 TYR CB   1 1 
        1   3865 2 2 118 TYR CD1  C  -53.415  -1.663  -64.702 1.00 . B B . 118 TYR CD1  1 1 
        1   3866 2 2 118 TYR CD2  C  -54.993  -0.049  -65.512 1.00 . B B . 118 TYR CD2  1 1 
        1   3867 2 2 118 TYR CE1  C  -52.427  -1.136  -65.550 1.00 . B B . 118 TYR CE1  1 1 
        1   3868 2 2 118 TYR CE2  C  -54.026   0.490  -66.364 1.00 . B B . 118 TYR CE2  1 1 
        1   3869 2 2 118 TYR CG   C  -54.706  -1.138  -64.681 1.00 . B B . 118 TYR CG   1 1 
        1   3870 2 2 118 TYR CZ   C  -52.734  -0.057  -66.373 1.00 . B B . 118 TYR CZ   1 1 
        1   3871 2 2 118 TYR H    H  -57.263  -3.285  -62.315 1.00 . B B . 118 TYR H    1 1 
        1   3872 2 2 118 TYR HA   H  -57.097  -2.617  -65.137 1.00 . B B . 118 TYR HA   1 1 
        1   3873 2 2 118 TYR HB2  H  -56.460  -0.922  -63.526 1.00 . B B . 118 TYR HB2  1 1 
        1   3874 2 2 118 TYR HB3  H  -55.271  -1.993  -62.824 1.00 . B B . 118 TYR HB3  1 1 
        1   3875 2 2 118 TYR HD1  H  -53.174  -2.500  -64.064 1.00 . B B . 118 TYR HD1  1 1 
        1   3876 2 2 118 TYR HD2  H  -55.988   0.371  -65.509 1.00 . B B . 118 TYR HD2  1 1 
        1   3877 2 2 118 TYR HE1  H  -51.433  -1.558  -65.555 1.00 . B B . 118 TYR HE1  1 1 
        1   3878 2 2 118 TYR HE2  H  -54.266   1.331  -66.998 1.00 . B B . 118 TYR HE2  1 1 
        1   3879 2 2 118 TYR HH   H  -51.125   0.938  -66.638 1.00 . B B . 118 TYR HH   1 1 
        1   3880 2 2 118 TYR N    N  -57.457  -3.436  -63.264 1.00 . B B . 118 TYR N    1 1 
        1   3881 2 2 118 TYR O    O  -55.119  -3.974  -65.796 1.00 . B B . 118 TYR O    1 1 
        1   3882 2 2 118 TYR OH   O  -51.743   0.451  -67.189 1.00 . B B . 118 TYR OH   1 1 
        1   3883 2 2 119 ASN C    C  -54.503  -7.027  -63.124 1.00 . B B . 119 ASN C    1 1 
        1   3884 2 2 119 ASN CA   C  -54.271  -5.919  -64.094 1.00 . B B . 119 ASN CA   1 1 
        1   3885 2 2 119 ASN CB   C  -52.801  -5.502  -64.145 1.00 . B B . 119 ASN CB   1 1 
        1   3886 2 2 119 ASN CG   C  -51.849  -6.697  -64.131 1.00 . B B . 119 ASN CG   1 1 
        1   3887 2 2 119 ASN H    H  -55.496  -4.757  -62.825 1.00 . B B . 119 ASN H    1 1 
        1   3888 2 2 119 ASN HA   H  -54.559  -6.272  -65.076 1.00 . B B . 119 ASN HA   1 1 
        1   3889 2 2 119 ASN HB2  H  -52.631  -4.933  -65.047 1.00 . B B . 119 ASN HB2  1 1 
        1   3890 2 2 119 ASN HB3  H  -52.588  -4.874  -63.292 1.00 . B B . 119 ASN HB3  1 1 
        1   3891 2 2 119 ASN HD21 H  -50.342  -5.528  -63.513 1.00 . B B . 119 ASN HD21 1 1 
        1   3892 2 2 119 ASN HD22 H  -49.941  -7.163  -63.728 1.00 . B B . 119 ASN HD22 1 1 
        1   3893 2 2 119 ASN N    N  -55.150  -4.827  -63.739 1.00 . B B . 119 ASN N    1 1 
        1   3894 2 2 119 ASN ND2  N  -50.602  -6.440  -63.758 1.00 . B B . 119 ASN ND2  1 1 
        1   3895 2 2 119 ASN O    O  -53.993  -7.002  -62.007 1.00 . B B . 119 ASN O    1 1 
        1   3896 2 2 119 ASN OD1  O  -52.226  -7.833  -64.432 1.00 . B B . 119 ASN OD1  1 1 
        1   3897 2 2 120 LEU C    C  -56.905  -8.396  -61.800 1.00 . B B . 120 LEU C    1 1 
        1   3898 2 2 120 LEU CA   C  -55.900  -9.043  -62.777 1.00 . B B . 120 LEU CA   1 1 
        1   3899 2 2 120 LEU CB   C  -54.854  -9.951  -62.102 1.00 . B B . 120 LEU CB   1 1 
        1   3900 2 2 120 LEU CD1  C  -53.177 -11.857  -62.553 1.00 . B B . 120 LEU CD1  1 1 
        1   3901 2 2 120 LEU CD2  C  -53.970 -10.413  -64.444 1.00 . B B . 120 LEU CD2  1 1 
        1   3902 2 2 120 LEU CG   C  -53.665 -10.447  -62.954 1.00 . B B . 120 LEU CG   1 1 
        1   3903 2 2 120 LEU H    H  -55.601  -7.907  -64.515 1.00 . B B . 120 LEU H    1 1 
        1   3904 2 2 120 LEU HA   H  -56.480  -9.663  -63.451 1.00 . B B . 120 LEU HA   1 1 
        1   3905 2 2 120 LEU HB2  H  -54.445  -9.412  -61.264 1.00 . B B . 120 LEU HB2  1 1 
        1   3906 2 2 120 LEU HB3  H  -55.375 -10.816  -61.714 1.00 . B B . 120 LEU HB3  1 1 
        1   3907 2 2 120 LEU HD11 H  -53.977 -12.388  -62.059 1.00 . B B . 120 LEU HD11 1 1 
        1   3908 2 2 120 LEU HD12 H  -52.335 -11.770  -61.882 1.00 . B B . 120 LEU HD12 1 1 
        1   3909 2 2 120 LEU HD13 H  -52.876 -12.399  -63.438 1.00 . B B . 120 LEU HD13 1 1 
        1   3910 2 2 120 LEU HD21 H  -54.224 -11.407  -64.782 1.00 . B B . 120 LEU HD21 1 1 
        1   3911 2 2 120 LEU HD22 H  -53.102 -10.061  -64.981 1.00 . B B . 120 LEU HD22 1 1 
        1   3912 2 2 120 LEU HD23 H  -54.801  -9.748  -64.626 1.00 . B B . 120 LEU HD23 1 1 
        1   3913 2 2 120 LEU HG   H  -52.843  -9.766  -62.773 1.00 . B B . 120 LEU HG   1 1 
        1   3914 2 2 120 LEU N    N  -55.275  -8.003  -63.596 1.00 . B B . 120 LEU N    1 1 
        1   3915 2 2 120 LEU O    O  -57.229  -7.210  -61.936 1.00 . B B . 120 LEU O    1 1 
        1   3916 2 2 121 TYR C    C  -57.774  -8.618  -58.512 1.00 . B B . 121 TYR C    1 1 
        1   3917 2 2 121 TYR CA   C  -58.380  -8.630  -59.907 1.00 . B B . 121 TYR CA   1 1 
        1   3918 2 2 121 TYR CB   C  -59.565  -9.561  -59.876 1.00 . B B . 121 TYR CB   1 1 
        1   3919 2 2 121 TYR CD1  C  -61.298  -8.174  -60.990 1.00 . B B . 121 TYR CD1  1 1 
        1   3920 2 2 121 TYR CD2  C  -60.907 -10.356  -61.845 1.00 . B B . 121 TYR CD2  1 1 
        1   3921 2 2 121 TYR CE1  C  -62.304  -7.971  -61.962 1.00 . B B . 121 TYR CE1  1 1 
        1   3922 2 2 121 TYR CE2  C  -61.908 -10.177  -62.834 1.00 . B B . 121 TYR CE2  1 1 
        1   3923 2 2 121 TYR CG   C  -60.591  -9.351  -60.930 1.00 . B B . 121 TYR CG   1 1 
        1   3924 2 2 121 TYR CZ   C  -62.606  -8.971  -62.887 1.00 . B B . 121 TYR CZ   1 1 
        1   3925 2 2 121 TYR H    H  -57.156 -10.099  -60.786 1.00 . B B . 121 TYR H    1 1 
        1   3926 2 2 121 TYR HA   H  -58.694  -7.640  -60.196 1.00 . B B . 121 TYR HA   1 1 
        1   3927 2 2 121 TYR HB2  H  -59.200 -10.570  -59.970 1.00 . B B . 121 TYR HB2  1 1 
        1   3928 2 2 121 TYR HB3  H  -60.040  -9.466  -58.909 1.00 . B B . 121 TYR HB3  1 1 
        1   3929 2 2 121 TYR HD1  H  -61.079  -7.388  -60.282 1.00 . B B . 121 TYR HD1  1 1 
        1   3930 2 2 121 TYR HD2  H  -60.362 -11.288  -61.812 1.00 . B B . 121 TYR HD2  1 1 
        1   3931 2 2 121 TYR HE1  H  -62.838  -7.033  -61.994 1.00 . B B . 121 TYR HE1  1 1 
        1   3932 2 2 121 TYR HE2  H  -62.135 -10.970  -63.531 1.00 . B B . 121 TYR HE2  1 1 
        1   3933 2 2 121 TYR HH   H  -63.274  -8.088  -64.453 1.00 . B B . 121 TYR HH   1 1 
        1   3934 2 2 121 TYR N    N  -57.421  -9.157  -60.846 1.00 . B B . 121 TYR N    1 1 
        1   3935 2 2 121 TYR O    O  -57.528  -9.683  -57.960 1.00 . B B . 121 TYR O    1 1 
        1   3936 2 2 121 TYR OH   O  -63.608  -8.725  -63.817 1.00 . B B . 121 TYR OH   1 1 
        1   3937 2 2 122 THR C    C  -58.236  -6.621  -55.640 1.00 . B B . 122 THR C    1 1 
        1   3938 2 2 122 THR CA   C  -57.242  -7.449  -56.454 1.00 . B B . 122 THR CA   1 1 
        1   3939 2 2 122 THR CB   C  -55.772  -7.126  -56.061 1.00 . B B . 122 THR CB   1 1 
        1   3940 2 2 122 THR CG2  C  -54.771  -7.838  -56.947 1.00 . B B . 122 THR CG2  1 1 
        1   3941 2 2 122 THR H    H  -57.729  -6.612  -58.372 1.00 . B B . 122 THR H    1 1 
        1   3942 2 2 122 THR HA   H  -57.410  -8.472  -56.140 1.00 . B B . 122 THR HA   1 1 
        1   3943 2 2 122 THR HB   H  -55.611  -7.433  -55.038 1.00 . B B . 122 THR HB   1 1 
        1   3944 2 2 122 THR HG1  H  -55.257  -5.420  -55.298 1.00 . B B . 122 THR HG1  1 1 
        1   3945 2 2 122 THR HG21 H  -53.891  -7.224  -57.062 1.00 . B B . 122 THR HG21 1 1 
        1   3946 2 2 122 THR HG22 H  -55.213  -8.019  -57.916 1.00 . B B . 122 THR HG22 1 1 
        1   3947 2 2 122 THR HG23 H  -54.496  -8.780  -56.495 1.00 . B B . 122 THR HG23 1 1 
        1   3948 2 2 122 THR N    N  -57.523  -7.452  -57.912 1.00 . B B . 122 THR N    1 1 
        1   3949 2 2 122 THR O    O  -58.892  -5.709  -56.168 1.00 . B B . 122 THR O    1 1 
        1   3950 2 2 122 THR OG1  O  -55.545  -5.734  -56.158 1.00 . B B . 122 THR OG1  1 1 
        1   3951 2 2 123 PHE C    C  -58.558  -5.592  -52.304 1.00 . B B . 123 PHE C    1 1 
        1   3952 2 2 123 PHE CA   C  -59.300  -6.362  -53.412 1.00 . B B . 123 PHE CA   1 1 
        1   3953 2 2 123 PHE CB   C  -60.252  -7.416  -52.786 1.00 . B B . 123 PHE CB   1 1 
        1   3954 2 2 123 PHE CD1  C  -60.930  -9.048  -54.632 1.00 . B B . 123 PHE CD1  1 1 
        1   3955 2 2 123 PHE CD2  C  -62.601  -7.548  -53.774 1.00 . B B . 123 PHE CD2  1 1 
        1   3956 2 2 123 PHE CE1  C  -61.872  -9.598  -55.522 1.00 . B B . 123 PHE CE1  1 1 
        1   3957 2 2 123 PHE CE2  C  -63.560  -8.088  -54.668 1.00 . B B . 123 PHE CE2  1 1 
        1   3958 2 2 123 PHE CG   C  -61.279  -8.010  -53.758 1.00 . B B . 123 PHE CG   1 1 
        1   3959 2 2 123 PHE CZ   C  -63.193  -9.126  -55.532 1.00 . B B . 123 PHE CZ   1 1 
        1   3960 2 2 123 PHE H    H  -57.799  -7.723  -54.039 1.00 . B B . 123 PHE H    1 1 
        1   3961 2 2 123 PHE HA   H  -59.902  -5.652  -53.962 1.00 . B B . 123 PHE HA   1 1 
        1   3962 2 2 123 PHE HB2  H  -59.656  -8.223  -52.391 1.00 . B B . 123 PHE HB2  1 1 
        1   3963 2 2 123 PHE HB3  H  -60.781  -6.951  -51.966 1.00 . B B . 123 PHE HB3  1 1 
        1   3964 2 2 123 PHE HD1  H  -59.917  -9.420  -54.636 1.00 . B B . 123 PHE HD1  1 1 
        1   3965 2 2 123 PHE HD2  H  -62.890  -6.747  -53.109 1.00 . B B . 123 PHE HD2  1 1 
        1   3966 2 2 123 PHE HE1  H  -61.581 -10.398  -56.187 1.00 . B B . 123 PHE HE1  1 1 
        1   3967 2 2 123 PHE HE2  H  -64.574  -7.716  -54.667 1.00 . B B . 123 PHE HE2  1 1 
        1   3968 2 2 123 PHE HZ   H  -63.916  -9.547  -56.214 1.00 . B B . 123 PHE HZ   1 1 
        1   3969 2 2 123 PHE N    N  -58.348  -6.976  -54.359 1.00 . B B . 123 PHE N    1 1 
        1   3970 2 2 123 PHE O    O  -57.375  -5.839  -52.015 1.00 . B B . 123 PHE O    1 1 
        1   3971 2 2 124 GLY C    C  -59.011  -4.920  -49.378 1.00 . B B . 124 GLY C    1 1 
        1   3972 2 2 124 GLY CA   C  -58.739  -3.982  -50.519 1.00 . B B . 124 GLY CA   1 1 
        1   3973 2 2 124 GLY H    H  -60.176  -4.466  -51.981 1.00 . B B . 124 GLY H    1 1 
        1   3974 2 2 124 GLY HA2  H  -57.675  -3.811  -50.622 1.00 . B B . 124 GLY HA2  1 1 
        1   3975 2 2 124 GLY HA3  H  -59.254  -3.049  -50.354 1.00 . B B . 124 GLY HA3  1 1 
        1   3976 2 2 124 GLY N    N  -59.252  -4.637  -51.702 1.00 . B B . 124 GLY N    1 1 
        1   3977 2 2 124 GLY O    O  -59.568  -5.992  -49.567 1.00 . B B . 124 GLY O    1 1 
        1   3978 2 2 125 GLY C    C  -60.256  -5.227  -46.495 1.00 . B B . 125 GLY C    1 1 
        1   3979 2 2 125 GLY CA   C  -58.832  -5.327  -47.004 1.00 . B B . 125 GLY CA   1 1 
        1   3980 2 2 125 GLY H    H  -58.178  -3.642  -48.096 1.00 . B B . 125 GLY H    1 1 
        1   3981 2 2 125 GLY HA2  H  -58.616  -6.358  -47.244 1.00 . B B . 125 GLY HA2  1 1 
        1   3982 2 2 125 GLY HA3  H  -58.159  -4.999  -46.226 1.00 . B B . 125 GLY HA3  1 1 
        1   3983 2 2 125 GLY N    N  -58.618  -4.513  -48.186 1.00 . B B . 125 GLY N    1 1 
        1   3984 2 2 125 GLY O    O  -60.805  -6.198  -45.970 1.00 . B B . 125 GLY O    1 1 
        1   3985 2 2 126 GLY C    C  -62.277  -2.755  -45.198 1.00 . B B . 126 GLY C    1 1 
        1   3986 2 2 126 GLY CA   C  -62.222  -3.861  -46.218 1.00 . B B . 126 GLY CA   1 1 
        1   3987 2 2 126 GLY H    H  -60.372  -3.318  -47.072 1.00 . B B . 126 GLY H    1 1 
        1   3988 2 2 126 GLY HA2  H  -62.832  -3.598  -47.070 1.00 . B B . 126 GLY HA2  1 1 
        1   3989 2 2 126 GLY HA3  H  -62.595  -4.771  -45.775 1.00 . B B . 126 GLY HA3  1 1 
        1   3990 2 2 126 GLY N    N  -60.856  -4.057  -46.647 1.00 . B B . 126 GLY N    1 1 
        1   3991 2 2 126 GLY O    O  -61.282  -2.463  -44.550 1.00 . B B . 126 GLY O    1 1 
        1   3992 2 2 127 THR C    C  -65.084  -1.378  -43.603 1.00 . B B . 127 THR C    1 1 
        1   3993 2 2 127 THR CA   C  -63.713  -1.047  -44.154 1.00 . B B . 127 THR CA   1 1 
        1   3994 2 2 127 THR CB   C  -63.765   0.325  -44.885 1.00 . B B . 127 THR CB   1 1 
        1   3995 2 2 127 THR CG2  C  -64.568   1.345  -44.104 1.00 . B B . 127 THR CG2  1 1 
        1   3996 2 2 127 THR H    H  -64.181  -2.432  -45.660 1.00 . B B . 127 THR H    1 1 
        1   3997 2 2 127 THR HA   H  -62.977  -1.034  -43.362 1.00 . B B . 127 THR HA   1 1 
        1   3998 2 2 127 THR HB   H  -64.227   0.186  -45.851 1.00 . B B . 127 THR HB   1 1 
        1   3999 2 2 127 THR HG1  H  -62.025   0.911  -44.214 1.00 . B B . 127 THR HG1  1 1 
        1   4000 2 2 127 THR HG21 H  -65.439   1.630  -44.674 1.00 . B B . 127 THR HG21 1 1 
        1   4001 2 2 127 THR HG22 H  -63.958   2.216  -43.917 1.00 . B B . 127 THR HG22 1 1 
        1   4002 2 2 127 THR HG23 H  -64.878   0.914  -43.163 1.00 . B B . 127 THR HG23 1 1 
        1   4003 2 2 127 THR N    N  -63.447  -2.134  -45.084 1.00 . B B . 127 THR N    1 1 
        1   4004 2 2 127 THR O    O  -66.065  -1.392  -44.357 1.00 . B B . 127 THR O    1 1 
        1   4005 2 2 127 THR OG1  O  -62.441   0.835  -45.076 1.00 . B B . 127 THR OG1  1 1 
        1   4006 2 2 128 LYS C    C  -67.168  -0.707  -41.220 1.00 . B B . 128 LYS C    1 1 
        1   4007 2 2 128 LYS CA   C  -66.419  -1.972  -41.646 1.00 . B B . 128 LYS CA   1 1 
        1   4008 2 2 128 LYS CB   C  -66.159  -2.856  -40.425 1.00 . B B . 128 LYS CB   1 1 
        1   4009 2 2 128 LYS CD   C  -67.129  -4.211  -38.472 1.00 . B B . 128 LYS CD   1 1 
        1   4010 2 2 128 LYS CE   C  -65.881  -5.117  -38.498 1.00 . B B . 128 LYS CE   1 1 
        1   4011 2 2 128 LYS CG   C  -67.418  -3.503  -39.816 1.00 . B B . 128 LYS CG   1 1 
        1   4012 2 2 128 LYS H    H  -64.333  -1.631  -41.768 1.00 . B B . 128 LYS H    1 1 
        1   4013 2 2 128 LYS HA   H  -67.038  -2.521  -42.340 1.00 . B B . 128 LYS HA   1 1 
        1   4014 2 2 128 LYS HB2  H  -65.480  -3.643  -40.712 1.00 . B B . 128 LYS HB2  1 1 
        1   4015 2 2 128 LYS HB3  H  -65.679  -2.253  -39.667 1.00 . B B . 128 LYS HB3  1 1 
        1   4016 2 2 128 LYS HD2  H  -66.988  -3.460  -37.711 1.00 . B B . 128 LYS HD2  1 1 
        1   4017 2 2 128 LYS HD3  H  -67.989  -4.811  -38.208 1.00 . B B . 128 LYS HD3  1 1 
        1   4018 2 2 128 LYS HE2  H  -65.011  -4.497  -38.642 1.00 . B B . 128 LYS HE2  1 1 
        1   4019 2 2 128 LYS HE3  H  -65.796  -5.607  -37.537 1.00 . B B . 128 LYS HE3  1 1 
        1   4020 2 2 128 LYS HG2  H  -68.161  -2.737  -39.652 1.00 . B B . 128 LYS HG2  1 1 
        1   4021 2 2 128 LYS HG3  H  -67.811  -4.226  -40.516 1.00 . B B . 128 LYS HG3  1 1 
        1   4022 2 2 128 LYS HZ1  H  -66.313  -5.768  -40.445 1.00 . B B . 128 LYS HZ1  1 1 
        1   4023 2 2 128 LYS HZ2  H  -66.467  -6.980  -39.265 1.00 . B B . 128 LYS HZ2  1 1 
        1   4024 2 2 128 LYS HZ3  H  -64.926  -6.480  -39.775 1.00 . B B . 128 LYS HZ3  1 1 
        1   4025 2 2 128 LYS N    N  -65.153  -1.654  -42.303 1.00 . B B . 128 LYS N    1 1 
        1   4026 2 2 128 LYS NZ   N  -65.898  -6.168  -39.580 1.00 . B B . 128 LYS NZ   1 1 
        1   4027 2 2 128 LYS O    O  -66.720  -0.004  -40.329 1.00 . B B . 128 LYS O    1 1 
        1   4028 2 2 129 LEU C    C  -70.231   0.259  -40.510 1.00 . B B . 129 LEU C    1 1 
        1   4029 2 2 129 LEU CA   C  -69.153   0.705  -41.485 1.00 . B B . 129 LEU CA   1 1 
        1   4030 2 2 129 LEU CB   C  -69.832   1.313  -42.710 1.00 . B B . 129 LEU CB   1 1 
        1   4031 2 2 129 LEU CD1  C  -70.322   3.633  -41.847 1.00 . B B . 129 LEU CD1  1 1 
        1   4032 2 2 129 LEU CD2  C  -71.572   2.749  -43.781 1.00 . B B . 129 LEU CD2  1 1 
        1   4033 2 2 129 LEU CG   C  -70.900   2.389  -42.483 1.00 . B B . 129 LEU CG   1 1 
        1   4034 2 2 129 LEU H    H  -68.601  -1.025  -42.574 1.00 . B B . 129 LEU H    1 1 
        1   4035 2 2 129 LEU HA   H  -68.546   1.462  -41.013 1.00 . B B . 129 LEU HA   1 1 
        1   4036 2 2 129 LEU HB2  H  -69.065   1.747  -43.329 1.00 . B B . 129 LEU HB2  1 1 
        1   4037 2 2 129 LEU HB3  H  -70.284   0.502  -43.268 1.00 . B B . 129 LEU HB3  1 1 
        1   4038 2 2 129 LEU HD11 H  -69.547   4.035  -42.482 1.00 . B B . 129 LEU HD11 1 1 
        1   4039 2 2 129 LEU HD12 H  -69.904   3.384  -40.882 1.00 . B B . 129 LEU HD12 1 1 
        1   4040 2 2 129 LEU HD13 H  -71.102   4.369  -41.722 1.00 . B B . 129 LEU HD13 1 1 
        1   4041 2 2 129 LEU HD21 H  -71.045   3.571  -44.242 1.00 . B B . 129 LEU HD21 1 1 
        1   4042 2 2 129 LEU HD22 H  -72.595   3.038  -43.589 1.00 . B B . 129 LEU HD22 1 1 
        1   4043 2 2 129 LEU HD23 H  -71.556   1.896  -44.443 1.00 . B B . 129 LEU HD23 1 1 
        1   4044 2 2 129 LEU HG   H  -71.647   1.985  -41.813 1.00 . B B . 129 LEU HG   1 1 
        1   4045 2 2 129 LEU N    N  -68.299  -0.422  -41.863 1.00 . B B . 129 LEU N    1 1 
        1   4046 2 2 129 LEU O    O  -71.363  -0.071  -40.923 1.00 . B B . 129 LEU O    1 1 
        1   4047 2 2 130 GLU C    C  -71.613   1.064  -37.626 1.00 . B B . 130 GLU C    1 1 
        1   4048 2 2 130 GLU CA   C  -70.848  -0.136  -38.170 1.00 . B B . 130 GLU CA   1 1 
        1   4049 2 2 130 GLU CB   C  -70.199  -0.959  -37.046 1.00 . B B . 130 GLU CB   1 1 
        1   4050 2 2 130 GLU CD   C  -68.136  -1.517  -35.731 1.00 . B B . 130 GLU CD   1 1 
        1   4051 2 2 130 GLU CG   C  -68.876  -0.451  -36.529 1.00 . B B . 130 GLU CG   1 1 
        1   4052 2 2 130 GLU H    H  -68.977   0.511  -38.963 1.00 . B B . 130 GLU H    1 1 
        1   4053 2 2 130 GLU HA   H  -71.581  -0.774  -38.646 1.00 . B B . 130 GLU HA   1 1 
        1   4054 2 2 130 GLU HB2  H  -70.886  -0.995  -36.216 1.00 . B B . 130 GLU HB2  1 1 
        1   4055 2 2 130 GLU HB3  H  -70.061  -1.969  -37.410 1.00 . B B . 130 GLU HB3  1 1 
        1   4056 2 2 130 GLU HG2  H  -68.263  -0.149  -37.366 1.00 . B B . 130 GLU HG2  1 1 
        1   4057 2 2 130 GLU HG3  H  -69.051   0.406  -35.895 1.00 . B B . 130 GLU HG3  1 1 
        1   4058 2 2 130 GLU N    N  -69.884   0.242  -39.219 1.00 . B B . 130 GLU N    1 1 
        1   4059 2 2 130 GLU O    O  -71.029   2.130  -37.419 1.00 . B B . 130 GLU O    1 1 
        1   4060 2 2 130 GLU OE1  O  -68.606  -2.681  -35.707 1.00 . B B . 130 GLU OE1  1 1 
        1   4061 2 2 130 GLU OE2  O  -67.085  -1.192  -35.126 1.00 . B B . 130 GLU OE2  1 1 
        1   4062 2 2 131 ILE C    C  -73.710   2.342  -35.511 1.00 . B B . 131 ILE C    1 1 
        1   4063 2 2 131 ILE CA   C  -73.789   1.994  -37.004 1.00 . B B . 131 ILE CA   1 1 
        1   4064 2 2 131 ILE CB   C  -75.262   1.773  -37.436 1.00 . B B . 131 ILE CB   1 1 
        1   4065 2 2 131 ILE CD1  C  -76.685   1.109  -39.489 1.00 . B B . 131 ILE CD1  1 1 
        1   4066 2 2 131 ILE CG1  C  -75.344   1.648  -38.960 1.00 . B B . 131 ILE CG1  1 1 
        1   4067 2 2 131 ILE CG2  C  -76.153   2.930  -36.980 1.00 . B B . 131 ILE CG2  1 1 
        1   4068 2 2 131 ILE H    H  -73.317   0.014  -37.604 1.00 . B B . 131 ILE H    1 1 
        1   4069 2 2 131 ILE HA   H  -73.438   2.866  -37.537 1.00 . B B . 131 ILE HA   1 1 
        1   4070 2 2 131 ILE HB   H  -75.623   0.858  -36.988 1.00 . B B . 131 ILE HB   1 1 
        1   4071 2 2 131 ILE HD11 H  -76.532   0.645  -40.452 1.00 . B B . 131 ILE HD11 1 1 
        1   4072 2 2 131 ILE HD12 H  -77.386   1.925  -39.590 1.00 . B B . 131 ILE HD12 1 1 
        1   4073 2 2 131 ILE HD13 H  -77.079   0.380  -38.796 1.00 . B B . 131 ILE HD13 1 1 
        1   4074 2 2 131 ILE HG12 H  -75.166   2.616  -39.399 1.00 . B B . 131 ILE HG12 1 1 
        1   4075 2 2 131 ILE HG13 H  -74.558   0.979  -39.281 1.00 . B B . 131 ILE HG13 1 1 
        1   4076 2 2 131 ILE HG21 H  -76.640   3.368  -37.839 1.00 . B B . 131 ILE HG21 1 1 
        1   4077 2 2 131 ILE HG22 H  -75.549   3.677  -36.488 1.00 . B B . 131 ILE HG22 1 1 
        1   4078 2 2 131 ILE HG23 H  -76.900   2.560  -36.293 1.00 . B B . 131 ILE HG23 1 1 
        1   4079 2 2 131 ILE N    N  -72.917   0.887  -37.409 1.00 . B B . 131 ILE N    1 1 
        1   4080 2 2 131 ILE O    O  -73.414   1.490  -34.661 1.00 . B B . 131 ILE O    1 1 
        1   4081 2 2 132 LYS C    C  -75.668   3.966  -33.619 1.00 . B B . 132 LYS C    1 1 
        1   4082 2 2 132 LYS CA   C  -74.183   4.145  -33.902 1.00 . B B . 132 LYS CA   1 1 
        1   4083 2 2 132 LYS CB   C  -73.820   5.628  -33.844 1.00 . B B . 132 LYS CB   1 1 
        1   4084 2 2 132 LYS CD   C  -71.906   7.260  -33.778 1.00 . B B . 132 LYS CD   1 1 
        1   4085 2 2 132 LYS CE   C  -71.113   7.093  -32.474 1.00 . B B . 132 LYS CE   1 1 
        1   4086 2 2 132 LYS CG   C  -72.406   5.920  -34.299 1.00 . B B . 132 LYS CG   1 1 
        1   4087 2 2 132 LYS H    H  -74.115   4.225  -35.992 1.00 . B B . 132 LYS H    1 1 
        1   4088 2 2 132 LYS HA   H  -73.601   3.593  -33.178 1.00 . B B . 132 LYS HA   1 1 
        1   4089 2 2 132 LYS HB2  H  -74.503   6.177  -34.472 1.00 . B B . 132 LYS HB2  1 1 
        1   4090 2 2 132 LYS HB3  H  -73.937   5.971  -32.825 1.00 . B B . 132 LYS HB3  1 1 
        1   4091 2 2 132 LYS HD2  H  -71.268   7.712  -34.523 1.00 . B B . 132 LYS HD2  1 1 
        1   4092 2 2 132 LYS HD3  H  -72.752   7.906  -33.597 1.00 . B B . 132 LYS HD3  1 1 
        1   4093 2 2 132 LYS HE2  H  -71.780   6.759  -31.695 1.00 . B B . 132 LYS HE2  1 1 
        1   4094 2 2 132 LYS HE3  H  -70.343   6.349  -32.622 1.00 . B B . 132 LYS HE3  1 1 
        1   4095 2 2 132 LYS HG2  H  -71.753   5.139  -33.939 1.00 . B B . 132 LYS HG2  1 1 
        1   4096 2 2 132 LYS HG3  H  -72.380   5.930  -35.379 1.00 . B B . 132 LYS HG3  1 1 
        1   4097 2 2 132 LYS HZ1  H  -69.547   8.181  -31.637 1.00 . B B . 132 LYS HZ1  1 1 
        1   4098 2 2 132 LYS HZ2  H  -71.085   8.843  -31.346 1.00 . B B . 132 LYS HZ2  1 1 
        1   4099 2 2 132 LYS HZ3  H  -70.368   8.995  -32.878 1.00 . B B . 132 LYS HZ3  1 1 
        1   4100 2 2 132 LYS N    N  -73.933   3.628  -35.236 1.00 . B B . 132 LYS N    1 1 
        1   4101 2 2 132 LYS NZ   N  -70.481   8.375  -32.052 1.00 . B B . 132 LYS NZ   1 1 
        1   4102 2 2 132 LYS O    O  -76.096   3.864  -32.473 1.00 . B B . 132 LYS O    1 1 
        1   4103 2 2 134 ALA C    C  -79.243   4.067  -28.114 1.00 . B B . 134 ALA C    1 1 
        1   4104 2 2 134 ALA CA   C  -78.991   5.430  -28.748 1.00 . B B . 134 ALA CA   1 1 
        1   4105 2 2 134 ALA CB   C  -80.205   6.344  -28.556 1.00 . B B . 134 ALA CB   1 1 
        1   4106 2 2 134 ALA H    H  -78.932   4.375  -30.520 1.00 . B B . 134 ALA H    1 1 
        1   4107 2 2 134 ALA HA   H  -78.152   5.881  -28.237 1.00 . B B . 134 ALA HA   1 1 
        1   4108 2 2 134 ALA HB1  H  -80.549   6.693  -29.519 1.00 . B B . 134 ALA HB1  1 1 
        1   4109 2 2 134 ALA HB2  H  -79.926   7.190  -27.945 1.00 . B B . 134 ALA HB2  1 1 
        1   4110 2 2 134 ALA HB3  H  -80.996   5.794  -28.069 1.00 . B B . 134 ALA HB3  1 1 
        1   4111 2 2 134 ALA N    N  -78.637   5.307  -30.168 1.00 . B B . 134 ALA N    1 1 
        1   4112 2 2 134 ALA O    O  -79.787   3.169  -28.761 1.00 . B B . 134 ALA O    1 1 
        1   4113 2 2 135 ASP C    C  -80.253   1.962  -26.119 1.00 . B B . 135 ASP C    1 1 
        1   4114 2 2 135 ASP CA   C  -78.865   2.646  -26.138 1.00 . B B . 135 ASP CA   1 1 
        1   4115 2 2 135 ASP CB   C  -78.320   2.832  -24.707 1.00 . B B . 135 ASP CB   1 1 
        1   4116 2 2 135 ASP CG   C  -77.165   3.845  -24.628 1.00 . B B . 135 ASP CG   1 1 
        1   4117 2 2 135 ASP H    H  -78.437   4.697  -26.406 1.00 . B B . 135 ASP H    1 1 
        1   4118 2 2 135 ASP HA   H  -78.188   1.984  -26.657 1.00 . B B . 135 ASP HA   1 1 
        1   4119 2 2 135 ASP HB2  H  -79.123   3.175  -24.072 1.00 . B B . 135 ASP HB2  1 1 
        1   4120 2 2 135 ASP HB3  H  -77.973   1.876  -24.342 1.00 . B B . 135 ASP HB3  1 1 
        1   4121 2 2 135 ASP N    N  -78.852   3.928  -26.848 1.00 . B B . 135 ASP N    1 1 
        1   4122 2 2 135 ASP O    O  -81.276   2.594  -26.428 1.00 . B B . 135 ASP O    1 1 
        1   4123 2 2 135 ASP OD1  O  -77.353   5.015  -25.027 1.00 . B B . 135 ASP OD1  1 1 
        1   4124 2 2 135 ASP OD2  O  -76.066   3.473  -24.154 1.00 . B B . 135 ASP OD2  1 1 
        1   4125 2 2 136 ALA C    C  -81.291  -1.235  -24.519 1.00 . B B . 136 ALA C    1 1 
        1   4126 2 2 136 ALA CA   C  -81.523  -0.061  -25.496 1.00 . B B . 136 ALA CA   1 1 
        1   4127 2 2 136 ALA CB   C  -82.220  -0.525  -26.776 1.00 . B B . 136 ALA CB   1 1 
        1   4128 2 2 136 ALA H    H  -79.425   0.225  -25.590 1.00 . B B . 136 ALA H    1 1 
        1   4129 2 2 136 ALA HA   H  -82.185   0.636  -25.001 1.00 . B B . 136 ALA HA   1 1 
        1   4130 2 2 136 ALA HB1  H  -82.906   0.239  -27.110 1.00 . B B . 136 ALA HB1  1 1 
        1   4131 2 2 136 ALA HB2  H  -82.765  -1.436  -26.579 1.00 . B B . 136 ALA HB2  1 1 
        1   4132 2 2 136 ALA HB3  H  -81.482  -0.706  -27.543 1.00 . B B . 136 ALA HB3  1 1 
        1   4133 2 2 136 ALA N    N  -80.276   0.666  -25.792 1.00 . B B . 136 ALA N    1 1 
        1   4134 2 2 136 ALA O    O  -80.157  -1.716  -24.354 1.00 . B B . 136 ALA O    1 1 
        1   4135 2 2 137 ALA C    C  -82.307  -4.162  -23.362 1.00 . B B . 137 ALA C    1 1 
        1   4136 2 2 137 ALA CA   C  -82.321  -2.720  -22.834 1.00 . B B . 137 ALA CA   1 1 
        1   4137 2 2 137 ALA CB   C  -83.484  -2.541  -21.888 1.00 . B B . 137 ALA CB   1 1 
        1   4138 2 2 137 ALA H    H  -83.232  -1.245  -24.052 1.00 . B B . 137 ALA H    1 1 
        1   4139 2 2 137 ALA HA   H  -81.415  -2.571  -22.267 1.00 . B B . 137 ALA HA   1 1 
        1   4140 2 2 137 ALA HB1  H  -83.150  -2.023  -21.001 1.00 . B B . 137 ALA HB1  1 1 
        1   4141 2 2 137 ALA HB2  H  -83.877  -3.509  -21.613 1.00 . B B . 137 ALA HB2  1 1 
        1   4142 2 2 137 ALA HB3  H  -84.256  -1.963  -22.372 1.00 . B B . 137 ALA HB3  1 1 
        1   4143 2 2 137 ALA N    N  -82.373  -1.679  -23.872 1.00 . B B . 137 ALA N    1 1 
        1   4144 2 2 137 ALA O    O  -83.229  -4.574  -24.064 1.00 . B B . 137 ALA O    1 1 
        1   4145 2 2 138 PRO C    C  -82.356  -7.172  -22.911 1.00 . B B . 138 PRO C    1 1 
        1   4146 2 2 138 PRO CA   C  -81.161  -6.366  -23.392 1.00 . B B . 138 PRO CA   1 1 
        1   4147 2 2 138 PRO CB   C  -79.897  -6.844  -22.661 1.00 . B B . 138 PRO CB   1 1 
        1   4148 2 2 138 PRO CD   C  -80.163  -4.527  -22.129 1.00 . B B . 138 PRO CD   1 1 
        1   4149 2 2 138 PRO CG   C  -79.671  -5.842  -21.578 1.00 . B B . 138 PRO CG   1 1 
        1   4150 2 2 138 PRO HA   H  -81.029  -6.466  -24.456 1.00 . B B . 138 PRO HA   1 1 
        1   4151 2 2 138 PRO HB2  H  -80.059  -7.827  -22.239 1.00 . B B . 138 PRO HB2  1 1 
        1   4152 2 2 138 PRO HB3  H  -79.055  -6.857  -23.334 1.00 . B B . 138 PRO HB3  1 1 
        1   4153 2 2 138 PRO HD2  H  -80.516  -3.887  -21.331 1.00 . B B . 138 PRO HD2  1 1 
        1   4154 2 2 138 PRO HD3  H  -79.394  -4.039  -22.707 1.00 . B B . 138 PRO HD3  1 1 
        1   4155 2 2 138 PRO HG2  H  -80.233  -6.115  -20.695 1.00 . B B . 138 PRO HG2  1 1 
        1   4156 2 2 138 PRO HG3  H  -78.619  -5.771  -21.347 1.00 . B B . 138 PRO HG3  1 1 
        1   4157 2 2 138 PRO N    N  -81.273  -4.943  -23.003 1.00 . B B . 138 PRO N    1 1 
        1   4158 2 2 138 PRO O    O  -82.853  -6.905  -21.809 1.00 . B B . 138 PRO O    1 1 
        1   4159 2 2 139 THR C    C  -83.844 -10.356  -23.129 1.00 . B B . 139 THR C    1 1 
        1   4160 2 2 139 THR CA   C  -84.055  -8.854  -23.433 1.00 . B B . 139 THR CA   1 1 
        1   4161 2 2 139 THR CB   C  -85.080  -8.639  -24.597 1.00 . B B . 139 THR CB   1 1 
        1   4162 2 2 139 THR CG2  C  -86.492  -8.984  -24.160 1.00 . B B . 139 THR CG2  1 1 
        1   4163 2 2 139 THR H    H  -82.344  -8.302  -24.565 1.00 . B B . 139 THR H    1 1 
        1   4164 2 2 139 THR HA   H  -84.480  -8.409  -22.545 1.00 . B B . 139 THR HA   1 1 
        1   4165 2 2 139 THR HB   H  -84.805  -9.281  -25.421 1.00 . B B . 139 THR HB   1 1 
        1   4166 2 2 139 THR HG1  H  -84.473  -6.784  -24.447 1.00 . B B . 139 THR HG1  1 1 
        1   4167 2 2 139 THR HG21 H  -86.577 -10.052  -24.029 1.00 . B B . 139 THR HG21 1 1 
        1   4168 2 2 139 THR HG22 H  -87.192  -8.656  -24.915 1.00 . B B . 139 THR HG22 1 1 
        1   4169 2 2 139 THR HG23 H  -86.711  -8.488  -23.226 1.00 . B B . 139 THR HG23 1 1 
        1   4170 2 2 139 THR N    N  -82.800  -8.144  -23.712 1.00 . B B . 139 THR N    1 1 
        1   4171 2 2 139 THR O    O  -84.121 -11.199  -23.979 1.00 . B B . 139 THR O    1 1 
        1   4172 2 2 139 THR OG1  O  -85.041  -7.276  -25.044 1.00 . B B . 139 THR OG1  1 1 
        1   4173 2 2 140 VAL C    C  -84.163 -13.073  -21.507 1.00 . B B . 140 VAL C    1 1 
        1   4174 2 2 140 VAL CA   C  -82.984 -12.093  -21.607 1.00 . B B . 140 VAL CA   1 1 
        1   4175 2 2 140 VAL CB   C  -82.007 -12.218  -20.377 1.00 . B B . 140 VAL CB   1 1 
        1   4176 2 2 140 VAL CG1  C  -82.655 -11.738  -19.102 1.00 . B B . 140 VAL CG1  1 1 
        1   4177 2 2 140 VAL CG2  C  -81.470 -13.655  -20.216 1.00 . B B . 140 VAL CG2  1 1 
        1   4178 2 2 140 VAL H    H  -83.176  -9.985  -21.273 1.00 . B B . 140 VAL H    1 1 
        1   4179 2 2 140 VAL HA   H  -82.416 -12.426  -22.466 1.00 . B B . 140 VAL HA   1 1 
        1   4180 2 2 140 VAL HB   H  -81.163 -11.569  -20.571 1.00 . B B . 140 VAL HB   1 1 
        1   4181 2 2 140 VAL HG11 H  -83.689 -11.495  -19.294 1.00 . B B . 140 VAL HG11 1 1 
        1   4182 2 2 140 VAL HG12 H  -82.138 -10.860  -18.745 1.00 . B B . 140 VAL HG12 1 1 
        1   4183 2 2 140 VAL HG13 H  -82.601 -12.516  -18.356 1.00 . B B . 140 VAL HG13 1 1 
        1   4184 2 2 140 VAL HG21 H  -82.267 -14.360  -20.402 1.00 . B B . 140 VAL HG21 1 1 
        1   4185 2 2 140 VAL HG22 H  -81.097 -13.790  -19.211 1.00 . B B . 140 VAL HG22 1 1 
        1   4186 2 2 140 VAL HG23 H  -80.670 -13.822  -20.922 1.00 . B B . 140 VAL HG23 1 1 
        1   4187 2 2 140 VAL N    N  -83.371 -10.692  -21.923 1.00 . B B . 140 VAL N    1 1 
        1   4188 2 2 140 VAL O    O  -85.320 -12.655  -21.366 1.00 . B B . 140 VAL O    1 1 
        1   4189 2 2 141 SER C    C  -84.048 -16.795  -21.485 1.00 . B B . 141 SER C    1 1 
        1   4190 2 2 141 SER CA   C  -84.813 -15.475  -21.618 1.00 . B B . 141 SER CA   1 1 
        1   4191 2 2 141 SER CB   C  -85.678 -15.464  -22.896 1.00 . B B . 141 SER CB   1 1 
        1   4192 2 2 141 SER H    H  -82.900 -14.593  -21.746 1.00 . B B . 141 SER H    1 1 
        1   4193 2 2 141 SER HA   H  -85.460 -15.366  -20.758 1.00 . B B . 141 SER HA   1 1 
        1   4194 2 2 141 SER HB2  H  -86.088 -16.446  -23.052 1.00 . B B . 141 SER HB2  1 1 
        1   4195 2 2 141 SER HB3  H  -86.495 -14.766  -22.756 1.00 . B B . 141 SER HB3  1 1 
        1   4196 2 2 141 SER HG   H  -84.092 -14.740  -23.754 1.00 . B B . 141 SER HG   1 1 
        1   4197 2 2 141 SER N    N  -83.845 -14.369  -21.615 1.00 . B B . 141 SER N    1 1 
        1   4198 2 2 141 SER O    O  -83.272 -17.142  -22.369 1.00 . B B . 141 SER O    1 1 
        1   4199 2 2 141 SER OG   O  -84.932 -15.100  -24.047 1.00 . B B . 141 SER OG   1 1 
        1   4200 2 2 142 ILE C    C  -84.139 -20.037  -20.679 1.00 . B B . 142 ILE C    1 1 
        1   4201 2 2 142 ILE CA   C  -83.499 -18.763  -20.118 1.00 . B B . 142 ILE CA   1 1 
        1   4202 2 2 142 ILE CB   C  -83.135 -18.945  -18.609 1.00 . B B . 142 ILE CB   1 1 
        1   4203 2 2 142 ILE CD1  C  -81.343 -20.149  -17.194 1.00 . B B . 142 ILE CD1  1 1 
        1   4204 2 2 142 ILE CG1  C  -82.278 -20.207  -18.401 1.00 . B B . 142 ILE CG1  1 1 
        1   4205 2 2 142 ILE CG2  C  -84.391 -18.976  -17.734 1.00 . B B . 142 ILE CG2  1 1 
        1   4206 2 2 142 ILE H    H  -84.882 -17.191  -19.708 1.00 . B B . 142 ILE H    1 1 
        1   4207 2 2 142 ILE HA   H  -82.560 -18.651  -20.642 1.00 . B B . 142 ILE HA   1 1 
        1   4208 2 2 142 ILE HB   H  -82.549 -18.086  -18.308 1.00 . B B . 142 ILE HB   1 1 
        1   4209 2 2 142 ILE HD11 H  -80.331 -20.356  -17.511 1.00 . B B . 142 ILE HD11 1 1 
        1   4210 2 2 142 ILE HD12 H  -81.649 -20.885  -16.465 1.00 . B B . 142 ILE HD12 1 1 
        1   4211 2 2 142 ILE HD13 H  -81.386 -19.165  -16.751 1.00 . B B . 142 ILE HD13 1 1 
        1   4212 2 2 142 ILE HG12 H  -82.940 -21.049  -18.273 1.00 . B B . 142 ILE HG12 1 1 
        1   4213 2 2 142 ILE HG13 H  -81.687 -20.370  -19.292 1.00 . B B . 142 ILE HG13 1 1 
        1   4214 2 2 142 ILE HG21 H  -84.235 -18.365  -16.858 1.00 . B B . 142 ILE HG21 1 1 
        1   4215 2 2 142 ILE HG22 H  -84.595 -19.993  -17.432 1.00 . B B . 142 ILE HG22 1 1 
        1   4216 2 2 142 ILE HG23 H  -85.230 -18.592  -18.296 1.00 . B B . 142 ILE HG23 1 1 
        1   4217 2 2 142 ILE N    N  -84.256 -17.521  -20.385 1.00 . B B . 142 ILE N    1 1 
        1   4218 2 2 142 ILE O    O  -85.370 -20.158  -20.741 1.00 . B B . 142 ILE O    1 1 
        1   4219 2 2 143 PHE C    C  -82.995 -23.458  -21.195 1.00 . B B . 143 PHE C    1 1 
        1   4220 2 2 143 PHE CA   C  -83.672 -22.204  -21.768 1.00 . B B . 143 PHE CA   1 1 
        1   4221 2 2 143 PHE CB   C  -83.392 -22.094  -23.274 1.00 . B B . 143 PHE CB   1 1 
        1   4222 2 2 143 PHE CD1  C  -84.130 -19.752  -23.823 1.00 . B B . 143 PHE CD1  1 1 
        1   4223 2 2 143 PHE CD2  C  -85.279 -21.588  -24.840 1.00 . B B . 143 PHE CD2  1 1 
        1   4224 2 2 143 PHE CE1  C  -84.967 -18.841  -24.479 1.00 . B B . 143 PHE CE1  1 1 
        1   4225 2 2 143 PHE CE2  C  -86.116 -20.690  -25.512 1.00 . B B . 143 PHE CE2  1 1 
        1   4226 2 2 143 PHE CG   C  -84.286 -21.126  -23.990 1.00 . B B . 143 PHE CG   1 1 
        1   4227 2 2 143 PHE CZ   C  -85.956 -19.308  -25.331 1.00 . B B . 143 PHE CZ   1 1 
        1   4228 2 2 143 PHE H    H  -82.314 -20.782  -20.986 1.00 . B B . 143 PHE H    1 1 
        1   4229 2 2 143 PHE HA   H  -84.738 -22.319  -21.640 1.00 . B B . 143 PHE HA   1 1 
        1   4230 2 2 143 PHE HB2  H  -82.371 -21.777  -23.412 1.00 . B B . 143 PHE HB2  1 1 
        1   4231 2 2 143 PHE HB3  H  -83.511 -23.073  -23.718 1.00 . B B . 143 PHE HB3  1 1 
        1   4232 2 2 143 PHE HD1  H  -83.359 -19.383  -23.163 1.00 . B B . 143 PHE HD1  1 1 
        1   4233 2 2 143 PHE HD2  H  -85.409 -22.650  -24.985 1.00 . B B . 143 PHE HD2  1 1 
        1   4234 2 2 143 PHE HE1  H  -84.830 -17.779  -24.337 1.00 . B B . 143 PHE HE1  1 1 
        1   4235 2 2 143 PHE HE2  H  -86.885 -21.061  -26.175 1.00 . B B . 143 PHE HE2  1 1 
        1   4236 2 2 143 PHE HZ   H  -86.606 -18.613  -25.841 1.00 . B B . 143 PHE HZ   1 1 
        1   4237 2 2 143 PHE N    N  -83.272 -20.970  -21.079 1.00 . B B . 143 PHE N    1 1 
        1   4238 2 2 143 PHE O    O  -81.783 -23.636  -21.345 1.00 . B B . 143 PHE O    1 1 
        1   4239 2 2 144 PRO C    C  -82.828 -26.571  -21.004 1.00 . B B . 144 PRO C    1 1 
        1   4240 2 2 144 PRO CA   C  -83.328 -25.588  -19.948 1.00 . B B . 144 PRO CA   1 1 
        1   4241 2 2 144 PRO CB   C  -84.602 -26.145  -19.328 1.00 . B B . 144 PRO CB   1 1 
        1   4242 2 2 144 PRO CD   C  -85.258 -24.219  -20.487 1.00 . B B . 144 PRO CD   1 1 
        1   4243 2 2 144 PRO CG   C  -85.690 -25.615  -20.211 1.00 . B B . 144 PRO CG   1 1 
        1   4244 2 2 144 PRO HA   H  -82.589 -25.412  -19.186 1.00 . B B . 144 PRO HA   1 1 
        1   4245 2 2 144 PRO HB2  H  -84.588 -27.227  -19.342 1.00 . B B . 144 PRO HB2  1 1 
        1   4246 2 2 144 PRO HB3  H  -84.729 -25.777  -18.322 1.00 . B B . 144 PRO HB3  1 1 
        1   4247 2 2 144 PRO HD2  H  -85.661 -23.874  -21.431 1.00 . B B . 144 PRO HD2  1 1 
        1   4248 2 2 144 PRO HD3  H  -85.543 -23.562  -19.681 1.00 . B B . 144 PRO HD3  1 1 
        1   4249 2 2 144 PRO HG2  H  -85.749 -26.190  -21.126 1.00 . B B . 144 PRO HG2  1 1 
        1   4250 2 2 144 PRO HG3  H  -86.637 -25.616  -19.695 1.00 . B B . 144 PRO HG3  1 1 
        1   4251 2 2 144 PRO N    N  -83.790 -24.338  -20.551 1.00 . B B . 144 PRO N    1 1 
        1   4252 2 2 144 PRO O    O  -83.143 -26.406  -22.182 1.00 . B B . 144 PRO O    1 1 
        1   4253 2 2 145 PRO C    C  -82.892 -29.248  -22.246 1.00 . B B . 145 PRO C    1 1 
        1   4254 2 2 145 PRO CA   C  -81.695 -28.690  -21.490 1.00 . B B . 145 PRO CA   1 1 
        1   4255 2 2 145 PRO CB   C  -81.174 -29.742  -20.517 1.00 . B B . 145 PRO CB   1 1 
        1   4256 2 2 145 PRO CD   C  -81.231 -27.602  -19.373 1.00 . B B . 145 PRO CD   1 1 
        1   4257 2 2 145 PRO CG   C  -80.517 -28.932  -19.437 1.00 . B B . 145 PRO CG   1 1 
        1   4258 2 2 145 PRO HA   H  -80.910 -28.403  -22.167 1.00 . B B . 145 PRO HA   1 1 
        1   4259 2 2 145 PRO HB2  H  -81.999 -30.314  -20.112 1.00 . B B . 145 PRO HB2  1 1 
        1   4260 2 2 145 PRO HB3  H  -80.455 -30.390  -20.992 1.00 . B B . 145 PRO HB3  1 1 
        1   4261 2 2 145 PRO HD2  H  -81.857 -27.551  -18.493 1.00 . B B . 145 PRO HD2  1 1 
        1   4262 2 2 145 PRO HD3  H  -80.523 -26.789  -19.387 1.00 . B B . 145 PRO HD3  1 1 
        1   4263 2 2 145 PRO HG2  H  -80.604 -29.445  -18.489 1.00 . B B . 145 PRO HG2  1 1 
        1   4264 2 2 145 PRO HG3  H  -79.477 -28.774  -19.677 1.00 . B B . 145 PRO HG3  1 1 
        1   4265 2 2 145 PRO N    N  -82.048 -27.585  -20.598 1.00 . B B . 145 PRO N    1 1 
        1   4266 2 2 145 PRO O    O  -84.028 -28.998  -21.860 1.00 . B B . 145 PRO O    1 1 
        1   4267 2 2 146 SER C    C  -83.690 -32.194  -23.689 1.00 . B B . 146 SER C    1 1 
        1   4268 2 2 146 SER CA   C  -83.708 -30.712  -24.020 1.00 . B B . 146 SER CA   1 1 
        1   4269 2 2 146 SER CB   C  -83.642 -30.516  -25.534 1.00 . B B . 146 SER CB   1 1 
        1   4270 2 2 146 SER H    H  -81.707 -30.140  -23.584 1.00 . B B . 146 SER H    1 1 
        1   4271 2 2 146 SER HA   H  -84.652 -30.313  -23.677 1.00 . B B . 146 SER HA   1 1 
        1   4272 2 2 146 SER HB2  H  -84.124 -31.344  -26.025 1.00 . B B . 146 SER HB2  1 1 
        1   4273 2 2 146 SER HB3  H  -84.155 -29.600  -25.797 1.00 . B B . 146 SER HB3  1 1 
        1   4274 2 2 146 SER HG   H  -82.018 -29.535  -25.912 1.00 . B B . 146 SER HG   1 1 
        1   4275 2 2 146 SER N    N  -82.638 -29.986  -23.321 1.00 . B B . 146 SER N    1 1 
        1   4276 2 2 146 SER O    O  -82.645 -32.848  -23.759 1.00 . B B . 146 SER O    1 1 
        1   4277 2 2 146 SER OG   O  -82.298 -30.453  -25.953 1.00 . B B . 146 SER OG   1 1 
        1   4278 2 2 147 SER C    C  -84.008 -35.008  -23.639 1.00 . B B . 147 SER C    1 1 
        1   4279 2 2 147 SER CA   C  -85.058 -34.106  -22.981 1.00 . B B . 147 SER CA   1 1 
        1   4280 2 2 147 SER CB   C  -86.486 -34.544  -23.337 1.00 . B B . 147 SER CB   1 1 
        1   4281 2 2 147 SER H    H  -85.640 -32.105  -23.296 1.00 . B B . 147 SER H    1 1 
        1   4282 2 2 147 SER HA   H  -84.943 -34.198  -21.910 1.00 . B B . 147 SER HA   1 1 
        1   4283 2 2 147 SER HB2  H  -87.089 -34.543  -22.446 1.00 . B B . 147 SER HB2  1 1 
        1   4284 2 2 147 SER HB3  H  -86.904 -33.833  -24.040 1.00 . B B . 147 SER HB3  1 1 
        1   4285 2 2 147 SER HG   H  -85.665 -36.004  -24.317 1.00 . B B . 147 SER HG   1 1 
        1   4286 2 2 147 SER N    N  -84.864 -32.702  -23.326 1.00 . B B . 147 SER N    1 1 
        1   4287 2 2 147 SER O    O  -83.235 -35.674  -22.935 1.00 . B B . 147 SER O    1 1 
        1   4288 2 2 147 SER OG   O  -86.514 -35.843  -23.899 1.00 . B B . 147 SER OG   1 1 
        1   4289 2 2 148 GLU C    C  -81.627 -35.710  -25.481 1.00 . B B . 148 GLU C    1 1 
        1   4290 2 2 148 GLU CA   C  -83.111 -35.921  -25.728 1.00 . B B . 148 GLU CA   1 1 
        1   4291 2 2 148 GLU CB   C  -83.428 -35.906  -27.225 1.00 . B B . 148 GLU CB   1 1 
        1   4292 2 2 148 GLU CD   C  -82.954 -34.842  -29.462 1.00 . B B . 148 GLU CD   1 1 
        1   4293 2 2 148 GLU CG   C  -83.016 -34.643  -27.957 1.00 . B B . 148 GLU CG   1 1 
        1   4294 2 2 148 GLU H    H  -84.579 -34.414  -25.466 1.00 . B B . 148 GLU H    1 1 
        1   4295 2 2 148 GLU HA   H  -83.346 -36.912  -25.367 1.00 . B B . 148 GLU HA   1 1 
        1   4296 2 2 148 GLU HB2  H  -82.926 -36.740  -27.687 1.00 . B B . 148 GLU HB2  1 1 
        1   4297 2 2 148 GLU HB3  H  -84.494 -36.043  -27.346 1.00 . B B . 148 GLU HB3  1 1 
        1   4298 2 2 148 GLU HG2  H  -83.729 -33.863  -27.738 1.00 . B B . 148 GLU HG2  1 1 
        1   4299 2 2 148 GLU HG3  H  -82.042 -34.336  -27.603 1.00 . B B . 148 GLU HG3  1 1 
        1   4300 2 2 148 GLU N    N  -83.957 -34.991  -24.976 1.00 . B B . 148 GLU N    1 1 
        1   4301 2 2 148 GLU O    O  -80.888 -36.687  -25.371 1.00 . B B . 148 GLU O    1 1 
        1   4302 2 2 148 GLU OE1  O  -84.035 -34.886  -30.097 1.00 . B B . 148 GLU OE1  1 1 
        1   4303 2 2 148 GLU OE2  O  -81.825 -34.965  -30.006 1.00 . B B . 148 GLU OE2  1 1 
        1   4304 2 2 149 GLN C    C  -79.420 -34.864  -23.754 1.00 . B B . 149 GLN C    1 1 
        1   4305 2 2 149 GLN CA   C  -79.811 -34.123  -25.035 1.00 . B B . 149 GLN CA   1 1 
        1   4306 2 2 149 GLN CB   C  -79.612 -32.609  -24.856 1.00 . B B . 149 GLN CB   1 1 
        1   4307 2 2 149 GLN CD   C  -78.035 -30.757  -23.991 1.00 . B B . 149 GLN CD   1 1 
        1   4308 2 2 149 GLN CG   C  -78.351 -32.251  -24.052 1.00 . B B . 149 GLN CG   1 1 
        1   4309 2 2 149 GLN H    H  -81.851 -33.720  -25.473 1.00 . B B . 149 GLN H    1 1 
        1   4310 2 2 149 GLN HA   H  -79.170 -34.464  -25.836 1.00 . B B . 149 GLN HA   1 1 
        1   4311 2 2 149 GLN HB2  H  -79.540 -32.151  -25.831 1.00 . B B . 149 GLN HB2  1 1 
        1   4312 2 2 149 GLN HB3  H  -80.476 -32.204  -24.348 1.00 . B B . 149 GLN HB3  1 1 
        1   4313 2 2 149 GLN HE21 H  -79.987 -30.272  -23.871 1.00 . B B . 149 GLN HE21 1 1 
        1   4314 2 2 149 GLN HE22 H  -78.920 -28.952  -23.855 1.00 . B B . 149 GLN HE22 1 1 
        1   4315 2 2 149 GLN HG2  H  -78.489 -32.603  -23.042 1.00 . B B . 149 GLN HG2  1 1 
        1   4316 2 2 149 GLN HG3  H  -77.507 -32.772  -24.482 1.00 . B B . 149 GLN HG3  1 1 
        1   4317 2 2 149 GLN N    N  -81.202 -34.448  -25.383 1.00 . B B . 149 GLN N    1 1 
        1   4318 2 2 149 GLN NE2  N  -79.073 -29.919  -23.898 1.00 . B B . 149 GLN NE2  1 1 
        1   4319 2 2 149 GLN O    O  -78.331 -35.460  -23.661 1.00 . B B . 149 GLN O    1 1 
        1   4320 2 2 149 GLN OE1  O  -76.863 -30.368  -24.019 1.00 . B B . 149 GLN OE1  1 1 
        1   4321 2 2 150 LEU C    C  -80.096 -36.972  -21.666 1.00 . B B . 150 LEU C    1 1 
        1   4322 2 2 150 LEU CA   C  -80.163 -35.473  -21.495 1.00 . B B . 150 LEU CA   1 1 
        1   4323 2 2 150 LEU CB   C  -81.298 -35.078  -20.552 1.00 . B B . 150 LEU CB   1 1 
        1   4324 2 2 150 LEU CD1  C  -82.667 -33.153  -19.705 1.00 . B B . 150 LEU CD1  1 1 
        1   4325 2 2 150 LEU CD2  C  -80.254 -33.389  -19.038 1.00 . B B . 150 LEU CD2  1 1 
        1   4326 2 2 150 LEU CG   C  -81.287 -33.610  -20.137 1.00 . B B . 150 LEU CG   1 1 
        1   4327 2 2 150 LEU H    H  -81.173 -34.347  -22.955 1.00 . B B . 150 LEU H    1 1 
        1   4328 2 2 150 LEU HA   H  -79.230 -35.136  -21.068 1.00 . B B . 150 LEU HA   1 1 
        1   4329 2 2 150 LEU HB2  H  -82.237 -35.282  -21.043 1.00 . B B . 150 LEU HB2  1 1 
        1   4330 2 2 150 LEU HB3  H  -81.236 -35.691  -19.664 1.00 . B B . 150 LEU HB3  1 1 
        1   4331 2 2 150 LEU HD11 H  -83.245 -34.008  -19.385 1.00 . B B . 150 LEU HD11 1 1 
        1   4332 2 2 150 LEU HD12 H  -83.164 -32.673  -20.535 1.00 . B B . 150 LEU HD12 1 1 
        1   4333 2 2 150 LEU HD13 H  -82.576 -32.454  -18.887 1.00 . B B . 150 LEU HD13 1 1 
        1   4334 2 2 150 LEU HD21 H  -80.203 -32.338  -18.798 1.00 . B B . 150 LEU HD21 1 1 
        1   4335 2 2 150 LEU HD22 H  -79.287 -33.727  -19.380 1.00 . B B . 150 LEU HD22 1 1 
        1   4336 2 2 150 LEU HD23 H  -80.540 -33.946  -18.158 1.00 . B B . 150 LEU HD23 1 1 
        1   4337 2 2 150 LEU HG   H  -80.997 -33.023  -20.998 1.00 . B B . 150 LEU HG   1 1 
        1   4338 2 2 150 LEU N    N  -80.337 -34.830  -22.786 1.00 . B B . 150 LEU N    1 1 
        1   4339 2 2 150 LEU O    O  -79.075 -37.576  -21.349 1.00 . B B . 150 LEU O    1 1 
        1   4340 2 2 151 THR C    C  -80.195 -39.544  -23.382 1.00 . B B . 151 THR C    1 1 
        1   4341 2 2 151 THR CA   C  -81.255 -39.015  -22.389 1.00 . B B . 151 THR CA   1 1 
        1   4342 2 2 151 THR CB   C  -82.707 -39.495  -22.748 1.00 . B B . 151 THR CB   1 1 
        1   4343 2 2 151 THR CG2  C  -83.613 -39.516  -21.507 1.00 . B B . 151 THR CG2  1 1 
        1   4344 2 2 151 THR H    H  -81.935 -37.003  -22.454 1.00 . B B . 151 THR H    1 1 
        1   4345 2 2 151 THR HA   H  -81.012 -39.455  -21.430 1.00 . B B . 151 THR HA   1 1 
        1   4346 2 2 151 THR HB   H  -82.649 -40.496  -23.152 1.00 . B B . 151 THR HB   1 1 
        1   4347 2 2 151 THR HG1  H  -82.725 -37.854  -23.812 1.00 . B B . 151 THR HG1  1 1 
        1   4348 2 2 151 THR HG21 H  -83.021 -39.321  -20.625 1.00 . B B . 151 THR HG21 1 1 
        1   4349 2 2 151 THR HG22 H  -84.081 -40.486  -21.418 1.00 . B B . 151 THR HG22 1 1 
        1   4350 2 2 151 THR HG23 H  -84.375 -38.757  -21.604 1.00 . B B . 151 THR HG23 1 1 
        1   4351 2 2 151 THR N    N  -81.168 -37.559  -22.201 1.00 . B B . 151 THR N    1 1 
        1   4352 2 2 151 THR O    O  -80.078 -40.758  -23.619 1.00 . B B . 151 THR O    1 1 
        1   4353 2 2 151 THR OG1  O  -83.280 -38.634  -23.739 1.00 . B B . 151 THR OG1  1 1 
        1   4354 2 2 152 SER C    C  -76.922 -38.518  -24.014 1.00 . B B . 152 SER C    1 1 
        1   4355 2 2 152 SER CA   C  -78.226 -38.960  -24.704 1.00 . B B . 152 SER CA   1 1 
        1   4356 2 2 152 SER CB   C  -78.332 -38.400  -26.119 1.00 . B B . 152 SER CB   1 1 
        1   4357 2 2 152 SER H    H  -79.553 -37.679  -23.682 1.00 . B B . 152 SER H    1 1 
        1   4358 2 2 152 SER HA   H  -78.197 -40.037  -24.784 1.00 . B B . 152 SER HA   1 1 
        1   4359 2 2 152 SER HB2  H  -78.408 -37.326  -26.075 1.00 . B B . 152 SER HB2  1 1 
        1   4360 2 2 152 SER HB3  H  -77.443 -38.669  -26.675 1.00 . B B . 152 SER HB3  1 1 
        1   4361 2 2 152 SER HG   H  -80.063 -39.280  -26.097 1.00 . B B . 152 SER HG   1 1 
        1   4362 2 2 152 SER N    N  -79.413 -38.617  -23.931 1.00 . B B . 152 SER N    1 1 
        1   4363 2 2 152 SER O    O  -75.886 -38.366  -24.665 1.00 . B B . 152 SER O    1 1 
        1   4364 2 2 152 SER OG   O  -79.482 -38.915  -26.768 1.00 . B B . 152 SER OG   1 1 
        1   4365 2 2 153 GLY C    C  -75.115 -36.913  -21.644 1.00 . B B . 153 GLY C    1 1 
        1   4366 2 2 153 GLY CA   C  -75.804 -38.249  -21.844 1.00 . B B . 153 GLY CA   1 1 
        1   4367 2 2 153 GLY H    H  -77.860 -38.432  -22.263 1.00 . B B . 153 GLY H    1 1 
        1   4368 2 2 153 GLY HA2  H  -76.094 -38.604  -20.868 1.00 . B B . 153 GLY HA2  1 1 
        1   4369 2 2 153 GLY HA3  H  -75.080 -38.947  -22.243 1.00 . B B . 153 GLY HA3  1 1 
        1   4370 2 2 153 GLY N    N  -76.992 -38.304  -22.699 1.00 . B B . 153 GLY N    1 1 
        1   4371 2 2 153 GLY O    O  -73.910 -36.868  -21.369 1.00 . B B . 153 GLY O    1 1 
        1   4372 2 2 154 GLY C    C  -76.415 -33.480  -21.190 1.00 . B B . 154 GLY C    1 1 
        1   4373 2 2 154 GLY CA   C  -75.337 -34.479  -21.559 1.00 . B B . 154 GLY CA   1 1 
        1   4374 2 2 154 GLY H    H  -76.827 -35.933  -21.965 1.00 . B B . 154 GLY H    1 1 
        1   4375 2 2 154 GLY HA2  H  -74.603 -34.510  -20.767 1.00 . B B . 154 GLY HA2  1 1 
        1   4376 2 2 154 GLY HA3  H  -74.856 -34.155  -22.469 1.00 . B B . 154 GLY HA3  1 1 
        1   4377 2 2 154 GLY N    N  -75.875 -35.827  -21.760 1.00 . B B . 154 GLY N    1 1 
        1   4378 2 2 154 GLY O    O  -77.608 -33.789  -21.268 1.00 . B B . 154 GLY O    1 1 
        1   4379 2 2 155 ALA C    C  -76.379 -29.831  -20.545 1.00 . B B . 155 ALA C    1 1 
        1   4380 2 2 155 ALA CA   C  -76.938 -31.240  -20.357 1.00 . B B . 155 ALA CA   1 1 
        1   4381 2 2 155 ALA CB   C  -77.335 -31.455  -18.901 1.00 . B B . 155 ALA CB   1 1 
        1   4382 2 2 155 ALA H    H  -75.033 -32.103  -20.738 1.00 . B B . 155 ALA H    1 1 
        1   4383 2 2 155 ALA HA   H  -77.828 -31.329  -20.961 1.00 . B B . 155 ALA HA   1 1 
        1   4384 2 2 155 ALA HB1  H  -76.496 -31.226  -18.261 1.00 . B B . 155 ALA HB1  1 1 
        1   4385 2 2 155 ALA HB2  H  -77.628 -32.484  -18.756 1.00 . B B . 155 ALA HB2  1 1 
        1   4386 2 2 155 ALA HB3  H  -78.163 -30.807  -18.654 1.00 . B B . 155 ALA HB3  1 1 
        1   4387 2 2 155 ALA N    N  -75.996 -32.283  -20.781 1.00 . B B . 155 ALA N    1 1 
        1   4388 2 2 155 ALA O    O  -75.323 -29.507  -19.998 1.00 . B B . 155 ALA O    1 1 
        1   4389 2 2 156 SER C    C  -77.753 -26.631  -21.361 1.00 . B B . 156 SER C    1 1 
        1   4390 2 2 156 SER CA   C  -76.646 -27.638  -21.597 1.00 . B B . 156 SER CA   1 1 
        1   4391 2 2 156 SER CB   C  -76.168 -27.531  -23.048 1.00 . B B . 156 SER CB   1 1 
        1   4392 2 2 156 SER H    H  -77.935 -29.318  -21.695 1.00 . B B . 156 SER H    1 1 
        1   4393 2 2 156 SER HA   H  -75.819 -27.400  -20.946 1.00 . B B . 156 SER HA   1 1 
        1   4394 2 2 156 SER HB2  H  -77.013 -27.615  -23.708 1.00 . B B . 156 SER HB2  1 1 
        1   4395 2 2 156 SER HB3  H  -75.706 -26.562  -23.193 1.00 . B B . 156 SER HB3  1 1 
        1   4396 2 2 156 SER HG   H  -74.363 -28.165  -23.389 1.00 . B B . 156 SER HG   1 1 
        1   4397 2 2 156 SER N    N  -77.097 -28.999  -21.300 1.00 . B B . 156 SER N    1 1 
        1   4398 2 2 156 SER O    O  -78.889 -26.844  -21.780 1.00 . B B . 156 SER O    1 1 
        1   4399 2 2 156 SER OG   O  -75.239 -28.556  -23.363 1.00 . B B . 156 SER OG   1 1 
        1   4400 2 2 157 VAL C    C  -77.997 -23.129  -20.968 1.00 . B B . 157 VAL C    1 1 
        1   4401 2 2 157 VAL CA   C  -78.399 -24.492  -20.388 1.00 . B B . 157 VAL CA   1 1 
        1   4402 2 2 157 VAL CB   C  -78.602 -24.399  -18.867 1.00 . B B . 157 VAL CB   1 1 
        1   4403 2 2 157 VAL CG1  C  -79.808 -23.529  -18.523 1.00 . B B . 157 VAL CG1  1 1 
        1   4404 2 2 157 VAL CG2  C  -78.777 -25.791  -18.282 1.00 . B B . 157 VAL CG2  1 1 
        1   4405 2 2 157 VAL H    H  -76.488 -25.405  -20.417 1.00 . B B . 157 VAL H    1 1 
        1   4406 2 2 157 VAL HA   H  -79.340 -24.779  -20.834 1.00 . B B . 157 VAL HA   1 1 
        1   4407 2 2 157 VAL HB   H  -77.721 -23.949  -18.432 1.00 . B B . 157 VAL HB   1 1 
        1   4408 2 2 157 VAL HG11 H  -79.485 -22.679  -17.941 1.00 . B B . 157 VAL HG11 1 1 
        1   4409 2 2 157 VAL HG12 H  -80.518 -24.108  -17.951 1.00 . B B . 157 VAL HG12 1 1 
        1   4410 2 2 157 VAL HG13 H  -80.275 -23.185  -19.434 1.00 . B B . 157 VAL HG13 1 1 
        1   4411 2 2 157 VAL HG21 H  -79.690 -25.827  -17.706 1.00 . B B . 157 VAL HG21 1 1 
        1   4412 2 2 157 VAL HG22 H  -77.938 -26.021  -17.642 1.00 . B B . 157 VAL HG22 1 1 
        1   4413 2 2 157 VAL HG23 H  -78.829 -26.514  -19.082 1.00 . B B . 157 VAL HG23 1 1 
        1   4414 2 2 157 VAL N    N  -77.415 -25.522  -20.710 1.00 . B B . 157 VAL N    1 1 
        1   4415 2 2 157 VAL O    O  -76.890 -22.658  -20.726 1.00 . B B . 157 VAL O    1 1 
        1   4416 2 2 158 VAL C    C  -79.624 -20.135  -22.181 1.00 . B B . 158 VAL C    1 1 
        1   4417 2 2 158 VAL CA   C  -78.623 -21.257  -22.470 1.00 . B B . 158 VAL CA   1 1 
        1   4418 2 2 158 VAL CB   C  -78.569 -21.467  -24.038 1.00 . B B . 158 VAL CB   1 1 
        1   4419 2 2 158 VAL CG1  C  -77.634 -22.588  -24.424 1.00 . B B . 158 VAL CG1  1 1 
        1   4420 2 2 158 VAL CG2  C  -79.945 -21.726  -24.632 1.00 . B B . 158 VAL CG2  1 1 
        1   4421 2 2 158 VAL H    H  -79.766 -22.953  -21.884 1.00 . B B . 158 VAL H    1 1 
        1   4422 2 2 158 VAL HA   H  -77.650 -20.912  -22.158 1.00 . B B . 158 VAL HA   1 1 
        1   4423 2 2 158 VAL HB   H  -78.181 -20.556  -24.473 1.00 . B B . 158 VAL HB   1 1 
        1   4424 2 2 158 VAL HG11 H  -77.782 -22.838  -25.464 1.00 . B B . 158 VAL HG11 1 1 
        1   4425 2 2 158 VAL HG12 H  -77.838 -23.454  -23.812 1.00 . B B . 158 VAL HG12 1 1 
        1   4426 2 2 158 VAL HG13 H  -76.612 -22.273  -24.272 1.00 . B B . 158 VAL HG13 1 1 
        1   4427 2 2 158 VAL HG21 H  -80.047 -22.777  -24.860 1.00 . B B . 158 VAL HG21 1 1 
        1   4428 2 2 158 VAL HG22 H  -80.061 -21.149  -25.538 1.00 . B B . 158 VAL HG22 1 1 
        1   4429 2 2 158 VAL HG23 H  -80.705 -21.437  -23.921 1.00 . B B . 158 VAL HG23 1 1 
        1   4430 2 2 158 VAL N    N  -78.904 -22.511  -21.736 1.00 . B B . 158 VAL N    1 1 
        1   4431 2 2 158 VAL O    O  -80.800 -20.389  -21.928 1.00 . B B . 158 VAL O    1 1 
        1   4432 2 2 159 CYS C    C  -79.628 -16.726  -23.348 1.00 . B B . 159 CYS C    1 1 
        1   4433 2 2 159 CYS CA   C  -80.056 -17.750  -22.305 1.00 . B B . 159 CYS CA   1 1 
        1   4434 2 2 159 CYS CB   C  -80.322 -17.078  -20.943 1.00 . B B . 159 CYS CB   1 1 
        1   4435 2 2 159 CYS H    H  -78.202 -18.760  -22.428 1.00 . B B . 159 CYS H    1 1 
        1   4436 2 2 159 CYS HA   H  -81.007 -18.145  -22.633 1.00 . B B . 159 CYS HA   1 1 
        1   4437 2 2 159 CYS HB2  H  -80.382 -16.016  -21.104 1.00 . B B . 159 CYS HB2  1 1 
        1   4438 2 2 159 CYS HB3  H  -81.290 -17.414  -20.593 1.00 . B B . 159 CYS HB3  1 1 
        1   4439 2 2 159 CYS N    N  -79.150 -18.895  -22.223 1.00 . B B . 159 CYS N    1 1 
        1   4440 2 2 159 CYS O    O  -78.460 -16.345  -23.423 1.00 . B B . 159 CYS O    1 1 
        1   4441 2 2 159 CYS SG   S  -79.110 -17.356  -19.631 1.00 . B B . 159 CYS SG   1 1 
        1   4442 2 2 160 PHE C    C  -80.554 -13.917  -24.642 1.00 . B B . 160 PHE C    1 1 
        1   4443 2 2 160 PHE CA   C  -80.384 -15.317  -25.200 1.00 . B B . 160 PHE CA   1 1 
        1   4444 2 2 160 PHE CB   C  -81.370 -15.531  -26.352 1.00 . B B . 160 PHE CB   1 1 
        1   4445 2 2 160 PHE CD1  C  -80.219 -17.303  -27.703 1.00 . B B . 160 PHE CD1  1 1 
        1   4446 2 2 160 PHE CD2  C  -82.361 -17.791  -26.780 1.00 . B B . 160 PHE CD2  1 1 
        1   4447 2 2 160 PHE CE1  C  -80.167 -18.567  -28.258 1.00 . B B . 160 PHE CE1  1 1 
        1   4448 2 2 160 PHE CE2  C  -82.318 -19.061  -27.336 1.00 . B B . 160 PHE CE2  1 1 
        1   4449 2 2 160 PHE CG   C  -81.314 -16.902  -26.955 1.00 . B B . 160 PHE CG   1 1 
        1   4450 2 2 160 PHE CZ   C  -81.221 -19.450  -28.072 1.00 . B B . 160 PHE CZ   1 1 
        1   4451 2 2 160 PHE H    H  -81.500 -16.666  -24.031 1.00 . B B . 160 PHE H    1 1 
        1   4452 2 2 160 PHE HA   H  -79.379 -15.423  -25.579 1.00 . B B . 160 PHE HA   1 1 
        1   4453 2 2 160 PHE HB2  H  -82.370 -15.364  -25.983 1.00 . B B . 160 PHE HB2  1 1 
        1   4454 2 2 160 PHE HB3  H  -81.163 -14.801  -27.122 1.00 . B B . 160 PHE HB3  1 1 
        1   4455 2 2 160 PHE HD1  H  -79.396 -16.621  -27.852 1.00 . B B . 160 PHE HD1  1 1 
        1   4456 2 2 160 PHE HD2  H  -83.221 -17.493  -26.199 1.00 . B B . 160 PHE HD2  1 1 
        1   4457 2 2 160 PHE HE1  H  -79.305 -18.869  -28.835 1.00 . B B . 160 PHE HE1  1 1 
        1   4458 2 2 160 PHE HE2  H  -83.142 -19.744  -27.191 1.00 . B B . 160 PHE HE2  1 1 
        1   4459 2 2 160 PHE HZ   H  -81.184 -20.438  -28.507 1.00 . B B . 160 PHE HZ   1 1 
        1   4460 2 2 160 PHE N    N  -80.598 -16.303  -24.154 1.00 . B B . 160 PHE N    1 1 
        1   4461 2 2 160 PHE O    O  -81.384 -13.689  -23.771 1.00 . B B . 160 PHE O    1 1 
        1   4462 2 2 161 LEU C    C  -80.156 -10.766  -26.020 1.00 . B B . 161 LEU C    1 1 
        1   4463 2 2 161 LEU CA   C  -79.831 -11.583  -24.771 1.00 . B B . 161 LEU CA   1 1 
        1   4464 2 2 161 LEU CB   C  -78.495 -11.130  -24.165 1.00 . B B . 161 LEU CB   1 1 
        1   4465 2 2 161 LEU CD1  C  -78.873 -10.982  -21.686 1.00 . B B . 161 LEU CD1  1 1 
        1   4466 2 2 161 LEU CD2  C  -77.759 -13.055  -22.605 1.00 . B B . 161 LEU CD2  1 1 
        1   4467 2 2 161 LEU CG   C  -77.977 -11.549  -22.780 1.00 . B B . 161 LEU CG   1 1 
        1   4468 2 2 161 LEU H    H  -79.122 -13.247  -25.852 1.00 . B B . 161 LEU H    1 1 
        1   4469 2 2 161 LEU HA   H  -80.619 -11.452  -24.043 1.00 . B B . 161 LEU HA   1 1 
        1   4470 2 2 161 LEU HB2  H  -77.733 -11.431  -24.858 1.00 . B B . 161 LEU HB2  1 1 
        1   4471 2 2 161 LEU HB3  H  -78.513 -10.045  -24.184 1.00 . B B . 161 LEU HB3  1 1 
        1   4472 2 2 161 LEU HD11 H  -78.368 -10.163  -21.195 1.00 . B B . 161 LEU HD11 1 1 
        1   4473 2 2 161 LEU HD12 H  -79.092 -11.755  -20.963 1.00 . B B . 161 LEU HD12 1 1 
        1   4474 2 2 161 LEU HD13 H  -79.794 -10.626  -22.123 1.00 . B B . 161 LEU HD13 1 1 
        1   4475 2 2 161 LEU HD21 H  -76.803 -13.228  -22.134 1.00 . B B . 161 LEU HD21 1 1 
        1   4476 2 2 161 LEU HD22 H  -77.776 -13.536  -23.572 1.00 . B B . 161 LEU HD22 1 1 
        1   4477 2 2 161 LEU HD23 H  -78.545 -13.463  -21.987 1.00 . B B . 161 LEU HD23 1 1 
        1   4478 2 2 161 LEU HG   H  -77.012 -11.068  -22.661 1.00 . B B . 161 LEU HG   1 1 
        1   4479 2 2 161 LEU N    N  -79.760 -12.985  -25.156 1.00 . B B . 161 LEU N    1 1 
        1   4480 2 2 161 LEU O    O  -79.292 -10.100  -26.591 1.00 . B B . 161 LEU O    1 1 
        1   4481 2 2 162 ASN C    C  -81.773  -8.696  -27.686 1.00 . B B . 162 ASN C    1 1 
        1   4482 2 2 162 ASN CA   C  -81.756 -10.223  -27.732 1.00 . B B . 162 ASN CA   1 1 
        1   4483 2 2 162 ASN CB   C  -83.085 -10.793  -28.251 1.00 . B B . 162 ASN CB   1 1 
        1   4484 2 2 162 ASN CG   C  -82.987 -12.277  -28.628 1.00 . B B . 162 ASN CG   1 1 
        1   4485 2 2 162 ASN H    H  -82.056 -11.387  -25.989 1.00 . B B . 162 ASN H    1 1 
        1   4486 2 2 162 ASN HA   H  -80.992 -10.506  -28.441 1.00 . B B . 162 ASN HA   1 1 
        1   4487 2 2 162 ASN HB2  H  -83.836 -10.680  -27.484 1.00 . B B . 162 ASN HB2  1 1 
        1   4488 2 2 162 ASN HB3  H  -83.388 -10.230  -29.121 1.00 . B B . 162 ASN HB3  1 1 
        1   4489 2 2 162 ASN HD21 H  -84.827 -12.237  -29.441 1.00 . B B . 162 ASN HD21 1 1 
        1   4490 2 2 162 ASN HD22 H  -84.044 -13.741  -29.517 1.00 . B B . 162 ASN HD22 1 1 
        1   4491 2 2 162 ASN N    N  -81.400 -10.832  -26.462 1.00 . B B . 162 ASN N    1 1 
        1   4492 2 2 162 ASN ND2  N  -84.046 -12.798  -29.250 1.00 . B B . 162 ASN ND2  1 1 
        1   4493 2 2 162 ASN O    O  -81.893  -8.107  -26.612 1.00 . B B . 162 ASN O    1 1 
        1   4494 2 2 162 ASN OD1  O  -81.976 -12.940  -28.366 1.00 . B B . 162 ASN OD1  1 1 
        1   4495 2 2 163 ASN C    C  -81.207  -5.588  -28.234 1.00 . B B . 163 ASN C    1 1 
        1   4496 2 2 163 ASN CA   C  -81.801  -6.662  -29.152 1.00 . B B . 163 ASN CA   1 1 
        1   4497 2 2 163 ASN CB   C  -83.297  -6.402  -29.344 1.00 . B B . 163 ASN CB   1 1 
        1   4498 2 2 163 ASN CG   C  -83.879  -7.193  -30.489 1.00 . B B . 163 ASN CG   1 1 
        1   4499 2 2 163 ASN H    H  -81.430  -8.676  -29.634 1.00 . B B . 163 ASN H    1 1 
        1   4500 2 2 163 ASN HA   H  -81.355  -6.492  -30.119 1.00 . B B . 163 ASN HA   1 1 
        1   4501 2 2 163 ASN HB2  H  -83.818  -6.668  -28.438 1.00 . B B . 163 ASN HB2  1 1 
        1   4502 2 2 163 ASN HB3  H  -83.445  -5.348  -29.535 1.00 . B B . 163 ASN HB3  1 1 
        1   4503 2 2 163 ASN HD21 H  -84.363  -5.515  -31.481 1.00 . B B . 163 ASN HD21 1 1 
        1   4504 2 2 163 ASN HD22 H  -84.772  -6.959  -32.273 1.00 . B B . 163 ASN HD22 1 1 
        1   4505 2 2 163 ASN N    N  -81.575  -8.091  -28.861 1.00 . B B . 163 ASN N    1 1 
        1   4506 2 2 163 ASN ND2  N  -84.382  -6.494  -31.503 1.00 . B B . 163 ASN ND2  1 1 
        1   4507 2 2 163 ASN O    O  -81.845  -4.560  -28.007 1.00 . B B . 163 ASN O    1 1 
        1   4508 2 2 163 ASN OD1  O  -83.880  -8.420  -30.464 1.00 . B B . 163 ASN OD1  1 1 
        1   4509 2 2 164 PHE C    C  -78.378  -3.890  -27.608 1.00 . B B . 164 PHE C    1 1 
        1   4510 2 2 164 PHE CA   C  -79.375  -4.778  -26.876 1.00 . B B . 164 PHE CA   1 1 
        1   4511 2 2 164 PHE CB   C  -78.744  -5.398  -25.636 1.00 . B B . 164 PHE CB   1 1 
        1   4512 2 2 164 PHE CD1  C  -76.332  -5.765  -26.240 1.00 . B B . 164 PHE CD1  1 1 
        1   4513 2 2 164 PHE CD2  C  -77.707  -7.662  -25.795 1.00 . B B . 164 PHE CD2  1 1 
        1   4514 2 2 164 PHE CE1  C  -75.238  -6.600  -26.474 1.00 . B B . 164 PHE CE1  1 1 
        1   4515 2 2 164 PHE CE2  C  -76.621  -8.504  -26.019 1.00 . B B . 164 PHE CE2  1 1 
        1   4516 2 2 164 PHE CG   C  -77.578  -6.292  -25.915 1.00 . B B . 164 PHE CG   1 1 
        1   4517 2 2 164 PHE CZ   C  -75.387  -7.974  -26.363 1.00 . B B . 164 PHE CZ   1 1 
        1   4518 2 2 164 PHE H    H  -79.504  -6.615  -27.946 1.00 . B B . 164 PHE H    1 1 
        1   4519 2 2 164 PHE HA   H  -80.172  -4.134  -26.534 1.00 . B B . 164 PHE HA   1 1 
        1   4520 2 2 164 PHE HB2  H  -78.410  -4.602  -24.989 1.00 . B B . 164 PHE HB2  1 1 
        1   4521 2 2 164 PHE HB3  H  -79.502  -5.966  -25.115 1.00 . B B . 164 PHE HB3  1 1 
        1   4522 2 2 164 PHE HD1  H  -76.216  -4.696  -26.337 1.00 . B B . 164 PHE HD1  1 1 
        1   4523 2 2 164 PHE HD2  H  -78.664  -8.086  -25.528 1.00 . B B . 164 PHE HD2  1 1 
        1   4524 2 2 164 PHE HE1  H  -74.276  -6.177  -26.725 1.00 . B B . 164 PHE HE1  1 1 
        1   4525 2 2 164 PHE HE2  H  -76.742  -9.573  -25.931 1.00 . B B . 164 PHE HE2  1 1 
        1   4526 2 2 164 PHE HZ   H  -74.546  -8.628  -26.542 1.00 . B B . 164 PHE HZ   1 1 
        1   4527 2 2 164 PHE N    N  -79.993  -5.794  -27.728 1.00 . B B . 164 PHE N    1 1 
        1   4528 2 2 164 PHE O    O  -77.999  -4.179  -28.739 1.00 . B B . 164 PHE O    1 1 
        1   4529 2 2 165 TYR C    C  -76.651  -0.809  -26.396 1.00 . B B . 165 TYR C    1 1 
        1   4530 2 2 165 TYR CA   C  -77.030  -1.822  -27.491 1.00 . B B . 165 TYR CA   1 1 
        1   4531 2 2 165 TYR CB   C  -77.675  -1.111  -28.690 1.00 . B B . 165 TYR CB   1 1 
        1   4532 2 2 165 TYR CD1  C  -75.718  -0.101  -29.935 1.00 . B B . 165 TYR CD1  1 1 
        1   4533 2 2 165 TYR CD2  C  -77.363   1.370  -29.018 1.00 . B B . 165 TYR CD2  1 1 
        1   4534 2 2 165 TYR CE1  C  -75.012   0.984  -30.417 1.00 . B B . 165 TYR CE1  1 1 
        1   4535 2 2 165 TYR CE2  C  -76.671   2.458  -29.499 1.00 . B B . 165 TYR CE2  1 1 
        1   4536 2 2 165 TYR CG   C  -76.901   0.074  -29.218 1.00 . B B . 165 TYR CG   1 1 
        1   4537 2 2 165 TYR CZ   C  -75.497   2.258  -30.194 1.00 . B B . 165 TYR CZ   1 1 
        1   4538 2 2 165 TYR H    H  -78.306  -2.670  -26.036 1.00 . B B . 165 TYR H    1 1 
        1   4539 2 2 165 TYR HA   H  -76.134  -2.326  -27.823 1.00 . B B . 165 TYR HA   1 1 
        1   4540 2 2 165 TYR HB2  H  -77.783  -1.825  -29.490 1.00 . B B . 165 TYR HB2  1 1 
        1   4541 2 2 165 TYR HB3  H  -78.661  -0.778  -28.396 1.00 . B B . 165 TYR HB3  1 1 
        1   4542 2 2 165 TYR HD1  H  -75.341  -1.099  -30.102 1.00 . B B . 165 TYR HD1  1 1 
        1   4543 2 2 165 TYR HD2  H  -78.283   1.526  -28.473 1.00 . B B . 165 TYR HD2  1 1 
        1   4544 2 2 165 TYR HE1  H  -74.097   0.837  -30.971 1.00 . B B . 165 TYR HE1  1 1 
        1   4545 2 2 165 TYR HE2  H  -77.041   3.459  -29.331 1.00 . B B . 165 TYR HE2  1 1 
        1   4546 2 2 165 TYR HH   H  -74.383   3.776  -29.928 1.00 . B B . 165 TYR HH   1 1 
        1   4547 2 2 165 TYR N    N  -77.956  -2.817  -26.939 1.00 . B B . 165 TYR N    1 1 
        1   4548 2 2 165 TYR O    O  -77.535  -0.298  -25.705 1.00 . B B . 165 TYR O    1 1 
        1   4549 2 2 165 TYR OH   O  -74.803   3.340  -30.673 1.00 . B B . 165 TYR OH   1 1 
        1   4550 2 2 166 PRO C    C  -73.724  -2.378  -26.642 1.00 . B B . 166 PRO C    1 1 
        1   4551 2 2 166 PRO CA   C  -74.156  -0.941  -26.940 1.00 . B B . 166 PRO CA   1 1 
        1   4552 2 2 166 PRO CB   C  -73.072   0.042  -26.455 1.00 . B B . 166 PRO CB   1 1 
        1   4553 2 2 166 PRO CD   C  -74.992   0.437  -25.148 1.00 . B B . 166 PRO CD   1 1 
        1   4554 2 2 166 PRO CG   C  -73.783   1.096  -25.691 1.00 . B B . 166 PRO CG   1 1 
        1   4555 2 2 166 PRO HA   H  -74.297  -0.808  -27.999 1.00 . B B . 166 PRO HA   1 1 
        1   4556 2 2 166 PRO HB2  H  -72.366  -0.471  -25.817 1.00 . B B . 166 PRO HB2  1 1 
        1   4557 2 2 166 PRO HB3  H  -72.562   0.480  -27.299 1.00 . B B . 166 PRO HB3  1 1 
        1   4558 2 2 166 PRO HD2  H  -74.762  -0.084  -24.227 1.00 . B B . 166 PRO HD2  1 1 
        1   4559 2 2 166 PRO HD3  H  -75.787   1.150  -25.002 1.00 . B B . 166 PRO HD3  1 1 
        1   4560 2 2 166 PRO HG2  H  -73.157   1.460  -24.887 1.00 . B B . 166 PRO HG2  1 1 
        1   4561 2 2 166 PRO HG3  H  -74.067   1.906  -26.343 1.00 . B B . 166 PRO HG3  1 1 
        1   4562 2 2 166 PRO N    N  -75.348  -0.511  -26.216 1.00 . B B . 166 PRO N    1 1 
        1   4563 2 2 166 PRO O    O  -74.361  -3.068  -25.839 1.00 . B B . 166 PRO O    1 1 
        1   4564 2 2 167 LYS C    C  -71.865  -4.666  -25.831 1.00 . B B . 167 LYS C    1 1 
        1   4565 2 2 167 LYS CA   C  -72.055  -4.135  -27.250 1.00 . B B . 167 LYS CA   1 1 
        1   4566 2 2 167 LYS CB   C  -70.702  -4.151  -28.002 1.00 . B B . 167 LYS CB   1 1 
        1   4567 2 2 167 LYS CD   C  -68.930  -5.877  -27.152 1.00 . B B . 167 LYS CD   1 1 
        1   4568 2 2 167 LYS CE   C  -68.188  -7.185  -27.482 1.00 . B B . 167 LYS CE   1 1 
        1   4569 2 2 167 LYS CG   C  -70.024  -5.546  -28.210 1.00 . B B . 167 LYS CG   1 1 
        1   4570 2 2 167 LYS H    H  -72.213  -2.142  -27.911 1.00 . B B . 167 LYS H    1 1 
        1   4571 2 2 167 LYS HA   H  -72.724  -4.805  -27.767 1.00 . B B . 167 LYS HA   1 1 
        1   4572 2 2 167 LYS HB2  H  -70.857  -3.714  -28.974 1.00 . B B . 167 LYS HB2  1 1 
        1   4573 2 2 167 LYS HB3  H  -70.014  -3.518  -27.458 1.00 . B B . 167 LYS HB3  1 1 
        1   4574 2 2 167 LYS HD2  H  -68.215  -5.068  -27.119 1.00 . B B . 167 LYS HD2  1 1 
        1   4575 2 2 167 LYS HD3  H  -69.397  -5.972  -26.182 1.00 . B B . 167 LYS HD3  1 1 
        1   4576 2 2 167 LYS HE2  H  -68.917  -7.965  -27.629 1.00 . B B . 167 LYS HE2  1 1 
        1   4577 2 2 167 LYS HE3  H  -67.648  -7.045  -28.409 1.00 . B B . 167 LYS HE3  1 1 
        1   4578 2 2 167 LYS HG2  H  -70.785  -6.309  -28.165 1.00 . B B . 167 LYS HG2  1 1 
        1   4579 2 2 167 LYS HG3  H  -69.575  -5.566  -29.193 1.00 . B B . 167 LYS HG3  1 1 
        1   4580 2 2 167 LYS HZ1  H  -67.751  -8.054  -25.632 1.00 . B B . 167 LYS HZ1  1 1 
        1   4581 2 2 167 LYS HZ2  H  -66.677  -6.818  -26.085 1.00 . B B . 167 LYS HZ2  1 1 
        1   4582 2 2 167 LYS HZ3  H  -66.579  -8.345  -26.823 1.00 . B B . 167 LYS HZ3  1 1 
        1   4583 2 2 167 LYS N    N  -72.635  -2.786  -27.305 1.00 . B B . 167 LYS N    1 1 
        1   4584 2 2 167 LYS NZ   N  -67.225  -7.635  -26.425 1.00 . B B . 167 LYS NZ   1 1 
        1   4585 2 2 167 LYS O    O  -72.141  -5.843  -25.558 1.00 . B B . 167 LYS O    1 1 
        1   4586 2 2 168 ASP C    C  -72.025  -4.665  -22.688 1.00 . B B . 168 ASP C    1 1 
        1   4587 2 2 168 ASP CA   C  -70.917  -4.204  -23.627 1.00 . B B . 168 ASP CA   1 1 
        1   4588 2 2 168 ASP CB   C  -70.073  -3.090  -23.017 1.00 . B B . 168 ASP CB   1 1 
        1   4589 2 2 168 ASP CG   C  -69.047  -2.558  -23.997 1.00 . B B . 168 ASP CG   1 1 
        1   4590 2 2 168 ASP H    H  -71.214  -2.878  -25.239 1.00 . B B . 168 ASP H    1 1 
        1   4591 2 2 168 ASP HA   H  -70.264  -5.050  -23.782 1.00 . B B . 168 ASP HA   1 1 
        1   4592 2 2 168 ASP HB2  H  -70.722  -2.282  -22.717 1.00 . B B . 168 ASP HB2  1 1 
        1   4593 2 2 168 ASP HB3  H  -69.563  -3.474  -22.145 1.00 . B B . 168 ASP HB3  1 1 
        1   4594 2 2 168 ASP N    N  -71.400  -3.793  -24.941 1.00 . B B . 168 ASP N    1 1 
        1   4595 2 2 168 ASP O    O  -72.942  -3.909  -22.351 1.00 . B B . 168 ASP O    1 1 
        1   4596 2 2 168 ASP OD1  O  -68.359  -3.390  -24.634 1.00 . B B . 168 ASP OD1  1 1 
        1   4597 2 2 168 ASP OD2  O  -68.944  -1.320  -24.148 1.00 . B B . 168 ASP OD2  1 1 
        1   4598 2 2 169 ILE C    C  -72.198  -7.746  -20.675 1.00 . B B . 169 ILE C    1 1 
        1   4599 2 2 169 ILE CA   C  -72.887  -6.600  -21.431 1.00 . B B . 169 ILE CA   1 1 
        1   4600 2 2 169 ILE CB   C  -74.130  -7.095  -22.243 1.00 . B B . 169 ILE CB   1 1 
        1   4601 2 2 169 ILE CD1  C  -76.421  -8.181  -22.012 1.00 . B B . 169 ILE CD1  1 1 
        1   4602 2 2 169 ILE CG1  C  -75.105  -7.869  -21.347 1.00 . B B . 169 ILE CG1  1 1 
        1   4603 2 2 169 ILE CG2  C  -73.705  -7.928  -23.456 1.00 . B B . 169 ILE CG2  1 1 
        1   4604 2 2 169 ILE H    H  -71.158  -6.457  -22.624 1.00 . B B . 169 ILE H    1 1 
        1   4605 2 2 169 ILE HA   H  -73.228  -5.880  -20.699 1.00 . B B . 169 ILE HA   1 1 
        1   4606 2 2 169 ILE HB   H  -74.642  -6.217  -22.616 1.00 . B B . 169 ILE HB   1 1 
        1   4607 2 2 169 ILE HD11 H  -76.243  -8.521  -23.021 1.00 . B B . 169 ILE HD11 1 1 
        1   4608 2 2 169 ILE HD12 H  -77.032  -7.290  -22.035 1.00 . B B . 169 ILE HD12 1 1 
        1   4609 2 2 169 ILE HD13 H  -76.931  -8.954  -21.457 1.00 . B B . 169 ILE HD13 1 1 
        1   4610 2 2 169 ILE HG12 H  -74.642  -8.798  -21.053 1.00 . B B . 169 ILE HG12 1 1 
        1   4611 2 2 169 ILE HG13 H  -75.293  -7.283  -20.458 1.00 . B B . 169 ILE HG13 1 1 
        1   4612 2 2 169 ILE HG21 H  -73.825  -7.341  -24.355 1.00 . B B . 169 ILE HG21 1 1 
        1   4613 2 2 169 ILE HG22 H  -74.321  -8.812  -23.519 1.00 . B B . 169 ILE HG22 1 1 
        1   4614 2 2 169 ILE HG23 H  -72.669  -8.216  -23.350 1.00 . B B . 169 ILE HG23 1 1 
        1   4615 2 2 169 ILE N    N  -71.917  -5.934  -22.293 1.00 . B B . 169 ILE N    1 1 
        1   4616 2 2 169 ILE O    O  -71.723  -8.708  -21.285 1.00 . B B . 169 ILE O    1 1 
        1   4617 2 2 170 ASN C    C  -72.633  -9.588  -17.985 1.00 . B B . 170 ASN C    1 1 
        1   4618 2 2 170 ASN CA   C  -71.537  -8.669  -18.520 1.00 . B B . 170 ASN CA   1 1 
        1   4619 2 2 170 ASN CB   C  -70.664  -8.088  -17.394 1.00 . B B . 170 ASN CB   1 1 
        1   4620 2 2 170 ASN CG   C  -69.661  -9.102  -16.838 1.00 . B B . 170 ASN CG   1 1 
        1   4621 2 2 170 ASN H    H  -72.493  -6.820  -18.922 1.00 . B B . 170 ASN H    1 1 
        1   4622 2 2 170 ASN HA   H  -70.898  -9.266  -19.157 1.00 . B B . 170 ASN HA   1 1 
        1   4623 2 2 170 ASN HB2  H  -70.121  -7.239  -17.777 1.00 . B B . 170 ASN HB2  1 1 
        1   4624 2 2 170 ASN HB3  H  -71.308  -7.756  -16.592 1.00 . B B . 170 ASN HB3  1 1 
        1   4625 2 2 170 ASN HD21 H  -69.818  -8.314  -14.997 1.00 . B B . 170 ASN HD21 1 1 
        1   4626 2 2 170 ASN HD22 H  -68.751  -9.627  -15.127 1.00 . B B . 170 ASN HD22 1 1 
        1   4627 2 2 170 ASN N    N  -72.119  -7.619  -19.350 1.00 . B B . 170 ASN N    1 1 
        1   4628 2 2 170 ASN ND2  N  -69.386  -9.006  -15.540 1.00 . B B . 170 ASN ND2  1 1 
        1   4629 2 2 170 ASN O    O  -73.368  -9.246  -17.052 1.00 . B B . 170 ASN O    1 1 
        1   4630 2 2 170 ASN OD1  O  -69.138  -9.951  -17.566 1.00 . B B . 170 ASN OD1  1 1 
        1   4631 2 2 171 VAL C    C  -73.252 -12.764  -17.303 1.00 . B B . 171 VAL C    1 1 
        1   4632 2 2 171 VAL CA   C  -73.773 -11.731  -18.301 1.00 . B B . 171 VAL CA   1 1 
        1   4633 2 2 171 VAL CB   C  -74.334 -12.400  -19.588 1.00 . B B . 171 VAL CB   1 1 
        1   4634 2 2 171 VAL CG1  C  -75.245 -13.567  -19.250 1.00 . B B . 171 VAL CG1  1 1 
        1   4635 2 2 171 VAL CG2  C  -75.078 -11.375  -20.445 1.00 . B B . 171 VAL CG2  1 1 
        1   4636 2 2 171 VAL H    H  -72.119 -10.947  -19.350 1.00 . B B . 171 VAL H    1 1 
        1   4637 2 2 171 VAL HA   H  -74.585 -11.200  -17.824 1.00 . B B . 171 VAL HA   1 1 
        1   4638 2 2 171 VAL HB   H  -73.498 -12.782  -20.159 1.00 . B B . 171 VAL HB   1 1 
        1   4639 2 2 171 VAL HG11 H  -75.269 -14.257  -20.080 1.00 . B B . 171 VAL HG11 1 1 
        1   4640 2 2 171 VAL HG12 H  -76.243 -13.200  -19.058 1.00 . B B . 171 VAL HG12 1 1 
        1   4641 2 2 171 VAL HG13 H  -74.873 -14.072  -18.372 1.00 . B B . 171 VAL HG13 1 1 
        1   4642 2 2 171 VAL HG21 H  -74.542 -11.222  -21.370 1.00 . B B . 171 VAL HG21 1 1 
        1   4643 2 2 171 VAL HG22 H  -75.146 -10.440  -19.909 1.00 . B B . 171 VAL HG22 1 1 
        1   4644 2 2 171 VAL HG23 H  -76.071 -11.740  -20.660 1.00 . B B . 171 VAL HG23 1 1 
        1   4645 2 2 171 VAL N    N  -72.734 -10.757  -18.611 1.00 . B B . 171 VAL N    1 1 
        1   4646 2 2 171 VAL O    O  -72.270 -13.462  -17.565 1.00 . B B . 171 VAL O    1 1 
        1   4647 2 2 172 LYS C    C  -74.500 -14.742  -14.695 1.00 . B B . 172 LYS C    1 1 
        1   4648 2 2 172 LYS CA   C  -73.494 -13.648  -15.022 1.00 . B B . 172 LYS CA   1 1 
        1   4649 2 2 172 LYS CB   C  -73.286 -12.751  -13.796 1.00 . B B . 172 LYS CB   1 1 
        1   4650 2 2 172 LYS CD   C  -74.170 -10.817  -12.378 1.00 . B B . 172 LYS CD   1 1 
        1   4651 2 2 172 LYS CE   C  -75.025 -11.424  -11.276 1.00 . B B . 172 LYS CE   1 1 
        1   4652 2 2 172 LYS CG   C  -74.290 -11.597  -13.687 1.00 . B B . 172 LYS CG   1 1 
        1   4653 2 2 172 LYS H    H  -74.697 -12.244  -16.036 1.00 . B B . 172 LYS H    1 1 
        1   4654 2 2 172 LYS HA   H  -72.551 -14.110  -15.270 1.00 . B B . 172 LYS HA   1 1 
        1   4655 2 2 172 LYS HB2  H  -73.368 -13.358  -12.908 1.00 . B B . 172 LYS HB2  1 1 
        1   4656 2 2 172 LYS HB3  H  -72.287 -12.339  -13.839 1.00 . B B . 172 LYS HB3  1 1 
        1   4657 2 2 172 LYS HD2  H  -73.138 -10.818  -12.062 1.00 . B B . 172 LYS HD2  1 1 
        1   4658 2 2 172 LYS HD3  H  -74.484  -9.797  -12.548 1.00 . B B . 172 LYS HD3  1 1 
        1   4659 2 2 172 LYS HE2  H  -76.038 -11.516  -11.636 1.00 . B B . 172 LYS HE2  1 1 
        1   4660 2 2 172 LYS HE3  H  -74.648 -12.406  -11.032 1.00 . B B . 172 LYS HE3  1 1 
        1   4661 2 2 172 LYS HG2  H  -74.133 -10.918  -14.511 1.00 . B B . 172 LYS HG2  1 1 
        1   4662 2 2 172 LYS HG3  H  -75.289 -12.003  -13.760 1.00 . B B . 172 LYS HG3  1 1 
        1   4663 2 2 172 LYS HZ1  H  -74.094 -10.146   -9.929 1.00 . B B . 172 LYS HZ1  1 1 
        1   4664 2 2 172 LYS HZ2  H  -75.255 -11.169   -9.227 1.00 . B B . 172 LYS HZ2  1 1 
        1   4665 2 2 172 LYS HZ3  H  -75.745  -9.831  -10.153 1.00 . B B . 172 LYS HZ3  1 1 
        1   4666 2 2 172 LYS N    N  -73.928 -12.839  -16.158 1.00 . B B . 172 LYS N    1 1 
        1   4667 2 2 172 LYS NZ   N  -75.030 -10.579  -10.055 1.00 . B B . 172 LYS NZ   1 1 
        1   4668 2 2 172 LYS O    O  -75.665 -14.450  -14.405 1.00 . B B . 172 LYS O    1 1 
        1   4669 2 2 173 TRP C    C  -74.950 -17.382  -12.875 1.00 . B B . 173 TRP C    1 1 
        1   4670 2 2 173 TRP CA   C  -74.867 -17.162  -14.397 1.00 . B B . 173 TRP CA   1 1 
        1   4671 2 2 173 TRP CB   C  -74.315 -18.434  -15.051 1.00 . B B . 173 TRP CB   1 1 
        1   4672 2 2 173 TRP CD1  C  -73.708 -18.213  -17.552 1.00 . B B . 173 TRP CD1  1 1 
        1   4673 2 2 173 TRP CD2  C  -75.688 -19.203  -17.184 1.00 . B B . 173 TRP CD2  1 1 
        1   4674 2 2 173 TRP CE2  C  -75.464 -19.141  -18.581 1.00 . B B . 173 TRP CE2  1 1 
        1   4675 2 2 173 TRP CE3  C  -76.878 -19.783  -16.715 1.00 . B B . 173 TRP CE3  1 1 
        1   4676 2 2 173 TRP CG   C  -74.553 -18.589  -16.544 1.00 . B B . 173 TRP CG   1 1 
        1   4677 2 2 173 TRP CH2  C  -77.541 -20.207  -19.024 1.00 . B B . 173 TRP CH2  1 1 
        1   4678 2 2 173 TRP CZ2  C  -76.387 -19.642  -19.512 1.00 . B B . 173 TRP CZ2  1 1 
        1   4679 2 2 173 TRP CZ3  C  -77.794 -20.283  -17.644 1.00 . B B . 173 TRP CZ3  1 1 
        1   4680 2 2 173 TRP H    H  -73.102 -16.141  -14.986 1.00 . B B . 173 TRP H    1 1 
        1   4681 2 2 173 TRP HA   H  -75.866 -16.994  -14.772 1.00 . B B . 173 TRP HA   1 1 
        1   4682 2 2 173 TRP HB2  H  -73.251 -18.460  -14.884 1.00 . B B . 173 TRP HB2  1 1 
        1   4683 2 2 173 TRP HB3  H  -74.753 -19.284  -14.545 1.00 . B B . 173 TRP HB3  1 1 
        1   4684 2 2 173 TRP HD1  H  -72.755 -17.725  -17.409 1.00 . B B . 173 TRP HD1  1 1 
        1   4685 2 2 173 TRP HE1  H  -73.852 -18.366  -19.653 1.00 . B B . 173 TRP HE1  1 1 
        1   4686 2 2 173 TRP HE3  H  -77.079 -19.845  -15.655 1.00 . B B . 173 TRP HE3  1 1 
        1   4687 2 2 173 TRP HH2  H  -78.269 -20.603  -19.717 1.00 . B B . 173 TRP HH2  1 1 
        1   4688 2 2 173 TRP HZ2  H  -76.197 -19.585  -20.574 1.00 . B B . 173 TRP HZ2  1 1 
        1   4689 2 2 173 TRP HZ3  H  -78.711 -20.735  -17.296 1.00 . B B . 173 TRP HZ3  1 1 
        1   4690 2 2 173 TRP N    N  -74.040 -15.995  -14.745 1.00 . B B . 173 TRP N    1 1 
        1   4691 2 2 173 TRP NE1  N  -74.251 -18.535  -18.774 1.00 . B B . 173 TRP NE1  1 1 
        1   4692 2 2 173 TRP O    O  -73.970 -17.161  -12.160 1.00 . B B . 173 TRP O    1 1 
        1   4693 2 2 174 LYS C    C  -76.940 -19.520  -10.779 1.00 . B B . 174 LYS C    1 1 
        1   4694 2 2 174 LYS CA   C  -76.339 -18.133  -10.969 1.00 . B B . 174 LYS CA   1 1 
        1   4695 2 2 174 LYS CB   C  -77.264 -17.106  -10.290 1.00 . B B . 174 LYS CB   1 1 
        1   4696 2 2 174 LYS CD   C  -77.437 -14.894   -9.091 1.00 . B B . 174 LYS CD   1 1 
        1   4697 2 2 174 LYS CE   C  -76.961 -13.456   -9.038 1.00 . B B . 174 LYS CE   1 1 
        1   4698 2 2 174 LYS CG   C  -76.732 -15.672  -10.197 1.00 . B B . 174 LYS CG   1 1 
        1   4699 2 2 174 LYS H    H  -76.851 -17.980  -13.025 1.00 . B B . 174 LYS H    1 1 
        1   4700 2 2 174 LYS HA   H  -75.383 -18.108  -10.467 1.00 . B B . 174 LYS HA   1 1 
        1   4701 2 2 174 LYS HB2  H  -78.192 -17.078  -10.837 1.00 . B B . 174 LYS HB2  1 1 
        1   4702 2 2 174 LYS HB3  H  -77.475 -17.458   -9.289 1.00 . B B . 174 LYS HB3  1 1 
        1   4703 2 2 174 LYS HD2  H  -78.501 -14.907   -9.273 1.00 . B B . 174 LYS HD2  1 1 
        1   4704 2 2 174 LYS HD3  H  -77.235 -15.369   -8.142 1.00 . B B . 174 LYS HD3  1 1 
        1   4705 2 2 174 LYS HE2  H  -75.894 -13.434   -9.199 1.00 . B B . 174 LYS HE2  1 1 
        1   4706 2 2 174 LYS HE3  H  -77.445 -12.897   -9.826 1.00 . B B . 174 LYS HE3  1 1 
        1   4707 2 2 174 LYS HG2  H  -75.673 -15.701   -9.989 1.00 . B B . 174 LYS HG2  1 1 
        1   4708 2 2 174 LYS HG3  H  -76.894 -15.172  -11.141 1.00 . B B . 174 LYS HG3  1 1 
        1   4709 2 2 174 LYS HZ1  H  -76.906 -11.840   -7.728 1.00 . B B . 174 LYS HZ1  1 1 
        1   4710 2 2 174 LYS HZ2  H  -76.802 -13.355   -6.966 1.00 . B B . 174 LYS HZ2  1 1 
        1   4711 2 2 174 LYS HZ3  H  -78.291 -12.808   -7.575 1.00 . B B . 174 LYS HZ3  1 1 
        1   4712 2 2 174 LYS N    N  -76.117 -17.822  -12.395 1.00 . B B . 174 LYS N    1 1 
        1   4713 2 2 174 LYS NZ   N  -77.263 -12.816   -7.728 1.00 . B B . 174 LYS NZ   1 1 
        1   4714 2 2 174 LYS O    O  -77.974 -19.854  -11.370 1.00 . B B . 174 LYS O    1 1 
        1   4715 2 2 175 ILE C    C  -77.476 -21.294   -8.107 1.00 . B B . 175 ILE C    1 1 
        1   4716 2 2 175 ILE CA   C  -76.881 -21.576   -9.492 1.00 . B B . 175 ILE CA   1 1 
        1   4717 2 2 175 ILE CB   C  -75.874 -22.767   -9.453 1.00 . B B . 175 ILE CB   1 1 
        1   4718 2 2 175 ILE CD1  C  -75.180 -22.710  -11.951 1.00 . B B . 175 ILE CD1  1 1 
        1   4719 2 2 175 ILE CG1  C  -74.747 -22.602  -10.488 1.00 . B B . 175 ILE CG1  1 1 
        1   4720 2 2 175 ILE CG2  C  -76.608 -24.085   -9.636 1.00 . B B . 175 ILE CG2  1 1 
        1   4721 2 2 175 ILE H    H  -75.469 -20.001   -9.518 1.00 . B B . 175 ILE H    1 1 
        1   4722 2 2 175 ILE HA   H  -77.693 -21.829  -10.163 1.00 . B B . 175 ILE HA   1 1 
        1   4723 2 2 175 ILE HB   H  -75.426 -22.781   -8.466 1.00 . B B . 175 ILE HB   1 1 
        1   4724 2 2 175 ILE HD11 H  -74.320 -22.583  -12.592 1.00 . B B . 175 ILE HD11 1 1 
        1   4725 2 2 175 ILE HD12 H  -75.908 -21.942  -12.169 1.00 . B B . 175 ILE HD12 1 1 
        1   4726 2 2 175 ILE HD13 H  -75.619 -23.681  -12.126 1.00 . B B . 175 ILE HD13 1 1 
        1   4727 2 2 175 ILE HG12 H  -74.295 -21.634  -10.345 1.00 . B B . 175 ILE HG12 1 1 
        1   4728 2 2 175 ILE HG13 H  -73.997 -23.357  -10.294 1.00 . B B . 175 ILE HG13 1 1 
        1   4729 2 2 175 ILE HG21 H  -77.671 -23.900   -9.691 1.00 . B B . 175 ILE HG21 1 1 
        1   4730 2 2 175 ILE HG22 H  -76.399 -24.734   -8.798 1.00 . B B . 175 ILE HG22 1 1 
        1   4731 2 2 175 ILE HG23 H  -76.278 -24.558  -10.549 1.00 . B B . 175 ILE HG23 1 1 
        1   4732 2 2 175 ILE N    N  -76.285 -20.327   -9.952 1.00 . B B . 175 ILE N    1 1 
        1   4733 2 2 175 ILE O    O  -76.746 -21.235   -7.105 1.00 . B B . 175 ILE O    1 1 
        1   4734 2 2 176 ASP C    C  -79.080 -19.359   -6.230 1.00 . B B . 176 ASP C    1 1 
        1   4735 2 2 176 ASP CA   C  -79.593 -20.636   -6.920 1.00 . B B . 176 ASP CA   1 1 
        1   4736 2 2 176 ASP CB   C  -79.935 -21.759   -5.900 1.00 . B B . 176 ASP CB   1 1 
        1   4737 2 2 176 ASP CG   C  -78.882 -22.880   -5.832 1.00 . B B . 176 ASP CG   1 1 
        1   4738 2 2 176 ASP H    H  -79.275 -21.181   -8.940 1.00 . B B . 176 ASP H    1 1 
        1   4739 2 2 176 ASP HA   H  -80.544 -20.344   -7.347 1.00 . B B . 176 ASP HA   1 1 
        1   4740 2 2 176 ASP HB2  H  -80.026 -21.317   -4.920 1.00 . B B . 176 ASP HB2  1 1 
        1   4741 2 2 176 ASP HB3  H  -80.888 -22.191   -6.172 1.00 . B B . 176 ASP HB3  1 1 
        1   4742 2 2 176 ASP N    N  -78.803 -21.113   -8.083 1.00 . B B . 176 ASP N    1 1 
        1   4743 2 2 176 ASP O    O  -79.864 -18.622   -5.618 1.00 . B B . 176 ASP O    1 1 
        1   4744 2 2 176 ASP OD1  O  -77.743 -22.628   -5.377 1.00 . B B . 176 ASP OD1  1 1 
        1   4745 2 2 176 ASP OD2  O  -79.204 -24.026   -6.218 1.00 . B B . 176 ASP OD2  1 1 
        1   4746 2 2 177 GLY C    C  -75.578 -18.156   -5.774 1.00 . B B . 177 GLY C    1 1 
        1   4747 2 2 177 GLY CA   C  -77.090 -17.967   -5.738 1.00 . B B . 177 GLY CA   1 1 
        1   4748 2 2 177 GLY H    H  -77.238 -19.729   -6.889 1.00 . B B . 177 GLY H    1 1 
        1   4749 2 2 177 GLY HA2  H  -77.348 -17.061   -6.266 1.00 . B B . 177 GLY HA2  1 1 
        1   4750 2 2 177 GLY HA3  H  -77.411 -17.883   -4.710 1.00 . B B . 177 GLY HA3  1 1 
        1   4751 2 2 177 GLY N    N  -77.778 -19.100   -6.365 1.00 . B B . 177 GLY N    1 1 
        1   4752 2 2 177 GLY O    O  -74.825 -17.181   -5.896 1.00 . B B . 177 GLY O    1 1 
        1   4753 2 2 178 SER C    C  -73.309 -19.746   -7.248 1.00 . B B . 178 SER C    1 1 
        1   4754 2 2 178 SER CA   C  -73.735 -19.813   -5.785 1.00 . B B . 178 SER CA   1 1 
        1   4755 2 2 178 SER CB   C  -73.523 -21.232   -5.248 1.00 . B B . 178 SER CB   1 1 
        1   4756 2 2 178 SER H    H  -75.816 -20.126   -5.560 1.00 . B B . 178 SER H    1 1 
        1   4757 2 2 178 SER HA   H  -73.128 -19.127   -5.212 1.00 . B B . 178 SER HA   1 1 
        1   4758 2 2 178 SER HB2  H  -74.046 -21.932   -5.876 1.00 . B B . 178 SER HB2  1 1 
        1   4759 2 2 178 SER HB3  H  -72.465 -21.462   -5.273 1.00 . B B . 178 SER HB3  1 1 
        1   4760 2 2 178 SER HG   H  -73.265 -21.255   -3.327 1.00 . B B . 178 SER HG   1 1 
        1   4761 2 2 178 SER N    N  -75.146 -19.418   -5.660 1.00 . B B . 178 SER N    1 1 
        1   4762 2 2 178 SER O    O  -73.909 -20.397   -8.111 1.00 . B B . 178 SER O    1 1 
        1   4763 2 2 178 SER OG   O  -74.008 -21.357   -3.927 1.00 . B B . 178 SER OG   1 1 
        1   4764 2 2 179 GLU C    C  -70.609 -19.208   -9.422 1.00 . B B . 179 GLU C    1 1 
        1   4765 2 2 179 GLU CA   C  -71.934 -18.629   -8.909 1.00 . B B . 179 GLU CA   1 1 
        1   4766 2 2 179 GLU CB   C  -72.000 -17.103   -9.099 1.00 . B B . 179 GLU CB   1 1 
        1   4767 2 2 179 GLU CD   C  -73.492 -15.001   -8.998 1.00 . B B . 179 GLU CD   1 1 
        1   4768 2 2 179 GLU CG   C  -73.407 -16.520   -8.850 1.00 . B B . 179 GLU CG   1 1 
        1   4769 2 2 179 GLU H    H  -71.822 -18.490   -6.799 1.00 . B B . 179 GLU H    1 1 
        1   4770 2 2 179 GLU HA   H  -72.713 -19.051   -9.527 1.00 . B B . 179 GLU HA   1 1 
        1   4771 2 2 179 GLU HB2  H  -71.309 -16.639   -8.412 1.00 . B B . 179 GLU HB2  1 1 
        1   4772 2 2 179 GLU HB3  H  -71.697 -16.866  -10.108 1.00 . B B . 179 GLU HB3  1 1 
        1   4773 2 2 179 GLU HG2  H  -74.093 -16.968   -9.552 1.00 . B B . 179 GLU HG2  1 1 
        1   4774 2 2 179 GLU HG3  H  -73.717 -16.790   -7.850 1.00 . B B . 179 GLU HG3  1 1 
        1   4775 2 2 179 GLU N    N  -72.265 -18.972   -7.528 1.00 . B B . 179 GLU N    1 1 
        1   4776 2 2 179 GLU O    O  -69.544 -18.631   -9.195 1.00 . B B . 179 GLU O    1 1 
        1   4777 2 2 179 GLU OE1  O  -72.820 -14.431   -9.893 1.00 . B B . 179 GLU OE1  1 1 
        1   4778 2 2 179 GLU OE2  O  -74.245 -14.378   -8.213 1.00 . B B . 179 GLU OE2  1 1 
        1   4779 2 2 180 ARG C    C  -69.431 -20.516  -12.298 1.00 . B B . 180 ARG C    1 1 
        1   4780 2 2 180 ARG CA   C  -69.551 -20.965  -10.823 1.00 . B B . 180 ARG CA   1 1 
        1   4781 2 2 180 ARG CB   C  -69.613 -22.499  -10.724 1.00 . B B . 180 ARG CB   1 1 
        1   4782 2 2 180 ARG CD   C  -71.401 -23.312  -12.405 1.00 . B B . 180 ARG CD   1 1 
        1   4783 2 2 180 ARG CG   C  -71.012 -23.122  -10.929 1.00 . B B . 180 ARG CG   1 1 
        1   4784 2 2 180 ARG CZ   C  -69.940 -25.206  -13.070 1.00 . B B . 180 ARG CZ   1 1 
        1   4785 2 2 180 ARG H    H  -71.587 -20.732  -10.256 1.00 . B B . 180 ARG H    1 1 
        1   4786 2 2 180 ARG HA   H  -68.653 -20.643  -10.316 1.00 . B B . 180 ARG HA   1 1 
        1   4787 2 2 180 ARG HB2  H  -68.951 -22.913  -11.467 1.00 . B B . 180 ARG HB2  1 1 
        1   4788 2 2 180 ARG HB3  H  -69.248 -22.788   -9.748 1.00 . B B . 180 ARG HB3  1 1 
        1   4789 2 2 180 ARG HD2  H  -72.285 -23.928  -12.455 1.00 . B B . 180 ARG HD2  1 1 
        1   4790 2 2 180 ARG HD3  H  -71.632 -22.344  -12.829 1.00 . B B . 180 ARG HD3  1 1 
        1   4791 2 2 180 ARG HE   H  -69.912 -23.397  -13.888 1.00 . B B . 180 ARG HE   1 1 
        1   4792 2 2 180 ARG HG2  H  -71.009 -24.096  -10.463 1.00 . B B . 180 ARG HG2  1 1 
        1   4793 2 2 180 ARG HG3  H  -71.753 -22.509  -10.438 1.00 . B B . 180 ARG HG3  1 1 
        1   4794 2 2 180 ARG HH11 H  -71.192 -25.668  -11.546 1.00 . B B . 180 ARG HH11 1 1 
        1   4795 2 2 180 ARG HH12 H  -70.155 -26.953  -12.067 1.00 . B B . 180 ARG HH12 1 1 
        1   4796 2 2 180 ARG HH21 H  -68.567 -25.073  -14.545 1.00 . B B . 180 ARG HH21 1 1 
        1   4797 2 2 180 ARG HH22 H  -68.669 -26.615  -13.763 1.00 . B B . 180 ARG HH22 1 1 
        1   4798 2 2 180 ARG N    N  -70.698 -20.344  -10.119 1.00 . B B . 180 ARG N    1 1 
        1   4799 2 2 180 ARG NE   N  -70.349 -23.944  -13.202 1.00 . B B . 180 ARG NE   1 1 
        1   4800 2 2 180 ARG NH1  N  -70.473 -26.009  -12.151 1.00 . B B . 180 ARG NH1  1 1 
        1   4801 2 2 180 ARG NH2  N  -68.980 -25.670  -13.857 1.00 . B B . 180 ARG NH2  1 1 
        1   4802 2 2 180 ARG O    O  -70.396 -20.002  -12.878 1.00 . B B . 180 ARG O    1 1 
        1   4803 2 2 181 GLN C    C  -67.418 -21.071  -15.301 1.00 . B B . 181 GLN C    1 1 
        1   4804 2 2 181 GLN CA   C  -67.987 -20.128  -14.225 1.00 . B B . 181 GLN CA   1 1 
        1   4805 2 2 181 GLN CB   C  -67.101 -18.887  -14.078 1.00 . B B . 181 GLN CB   1 1 
        1   4806 2 2 181 GLN CD   C  -67.637 -17.682  -16.283 1.00 . B B . 181 GLN CD   1 1 
        1   4807 2 2 181 GLN CG   C  -67.664 -17.632  -14.750 1.00 . B B . 181 GLN CG   1 1 
        1   4808 2 2 181 GLN H    H  -67.526 -21.139  -12.409 1.00 . B B . 181 GLN H    1 1 
        1   4809 2 2 181 GLN HA   H  -68.936 -19.779  -14.600 1.00 . B B . 181 GLN HA   1 1 
        1   4810 2 2 181 GLN HB2  H  -66.955 -18.683  -13.029 1.00 . B B . 181 GLN HB2  1 1 
        1   4811 2 2 181 GLN HB3  H  -66.139 -19.109  -14.519 1.00 . B B . 181 GLN HB3  1 1 
        1   4812 2 2 181 GLN HE21 H  -69.316 -16.577  -16.396 1.00 . B B . 181 GLN HE21 1 1 
        1   4813 2 2 181 GLN HE22 H  -68.661 -17.039  -17.892 1.00 . B B . 181 GLN HE22 1 1 
        1   4814 2 2 181 GLN HG2  H  -68.685 -17.499  -14.431 1.00 . B B . 181 GLN HG2  1 1 
        1   4815 2 2 181 GLN HG3  H  -67.087 -16.779  -14.421 1.00 . B B . 181 GLN HG3  1 1 
        1   4816 2 2 181 GLN N    N  -68.258 -20.719  -12.906 1.00 . B B . 181 GLN N    1 1 
        1   4817 2 2 181 GLN NE2  N  -68.626 -17.043  -16.913 1.00 . B B . 181 GLN NE2  1 1 
        1   4818 2 2 181 GLN O    O  -67.827 -20.988  -16.461 1.00 . B B . 181 GLN O    1 1 
        1   4819 2 2 181 GLN OE1  O  -66.736 -18.272  -16.890 1.00 . B B . 181 GLN OE1  1 1 
        1   4820 2 2 182 ASN C    C  -66.800 -23.643  -16.827 1.00 . B B . 182 ASN C    1 1 
        1   4821 2 2 182 ASN CA   C  -65.840 -22.881  -15.881 1.00 . B B . 182 ASN CA   1 1 
        1   4822 2 2 182 ASN CB   C  -64.882 -23.847  -15.150 1.00 . B B . 182 ASN CB   1 1 
        1   4823 2 2 182 ASN CG   C  -65.560 -24.621  -14.003 1.00 . B B . 182 ASN CG   1 1 
        1   4824 2 2 182 ASN H    H  -66.202 -21.965  -13.989 1.00 . B B . 182 ASN H    1 1 
        1   4825 2 2 182 ASN HA   H  -65.222 -22.266  -16.519 1.00 . B B . 182 ASN HA   1 1 
        1   4826 2 2 182 ASN HB2  H  -64.494 -24.557  -15.863 1.00 . B B . 182 ASN HB2  1 1 
        1   4827 2 2 182 ASN HB3  H  -64.057 -23.276  -14.746 1.00 . B B . 182 ASN HB3  1 1 
        1   4828 2 2 182 ASN HD21 H  -63.897 -25.711  -13.699 1.00 . B B . 182 ASN HD21 1 1 
        1   4829 2 2 182 ASN HD22 H  -65.193 -26.079  -12.666 1.00 . B B . 182 ASN HD22 1 1 
        1   4830 2 2 182 ASN N    N  -66.487 -21.951  -14.926 1.00 . B B . 182 ASN N    1 1 
        1   4831 2 2 182 ASN ND2  N  -64.818 -25.552  -13.403 1.00 . B B . 182 ASN ND2  1 1 
        1   4832 2 2 182 ASN O    O  -67.437 -24.624  -16.438 1.00 . B B . 182 ASN O    1 1 
        1   4833 2 2 182 ASN OD1  O  -66.726 -24.383  -13.664 1.00 . B B . 182 ASN OD1  1 1 
        1   4834 2 2 183 GLY C    C  -68.961 -22.937  -19.448 1.00 . B B . 183 GLY C    1 1 
        1   4835 2 2 183 GLY CA   C  -67.766 -23.793  -19.076 1.00 . B B . 183 GLY CA   1 1 
        1   4836 2 2 183 GLY H    H  -66.374 -22.384  -18.320 1.00 . B B . 183 GLY H    1 1 
        1   4837 2 2 183 GLY HA2  H  -67.184 -23.978  -19.967 1.00 . B B . 183 GLY HA2  1 1 
        1   4838 2 2 183 GLY HA3  H  -68.121 -24.738  -18.692 1.00 . B B . 183 GLY HA3  1 1 
        1   4839 2 2 183 GLY N    N  -66.900 -23.172  -18.069 1.00 . B B . 183 GLY N    1 1 
        1   4840 2 2 183 GLY O    O  -70.092 -23.408  -19.419 1.00 . B B . 183 GLY O    1 1 
        1   4841 2 2 184 VAL C    C  -69.349 -19.856  -21.339 1.00 . B B . 184 VAL C    1 1 
        1   4842 2 2 184 VAL CA   C  -69.739 -20.691  -20.107 1.00 . B B . 184 VAL CA   1 1 
        1   4843 2 2 184 VAL CB   C  -70.021 -19.779  -18.870 1.00 . B B . 184 VAL CB   1 1 
        1   4844 2 2 184 VAL CG1  C  -70.669 -18.455  -19.277 1.00 . B B . 184 VAL CG1  1 1 
        1   4845 2 2 184 VAL CG2  C  -70.881 -20.507  -17.843 1.00 . B B . 184 VAL CG2  1 1 
        1   4846 2 2 184 VAL H    H  -67.764 -21.388  -19.808 1.00 . B B . 184 VAL H    1 1 
        1   4847 2 2 184 VAL HA   H  -70.648 -21.226  -20.343 1.00 . B B . 184 VAL HA   1 1 
        1   4848 2 2 184 VAL HB   H  -69.069 -19.549  -18.410 1.00 . B B . 184 VAL HB   1 1 
        1   4849 2 2 184 VAL HG11 H  -71.741 -18.579  -19.326 1.00 . B B . 184 VAL HG11 1 1 
        1   4850 2 2 184 VAL HG12 H  -70.297 -18.155  -20.245 1.00 . B B . 184 VAL HG12 1 1 
        1   4851 2 2 184 VAL HG13 H  -70.428 -17.697  -18.547 1.00 . B B . 184 VAL HG13 1 1 
        1   4852 2 2 184 VAL HG21 H  -70.931 -21.557  -18.094 1.00 . B B . 184 VAL HG21 1 1 
        1   4853 2 2 184 VAL HG22 H  -71.877 -20.089  -17.845 1.00 . B B . 184 VAL HG22 1 1 
        1   4854 2 2 184 VAL HG23 H  -70.445 -20.392  -16.862 1.00 . B B . 184 VAL HG23 1 1 
        1   4855 2 2 184 VAL N    N  -68.699 -21.682  -19.804 1.00 . B B . 184 VAL N    1 1 
        1   4856 2 2 184 VAL O    O  -68.734 -18.790  -21.216 1.00 . B B . 184 VAL O    1 1 
        1   4857 2 2 185 LEU C    C  -70.277 -18.967  -24.582 1.00 . B B . 185 LEU C    1 1 
        1   4858 2 2 185 LEU CA   C  -69.231 -19.779  -23.801 1.00 . B B . 185 LEU CA   1 1 
        1   4859 2 2 185 LEU CB   C  -68.640 -20.882  -24.685 1.00 . B B . 185 LEU CB   1 1 
        1   4860 2 2 185 LEU CD1  C  -66.574 -21.047  -23.115 1.00 . B B . 185 LEU CD1  1 1 
        1   4861 2 2 185 LEU CD2  C  -67.142 -22.862  -24.768 1.00 . B B . 185 LEU CD2  1 1 
        1   4862 2 2 185 LEU CG   C  -67.198 -21.366  -24.483 1.00 . B B . 185 LEU CG   1 1 
        1   4863 2 2 185 LEU H    H  -70.200 -21.197  -22.549 1.00 . B B . 185 LEU H    1 1 
        1   4864 2 2 185 LEU HA   H  -68.425 -19.102  -23.559 1.00 . B B . 185 LEU HA   1 1 
        1   4865 2 2 185 LEU HB2  H  -69.270 -21.747  -24.571 1.00 . B B . 185 LEU HB2  1 1 
        1   4866 2 2 185 LEU HB3  H  -68.738 -20.550  -25.711 1.00 . B B . 185 LEU HB3  1 1 
        1   4867 2 2 185 LEU HD11 H  -65.588 -20.630  -23.257 1.00 . B B . 185 LEU HD11 1 1 
        1   4868 2 2 185 LEU HD12 H  -66.500 -21.954  -22.532 1.00 . B B . 185 LEU HD12 1 1 
        1   4869 2 2 185 LEU HD13 H  -67.195 -20.334  -22.593 1.00 . B B . 185 LEU HD13 1 1 
        1   4870 2 2 185 LEU HD21 H  -66.473 -23.337  -24.066 1.00 . B B . 185 LEU HD21 1 1 
        1   4871 2 2 185 LEU HD22 H  -66.783 -23.024  -25.774 1.00 . B B . 185 LEU HD22 1 1 
        1   4872 2 2 185 LEU HD23 H  -68.131 -23.285  -24.666 1.00 . B B . 185 LEU HD23 1 1 
        1   4873 2 2 185 LEU HG   H  -66.591 -20.875  -25.230 1.00 . B B . 185 LEU HG   1 1 
        1   4874 2 2 185 LEU N    N  -69.712 -20.348  -22.526 1.00 . B B . 185 LEU N    1 1 
        1   4875 2 2 185 LEU O    O  -71.343 -19.478  -24.934 1.00 . B B . 185 LEU O    1 1 
        1   4876 2 2 186 ASN C    C  -70.761 -16.546  -26.950 1.00 . B B . 186 ASN C    1 1 
        1   4877 2 2 186 ASN CA   C  -70.862 -16.731  -25.435 1.00 . B B . 186 ASN CA   1 1 
        1   4878 2 2 186 ASN CB   C  -70.640 -15.378  -24.756 1.00 . B B . 186 ASN CB   1 1 
        1   4879 2 2 186 ASN CG   C  -70.848 -15.431  -23.251 1.00 . B B . 186 ASN CG   1 1 
        1   4880 2 2 186 ASN H    H  -69.054 -17.398  -24.577 1.00 . B B . 186 ASN H    1 1 
        1   4881 2 2 186 ASN HA   H  -71.866 -17.051  -25.204 1.00 . B B . 186 ASN HA   1 1 
        1   4882 2 2 186 ASN HB2  H  -69.631 -15.052  -24.954 1.00 . B B . 186 ASN HB2  1 1 
        1   4883 2 2 186 ASN HB3  H  -71.327 -14.659  -25.180 1.00 . B B . 186 ASN HB3  1 1 
        1   4884 2 2 186 ASN HD21 H  -70.880 -13.429  -23.151 1.00 . B B . 186 ASN HD21 1 1 
        1   4885 2 2 186 ASN HD22 H  -71.078 -14.226  -21.665 1.00 . B B . 186 ASN HD22 1 1 
        1   4886 2 2 186 ASN N    N  -69.934 -17.713  -24.871 1.00 . B B . 186 ASN N    1 1 
        1   4887 2 2 186 ASN ND2  N  -70.943 -14.260  -22.635 1.00 . B B . 186 ASN ND2  1 1 
        1   4888 2 2 186 ASN O    O  -69.957 -17.204  -27.614 1.00 . B B . 186 ASN O    1 1 
        1   4889 2 2 186 ASN OD1  O  -70.915 -16.506  -22.646 1.00 . B B . 186 ASN OD1  1 1 
        1   4890 2 2 187 SER C    C  -72.379 -13.945  -29.150 1.00 . B B . 187 SER C    1 1 
        1   4891 2 2 187 SER CA   C  -71.424 -15.087  -28.820 1.00 . B B . 187 SER CA   1 1 
        1   4892 2 2 187 SER CB   C  -71.481 -16.122  -29.940 1.00 . B B . 187 SER CB   1 1 
        1   4893 2 2 187 SER H    H  -72.241 -15.222  -26.882 1.00 . B B . 187 SER H    1 1 
        1   4894 2 2 187 SER HA   H  -70.428 -14.670  -28.832 1.00 . B B . 187 SER HA   1 1 
        1   4895 2 2 187 SER HB2  H  -70.816 -16.939  -29.717 1.00 . B B . 187 SER HB2  1 1 
        1   4896 2 2 187 SER HB3  H  -72.493 -16.497  -30.028 1.00 . B B . 187 SER HB3  1 1 
        1   4897 2 2 187 SER HG   H  -70.457 -14.812  -30.948 1.00 . B B . 187 SER HG   1 1 
        1   4898 2 2 187 SER N    N  -71.614 -15.671  -27.486 1.00 . B B . 187 SER N    1 1 
        1   4899 2 2 187 SER O    O  -73.604 -14.095  -29.084 1.00 . B B . 187 SER O    1 1 
        1   4900 2 2 187 SER OG   O  -71.084 -15.508  -31.158 1.00 . B B . 187 SER OG   1 1 
        1   4901 2 2 188 TRP C    C  -72.751 -11.735  -31.429 1.00 . B B . 188 TRP C    1 1 
        1   4902 2 2 188 TRP CA   C  -72.526 -11.630  -29.932 1.00 . B B . 188 TRP CA   1 1 
        1   4903 2 2 188 TRP CB   C  -71.705 -10.360  -29.640 1.00 . B B . 188 TRP CB   1 1 
        1   4904 2 2 188 TRP CD1  C  -71.735  -9.012  -27.435 1.00 . B B . 188 TRP CD1  1 1 
        1   4905 2 2 188 TRP CD2  C  -70.510 -10.898  -27.323 1.00 . B B . 188 TRP CD2  1 1 
        1   4906 2 2 188 TRP CE2  C  -70.453 -10.246  -26.069 1.00 . B B . 188 TRP CE2  1 1 
        1   4907 2 2 188 TRP CE3  C  -69.816 -12.114  -27.486 1.00 . B B . 188 TRP CE3  1 1 
        1   4908 2 2 188 TRP CG   C  -71.347 -10.092  -28.185 1.00 . B B . 188 TRP CG   1 1 
        1   4909 2 2 188 TRP CH2  C  -69.055 -11.959  -25.168 1.00 . B B . 188 TRP CH2  1 1 
        1   4910 2 2 188 TRP CZ2  C  -69.723 -10.769  -24.980 1.00 . B B . 188 TRP CZ2  1 1 
        1   4911 2 2 188 TRP CZ3  C  -69.096 -12.637  -26.401 1.00 . B B . 188 TRP CZ3  1 1 
        1   4912 2 2 188 TRP H    H  -70.810 -12.792  -29.573 1.00 . B B . 188 TRP H    1 1 
        1   4913 2 2 188 TRP HA   H  -73.473 -11.587  -29.414 1.00 . B B . 188 TRP HA   1 1 
        1   4914 2 2 188 TRP HB2  H  -70.784 -10.424  -30.196 1.00 . B B . 188 TRP HB2  1 1 
        1   4915 2 2 188 TRP HB3  H  -72.262  -9.512  -30.016 1.00 . B B . 188 TRP HB3  1 1 
        1   4916 2 2 188 TRP HD1  H  -72.368  -8.210  -27.786 1.00 . B B . 188 TRP HD1  1 1 
        1   4917 2 2 188 TRP HE1  H  -71.335  -8.460  -25.436 1.00 . B B . 188 TRP HE1  1 1 
        1   4918 2 2 188 TRP HE3  H  -69.844 -12.639  -28.430 1.00 . B B . 188 TRP HE3  1 1 
        1   4919 2 2 188 TRP HH2  H  -68.493 -12.385  -24.350 1.00 . B B . 188 TRP HH2  1 1 
        1   4920 2 2 188 TRP HZ2  H  -69.688 -10.253  -24.032 1.00 . B B . 188 TRP HZ2  1 1 
        1   4921 2 2 188 TRP HZ3  H  -68.561 -13.568  -26.515 1.00 . B B . 188 TRP HZ3  1 1 
        1   4922 2 2 188 TRP N    N  -71.789 -12.816  -29.531 1.00 . B B . 188 TRP N    1 1 
        1   4923 2 2 188 TRP NE1  N  -71.206  -9.100  -26.167 1.00 . B B . 188 TRP NE1  1 1 
        1   4924 2 2 188 TRP O    O  -71.808 -12.021  -32.168 1.00 . B B . 188 TRP O    1 1 
        1   4925 2 2 189 THR C    C  -73.434 -10.055  -33.682 1.00 . B B . 189 THR C    1 1 
        1   4926 2 2 189 THR CA   C  -74.180 -11.331  -33.321 1.00 . B B . 189 THR CA   1 1 
        1   4927 2 2 189 THR CB   C  -75.682 -11.230  -33.793 1.00 . B B . 189 THR CB   1 1 
        1   4928 2 2 189 THR CG2  C  -76.526 -12.386  -33.285 1.00 . B B . 189 THR CG2  1 1 
        1   4929 2 2 189 THR H    H  -74.708 -11.310  -31.266 1.00 . B B . 189 THR H    1 1 
        1   4930 2 2 189 THR HA   H  -73.708 -12.156  -33.840 1.00 . B B . 189 THR HA   1 1 
        1   4931 2 2 189 THR HB   H  -75.686 -11.265  -34.874 1.00 . B B . 189 THR HB   1 1 
        1   4932 2 2 189 THR HG1  H  -75.550  -9.386  -33.155 1.00 . B B . 189 THR HG1  1 1 
        1   4933 2 2 189 THR HG21 H  -76.378 -13.247  -33.921 1.00 . B B . 189 THR HG21 1 1 
        1   4934 2 2 189 THR HG22 H  -77.569 -12.103  -33.298 1.00 . B B . 189 THR HG22 1 1 
        1   4935 2 2 189 THR HG23 H  -76.232 -12.630  -32.275 1.00 . B B . 189 THR HG23 1 1 
        1   4936 2 2 189 THR N    N  -73.984 -11.524  -31.890 1.00 . B B . 189 THR N    1 1 
        1   4937 2 2 189 THR O    O  -73.270  -9.165  -32.852 1.00 . B B . 189 THR O    1 1 
        1   4938 2 2 189 THR OG1  O  -76.263  -9.981  -33.400 1.00 . B B . 189 THR OG1  1 1 
        1   4939 2 2 190 ASP C    C  -73.713  -7.895  -35.647 1.00 . B B . 190 ASP C    1 1 
        1   4940 2 2 190 ASP CA   C  -72.455  -8.738  -35.440 1.00 . B B . 190 ASP CA   1 1 
        1   4941 2 2 190 ASP CB   C  -71.655  -8.965  -36.738 1.00 . B B . 190 ASP CB   1 1 
        1   4942 2 2 190 ASP CG   C  -70.359  -9.775  -36.504 1.00 . B B . 190 ASP CG   1 1 
        1   4943 2 2 190 ASP H    H  -73.060 -10.752  -35.512 1.00 . B B . 190 ASP H    1 1 
        1   4944 2 2 190 ASP HA   H  -71.824  -8.258  -34.703 1.00 . B B . 190 ASP HA   1 1 
        1   4945 2 2 190 ASP HB2  H  -72.275  -9.498  -37.442 1.00 . B B . 190 ASP HB2  1 1 
        1   4946 2 2 190 ASP HB3  H  -71.396  -8.005  -37.159 1.00 . B B . 190 ASP HB3  1 1 
        1   4947 2 2 190 ASP N    N  -72.934  -9.992  -34.905 1.00 . B B . 190 ASP N    1 1 
        1   4948 2 2 190 ASP O    O  -74.698  -8.368  -36.217 1.00 . B B . 190 ASP O    1 1 
        1   4949 2 2 190 ASP OD1  O  -70.454 -10.991  -36.210 1.00 . B B . 190 ASP OD1  1 1 
        1   4950 2 2 190 ASP OD2  O  -69.246  -9.196  -36.599 1.00 . B B . 190 ASP OD2  1 1 
        1   4951 2 2 191 GLN C    C  -75.868  -5.907  -36.234 1.00 . B B . 191 GLN C    1 1 
        1   4952 2 2 191 GLN CA   C  -74.787  -5.700  -35.139 1.00 . B B . 191 GLN CA   1 1 
        1   4953 2 2 191 GLN CB   C  -74.178  -4.291  -35.226 1.00 . B B . 191 GLN CB   1 1 
        1   4954 2 2 191 GLN CD   C  -74.424  -1.799  -35.087 1.00 . B B . 191 GLN CD   1 1 
        1   4955 2 2 191 GLN CG   C  -75.077  -3.139  -34.821 1.00 . B B . 191 GLN CG   1 1 
        1   4956 2 2 191 GLN H    H  -72.867  -6.421  -34.629 1.00 . B B . 191 GLN H    1 1 
        1   4957 2 2 191 GLN HA   H  -75.290  -5.764  -34.187 1.00 . B B . 191 GLN HA   1 1 
        1   4958 2 2 191 GLN HB2  H  -73.306  -4.264  -34.594 1.00 . B B . 191 GLN HB2  1 1 
        1   4959 2 2 191 GLN HB3  H  -73.855  -4.131  -36.247 1.00 . B B . 191 GLN HB3  1 1 
        1   4960 2 2 191 GLN HE21 H  -76.139  -1.036  -35.807 1.00 . B B . 191 GLN HE21 1 1 
        1   4961 2 2 191 GLN HE22 H  -74.823   0.036  -35.804 1.00 . B B . 191 GLN HE22 1 1 
        1   4962 2 2 191 GLN HG2  H  -75.999  -3.198  -35.379 1.00 . B B . 191 GLN HG2  1 1 
        1   4963 2 2 191 GLN HG3  H  -75.298  -3.220  -33.767 1.00 . B B . 191 GLN HG3  1 1 
        1   4964 2 2 191 GLN N    N  -73.682  -6.679  -35.108 1.00 . B B . 191 GLN N    1 1 
        1   4965 2 2 191 GLN NE2  N  -75.197  -0.849  -35.612 1.00 . B B . 191 GLN NE2  1 1 
        1   4966 2 2 191 GLN O    O  -75.548  -6.073  -37.410 1.00 . B B . 191 GLN O    1 1 
        1   4967 2 2 191 GLN OE1  O  -73.234  -1.622  -34.828 1.00 . B B . 191 GLN OE1  1 1 
        1   4968 2 2 192 ASP C    C  -78.280  -4.917  -37.777 1.00 . B B . 192 ASP C    1 1 
        1   4969 2 2 192 ASP CA   C  -78.306  -6.006  -36.706 1.00 . B B . 192 ASP CA   1 1 
        1   4970 2 2 192 ASP CB   C  -79.579  -5.881  -35.863 1.00 . B B . 192 ASP CB   1 1 
        1   4971 2 2 192 ASP CG   C  -80.846  -6.219  -36.629 1.00 . B B . 192 ASP CG   1 1 
        1   4972 2 2 192 ASP H    H  -77.301  -5.756  -34.862 1.00 . B B . 192 ASP H    1 1 
        1   4973 2 2 192 ASP HA   H  -78.295  -6.973  -37.184 1.00 . B B . 192 ASP HA   1 1 
        1   4974 2 2 192 ASP HB2  H  -79.501  -6.547  -35.017 1.00 . B B . 192 ASP HB2  1 1 
        1   4975 2 2 192 ASP HB3  H  -79.652  -4.867  -35.497 1.00 . B B . 192 ASP HB3  1 1 
        1   4976 2 2 192 ASP N    N  -77.136  -5.892  -35.818 1.00 . B B . 192 ASP N    1 1 
        1   4977 2 2 192 ASP O    O  -77.676  -3.869  -37.573 1.00 . B B . 192 ASP O    1 1 
        1   4978 2 2 192 ASP OD1  O  -81.148  -5.579  -37.657 1.00 . B B . 192 ASP OD1  1 1 
        1   4979 2 2 192 ASP OD2  O  -81.570  -7.118  -36.171 1.00 . B B . 192 ASP OD2  1 1 
        1   4980 2 2 193 SER C    C  -80.228  -3.387  -40.146 1.00 . B B . 193 SER C    1 1 
        1   4981 2 2 193 SER CA   C  -78.924  -4.184  -40.013 1.00 . B B . 193 SER CA   1 1 
        1   4982 2 2 193 SER CB   C  -78.598  -4.874  -41.336 1.00 . B B . 193 SER CB   1 1 
        1   4983 2 2 193 SER H    H  -79.399  -6.011  -39.027 1.00 . B B . 193 SER H    1 1 
        1   4984 2 2 193 SER HA   H  -78.133  -3.478  -39.814 1.00 . B B . 193 SER HA   1 1 
        1   4985 2 2 193 SER HB2  H  -78.273  -4.139  -42.053 1.00 . B B . 193 SER HB2  1 1 
        1   4986 2 2 193 SER HB3  H  -77.801  -5.589  -41.177 1.00 . B B . 193 SER HB3  1 1 
        1   4987 2 2 193 SER HG   H  -80.518  -5.143  -41.429 1.00 . B B . 193 SER HG   1 1 
        1   4988 2 2 193 SER N    N  -78.931  -5.158  -38.913 1.00 . B B . 193 SER N    1 1 
        1   4989 2 2 193 SER O    O  -80.221  -2.238  -40.587 1.00 . B B . 193 SER O    1 1 
        1   4990 2 2 193 SER OG   O  -79.745  -5.534  -41.841 1.00 . B B . 193 SER OG   1 1 
        1   4991 2 2 194 LYS C    C  -82.757  -2.472  -38.534 1.00 . B B . 194 LYS C    1 1 
        1   4992 2 2 194 LYS CA   C  -82.635  -3.337  -39.782 1.00 . B B . 194 LYS CA   1 1 
        1   4993 2 2 194 LYS CB   C  -83.771  -4.356  -39.826 1.00 . B B . 194 LYS CB   1 1 
        1   4994 2 2 194 LYS CD   C  -85.816  -5.137  -41.002 1.00 . B B . 194 LYS CD   1 1 
        1   4995 2 2 194 LYS CE   C  -86.847  -4.797  -42.059 1.00 . B B . 194 LYS CE   1 1 
        1   4996 2 2 194 LYS CG   C  -84.932  -3.941  -40.701 1.00 . B B . 194 LYS CG   1 1 
        1   4997 2 2 194 LYS H    H  -81.287  -4.934  -39.456 1.00 . B B . 194 LYS H    1 1 
        1   4998 2 2 194 LYS HA   H  -82.699  -2.703  -40.654 1.00 . B B . 194 LYS HA   1 1 
        1   4999 2 2 194 LYS HB2  H  -83.381  -5.290  -40.199 1.00 . B B . 194 LYS HB2  1 1 
        1   5000 2 2 194 LYS HB3  H  -84.132  -4.512  -38.819 1.00 . B B . 194 LYS HB3  1 1 
        1   5001 2 2 194 LYS HD2  H  -85.202  -5.952  -41.356 1.00 . B B . 194 LYS HD2  1 1 
        1   5002 2 2 194 LYS HD3  H  -86.322  -5.440  -40.098 1.00 . B B . 194 LYS HD3  1 1 
        1   5003 2 2 194 LYS HE2  H  -87.131  -3.761  -41.954 1.00 . B B . 194 LYS HE2  1 1 
        1   5004 2 2 194 LYS HE3  H  -86.412  -4.945  -43.037 1.00 . B B . 194 LYS HE3  1 1 
        1   5005 2 2 194 LYS HG2  H  -85.512  -3.187  -40.190 1.00 . B B . 194 LYS HG2  1 1 
        1   5006 2 2 194 LYS HG3  H  -84.554  -3.535  -41.628 1.00 . B B . 194 LYS HG3  1 1 
        1   5007 2 2 194 LYS HZ1  H  -87.815  -6.645  -42.093 1.00 . B B . 194 LYS HZ1  1 1 
        1   5008 2 2 194 LYS HZ2  H  -88.773  -5.352  -42.637 1.00 . B B . 194 LYS HZ2  1 1 
        1   5009 2 2 194 LYS HZ3  H  -88.467  -5.545  -40.977 1.00 . B B . 194 LYS HZ3  1 1 
        1   5010 2 2 194 LYS N    N  -81.343  -4.012  -39.784 1.00 . B B . 194 LYS N    1 1 
        1   5011 2 2 194 LYS NZ   N  -88.068  -5.650  -41.932 1.00 . B B . 194 LYS NZ   1 1 
        1   5012 2 2 194 LYS O    O  -82.957  -1.258  -38.622 1.00 . B B . 194 LYS O    1 1 
        1   5013 2 2 195 ASP C    C  -81.381  -1.917  -35.591 1.00 . B B . 195 ASP C    1 1 
        1   5014 2 2 195 ASP CA   C  -82.726  -2.451  -36.087 1.00 . B B . 195 ASP CA   1 1 
        1   5015 2 2 195 ASP CB   C  -83.376  -3.411  -35.079 1.00 . B B . 195 ASP CB   1 1 
        1   5016 2 2 195 ASP CG   C  -82.510  -3.670  -33.860 1.00 . B B . 195 ASP CG   1 1 
        1   5017 2 2 195 ASP H    H  -82.443  -4.076  -37.396 1.00 . B B . 195 ASP H    1 1 
        1   5018 2 2 195 ASP HA   H  -83.387  -1.606  -36.208 1.00 . B B . 195 ASP HA   1 1 
        1   5019 2 2 195 ASP HB2  H  -84.314  -2.991  -34.753 1.00 . B B . 195 ASP HB2  1 1 
        1   5020 2 2 195 ASP HB3  H  -83.571  -4.351  -35.575 1.00 . B B . 195 ASP HB3  1 1 
        1   5021 2 2 195 ASP N    N  -82.614  -3.111  -37.378 1.00 . B B . 195 ASP N    1 1 
        1   5022 2 2 195 ASP O    O  -81.339  -1.065  -34.712 1.00 . B B . 195 ASP O    1 1 
        1   5023 2 2 195 ASP OD1  O  -82.572  -2.871  -32.910 1.00 . B B . 195 ASP OD1  1 1 
        1   5024 2 2 195 ASP OD2  O  -81.761  -4.670  -33.855 1.00 . B B . 195 ASP OD2  1 1 
        1   5025 2 2 196 SER C    C  -78.479  -2.038  -34.439 1.00 . B B . 196 SER C    1 1 
        1   5026 2 2 196 SER CA   C  -78.944  -1.919  -35.886 1.00 . B B . 196 SER CA   1 1 
        1   5027 2 2 196 SER CB   C  -78.807  -0.476  -36.383 1.00 . B B . 196 SER CB   1 1 
        1   5028 2 2 196 SER H    H  -80.401  -3.119  -36.841 1.00 . B B . 196 SER H    1 1 
        1   5029 2 2 196 SER HA   H  -78.266  -2.516  -36.477 1.00 . B B . 196 SER HA   1 1 
        1   5030 2 2 196 SER HB2  H  -79.434   0.170  -35.792 1.00 . B B . 196 SER HB2  1 1 
        1   5031 2 2 196 SER HB3  H  -77.776  -0.161  -36.280 1.00 . B B . 196 SER HB3  1 1 
        1   5032 2 2 196 SER HG   H  -78.802   0.394  -38.116 1.00 . B B . 196 SER HG   1 1 
        1   5033 2 2 196 SER N    N  -80.291  -2.432  -36.151 1.00 . B B . 196 SER N    1 1 
        1   5034 2 2 196 SER O    O  -77.813  -1.143  -33.914 1.00 . B B . 196 SER O    1 1 
        1   5035 2 2 196 SER OG   O  -79.204  -0.391  -37.738 1.00 . B B . 196 SER OG   1 1 
        1   5036 2 2 197 THR C    C  -77.942  -4.840  -32.195 1.00 . B B . 197 THR C    1 1 
        1   5037 2 2 197 THR CA   C  -78.404  -3.401  -32.421 1.00 . B B . 197 THR CA   1 1 
        1   5038 2 2 197 THR CB   C  -79.564  -3.130  -31.439 1.00 . B B . 197 THR CB   1 1 
        1   5039 2 2 197 THR CG2  C  -80.127  -1.691  -31.587 1.00 . B B . 197 THR CG2  1 1 
        1   5040 2 2 197 THR H    H  -79.329  -3.841  -34.280 1.00 . B B . 197 THR H    1 1 
        1   5041 2 2 197 THR HA   H  -77.591  -2.735  -32.179 1.00 . B B . 197 THR HA   1 1 
        1   5042 2 2 197 THR HB   H  -79.188  -3.247  -30.432 1.00 . B B . 197 THR HB   1 1 
        1   5043 2 2 197 THR HG1  H  -80.804  -4.500  -30.800 1.00 . B B . 197 THR HG1  1 1 
        1   5044 2 2 197 THR HG21 H  -80.825  -1.661  -32.410 1.00 . B B . 197 THR HG21 1 1 
        1   5045 2 2 197 THR HG22 H  -79.316  -1.005  -31.779 1.00 . B B . 197 THR HG22 1 1 
        1   5046 2 2 197 THR HG23 H  -80.631  -1.406  -30.675 1.00 . B B . 197 THR HG23 1 1 
        1   5047 2 2 197 THR N    N  -78.812  -3.157  -33.805 1.00 . B B . 197 THR N    1 1 
        1   5048 2 2 197 THR O    O  -78.585  -5.776  -32.675 1.00 . B B . 197 THR O    1 1 
        1   5049 2 2 197 THR OG1  O  -80.597  -4.100  -31.648 1.00 . B B . 197 THR OG1  1 1 
        1   5050 2 2 198 TYR C    C  -77.305  -7.342  -30.555 1.00 . B B . 198 TYR C    1 1 
        1   5051 2 2 198 TYR CA   C  -76.299  -6.329  -31.117 1.00 . B B . 198 TYR CA   1 1 
        1   5052 2 2 198 TYR CB   C  -75.166  -6.193  -30.101 1.00 . B B . 198 TYR CB   1 1 
        1   5053 2 2 198 TYR CD1  C  -74.045  -3.936  -30.403 1.00 . B B . 198 TYR CD1  1 1 
        1   5054 2 2 198 TYR CD2  C  -72.806  -5.911  -30.981 1.00 . B B . 198 TYR CD2  1 1 
        1   5055 2 2 198 TYR CE1  C  -72.960  -3.143  -30.767 1.00 . B B . 198 TYR CE1  1 1 
        1   5056 2 2 198 TYR CE2  C  -71.718  -5.126  -31.347 1.00 . B B . 198 TYR CE2  1 1 
        1   5057 2 2 198 TYR CG   C  -73.991  -5.333  -30.518 1.00 . B B . 198 TYR CG   1 1 
        1   5058 2 2 198 TYR CZ   C  -71.805  -3.745  -31.240 1.00 . B B . 198 TYR CZ   1 1 
        1   5059 2 2 198 TYR H    H  -76.421  -4.215  -31.066 1.00 . B B . 198 TYR H    1 1 
        1   5060 2 2 198 TYR HA   H  -75.879  -6.740  -32.022 1.00 . B B . 198 TYR HA   1 1 
        1   5061 2 2 198 TYR HB2  H  -75.576  -5.776  -29.196 1.00 . B B . 198 TYR HB2  1 1 
        1   5062 2 2 198 TYR HB3  H  -74.801  -7.186  -29.876 1.00 . B B . 198 TYR HB3  1 1 
        1   5063 2 2 198 TYR HD1  H  -74.950  -3.467  -30.047 1.00 . B B . 198 TYR HD1  1 1 
        1   5064 2 2 198 TYR HD2  H  -72.737  -6.986  -31.065 1.00 . B B . 198 TYR HD2  1 1 
        1   5065 2 2 198 TYR HE1  H  -73.015  -2.068  -30.673 1.00 . B B . 198 TYR HE1  1 1 
        1   5066 2 2 198 TYR HE2  H  -70.814  -5.587  -31.716 1.00 . B B . 198 TYR HE2  1 1 
        1   5067 2 2 198 TYR HH   H  -70.362  -2.587  -30.795 1.00 . B B . 198 TYR HH   1 1 
        1   5068 2 2 198 TYR N    N  -76.860  -5.010  -31.436 1.00 . B B . 198 TYR N    1 1 
        1   5069 2 2 198 TYR O    O  -78.482  -7.034  -30.364 1.00 . B B . 198 TYR O    1 1 
        1   5070 2 2 198 TYR OH   O  -70.737  -2.959  -31.596 1.00 . B B . 198 TYR OH   1 1 
        1   5071 2 2 199 SER C    C  -76.430 -10.412  -28.859 1.00 . B B . 199 SER C    1 1 
        1   5072 2 2 199 SER CA   C  -77.517  -9.603  -29.555 1.00 . B B . 199 SER CA   1 1 
        1   5073 2 2 199 SER CB   C  -78.338 -10.504  -30.472 1.00 . B B . 199 SER CB   1 1 
        1   5074 2 2 199 SER H    H  -75.874  -8.714  -30.523 1.00 . B B . 199 SER H    1 1 
        1   5075 2 2 199 SER HA   H  -78.159  -9.145  -28.815 1.00 . B B . 199 SER HA   1 1 
        1   5076 2 2 199 SER HB2  H  -77.680 -11.069  -31.109 1.00 . B B . 199 SER HB2  1 1 
        1   5077 2 2 199 SER HB3  H  -78.908 -11.192  -29.859 1.00 . B B . 199 SER HB3  1 1 
        1   5078 2 2 199 SER HG   H  -79.108  -8.821  -31.036 1.00 . B B . 199 SER HG   1 1 
        1   5079 2 2 199 SER N    N  -76.820  -8.560  -30.317 1.00 . B B . 199 SER N    1 1 
        1   5080 2 2 199 SER O    O  -75.260 -10.038  -28.930 1.00 . B B . 199 SER O    1 1 
        1   5081 2 2 199 SER OG   O  -79.216  -9.745  -31.271 1.00 . B B . 199 SER OG   1 1 
        1   5082 2 2 200 MET C    C  -76.409 -13.681  -27.111 1.00 . B B . 200 MET C    1 1 
        1   5083 2 2 200 MET CA   C  -75.793 -12.356  -27.531 1.00 . B B . 200 MET CA   1 1 
        1   5084 2 2 200 MET CB   C  -75.218 -11.664  -26.298 1.00 . B B . 200 MET CB   1 1 
        1   5085 2 2 200 MET CE   C  -73.913 -13.811  -24.084 1.00 . B B . 200 MET CE   1 1 
        1   5086 2 2 200 MET CG   C  -73.742 -11.926  -26.094 1.00 . B B . 200 MET CG   1 1 
        1   5087 2 2 200 MET H    H  -77.735 -11.760  -28.162 1.00 . B B . 200 MET H    1 1 
        1   5088 2 2 200 MET HA   H  -74.989 -12.551  -28.225 1.00 . B B . 200 MET HA   1 1 
        1   5089 2 2 200 MET HB2  H  -75.366 -10.600  -26.398 1.00 . B B . 200 MET HB2  1 1 
        1   5090 2 2 200 MET HB3  H  -75.758 -12.006  -25.426 1.00 . B B . 200 MET HB3  1 1 
        1   5091 2 2 200 MET HE1  H  -73.260 -14.555  -24.518 1.00 . B B . 200 MET HE1  1 1 
        1   5092 2 2 200 MET HE2  H  -74.889 -13.885  -24.538 1.00 . B B . 200 MET HE2  1 1 
        1   5093 2 2 200 MET HE3  H  -73.999 -13.976  -23.019 1.00 . B B . 200 MET HE3  1 1 
        1   5094 2 2 200 MET HG2  H  -73.472 -12.805  -26.656 1.00 . B B . 200 MET HG2  1 1 
        1   5095 2 2 200 MET HG3  H  -73.192 -11.085  -26.496 1.00 . B B . 200 MET HG3  1 1 
        1   5096 2 2 200 MET N    N  -76.790 -11.504  -28.191 1.00 . B B . 200 MET N    1 1 
        1   5097 2 2 200 MET O    O  -77.631 -13.805  -27.104 1.00 . B B . 200 MET O    1 1 
        1   5098 2 2 200 MET SD   S  -73.237 -12.182  -24.380 1.00 . B B . 200 MET SD   1 1 
        1   5099 2 2 201 SER C    C  -75.013 -16.736  -25.474 1.00 . B B . 201 SER C    1 1 
        1   5100 2 2 201 SER CA   C  -76.069 -15.958  -26.256 1.00 . B B . 201 SER CA   1 1 
        1   5101 2 2 201 SER CB   C  -76.624 -16.829  -27.391 1.00 . B B . 201 SER CB   1 1 
        1   5102 2 2 201 SER H    H  -74.611 -14.502  -26.789 1.00 . B B . 201 SER H    1 1 
        1   5103 2 2 201 SER HA   H  -76.884 -15.750  -25.579 1.00 . B B . 201 SER HA   1 1 
        1   5104 2 2 201 SER HB2  H  -77.228 -17.615  -26.972 1.00 . B B . 201 SER HB2  1 1 
        1   5105 2 2 201 SER HB3  H  -77.244 -16.217  -28.033 1.00 . B B . 201 SER HB3  1 1 
        1   5106 2 2 201 SER HG   H  -74.747 -17.042  -27.846 1.00 . B B . 201 SER HG   1 1 
        1   5107 2 2 201 SER N    N  -75.577 -14.665  -26.762 1.00 . B B . 201 SER N    1 1 
        1   5108 2 2 201 SER O    O  -74.049 -17.243  -26.053 1.00 . B B . 201 SER O    1 1 
        1   5109 2 2 201 SER OG   O  -75.579 -17.415  -28.150 1.00 . B B . 201 SER OG   1 1 
        1   5110 2 2 202 SER C    C  -74.816 -19.015  -23.056 1.00 . B B . 202 SER C    1 1 
        1   5111 2 2 202 SER CA   C  -74.323 -17.592  -23.286 1.00 . B B . 202 SER CA   1 1 
        1   5112 2 2 202 SER CB   C  -74.156 -16.900  -21.943 1.00 . B B . 202 SER CB   1 1 
        1   5113 2 2 202 SER H    H  -76.005 -16.406  -23.770 1.00 . B B . 202 SER H    1 1 
        1   5114 2 2 202 SER HA   H  -73.353 -17.645  -23.758 1.00 . B B . 202 SER HA   1 1 
        1   5115 2 2 202 SER HB2  H  -73.668 -15.950  -22.086 1.00 . B B . 202 SER HB2  1 1 
        1   5116 2 2 202 SER HB3  H  -75.131 -16.736  -21.502 1.00 . B B . 202 SER HB3  1 1 
        1   5117 2 2 202 SER HG   H  -72.890 -17.119  -20.491 1.00 . B B . 202 SER HG   1 1 
        1   5118 2 2 202 SER N    N  -75.212 -16.830  -24.159 1.00 . B B . 202 SER N    1 1 
        1   5119 2 2 202 SER O    O  -76.007 -19.248  -22.860 1.00 . B B . 202 SER O    1 1 
        1   5120 2 2 202 SER OG   O  -73.366 -17.702  -21.088 1.00 . B B . 202 SER OG   1 1 
        1   5121 2 2 203 THR C    C  -73.409 -21.988  -21.775 1.00 . B B . 203 THR C    1 1 
        1   5122 2 2 203 THR CA   C  -74.203 -21.368  -22.915 1.00 . B B . 203 THR CA   1 1 
        1   5123 2 2 203 THR CB   C  -73.931 -22.146  -24.227 1.00 . B B . 203 THR CB   1 1 
        1   5124 2 2 203 THR CG2  C  -74.170 -23.648  -24.046 1.00 . B B . 203 THR CG2  1 1 
        1   5125 2 2 203 THR H    H  -72.948 -19.696  -23.201 1.00 . B B . 203 THR H    1 1 
        1   5126 2 2 203 THR HA   H  -75.254 -21.454  -22.683 1.00 . B B . 203 THR HA   1 1 
        1   5127 2 2 203 THR HB   H  -72.903 -21.989  -24.520 1.00 . B B . 203 THR HB   1 1 
        1   5128 2 2 203 THR HG1  H  -74.493 -20.773  -25.497 1.00 . B B . 203 THR HG1  1 1 
        1   5129 2 2 203 THR HG21 H  -75.115 -23.918  -24.492 1.00 . B B . 203 THR HG21 1 1 
        1   5130 2 2 203 THR HG22 H  -74.188 -23.885  -22.992 1.00 . B B . 203 THR HG22 1 1 
        1   5131 2 2 203 THR HG23 H  -73.374 -24.199  -24.525 1.00 . B B . 203 THR HG23 1 1 
        1   5132 2 2 203 THR N    N  -73.882 -19.957  -23.057 1.00 . B B . 203 THR N    1 1 
        1   5133 2 2 203 THR O    O  -72.180 -22.095  -21.822 1.00 . B B . 203 THR O    1 1 
        1   5134 2 2 203 THR OG1  O  -74.788 -21.656  -25.262 1.00 . B B . 203 THR OG1  1 1 
        1   5135 2 2 204 LEU C    C  -73.701 -24.638  -19.997 1.00 . B B . 204 LEU C    1 1 
        1   5136 2 2 204 LEU CA   C  -73.560 -23.156  -19.665 1.00 . B B . 204 LEU CA   1 1 
        1   5137 2 2 204 LEU CB   C  -74.273 -22.819  -18.366 1.00 . B B . 204 LEU CB   1 1 
        1   5138 2 2 204 LEU CD1  C  -73.919 -22.076  -16.045 1.00 . B B . 204 LEU CD1  1 1 
        1   5139 2 2 204 LEU CD2  C  -73.380 -24.485  -16.661 1.00 . B B . 204 LEU CD2  1 1 
        1   5140 2 2 204 LEU CG   C  -73.416 -23.012  -17.126 1.00 . B B . 204 LEU CG   1 1 
        1   5141 2 2 204 LEU H    H  -75.106 -22.276  -20.779 1.00 . B B . 204 LEU H    1 1 
        1   5142 2 2 204 LEU HA   H  -72.512 -22.910  -19.573 1.00 . B B . 204 LEU HA   1 1 
        1   5143 2 2 204 LEU HB2  H  -74.589 -21.788  -18.404 1.00 . B B . 204 LEU HB2  1 1 
        1   5144 2 2 204 LEU HB3  H  -75.151 -23.444  -18.283 1.00 . B B . 204 LEU HB3  1 1 
        1   5145 2 2 204 LEU HD11 H  -74.217 -22.651  -15.181 1.00 . B B . 204 LEU HD11 1 1 
        1   5146 2 2 204 LEU HD12 H  -74.767 -21.519  -16.417 1.00 . B B . 204 LEU HD12 1 1 
        1   5147 2 2 204 LEU HD13 H  -73.132 -21.391  -15.767 1.00 . B B . 204 LEU HD13 1 1 
        1   5148 2 2 204 LEU HD21 H  -72.966 -25.100  -17.446 1.00 . B B . 204 LEU HD21 1 1 
        1   5149 2 2 204 LEU HD22 H  -74.383 -24.816  -16.436 1.00 . B B . 204 LEU HD22 1 1 
        1   5150 2 2 204 LEU HD23 H  -72.766 -24.568  -15.776 1.00 . B B . 204 LEU HD23 1 1 
        1   5151 2 2 204 LEU HG   H  -72.406 -22.709  -17.377 1.00 . B B . 204 LEU HG   1 1 
        1   5152 2 2 204 LEU N    N  -74.133 -22.395  -20.748 1.00 . B B . 204 LEU N    1 1 
        1   5153 2 2 204 LEU O    O  -74.810 -25.137  -20.211 1.00 . B B . 204 LEU O    1 1 
        1   5154 2 2 205 THR C    C  -71.951 -27.707  -19.584 1.00 . B B . 205 THR C    1 1 
        1   5155 2 2 205 THR CA   C  -72.561 -26.692  -20.561 1.00 . B B . 205 THR CA   1 1 
        1   5156 2 2 205 THR CB   C  -71.909 -26.728  -21.980 1.00 . B B . 205 THR CB   1 1 
        1   5157 2 2 205 THR CG2  C  -70.568 -25.972  -22.008 1.00 . B B . 205 THR CG2  1 1 
        1   5158 2 2 205 THR H    H  -71.726 -24.887  -19.847 1.00 . B B . 205 THR H    1 1 
        1   5159 2 2 205 THR HA   H  -73.595 -26.980  -20.688 1.00 . B B . 205 THR HA   1 1 
        1   5160 2 2 205 THR HB   H  -72.585 -26.246  -22.672 1.00 . B B . 205 THR HB   1 1 
        1   5161 2 2 205 THR HG1  H  -70.914 -28.413  -22.013 1.00 . B B . 205 THR HG1  1 1 
        1   5162 2 2 205 THR HG21 H  -70.208 -25.841  -20.998 1.00 . B B . 205 THR HG21 1 1 
        1   5163 2 2 205 THR HG22 H  -70.710 -25.004  -22.467 1.00 . B B . 205 THR HG22 1 1 
        1   5164 2 2 205 THR HG23 H  -69.847 -26.538  -22.578 1.00 . B B . 205 THR HG23 1 1 
        1   5165 2 2 205 THR N    N  -72.576 -25.338  -20.032 1.00 . B B . 205 THR N    1 1 
        1   5166 2 2 205 THR O    O  -70.731 -27.791  -19.439 1.00 . B B . 205 THR O    1 1 
        1   5167 2 2 205 THR OG1  O  -71.726 -28.085  -22.407 1.00 . B B . 205 THR OG1  1 1 
        1   5168 2 2 206 LEU C    C  -72.349 -30.888  -18.415 1.00 . B B . 206 LEU C    1 1 
        1   5169 2 2 206 LEU CA   C  -72.449 -29.453  -17.898 1.00 . B B . 206 LEU CA   1 1 
        1   5170 2 2 206 LEU CB   C  -73.457 -29.420  -16.742 1.00 . B B . 206 LEU CB   1 1 
        1   5171 2 2 206 LEU CD1  C  -74.486 -28.000  -14.934 1.00 . B B . 206 LEU CD1  1 1 
        1   5172 2 2 206 LEU CD2  C  -72.187 -28.983  -14.604 1.00 . B B . 206 LEU CD2  1 1 
        1   5173 2 2 206 LEU CG   C  -73.188 -28.422  -15.617 1.00 . B B . 206 LEU CG   1 1 
        1   5174 2 2 206 LEU H    H  -73.782 -28.334  -19.103 1.00 . B B . 206 LEU H    1 1 
        1   5175 2 2 206 LEU HA   H  -71.486 -29.171  -17.503 1.00 . B B . 206 LEU HA   1 1 
        1   5176 2 2 206 LEU HB2  H  -74.426 -29.192  -17.153 1.00 . B B . 206 LEU HB2  1 1 
        1   5177 2 2 206 LEU HB3  H  -73.503 -30.413  -16.313 1.00 . B B . 206 LEU HB3  1 1 
        1   5178 2 2 206 LEU HD11 H  -74.965 -27.228  -15.518 1.00 . B B . 206 LEU HD11 1 1 
        1   5179 2 2 206 LEU HD12 H  -74.267 -27.621  -13.947 1.00 . B B . 206 LEU HD12 1 1 
        1   5180 2 2 206 LEU HD13 H  -75.145 -28.852  -14.855 1.00 . B B . 206 LEU HD13 1 1 
        1   5181 2 2 206 LEU HD21 H  -72.722 -29.420  -13.773 1.00 . B B . 206 LEU HD21 1 1 
        1   5182 2 2 206 LEU HD22 H  -71.553 -28.186  -14.245 1.00 . B B . 206 LEU HD22 1 1 
        1   5183 2 2 206 LEU HD23 H  -71.580 -29.740  -15.079 1.00 . B B . 206 LEU HD23 1 1 
        1   5184 2 2 206 LEU HG   H  -72.753 -27.537  -16.063 1.00 . B B . 206 LEU HG   1 1 
        1   5185 2 2 206 LEU N    N  -72.828 -28.469  -18.924 1.00 . B B . 206 LEU N    1 1 
        1   5186 2 2 206 LEU O    O  -72.426 -31.136  -19.624 1.00 . B B . 206 LEU O    1 1 
        1   5187 2 2 207 THR C    C  -73.837 -33.609  -17.501 1.00 . B B . 207 THR C    1 1 
        1   5188 2 2 207 THR CA   C  -72.357 -33.254  -17.775 1.00 . B B . 207 THR CA   1 1 
        1   5189 2 2 207 THR CB   C  -71.360 -34.194  -16.989 1.00 . B B . 207 THR CB   1 1 
        1   5190 2 2 207 THR CG2  C  -69.947 -33.588  -16.898 1.00 . B B . 207 THR CG2  1 1 
        1   5191 2 2 207 THR H    H  -72.093 -31.547  -16.546 1.00 . B B . 207 THR H    1 1 
        1   5192 2 2 207 THR HA   H  -72.182 -33.393  -18.835 1.00 . B B . 207 THR HA   1 1 
        1   5193 2 2 207 THR HB   H  -71.292 -35.130  -17.525 1.00 . B B . 207 THR HB   1 1 
        1   5194 2 2 207 THR HG1  H  -71.228 -34.120  -15.040 1.00 . B B . 207 THR HG1  1 1 
        1   5195 2 2 207 THR HG21 H  -69.215 -34.383  -16.886 1.00 . B B . 207 THR HG21 1 1 
        1   5196 2 2 207 THR HG22 H  -69.861 -33.007  -15.992 1.00 . B B . 207 THR HG22 1 1 
        1   5197 2 2 207 THR HG23 H  -69.773 -32.950  -17.752 1.00 . B B . 207 THR HG23 1 1 
        1   5198 2 2 207 THR N    N  -72.160 -31.826  -17.483 1.00 . B B . 207 THR N    1 1 
        1   5199 2 2 207 THR O    O  -74.549 -32.836  -16.839 1.00 . B B . 207 THR O    1 1 
        1   5200 2 2 207 THR OG1  O  -71.857 -34.471  -15.675 1.00 . B B . 207 THR OG1  1 1 
        1   5201 2 2 208 LYS C    C  -76.079 -35.241  -16.319 1.00 . B B . 208 LYS C    1 1 
        1   5202 2 2 208 LYS CA   C  -75.670 -35.234  -17.799 1.00 . B B . 208 LYS CA   1 1 
        1   5203 2 2 208 LYS CB   C  -75.822 -36.646  -18.382 1.00 . B B . 208 LYS CB   1 1 
        1   5204 2 2 208 LYS CD   C  -77.123 -38.790  -18.521 1.00 . B B . 208 LYS CD   1 1 
        1   5205 2 2 208 LYS CE   C  -78.489 -39.454  -18.471 1.00 . B B . 208 LYS CE   1 1 
        1   5206 2 2 208 LYS CG   C  -77.190 -37.303  -18.186 1.00 . B B . 208 LYS CG   1 1 
        1   5207 2 2 208 LYS H    H  -73.685 -35.302  -18.551 1.00 . B B . 208 LYS H    1 1 
        1   5208 2 2 208 LYS HA   H  -76.346 -34.582  -18.330 1.00 . B B . 208 LYS HA   1 1 
        1   5209 2 2 208 LYS HB2  H  -75.626 -36.597  -19.441 1.00 . B B . 208 LYS HB2  1 1 
        1   5210 2 2 208 LYS HB3  H  -75.070 -37.278  -17.930 1.00 . B B . 208 LYS HB3  1 1 
        1   5211 2 2 208 LYS HD2  H  -76.716 -38.905  -19.514 1.00 . B B . 208 LYS HD2  1 1 
        1   5212 2 2 208 LYS HD3  H  -76.466 -39.279  -17.815 1.00 . B B . 208 LYS HD3  1 1 
        1   5213 2 2 208 LYS HE2  H  -78.827 -39.495  -17.447 1.00 . B B . 208 LYS HE2  1 1 
        1   5214 2 2 208 LYS HE3  H  -79.189 -38.874  -19.055 1.00 . B B . 208 LYS HE3  1 1 
        1   5215 2 2 208 LYS HG2  H  -77.498 -37.184  -17.157 1.00 . B B . 208 LYS HG2  1 1 
        1   5216 2 2 208 LYS HG3  H  -77.912 -36.825  -18.832 1.00 . B B . 208 LYS HG3  1 1 
        1   5217 2 2 208 LYS HZ1  H  -79.378 -41.227  -19.108 1.00 . B B . 208 LYS HZ1  1 1 
        1   5218 2 2 208 LYS HZ2  H  -77.859 -41.438  -18.377 1.00 . B B . 208 LYS HZ2  1 1 
        1   5219 2 2 208 LYS HZ3  H  -77.967 -40.820  -19.956 1.00 . B B . 208 LYS HZ3  1 1 
        1   5220 2 2 208 LYS N    N  -74.297 -34.748  -18.023 1.00 . B B . 208 LYS N    1 1 
        1   5221 2 2 208 LYS NZ   N  -78.418 -40.839  -19.019 1.00 . B B . 208 LYS NZ   1 1 
        1   5222 2 2 208 LYS O    O  -77.182 -34.803  -15.968 1.00 . B B . 208 LYS O    1 1 
        1   5223 2 2 209 ASP C    C  -75.136 -34.849  -13.111 1.00 . B B . 209 ASP C    1 1 
        1   5224 2 2 209 ASP CA   C  -75.411 -36.023  -14.056 1.00 . B B . 209 ASP CA   1 1 
        1   5225 2 2 209 ASP CB   C  -74.597 -37.254  -13.619 1.00 . B B . 209 ASP CB   1 1 
        1   5226 2 2 209 ASP CG   C  -74.891 -38.497  -14.469 1.00 . B B . 209 ASP CG   1 1 
        1   5227 2 2 209 ASP H    H  -74.314 -36.034  -15.858 1.00 . B B . 209 ASP H    1 1 
        1   5228 2 2 209 ASP HA   H  -76.456 -36.278  -13.957 1.00 . B B . 209 ASP HA   1 1 
        1   5229 2 2 209 ASP HB2  H  -73.546 -37.022  -13.699 1.00 . B B . 209 ASP HB2  1 1 
        1   5230 2 2 209 ASP HB3  H  -74.826 -37.474  -12.586 1.00 . B B . 209 ASP HB3  1 1 
        1   5231 2 2 209 ASP N    N  -75.163 -35.729  -15.475 1.00 . B B . 209 ASP N    1 1 
        1   5232 2 2 209 ASP O    O  -75.855 -34.655  -12.130 1.00 . B B . 209 ASP O    1 1 
        1   5233 2 2 209 ASP OD1  O  -74.713 -38.446  -15.706 1.00 . B B . 209 ASP OD1  1 1 
        1   5234 2 2 209 ASP OD2  O  -75.299 -39.532  -13.894 1.00 . B B . 209 ASP OD2  1 1 
        1   5235 2 2 210 GLU C    C  -74.865 -31.763  -12.700 1.00 . B B . 210 GLU C    1 1 
        1   5236 2 2 210 GLU CA   C  -73.776 -32.860  -12.658 1.00 . B B . 210 GLU CA   1 1 
        1   5237 2 2 210 GLU CB   C  -72.452 -32.261  -13.155 1.00 . B B . 210 GLU CB   1 1 
        1   5238 2 2 210 GLU CD   C  -69.917 -32.447  -13.417 1.00 . B B . 210 GLU CD   1 1 
        1   5239 2 2 210 GLU CG   C  -71.180 -32.994  -12.735 1.00 . B B . 210 GLU CG   1 1 
        1   5240 2 2 210 GLU H    H  -73.568 -34.288  -14.208 1.00 . B B . 210 GLU H    1 1 
        1   5241 2 2 210 GLU HA   H  -73.636 -33.143  -11.626 1.00 . B B . 210 GLU HA   1 1 
        1   5242 2 2 210 GLU HB2  H  -72.479 -32.239  -14.232 1.00 . B B . 210 GLU HB2  1 1 
        1   5243 2 2 210 GLU HB3  H  -72.393 -31.240  -12.801 1.00 . B B . 210 GLU HB3  1 1 
        1   5244 2 2 210 GLU HG2  H  -71.063 -32.901  -11.666 1.00 . B B . 210 GLU HG2  1 1 
        1   5245 2 2 210 GLU HG3  H  -71.286 -34.041  -12.982 1.00 . B B . 210 GLU HG3  1 1 
        1   5246 2 2 210 GLU N    N  -74.099 -34.075  -13.412 1.00 . B B . 210 GLU N    1 1 
        1   5247 2 2 210 GLU O    O  -74.808 -30.812  -11.914 1.00 . B B . 210 GLU O    1 1 
        1   5248 2 2 210 GLU OE1  O  -70.019 -31.492  -14.220 1.00 . B B . 210 GLU OE1  1 1 
        1   5249 2 2 210 GLU OE2  O  -68.816 -32.981  -13.154 1.00 . B B . 210 GLU OE2  1 1 
        1   5250 2 2 211 TYR C    C  -77.888 -30.764  -12.688 1.00 . B B . 211 TYR C    1 1 
        1   5251 2 2 211 TYR CA   C  -76.860 -30.837  -13.820 1.00 . B B . 211 TYR CA   1 1 
        1   5252 2 2 211 TYR CB   C  -77.534 -30.982  -15.212 1.00 . B B . 211 TYR CB   1 1 
        1   5253 2 2 211 TYR CD1  C  -79.056 -28.918  -15.375 1.00 . B B . 211 TYR CD1  1 1 
        1   5254 2 2 211 TYR CD2  C  -80.048 -31.083  -15.668 1.00 . B B . 211 TYR CD2  1 1 
        1   5255 2 2 211 TYR CE1  C  -80.312 -28.321  -15.564 1.00 . B B . 211 TYR CE1  1 1 
        1   5256 2 2 211 TYR CE2  C  -81.304 -30.494  -15.861 1.00 . B B . 211 TYR CE2  1 1 
        1   5257 2 2 211 TYR CG   C  -78.907 -30.310  -15.408 1.00 . B B . 211 TYR CG   1 1 
        1   5258 2 2 211 TYR CZ   C  -81.428 -29.118  -15.804 1.00 . B B . 211 TYR CZ   1 1 
        1   5259 2 2 211 TYR H    H  -75.818 -32.654  -14.217 1.00 . B B . 211 TYR H    1 1 
        1   5260 2 2 211 TYR HA   H  -76.339 -29.889  -13.822 1.00 . B B . 211 TYR HA   1 1 
        1   5261 2 2 211 TYR HB2  H  -76.864 -30.572  -15.949 1.00 . B B . 211 TYR HB2  1 1 
        1   5262 2 2 211 TYR HB3  H  -77.642 -32.039  -15.415 1.00 . B B . 211 TYR HB3  1 1 
        1   5263 2 2 211 TYR HD1  H  -78.196 -28.296  -15.177 1.00 . B B . 211 TYR HD1  1 1 
        1   5264 2 2 211 TYR HD2  H  -79.958 -32.159  -15.714 1.00 . B B . 211 TYR HD2  1 1 
        1   5265 2 2 211 TYR HE1  H  -80.410 -27.246  -15.535 1.00 . B B . 211 TYR HE1  1 1 
        1   5266 2 2 211 TYR HE2  H  -82.171 -31.111  -16.047 1.00 . B B . 211 TYR HE2  1 1 
        1   5267 2 2 211 TYR HH   H  -82.560 -27.593  -15.992 1.00 . B B . 211 TYR HH   1 1 
        1   5268 2 2 211 TYR N    N  -75.833 -31.882  -13.614 1.00 . B B . 211 TYR N    1 1 
        1   5269 2 2 211 TYR O    O  -78.342 -29.677  -12.335 1.00 . B B . 211 TYR O    1 1 
        1   5270 2 2 211 TYR OH   O  -82.670 -28.547  -15.986 1.00 . B B . 211 TYR OH   1 1 
        1   5271 2 2 212 GLU C    C  -78.621 -31.769   -9.635 1.00 . B B . 212 GLU C    1 1 
        1   5272 2 2 212 GLU CA   C  -79.222 -31.983  -11.033 1.00 . B B . 212 GLU CA   1 1 
        1   5273 2 2 212 GLU CB   C  -79.979 -33.303  -11.114 1.00 . B B . 212 GLU CB   1 1 
        1   5274 2 2 212 GLU CD   C  -80.445 -34.836  -13.062 1.00 . B B . 212 GLU CD   1 1 
        1   5275 2 2 212 GLU CG   C  -80.693 -33.482  -12.439 1.00 . B B . 212 GLU CG   1 1 
        1   5276 2 2 212 GLU H    H  -77.818 -32.744  -12.431 1.00 . B B . 212 GLU H    1 1 
        1   5277 2 2 212 GLU HA   H  -79.936 -31.189  -11.200 1.00 . B B . 212 GLU HA   1 1 
        1   5278 2 2 212 GLU HB2  H  -79.281 -34.115  -10.984 1.00 . B B . 212 GLU HB2  1 1 
        1   5279 2 2 212 GLU HB3  H  -80.707 -33.337  -10.316 1.00 . B B . 212 GLU HB3  1 1 
        1   5280 2 2 212 GLU HG2  H  -81.754 -33.368  -12.277 1.00 . B B . 212 GLU HG2  1 1 
        1   5281 2 2 212 GLU HG3  H  -80.361 -32.713  -13.121 1.00 . B B . 212 GLU HG3  1 1 
        1   5282 2 2 212 GLU N    N  -78.230 -31.914  -12.112 1.00 . B B . 212 GLU N    1 1 
        1   5283 2 2 212 GLU O    O  -79.284 -32.007   -8.624 1.00 . B B . 212 GLU O    1 1 
        1   5284 2 2 212 GLU OE1  O  -79.295 -35.325  -13.002 1.00 . B B . 212 GLU OE1  1 1 
        1   5285 2 2 212 GLU OE2  O  -81.399 -35.410  -13.627 1.00 . B B . 212 GLU OE2  1 1 
        1   5286 2 2 213 ARG C    C  -77.374 -29.887   -7.555 1.00 . B B . 213 ARG C    1 1 
        1   5287 2 2 213 ARG CA   C  -76.632 -30.932   -8.391 1.00 . B B . 213 ARG CA   1 1 
        1   5288 2 2 213 ARG CB   C  -75.233 -30.405   -8.765 1.00 . B B . 213 ARG CB   1 1 
        1   5289 2 2 213 ARG CD   C  -73.045 -29.398   -8.020 1.00 . B B . 213 ARG CD   1 1 
        1   5290 2 2 213 ARG CG   C  -74.254 -30.230   -7.602 1.00 . B B . 213 ARG CG   1 1 
        1   5291 2 2 213 ARG CZ   C  -71.549 -30.333   -9.777 1.00 . B B . 213 ARG CZ   1 1 
        1   5292 2 2 213 ARG H    H  -76.930 -31.136  -10.469 1.00 . B B . 213 ARG H    1 1 
        1   5293 2 2 213 ARG HA   H  -76.506 -31.819   -7.789 1.00 . B B . 213 ARG HA   1 1 
        1   5294 2 2 213 ARG HB2  H  -74.793 -31.105   -9.457 1.00 . B B . 213 ARG HB2  1 1 
        1   5295 2 2 213 ARG HB3  H  -75.347 -29.457   -9.272 1.00 . B B . 213 ARG HB3  1 1 
        1   5296 2 2 213 ARG HD2  H  -73.346 -28.726   -8.807 1.00 . B B . 213 ARG HD2  1 1 
        1   5297 2 2 213 ARG HD3  H  -72.726 -28.809   -7.171 1.00 . B B . 213 ARG HD3  1 1 
        1   5298 2 2 213 ARG HE   H  -71.372 -30.659   -7.827 1.00 . B B . 213 ARG HE   1 1 
        1   5299 2 2 213 ARG HG2  H  -74.761 -29.728   -6.791 1.00 . B B . 213 ARG HG2  1 1 
        1   5300 2 2 213 ARG HG3  H  -73.921 -31.201   -7.264 1.00 . B B . 213 ARG HG3  1 1 
        1   5301 2 2 213 ARG HH11 H  -73.033 -29.186  -10.528 1.00 . B B . 213 ARG HH11 1 1 
        1   5302 2 2 213 ARG HH12 H  -71.947 -29.857  -11.699 1.00 . B B . 213 ARG HH12 1 1 
        1   5303 2 2 213 ARG HH21 H  -69.969 -31.522   -9.356 1.00 . B B . 213 ARG HH21 1 1 
        1   5304 2 2 213 ARG HH22 H  -70.213 -31.179  -11.036 1.00 . B B . 213 ARG HH22 1 1 
        1   5305 2 2 213 ARG N    N  -77.368 -31.302   -9.608 1.00 . B B . 213 ARG N    1 1 
        1   5306 2 2 213 ARG NE   N  -71.911 -30.194   -8.500 1.00 . B B . 213 ARG NE   1 1 
        1   5307 2 2 213 ARG NH1  N  -72.232 -29.744  -10.747 1.00 . B B . 213 ARG NH1  1 1 
        1   5308 2 2 213 ARG NH2  N  -70.490 -31.072  -10.081 1.00 . B B . 213 ARG NH2  1 1 
        1   5309 2 2 213 ARG O    O  -77.423 -29.991   -6.331 1.00 . B B . 213 ARG O    1 1 
        1   5310 2 2 214 HIS C    C  -80.182 -27.894   -8.194 1.00 . B B . 214 HIS C    1 1 
        1   5311 2 2 214 HIS CA   C  -78.776 -27.871   -7.584 1.00 . B B . 214 HIS CA   1 1 
        1   5312 2 2 214 HIS CB   C  -78.176 -26.472   -7.754 1.00 . B B . 214 HIS CB   1 1 
        1   5313 2 2 214 HIS CD2  C  -75.670 -26.980   -7.254 1.00 . B B . 214 HIS CD2  1 1 
        1   5314 2 2 214 HIS CE1  C  -75.298 -25.333   -5.852 1.00 . B B . 214 HIS CE1  1 1 
        1   5315 2 2 214 HIS CG   C  -76.830 -26.290   -7.116 1.00 . B B . 214 HIS CG   1 1 
        1   5316 2 2 214 HIS H    H  -77.840 -28.861   -9.201 1.00 . B B . 214 HIS H    1 1 
        1   5317 2 2 214 HIS HA   H  -78.848 -28.094   -6.530 1.00 . B B . 214 HIS HA   1 1 
        1   5318 2 2 214 HIS HB2  H  -78.080 -26.266   -8.808 1.00 . B B . 214 HIS HB2  1 1 
        1   5319 2 2 214 HIS HB3  H  -78.862 -25.753   -7.327 1.00 . B B . 214 HIS HB3  1 1 
        1   5320 2 2 214 HIS HD1  H  -77.203 -24.580   -5.949 1.00 . B B . 214 HIS HD1  1 1 
        1   5321 2 2 214 HIS HD2  H  -75.510 -27.847   -7.877 1.00 . B B . 214 HIS HD2  1 1 
        1   5322 2 2 214 HIS HE1  H  -74.809 -24.660   -5.164 1.00 . B B . 214 HIS HE1  1 1 
        1   5323 2 2 214 HIS HE2  H  -73.806 -26.655   -6.341 1.00 . B B . 214 HIS HE2  1 1 
        1   5324 2 2 214 HIS N    N  -77.933 -28.881   -8.225 1.00 . B B . 214 HIS N    1 1 
        1   5325 2 2 214 HIS ND1  N  -76.560 -25.260   -6.239 1.00 . B B . 214 HIS ND1  1 1 
        1   5326 2 2 214 HIS NE2  N  -74.736 -26.369   -6.451 1.00 . B B . 214 HIS NE2  1 1 
        1   5327 2 2 214 HIS O    O  -80.542 -28.819   -8.936 1.00 . B B . 214 HIS O    1 1 
        1   5328 2 2 215 ASN C    C  -82.570 -25.478   -9.200 1.00 . B B . 215 ASN C    1 1 
        1   5329 2 2 215 ASN CA   C  -82.330 -26.763   -8.403 1.00 . B B . 215 ASN CA   1 1 
        1   5330 2 2 215 ASN CB   C  -83.358 -26.892   -7.274 1.00 . B B . 215 ASN CB   1 1 
        1   5331 2 2 215 ASN CG   C  -84.778 -27.026   -7.792 1.00 . B B . 215 ASN CG   1 1 
        1   5332 2 2 215 ASN H    H  -80.627 -26.163   -7.295 1.00 . B B . 215 ASN H    1 1 
        1   5333 2 2 215 ASN HA   H  -82.483 -27.593   -9.076 1.00 . B B . 215 ASN HA   1 1 
        1   5334 2 2 215 ASN HB2  H  -83.120 -27.763   -6.682 1.00 . B B . 215 ASN HB2  1 1 
        1   5335 2 2 215 ASN HB3  H  -83.295 -26.016   -6.644 1.00 . B B . 215 ASN HB3  1 1 
        1   5336 2 2 215 ASN HD21 H  -85.343 -25.344   -6.843 1.00 . B B . 215 ASN HD21 1 1 
        1   5337 2 2 215 ASN HD22 H  -86.571 -26.115   -7.726 1.00 . B B . 215 ASN HD22 1 1 
        1   5338 2 2 215 ASN N    N  -80.970 -26.868   -7.883 1.00 . B B . 215 ASN N    1 1 
        1   5339 2 2 215 ASN ND2  N  -85.640 -26.078   -7.421 1.00 . B B . 215 ASN ND2  1 1 
        1   5340 2 2 215 ASN O    O  -82.883 -25.529  -10.396 1.00 . B B . 215 ASN O    1 1 
        1   5341 2 2 215 ASN OD1  O  -85.098 -27.976   -8.515 1.00 . B B . 215 ASN OD1  1 1 
        1   5342 2 2 216 SER C    C  -81.441 -22.668  -10.071 1.00 . B B . 216 SER C    1 1 
        1   5343 2 2 216 SER CA   C  -82.639 -23.054   -9.207 1.00 . B B . 216 SER CA   1 1 
        1   5344 2 2 216 SER CB   C  -82.955 -21.953   -8.194 1.00 . B B . 216 SER CB   1 1 
        1   5345 2 2 216 SER H    H  -82.174 -24.348   -7.595 1.00 . B B . 216 SER H    1 1 
        1   5346 2 2 216 SER HA   H  -83.495 -23.163   -9.859 1.00 . B B . 216 SER HA   1 1 
        1   5347 2 2 216 SER HB2  H  -83.648 -22.328   -7.461 1.00 . B B . 216 SER HB2  1 1 
        1   5348 2 2 216 SER HB3  H  -82.039 -21.661   -7.694 1.00 . B B . 216 SER HB3  1 1 
        1   5349 2 2 216 SER HG   H  -82.916 -20.093   -8.760 1.00 . B B . 216 SER HG   1 1 
        1   5350 2 2 216 SER N    N  -82.423 -24.332   -8.542 1.00 . B B . 216 SER N    1 1 
        1   5351 2 2 216 SER O    O  -80.285 -22.857   -9.679 1.00 . B B . 216 SER O    1 1 
        1   5352 2 2 216 SER OG   O  -83.532 -20.826   -8.836 1.00 . B B . 216 SER OG   1 1 
        1   5353 2 2 217 TYR C    C  -81.227 -20.257  -12.697 1.00 . B B . 217 TYR C    1 1 
        1   5354 2 2 217 TYR CA   C  -80.757 -21.606  -12.177 1.00 . B B . 217 TYR CA   1 1 
        1   5355 2 2 217 TYR CB   C  -80.606 -22.520  -13.383 1.00 . B B . 217 TYR CB   1 1 
        1   5356 2 2 217 TYR CD1  C  -78.543 -23.904  -12.956 1.00 . B B . 217 TYR CD1  1 1 
        1   5357 2 2 217 TYR CD2  C  -80.646 -25.027  -13.166 1.00 . B B . 217 TYR CD2  1 1 
        1   5358 2 2 217 TYR CE1  C  -77.903 -25.126  -12.765 1.00 . B B . 217 TYR CE1  1 1 
        1   5359 2 2 217 TYR CE2  C  -80.019 -26.250  -12.974 1.00 . B B . 217 TYR CE2  1 1 
        1   5360 2 2 217 TYR CG   C  -79.922 -23.837  -13.145 1.00 . B B . 217 TYR CG   1 1 
        1   5361 2 2 217 TYR CZ   C  -78.649 -26.294  -12.775 1.00 . B B . 217 TYR CZ   1 1 
        1   5362 2 2 217 TYR H    H  -82.692 -22.052  -11.490 1.00 . B B . 217 TYR H    1 1 
        1   5363 2 2 217 TYR HA   H  -79.806 -21.500  -11.680 1.00 . B B . 217 TYR HA   1 1 
        1   5364 2 2 217 TYR HB2  H  -81.590 -22.727  -13.770 1.00 . B B . 217 TYR HB2  1 1 
        1   5365 2 2 217 TYR HB3  H  -80.056 -21.981  -14.143 1.00 . B B . 217 TYR HB3  1 1 
        1   5366 2 2 217 TYR HD1  H  -77.963 -22.994  -12.948 1.00 . B B . 217 TYR HD1  1 1 
        1   5367 2 2 217 TYR HD2  H  -81.716 -24.995  -13.312 1.00 . B B . 217 TYR HD2  1 1 
        1   5368 2 2 217 TYR HE1  H  -76.835 -25.163  -12.609 1.00 . B B . 217 TYR HE1  1 1 
        1   5369 2 2 217 TYR HE2  H  -80.595 -27.164  -12.994 1.00 . B B . 217 TYR HE2  1 1 
        1   5370 2 2 217 TYR HH   H  -77.269 -27.359  -12.004 1.00 . B B . 217 TYR HH   1 1 
        1   5371 2 2 217 TYR N    N  -81.745 -22.147  -11.257 1.00 . B B . 217 TYR N    1 1 
        1   5372 2 2 217 TYR O    O  -82.428 -20.018  -12.837 1.00 . B B . 217 TYR O    1 1 
        1   5373 2 2 217 TYR OH   O  -78.020 -27.503  -12.584 1.00 . B B . 217 TYR OH   1 1 
        1   5374 2 2 218 THR C    C  -79.365 -17.508  -14.385 1.00 . B B . 218 THR C    1 1 
        1   5375 2 2 218 THR CA   C  -80.591 -18.121  -13.685 1.00 . B B . 218 THR CA   1 1 
        1   5376 2 2 218 THR CB   C  -81.309 -17.096  -12.735 1.00 . B B . 218 THR CB   1 1 
        1   5377 2 2 218 THR CG2  C  -80.654 -17.027  -11.357 1.00 . B B . 218 THR CG2  1 1 
        1   5378 2 2 218 THR H    H  -79.339 -19.639  -12.885 1.00 . B B . 218 THR H    1 1 
        1   5379 2 2 218 THR HA   H  -81.295 -18.366  -14.468 1.00 . B B . 218 THR HA   1 1 
        1   5380 2 2 218 THR HB   H  -82.331 -17.425  -12.607 1.00 . B B . 218 THR HB   1 1 
        1   5381 2 2 218 THR HG1  H  -80.756 -15.222  -12.839 1.00 . B B . 218 THR HG1  1 1 
        1   5382 2 2 218 THR HG21 H  -80.666 -16.007  -11.003 1.00 . B B . 218 THR HG21 1 1 
        1   5383 2 2 218 THR HG22 H  -79.632 -17.371  -11.427 1.00 . B B . 218 THR HG22 1 1 
        1   5384 2 2 218 THR HG23 H  -81.199 -17.654  -10.667 1.00 . B B . 218 THR HG23 1 1 
        1   5385 2 2 218 THR N    N  -80.278 -19.383  -13.005 1.00 . B B . 218 THR N    1 1 
        1   5386 2 2 218 THR O    O  -78.247 -18.022  -14.288 1.00 . B B . 218 THR O    1 1 
        1   5387 2 2 218 THR OG1  O  -81.340 -15.796  -13.340 1.00 . B B . 218 THR OG1  1 1 
        1   5388 2 2 219 CYS C    C  -78.896 -14.164  -15.560 1.00 . B B . 219 CYS C    1 1 
        1   5389 2 2 219 CYS CA   C  -78.504 -15.628  -15.643 1.00 . B B . 219 CYS CA   1 1 
        1   5390 2 2 219 CYS CB   C  -78.079 -16.050  -17.067 1.00 . B B . 219 CYS CB   1 1 
        1   5391 2 2 219 CYS H    H  -80.512 -16.095  -15.202 1.00 . B B . 219 CYS H    1 1 
        1   5392 2 2 219 CYS HA   H  -77.657 -15.774  -14.985 1.00 . B B . 219 CYS HA   1 1 
        1   5393 2 2 219 CYS HB2  H  -77.132 -15.584  -17.275 1.00 . B B . 219 CYS HB2  1 1 
        1   5394 2 2 219 CYS HB3  H  -77.915 -17.121  -17.048 1.00 . B B . 219 CYS HB3  1 1 
        1   5395 2 2 219 CYS N    N  -79.596 -16.436  -15.131 1.00 . B B . 219 CYS N    1 1 
        1   5396 2 2 219 CYS O    O  -80.085 -13.824  -15.584 1.00 . B B . 219 CYS O    1 1 
        1   5397 2 2 219 CYS SG   S  -79.191 -15.666  -18.493 1.00 . B B . 219 CYS SG   1 1 
        1   5398 2 2 220 GLU C    C  -77.297 -11.087  -16.331 1.00 . B B . 220 GLU C    1 1 
        1   5399 2 2 220 GLU CA   C  -78.152 -11.876  -15.365 1.00 . B B . 220 GLU CA   1 1 
        1   5400 2 2 220 GLU CB   C  -77.922 -11.348  -13.948 1.00 . B B . 220 GLU CB   1 1 
        1   5401 2 2 220 GLU CD   C  -79.001 -10.800  -11.723 1.00 . B B . 220 GLU CD   1 1 
        1   5402 2 2 220 GLU CG   C  -79.005 -11.702  -12.949 1.00 . B B . 220 GLU CG   1 1 
        1   5403 2 2 220 GLU H    H  -76.974 -13.630  -15.397 1.00 . B B . 220 GLU H    1 1 
        1   5404 2 2 220 GLU HA   H  -79.187 -11.708  -15.618 1.00 . B B . 220 GLU HA   1 1 
        1   5405 2 2 220 GLU HB2  H  -76.988 -11.745  -13.585 1.00 . B B . 220 GLU HB2  1 1 
        1   5406 2 2 220 GLU HB3  H  -77.836 -10.271  -13.998 1.00 . B B . 220 GLU HB3  1 1 
        1   5407 2 2 220 GLU HG2  H  -79.965 -11.617  -13.434 1.00 . B B . 220 GLU HG2  1 1 
        1   5408 2 2 220 GLU HG3  H  -78.865 -12.725  -12.632 1.00 . B B . 220 GLU HG3  1 1 
        1   5409 2 2 220 GLU N    N  -77.897 -13.301  -15.432 1.00 . B B . 220 GLU N    1 1 
        1   5410 2 2 220 GLU O    O  -76.147 -11.432  -16.582 1.00 . B B . 220 GLU O    1 1 
        1   5411 2 2 220 GLU OE1  O  -78.106  -9.932  -11.600 1.00 . B B . 220 GLU OE1  1 1 
        1   5412 2 2 220 GLU OE2  O  -79.900 -10.971  -10.874 1.00 . B B . 220 GLU OE2  1 1 
        1   5413 2 2 221 ALA C    C  -76.604  -7.961  -16.607 1.00 . B B . 221 ALA C    1 1 
        1   5414 2 2 221 ALA CA   C  -77.143  -9.004  -17.592 1.00 . B B . 221 ALA CA   1 1 
        1   5415 2 2 221 ALA CB   C  -78.046  -8.344  -18.610 1.00 . B B . 221 ALA CB   1 1 
        1   5416 2 2 221 ALA H    H  -78.808  -9.825  -16.606 1.00 . B B . 221 ALA H    1 1 
        1   5417 2 2 221 ALA HA   H  -76.313  -9.469  -18.103 1.00 . B B . 221 ALA HA   1 1 
        1   5418 2 2 221 ALA HB1  H  -79.065  -8.662  -18.447 1.00 . B B . 221 ALA HB1  1 1 
        1   5419 2 2 221 ALA HB2  H  -77.734  -8.628  -19.604 1.00 . B B . 221 ALA HB2  1 1 
        1   5420 2 2 221 ALA HB3  H  -77.983  -7.272  -18.505 1.00 . B B . 221 ALA HB3  1 1 
        1   5421 2 2 221 ALA N    N  -77.883 -10.022  -16.864 1.00 . B B . 221 ALA N    1 1 
        1   5422 2 2 221 ALA O    O  -76.762  -8.114  -15.391 1.00 . B B . 221 ALA O    1 1 
        1   5423 2 2 222 THR C    C  -75.447  -4.536  -17.300 1.00 . B B . 222 THR C    1 1 
        1   5424 2 2 222 THR CA   C  -75.532  -5.743  -16.363 1.00 . B B . 222 THR CA   1 1 
        1   5425 2 2 222 THR CB   C  -74.182  -5.965  -15.604 1.00 . B B . 222 THR CB   1 1 
        1   5426 2 2 222 THR CG2  C  -74.424  -6.452  -14.175 1.00 . B B . 222 THR CG2  1 1 
        1   5427 2 2 222 THR H    H  -75.862  -6.889  -18.113 1.00 . B B . 222 THR H    1 1 
        1   5428 2 2 222 THR HA   H  -76.301  -5.537  -15.631 1.00 . B B . 222 THR HA   1 1 
        1   5429 2 2 222 THR HB   H  -73.639  -5.032  -15.570 1.00 . B B . 222 THR HB   1 1 
        1   5430 2 2 222 THR HG1  H  -72.499  -6.905  -15.932 1.00 . B B . 222 THR HG1  1 1 
        1   5431 2 2 222 THR HG21 H  -74.280  -7.522  -14.130 1.00 . B B . 222 THR HG21 1 1 
        1   5432 2 2 222 THR HG22 H  -75.435  -6.212  -13.879 1.00 . B B . 222 THR HG22 1 1 
        1   5433 2 2 222 THR HG23 H  -73.728  -5.967  -13.506 1.00 . B B . 222 THR HG23 1 1 
        1   5434 2 2 222 THR N    N  -75.957  -6.922  -17.138 1.00 . B B . 222 THR N    1 1 
        1   5435 2 2 222 THR O    O  -75.136  -3.418  -16.879 1.00 . B B . 222 THR O    1 1 
        1   5436 2 2 222 THR OG1  O  -73.390  -6.943  -16.288 1.00 . B B . 222 THR OG1  1 1 
        1   5437 2 2 223 HIS C    C  -76.150  -2.397  -19.286 1.00 . B B . 223 HIS C    1 1 
        1   5438 2 2 223 HIS CA   C  -75.749  -3.828  -19.667 1.00 . B B . 223 HIS CA   1 1 
        1   5439 2 2 223 HIS CB   C  -76.620  -4.350  -20.811 1.00 . B B . 223 HIS CB   1 1 
        1   5440 2 2 223 HIS CD2  C  -75.846  -3.479  -23.130 1.00 . B B . 223 HIS CD2  1 1 
        1   5441 2 2 223 HIS CE1  C  -77.294  -1.849  -23.348 1.00 . B B . 223 HIS CE1  1 1 
        1   5442 2 2 223 HIS CG   C  -76.625  -3.474  -22.023 1.00 . B B . 223 HIS CG   1 1 
        1   5443 2 2 223 HIS H    H  -76.000  -5.723  -18.789 1.00 . B B . 223 HIS H    1 1 
        1   5444 2 2 223 HIS HA   H  -74.738  -3.780  -20.041 1.00 . B B . 223 HIS HA   1 1 
        1   5445 2 2 223 HIS HB2  H  -76.202  -5.298  -21.112 1.00 . B B . 223 HIS HB2  1 1 
        1   5446 2 2 223 HIS HB3  H  -77.628  -4.516  -20.469 1.00 . B B . 223 HIS HB3  1 1 
        1   5447 2 2 223 HIS HD1  H  -78.226  -2.192  -21.555 1.00 . B B . 223 HIS HD1  1 1 
        1   5448 2 2 223 HIS HD2  H  -75.033  -4.159  -23.340 1.00 . B B . 223 HIS HD2  1 1 
        1   5449 2 2 223 HIS HE1  H  -77.841  -1.006  -23.744 1.00 . B B . 223 HIS HE1  1 1 
        1   5450 2 2 223 HIS HE2  H  -75.903  -2.218  -24.808 1.00 . B B . 223 HIS HE2  1 1 
        1   5451 2 2 223 HIS N    N  -75.753  -4.801  -18.570 1.00 . B B . 223 HIS N    1 1 
        1   5452 2 2 223 HIS ND1  N  -77.525  -2.443  -22.193 1.00 . B B . 223 HIS ND1  1 1 
        1   5453 2 2 223 HIS NE2  N  -76.282  -2.457  -23.937 1.00 . B B . 223 HIS NE2  1 1 
        1   5454 2 2 223 HIS O    O  -77.187  -2.154  -18.667 1.00 . B B . 223 HIS O    1 1 
        1   5455 2 2 224 LYS C    C  -76.458   0.788  -19.805 1.00 . B B . 224 LYS C    1 1 
        1   5456 2 2 224 LYS CA   C  -75.336  -0.086  -19.227 1.00 . B B . 224 LYS CA   1 1 
        1   5457 2 2 224 LYS CB   C  -73.964   0.566  -19.475 1.00 . B B . 224 LYS CB   1 1 
        1   5458 2 2 224 LYS CD   C  -72.532   2.556  -18.930 1.00 . B B . 224 LYS CD   1 1 
        1   5459 2 2 224 LYS CE   C  -72.329   3.700  -17.934 1.00 . B B . 224 LYS CE   1 1 
        1   5460 2 2 224 LYS CG   C  -73.531   1.545  -18.398 1.00 . B B . 224 LYS CG   1 1 
        1   5461 2 2 224 LYS H    H  -74.534  -1.743  -20.230 1.00 . B B . 224 LYS H    1 1 
        1   5462 2 2 224 LYS HA   H  -75.480  -0.126  -18.159 1.00 . B B . 224 LYS HA   1 1 
        1   5463 2 2 224 LYS HB2  H  -73.221  -0.213  -19.543 1.00 . B B . 224 LYS HB2  1 1 
        1   5464 2 2 224 LYS HB3  H  -74.000   1.087  -20.422 1.00 . B B . 224 LYS HB3  1 1 
        1   5465 2 2 224 LYS HD2  H  -71.586   2.063  -19.102 1.00 . B B . 224 LYS HD2  1 1 
        1   5466 2 2 224 LYS HD3  H  -72.897   2.959  -19.863 1.00 . B B . 224 LYS HD3  1 1 
        1   5467 2 2 224 LYS HE2  H  -71.997   3.286  -16.995 1.00 . B B . 224 LYS HE2  1 1 
        1   5468 2 2 224 LYS HE3  H  -71.555   4.352  -18.314 1.00 . B B . 224 LYS HE3  1 1 
        1   5469 2 2 224 LYS HG2  H  -74.399   2.069  -18.027 1.00 . B B . 224 LYS HG2  1 1 
        1   5470 2 2 224 LYS HG3  H  -73.079   0.995  -17.585 1.00 . B B . 224 LYS HG3  1 1 
        1   5471 2 2 224 LYS HZ1  H  -74.404   3.956  -17.952 1.00 . B B . 224 LYS HZ1  1 1 
        1   5472 2 2 224 LYS HZ2  H  -73.530   5.381  -18.253 1.00 . B B . 224 LYS HZ2  1 1 
        1   5473 2 2 224 LYS HZ3  H  -73.622   4.755  -16.676 1.00 . B B . 224 LYS HZ3  1 1 
        1   5474 2 2 224 LYS N    N  -75.316  -1.457  -19.713 1.00 . B B . 224 LYS N    1 1 
        1   5475 2 2 224 LYS NZ   N  -73.566   4.510  -17.685 1.00 . B B . 224 LYS NZ   1 1 
        1   5476 2 2 224 LYS O    O  -76.199   1.902  -20.265 1.00 . B B . 224 LYS O    1 1 
        1   5477 2 2 225 THR C    C  -79.220   1.678  -18.543 1.00 . B B . 225 THR C    1 1 
        1   5478 2 2 225 THR CA   C  -78.860   1.174  -19.937 1.00 . B B . 225 THR CA   1 1 
        1   5479 2 2 225 THR CB   C  -80.075   0.504  -20.607 1.00 . B B . 225 THR CB   1 1 
        1   5480 2 2 225 THR CG2  C  -80.395   1.208  -21.910 1.00 . B B . 225 THR CG2  1 1 
        1   5481 2 2 225 THR H    H  -77.829  -0.612  -19.431 1.00 . B B . 225 THR H    1 1 
        1   5482 2 2 225 THR HA   H  -78.562   2.026  -20.534 1.00 . B B . 225 THR HA   1 1 
        1   5483 2 2 225 THR HB   H  -80.927   0.571  -19.949 1.00 . B B . 225 THR HB   1 1 
        1   5484 2 2 225 THR HG1  H  -79.372  -1.248  -20.088 1.00 . B B . 225 THR HG1  1 1 
        1   5485 2 2 225 THR HG21 H  -79.878   2.155  -21.943 1.00 . B B . 225 THR HG21 1 1 
        1   5486 2 2 225 THR HG22 H  -81.460   1.377  -21.975 1.00 . B B . 225 THR HG22 1 1 
        1   5487 2 2 225 THR HG23 H  -80.076   0.594  -22.739 1.00 . B B . 225 THR HG23 1 1 
        1   5488 2 2 225 THR N    N  -77.691   0.287  -19.797 1.00 . B B . 225 THR N    1 1 
        1   5489 2 2 225 THR O    O  -79.578   2.849  -18.356 1.00 . B B . 225 THR O    1 1 
        1   5490 2 2 225 THR OG1  O  -79.787  -0.878  -20.870 1.00 . B B . 225 THR OG1  1 1 
        1   5491 2 2 226 SER C    C  -78.305  -0.259  -15.578 1.00 . B B . 226 SER C    1 1 
        1   5492 2 2 226 SER CA   C  -78.875   1.027  -16.174 1.00 . B B . 226 SER CA   1 1 
        1   5493 2 2 226 SER CB   C  -80.114   1.498  -15.403 1.00 . B B . 226 SER CB   1 1 
        1   5494 2 2 226 SER H    H  -78.896  -0.148  -17.889 1.00 . B B . 226 SER H    1 1 
        1   5495 2 2 226 SER HA   H  -78.113   1.795  -16.118 1.00 . B B . 226 SER HA   1 1 
        1   5496 2 2 226 SER HB2  H  -80.664   2.202  -16.005 1.00 . B B . 226 SER HB2  1 1 
        1   5497 2 2 226 SER HB3  H  -80.747   0.645  -15.193 1.00 . B B . 226 SER HB3  1 1 
        1   5498 2 2 226 SER HG   H  -79.013   2.736  -14.376 1.00 . B B . 226 SER HG   1 1 
        1   5499 2 2 226 SER N    N  -79.145   0.750  -17.587 1.00 . B B . 226 SER N    1 1 
        1   5500 2 2 226 SER O    O  -78.823  -1.353  -15.831 1.00 . B B . 226 SER O    1 1 
        1   5501 2 2 226 SER OG   O  -79.734   2.132  -14.184 1.00 . B B . 226 SER OG   1 1 
        1   5502 2 2 227 THR C    C  -77.327  -1.947  -13.094 1.00 . B B . 227 THR C    1 1 
        1   5503 2 2 227 THR CA   C  -76.533  -1.294  -14.249 1.00 . B B . 227 THR CA   1 1 
        1   5504 2 2 227 THR CB   C  -75.039  -0.978  -13.911 1.00 . B B . 227 THR CB   1 1 
        1   5505 2 2 227 THR CG2  C  -74.234  -0.777  -15.200 1.00 . B B . 227 THR CG2  1 1 
        1   5506 2 2 227 THR H    H  -76.858   0.764  -14.652 1.00 . B B . 227 THR H    1 1 
        1   5507 2 2 227 THR HA   H  -76.503  -2.031  -15.041 1.00 . B B . 227 THR HA   1 1 
        1   5508 2 2 227 THR HB   H  -74.617  -1.803  -13.357 1.00 . B B . 227 THR HB   1 1 
        1   5509 2 2 227 THR HG1  H  -74.162   0.155  -12.577 1.00 . B B . 227 THR HG1  1 1 
        1   5510 2 2 227 THR HG21 H  -74.217   0.272  -15.454 1.00 . B B . 227 THR HG21 1 1 
        1   5511 2 2 227 THR HG22 H  -74.695  -1.334  -16.003 1.00 . B B . 227 THR HG22 1 1 
        1   5512 2 2 227 THR HG23 H  -73.224  -1.129  -15.053 1.00 . B B . 227 THR HG23 1 1 
        1   5513 2 2 227 THR N    N  -77.230  -0.130  -14.804 1.00 . B B . 227 THR N    1 1 
        1   5514 2 2 227 THR O    O  -76.793  -2.289  -12.027 1.00 . B B . 227 THR O    1 1 
        1   5515 2 2 227 THR OG1  O  -74.950   0.217  -13.122 1.00 . B B . 227 THR OG1  1 1 
        1   5516 2 2 228 SER C    C  -79.741  -4.207  -13.202 1.00 . B B . 228 SER C    1 1 
        1   5517 2 2 228 SER CA   C  -79.564  -2.832  -12.535 1.00 . B B . 228 SER CA   1 1 
        1   5518 2 2 228 SER CB   C  -80.906  -2.085  -12.477 1.00 . B B . 228 SER CB   1 1 
        1   5519 2 2 228 SER H    H  -78.940  -1.783  -14.233 1.00 . B B . 228 SER H    1 1 
        1   5520 2 2 228 SER HA   H  -79.163  -2.954  -11.539 1.00 . B B . 228 SER HA   1 1 
        1   5521 2 2 228 SER HB2  H  -81.567  -2.489  -13.224 1.00 . B B . 228 SER HB2  1 1 
        1   5522 2 2 228 SER HB3  H  -81.350  -2.242  -11.501 1.00 . B B . 228 SER HB3  1 1 
        1   5523 2 2 228 SER HG   H  -80.376  -0.295  -11.924 1.00 . B B . 228 SER HG   1 1 
        1   5524 2 2 228 SER N    N  -78.623  -2.096  -13.360 1.00 . B B . 228 SER N    1 1 
        1   5525 2 2 228 SER O    O  -80.559  -4.353  -14.118 1.00 . B B . 228 SER O    1 1 
        1   5526 2 2 228 SER OG   O  -80.753  -0.691  -12.714 1.00 . B B . 228 SER OG   1 1 
        1   5527 2 2 229 PRO C    C  -79.992  -7.315  -13.792 1.00 . B B . 229 PRO C    1 1 
        1   5528 2 2 229 PRO CA   C  -78.746  -6.478  -13.474 1.00 . B B . 229 PRO CA   1 1 
        1   5529 2 2 229 PRO CB   C  -77.781  -7.245  -12.559 1.00 . B B . 229 PRO CB   1 1 
        1   5530 2 2 229 PRO CD   C  -78.172  -5.164  -11.504 1.00 . B B . 229 PRO CD   1 1 
        1   5531 2 2 229 PRO CG   C  -77.107  -6.188  -11.751 1.00 . B B . 229 PRO CG   1 1 
        1   5532 2 2 229 PRO HA   H  -78.228  -6.267  -14.394 1.00 . B B . 229 PRO HA   1 1 
        1   5533 2 2 229 PRO HB2  H  -78.330  -7.921  -11.917 1.00 . B B . 229 PRO HB2  1 1 
        1   5534 2 2 229 PRO HB3  H  -77.053  -7.785  -13.144 1.00 . B B . 229 PRO HB3  1 1 
        1   5535 2 2 229 PRO HD2  H  -78.775  -5.440  -10.649 1.00 . B B . 229 PRO HD2  1 1 
        1   5536 2 2 229 PRO HD3  H  -77.742  -4.184  -11.375 1.00 . B B . 229 PRO HD3  1 1 
        1   5537 2 2 229 PRO HG2  H  -76.751  -6.601  -10.817 1.00 . B B . 229 PRO HG2  1 1 
        1   5538 2 2 229 PRO HG3  H  -76.294  -5.748  -12.306 1.00 . B B . 229 PRO HG3  1 1 
        1   5539 2 2 229 PRO N    N  -78.965  -5.214  -12.748 1.00 . B B . 229 PRO N    1 1 
        1   5540 2 2 229 PRO O    O  -80.418  -8.119  -12.963 1.00 . B B . 229 PRO O    1 1 
        1   5541 2 2 230 ILE C    C  -81.589  -9.387  -15.352 1.00 . B B . 230 ILE C    1 1 
        1   5542 2 2 230 ILE CA   C  -81.714  -7.865  -15.524 1.00 . B B . 230 ILE CA   1 1 
        1   5543 2 2 230 ILE CB   C  -82.009  -7.519  -17.022 1.00 . B B . 230 ILE CB   1 1 
        1   5544 2 2 230 ILE CD1  C  -81.987  -5.516  -18.603 1.00 . B B . 230 ILE CD1  1 1 
        1   5545 2 2 230 ILE CG1  C  -82.236  -6.018  -17.198 1.00 . B B . 230 ILE CG1  1 1 
        1   5546 2 2 230 ILE CG2  C  -83.223  -8.281  -17.532 1.00 . B B . 230 ILE CG2  1 1 
        1   5547 2 2 230 ILE H    H  -80.103  -6.486  -15.603 1.00 . B B . 230 ILE H    1 1 
        1   5548 2 2 230 ILE HA   H  -82.568  -7.545  -14.944 1.00 . B B . 230 ILE HA   1 1 
        1   5549 2 2 230 ILE HB   H  -81.152  -7.811  -17.613 1.00 . B B . 230 ILE HB   1 1 
        1   5550 2 2 230 ILE HD11 H  -82.931  -5.309  -19.084 1.00 . B B . 230 ILE HD11 1 1 
        1   5551 2 2 230 ILE HD12 H  -81.453  -6.268  -19.165 1.00 . B B . 230 ILE HD12 1 1 
        1   5552 2 2 230 ILE HD13 H  -81.398  -4.611  -18.563 1.00 . B B . 230 ILE HD13 1 1 
        1   5553 2 2 230 ILE HG12 H  -83.256  -5.791  -16.932 1.00 . B B . 230 ILE HG12 1 1 
        1   5554 2 2 230 ILE HG13 H  -81.579  -5.492  -16.519 1.00 . B B . 230 ILE HG13 1 1 
        1   5555 2 2 230 ILE HG21 H  -83.284  -9.236  -17.032 1.00 . B B . 230 ILE HG21 1 1 
        1   5556 2 2 230 ILE HG22 H  -83.129  -8.437  -18.597 1.00 . B B . 230 ILE HG22 1 1 
        1   5557 2 2 230 ILE HG23 H  -84.117  -7.711  -17.330 1.00 . B B . 230 ILE HG23 1 1 
        1   5558 2 2 230 ILE N    N  -80.534  -7.133  -15.006 1.00 . B B . 230 ILE N    1 1 
        1   5559 2 2 230 ILE O    O  -80.701 -10.020  -15.929 1.00 . B B . 230 ILE O    1 1 
        1   5560 2 2 231 VAL C    C  -83.625 -12.184  -14.783 1.00 . B B . 231 VAL C    1 1 
        1   5561 2 2 231 VAL CA   C  -82.459 -11.369  -14.171 1.00 . B B . 231 VAL CA   1 1 
        1   5562 2 2 231 VAL CB   C  -82.404 -11.503  -12.609 1.00 . B B . 231 VAL CB   1 1 
        1   5563 2 2 231 VAL CG1  C  -83.576 -10.765  -11.928 1.00 . B B . 231 VAL CG1  1 1 
        1   5564 2 2 231 VAL CG2  C  -82.304 -12.957  -12.157 1.00 . B B . 231 VAL CG2  1 1 
        1   5565 2 2 231 VAL H    H  -83.171  -9.379  -14.142 1.00 . B B . 231 VAL H    1 1 
        1   5566 2 2 231 VAL HA   H  -81.541 -11.784  -14.562 1.00 . B B . 231 VAL HA   1 1 
        1   5567 2 2 231 VAL HB   H  -81.498 -11.001  -12.289 1.00 . B B . 231 VAL HB   1 1 
        1   5568 2 2 231 VAL HG11 H  -84.316 -11.484  -11.607 1.00 . B B . 231 VAL HG11 1 1 
        1   5569 2 2 231 VAL HG12 H  -84.024 -10.076  -12.628 1.00 . B B . 231 VAL HG12 1 1 
        1   5570 2 2 231 VAL HG13 H  -83.208 -10.219  -11.071 1.00 . B B . 231 VAL HG13 1 1 
        1   5571 2 2 231 VAL HG21 H  -83.227 -13.250  -11.680 1.00 . B B . 231 VAL HG21 1 1 
        1   5572 2 2 231 VAL HG22 H  -81.488 -13.062  -11.458 1.00 . B B . 231 VAL HG22 1 1 
        1   5573 2 2 231 VAL HG23 H  -82.127 -13.589  -13.015 1.00 . B B . 231 VAL HG23 1 1 
        1   5574 2 2 231 VAL N    N  -82.494  -9.954  -14.556 1.00 . B B . 231 VAL N    1 1 
        1   5575 2 2 231 VAL O    O  -84.755 -11.690  -14.894 1.00 . B B . 231 VAL O    1 1 
        1   5576 2 2 232 LYS C    C  -84.002 -15.752  -15.294 1.00 . B B . 232 LYS C    1 1 
        1   5577 2 2 232 LYS CA   C  -84.368 -14.328  -15.690 1.00 . B B . 232 LYS CA   1 1 
        1   5578 2 2 232 LYS CB   C  -84.529 -14.197  -17.204 1.00 . B B . 232 LYS CB   1 1 
        1   5579 2 2 232 LYS CD   C  -86.215 -15.845  -18.073 1.00 . B B . 232 LYS CD   1 1 
        1   5580 2 2 232 LYS CE   C  -87.467 -15.979  -18.918 1.00 . B B . 232 LYS CE   1 1 
        1   5581 2 2 232 LYS CG   C  -85.946 -14.394  -17.718 1.00 . B B . 232 LYS CG   1 1 
        1   5582 2 2 232 LYS H    H  -82.418 -13.747  -15.101 1.00 . B B . 232 LYS H    1 1 
        1   5583 2 2 232 LYS HA   H  -85.306 -14.071  -15.218 1.00 . B B . 232 LYS HA   1 1 
        1   5584 2 2 232 LYS HB2  H  -84.199 -13.213  -17.497 1.00 . B B . 232 LYS HB2  1 1 
        1   5585 2 2 232 LYS HB3  H  -83.885 -14.926  -17.678 1.00 . B B . 232 LYS HB3  1 1 
        1   5586 2 2 232 LYS HD2  H  -85.373 -16.237  -18.625 1.00 . B B . 232 LYS HD2  1 1 
        1   5587 2 2 232 LYS HD3  H  -86.338 -16.415  -17.164 1.00 . B B . 232 LYS HD3  1 1 
        1   5588 2 2 232 LYS HE2  H  -88.244 -15.419  -18.416 1.00 . B B . 232 LYS HE2  1 1 
        1   5589 2 2 232 LYS HE3  H  -87.319 -15.568  -19.904 1.00 . B B . 232 LYS HE3  1 1 
        1   5590 2 2 232 LYS HG2  H  -86.644 -14.083  -16.956 1.00 . B B . 232 LYS HG2  1 1 
        1   5591 2 2 232 LYS HG3  H  -86.089 -13.782  -18.597 1.00 . B B . 232 LYS HG3  1 1 
        1   5592 2 2 232 LYS HZ1  H  -88.267 -17.694  -18.062 1.00 . B B . 232 LYS HZ1  1 1 
        1   5593 2 2 232 LYS HZ2  H  -87.127 -17.995  -19.285 1.00 . B B . 232 LYS HZ2  1 1 
        1   5594 2 2 232 LYS HZ3  H  -88.690 -17.469  -19.691 1.00 . B B . 232 LYS HZ3  1 1 
        1   5595 2 2 232 LYS N    N  -83.336 -13.417  -15.197 1.00 . B B . 232 LYS N    1 1 
        1   5596 2 2 232 LYS NZ   N  -87.922 -17.390  -18.995 1.00 . B B . 232 LYS NZ   1 1 
        1   5597 2 2 232 LYS O    O  -82.898 -16.223  -15.594 1.00 . B B . 232 LYS O    1 1 
        1   5598 2 2 233 SER C    C  -85.597 -18.832  -14.203 1.00 . B B . 233 SER C    1 1 
        1   5599 2 2 233 SER CA   C  -84.655 -17.663  -13.895 1.00 . B B . 233 SER CA   1 1 
        1   5600 2 2 233 SER CB   C  -84.697 -17.357  -12.394 1.00 . B B . 233 SER CB   1 1 
        1   5601 2 2 233 SER H    H  -85.794 -15.979  -14.457 1.00 . B B . 233 SER H    1 1 
        1   5602 2 2 233 SER HA   H  -83.651 -17.972  -14.138 1.00 . B B . 233 SER HA   1 1 
        1   5603 2 2 233 SER HB2  H  -84.373 -16.343  -12.231 1.00 . B B . 233 SER HB2  1 1 
        1   5604 2 2 233 SER HB3  H  -85.717 -17.455  -12.045 1.00 . B B . 233 SER HB3  1 1 
        1   5605 2 2 233 SER HG   H  -83.353 -17.689  -11.034 1.00 . B B . 233 SER HG   1 1 
        1   5606 2 2 233 SER N    N  -84.943 -16.430  -14.634 1.00 . B B . 233 SER N    1 1 
        1   5607 2 2 233 SER O    O  -86.669 -18.644  -14.773 1.00 . B B . 233 SER O    1 1 
        1   5608 2 2 233 SER OG   O  -83.854 -18.222  -11.656 1.00 . B B . 233 SER OG   1 1 
        1   5609 2 2 234 PHE C    C  -85.481 -22.183  -12.711 1.00 . B B . 234 PHE C    1 1 
        1   5610 2 2 234 PHE CA   C  -86.045 -21.208  -13.748 1.00 . B B . 234 PHE CA   1 1 
        1   5611 2 2 234 PHE CB   C  -86.259 -21.869  -15.124 1.00 . B B . 234 PHE CB   1 1 
        1   5612 2 2 234 PHE CD1  C  -83.984 -22.613  -15.946 1.00 . B B . 234 PHE CD1  1 1 
        1   5613 2 2 234 PHE CD2  C  -85.593 -24.296  -15.361 1.00 . B B . 234 PHE CD2  1 1 
        1   5614 2 2 234 PHE CE1  C  -83.054 -23.613  -16.282 1.00 . B B . 234 PHE CE1  1 1 
        1   5615 2 2 234 PHE CE2  C  -84.669 -25.300  -15.691 1.00 . B B . 234 PHE CE2  1 1 
        1   5616 2 2 234 PHE CG   C  -85.254 -22.945  -15.473 1.00 . B B . 234 PHE CG   1 1 
        1   5617 2 2 234 PHE CZ   C  -83.398 -24.955  -16.150 1.00 . B B . 234 PHE CZ   1 1 
        1   5618 2 2 234 PHE H    H  -84.288 -20.096  -13.408 1.00 . B B . 234 PHE H    1 1 
        1   5619 2 2 234 PHE HA   H  -87.007 -20.867  -13.386 1.00 . B B . 234 PHE HA   1 1 
        1   5620 2 2 234 PHE HB2  H  -87.243 -22.309  -15.141 1.00 . B B . 234 PHE HB2  1 1 
        1   5621 2 2 234 PHE HB3  H  -86.218 -21.097  -15.881 1.00 . B B . 234 PHE HB3  1 1 
        1   5622 2 2 234 PHE HD1  H  -83.710 -21.574  -16.051 1.00 . B B . 234 PHE HD1  1 1 
        1   5623 2 2 234 PHE HD2  H  -86.572 -24.571  -14.997 1.00 . B B . 234 PHE HD2  1 1 
        1   5624 2 2 234 PHE HE1  H  -82.071 -23.339  -16.637 1.00 . B B . 234 PHE HE1  1 1 
        1   5625 2 2 234 PHE HE2  H  -84.946 -26.340  -15.599 1.00 . B B . 234 PHE HE2  1 1 
        1   5626 2 2 234 PHE HZ   H  -82.685 -25.725  -16.404 1.00 . B B . 234 PHE HZ   1 1 
        1   5627 2 2 234 PHE N    N  -85.167 -20.038  -13.836 1.00 . B B . 234 PHE N    1 1 
        1   5628 2 2 234 PHE O    O  -84.382 -21.964  -12.202 1.00 . B B . 234 PHE O    1 1 
        1   5629 2 2 235 ASN C    C  -85.962 -25.706  -11.872 1.00 . B B . 235 ASN C    1 1 
        1   5630 2 2 235 ASN CA   C  -85.738 -24.262  -11.440 1.00 . B B . 235 ASN CA   1 1 
        1   5631 2 2 235 ASN CB   C  -86.256 -24.027  -10.015 1.00 . B B . 235 ASN CB   1 1 
        1   5632 2 2 235 ASN CG   C  -87.737 -23.720   -9.973 1.00 . B B . 235 ASN CG   1 1 
        1   5633 2 2 235 ASN H    H  -87.106 -23.356  -12.802 1.00 . B B . 235 ASN H    1 1 
        1   5634 2 2 235 ASN HA   H  -84.666 -24.130  -11.395 1.00 . B B . 235 ASN HA   1 1 
        1   5635 2 2 235 ASN HB2  H  -86.070 -24.912   -9.426 1.00 . B B . 235 ASN HB2  1 1 
        1   5636 2 2 235 ASN HB3  H  -85.713 -23.200   -9.580 1.00 . B B . 235 ASN HB3  1 1 
        1   5637 2 2 235 ASN HD21 H  -87.364 -21.832   -9.410 1.00 . B B . 235 ASN HD21 1 1 
        1   5638 2 2 235 ASN HD22 H  -89.008 -22.221   -9.577 1.00 . B B . 235 ASN HD22 1 1 
        1   5639 2 2 235 ASN N    N  -86.230 -23.238  -12.380 1.00 . B B . 235 ASN N    1 1 
        1   5640 2 2 235 ASN ND2  N  -88.065 -22.483   -9.623 1.00 . B B . 235 ASN ND2  1 1 
        1   5641 2 2 235 ASN O    O  -87.062 -26.094  -12.250 1.00 . B B . 235 ASN O    1 1 
        1   5642 2 2 235 ASN OD1  O  -88.578 -24.580  -10.244 1.00 . B B . 235 ASN OD1  1 1 
        1   5643 2 2 236 ARG C    C  -86.041 -28.718  -12.099 1.00 . B B . 236 ARG C    1 1 
        1   5644 2 2 236 ARG CA   C  -84.776 -27.865  -12.248 1.00 . B B . 236 ARG CA   1 1 
        1   5645 2 2 236 ARG CB   C  -83.615 -28.549  -11.511 1.00 . B B . 236 ARG CB   1 1 
        1   5646 2 2 236 ARG CD   C  -82.637 -30.843  -11.652 1.00 . B B . 236 ARG CD   1 1 
        1   5647 2 2 236 ARG CG   C  -82.802 -29.510  -12.350 1.00 . B B . 236 ARG CG   1 1 
        1   5648 2 2 236 ARG CZ   C  -84.192 -32.294  -12.926 1.00 . B B . 236 ARG CZ   1 1 
        1   5649 2 2 236 ARG H    H  -84.063 -26.058  -11.448 1.00 . B B . 236 ARG H    1 1 
        1   5650 2 2 236 ARG HA   H  -84.520 -27.840  -13.295 1.00 . B B . 236 ARG HA   1 1 
        1   5651 2 2 236 ARG HB2  H  -82.951 -27.785  -11.140 1.00 . B B . 236 ARG HB2  1 1 
        1   5652 2 2 236 ARG HB3  H  -84.020 -29.087  -10.665 1.00 . B B . 236 ARG HB3  1 1 
        1   5653 2 2 236 ARG HD2  H  -81.795 -31.366  -12.078 1.00 . B B . 236 ARG HD2  1 1 
        1   5654 2 2 236 ARG HD3  H  -82.453 -30.672  -10.601 1.00 . B B . 236 ARG HD3  1 1 
        1   5655 2 2 236 ARG HE   H  -84.426 -31.759  -11.026 1.00 . B B . 236 ARG HE   1 1 
        1   5656 2 2 236 ARG HG2  H  -83.301 -29.664  -13.295 1.00 . B B . 236 ARG HG2  1 1 
        1   5657 2 2 236 ARG HG3  H  -81.827 -29.082  -12.531 1.00 . B B . 236 ARG HG3  1 1 
        1   5658 2 2 236 ARG HH11 H  -82.602 -31.672  -14.011 1.00 . B B . 236 ARG HH11 1 1 
        1   5659 2 2 236 ARG HH12 H  -83.723 -32.688  -14.854 1.00 . B B . 236 ARG HH12 1 1 
        1   5660 2 2 236 ARG HH21 H  -85.888 -33.074  -12.148 1.00 . B B . 236 ARG HH21 1 1 
        1   5661 2 2 236 ARG HH22 H  -85.576 -33.479  -13.803 1.00 . B B . 236 ARG HH22 1 1 
        1   5662 2 2 236 ARG N    N  -84.884 -26.478  -11.781 1.00 . B B . 236 ARG N    1 1 
        1   5663 2 2 236 ARG NE   N  -83.838 -31.666  -11.804 1.00 . B B . 236 ARG NE   1 1 
        1   5664 2 2 236 ARG NH1  N  -83.444 -32.211  -14.020 1.00 . B B . 236 ARG NH1  1 1 
        1   5665 2 2 236 ARG NH2  N  -85.311 -33.008  -12.962 1.00 . B B . 236 ARG NH2  1 1 
        1   5666 2 2 236 ARG O    O  -86.886 -28.735  -12.989 1.00 . B B . 236 ARG O    1 1 
        1   5667 2 2 237 ASN C    C  -88.168 -30.880  -11.722 1.00 . B B . 237 ASN C    1 1 
        1   5668 2 2 237 ASN CA   C  -87.194 -30.399  -10.621 1.00 . B B . 237 ASN CA   1 1 
        1   5669 2 2 237 ASN CB   C  -87.959 -29.958   -9.356 1.00 . B B . 237 ASN CB   1 1 
        1   5670 2 2 237 ASN CG   C  -88.327 -28.477   -9.369 1.00 . B B . 237 ASN CG   1 1 
        1   5671 2 2 237 ASN H    H  -85.392 -29.331  -10.327 1.00 . B B . 237 ASN H    1 1 
        1   5672 2 2 237 ASN HA   H  -86.659 -31.289  -10.326 1.00 . B B . 237 ASN HA   1 1 
        1   5673 2 2 237 ASN HB2  H  -88.866 -30.538   -9.277 1.00 . B B . 237 ASN HB2  1 1 
        1   5674 2 2 237 ASN HB3  H  -87.343 -30.158   -8.491 1.00 . B B . 237 ASN HB3  1 1 
        1   5675 2 2 237 ASN HD21 H  -89.431 -28.652  -10.979 1.00 . B B . 237 ASN HD21 1 1 
        1   5676 2 2 237 ASN HD22 H  -89.389 -27.116  -10.407 1.00 . B B . 237 ASN HD22 1 1 
        1   5677 2 2 237 ASN N    N  -86.132 -29.421  -10.964 1.00 . B B . 237 ASN N    1 1 
        1   5678 2 2 237 ASN ND2  N  -89.125 -28.058  -10.357 1.00 . B B . 237 ASN ND2  1 1 
        1   5679 2 2 237 ASN O    O  -88.123 -32.055  -12.131 1.00 . B B . 237 ASN O    1 1 
        1   5680 2 2 237 ASN OD1  O  -87.898 -27.720   -8.495 1.00 . B B . 237 ASN OD1  1 1 
        1   5681 2 2 238 GLU C    C  -89.353 -30.727  -14.528 1.00 . B B . 238 GLU C    1 1 
        1   5682 2 2 238 GLU CA   C  -90.028 -30.330  -13.206 1.00 . B B . 238 GLU CA   1 1 
        1   5683 2 2 238 GLU CB   C  -91.043 -29.192  -13.412 1.00 . B B . 238 GLU CB   1 1 
        1   5684 2 2 238 GLU CD   C  -92.806 -30.976  -14.010 1.00 . B B . 238 GLU CD   1 1 
        1   5685 2 2 238 GLU CG   C  -92.234 -29.578  -14.310 1.00 . B B . 238 GLU CG   1 1 
        1   5686 2 2 238 GLU H    H  -89.038 -29.077  -11.813 1.00 . B B . 238 GLU H    1 1 
        1   5687 2 2 238 GLU HA   H  -90.572 -31.194  -12.850 1.00 . B B . 238 GLU HA   1 1 
        1   5688 2 2 238 GLU HB2  H  -91.422 -28.883  -12.450 1.00 . B B . 238 GLU HB2  1 1 
        1   5689 2 2 238 GLU HB3  H  -90.529 -28.355  -13.863 1.00 . B B . 238 GLU HB3  1 1 
        1   5690 2 2 238 GLU HG2  H  -93.019 -28.851  -14.173 1.00 . B B . 238 GLU HG2  1 1 
        1   5691 2 2 238 GLU HG3  H  -91.911 -29.548  -15.341 1.00 . B B . 238 GLU HG3  1 1 
        1   5692 2 2 238 GLU N    N  -89.045 -29.985  -12.182 1.00 . B B . 238 GLU N    1 1 
        1   5693 2 2 238 GLU O    O  -89.698 -31.750  -15.138 1.00 . B B . 238 GLU O    1 1 
        1   5694 2 2 238 GLU OE1  O  -93.345 -31.188  -12.900 1.00 . B B . 238 GLU OE1  1 1 
        1   5695 2 2 238 GLU OE2  O  -92.710 -31.862  -14.889 1.00 . B B . 238 GLU OE2  1 1 
        1   5696 2 2 239 CYS C    C  -86.259 -30.419  -16.152 1.00 . B B . 239 CYS C    1 1 
        1   5697 2 2 239 CYS CA   C  -87.750 -30.066  -16.250 1.00 . B B . 239 CYS CA   1 1 
        1   5698 2 2 239 CYS CB   C  -88.016 -28.800  -17.078 1.00 . B B . 239 CYS CB   1 1 
        1   5699 2 2 239 CYS H    H  -88.139 -29.151  -14.390 1.00 . B B . 239 CYS H    1 1 
        1   5700 2 2 239 CYS HA   H  -88.239 -30.889  -16.751 1.00 . B B . 239 CYS HA   1 1 
        1   5701 2 2 239 CYS HB2  H  -87.901 -27.934  -16.444 1.00 . B B . 239 CYS HB2  1 1 
        1   5702 2 2 239 CYS HB3  H  -87.294 -28.746  -17.880 1.00 . B B . 239 CYS HB3  1 1 
        1   5703 2 2 239 CYS N    N  -88.372 -29.928  -14.940 1.00 . B B . 239 CYS N    1 1 
        1   5704 2 2 239 CYS O    O  -85.409 -29.960  -16.925 1.00 . B B . 239 CYS O    1 1 
        1   5705 2 2 239 CYS OXT  O  -85.874 -31.203  -15.280 1.00 . B B . 239 CYS OXT  1 1 
        1   5706 2 2 239 CYS SG   S  -89.703 -28.796  -17.788 1.00 . B B . 239 CYS SG   1 1 
        1   5707 3 3   1 GLU C    C  -83.229 -13.348  -63.136 1.00 . C C .   1 GLU C    1 1 
        1   5708 3 3   1 GLU CA   C  -84.435 -12.500  -62.735 1.00 . C C .   1 GLU CA   1 1 
        1   5709 3 3   1 GLU CB   C  -84.220 -11.033  -63.142 1.00 . C C .   1 GLU CB   1 1 
        1   5710 3 3   1 GLU CD   C  -84.461  -9.673  -65.302 1.00 . C C .   1 GLU CD   1 1 
        1   5711 3 3   1 GLU CG   C  -83.782 -10.858  -64.611 1.00 . C C .   1 GLU CG   1 1 
        1   5712 3 3   1 GLU H1   H  -85.718 -12.812  -61.126 1.00 . C C .   1 GLU H1   1 1 
        1   5713 3 3   1 GLU H2   H  -84.449 -11.730  -60.801 1.00 . C C .   1 GLU H2   1 1 
        1   5714 3 3   1 GLU H3   H  -84.146 -13.400  -60.881 1.00 . C C .   1 GLU H3   1 1 
        1   5715 3 3   1 GLU HA   H  -85.298 -12.875  -63.267 1.00 . C C .   1 GLU HA   1 1 
        1   5716 3 3   1 GLU HB2  H  -85.143 -10.495  -62.993 1.00 . C C .   1 GLU HB2  1 1 
        1   5717 3 3   1 GLU HB3  H  -83.464 -10.605  -62.500 1.00 . C C .   1 GLU HB3  1 1 
        1   5718 3 3   1 GLU HG2  H  -82.714 -10.709  -64.640 1.00 . C C .   1 GLU HG2  1 1 
        1   5719 3 3   1 GLU HG3  H  -84.019 -11.763  -65.153 1.00 . C C .   1 GLU HG3  1 1 
        1   5720 3 3   1 GLU N    N  -84.707 -12.620  -61.276 1.00 . C C .   1 GLU N    1 1 
        1   5721 3 3   1 GLU O    O  -83.362 -14.300  -63.913 1.00 . C C .   1 GLU O    1 1 
        1   5722 3 3   1 GLU OE1  O  -84.129  -8.510  -64.967 1.00 . C C .   1 GLU OE1  1 1 
        1   5723 3 3   1 GLU OE2  O  -85.326  -9.907  -66.185 1.00 . C C .   1 GLU OE2  1 1 
        1   5724 3 3   2 VAL C    C  -80.258 -14.307  -61.608 1.00 . C C .   2 VAL C    1 1 
        1   5725 3 3   2 VAL CA   C  -80.784 -13.635  -62.873 1.00 . C C .   2 VAL CA   1 1 
        1   5726 3 3   2 VAL CB   C  -79.756 -12.613  -63.430 1.00 . C C .   2 VAL CB   1 1 
        1   5727 3 3   2 VAL CG1  C  -80.041 -11.221  -62.880 1.00 . C C .   2 VAL CG1  1 1 
        1   5728 3 3   2 VAL CG2  C  -78.319 -13.038  -63.136 1.00 . C C .   2 VAL CG2  1 1 
        1   5729 3 3   2 VAL H    H  -82.068 -12.215  -61.985 1.00 . C C .   2 VAL H    1 1 
        1   5730 3 3   2 VAL HA   H  -80.947 -14.398  -63.620 1.00 . C C .   2 VAL HA   1 1 
        1   5731 3 3   2 VAL HB   H  -79.885 -12.573  -64.504 1.00 . C C .   2 VAL HB   1 1 
        1   5732 3 3   2 VAL HG11 H  -79.658 -11.145  -61.873 1.00 . C C .   2 VAL HG11 1 1 
        1   5733 3 3   2 VAL HG12 H  -81.107 -11.048  -62.873 1.00 . C C .   2 VAL HG12 1 1 
        1   5734 3 3   2 VAL HG13 H  -79.561 -10.482  -63.504 1.00 . C C .   2 VAL HG13 1 1 
        1   5735 3 3   2 VAL HG21 H  -77.744 -13.020  -64.050 1.00 . C C .   2 VAL HG21 1 1 
        1   5736 3 3   2 VAL HG22 H  -78.315 -14.039  -62.728 1.00 . C C .   2 VAL HG22 1 1 
        1   5737 3 3   2 VAL HG23 H  -77.880 -12.357  -62.421 1.00 . C C .   2 VAL HG23 1 1 
        1   5738 3 3   2 VAL N    N  -82.068 -12.984  -62.592 1.00 . C C .   2 VAL N    1 1 
        1   5739 3 3   2 VAL O    O  -80.118 -13.670  -60.571 1.00 . C C .   2 VAL O    1 1 
        1   5740 3 3   3 GLN C    C  -78.251 -17.165  -60.742 1.00 . C C .   3 GLN C    1 1 
        1   5741 3 3   3 GLN CA   C  -79.531 -16.357  -60.541 1.00 . C C .   3 GLN CA   1 1 
        1   5742 3 3   3 GLN CB   C  -80.641 -17.281  -60.050 1.00 . C C .   3 GLN CB   1 1 
        1   5743 3 3   3 GLN CD   C  -81.901 -18.061  -58.013 1.00 . C C .   3 GLN CD   1 1 
        1   5744 3 3   3 GLN CG   C  -81.305 -16.868  -58.748 1.00 . C C .   3 GLN CG   1 1 
        1   5745 3 3   3 GLN H    H  -80.111 -16.062  -62.555 1.00 . C C .   3 GLN H    1 1 
        1   5746 3 3   3 GLN HA   H  -79.339 -15.646  -59.752 1.00 . C C .   3 GLN HA   1 1 
        1   5747 3 3   3 GLN HB2  H  -81.405 -17.314  -60.810 1.00 . C C .   3 GLN HB2  1 1 
        1   5748 3 3   3 GLN HB3  H  -80.235 -18.276  -59.935 1.00 . C C .   3 GLN HB3  1 1 
        1   5749 3 3   3 GLN HE21 H  -81.089 -17.446  -56.284 1.00 . C C .   3 GLN HE21 1 1 
        1   5750 3 3   3 GLN HE22 H  -81.992 -18.879  -56.182 1.00 . C C .   3 GLN HE22 1 1 
        1   5751 3 3   3 GLN HG2  H  -80.575 -16.388  -58.113 1.00 . C C .   3 GLN HG2  1 1 
        1   5752 3 3   3 GLN HG3  H  -82.094 -16.164  -58.970 1.00 . C C .   3 GLN HG3  1 1 
        1   5753 3 3   3 GLN N    N  -79.975 -15.600  -61.702 1.00 . C C .   3 GLN N    1 1 
        1   5754 3 3   3 GLN NE2  N  -81.638 -18.135  -56.712 1.00 . C C .   3 GLN NE2  1 1 
        1   5755 3 3   3 GLN O    O  -77.898 -17.556  -61.854 1.00 . C C .   3 GLN O    1 1 
        1   5756 3 3   3 GLN OE1  O  -82.581 -18.914  -58.606 1.00 . C C .   3 GLN OE1  1 1 
        1   5757 3 3   4 LEU C    C  -76.490 -19.018  -58.175 1.00 . C C .   4 LEU C    1 1 
        1   5758 3 3   4 LEU CA   C  -76.420 -18.280  -59.516 1.00 . C C .   4 LEU CA   1 1 
        1   5759 3 3   4 LEU CB   C  -75.108 -17.496  -59.616 1.00 . C C .   4 LEU CB   1 1 
        1   5760 3 3   4 LEU CD1  C  -73.577 -15.898  -60.784 1.00 . C C .   4 LEU CD1  1 1 
        1   5761 3 3   4 LEU CD2  C  -74.594 -17.825  -61.959 1.00 . C C .   4 LEU CD2  1 1 
        1   5762 3 3   4 LEU CG   C  -74.802 -16.771  -60.918 1.00 . C C .   4 LEU CG   1 1 
        1   5763 3 3   4 LEU H    H  -77.936 -17.026  -58.790 1.00 . C C .   4 LEU H    1 1 
        1   5764 3 3   4 LEU HA   H  -76.461 -19.004  -60.317 1.00 . C C .   4 LEU HA   1 1 
        1   5765 3 3   4 LEU HB2  H  -75.106 -16.759  -58.832 1.00 . C C .   4 LEU HB2  1 1 
        1   5766 3 3   4 LEU HB3  H  -74.300 -18.188  -59.417 1.00 . C C .   4 LEU HB3  1 1 
        1   5767 3 3   4 LEU HD11 H  -72.757 -16.484  -60.396 1.00 . C C .   4 LEU HD11 1 1 
        1   5768 3 3   4 LEU HD12 H  -73.789 -15.082  -60.108 1.00 . C C .   4 LEU HD12 1 1 
        1   5769 3 3   4 LEU HD13 H  -73.310 -15.502  -61.752 1.00 . C C .   4 LEU HD13 1 1 
        1   5770 3 3   4 LEU HD21 H  -74.885 -18.786  -61.561 1.00 . C C .   4 LEU HD21 1 1 
        1   5771 3 3   4 LEU HD22 H  -73.552 -17.852  -62.240 1.00 . C C .   4 LEU HD22 1 1 
        1   5772 3 3   4 LEU HD23 H  -75.196 -17.598  -62.826 1.00 . C C .   4 LEU HD23 1 1 
        1   5773 3 3   4 LEU HG   H  -75.648 -16.160  -61.194 1.00 . C C .   4 LEU HG   1 1 
        1   5774 3 3   4 LEU N    N  -77.570 -17.391  -59.622 1.00 . C C .   4 LEU N    1 1 
        1   5775 3 3   4 LEU O    O  -76.705 -18.408  -57.116 1.00 . C C .   4 LEU O    1 1 
        1   5776 3 3   5 VAL C    C  -75.158 -22.165  -57.233 1.00 . C C .   5 VAL C    1 1 
        1   5777 3 3   5 VAL CA   C  -76.284 -21.177  -57.061 1.00 . C C .   5 VAL CA   1 1 
        1   5778 3 3   5 VAL CB   C  -77.591 -21.948  -56.830 1.00 . C C .   5 VAL CB   1 1 
        1   5779 3 3   5 VAL CG1  C  -78.471 -21.220  -55.836 1.00 . C C .   5 VAL CG1  1 1 
        1   5780 3 3   5 VAL CG2  C  -78.331 -22.197  -58.153 1.00 . C C .   5 VAL CG2  1 1 
        1   5781 3 3   5 VAL H    H  -76.184 -20.745  -59.119 1.00 . C C .   5 VAL H    1 1 
        1   5782 3 3   5 VAL HA   H  -76.080 -20.560  -56.198 1.00 . C C .   5 VAL HA   1 1 
        1   5783 3 3   5 VAL HB   H  -77.335 -22.907  -56.400 1.00 . C C .   5 VAL HB   1 1 
        1   5784 3 3   5 VAL HG11 H  -79.161 -20.581  -56.366 1.00 . C C .   5 VAL HG11 1 1 
        1   5785 3 3   5 VAL HG12 H  -77.855 -20.621  -55.182 1.00 . C C .   5 VAL HG12 1 1 
        1   5786 3 3   5 VAL HG13 H  -79.024 -21.940  -55.251 1.00 . C C .   5 VAL HG13 1 1 
        1   5787 3 3   5 VAL HG21 H  -79.293 -21.706  -58.126 1.00 . C C .   5 VAL HG21 1 1 
        1   5788 3 3   5 VAL HG22 H  -78.473 -23.259  -58.292 1.00 . C C .   5 VAL HG22 1 1 
        1   5789 3 3   5 VAL HG23 H  -77.747 -21.802  -58.972 1.00 . C C .   5 VAL HG23 1 1 
        1   5790 3 3   5 VAL N    N  -76.332 -20.334  -58.242 1.00 . C C .   5 VAL N    1 1 
        1   5791 3 3   5 VAL O    O  -75.304 -23.180  -57.920 1.00 . C C .   5 VAL O    1 1 
        1   5792 3 3   6 GLU C    C  -73.136 -23.769  -55.561 1.00 . C C .   6 GLU C    1 1 
        1   5793 3 3   6 GLU CA   C  -72.889 -22.757  -56.652 1.00 . C C .   6 GLU CA   1 1 
        1   5794 3 3   6 GLU CB   C  -71.547 -22.025  -56.461 1.00 . C C .   6 GLU CB   1 1 
        1   5795 3 3   6 GLU CD   C  -71.985 -19.887  -55.174 1.00 . C C .   6 GLU CD   1 1 
        1   5796 3 3   6 GLU CG   C  -71.380 -21.273  -55.142 1.00 . C C .   6 GLU CG   1 1 
        1   5797 3 3   6 GLU H    H  -73.958 -21.010  -56.129 1.00 . C C .   6 GLU H    1 1 
        1   5798 3 3   6 GLU HA   H  -72.877 -23.273  -57.603 1.00 . C C .   6 GLU HA   1 1 
        1   5799 3 3   6 GLU HB2  H  -70.754 -22.753  -56.530 1.00 . C C .   6 GLU HB2  1 1 
        1   5800 3 3   6 GLU HB3  H  -71.429 -21.322  -57.275 1.00 . C C .   6 GLU HB3  1 1 
        1   5801 3 3   6 GLU HG2  H  -71.856 -21.839  -54.356 1.00 . C C .   6 GLU HG2  1 1 
        1   5802 3 3   6 GLU HG3  H  -70.325 -21.191  -54.920 1.00 . C C .   6 GLU HG3  1 1 
        1   5803 3 3   6 GLU N    N  -74.019 -21.845  -56.637 1.00 . C C .   6 GLU N    1 1 
        1   5804 3 3   6 GLU O    O  -73.961 -23.531  -54.680 1.00 . C C .   6 GLU O    1 1 
        1   5805 3 3   6 GLU OE1  O  -71.378 -18.988  -55.797 1.00 . C C .   6 GLU OE1  1 1 
        1   5806 3 3   6 GLU OE2  O  -73.068 -19.701  -54.581 1.00 . C C .   6 GLU OE2  1 1 
        1   5807 3 3   7 SER C    C  -71.714 -27.150  -54.877 1.00 . C C .   7 SER C    1 1 
        1   5808 3 3   7 SER CA   C  -72.628 -25.953  -54.654 1.00 . C C .   7 SER CA   1 1 
        1   5809 3 3   7 SER CB   C  -74.094 -26.389  -54.640 1.00 . C C .   7 SER CB   1 1 
        1   5810 3 3   7 SER H    H  -71.813 -25.033  -56.372 1.00 . C C .   7 SER H    1 1 
        1   5811 3 3   7 SER HA   H  -72.400 -25.543  -53.682 1.00 . C C .   7 SER HA   1 1 
        1   5812 3 3   7 SER HB2  H  -74.164 -27.407  -54.297 1.00 . C C .   7 SER HB2  1 1 
        1   5813 3 3   7 SER HB3  H  -74.650 -25.748  -53.968 1.00 . C C .   7 SER HB3  1 1 
        1   5814 3 3   7 SER HG   H  -74.130 -25.649  -56.440 1.00 . C C .   7 SER HG   1 1 
        1   5815 3 3   7 SER N    N  -72.443 -24.900  -55.633 1.00 . C C .   7 SER N    1 1 
        1   5816 3 3   7 SER O    O  -71.002 -27.230  -55.873 1.00 . C C .   7 SER O    1 1 
        1   5817 3 3   7 SER OG   O  -74.636 -26.302  -55.952 1.00 . C C .   7 SER OG   1 1 
        1   5818 3 3   8 GLY C    C  -69.624 -29.308  -53.392 1.00 . C C .   8 GLY C    1 1 
        1   5819 3 3   8 GLY CA   C  -71.031 -29.325  -53.983 1.00 . C C .   8 GLY CA   1 1 
        1   5820 3 3   8 GLY H    H  -72.337 -27.909  -53.147 1.00 . C C .   8 GLY H    1 1 
        1   5821 3 3   8 GLY HA2  H  -71.605 -30.054  -53.431 1.00 . C C .   8 GLY HA2  1 1 
        1   5822 3 3   8 GLY HA3  H  -70.977 -29.644  -55.013 1.00 . C C .   8 GLY HA3  1 1 
        1   5823 3 3   8 GLY N    N  -71.746 -28.064  -53.913 1.00 . C C .   8 GLY N    1 1 
        1   5824 3 3   8 GLY O    O  -68.646 -29.588  -54.102 1.00 . C C .   8 GLY O    1 1 
        1   5825 3 3   9 GLY C    C  -68.226 -28.766  -50.003 1.00 . C C .   9 GLY C    1 1 
        1   5826 3 3   9 GLY CA   C  -68.191 -29.040  -51.477 1.00 . C C .   9 GLY CA   1 1 
        1   5827 3 3   9 GLY H    H  -70.297 -28.812  -51.561 1.00 . C C .   9 GLY H    1 1 
        1   5828 3 3   9 GLY HA2  H  -67.755 -30.015  -51.636 1.00 . C C .   9 GLY HA2  1 1 
        1   5829 3 3   9 GLY HA3  H  -67.565 -28.299  -51.954 1.00 . C C .   9 GLY HA3  1 1 
        1   5830 3 3   9 GLY N    N  -69.501 -29.010  -52.099 1.00 . C C .   9 GLY N    1 1 
        1   5831 3 3   9 GLY O    O  -68.782 -27.768  -49.570 1.00 . C C .   9 GLY O    1 1 
        1   5832 3 3  10 GLY C    C  -66.004 -29.615  -47.377 1.00 . C C .  10 GLY C    1 1 
        1   5833 3 3  10 GLY CA   C  -67.455 -29.460  -47.800 1.00 . C C .  10 GLY CA   1 1 
        1   5834 3 3  10 GLY H    H  -67.206 -30.441  -49.654 1.00 . C C .  10 GLY H    1 1 
        1   5835 3 3  10 GLY HA2  H  -67.791 -28.466  -47.543 1.00 . C C .  10 GLY HA2  1 1 
        1   5836 3 3  10 GLY HA3  H  -68.054 -30.183  -47.267 1.00 . C C .  10 GLY HA3  1 1 
        1   5837 3 3  10 GLY N    N  -67.628 -29.663  -49.233 1.00 . C C .  10 GLY N    1 1 
        1   5838 3 3  10 GLY O    O  -65.167 -28.742  -47.662 1.00 . C C .  10 GLY O    1 1 
        1   5839 3 3  11 LEU C    C  -63.537 -31.854  -47.122 1.00 . C C .  11 LEU C    1 1 
        1   5840 3 3  11 LEU CA   C  -64.345 -30.951  -46.186 1.00 . C C .  11 LEU CA   1 1 
        1   5841 3 3  11 LEU CB   C  -64.370 -31.491  -44.751 1.00 . C C .  11 LEU CB   1 1 
        1   5842 3 3  11 LEU CD1  C  -62.079 -31.018  -43.733 1.00 . C C .  11 LEU CD1  1 1 
        1   5843 3 3  11 LEU CD2  C  -63.372 -33.057  -43.061 1.00 . C C .  11 LEU CD2  1 1 
        1   5844 3 3  11 LEU CG   C  -63.070 -32.083  -44.193 1.00 . C C .  11 LEU CG   1 1 
        1   5845 3 3  11 LEU H    H  -66.403 -31.375  -46.500 1.00 . C C .  11 LEU H    1 1 
        1   5846 3 3  11 LEU HA   H  -63.847 -29.991  -46.164 1.00 . C C .  11 LEU HA   1 1 
        1   5847 3 3  11 LEU HB2  H  -64.663 -30.685  -44.100 1.00 . C C .  11 LEU HB2  1 1 
        1   5848 3 3  11 LEU HB3  H  -65.138 -32.252  -44.700 1.00 . C C .  11 LEU HB3  1 1 
        1   5849 3 3  11 LEU HD11 H  -61.088 -31.443  -43.687 1.00 . C C .  11 LEU HD11 1 1 
        1   5850 3 3  11 LEU HD12 H  -62.363 -30.661  -42.754 1.00 . C C .  11 LEU HD12 1 1 
        1   5851 3 3  11 LEU HD13 H  -62.086 -30.194  -44.432 1.00 . C C .  11 LEU HD13 1 1 
        1   5852 3 3  11 LEU HD21 H  -63.074 -34.053  -43.354 1.00 . C C .  11 LEU HD21 1 1 
        1   5853 3 3  11 LEU HD22 H  -64.431 -33.046  -42.850 1.00 . C C .  11 LEU HD22 1 1 
        1   5854 3 3  11 LEU HD23 H  -62.825 -32.764  -42.178 1.00 . C C .  11 LEU HD23 1 1 
        1   5855 3 3  11 LEU HG   H  -62.599 -32.640  -44.991 1.00 . C C .  11 LEU HG   1 1 
        1   5856 3 3  11 LEU N    N  -65.698 -30.722  -46.696 1.00 . C C .  11 LEU N    1 1 
        1   5857 3 3  11 LEU O    O  -64.085 -32.762  -47.741 1.00 . C C .  11 LEU O    1 1 
        1   5858 3 3  12 VAL C    C  -59.935 -32.296  -47.484 1.00 . C C .  12 VAL C    1 1 
        1   5859 3 3  12 VAL CA   C  -61.329 -32.329  -48.079 1.00 . C C .  12 VAL CA   1 1 
        1   5860 3 3  12 VAL CB   C  -61.281 -31.792  -49.515 1.00 . C C .  12 VAL CB   1 1 
        1   5861 3 3  12 VAL CG1  C  -60.630 -30.422  -49.549 1.00 . C C .  12 VAL CG1  1 1 
        1   5862 3 3  12 VAL CG2  C  -60.531 -32.757  -50.413 1.00 . C C .  12 VAL CG2  1 1 
        1   5863 3 3  12 VAL H    H  -61.884 -30.809  -46.726 1.00 . C C .  12 VAL H    1 1 
        1   5864 3 3  12 VAL HA   H  -61.665 -33.355  -48.106 1.00 . C C .  12 VAL HA   1 1 
        1   5865 3 3  12 VAL HB   H  -62.296 -31.697  -49.877 1.00 . C C .  12 VAL HB   1 1 
        1   5866 3 3  12 VAL HG11 H  -61.235 -29.750  -50.140 1.00 . C C .  12 VAL HG11 1 1 
        1   5867 3 3  12 VAL HG12 H  -59.646 -30.502  -49.988 1.00 . C C .  12 VAL HG12 1 1 
        1   5868 3 3  12 VAL HG13 H  -60.545 -30.039  -48.543 1.00 . C C .  12 VAL HG13 1 1 
        1   5869 3 3  12 VAL HG21 H  -61.150 -33.019  -51.257 1.00 . C C .  12 VAL HG21 1 1 
        1   5870 3 3  12 VAL HG22 H  -60.284 -33.649  -49.856 1.00 . C C .  12 VAL HG22 1 1 
        1   5871 3 3  12 VAL HG23 H  -59.623 -32.289  -50.764 1.00 . C C .  12 VAL HG23 1 1 
        1   5872 3 3  12 VAL N    N  -62.241 -31.566  -47.236 1.00 . C C .  12 VAL N    1 1 
        1   5873 3 3  12 VAL O    O  -59.502 -31.274  -46.940 1.00 . C C .  12 VAL O    1 1 
        1   5874 3 3  13 LYS C    C  -56.873 -32.824  -47.792 1.00 . C C .  13 LYS C    1 1 
        1   5875 3 3  13 LYS CA   C  -57.937 -33.540  -46.956 1.00 . C C .  13 LYS CA   1 1 
        1   5876 3 3  13 LYS CB   C  -57.572 -35.018  -46.648 1.00 . C C .  13 LYS CB   1 1 
        1   5877 3 3  13 LYS CD   C  -57.218 -37.413  -47.388 1.00 . C C .  13 LYS CD   1 1 
        1   5878 3 3  13 LYS CE   C  -57.298 -38.408  -48.562 1.00 . C C .  13 LYS CE   1 1 
        1   5879 3 3  13 LYS CG   C  -57.954 -36.095  -47.689 1.00 . C C .  13 LYS CG   1 1 
        1   5880 3 3  13 LYS H    H  -59.640 -34.201  -48.026 1.00 . C C .  13 LYS H    1 1 
        1   5881 3 3  13 LYS HA   H  -57.997 -33.018  -46.010 1.00 . C C .  13 LYS HA   1 1 
        1   5882 3 3  13 LYS HB2  H  -56.505 -35.070  -46.510 1.00 . C C .  13 LYS HB2  1 1 
        1   5883 3 3  13 LYS HB3  H  -58.038 -35.279  -45.706 1.00 . C C .  13 LYS HB3  1 1 
        1   5884 3 3  13 LYS HD2  H  -56.180 -37.196  -47.185 1.00 . C C .  13 LYS HD2  1 1 
        1   5885 3 3  13 LYS HD3  H  -57.658 -37.867  -46.512 1.00 . C C .  13 LYS HD3  1 1 
        1   5886 3 3  13 LYS HE2  H  -58.338 -38.572  -48.795 1.00 . C C .  13 LYS HE2  1 1 
        1   5887 3 3  13 LYS HE3  H  -56.830 -37.949  -49.422 1.00 . C C .  13 LYS HE3  1 1 
        1   5888 3 3  13 LYS HG2  H  -59.021 -36.263  -47.657 1.00 . C C .  13 LYS HG2  1 1 
        1   5889 3 3  13 LYS HG3  H  -57.676 -35.750  -48.674 1.00 . C C .  13 LYS HG3  1 1 
        1   5890 3 3  13 LYS HZ1  H  -56.056 -39.723  -47.476 1.00 . C C .  13 LYS HZ1  1 1 
        1   5891 3 3  13 LYS HZ2  H  -56.066 -40.017  -49.149 1.00 . C C .  13 LYS HZ2  1 1 
        1   5892 3 3  13 LYS HZ3  H  -57.392 -40.484  -48.195 1.00 . C C .  13 LYS HZ3  1 1 
        1   5893 3 3  13 LYS N    N  -59.240 -33.422  -47.586 1.00 . C C .  13 LYS N    1 1 
        1   5894 3 3  13 LYS NZ   N  -56.652 -39.766  -48.327 1.00 . C C .  13 LYS NZ   1 1 
        1   5895 3 3  13 LYS O    O  -57.059 -32.671  -49.004 1.00 . C C .  13 LYS O    1 1 
        1   5896 3 3  14 PRO C    C  -54.211 -32.716  -49.025 1.00 . C C .  14 PRO C    1 1 
        1   5897 3 3  14 PRO CA   C  -54.604 -31.849  -47.839 1.00 . C C .  14 PRO CA   1 1 
        1   5898 3 3  14 PRO CB   C  -53.537 -31.899  -46.753 1.00 . C C .  14 PRO CB   1 1 
        1   5899 3 3  14 PRO CD   C  -55.729 -31.957  -45.719 1.00 . C C .  14 PRO CD   1 1 
        1   5900 3 3  14 PRO CG   C  -54.282 -31.510  -45.535 1.00 . C C .  14 PRO CG   1 1 
        1   5901 3 3  14 PRO HA   H  -54.745 -30.828  -48.151 1.00 . C C .  14 PRO HA   1 1 
        1   5902 3 3  14 PRO HB2  H  -53.138 -32.901  -46.659 1.00 . C C .  14 PRO HB2  1 1 
        1   5903 3 3  14 PRO HB3  H  -52.752 -31.188  -46.954 1.00 . C C .  14 PRO HB3  1 1 
        1   5904 3 3  14 PRO HD2  H  -55.949 -32.806  -45.085 1.00 . C C .  14 PRO HD2  1 1 
        1   5905 3 3  14 PRO HD3  H  -56.409 -31.143  -45.521 1.00 . C C .  14 PRO HD3  1 1 
        1   5906 3 3  14 PRO HG2  H  -53.850 -31.998  -44.671 1.00 . C C .  14 PRO HG2  1 1 
        1   5907 3 3  14 PRO HG3  H  -54.248 -30.440  -45.409 1.00 . C C .  14 PRO HG3  1 1 
        1   5908 3 3  14 PRO N    N  -55.788 -32.336  -47.141 1.00 . C C .  14 PRO N    1 1 
        1   5909 3 3  14 PRO O    O  -54.437 -33.927  -49.008 1.00 . C C .  14 PRO O    1 1 
        1   5910 3 3  15 GLY C    C  -54.610 -33.246  -52.050 1.00 . C C .  15 GLY C    1 1 
        1   5911 3 3  15 GLY CA   C  -53.359 -32.785  -51.315 1.00 . C C .  15 GLY CA   1 1 
        1   5912 3 3  15 GLY H    H  -53.528 -31.122  -50.014 1.00 . C C .  15 GLY H    1 1 
        1   5913 3 3  15 GLY HA2  H  -52.806 -32.117  -51.958 1.00 . C C .  15 GLY HA2  1 1 
        1   5914 3 3  15 GLY HA3  H  -52.745 -33.647  -51.098 1.00 . C C .  15 GLY HA3  1 1 
        1   5915 3 3  15 GLY N    N  -53.657 -32.092  -50.060 1.00 . C C .  15 GLY N    1 1 
        1   5916 3 3  15 GLY O    O  -54.531 -33.723  -53.184 1.00 . C C .  15 GLY O    1 1 
        1   5917 3 3  16 GLY C    C  -57.583 -33.014  -53.209 1.00 . C C .  16 GLY C    1 1 
        1   5918 3 3  16 GLY CA   C  -57.032 -33.593  -51.913 1.00 . C C .  16 GLY CA   1 1 
        1   5919 3 3  16 GLY H    H  -55.746 -32.671  -50.515 1.00 . C C .  16 GLY H    1 1 
        1   5920 3 3  16 GLY HA2  H  -56.919 -34.654  -52.059 1.00 . C C .  16 GLY HA2  1 1 
        1   5921 3 3  16 GLY HA3  H  -57.774 -33.446  -51.139 1.00 . C C .  16 GLY HA3  1 1 
        1   5922 3 3  16 GLY N    N  -55.763 -33.077  -51.407 1.00 . C C .  16 GLY N    1 1 
        1   5923 3 3  16 GLY O    O  -56.916 -32.252  -53.918 1.00 . C C .  16 GLY O    1 1 
        1   5924 3 3  17 SER C    C  -60.988 -32.847  -54.498 1.00 . C C .  17 SER C    1 1 
        1   5925 3 3  17 SER CA   C  -59.484 -32.955  -54.729 1.00 . C C .  17 SER CA   1 1 
        1   5926 3 3  17 SER CB   C  -59.138 -33.871  -55.905 1.00 . C C .  17 SER CB   1 1 
        1   5927 3 3  17 SER H    H  -59.285 -34.015  -52.916 1.00 . C C .  17 SER H    1 1 
        1   5928 3 3  17 SER HA   H  -59.118 -31.964  -54.960 1.00 . C C .  17 SER HA   1 1 
        1   5929 3 3  17 SER HB2  H  -59.414 -34.884  -55.667 1.00 . C C .  17 SER HB2  1 1 
        1   5930 3 3  17 SER HB3  H  -59.686 -33.550  -56.782 1.00 . C C .  17 SER HB3  1 1 
        1   5931 3 3  17 SER HG   H  -57.403 -32.979  -55.830 1.00 . C C .  17 SER HG   1 1 
        1   5932 3 3  17 SER N    N  -58.816 -33.401  -53.518 1.00 . C C .  17 SER N    1 1 
        1   5933 3 3  17 SER O    O  -61.494 -33.359  -53.494 1.00 . C C .  17 SER O    1 1 
        1   5934 3 3  17 SER OG   O  -57.734 -33.817  -56.162 1.00 . C C .  17 SER OG   1 1 
        1   5935 3 3  18 LEU C    C  -63.541 -30.718  -56.217 1.00 . C C .  18 LEU C    1 1 
        1   5936 3 3  18 LEU CA   C  -63.116 -31.819  -55.246 1.00 . C C .  18 LEU CA   1 1 
        1   5937 3 3  18 LEU CB   C  -63.435 -31.414  -53.793 1.00 . C C .  18 LEU CB   1 1 
        1   5938 3 3  18 LEU CD1  C  -65.908 -30.976  -53.648 1.00 . C C .  18 LEU CD1  1 1 
        1   5939 3 3  18 LEU CD2  C  -64.342 -29.878  -52.047 1.00 . C C .  18 LEU CD2  1 1 
        1   5940 3 3  18 LEU CG   C  -64.526 -30.390  -53.465 1.00 . C C .  18 LEU CG   1 1 
        1   5941 3 3  18 LEU H    H  -61.201 -31.773  -56.167 1.00 . C C .  18 LEU H    1 1 
        1   5942 3 3  18 LEU HA   H  -63.689 -32.707  -55.482 1.00 . C C .  18 LEU HA   1 1 
        1   5943 3 3  18 LEU HB2  H  -63.698 -32.313  -53.267 1.00 . C C .  18 LEU HB2  1 1 
        1   5944 3 3  18 LEU HB3  H  -62.508 -31.055  -53.359 1.00 . C C .  18 LEU HB3  1 1 
        1   5945 3 3  18 LEU HD11 H  -66.435 -30.957  -52.706 1.00 . C C .  18 LEU HD11 1 1 
        1   5946 3 3  18 LEU HD12 H  -65.824 -31.997  -53.992 1.00 . C C .  18 LEU HD12 1 1 
        1   5947 3 3  18 LEU HD13 H  -66.453 -30.394  -54.376 1.00 . C C .  18 LEU HD13 1 1 
        1   5948 3 3  18 LEU HD21 H  -65.304 -29.815  -51.560 1.00 . C C .  18 LEU HD21 1 1 
        1   5949 3 3  18 LEU HD22 H  -63.887 -28.899  -52.074 1.00 . C C .  18 LEU HD22 1 1 
        1   5950 3 3  18 LEU HD23 H  -63.705 -30.557  -51.499 1.00 . C C .  18 LEU HD23 1 1 
        1   5951 3 3  18 LEU HG   H  -64.421 -29.556  -54.145 1.00 . C C .  18 LEU HG   1 1 
        1   5952 3 3  18 LEU N    N  -61.686 -32.161  -55.409 1.00 . C C .  18 LEU N    1 1 
        1   5953 3 3  18 LEU O    O  -62.836 -29.720  -56.382 1.00 . C C .  18 LEU O    1 1 
        1   5954 3 3  19 LYS C    C  -66.560 -29.418  -57.629 1.00 . C C .  19 LYS C    1 1 
        1   5955 3 3  19 LYS CA   C  -65.199 -30.078  -57.928 1.00 . C C .  19 LYS CA   1 1 
        1   5956 3 3  19 LYS CB   C  -65.272 -30.939  -59.191 1.00 . C C .  19 LYS CB   1 1 
        1   5957 3 3  19 LYS CD   C  -65.781 -31.073  -61.626 1.00 . C C .  19 LYS CD   1 1 
        1   5958 3 3  19 LYS CE   C  -66.645 -30.497  -62.711 1.00 . C C .  19 LYS CE   1 1 
        1   5959 3 3  19 LYS CG   C  -66.080 -30.367  -60.324 1.00 . C C .  19 LYS CG   1 1 
        1   5960 3 3  19 LYS H    H  -65.215 -31.720  -56.607 1.00 . C C .  19 LYS H    1 1 
        1   5961 3 3  19 LYS HA   H  -64.478 -29.293  -58.101 1.00 . C C .  19 LYS HA   1 1 
        1   5962 3 3  19 LYS HB2  H  -64.268 -31.101  -59.547 1.00 . C C .  19 LYS HB2  1 1 
        1   5963 3 3  19 LYS HB3  H  -65.691 -31.898  -58.919 1.00 . C C .  19 LYS HB3  1 1 
        1   5964 3 3  19 LYS HD2  H  -64.740 -30.933  -61.880 1.00 . C C .  19 LYS HD2  1 1 
        1   5965 3 3  19 LYS HD3  H  -65.989 -32.127  -61.522 1.00 . C C .  19 LYS HD3  1 1 
        1   5966 3 3  19 LYS HE2  H  -67.486 -31.153  -62.877 1.00 . C C .  19 LYS HE2  1 1 
        1   5967 3 3  19 LYS HE3  H  -67.010 -29.531  -62.393 1.00 . C C .  19 LYS HE3  1 1 
        1   5968 3 3  19 LYS HG2  H  -67.130 -30.474  -60.099 1.00 . C C .  19 LYS HG2  1 1 
        1   5969 3 3  19 LYS HG3  H  -65.846 -29.318  -60.430 1.00 . C C .  19 LYS HG3  1 1 
        1   5970 3 3  19 LYS HZ1  H  -66.446 -29.746  -64.630 1.00 . C C .  19 LYS HZ1  1 1 
        1   5971 3 3  19 LYS HZ2  H  -65.745 -31.277  -64.405 1.00 . C C .  19 LYS HZ2  1 1 
        1   5972 3 3  19 LYS HZ3  H  -64.983 -29.890  -63.786 1.00 . C C .  19 LYS HZ3  1 1 
        1   5973 3 3  19 LYS N    N  -64.713 -30.906  -56.824 1.00 . C C .  19 LYS N    1 1 
        1   5974 3 3  19 LYS NZ   N  -65.900 -30.341  -63.976 1.00 . C C .  19 LYS NZ   1 1 
        1   5975 3 3  19 LYS O    O  -67.522 -30.094  -57.240 1.00 . C C .  19 LYS O    1 1 
        1   5976 3 3  20 LEU C    C  -68.459 -26.828  -58.772 1.00 . C C .  20 LEU C    1 1 
        1   5977 3 3  20 LEU CA   C  -67.843 -27.333  -57.498 1.00 . C C .  20 LEU CA   1 1 
        1   5978 3 3  20 LEU CB   C  -67.531 -26.139  -56.596 1.00 . C C .  20 LEU CB   1 1 
        1   5979 3 3  20 LEU CD1  C  -65.883 -24.862  -55.262 1.00 . C C .  20 LEU CD1  1 1 
        1   5980 3 3  20 LEU CD2  C  -66.562 -27.110  -54.504 1.00 . C C .  20 LEU CD2  1 1 
        1   5981 3 3  20 LEU CG   C  -66.301 -26.234  -55.698 1.00 . C C .  20 LEU CG   1 1 
        1   5982 3 3  20 LEU H    H  -65.837 -27.619  -58.126 1.00 . C C .  20 LEU H    1 1 
        1   5983 3 3  20 LEU HA   H  -68.549 -27.979  -56.996 1.00 . C C .  20 LEU HA   1 1 
        1   5984 3 3  20 LEU HB2  H  -67.404 -25.275  -57.227 1.00 . C C .  20 LEU HB2  1 1 
        1   5985 3 3  20 LEU HB3  H  -68.396 -25.966  -55.970 1.00 . C C .  20 LEU HB3  1 1 
        1   5986 3 3  20 LEU HD11 H  -65.759 -24.846  -54.190 1.00 . C C .  20 LEU HD11 1 1 
        1   5987 3 3  20 LEU HD12 H  -66.641 -24.147  -55.548 1.00 . C C .  20 LEU HD12 1 1 
        1   5988 3 3  20 LEU HD13 H  -64.947 -24.603  -55.735 1.00 . C C .  20 LEU HD13 1 1 
        1   5989 3 3  20 LEU HD21 H  -66.428 -28.145  -54.781 1.00 . C C .  20 LEU HD21 1 1 
        1   5990 3 3  20 LEU HD22 H  -67.575 -26.957  -54.161 1.00 . C C .  20 LEU HD22 1 1 
        1   5991 3 3  20 LEU HD23 H  -65.872 -26.857  -53.714 1.00 . C C .  20 LEU HD23 1 1 
        1   5992 3 3  20 LEU HG   H  -65.494 -26.666  -56.275 1.00 . C C .  20 LEU HG   1 1 
        1   5993 3 3  20 LEU N    N  -66.633 -28.099  -57.815 1.00 . C C .  20 LEU N    1 1 
        1   5994 3 3  20 LEU O    O  -67.760 -26.536  -59.739 1.00 . C C .  20 LEU O    1 1 
        1   5995 3 3  21 SER C    C  -71.416 -25.155  -59.610 1.00 . C C .  21 SER C    1 1 
        1   5996 3 3  21 SER CA   C  -70.478 -26.267  -59.958 1.00 . C C .  21 SER CA   1 1 
        1   5997 3 3  21 SER CB   C  -71.259 -27.415  -60.586 1.00 . C C .  21 SER CB   1 1 
        1   5998 3 3  21 SER H    H  -70.282 -26.952  -57.970 1.00 . C C .  21 SER H    1 1 
        1   5999 3 3  21 SER HA   H  -69.758 -25.905  -60.676 1.00 . C C .  21 SER HA   1 1 
        1   6000 3 3  21 SER HB2  H  -72.139 -27.026  -61.069 1.00 . C C .  21 SER HB2  1 1 
        1   6001 3 3  21 SER HB3  H  -70.636 -27.902  -61.326 1.00 . C C .  21 SER HB3  1 1 
        1   6002 3 3  21 SER HG   H  -71.209 -28.123  -58.779 1.00 . C C .  21 SER HG   1 1 
        1   6003 3 3  21 SER N    N  -69.774 -26.713  -58.774 1.00 . C C .  21 SER N    1 1 
        1   6004 3 3  21 SER O    O  -72.175 -25.249  -58.663 1.00 . C C .  21 SER O    1 1 
        1   6005 3 3  21 SER OG   O  -71.653 -28.351  -59.599 1.00 . C C .  21 SER OG   1 1 
        1   6006 3 3  22 CYS C    C  -73.402 -23.263  -61.173 1.00 . C C .  22 CYS C    1 1 
        1   6007 3 3  22 CYS CA   C  -72.257 -22.992  -60.229 1.00 . C C .  22 CYS CA   1 1 
        1   6008 3 3  22 CYS CB   C  -71.556 -21.707  -60.622 1.00 . C C .  22 CYS CB   1 1 
        1   6009 3 3  22 CYS H    H  -70.703 -24.077  -61.120 1.00 . C C .  22 CYS H    1 1 
        1   6010 3 3  22 CYS HA   H  -72.612 -22.932  -59.211 1.00 . C C .  22 CYS HA   1 1 
        1   6011 3 3  22 CYS HB2  H  -70.687 -21.590  -59.997 1.00 . C C .  22 CYS HB2  1 1 
        1   6012 3 3  22 CYS HB3  H  -71.223 -21.806  -61.647 1.00 . C C .  22 CYS HB3  1 1 
        1   6013 3 3  22 CYS N    N  -71.346 -24.090  -60.380 1.00 . C C .  22 CYS N    1 1 
        1   6014 3 3  22 CYS O    O  -73.214 -23.259  -62.392 1.00 . C C .  22 CYS O    1 1 
        1   6015 3 3  22 CYS SG   S  -72.541 -20.217  -60.480 1.00 . C C .  22 CYS SG   1 1 
        1   6016 3 3  23 ALA C    C  -76.297 -22.391  -61.878 1.00 . C C .  23 ALA C    1 1 
        1   6017 3 3  23 ALA CA   C  -75.756 -23.756  -61.455 1.00 . C C .  23 ALA CA   1 1 
        1   6018 3 3  23 ALA CB   C  -76.803 -24.581  -60.695 1.00 . C C .  23 ALA CB   1 1 
        1   6019 3 3  23 ALA H    H  -74.670 -23.537  -59.645 1.00 . C C .  23 ALA H    1 1 
        1   6020 3 3  23 ALA HA   H  -75.453 -24.299  -62.340 1.00 . C C .  23 ALA HA   1 1 
        1   6021 3 3  23 ALA HB1  H  -77.788 -24.184  -60.893 1.00 . C C .  23 ALA HB1  1 1 
        1   6022 3 3  23 ALA HB2  H  -76.602 -24.530  -59.635 1.00 . C C .  23 ALA HB2  1 1 
        1   6023 3 3  23 ALA HB3  H  -76.758 -25.609  -61.021 1.00 . C C .  23 ALA HB3  1 1 
        1   6024 3 3  23 ALA N    N  -74.582 -23.527  -60.621 1.00 . C C .  23 ALA N    1 1 
        1   6025 3 3  23 ALA O    O  -76.826 -21.651  -61.051 1.00 . C C .  23 ALA O    1 1 
        1   6026 3 3  24 ALA C    C  -77.933 -20.678  -64.128 1.00 . C C .  24 ALA C    1 1 
        1   6027 3 3  24 ALA CA   C  -76.515 -20.686  -63.580 1.00 . C C .  24 ALA CA   1 1 
        1   6028 3 3  24 ALA CB   C  -75.565 -20.172  -64.612 1.00 . C C .  24 ALA CB   1 1 
        1   6029 3 3  24 ALA H    H  -75.658 -22.624  -63.765 1.00 . C C .  24 ALA H    1 1 
        1   6030 3 3  24 ALA HA   H  -76.479 -20.027  -62.725 1.00 . C C .  24 ALA HA   1 1 
        1   6031 3 3  24 ALA HB1  H  -75.061 -19.295  -64.233 1.00 . C C .  24 ALA HB1  1 1 
        1   6032 3 3  24 ALA HB2  H  -76.111 -19.914  -65.507 1.00 . C C .  24 ALA HB2  1 1 
        1   6033 3 3  24 ALA HB3  H  -74.835 -20.934  -64.842 1.00 . C C .  24 ALA HB3  1 1 
        1   6034 3 3  24 ALA N    N  -76.121 -22.025  -63.143 1.00 . C C .  24 ALA N    1 1 
        1   6035 3 3  24 ALA O    O  -78.300 -21.580  -64.881 1.00 . C C .  24 ALA O    1 1 
        1   6036 3 3  25 SER C    C  -80.809 -18.253  -64.267 1.00 . C C .  25 SER C    1 1 
        1   6037 3 3  25 SER CA   C  -80.114 -19.626  -64.241 1.00 . C C .  25 SER CA   1 1 
        1   6038 3 3  25 SER CB   C  -80.960 -20.616  -63.437 1.00 . C C .  25 SER CB   1 1 
        1   6039 3 3  25 SER H    H  -78.388 -18.959  -63.186 1.00 . C C .  25 SER H    1 1 
        1   6040 3 3  25 SER HA   H  -80.108 -19.986  -65.257 1.00 . C C .  25 SER HA   1 1 
        1   6041 3 3  25 SER HB2  H  -80.320 -21.373  -63.017 1.00 . C C .  25 SER HB2  1 1 
        1   6042 3 3  25 SER HB3  H  -81.453 -20.086  -62.632 1.00 . C C .  25 SER HB3  1 1 
        1   6043 3 3  25 SER HG   H  -82.726 -20.709  -64.243 1.00 . C C .  25 SER HG   1 1 
        1   6044 3 3  25 SER N    N  -78.726 -19.664  -63.777 1.00 . C C .  25 SER N    1 1 
        1   6045 3 3  25 SER O    O  -81.204 -17.697  -63.226 1.00 . C C .  25 SER O    1 1 
        1   6046 3 3  25 SER OG   O  -81.928 -21.243  -64.263 1.00 . C C .  25 SER OG   1 1 
        1   6047 3 3  26 GLY C    C  -81.228 -15.435  -66.433 1.00 . C C .  26 GLY C    1 1 
        1   6048 3 3  26 GLY CA   C  -81.868 -16.583  -65.686 1.00 . C C .  26 GLY CA   1 1 
        1   6049 3 3  26 GLY H    H  -80.678 -18.234  -66.260 1.00 . C C .  26 GLY H    1 1 
        1   6050 3 3  26 GLY HA2  H  -82.734 -16.909  -66.241 1.00 . C C .  26 GLY HA2  1 1 
        1   6051 3 3  26 GLY HA3  H  -82.195 -16.225  -64.720 1.00 . C C .  26 GLY HA3  1 1 
        1   6052 3 3  26 GLY N    N  -80.990 -17.732  -65.479 1.00 . C C .  26 GLY N    1 1 
        1   6053 3 3  26 GLY O    O  -81.613 -14.274  -66.246 1.00 . C C .  26 GLY O    1 1 
        1   6054 3 3  27 PHE C    C  -78.971 -15.564  -69.324 1.00 . C C .  27 PHE C    1 1 
        1   6055 3 3  27 PHE CA   C  -79.602 -14.803  -68.161 1.00 . C C .  27 PHE CA   1 1 
        1   6056 3 3  27 PHE CB   C  -78.562 -13.920  -67.424 1.00 . C C .  27 PHE CB   1 1 
        1   6057 3 3  27 PHE CD1  C  -77.409 -15.331  -65.666 1.00 . C C .  27 PHE CD1  1 1 
        1   6058 3 3  27 PHE CD2  C  -76.186 -14.754  -67.654 1.00 . C C .  27 PHE CD2  1 1 
        1   6059 3 3  27 PHE CE1  C  -76.309 -16.051  -65.190 1.00 . C C .  27 PHE CE1  1 1 
        1   6060 3 3  27 PHE CE2  C  -75.086 -15.467  -67.186 1.00 . C C .  27 PHE CE2  1 1 
        1   6061 3 3  27 PHE CG   C  -77.361 -14.679  -66.902 1.00 . C C .  27 PHE CG   1 1 
        1   6062 3 3  27 PHE CZ   C  -75.146 -16.115  -65.947 1.00 . C C .  27 PHE CZ   1 1 
        1   6063 3 3  27 PHE H    H  -79.992 -16.708  -67.338 1.00 . C C .  27 PHE H    1 1 
        1   6064 3 3  27 PHE HA   H  -80.373 -14.159  -68.562 1.00 . C C .  27 PHE HA   1 1 
        1   6065 3 3  27 PHE HB2  H  -78.212 -13.161  -68.106 1.00 . C C .  27 PHE HB2  1 1 
        1   6066 3 3  27 PHE HB3  H  -79.054 -13.433  -66.593 1.00 . C C .  27 PHE HB3  1 1 
        1   6067 3 3  27 PHE HD1  H  -78.311 -15.284  -65.074 1.00 . C C .  27 PHE HD1  1 1 
        1   6068 3 3  27 PHE HD2  H  -76.131 -14.257  -68.611 1.00 . C C .  27 PHE HD2  1 1 
        1   6069 3 3  27 PHE HE1  H  -76.360 -16.550  -64.233 1.00 . C C .  27 PHE HE1  1 1 
        1   6070 3 3  27 PHE HE2  H  -74.183 -15.516  -67.777 1.00 . C C .  27 PHE HE2  1 1 
        1   6071 3 3  27 PHE HZ   H  -74.292 -16.668  -65.584 1.00 . C C .  27 PHE HZ   1 1 
        1   6072 3 3  27 PHE N    N  -80.241 -15.763  -67.263 1.00 . C C .  27 PHE N    1 1 
        1   6073 3 3  27 PHE O    O  -78.743 -16.774  -69.235 1.00 . C C .  27 PHE O    1 1 
        1   6074 3 3  28 ALA C    C  -76.669 -16.009  -71.233 1.00 . C C .  28 ALA C    1 1 
        1   6075 3 3  28 ALA CA   C  -78.046 -15.432  -71.586 1.00 . C C .  28 ALA CA   1 1 
        1   6076 3 3  28 ALA CB   C  -77.928 -14.388  -72.688 1.00 . C C .  28 ALA CB   1 1 
        1   6077 3 3  28 ALA H    H  -78.912 -13.894  -70.416 1.00 . C C .  28 ALA H    1 1 
        1   6078 3 3  28 ALA HA   H  -78.665 -16.240  -71.949 1.00 . C C .  28 ALA HA   1 1 
        1   6079 3 3  28 ALA HB1  H  -77.571 -14.859  -73.593 1.00 . C C .  28 ALA HB1  1 1 
        1   6080 3 3  28 ALA HB2  H  -77.233 -13.620  -72.384 1.00 . C C .  28 ALA HB2  1 1 
        1   6081 3 3  28 ALA HB3  H  -78.897 -13.946  -72.871 1.00 . C C .  28 ALA HB3  1 1 
        1   6082 3 3  28 ALA N    N  -78.699 -14.851  -70.412 1.00 . C C .  28 ALA N    1 1 
        1   6083 3 3  28 ALA O    O  -75.628 -15.397  -71.515 1.00 . C C .  28 ALA O    1 1 
        1   6084 3 3  29 PHE C    C  -74.256 -17.702  -71.100 1.00 . C C .  29 PHE C    1 1 
        1   6085 3 3  29 PHE CA   C  -75.436 -17.764  -70.111 1.00 . C C .  29 PHE CA   1 1 
        1   6086 3 3  29 PHE CB   C  -75.645 -19.193  -69.597 1.00 . C C .  29 PHE CB   1 1 
        1   6087 3 3  29 PHE CD1  C  -74.261 -19.561  -67.513 1.00 . C C .  29 PHE CD1  1 1 
        1   6088 3 3  29 PHE CD2  C  -73.459 -20.479  -69.591 1.00 . C C .  29 PHE CD2  1 1 
        1   6089 3 3  29 PHE CE1  C  -73.136 -20.077  -66.851 1.00 . C C .  29 PHE CE1  1 1 
        1   6090 3 3  29 PHE CE2  C  -72.338 -20.997  -68.937 1.00 . C C .  29 PHE CE2  1 1 
        1   6091 3 3  29 PHE CG   C  -74.435 -19.759  -68.885 1.00 . C C .  29 PHE CG   1 1 
        1   6092 3 3  29 PHE CZ   C  -72.178 -20.798  -67.563 1.00 . C C .  29 PHE CZ   1 1 
        1   6093 3 3  29 PHE H    H  -77.523 -17.631  -70.425 1.00 . C C .  29 PHE H    1 1 
        1   6094 3 3  29 PHE HA   H  -75.151 -17.166  -69.257 1.00 . C C .  29 PHE HA   1 1 
        1   6095 3 3  29 PHE HB2  H  -76.478 -19.196  -68.912 1.00 . C C .  29 PHE HB2  1 1 
        1   6096 3 3  29 PHE HB3  H  -75.886 -19.830  -70.436 1.00 . C C .  29 PHE HB3  1 1 
        1   6097 3 3  29 PHE HD1  H  -75.003 -19.008  -66.955 1.00 . C C .  29 PHE HD1  1 1 
        1   6098 3 3  29 PHE HD2  H  -73.577 -20.637  -70.653 1.00 . C C .  29 PHE HD2  1 1 
        1   6099 3 3  29 PHE HE1  H  -73.013 -19.917  -65.790 1.00 . C C .  29 PHE HE1  1 1 
        1   6100 3 3  29 PHE HE2  H  -71.599 -21.555  -69.492 1.00 . C C .  29 PHE HE2  1 1 
        1   6101 3 3  29 PHE HZ   H  -71.311 -21.196  -67.056 1.00 . C C .  29 PHE HZ   1 1 
        1   6102 3 3  29 PHE N    N  -76.670 -17.190  -70.620 1.00 . C C .  29 PHE N    1 1 
        1   6103 3 3  29 PHE O    O  -73.246 -17.069  -70.800 1.00 . C C .  29 PHE O    1 1 
        1   6104 3 3  30 SER C    C  -72.588 -17.242  -73.691 1.00 . C C .  30 SER C    1 1 
        1   6105 3 3  30 SER CA   C  -73.248 -18.528  -73.177 1.00 . C C .  30 SER CA   1 1 
        1   6106 3 3  30 SER CB   C  -73.617 -19.475  -74.336 1.00 . C C .  30 SER CB   1 1 
        1   6107 3 3  30 SER H    H  -75.237 -18.782  -72.465 1.00 . C C .  30 SER H    1 1 
        1   6108 3 3  30 SER HA   H  -72.495 -19.038  -72.592 1.00 . C C .  30 SER HA   1 1 
        1   6109 3 3  30 SER HB2  H  -72.778 -20.115  -74.545 1.00 . C C .  30 SER HB2  1 1 
        1   6110 3 3  30 SER HB3  H  -74.451 -20.093  -74.024 1.00 . C C .  30 SER HB3  1 1 
        1   6111 3 3  30 SER HG   H  -74.005 -17.844  -75.327 1.00 . C C .  30 SER HG   1 1 
        1   6112 3 3  30 SER N    N  -74.395 -18.318  -72.273 1.00 . C C .  30 SER N    1 1 
        1   6113 3 3  30 SER O    O  -71.536 -17.280  -74.327 1.00 . C C .  30 SER O    1 1 
        1   6114 3 3  30 SER OG   O  -73.959 -18.781  -75.531 1.00 . C C .  30 SER OG   1 1 
        1   6115 3 3  31 SER C    C  -71.813 -14.061  -72.759 1.00 . C C .  31 SER C    1 1 
        1   6116 3 3  31 SER CA   C  -72.720 -14.805  -73.791 1.00 . C C .  31 SER CA   1 1 
        1   6117 3 3  31 SER CB   C  -73.932 -13.955  -74.113 1.00 . C C .  31 SER CB   1 1 
        1   6118 3 3  31 SER H    H  -74.024 -16.164  -72.842 1.00 . C C .  31 SER H    1 1 
        1   6119 3 3  31 SER HA   H  -72.156 -14.930  -74.701 1.00 . C C .  31 SER HA   1 1 
        1   6120 3 3  31 SER HB2  H  -73.651 -12.915  -74.126 1.00 . C C .  31 SER HB2  1 1 
        1   6121 3 3  31 SER HB3  H  -74.319 -14.234  -75.084 1.00 . C C .  31 SER HB3  1 1 
        1   6122 3 3  31 SER HG   H  -74.565 -13.869  -72.276 1.00 . C C .  31 SER HG   1 1 
        1   6123 3 3  31 SER N    N  -73.203 -16.115  -73.375 1.00 . C C .  31 SER N    1 1 
        1   6124 3 3  31 SER O    O  -70.939 -13.254  -73.141 1.00 . C C .  31 SER O    1 1 
        1   6125 3 3  31 SER OG   O  -74.925 -14.158  -73.118 1.00 . C C .  31 SER OG   1 1 
        1   6126 3 3  32 TYR C    C  -69.891 -14.500  -70.185 1.00 . C C .  32 TYR C    1 1 
        1   6127 3 3  32 TYR CA   C  -71.180 -13.701  -70.448 1.00 . C C .  32 TYR CA   1 1 
        1   6128 3 3  32 TYR CB   C  -71.993 -13.458  -69.163 1.00 . C C .  32 TYR CB   1 1 
        1   6129 3 3  32 TYR CD1  C  -74.054 -12.181  -69.964 1.00 . C C .  32 TYR CD1  1 1 
        1   6130 3 3  32 TYR CD2  C  -72.492 -11.017  -68.550 1.00 . C C .  32 TYR CD2  1 1 
        1   6131 3 3  32 TYR CE1  C  -74.851 -11.026  -70.035 1.00 . C C .  32 TYR CE1  1 1 
        1   6132 3 3  32 TYR CE2  C  -73.285  -9.854  -68.620 1.00 . C C .  32 TYR CE2  1 1 
        1   6133 3 3  32 TYR CG   C  -72.865 -12.199  -69.223 1.00 . C C .  32 TYR CG   1 1 
        1   6134 3 3  32 TYR CZ   C  -74.463  -9.878  -69.363 1.00 . C C .  32 TYR CZ   1 1 
        1   6135 3 3  32 TYR H    H  -72.729 -14.939  -71.202 1.00 . C C .  32 TYR H    1 1 
        1   6136 3 3  32 TYR HA   H  -70.880 -12.734  -70.824 1.00 . C C .  32 TYR HA   1 1 
        1   6137 3 3  32 TYR HB2  H  -72.631 -14.311  -68.990 1.00 . C C .  32 TYR HB2  1 1 
        1   6138 3 3  32 TYR HB3  H  -71.306 -13.368  -68.333 1.00 . C C .  32 TYR HB3  1 1 
        1   6139 3 3  32 TYR HD1  H  -74.364 -13.072  -70.490 1.00 . C C .  32 TYR HD1  1 1 
        1   6140 3 3  32 TYR HD2  H  -71.578 -11.001  -67.974 1.00 . C C .  32 TYR HD2  1 1 
        1   6141 3 3  32 TYR HE1  H  -75.764 -11.033  -70.612 1.00 . C C .  32 TYR HE1  1 1 
        1   6142 3 3  32 TYR HE2  H  -72.987  -8.957  -68.098 1.00 . C C .  32 TYR HE2  1 1 
        1   6143 3 3  32 TYR HH   H  -74.703  -7.991  -69.403 1.00 . C C .  32 TYR HH   1 1 
        1   6144 3 3  32 TYR N    N  -72.026 -14.310  -71.467 1.00 . C C .  32 TYR N    1 1 
        1   6145 3 3  32 TYR O    O  -69.751 -15.632  -70.638 1.00 . C C .  32 TYR O    1 1 
        1   6146 3 3  32 TYR OH   O  -75.265  -8.768  -69.450 1.00 . C C .  32 TYR OH   1 1 
        1   6147 3 3  33 ASP C    C  -68.086 -15.036  -67.492 1.00 . C C .  33 ASP C    1 1 
        1   6148 3 3  33 ASP CA   C  -67.792 -14.611  -68.923 1.00 . C C .  33 ASP CA   1 1 
        1   6149 3 3  33 ASP CB   C  -66.542 -13.744  -68.937 1.00 . C C .  33 ASP CB   1 1 
        1   6150 3 3  33 ASP CG   C  -65.957 -13.592  -70.314 1.00 . C C .  33 ASP CG   1 1 
        1   6151 3 3  33 ASP H    H  -69.101 -12.971  -69.179 1.00 . C C .  33 ASP H    1 1 
        1   6152 3 3  33 ASP HA   H  -67.612 -15.493  -69.519 1.00 . C C .  33 ASP HA   1 1 
        1   6153 3 3  33 ASP HB2  H  -66.791 -12.766  -68.556 1.00 . C C .  33 ASP HB2  1 1 
        1   6154 3 3  33 ASP HB3  H  -65.802 -14.192  -68.288 1.00 . C C .  33 ASP HB3  1 1 
        1   6155 3 3  33 ASP N    N  -68.937 -13.888  -69.483 1.00 . C C .  33 ASP N    1 1 
        1   6156 3 3  33 ASP O    O  -69.037 -14.569  -66.869 1.00 . C C .  33 ASP O    1 1 
        1   6157 3 3  33 ASP OD1  O  -66.725 -13.723  -71.285 1.00 . C C .  33 ASP OD1  1 1 
        1   6158 3 3  33 ASP OD2  O  -64.741 -13.330  -70.433 1.00 . C C .  33 ASP OD2  1 1 
        1   6159 3 3  34 MET C    C  -66.227 -16.406  -64.782 1.00 . C C .  34 MET C    1 1 
        1   6160 3 3  34 MET CA   C  -67.503 -16.372  -65.609 1.00 . C C .  34 MET CA   1 1 
        1   6161 3 3  34 MET CB   C  -68.206 -17.729  -65.615 1.00 . C C .  34 MET CB   1 1 
        1   6162 3 3  34 MET CE   C  -71.290 -17.207  -64.002 1.00 . C C .  34 MET CE   1 1 
        1   6163 3 3  34 MET CG   C  -69.626 -17.702  -66.197 1.00 . C C .  34 MET CG   1 1 
        1   6164 3 3  34 MET H    H  -66.516 -16.282  -67.479 1.00 . C C .  34 MET H    1 1 
        1   6165 3 3  34 MET HA   H  -68.171 -15.661  -65.144 1.00 . C C .  34 MET HA   1 1 
        1   6166 3 3  34 MET HB2  H  -67.615 -18.418  -66.198 1.00 . C C .  34 MET HB2  1 1 
        1   6167 3 3  34 MET HB3  H  -68.255 -18.095  -64.599 1.00 . C C .  34 MET HB3  1 1 
        1   6168 3 3  34 MET HE1  H  -72.345 -17.009  -63.874 1.00 . C C .  34 MET HE1  1 1 
        1   6169 3 3  34 MET HE2  H  -70.747 -16.813  -63.158 1.00 . C C .  34 MET HE2  1 1 
        1   6170 3 3  34 MET HE3  H  -71.124 -18.273  -64.069 1.00 . C C .  34 MET HE3  1 1 
        1   6171 3 3  34 MET HG2  H  -69.554 -17.546  -67.261 1.00 . C C .  34 MET HG2  1 1 
        1   6172 3 3  34 MET HG3  H  -70.081 -18.669  -66.026 1.00 . C C .  34 MET HG3  1 1 
        1   6173 3 3  34 MET N    N  -67.267 -15.926  -66.961 1.00 . C C .  34 MET N    1 1 
        1   6174 3 3  34 MET O    O  -65.126 -16.638  -65.326 1.00 . C C .  34 MET O    1 1 
        1   6175 3 3  34 MET SD   S  -70.713 -16.416  -65.513 1.00 . C C .  34 MET SD   1 1 
        1   6176 3 3  35 SER C    C  -65.626 -16.780  -61.245 1.00 . C C .  35 SER C    1 1 
        1   6177 3 3  35 SER CA   C  -65.294 -16.054  -62.518 1.00 . C C .  35 SER CA   1 1 
        1   6178 3 3  35 SER CB   C  -65.052 -14.603  -62.164 1.00 . C C .  35 SER CB   1 1 
        1   6179 3 3  35 SER H    H  -67.306 -15.989  -63.152 1.00 . C C .  35 SER H    1 1 
        1   6180 3 3  35 SER HA   H  -64.397 -16.470  -62.950 1.00 . C C .  35 SER HA   1 1 
        1   6181 3 3  35 SER HB2  H  -64.158 -14.519  -61.569 1.00 . C C .  35 SER HB2  1 1 
        1   6182 3 3  35 SER HB3  H  -64.934 -14.027  -63.073 1.00 . C C .  35 SER HB3  1 1 
        1   6183 3 3  35 SER HG   H  -65.830 -13.446  -60.817 1.00 . C C .  35 SER HG   1 1 
        1   6184 3 3  35 SER N    N  -66.397 -16.164  -63.475 1.00 . C C .  35 SER N    1 1 
        1   6185 3 3  35 SER O    O  -66.790 -17.044  -60.972 1.00 . C C .  35 SER O    1 1 
        1   6186 3 3  35 SER OG   O  -66.154 -14.117  -61.422 1.00 . C C .  35 SER OG   1 1 
        1   6187 3 3  36 TRP C    C  -63.989 -17.179  -58.130 1.00 . C C .  36 TRP C    1 1 
        1   6188 3 3  36 TRP CA   C  -64.732 -17.843  -59.236 1.00 . C C .  36 TRP CA   1 1 
        1   6189 3 3  36 TRP CB   C  -64.096 -19.209  -59.416 1.00 . C C .  36 TRP CB   1 1 
        1   6190 3 3  36 TRP CD1  C  -65.071 -20.876  -61.059 1.00 . C C .  36 TRP CD1  1 1 
        1   6191 3 3  36 TRP CD2  C  -66.076 -20.839  -59.068 1.00 . C C .  36 TRP CD2  1 1 
        1   6192 3 3  36 TRP CE2  C  -66.706 -21.803  -59.870 1.00 . C C .  36 TRP CE2  1 1 
        1   6193 3 3  36 TRP CE3  C  -66.540 -20.634  -57.766 1.00 . C C .  36 TRP CE3  1 1 
        1   6194 3 3  36 TRP CG   C  -65.033 -20.261  -59.847 1.00 . C C .  36 TRP CG   1 1 
        1   6195 3 3  36 TRP CH2  C  -68.223 -22.343  -58.136 1.00 . C C .  36 TRP CH2  1 1 
        1   6196 3 3  36 TRP CZ2  C  -67.782 -22.561  -59.420 1.00 . C C .  36 TRP CZ2  1 1 
        1   6197 3 3  36 TRP CZ3  C  -67.612 -21.394  -57.309 1.00 . C C .  36 TRP CZ3  1 1 
        1   6198 3 3  36 TRP H    H  -63.699 -16.779  -60.735 1.00 . C C .  36 TRP H    1 1 
        1   6199 3 3  36 TRP HA   H  -65.772 -17.955  -58.975 1.00 . C C .  36 TRP HA   1 1 
        1   6200 3 3  36 TRP HB2  H  -63.314 -19.130  -60.155 1.00 . C C .  36 TRP HB2  1 1 
        1   6201 3 3  36 TRP HB3  H  -63.648 -19.504  -58.476 1.00 . C C .  36 TRP HB3  1 1 
        1   6202 3 3  36 TRP HD1  H  -64.403 -20.664  -61.882 1.00 . C C .  36 TRP HD1  1 1 
        1   6203 3 3  36 TRP HE1  H  -66.308 -22.393  -61.831 1.00 . C C .  36 TRP HE1  1 1 
        1   6204 3 3  36 TRP HE3  H  -66.071 -19.902  -57.124 1.00 . C C .  36 TRP HE3  1 1 
        1   6205 3 3  36 TRP HH2  H  -69.054 -22.919  -57.757 1.00 . C C .  36 TRP HH2  1 1 
        1   6206 3 3  36 TRP HZ2  H  -68.255 -23.294  -60.056 1.00 . C C .  36 TRP HZ2  1 1 
        1   6207 3 3  36 TRP HZ3  H  -67.981 -21.246  -56.304 1.00 . C C .  36 TRP HZ3  1 1 
        1   6208 3 3  36 TRP N    N  -64.596 -17.057  -60.453 1.00 . C C .  36 TRP N    1 1 
        1   6209 3 3  36 TRP NE1  N  -66.068 -21.810  -61.081 1.00 . C C .  36 TRP NE1  1 1 
        1   6210 3 3  36 TRP O    O  -62.778 -17.306  -58.069 1.00 . C C .  36 TRP O    1 1 
        1   6211 3 3  37 VAL C    C  -64.272 -16.582  -54.853 1.00 . C C .  37 VAL C    1 1 
        1   6212 3 3  37 VAL CA   C  -64.053 -15.799  -56.143 1.00 . C C .  37 VAL CA   1 1 
        1   6213 3 3  37 VAL CB   C  -64.583 -14.350  -56.017 1.00 . C C .  37 VAL CB   1 1 
        1   6214 3 3  37 VAL CG1  C  -63.759 -13.551  -55.031 1.00 . C C .  37 VAL CG1  1 1 
        1   6215 3 3  37 VAL CG2  C  -64.558 -13.651  -57.365 1.00 . C C .  37 VAL CG2  1 1 
        1   6216 3 3  37 VAL H    H  -65.671 -16.454  -57.336 1.00 . C C .  37 VAL H    1 1 
        1   6217 3 3  37 VAL HA   H  -62.991 -15.760  -56.341 1.00 . C C .  37 VAL HA   1 1 
        1   6218 3 3  37 VAL HB   H  -65.604 -14.387  -55.662 1.00 . C C .  37 VAL HB   1 1 
        1   6219 3 3  37 VAL HG11 H  -63.475 -14.183  -54.203 1.00 . C C .  37 VAL HG11 1 1 
        1   6220 3 3  37 VAL HG12 H  -64.342 -12.718  -54.666 1.00 . C C .  37 VAL HG12 1 1 
        1   6221 3 3  37 VAL HG13 H  -62.871 -13.181  -55.521 1.00 . C C .  37 VAL HG13 1 1 
        1   6222 3 3  37 VAL HG21 H  -65.566 -13.558  -57.742 1.00 . C C .  37 VAL HG21 1 1 
        1   6223 3 3  37 VAL HG22 H  -63.966 -14.229  -58.059 1.00 . C C .  37 VAL HG22 1 1 
        1   6224 3 3  37 VAL HG23 H  -64.124 -12.668  -57.253 1.00 . C C .  37 VAL HG23 1 1 
        1   6225 3 3  37 VAL N    N  -64.697 -16.500  -57.242 1.00 . C C .  37 VAL N    1 1 
        1   6226 3 3  37 VAL O    O  -65.364 -17.101  -54.617 1.00 . C C .  37 VAL O    1 1 
        1   6227 3 3  38 ARG C    C  -63.104 -16.195  -51.652 1.00 . C C .  38 ARG C    1 1 
        1   6228 3 3  38 ARG CA   C  -63.312 -17.272  -52.700 1.00 . C C .  38 ARG CA   1 1 
        1   6229 3 3  38 ARG CB   C  -62.278 -18.370  -52.495 1.00 . C C .  38 ARG CB   1 1 
        1   6230 3 3  38 ARG CD   C  -59.822 -18.971  -52.446 1.00 . C C .  38 ARG CD   1 1 
        1   6231 3 3  38 ARG CG   C  -60.850 -17.860  -52.394 1.00 . C C .  38 ARG CG   1 1 
        1   6232 3 3  38 ARG CZ   C  -57.370 -19.170  -52.739 1.00 . C C .  38 ARG CZ   1 1 
        1   6233 3 3  38 ARG H    H  -62.372 -16.272  -54.314 1.00 . C C .  38 ARG H    1 1 
        1   6234 3 3  38 ARG HA   H  -64.299 -17.694  -52.574 1.00 . C C .  38 ARG HA   1 1 
        1   6235 3 3  38 ARG HB2  H  -62.516 -18.902  -51.588 1.00 . C C .  38 ARG HB2  1 1 
        1   6236 3 3  38 ARG HB3  H  -62.342 -19.060  -53.325 1.00 . C C .  38 ARG HB3  1 1 
        1   6237 3 3  38 ARG HD2  H  -59.878 -19.550  -51.537 1.00 . C C .  38 ARG HD2  1 1 
        1   6238 3 3  38 ARG HD3  H  -60.040 -19.614  -53.288 1.00 . C C .  38 ARG HD3  1 1 
        1   6239 3 3  38 ARG HE   H  -58.367 -17.460  -52.573 1.00 . C C .  38 ARG HE   1 1 
        1   6240 3 3  38 ARG HG2  H  -60.665 -17.179  -53.209 1.00 . C C .  38 ARG HG2  1 1 
        1   6241 3 3  38 ARG HG3  H  -60.739 -17.325  -51.461 1.00 . C C .  38 ARG HG3  1 1 
        1   6242 3 3  38 ARG HH11 H  -58.294 -20.975  -52.680 1.00 . C C .  38 ARG HH11 1 1 
        1   6243 3 3  38 ARG HH12 H  -56.576 -21.031  -52.887 1.00 . C C .  38 ARG HH12 1 1 
        1   6244 3 3  38 ARG HH21 H  -56.154 -17.561  -52.849 1.00 . C C .  38 ARG HH21 1 1 
        1   6245 3 3  38 ARG HH22 H  -55.366 -19.097  -52.982 1.00 . C C .  38 ARG HH22 1 1 
        1   6246 3 3  38 ARG N    N  -63.216 -16.690  -54.043 1.00 . C C .  38 ARG N    1 1 
        1   6247 3 3  38 ARG NE   N  -58.471 -18.435  -52.587 1.00 . C C .  38 ARG NE   1 1 
        1   6248 3 3  38 ARG NH1  N  -57.417 -20.504  -52.771 1.00 . C C .  38 ARG NH1  1 1 
        1   6249 3 3  38 ARG NH2  N  -56.201 -18.559  -52.868 1.00 . C C .  38 ARG NH2  1 1 
        1   6250 3 3  38 ARG O    O  -62.554 -15.124  -51.943 1.00 . C C .  38 ARG O    1 1 
        1   6251 3 3  39 GLN C    C  -62.740 -16.275  -48.160 1.00 . C C .  39 GLN C    1 1 
        1   6252 3 3  39 GLN CA   C  -63.313 -15.540  -49.337 1.00 . C C .  39 GLN CA   1 1 
        1   6253 3 3  39 GLN CB   C  -64.606 -14.843  -48.931 1.00 . C C .  39 GLN CB   1 1 
        1   6254 3 3  39 GLN CD   C  -65.645 -12.879  -47.675 1.00 . C C .  39 GLN CD   1 1 
        1   6255 3 3  39 GLN CG   C  -64.414 -13.757  -47.871 1.00 . C C .  39 GLN CG   1 1 
        1   6256 3 3  39 GLN H    H  -63.956 -17.340  -50.250 1.00 . C C .  39 GLN H    1 1 
        1   6257 3 3  39 GLN HA   H  -62.602 -14.793  -49.659 1.00 . C C .  39 GLN HA   1 1 
        1   6258 3 3  39 GLN HB2  H  -65.043 -14.390  -49.808 1.00 . C C .  39 GLN HB2  1 1 
        1   6259 3 3  39 GLN HB3  H  -65.292 -15.585  -48.549 1.00 . C C .  39 GLN HB3  1 1 
        1   6260 3 3  39 GLN HE21 H  -64.571 -11.534  -46.641 1.00 . C C .  39 GLN HE21 1 1 
        1   6261 3 3  39 GLN HE22 H  -66.214 -11.149  -46.829 1.00 . C C .  39 GLN HE22 1 1 
        1   6262 3 3  39 GLN HG2  H  -64.175 -14.229  -46.931 1.00 . C C .  39 GLN HG2  1 1 
        1   6263 3 3  39 GLN HG3  H  -63.582 -13.132  -48.164 1.00 . C C .  39 GLN HG3  1 1 
        1   6264 3 3  39 GLN N    N  -63.532 -16.475  -50.429 1.00 . C C .  39 GLN N    1 1 
        1   6265 3 3  39 GLN NE2  N  -65.461 -11.755  -46.988 1.00 . C C .  39 GLN NE2  1 1 
        1   6266 3 3  39 GLN O    O  -63.361 -17.198  -47.651 1.00 . C C .  39 GLN O    1 1 
        1   6267 3 3  39 GLN OE1  O  -66.747 -13.210  -48.127 1.00 . C C .  39 GLN OE1  1 1 
        1   6268 3 3  40 THR C    C  -61.532 -16.455  -45.338 1.00 . C C .  40 THR C    1 1 
        1   6269 3 3  40 THR CA   C  -60.841 -16.587  -46.685 1.00 . C C .  40 THR CA   1 1 
        1   6270 3 3  40 THR CB   C  -59.417 -16.089  -46.504 1.00 . C C .  40 THR CB   1 1 
        1   6271 3 3  40 THR CG2  C  -58.841 -15.605  -47.823 1.00 . C C .  40 THR CG2  1 1 
        1   6272 3 3  40 THR H    H  -61.115 -15.110  -48.175 1.00 . C C .  40 THR H    1 1 
        1   6273 3 3  40 THR HA   H  -60.807 -17.631  -46.955 1.00 . C C .  40 THR HA   1 1 
        1   6274 3 3  40 THR HB   H  -58.811 -16.905  -46.138 1.00 . C C .  40 THR HB   1 1 
        1   6275 3 3  40 THR HG1  H  -58.513 -14.721  -45.436 1.00 . C C .  40 THR HG1  1 1 
        1   6276 3 3  40 THR HG21 H  -59.647 -15.346  -48.494 1.00 . C C .  40 THR HG21 1 1 
        1   6277 3 3  40 THR HG22 H  -58.243 -16.389  -48.263 1.00 . C C .  40 THR HG22 1 1 
        1   6278 3 3  40 THR HG23 H  -58.225 -14.736  -47.649 1.00 . C C .  40 THR HG23 1 1 
        1   6279 3 3  40 THR N    N  -61.556 -15.860  -47.724 1.00 . C C .  40 THR N    1 1 
        1   6280 3 3  40 THR O    O  -62.481 -15.670  -45.201 1.00 . C C .  40 THR O    1 1 
        1   6281 3 3  40 THR OG1  O  -59.413 -15.042  -45.523 1.00 . C C .  40 THR OG1  1 1 
        1   6282 3 3  41 PRO C    C  -61.237 -15.782  -42.325 1.00 . C C .  41 PRO C    1 1 
        1   6283 3 3  41 PRO CA   C  -61.537 -17.125  -42.962 1.00 . C C .  41 PRO CA   1 1 
        1   6284 3 3  41 PRO CB   C  -60.795 -18.251  -42.257 1.00 . C C .  41 PRO CB   1 1 
        1   6285 3 3  41 PRO CD   C  -60.315 -18.500  -44.539 1.00 . C C .  41 PRO CD   1 1 
        1   6286 3 3  41 PRO CG   C  -60.697 -19.313  -43.334 1.00 . C C .  41 PRO CG   1 1 
        1   6287 3 3  41 PRO HA   H  -62.594 -17.323  -42.919 1.00 . C C .  41 PRO HA   1 1 
        1   6288 3 3  41 PRO HB2  H  -59.812 -17.922  -41.945 1.00 . C C .  41 PRO HB2  1 1 
        1   6289 3 3  41 PRO HB3  H  -61.363 -18.621  -41.420 1.00 . C C .  41 PRO HB3  1 1 
        1   6290 3 3  41 PRO HD2  H  -59.248 -18.318  -44.552 1.00 . C C .  41 PRO HD2  1 1 
        1   6291 3 3  41 PRO HD3  H  -60.635 -18.985  -45.447 1.00 . C C .  41 PRO HD3  1 1 
        1   6292 3 3  41 PRO HG2  H  -59.930 -20.036  -43.090 1.00 . C C .  41 PRO HG2  1 1 
        1   6293 3 3  41 PRO HG3  H  -61.649 -19.792  -43.493 1.00 . C C .  41 PRO HG3  1 1 
        1   6294 3 3  41 PRO N    N  -61.064 -17.240  -44.341 1.00 . C C .  41 PRO N    1 1 
        1   6295 3 3  41 PRO O    O  -61.955 -15.382  -41.415 1.00 . C C .  41 PRO O    1 1 
        1   6296 3 3  42 GLU C    C  -60.969 -12.744  -42.942 1.00 . C C .  42 GLU C    1 1 
        1   6297 3 3  42 GLU CA   C  -59.943 -13.718  -42.379 1.00 . C C .  42 GLU CA   1 1 
        1   6298 3 3  42 GLU CB   C  -58.546 -13.255  -42.797 1.00 . C C .  42 GLU CB   1 1 
        1   6299 3 3  42 GLU CD   C  -57.578 -15.566  -42.875 1.00 . C C .  42 GLU CD   1 1 
        1   6300 3 3  42 GLU CG   C  -57.406 -14.144  -42.380 1.00 . C C .  42 GLU CG   1 1 
        1   6301 3 3  42 GLU H    H  -59.712 -15.447  -43.578 1.00 . C C .  42 GLU H    1 1 
        1   6302 3 3  42 GLU HA   H  -60.004 -13.693  -41.301 1.00 . C C .  42 GLU HA   1 1 
        1   6303 3 3  42 GLU HB2  H  -58.526 -13.172  -43.871 1.00 . C C .  42 GLU HB2  1 1 
        1   6304 3 3  42 GLU HB3  H  -58.383 -12.269  -42.382 1.00 . C C .  42 GLU HB3  1 1 
        1   6305 3 3  42 GLU HG2  H  -56.486 -13.744  -42.778 1.00 . C C .  42 GLU HG2  1 1 
        1   6306 3 3  42 GLU HG3  H  -57.346 -14.153  -41.301 1.00 . C C .  42 GLU HG3  1 1 
        1   6307 3 3  42 GLU N    N  -60.223 -15.078  -42.827 1.00 . C C .  42 GLU N    1 1 
        1   6308 3 3  42 GLU O    O  -60.957 -11.577  -42.572 1.00 . C C .  42 GLU O    1 1 
        1   6309 3 3  42 GLU OE1  O  -57.152 -15.881  -44.013 1.00 . C C .  42 GLU OE1  1 1 
        1   6310 3 3  42 GLU OE2  O  -58.149 -16.374  -42.114 1.00 . C C .  42 GLU OE2  1 1 
        1   6311 3 3  43 LYS C    C  -62.251 -11.720  -45.740 1.00 . C C .  43 LYS C    1 1 
        1   6312 3 3  43 LYS CA   C  -62.853 -12.378  -44.507 1.00 . C C .  43 LYS CA   1 1 
        1   6313 3 3  43 LYS CB   C  -63.475 -11.326  -43.574 1.00 . C C .  43 LYS CB   1 1 
        1   6314 3 3  43 LYS CD   C  -64.056 -12.628  -41.462 1.00 . C C .  43 LYS CD   1 1 
        1   6315 3 3  43 LYS CE   C  -65.190 -13.362  -40.730 1.00 . C C .  43 LYS CE   1 1 
        1   6316 3 3  43 LYS CG   C  -64.587 -11.842  -42.662 1.00 . C C .  43 LYS CG   1 1 
        1   6317 3 3  43 LYS H    H  -61.808 -14.170  -44.054 1.00 . C C .  43 LYS H    1 1 
        1   6318 3 3  43 LYS HA   H  -63.648 -13.030  -44.844 1.00 . C C .  43 LYS HA   1 1 
        1   6319 3 3  43 LYS HB2  H  -62.694 -10.917  -42.953 1.00 . C C .  43 LYS HB2  1 1 
        1   6320 3 3  43 LYS HB3  H  -63.874 -10.528  -44.185 1.00 . C C .  43 LYS HB3  1 1 
        1   6321 3 3  43 LYS HD2  H  -63.331 -13.351  -41.805 1.00 . C C .  43 LYS HD2  1 1 
        1   6322 3 3  43 LYS HD3  H  -63.577 -11.945  -40.776 1.00 . C C .  43 LYS HD3  1 1 
        1   6323 3 3  43 LYS HE2  H  -65.794 -13.878  -41.459 1.00 . C C .  43 LYS HE2  1 1 
        1   6324 3 3  43 LYS HE3  H  -64.752 -14.095  -40.067 1.00 . C C .  43 LYS HE3  1 1 
        1   6325 3 3  43 LYS HG2  H  -65.157 -11.001  -42.299 1.00 . C C .  43 LYS HG2  1 1 
        1   6326 3 3  43 LYS HG3  H  -65.240 -12.482  -43.238 1.00 . C C .  43 LYS HG3  1 1 
        1   6327 3 3  43 LYS HZ1  H  -65.556 -12.051  -39.122 1.00 . C C .  43 LYS HZ1  1 1 
        1   6328 3 3  43 LYS HZ2  H  -66.902 -12.991  -39.560 1.00 . C C .  43 LYS HZ2  1 1 
        1   6329 3 3  43 LYS HZ3  H  -66.432 -11.674  -40.525 1.00 . C C .  43 LYS HZ3  1 1 
        1   6330 3 3  43 LYS N    N  -61.856 -13.221  -43.817 1.00 . C C .  43 LYS N    1 1 
        1   6331 3 3  43 LYS NZ   N  -66.091 -12.448  -39.921 1.00 . C C .  43 LYS NZ   1 1 
        1   6332 3 3  43 LYS O    O  -62.912 -10.954  -46.440 1.00 . C C .  43 LYS O    1 1 
        1   6333 3 3  44 ARG C    C  -60.819 -12.070  -48.476 1.00 . C C .  44 ARG C    1 1 
        1   6334 3 3  44 ARG CA   C  -60.172 -11.640  -47.141 1.00 . C C .  44 ARG CA   1 1 
        1   6335 3 3  44 ARG CB   C  -58.767 -12.245  -46.961 1.00 . C C .  44 ARG CB   1 1 
        1   6336 3 3  44 ARG CD   C  -57.416 -10.218  -47.441 1.00 . C C .  44 ARG CD   1 1 
        1   6337 3 3  44 ARG CG   C  -57.680 -11.670  -47.814 1.00 . C C .  44 ARG CG   1 1 
        1   6338 3 3  44 ARG CZ   C  -58.290  -8.877  -49.360 1.00 . C C .  44 ARG CZ   1 1 
        1   6339 3 3  44 ARG H    H  -60.560 -12.673  -45.348 1.00 . C C .  44 ARG H    1 1 
        1   6340 3 3  44 ARG HA   H  -60.083 -10.564  -47.134 1.00 . C C .  44 ARG HA   1 1 
        1   6341 3 3  44 ARG HB2  H  -58.477 -12.118  -45.931 1.00 . C C .  44 ARG HB2  1 1 
        1   6342 3 3  44 ARG HB3  H  -58.834 -13.307  -47.159 1.00 . C C .  44 ARG HB3  1 1 
        1   6343 3 3  44 ARG HD2  H  -58.238  -9.853  -46.845 1.00 . C C .  44 ARG HD2  1 1 
        1   6344 3 3  44 ARG HD3  H  -56.508 -10.164  -46.858 1.00 . C C .  44 ARG HD3  1 1 
        1   6345 3 3  44 ARG HE   H  -56.368  -9.142  -48.920 1.00 . C C .  44 ARG HE   1 1 
        1   6346 3 3  44 ARG HG2  H  -56.775 -12.244  -47.673 1.00 . C C .  44 ARG HG2  1 1 
        1   6347 3 3  44 ARG HG3  H  -57.976 -11.721  -48.851 1.00 . C C .  44 ARG HG3  1 1 
        1   6348 3 3  44 ARG HH11 H  -59.777  -9.690  -48.240 1.00 . C C .  44 ARG HH11 1 1 
        1   6349 3 3  44 ARG HH12 H  -60.304  -8.749  -49.596 1.00 . C C .  44 ARG HH12 1 1 
        1   6350 3 3  44 ARG HH21 H  -57.081  -7.916  -50.669 1.00 . C C .  44 ARG HH21 1 1 
        1   6351 3 3  44 ARG HH22 H  -58.778  -7.747  -50.968 1.00 . C C .  44 ARG HH22 1 1 
        1   6352 3 3  44 ARG N    N  -60.980 -12.051  -45.978 1.00 . C C .  44 ARG N    1 1 
        1   6353 3 3  44 ARG NE   N  -57.277  -9.368  -48.634 1.00 . C C .  44 ARG NE   1 1 
        1   6354 3 3  44 ARG NH1  N  -59.564  -9.126  -49.038 1.00 . C C .  44 ARG NH1  1 1 
        1   6355 3 3  44 ARG NH2  N  -58.028  -8.117  -50.420 1.00 . C C .  44 ARG NH2  1 1 
        1   6356 3 3  44 ARG O    O  -61.585 -13.032  -48.504 1.00 . C C .  44 ARG O    1 1 
        1   6357 3 3  45 LEU C    C  -60.260 -11.949  -52.057 1.00 . C C .  45 LEU C    1 1 
        1   6358 3 3  45 LEU CA   C  -61.191 -11.677  -50.868 1.00 . C C .  45 LEU CA   1 1 
        1   6359 3 3  45 LEU CB   C  -62.213 -10.597  -51.254 1.00 . C C .  45 LEU CB   1 1 
        1   6360 3 3  45 LEU CD1  C  -64.605  -9.737  -51.333 1.00 . C C .  45 LEU CD1  1 1 
        1   6361 3 3  45 LEU CD2  C  -64.130 -12.206  -51.398 1.00 . C C .  45 LEU CD2  1 1 
        1   6362 3 3  45 LEU CG   C  -63.670 -10.855  -50.862 1.00 . C C .  45 LEU CG   1 1 
        1   6363 3 3  45 LEU H    H  -59.932 -10.596  -49.509 1.00 . C C .  45 LEU H    1 1 
        1   6364 3 3  45 LEU HA   H  -61.753 -12.585  -50.710 1.00 . C C .  45 LEU HA   1 1 
        1   6365 3 3  45 LEU HB2  H  -61.910  -9.671  -50.795 1.00 . C C .  45 LEU HB2  1 1 
        1   6366 3 3  45 LEU HB3  H  -62.167 -10.467  -52.327 1.00 . C C .  45 LEU HB3  1 1 
        1   6367 3 3  45 LEU HD11 H  -65.565 -10.157  -51.595 1.00 . C C .  45 LEU HD11 1 1 
        1   6368 3 3  45 LEU HD12 H  -64.178  -9.250  -52.198 1.00 . C C .  45 LEU HD12 1 1 
        1   6369 3 3  45 LEU HD13 H  -64.732  -9.015  -50.540 1.00 . C C .  45 LEU HD13 1 1 
        1   6370 3 3  45 LEU HD21 H  -63.656 -12.997  -50.837 1.00 . C C .  45 LEU HD21 1 1 
        1   6371 3 3  45 LEU HD22 H  -63.859 -12.291  -52.440 1.00 . C C .  45 LEU HD22 1 1 
        1   6372 3 3  45 LEU HD23 H  -65.203 -12.286  -51.298 1.00 . C C .  45 LEU HD23 1 1 
        1   6373 3 3  45 LEU HG   H  -63.718 -10.889  -49.783 1.00 . C C .  45 LEU HG   1 1 
        1   6374 3 3  45 LEU N    N  -60.537 -11.364  -49.572 1.00 . C C .  45 LEU N    1 1 
        1   6375 3 3  45 LEU O    O  -59.745 -11.015  -52.673 1.00 . C C .  45 LEU O    1 1 
        1   6376 3 3  46 GLU C    C  -59.940 -14.023  -54.743 1.00 . C C .  46 GLU C    1 1 
        1   6377 3 3  46 GLU CA   C  -59.177 -13.530  -53.517 1.00 . C C .  46 GLU CA   1 1 
        1   6378 3 3  46 GLU CB   C  -58.118 -14.542  -53.104 1.00 . C C .  46 GLU CB   1 1 
        1   6379 3 3  46 GLU CD   C  -56.460 -15.307  -51.339 1.00 . C C .  46 GLU CD   1 1 
        1   6380 3 3  46 GLU CG   C  -57.298 -14.146  -51.880 1.00 . C C .  46 GLU CG   1 1 
        1   6381 3 3  46 GLU H    H  -60.508 -13.934  -51.909 1.00 . C C .  46 GLU H    1 1 
        1   6382 3 3  46 GLU HA   H  -58.669 -12.618  -53.795 1.00 . C C .  46 GLU HA   1 1 
        1   6383 3 3  46 GLU HB2  H  -58.608 -15.479  -52.892 1.00 . C C .  46 GLU HB2  1 1 
        1   6384 3 3  46 GLU HB3  H  -57.446 -14.691  -53.938 1.00 . C C .  46 GLU HB3  1 1 
        1   6385 3 3  46 GLU HG2  H  -56.639 -13.335  -52.148 1.00 . C C .  46 GLU HG2  1 1 
        1   6386 3 3  46 GLU HG3  H  -57.971 -13.808  -51.104 1.00 . C C .  46 GLU HG3  1 1 
        1   6387 3 3  46 GLU N    N  -60.066 -13.214  -52.405 1.00 . C C .  46 GLU N    1 1 
        1   6388 3 3  46 GLU O    O  -60.874 -14.851  -54.637 1.00 . C C .  46 GLU O    1 1 
        1   6389 3 3  46 GLU OE1  O  -55.754 -15.965  -52.143 1.00 . C C .  46 GLU OE1  1 1 
        1   6390 3 3  46 GLU OE2  O  -56.505 -15.572  -50.112 1.00 . C C .  46 GLU OE2  1 1 
        1   6391 3 3  47 TRP C    C  -59.332 -15.177  -57.517 1.00 . C C .  47 TRP C    1 1 
        1   6392 3 3  47 TRP CA   C  -60.099 -13.929  -57.185 1.00 . C C .  47 TRP CA   1 1 
        1   6393 3 3  47 TRP CB   C  -59.866 -12.893  -58.265 1.00 . C C .  47 TRP CB   1 1 
        1   6394 3 3  47 TRP CD1  C  -60.706 -14.091  -60.365 1.00 . C C .  47 TRP CD1  1 1 
        1   6395 3 3  47 TRP CD2  C  -58.527 -13.558  -60.426 1.00 . C C .  47 TRP CD2  1 1 
        1   6396 3 3  47 TRP CE2  C  -58.868 -14.211  -61.639 1.00 . C C .  47 TRP CE2  1 1 
        1   6397 3 3  47 TRP CE3  C  -57.206 -13.138  -60.235 1.00 . C C .  47 TRP CE3  1 1 
        1   6398 3 3  47 TRP CG   C  -59.723 -13.493  -59.627 1.00 . C C .  47 TRP CG   1 1 
        1   6399 3 3  47 TRP CH2  C  -56.642 -14.026  -62.443 1.00 . C C .  47 TRP CH2  1 1 
        1   6400 3 3  47 TRP CZ2  C  -57.928 -14.453  -62.656 1.00 . C C .  47 TRP CZ2  1 1 
        1   6401 3 3  47 TRP CZ3  C  -56.277 -13.373  -61.248 1.00 . C C .  47 TRP CZ3  1 1 
        1   6402 3 3  47 TRP H    H  -58.825 -12.830  -55.903 1.00 . C C .  47 TRP H    1 1 
        1   6403 3 3  47 TRP HA   H  -61.153 -14.149  -57.088 1.00 . C C .  47 TRP HA   1 1 
        1   6404 3 3  47 TRP HB2  H  -60.699 -12.208  -58.276 1.00 . C C .  47 TRP HB2  1 1 
        1   6405 3 3  47 TRP HB3  H  -58.967 -12.342  -58.029 1.00 . C C .  47 TRP HB3  1 1 
        1   6406 3 3  47 TRP HD1  H  -61.732 -14.207  -60.047 1.00 . C C .  47 TRP HD1  1 1 
        1   6407 3 3  47 TRP HE1  H  -60.698 -14.982  -62.284 1.00 . C C .  47 TRP HE1  1 1 
        1   6408 3 3  47 TRP HE3  H  -56.914 -12.637  -59.324 1.00 . C C .  47 TRP HE3  1 1 
        1   6409 3 3  47 TRP HH2  H  -55.896 -14.191  -63.205 1.00 . C C .  47 TRP HH2  1 1 
        1   6410 3 3  47 TRP HZ2  H  -58.209 -14.953  -63.571 1.00 . C C .  47 TRP HZ2  1 1 
        1   6411 3 3  47 TRP HZ3  H  -55.255 -13.050  -61.113 1.00 . C C .  47 TRP HZ3  1 1 
        1   6412 3 3  47 TRP N    N  -59.552 -13.488  -55.905 1.00 . C C .  47 TRP N    1 1 
        1   6413 3 3  47 TRP NE1  N  -60.202 -14.524  -61.574 1.00 . C C .  47 TRP NE1  1 1 
        1   6414 3 3  47 TRP O    O  -58.135 -15.263  -57.209 1.00 . C C .  47 TRP O    1 1 
        1   6415 3 3  48 VAL C    C  -59.347 -18.032  -59.677 1.00 . C C .  48 VAL C    1 1 
        1   6416 3 3  48 VAL CA   C  -59.455 -17.479  -58.254 1.00 . C C .  48 VAL CA   1 1 
        1   6417 3 3  48 VAL CB   C  -60.226 -18.406  -57.317 1.00 . C C .  48 VAL CB   1 1 
        1   6418 3 3  48 VAL CG1  C  -60.471 -19.772  -57.931 1.00 . C C .  48 VAL CG1  1 1 
        1   6419 3 3  48 VAL CG2  C  -59.507 -18.496  -55.989 1.00 . C C .  48 VAL CG2  1 1 
        1   6420 3 3  48 VAL H    H  -60.941 -15.989  -58.379 1.00 . C C .  48 VAL H    1 1 
        1   6421 3 3  48 VAL HA   H  -58.446 -17.428  -57.873 1.00 . C C .  48 VAL HA   1 1 
        1   6422 3 3  48 VAL HB   H  -61.193 -17.955  -57.140 1.00 . C C .  48 VAL HB   1 1 
        1   6423 3 3  48 VAL HG11 H  -59.779 -20.486  -57.509 1.00 . C C .  48 VAL HG11 1 1 
        1   6424 3 3  48 VAL HG12 H  -60.325 -19.717  -59.000 1.00 . C C .  48 VAL HG12 1 1 
        1   6425 3 3  48 VAL HG13 H  -61.483 -20.085  -57.721 1.00 . C C .  48 VAL HG13 1 1 
        1   6426 3 3  48 VAL HG21 H  -59.126 -17.522  -55.719 1.00 . C C .  48 VAL HG21 1 1 
        1   6427 3 3  48 VAL HG22 H  -58.686 -19.194  -56.070 1.00 . C C .  48 VAL HG22 1 1 
        1   6428 3 3  48 VAL HG23 H  -60.195 -18.836  -55.229 1.00 . C C .  48 VAL HG23 1 1 
        1   6429 3 3  48 VAL N    N  -59.998 -16.136  -58.155 1.00 . C C .  48 VAL N    1 1 
        1   6430 3 3  48 VAL O    O  -58.367 -18.694  -60.014 1.00 . C C .  48 VAL O    1 1 
        1   6431 3 3  49 ALA C    C  -61.236 -17.415  -62.735 1.00 . C C .  49 ALA C    1 1 
        1   6432 3 3  49 ALA CA   C  -60.311 -18.245  -61.879 1.00 . C C .  49 ALA CA   1 1 
        1   6433 3 3  49 ALA CB   C  -60.725 -19.680  -61.924 1.00 . C C .  49 ALA CB   1 1 
        1   6434 3 3  49 ALA H    H  -61.097 -17.224  -60.205 1.00 . C C .  49 ALA H    1 1 
        1   6435 3 3  49 ALA HA   H  -59.306 -18.158  -62.263 1.00 . C C .  49 ALA HA   1 1 
        1   6436 3 3  49 ALA HB1  H  -60.983 -20.012  -60.929 1.00 . C C .  49 ALA HB1  1 1 
        1   6437 3 3  49 ALA HB2  H  -59.908 -20.278  -62.303 1.00 . C C .  49 ALA HB2  1 1 
        1   6438 3 3  49 ALA HB3  H  -61.582 -19.788  -62.572 1.00 . C C .  49 ALA HB3  1 1 
        1   6439 3 3  49 ALA N    N  -60.337 -17.761  -60.513 1.00 . C C .  49 ALA N    1 1 
        1   6440 3 3  49 ALA O    O  -62.170 -16.764  -62.245 1.00 . C C .  49 ALA O    1 1 
        1   6441 3 3  50 TYR C    C  -61.830 -17.471  -66.259 1.00 . C C .  50 TYR C    1 1 
        1   6442 3 3  50 TYR CA   C  -61.776 -16.699  -64.979 1.00 . C C .  50 TYR CA   1 1 
        1   6443 3 3  50 TYR CB   C  -61.121 -15.358  -65.261 1.00 . C C .  50 TYR CB   1 1 
        1   6444 3 3  50 TYR CD1  C  -61.991 -14.404  -67.410 1.00 . C C .  50 TYR CD1  1 1 
        1   6445 3 3  50 TYR CD2  C  -62.757 -13.457  -65.355 1.00 . C C .  50 TYR CD2  1 1 
        1   6446 3 3  50 TYR CE1  C  -62.761 -13.497  -68.112 1.00 . C C .  50 TYR CE1  1 1 
        1   6447 3 3  50 TYR CE2  C  -63.536 -12.547  -66.034 1.00 . C C .  50 TYR CE2  1 1 
        1   6448 3 3  50 TYR CG   C  -61.979 -14.398  -66.027 1.00 . C C .  50 TYR CG   1 1 
        1   6449 3 3  50 TYR CZ   C  -63.542 -12.566  -67.420 1.00 . C C .  50 TYR CZ   1 1 
        1   6450 3 3  50 TYR H    H  -60.225 -17.987  -64.355 1.00 . C C .  50 TYR H    1 1 
        1   6451 3 3  50 TYR HA   H  -62.771 -16.548  -64.591 1.00 . C C .  50 TYR HA   1 1 
        1   6452 3 3  50 TYR HB2  H  -60.860 -14.901  -64.320 1.00 . C C .  50 TYR HB2  1 1 
        1   6453 3 3  50 TYR HB3  H  -60.212 -15.534  -65.819 1.00 . C C .  50 TYR HB3  1 1 
        1   6454 3 3  50 TYR HD1  H  -61.388 -15.121  -67.946 1.00 . C C .  50 TYR HD1  1 1 
        1   6455 3 3  50 TYR HD2  H  -62.754 -13.446  -64.275 1.00 . C C .  50 TYR HD2  1 1 
        1   6456 3 3  50 TYR HE1  H  -62.766 -13.513  -69.192 1.00 . C C .  50 TYR HE1  1 1 
        1   6457 3 3  50 TYR HE2  H  -64.131 -11.826  -65.494 1.00 . C C .  50 TYR HE2  1 1 
        1   6458 3 3  50 TYR HH   H  -64.116 -10.774  -67.781 1.00 . C C .  50 TYR HH   1 1 
        1   6459 3 3  50 TYR N    N  -60.976 -17.447  -64.030 1.00 . C C .  50 TYR N    1 1 
        1   6460 3 3  50 TYR O    O  -60.788 -17.761  -66.849 1.00 . C C .  50 TYR O    1 1 
        1   6461 3 3  50 TYR OH   O  -64.333 -11.652  -68.103 1.00 . C C .  50 TYR OH   1 1 
        1   6462 3 3  51 ILE C    C  -63.909 -17.432  -68.938 1.00 . C C .  51 ILE C    1 1 
        1   6463 3 3  51 ILE CA   C  -63.206 -18.418  -67.999 1.00 . C C .  51 ILE CA   1 1 
        1   6464 3 3  51 ILE CB   C  -63.941 -19.786  -67.926 1.00 . C C .  51 ILE CB   1 1 
        1   6465 3 3  51 ILE CD1  C  -64.410 -21.898  -69.271 1.00 . C C .  51 ILE CD1  1 1 
        1   6466 3 3  51 ILE CG1  C  -63.912 -20.478  -69.291 1.00 . C C .  51 ILE CG1  1 1 
        1   6467 3 3  51 ILE CG2  C  -65.357 -19.616  -67.377 1.00 . C C .  51 ILE CG2  1 1 
        1   6468 3 3  51 ILE H    H  -63.826 -17.557  -66.165 1.00 . C C .  51 ILE H    1 1 
        1   6469 3 3  51 ILE HA   H  -62.218 -18.596  -68.401 1.00 . C C .  51 ILE HA   1 1 
        1   6470 3 3  51 ILE HB   H  -63.397 -20.406  -67.224 1.00 . C C .  51 ILE HB   1 1 
        1   6471 3 3  51 ILE HD11 H  -64.223 -22.332  -68.300 1.00 . C C .  51 ILE HD11 1 1 
        1   6472 3 3  51 ILE HD12 H  -63.893 -22.471  -70.028 1.00 . C C .  51 ILE HD12 1 1 
        1   6473 3 3  51 ILE HD13 H  -65.471 -21.911  -69.472 1.00 . C C .  51 ILE HD13 1 1 
        1   6474 3 3  51 ILE HG12 H  -64.525 -19.913  -69.976 1.00 . C C .  51 ILE HG12 1 1 
        1   6475 3 3  51 ILE HG13 H  -62.895 -20.470  -69.657 1.00 . C C .  51 ILE HG13 1 1 
        1   6476 3 3  51 ILE HG21 H  -65.440 -18.659  -66.884 1.00 . C C .  51 ILE HG21 1 1 
        1   6477 3 3  51 ILE HG22 H  -65.566 -20.405  -66.670 1.00 . C C .  51 ILE HG22 1 1 
        1   6478 3 3  51 ILE HG23 H  -66.066 -19.664  -68.191 1.00 . C C .  51 ILE HG23 1 1 
        1   6479 3 3  51 ILE N    N  -63.037 -17.813  -66.686 1.00 . C C .  51 ILE N    1 1 
        1   6480 3 3  51 ILE O    O  -64.806 -16.677  -68.513 1.00 . C C .  51 ILE O    1 1 
        1   6481 3 3  52 SER C    C  -65.449 -17.195  -71.716 1.00 . C C .  52 SER C    1 1 
        1   6482 3 3  52 SER CA   C  -64.115 -16.631  -71.242 1.00 . C C .  52 SER CA   1 1 
        1   6483 3 3  52 SER CB   C  -63.182 -16.550  -72.430 1.00 . C C .  52 SER CB   1 1 
        1   6484 3 3  52 SER H    H  -62.770 -18.055  -70.453 1.00 . C C .  52 SER H    1 1 
        1   6485 3 3  52 SER HA   H  -64.272 -15.634  -70.863 1.00 . C C .  52 SER HA   1 1 
        1   6486 3 3  52 SER HB2  H  -63.693 -16.091  -73.259 1.00 . C C .  52 SER HB2  1 1 
        1   6487 3 3  52 SER HB3  H  -62.322 -15.948  -72.166 1.00 . C C .  52 SER HB3  1 1 
        1   6488 3 3  52 SER HG   H  -61.942 -18.041  -72.348 1.00 . C C .  52 SER HG   1 1 
        1   6489 3 3  52 SER N    N  -63.488 -17.438  -70.201 1.00 . C C .  52 SER N    1 1 
        1   6490 3 3  52 SER O    O  -65.675 -18.408  -71.687 1.00 . C C .  52 SER O    1 1 
        1   6491 3 3  52 SER OG   O  -62.763 -17.849  -72.807 1.00 . C C .  52 SER OG   1 1 
        1   6492 3 3  53 SER C    C  -67.822 -17.976  -73.357 1.00 . C C .  53 SER C    1 1 
        1   6493 3 3  53 SER CA   C  -67.673 -16.604  -72.686 1.00 . C C .  53 SER CA   1 1 
        1   6494 3 3  53 SER CB   C  -68.178 -15.478  -73.633 1.00 . C C .  53 SER CB   1 1 
        1   6495 3 3  53 SER H    H  -66.029 -15.354  -72.182 1.00 . C C .  53 SER H    1 1 
        1   6496 3 3  53 SER HA   H  -68.328 -16.606  -71.827 1.00 . C C .  53 SER HA   1 1 
        1   6497 3 3  53 SER HB2  H  -68.330 -14.581  -73.059 1.00 . C C .  53 SER HB2  1 1 
        1   6498 3 3  53 SER HB3  H  -67.414 -15.284  -74.377 1.00 . C C .  53 SER HB3  1 1 
        1   6499 3 3  53 SER HG   H  -69.846 -16.480  -73.755 1.00 . C C .  53 SER HG   1 1 
        1   6500 3 3  53 SER N    N  -66.311 -16.293  -72.180 1.00 . C C .  53 SER N    1 1 
        1   6501 3 3  53 SER O    O  -68.720 -18.754  -72.999 1.00 . C C .  53 SER O    1 1 
        1   6502 3 3  53 SER OG   O  -69.404 -15.809  -74.281 1.00 . C C .  53 SER OG   1 1 
        1   6503 3 3  54 GLY C    C  -65.863 -20.438  -74.675 1.00 . C C .  54 GLY C    1 1 
        1   6504 3 3  54 GLY CA   C  -66.968 -19.482  -75.088 1.00 . C C .  54 GLY CA   1 1 
        1   6505 3 3  54 GLY H    H  -66.271 -17.567  -74.552 1.00 . C C .  54 GLY H    1 1 
        1   6506 3 3  54 GLY HA2  H  -67.922 -19.965  -74.938 1.00 . C C .  54 GLY HA2  1 1 
        1   6507 3 3  54 GLY HA3  H  -66.854 -19.250  -76.137 1.00 . C C .  54 GLY HA3  1 1 
        1   6508 3 3  54 GLY N    N  -66.945 -18.243  -74.328 1.00 . C C .  54 GLY N    1 1 
        1   6509 3 3  54 GLY O    O  -65.180 -20.992  -75.527 1.00 . C C .  54 GLY O    1 1 
        1   6510 3 3  55 GLY C    C  -63.303 -21.506  -73.428 1.00 . C C .  55 GLY C    1 1 
        1   6511 3 3  55 GLY CA   C  -64.697 -21.581  -72.844 1.00 . C C .  55 GLY CA   1 1 
        1   6512 3 3  55 GLY H    H  -66.238 -20.133  -72.738 1.00 . C C .  55 GLY H    1 1 
        1   6513 3 3  55 GLY HA2  H  -64.618 -21.430  -71.779 1.00 . C C .  55 GLY HA2  1 1 
        1   6514 3 3  55 GLY HA3  H  -65.085 -22.576  -73.014 1.00 . C C .  55 GLY HA3  1 1 
        1   6515 3 3  55 GLY N    N  -65.668 -20.619  -73.370 1.00 . C C .  55 GLY N    1 1 
        1   6516 3 3  55 GLY O    O  -62.452 -22.325  -73.118 1.00 . C C .  55 GLY O    1 1 
        1   6517 3 3  56 GLY C    C  -60.631 -20.221  -74.178 1.00 . C C .  56 GLY C    1 1 
        1   6518 3 3  56 GLY CA   C  -61.859 -20.359  -75.043 1.00 . C C .  56 GLY CA   1 1 
        1   6519 3 3  56 GLY H    H  -63.816 -19.879  -74.442 1.00 . C C .  56 GLY H    1 1 
        1   6520 3 3  56 GLY HA2  H  -61.745 -21.229  -75.672 1.00 . C C .  56 GLY HA2  1 1 
        1   6521 3 3  56 GLY HA3  H  -61.945 -19.484  -75.670 1.00 . C C .  56 GLY HA3  1 1 
        1   6522 3 3  56 GLY N    N  -63.080 -20.501  -74.262 1.00 . C C .  56 GLY N    1 1 
        1   6523 3 3  56 GLY O    O  -59.853 -21.168  -74.046 1.00 . C C .  56 GLY O    1 1 
        1   6524 3 3  57 SER C    C  -59.804 -18.929  -71.157 1.00 . C C .  57 SER C    1 1 
        1   6525 3 3  57 SER CA   C  -59.382 -18.775  -72.646 1.00 . C C .  57 SER CA   1 1 
        1   6526 3 3  57 SER CB   C  -58.820 -17.380  -72.911 1.00 . C C .  57 SER CB   1 1 
        1   6527 3 3  57 SER H    H  -61.137 -18.342  -73.747 1.00 . C C .  57 SER H    1 1 
        1   6528 3 3  57 SER HA   H  -58.595 -19.489  -72.840 1.00 . C C .  57 SER HA   1 1 
        1   6529 3 3  57 SER HB2  H  -58.357 -17.003  -72.015 1.00 . C C .  57 SER HB2  1 1 
        1   6530 3 3  57 SER HB3  H  -58.077 -17.439  -73.697 1.00 . C C .  57 SER HB3  1 1 
        1   6531 3 3  57 SER HG   H  -59.903 -15.785  -72.658 1.00 . C C .  57 SER HG   1 1 
        1   6532 3 3  57 SER N    N  -60.468 -19.041  -73.590 1.00 . C C .  57 SER N    1 1 
        1   6533 3 3  57 SER O    O  -60.986 -18.729  -70.793 1.00 . C C .  57 SER O    1 1 
        1   6534 3 3  57 SER OG   O  -59.864 -16.499  -73.298 1.00 . C C .  57 SER OG   1 1 
        1   6535 3 3  58 THR C    C  -57.907 -18.530  -68.265 1.00 . C C .  58 THR C    1 1 
        1   6536 3 3  58 THR CA   C  -59.056 -19.301  -68.867 1.00 . C C .  58 THR CA   1 1 
        1   6537 3 3  58 THR CB   C  -59.094 -20.706  -68.245 1.00 . C C .  58 THR CB   1 1 
        1   6538 3 3  58 THR CG2  C  -60.255 -21.488  -68.802 1.00 . C C .  58 THR CG2  1 1 
        1   6539 3 3  58 THR H    H  -57.947 -19.491  -70.660 1.00 . C C .  58 THR H    1 1 
        1   6540 3 3  58 THR HA   H  -59.981 -18.786  -68.649 1.00 . C C .  58 THR HA   1 1 
        1   6541 3 3  58 THR HB   H  -59.224 -20.608  -67.177 1.00 . C C .  58 THR HB   1 1 
        1   6542 3 3  58 THR HG1  H  -57.153 -20.736  -68.499 1.00 . C C .  58 THR HG1  1 1 
        1   6543 3 3  58 THR HG21 H  -60.040 -21.775  -69.821 1.00 . C C .  58 THR HG21 1 1 
        1   6544 3 3  58 THR HG22 H  -61.145 -20.876  -68.780 1.00 . C C .  58 THR HG22 1 1 
        1   6545 3 3  58 THR HG23 H  -60.412 -22.374  -68.205 1.00 . C C .  58 THR HG23 1 1 
        1   6546 3 3  58 THR N    N  -58.847 -19.321  -70.313 1.00 . C C .  58 THR N    1 1 
        1   6547 3 3  58 THR O    O  -56.856 -18.455  -68.888 1.00 . C C .  58 THR O    1 1 
        1   6548 3 3  58 THR OG1  O  -57.856 -21.389  -68.496 1.00 . C C .  58 THR OG1  1 1 
        1   6549 3 3  59 TYR C    C  -56.975 -17.595  -64.847 1.00 . C C .  59 TYR C    1 1 
        1   6550 3 3  59 TYR CA   C  -56.980 -17.299  -66.351 1.00 . C C .  59 TYR CA   1 1 
        1   6551 3 3  59 TYR CB   C  -56.995 -15.789  -66.588 1.00 . C C .  59 TYR CB   1 1 
        1   6552 3 3  59 TYR CD1  C  -58.739 -15.243  -68.319 1.00 . C C .  59 TYR CD1  1 1 
        1   6553 3 3  59 TYR CD2  C  -56.449 -15.060  -68.947 1.00 . C C .  59 TYR CD2  1 1 
        1   6554 3 3  59 TYR CE1  C  -59.131 -14.837  -69.607 1.00 . C C .  59 TYR CE1  1 1 
        1   6555 3 3  59 TYR CE2  C  -56.825 -14.651  -70.247 1.00 . C C .  59 TYR CE2  1 1 
        1   6556 3 3  59 TYR CG   C  -57.401 -15.361  -67.978 1.00 . C C .  59 TYR CG   1 1 
        1   6557 3 3  59 TYR CZ   C  -58.174 -14.544  -70.567 1.00 . C C .  59 TYR CZ   1 1 
        1   6558 3 3  59 TYR H    H  -58.960 -18.053  -66.625 1.00 . C C .  59 TYR H    1 1 
        1   6559 3 3  59 TYR HA   H  -56.058 -17.684  -66.760 1.00 . C C .  59 TYR HA   1 1 
        1   6560 3 3  59 TYR HB2  H  -57.680 -15.342  -65.886 1.00 . C C .  59 TYR HB2  1 1 
        1   6561 3 3  59 TYR HB3  H  -56.004 -15.406  -66.385 1.00 . C C .  59 TYR HB3  1 1 
        1   6562 3 3  59 TYR HD1  H  -59.496 -15.472  -67.583 1.00 . C C .  59 TYR HD1  1 1 
        1   6563 3 3  59 TYR HD2  H  -55.401 -15.143  -68.701 1.00 . C C .  59 TYR HD2  1 1 
        1   6564 3 3  59 TYR HE1  H  -60.180 -14.753  -69.849 1.00 . C C .  59 TYR HE1  1 1 
        1   6565 3 3  59 TYR HE2  H  -56.071 -14.425  -70.986 1.00 . C C .  59 TYR HE2  1 1 
        1   6566 3 3  59 TYR HH   H  -58.198 -13.273  -71.996 1.00 . C C .  59 TYR HH   1 1 
        1   6567 3 3  59 TYR N    N  -58.093 -17.958  -67.071 1.00 . C C .  59 TYR N    1 1 
        1   6568 3 3  59 TYR O    O  -58.022 -17.837  -64.245 1.00 . C C .  59 TYR O    1 1 
        1   6569 3 3  59 TYR OH   O  -58.582 -14.136  -71.825 1.00 . C C .  59 TYR OH   1 1 
        1   6570 3 3  60 TYR C    C  -54.623 -17.055  -62.138 1.00 . C C .  60 TYR C    1 1 
        1   6571 3 3  60 TYR CA   C  -55.714 -17.846  -62.808 1.00 . C C .  60 TYR CA   1 1 
        1   6572 3 3  60 TYR CB   C  -55.430 -19.311  -62.508 1.00 . C C .  60 TYR CB   1 1 
        1   6573 3 3  60 TYR CD1  C  -55.845 -20.800  -64.476 1.00 . C C .  60 TYR CD1  1 1 
        1   6574 3 3  60 TYR CD2  C  -57.460 -20.771  -62.733 1.00 . C C .  60 TYR CD2  1 1 
        1   6575 3 3  60 TYR CE1  C  -56.580 -21.717  -65.166 1.00 . C C .  60 TYR CE1  1 1 
        1   6576 3 3  60 TYR CE2  C  -58.209 -21.702  -63.419 1.00 . C C .  60 TYR CE2  1 1 
        1   6577 3 3  60 TYR CG   C  -56.269 -20.300  -63.258 1.00 . C C .  60 TYR CG   1 1 
        1   6578 3 3  60 TYR CZ   C  -57.762 -22.164  -64.646 1.00 . C C .  60 TYR CZ   1 1 
        1   6579 3 3  60 TYR H    H  -54.981 -17.405  -64.754 1.00 . C C .  60 TYR H    1 1 
        1   6580 3 3  60 TYR HA   H  -56.658 -17.585  -62.357 1.00 . C C .  60 TYR HA   1 1 
        1   6581 3 3  60 TYR HB2  H  -54.396 -19.510  -62.739 1.00 . C C .  60 TYR HB2  1 1 
        1   6582 3 3  60 TYR HB3  H  -55.574 -19.471  -61.447 1.00 . C C .  60 TYR HB3  1 1 
        1   6583 3 3  60 TYR HD1  H  -54.917 -20.442  -64.898 1.00 . C C .  60 TYR HD1  1 1 
        1   6584 3 3  60 TYR HD2  H  -57.804 -20.408  -61.776 1.00 . C C .  60 TYR HD2  1 1 
        1   6585 3 3  60 TYR HE1  H  -56.228 -22.093  -66.115 1.00 . C C .  60 TYR HE1  1 1 
        1   6586 3 3  60 TYR HE2  H  -59.143 -22.057  -63.011 1.00 . C C .  60 TYR HE2  1 1 
        1   6587 3 3  60 TYR HH   H  -58.006 -23.267  -66.179 1.00 . C C .  60 TYR HH   1 1 
        1   6588 3 3  60 TYR N    N  -55.796 -17.591  -64.241 1.00 . C C .  60 TYR N    1 1 
        1   6589 3 3  60 TYR O    O  -53.576 -16.816  -62.723 1.00 . C C .  60 TYR O    1 1 
        1   6590 3 3  60 TYR OH   O  -58.490 -23.077  -65.371 1.00 . C C .  60 TYR OH   1 1 
        1   6591 3 3  61 PRO C    C  -52.711 -17.294  -60.035 1.00 . C C .  61 PRO C    1 1 
        1   6592 3 3  61 PRO CA   C  -53.749 -16.196  -60.097 1.00 . C C .  61 PRO CA   1 1 
        1   6593 3 3  61 PRO CB   C  -54.380 -16.047  -58.718 1.00 . C C .  61 PRO CB   1 1 
        1   6594 3 3  61 PRO CD   C  -56.081 -16.732  -60.102 1.00 . C C .  61 PRO CD   1 1 
        1   6595 3 3  61 PRO CG   C  -55.578 -16.932  -58.750 1.00 . C C .  61 PRO CG   1 1 
        1   6596 3 3  61 PRO HA   H  -53.351 -15.261  -60.452 1.00 . C C .  61 PRO HA   1 1 
        1   6597 3 3  61 PRO HB2  H  -53.688 -16.371  -57.953 1.00 . C C .  61 PRO HB2  1 1 
        1   6598 3 3  61 PRO HB3  H  -54.680 -15.025  -58.549 1.00 . C C .  61 PRO HB3  1 1 
        1   6599 3 3  61 PRO HD2  H  -56.696 -17.569  -60.409 1.00 . C C .  61 PRO HD2  1 1 
        1   6600 3 3  61 PRO HD3  H  -56.622 -15.803  -60.180 1.00 . C C .  61 PRO HD3  1 1 
        1   6601 3 3  61 PRO HG2  H  -55.294 -17.964  -58.589 1.00 . C C .  61 PRO HG2  1 1 
        1   6602 3 3  61 PRO HG3  H  -56.311 -16.614  -58.026 1.00 . C C .  61 PRO HG3  1 1 
        1   6603 3 3  61 PRO N    N  -54.846 -16.668  -60.886 1.00 . C C .  61 PRO N    1 1 
        1   6604 3 3  61 PRO O    O  -53.077 -18.485  -60.069 1.00 . C C .  61 PRO O    1 1 
        1   6605 3 3  62 ASP C    C  -50.576 -18.812  -58.521 1.00 . C C .  62 ASP C    1 1 
        1   6606 3 3  62 ASP CA   C  -50.371 -17.889  -59.733 1.00 . C C .  62 ASP CA   1 1 
        1   6607 3 3  62 ASP CB   C  -49.031 -17.190  -59.601 1.00 . C C .  62 ASP CB   1 1 
        1   6608 3 3  62 ASP CG   C  -48.438 -16.810  -60.935 1.00 . C C .  62 ASP CG   1 1 
        1   6609 3 3  62 ASP H    H  -51.225 -15.957  -59.917 1.00 . C C .  62 ASP H    1 1 
        1   6610 3 3  62 ASP HA   H  -50.325 -18.512  -60.613 1.00 . C C .  62 ASP HA   1 1 
        1   6611 3 3  62 ASP HB2  H  -49.162 -16.294  -59.013 1.00 . C C .  62 ASP HB2  1 1 
        1   6612 3 3  62 ASP HB3  H  -48.345 -17.847  -59.085 1.00 . C C .  62 ASP HB3  1 1 
        1   6613 3 3  62 ASP N    N  -51.438 -16.913  -59.941 1.00 . C C .  62 ASP N    1 1 
        1   6614 3 3  62 ASP O    O  -49.999 -19.910  -58.483 1.00 . C C .  62 ASP O    1 1 
        1   6615 3 3  62 ASP OD1  O  -49.041 -17.152  -61.990 1.00 . C C .  62 ASP OD1  1 1 
        1   6616 3 3  62 ASP OD2  O  -47.355 -16.165  -60.925 1.00 . C C .  62 ASP OD2  1 1 
        1   6617 3 3  63 THR C    C  -52.494 -20.361  -56.516 1.00 . C C .  63 THR C    1 1 
        1   6618 3 3  63 THR CA   C  -51.621 -19.142  -56.326 1.00 . C C .  63 THR CA   1 1 
        1   6619 3 3  63 THR CB   C  -52.216 -18.297  -55.209 1.00 . C C .  63 THR CB   1 1 
        1   6620 3 3  63 THR CG2  C  -51.140 -17.420  -54.573 1.00 . C C .  63 THR CG2  1 1 
        1   6621 3 3  63 THR H    H  -51.815 -17.501  -57.647 1.00 . C C .  63 THR H    1 1 
        1   6622 3 3  63 THR HA   H  -50.658 -19.490  -55.982 1.00 . C C .  63 THR HA   1 1 
        1   6623 3 3  63 THR HB   H  -52.627 -18.950  -54.453 1.00 . C C .  63 THR HB   1 1 
        1   6624 3 3  63 THR HG1  H  -52.967 -16.567  -55.697 1.00 . C C .  63 THR HG1  1 1 
        1   6625 3 3  63 THR HG21 H  -50.936 -16.577  -55.216 1.00 . C C .  63 THR HG21 1 1 
        1   6626 3 3  63 THR HG22 H  -50.237 -17.998  -54.441 1.00 . C C .  63 THR HG22 1 1 
        1   6627 3 3  63 THR HG23 H  -51.484 -17.066  -53.613 1.00 . C C .  63 THR HG23 1 1 
        1   6628 3 3  63 THR N    N  -51.388 -18.378  -57.549 1.00 . C C .  63 THR N    1 1 
        1   6629 3 3  63 THR O    O  -52.478 -21.257  -55.677 1.00 . C C .  63 THR O    1 1 
        1   6630 3 3  63 THR OG1  O  -53.258 -17.481  -55.736 1.00 . C C .  63 THR OG1  1 1 
        1   6631 3 3  64 VAL C    C  -53.548 -22.203  -59.342 1.00 . C C .  64 VAL C    1 1 
        1   6632 3 3  64 VAL CA   C  -53.890 -21.701  -57.936 1.00 . C C .  64 VAL CA   1 1 
        1   6633 3 3  64 VAL CB   C  -55.446 -21.772  -57.639 1.00 . C C .  64 VAL CB   1 1 
        1   6634 3 3  64 VAL CG1  C  -55.707 -21.733  -56.165 1.00 . C C .  64 VAL CG1  1 1 
        1   6635 3 3  64 VAL CG2  C  -56.245 -20.680  -58.336 1.00 . C C .  64 VAL CG2  1 1 
        1   6636 3 3  64 VAL H    H  -53.247 -19.689  -58.249 1.00 . C C .  64 VAL H    1 1 
        1   6637 3 3  64 VAL HA   H  -53.434 -22.419  -57.266 1.00 . C C .  64 VAL HA   1 1 
        1   6638 3 3  64 VAL HB   H  -55.799 -22.730  -58.002 1.00 . C C .  64 VAL HB   1 1 
        1   6639 3 3  64 VAL HG11 H  -56.757 -21.556  -55.989 1.00 . C C .  64 VAL HG11 1 1 
        1   6640 3 3  64 VAL HG12 H  -55.128 -20.938  -55.718 1.00 . C C .  64 VAL HG12 1 1 
        1   6641 3 3  64 VAL HG13 H  -55.423 -22.677  -55.724 1.00 . C C .  64 VAL HG13 1 1 
        1   6642 3 3  64 VAL HG21 H  -56.244 -19.788  -57.727 1.00 . C C .  64 VAL HG21 1 1 
        1   6643 3 3  64 VAL HG22 H  -57.262 -21.015  -58.482 1.00 . C C .  64 VAL HG22 1 1 
        1   6644 3 3  64 VAL HG23 H  -55.797 -20.462  -59.294 1.00 . C C .  64 VAL HG23 1 1 
        1   6645 3 3  64 VAL N    N  -53.258 -20.421  -57.597 1.00 . C C .  64 VAL N    1 1 
        1   6646 3 3  64 VAL O    O  -53.948 -23.304  -59.726 1.00 . C C .  64 VAL O    1 1 
        1   6647 3 3  65 LYS C    C  -51.796 -23.181  -61.350 1.00 . C C .  65 LYS C    1 1 
        1   6648 3 3  65 LYS CA   C  -52.471 -21.839  -61.461 1.00 . C C .  65 LYS CA   1 1 
        1   6649 3 3  65 LYS CB   C  -51.552 -20.849  -62.168 1.00 . C C .  65 LYS CB   1 1 
        1   6650 3 3  65 LYS CD   C  -50.153 -20.476  -64.245 1.00 . C C .  65 LYS CD   1 1 
        1   6651 3 3  65 LYS CE   C  -50.091 -18.947  -64.337 1.00 . C C .  65 LYS CE   1 1 
        1   6652 3 3  65 LYS CG   C  -51.475 -21.020  -63.680 1.00 . C C .  65 LYS CG   1 1 
        1   6653 3 3  65 LYS H    H  -52.498 -20.542  -59.774 1.00 . C C .  65 LYS H    1 1 
        1   6654 3 3  65 LYS HA   H  -53.383 -21.950  -62.031 1.00 . C C .  65 LYS HA   1 1 
        1   6655 3 3  65 LYS HB2  H  -51.902 -19.850  -61.960 1.00 . C C .  65 LYS HB2  1 1 
        1   6656 3 3  65 LYS HB3  H  -50.558 -20.954  -61.757 1.00 . C C .  65 LYS HB3  1 1 
        1   6657 3 3  65 LYS HD2  H  -49.346 -20.811  -63.612 1.00 . C C .  65 LYS HD2  1 1 
        1   6658 3 3  65 LYS HD3  H  -50.007 -20.890  -65.233 1.00 . C C .  65 LYS HD3  1 1 
        1   6659 3 3  65 LYS HE2  H  -50.359 -18.525  -63.381 1.00 . C C .  65 LYS HE2  1 1 
        1   6660 3 3  65 LYS HE3  H  -49.082 -18.649  -64.583 1.00 . C C .  65 LYS HE3  1 1 
        1   6661 3 3  65 LYS HG2  H  -51.555 -22.070  -63.920 1.00 . C C .  65 LYS HG2  1 1 
        1   6662 3 3  65 LYS HG3  H  -52.298 -20.490  -64.137 1.00 . C C .  65 LYS HG3  1 1 
        1   6663 3 3  65 LYS HZ1  H  -51.901 -18.972  -65.342 1.00 . C C .  65 LYS HZ1  1 1 
        1   6664 3 3  65 LYS HZ2  H  -50.575 -18.520  -66.304 1.00 . C C .  65 LYS HZ2  1 1 
        1   6665 3 3  65 LYS HZ3  H  -51.221 -17.428  -65.174 1.00 . C C .  65 LYS HZ3  1 1 
        1   6666 3 3  65 LYS N    N  -52.806 -21.410  -60.109 1.00 . C C .  65 LYS N    1 1 
        1   6667 3 3  65 LYS NZ   N  -51.015 -18.428  -65.365 1.00 . C C .  65 LYS NZ   1 1 
        1   6668 3 3  65 LYS O    O  -50.837 -23.346  -60.593 1.00 . C C .  65 LYS O    1 1 
        1   6669 3 3  66 GLY C    C  -52.731 -26.463  -61.315 1.00 . C C .  66 GLY C    1 1 
        1   6670 3 3  66 GLY CA   C  -51.829 -25.510  -62.071 1.00 . C C .  66 GLY CA   1 1 
        1   6671 3 3  66 GLY H    H  -53.111 -23.930  -62.644 1.00 . C C .  66 GLY H    1 1 
        1   6672 3 3  66 GLY HA2  H  -51.733 -25.857  -63.089 1.00 . C C .  66 GLY HA2  1 1 
        1   6673 3 3  66 GLY HA3  H  -50.852 -25.514  -61.609 1.00 . C C .  66 GLY HA3  1 1 
        1   6674 3 3  66 GLY N    N  -52.332 -24.141  -62.088 1.00 . C C .  66 GLY N    1 1 
        1   6675 3 3  66 GLY O    O  -52.946 -27.587  -61.758 1.00 . C C .  66 GLY O    1 1 
        1   6676 3 3  67 ARG C    C  -55.539 -26.704  -59.494 1.00 . C C .  67 ARG C    1 1 
        1   6677 3 3  67 ARG CA   C  -54.047 -26.856  -59.283 1.00 . C C .  67 ARG CA   1 1 
        1   6678 3 3  67 ARG CB   C  -53.708 -26.551  -57.817 1.00 . C C .  67 ARG CB   1 1 
        1   6679 3 3  67 ARG CD   C  -51.885 -26.579  -56.010 1.00 . C C .  67 ARG CD   1 1 
        1   6680 3 3  67 ARG CG   C  -52.200 -26.383  -57.503 1.00 . C C .  67 ARG CG   1 1 
        1   6681 3 3  67 ARG CZ   C  -53.106 -24.854  -54.750 1.00 . C C .  67 ARG CZ   1 1 
        1   6682 3 3  67 ARG H    H  -53.061 -25.093  -59.900 1.00 . C C .  67 ARG H    1 1 
        1   6683 3 3  67 ARG HA   H  -53.783 -27.884  -59.479 1.00 . C C .  67 ARG HA   1 1 
        1   6684 3 3  67 ARG HB2  H  -54.210 -25.638  -57.537 1.00 . C C .  67 ARG HB2  1 1 
        1   6685 3 3  67 ARG HB3  H  -54.099 -27.353  -57.206 1.00 . C C .  67 ARG HB3  1 1 
        1   6686 3 3  67 ARG HD2  H  -51.722 -27.627  -55.815 1.00 . C C .  67 ARG HD2  1 1 
        1   6687 3 3  67 ARG HD3  H  -50.988 -26.029  -55.762 1.00 . C C .  67 ARG HD3  1 1 
        1   6688 3 3  67 ARG HE   H  -53.685 -26.746  -54.926 1.00 . C C .  67 ARG HE   1 1 
        1   6689 3 3  67 ARG HG2  H  -51.641 -27.108  -58.074 1.00 . C C .  67 ARG HG2  1 1 
        1   6690 3 3  67 ARG HG3  H  -51.890 -25.391  -57.800 1.00 . C C .  67 ARG HG3  1 1 
        1   6691 3 3  67 ARG HH11 H  -51.381 -24.235  -55.612 1.00 . C C .  67 ARG HH11 1 1 
        1   6692 3 3  67 ARG HH12 H  -52.251 -23.018  -54.739 1.00 . C C .  67 ARG HH12 1 1 
        1   6693 3 3  67 ARG HH21 H  -54.846 -25.175  -53.775 1.00 . C C .  67 ARG HH21 1 1 
        1   6694 3 3  67 ARG HH22 H  -54.235 -23.557  -53.689 1.00 . C C .  67 ARG HH22 1 1 
        1   6695 3 3  67 ARG N    N  -53.269 -26.008  -60.182 1.00 . C C .  67 ARG N    1 1 
        1   6696 3 3  67 ARG NE   N  -52.989 -26.104  -55.178 1.00 . C C .  67 ARG NE   1 1 
        1   6697 3 3  67 ARG NH1  N  -52.168 -23.962  -55.060 1.00 . C C .  67 ARG NH1  1 1 
        1   6698 3 3  67 ARG NH2  N  -54.147 -24.500  -54.011 1.00 . C C .  67 ARG NH2  1 1 
        1   6699 3 3  67 ARG O    O  -56.314 -27.466  -58.934 1.00 . C C .  67 ARG O    1 1 
        1   6700 3 3  68 PHE C    C  -57.829 -25.153  -61.908 1.00 . C C .  68 PHE C    1 1 
        1   6701 3 3  68 PHE CA   C  -57.358 -25.326  -60.441 1.00 . C C .  68 PHE CA   1 1 
        1   6702 3 3  68 PHE CB   C  -57.600 -24.048  -59.641 1.00 . C C .  68 PHE CB   1 1 
        1   6703 3 3  68 PHE CD1  C  -57.162 -25.303  -57.502 1.00 . C C .  68 PHE CD1  1 1 
        1   6704 3 3  68 PHE CD2  C  -58.603 -23.417  -57.430 1.00 . C C .  68 PHE CD2  1 1 
        1   6705 3 3  68 PHE CE1  C  -57.345 -25.497  -56.128 1.00 . C C .  68 PHE CE1  1 1 
        1   6706 3 3  68 PHE CE2  C  -58.789 -23.598  -56.058 1.00 . C C .  68 PHE CE2  1 1 
        1   6707 3 3  68 PHE CG   C  -57.795 -24.270  -58.164 1.00 . C C .  68 PHE CG   1 1 
        1   6708 3 3  68 PHE CZ   C  -58.159 -24.639  -55.408 1.00 . C C .  68 PHE CZ   1 1 
        1   6709 3 3  68 PHE H    H  -55.256 -25.157  -60.717 1.00 . C C .  68 PHE H    1 1 
        1   6710 3 3  68 PHE HA   H  -57.959 -26.106  -59.998 1.00 . C C .  68 PHE HA   1 1 
        1   6711 3 3  68 PHE HB2  H  -56.753 -23.394  -59.776 1.00 . C C .  68 PHE HB2  1 1 
        1   6712 3 3  68 PHE HB3  H  -58.478 -23.557  -60.039 1.00 . C C .  68 PHE HB3  1 1 
        1   6713 3 3  68 PHE HD1  H  -56.528 -25.979  -58.055 1.00 . C C .  68 PHE HD1  1 1 
        1   6714 3 3  68 PHE HD2  H  -59.101 -22.599  -57.929 1.00 . C C .  68 PHE HD2  1 1 
        1   6715 3 3  68 PHE HE1  H  -56.842 -26.311  -55.627 1.00 . C C .  68 PHE HE1  1 1 
        1   6716 3 3  68 PHE HE2  H  -59.426 -22.923  -55.506 1.00 . C C .  68 PHE HE2  1 1 
        1   6717 3 3  68 PHE HZ   H  -58.303 -24.786  -54.348 1.00 . C C .  68 PHE HZ   1 1 
        1   6718 3 3  68 PHE N    N  -55.939 -25.724  -60.301 1.00 . C C .  68 PHE N    1 1 
        1   6719 3 3  68 PHE O    O  -57.039 -24.764  -62.773 1.00 . C C .  68 PHE O    1 1 
        1   6720 3 3  69 THR C    C  -60.995 -25.107  -63.900 1.00 . C C .  69 THR C    1 1 
        1   6721 3 3  69 THR CA   C  -59.556 -25.596  -63.591 1.00 . C C .  69 THR CA   1 1 
        1   6722 3 3  69 THR CB   C  -59.402 -27.065  -64.059 1.00 . C C .  69 THR CB   1 1 
        1   6723 3 3  69 THR CG2  C  -59.059 -27.130  -65.537 1.00 . C C .  69 THR CG2  1 1 
        1   6724 3 3  69 THR H    H  -59.690 -25.746  -61.465 1.00 . C C .  69 THR H    1 1 
        1   6725 3 3  69 THR HA   H  -58.889 -25.005  -64.199 1.00 . C C .  69 THR HA   1 1 
        1   6726 3 3  69 THR HB   H  -60.339 -27.578  -63.898 1.00 . C C .  69 THR HB   1 1 
        1   6727 3 3  69 THR HG1  H  -58.047 -27.095  -62.643 1.00 . C C .  69 THR HG1  1 1 
        1   6728 3 3  69 THR HG21 H  -58.952 -28.162  -65.837 1.00 . C C .  69 THR HG21 1 1 
        1   6729 3 3  69 THR HG22 H  -58.132 -26.605  -65.715 1.00 . C C .  69 THR HG22 1 1 
        1   6730 3 3  69 THR HG23 H  -59.850 -26.670  -66.111 1.00 . C C .  69 THR HG23 1 1 
        1   6731 3 3  69 THR N    N  -59.103 -25.442  -62.189 1.00 . C C .  69 THR N    1 1 
        1   6732 3 3  69 THR O    O  -61.989 -25.814  -63.663 1.00 . C C .  69 THR O    1 1 
        1   6733 3 3  69 THR OG1  O  -58.382 -27.722  -63.288 1.00 . C C .  69 THR OG1  1 1 
        1   6734 3 3  70 ILE C    C  -63.073 -23.704  -65.918 1.00 . C C .  70 ILE C    1 1 
        1   6735 3 3  70 ILE CA   C  -62.397 -23.288  -64.611 1.00 . C C .  70 ILE CA   1 1 
        1   6736 3 3  70 ILE CB   C  -62.322 -21.738  -64.419 1.00 . C C .  70 ILE CB   1 1 
        1   6737 3 3  70 ILE CD1  C  -63.873 -19.749  -63.917 1.00 . C C .  70 ILE CD1  1 1 
        1   6738 3 3  70 ILE CG1  C  -63.709 -21.104  -64.571 1.00 . C C .  70 ILE CG1  1 1 
        1   6739 3 3  70 ILE CG2  C  -61.305 -21.091  -65.356 1.00 . C C .  70 ILE CG2  1 1 
        1   6740 3 3  70 ILE H    H  -60.292 -23.389  -64.644 1.00 . C C .  70 ILE H    1 1 
        1   6741 3 3  70 ILE HA   H  -63.017 -23.672  -63.813 1.00 . C C .  70 ILE HA   1 1 
        1   6742 3 3  70 ILE HB   H  -61.984 -21.557  -63.406 1.00 . C C .  70 ILE HB   1 1 
        1   6743 3 3  70 ILE HD11 H  -63.419 -18.992  -64.539 1.00 . C C .  70 ILE HD11 1 1 
        1   6744 3 3  70 ILE HD12 H  -63.393 -19.756  -62.949 1.00 . C C .  70 ILE HD12 1 1 
        1   6745 3 3  70 ILE HD13 H  -64.924 -19.532  -63.796 1.00 . C C .  70 ILE HD13 1 1 
        1   6746 3 3  70 ILE HG12 H  -63.920 -20.995  -65.622 1.00 . C C .  70 ILE HG12 1 1 
        1   6747 3 3  70 ILE HG13 H  -64.439 -21.782  -64.148 1.00 . C C .  70 ILE HG13 1 1 
        1   6748 3 3  70 ILE HG21 H  -60.760 -20.326  -64.822 1.00 . C C .  70 ILE HG21 1 1 
        1   6749 3 3  70 ILE HG22 H  -61.821 -20.646  -66.195 1.00 . C C .  70 ILE HG22 1 1 
        1   6750 3 3  70 ILE HG23 H  -60.616 -21.841  -65.714 1.00 . C C .  70 ILE HG23 1 1 
        1   6751 3 3  70 ILE N    N  -61.102 -23.908  -64.454 1.00 . C C .  70 ILE N    1 1 
        1   6752 3 3  70 ILE O    O  -62.947 -23.041  -66.937 1.00 . C C .  70 ILE O    1 1 
        1   6753 3 3  71 SER C    C  -65.998 -24.728  -67.018 1.00 . C C .  71 SER C    1 1 
        1   6754 3 3  71 SER CA   C  -64.551 -25.228  -67.079 1.00 . C C .  71 SER CA   1 1 
        1   6755 3 3  71 SER CB   C  -64.519 -26.746  -67.231 1.00 . C C .  71 SER CB   1 1 
        1   6756 3 3  71 SER H    H  -63.872 -25.326  -65.063 1.00 . C C .  71 SER H    1 1 
        1   6757 3 3  71 SER HA   H  -64.081 -24.791  -67.948 1.00 . C C .  71 SER HA   1 1 
        1   6758 3 3  71 SER HB2  H  -65.107 -27.031  -68.087 1.00 . C C .  71 SER HB2  1 1 
        1   6759 3 3  71 SER HB3  H  -63.495 -27.063  -67.387 1.00 . C C .  71 SER HB3  1 1 
        1   6760 3 3  71 SER HG   H  -64.585 -27.041  -65.312 1.00 . C C .  71 SER HG   1 1 
        1   6761 3 3  71 SER N    N  -63.794 -24.814  -65.895 1.00 . C C .  71 SER N    1 1 
        1   6762 3 3  71 SER O    O  -66.468 -24.288  -65.955 1.00 . C C .  71 SER O    1 1 
        1   6763 3 3  71 SER OG   O  -65.049 -27.382  -66.080 1.00 . C C .  71 SER OG   1 1 
        1   6764 3 3  72 ARG C    C  -68.810 -25.400  -69.245 1.00 . C C .  72 ARG C    1 1 
        1   6765 3 3  72 ARG CA   C  -68.122 -24.479  -68.248 1.00 . C C .  72 ARG CA   1 1 
        1   6766 3 3  72 ARG CB   C  -68.394 -23.018  -68.623 1.00 . C C .  72 ARG CB   1 1 
        1   6767 3 3  72 ARG CD   C  -68.081 -21.225  -70.362 1.00 . C C .  72 ARG CD   1 1 
        1   6768 3 3  72 ARG CG   C  -68.269 -22.717  -70.107 1.00 . C C .  72 ARG CG   1 1 
        1   6769 3 3  72 ARG CZ   C  -69.369 -19.120  -70.136 1.00 . C C .  72 ARG CZ   1 1 
        1   6770 3 3  72 ARG H    H  -66.227 -25.112  -68.966 1.00 . C C .  72 ARG H    1 1 
        1   6771 3 3  72 ARG HA   H  -68.554 -24.662  -67.274 1.00 . C C .  72 ARG HA   1 1 
        1   6772 3 3  72 ARG HB2  H  -69.393 -22.763  -68.309 1.00 . C C .  72 ARG HB2  1 1 
        1   6773 3 3  72 ARG HB3  H  -67.696 -22.392  -68.083 1.00 . C C .  72 ARG HB3  1 1 
        1   6774 3 3  72 ARG HD2  H  -67.350 -20.845  -69.666 1.00 . C C .  72 ARG HD2  1 1 
        1   6775 3 3  72 ARG HD3  H  -67.701 -21.092  -71.366 1.00 . C C .  72 ARG HD3  1 1 
        1   6776 3 3  72 ARG HE   H  -70.157 -20.944  -70.162 1.00 . C C .  72 ARG HE   1 1 
        1   6777 3 3  72 ARG HG2  H  -67.420 -23.252  -70.505 1.00 . C C .  72 ARG HG2  1 1 
        1   6778 3 3  72 ARG HG3  H  -69.165 -23.051  -70.610 1.00 . C C .  72 ARG HG3  1 1 
        1   6779 3 3  72 ARG HH11 H  -67.373 -18.835  -70.283 1.00 . C C .  72 ARG HH11 1 1 
        1   6780 3 3  72 ARG HH12 H  -68.319 -17.392  -70.130 1.00 . C C .  72 ARG HH12 1 1 
        1   6781 3 3  72 ARG HH21 H  -71.382 -19.066  -69.957 1.00 . C C .  72 ARG HH21 1 1 
        1   6782 3 3  72 ARG HH22 H  -70.594 -17.523  -69.945 1.00 . C C .  72 ARG HH22 1 1 
        1   6783 3 3  72 ARG N    N  -66.680 -24.772  -68.166 1.00 . C C .  72 ARG N    1 1 
        1   6784 3 3  72 ARG NE   N  -69.312 -20.449  -70.211 1.00 . C C .  72 ARG NE   1 1 
        1   6785 3 3  72 ARG NH1  N  -68.263 -18.389  -70.187 1.00 . C C .  72 ARG NH1  1 1 
        1   6786 3 3  72 ARG NH2  N  -70.545 -18.521  -70.002 1.00 . C C .  72 ARG NH2  1 1 
        1   6787 3 3  72 ARG O    O  -68.167 -25.967  -70.131 1.00 . C C .  72 ARG O    1 1 
        1   6788 3 3  73 ASP C    C  -72.247 -25.603  -70.181 1.00 . C C .  73 ASP C    1 1 
        1   6789 3 3  73 ASP CA   C  -70.924 -26.330  -69.995 1.00 . C C .  73 ASP CA   1 1 
        1   6790 3 3  73 ASP CB   C  -71.124 -27.740  -69.420 1.00 . C C .  73 ASP CB   1 1 
        1   6791 3 3  73 ASP CG   C  -72.156 -28.552  -70.193 1.00 . C C .  73 ASP CG   1 1 
        1   6792 3 3  73 ASP H    H  -70.565 -25.048  -68.369 1.00 . C C .  73 ASP H    1 1 
        1   6793 3 3  73 ASP HA   H  -70.422 -26.400  -70.950 1.00 . C C .  73 ASP HA   1 1 
        1   6794 3 3  73 ASP HB2  H  -70.182 -28.266  -69.432 1.00 . C C .  73 ASP HB2  1 1 
        1   6795 3 3  73 ASP HB3  H  -71.455 -27.646  -68.396 1.00 . C C .  73 ASP HB3  1 1 
        1   6796 3 3  73 ASP N    N  -70.121 -25.535  -69.095 1.00 . C C .  73 ASP N    1 1 
        1   6797 3 3  73 ASP O    O  -73.161 -25.716  -69.359 1.00 . C C .  73 ASP O    1 1 
        1   6798 3 3  73 ASP OD1  O  -72.027 -28.611  -71.445 1.00 . C C .  73 ASP OD1  1 1 
        1   6799 3 3  73 ASP OD2  O  -73.087 -29.119  -69.546 1.00 . C C .  73 ASP OD2  1 1 
        1   6800 3 3  74 ASN C    C  -74.616 -24.946  -72.196 1.00 . C C .  74 ASN C    1 1 
        1   6801 3 3  74 ASN CA   C  -73.535 -24.045  -71.574 1.00 . C C .  74 ASN CA   1 1 
        1   6802 3 3  74 ASN CB   C  -73.191 -22.885  -72.519 1.00 . C C .  74 ASN CB   1 1 
        1   6803 3 3  74 ASN CG   C  -71.699 -22.721  -72.712 1.00 . C C .  74 ASN CG   1 1 
        1   6804 3 3  74 ASN H    H  -71.557 -24.768  -71.855 1.00 . C C .  74 ASN H    1 1 
        1   6805 3 3  74 ASN HA   H  -73.925 -23.633  -70.654 1.00 . C C .  74 ASN HA   1 1 
        1   6806 3 3  74 ASN HB2  H  -73.647 -23.068  -73.479 1.00 . C C .  74 ASN HB2  1 1 
        1   6807 3 3  74 ASN HB3  H  -73.595 -21.970  -72.109 1.00 . C C .  74 ASN HB3  1 1 
        1   6808 3 3  74 ASN HD21 H  -71.889 -20.745  -72.980 1.00 . C C .  74 ASN HD21 1 1 
        1   6809 3 3  74 ASN HD22 H  -70.300 -21.334  -73.074 1.00 . C C .  74 ASN HD22 1 1 
        1   6810 3 3  74 ASN N    N  -72.330 -24.828  -71.256 1.00 . C C .  74 ASN N    1 1 
        1   6811 3 3  74 ASN ND2  N  -71.258 -21.493  -72.942 1.00 . C C .  74 ASN ND2  1 1 
        1   6812 3 3  74 ASN O    O  -75.629 -24.468  -72.735 1.00 . C C .  74 ASN O    1 1 
        1   6813 3 3  74 ASN OD1  O  -70.949 -23.697  -72.653 1.00 . C C .  74 ASN OD1  1 1 
        1   6814 3 3  75 ALA C    C  -76.257 -27.282  -71.199 1.00 . C C .  75 ALA C    1 1 
        1   6815 3 3  75 ALA CA   C  -75.395 -27.213  -72.453 1.00 . C C .  75 ALA CA   1 1 
        1   6816 3 3  75 ALA CB   C  -74.783 -28.557  -72.781 1.00 . C C .  75 ALA CB   1 1 
        1   6817 3 3  75 ALA H    H  -73.538 -26.563  -71.734 1.00 . C C .  75 ALA H    1 1 
        1   6818 3 3  75 ALA HA   H  -75.989 -26.861  -73.286 1.00 . C C .  75 ALA HA   1 1 
        1   6819 3 3  75 ALA HB1  H  -73.767 -28.590  -72.414 1.00 . C C .  75 ALA HB1  1 1 
        1   6820 3 3  75 ALA HB2  H  -74.784 -28.702  -73.851 1.00 . C C .  75 ALA HB2  1 1 
        1   6821 3 3  75 ALA HB3  H  -75.359 -29.340  -72.311 1.00 . C C .  75 ALA HB3  1 1 
        1   6822 3 3  75 ALA N    N  -74.370 -26.253  -72.147 1.00 . C C .  75 ALA N    1 1 
        1   6823 3 3  75 ALA O    O  -77.450 -26.948  -71.221 1.00 . C C .  75 ALA O    1 1 
        1   6824 3 3  76 LYS C    C  -76.201 -26.497  -67.958 1.00 . C C .  76 LYS C    1 1 
        1   6825 3 3  76 LYS CA   C  -76.380 -27.729  -68.842 1.00 . C C .  76 LYS CA   1 1 
        1   6826 3 3  76 LYS CB   C  -76.101 -29.051  -68.118 1.00 . C C .  76 LYS CB   1 1 
        1   6827 3 3  76 LYS CD   C  -78.062 -30.049  -69.569 1.00 . C C .  76 LYS CD   1 1 
        1   6828 3 3  76 LYS CE   C  -79.533 -30.518  -69.420 1.00 . C C .  76 LYS CE   1 1 
        1   6829 3 3  76 LYS CG   C  -77.285 -30.057  -68.204 1.00 . C C .  76 LYS CG   1 1 
        1   6830 3 3  76 LYS H    H  -74.688 -27.886  -70.106 1.00 . C C .  76 LYS H    1 1 
        1   6831 3 3  76 LYS HA   H  -77.426 -27.746  -69.115 1.00 . C C .  76 LYS HA   1 1 
        1   6832 3 3  76 LYS HB2  H  -75.226 -29.508  -68.555 1.00 . C C .  76 LYS HB2  1 1 
        1   6833 3 3  76 LYS HB3  H  -75.899 -28.840  -67.077 1.00 . C C .  76 LYS HB3  1 1 
        1   6834 3 3  76 LYS HD2  H  -78.056 -29.046  -69.968 1.00 . C C .  76 LYS HD2  1 1 
        1   6835 3 3  76 LYS HD3  H  -77.553 -30.702  -70.263 1.00 . C C .  76 LYS HD3  1 1 
        1   6836 3 3  76 LYS HE2  H  -79.871 -30.908  -70.367 1.00 . C C .  76 LYS HE2  1 1 
        1   6837 3 3  76 LYS HE3  H  -79.572 -31.310  -68.685 1.00 . C C .  76 LYS HE3  1 1 
        1   6838 3 3  76 LYS HG2  H  -76.900 -31.052  -68.042 1.00 . C C .  76 LYS HG2  1 1 
        1   6839 3 3  76 LYS HG3  H  -77.983 -29.830  -67.410 1.00 . C C .  76 LYS HG3  1 1 
        1   6840 3 3  76 LYS HZ1  H  -80.339 -28.601  -69.636 1.00 . C C .  76 LYS HZ1  1 1 
        1   6841 3 3  76 LYS HZ2  H  -80.234 -29.128  -68.024 1.00 . C C .  76 LYS HZ2  1 1 
        1   6842 3 3  76 LYS HZ3  H  -81.441 -29.748  -69.047 1.00 . C C .  76 LYS HZ3  1 1 
        1   6843 3 3  76 LYS N    N  -75.643 -27.666  -70.089 1.00 . C C .  76 LYS N    1 1 
        1   6844 3 3  76 LYS NZ   N  -80.457 -29.414  -69.000 1.00 . C C .  76 LYS NZ   1 1 
        1   6845 3 3  76 LYS O    O  -76.425 -26.545  -66.748 1.00 . C C .  76 LYS O    1 1 
        1   6846 3 3  77 ASN C    C  -74.937 -23.911  -66.691 1.00 . C C .  77 ASN C    1 1 
        1   6847 3 3  77 ASN CA   C  -75.801 -24.073  -67.946 1.00 . C C .  77 ASN CA   1 1 
        1   6848 3 3  77 ASN CB   C  -77.234 -23.616  -67.667 1.00 . C C .  77 ASN CB   1 1 
        1   6849 3 3  77 ASN CG   C  -77.631 -22.421  -68.507 1.00 . C C .  77 ASN CG   1 1 
        1   6850 3 3  77 ASN H    H  -75.664 -25.431  -69.553 1.00 . C C .  77 ASN H    1 1 
        1   6851 3 3  77 ASN HA   H  -75.403 -23.385  -68.676 1.00 . C C .  77 ASN HA   1 1 
        1   6852 3 3  77 ASN HB2  H  -77.909 -24.430  -67.880 1.00 . C C .  77 ASN HB2  1 1 
        1   6853 3 3  77 ASN HB3  H  -77.319 -23.356  -66.622 1.00 . C C .  77 ASN HB3  1 1 
        1   6854 3 3  77 ASN HD21 H  -78.779 -21.735  -67.016 1.00 . C C .  77 ASN HD21 1 1 
        1   6855 3 3  77 ASN HD22 H  -78.763 -20.771  -68.413 1.00 . C C .  77 ASN HD22 1 1 
        1   6856 3 3  77 ASN N    N  -75.812 -25.387  -68.586 1.00 . C C .  77 ASN N    1 1 
        1   6857 3 3  77 ASN ND2  N  -78.463 -21.568  -67.929 1.00 . C C .  77 ASN ND2  1 1 
        1   6858 3 3  77 ASN O    O  -74.973 -22.877  -66.010 1.00 . C C .  77 ASN O    1 1 
        1   6859 3 3  77 ASN OD1  O  -77.188 -22.250  -69.658 1.00 . C C .  77 ASN OD1  1 1 
        1   6860 3 3  78 THR C    C  -71.910 -24.300  -65.505 1.00 . C C .  78 THR C    1 1 
        1   6861 3 3  78 THR CA   C  -73.294 -24.936  -65.217 1.00 . C C .  78 THR CA   1 1 
        1   6862 3 3  78 THR CB   C  -73.122 -26.382  -64.624 1.00 . C C .  78 THR CB   1 1 
        1   6863 3 3  78 THR CG2  C  -74.485 -27.103  -64.416 1.00 . C C .  78 THR CG2  1 1 
        1   6864 3 3  78 THR H    H  -74.154 -25.723  -66.984 1.00 . C C .  78 THR H    1 1 
        1   6865 3 3  78 THR HA   H  -73.780 -24.330  -64.466 1.00 . C C .  78 THR HA   1 1 
        1   6866 3 3  78 THR HB   H  -72.624 -26.302  -63.668 1.00 . C C .  78 THR HB   1 1 
        1   6867 3 3  78 THR HG1  H  -71.407 -26.807  -65.454 1.00 . C C .  78 THR HG1  1 1 
        1   6868 3 3  78 THR HG21 H  -75.111 -26.947  -65.283 1.00 . C C .  78 THR HG21 1 1 
        1   6869 3 3  78 THR HG22 H  -74.976 -26.701  -63.542 1.00 . C C .  78 THR HG22 1 1 
        1   6870 3 3  78 THR HG23 H  -74.316 -28.161  -64.279 1.00 . C C .  78 THR HG23 1 1 
        1   6871 3 3  78 THR N    N  -74.148 -24.936  -66.400 1.00 . C C .  78 THR N    1 1 
        1   6872 3 3  78 THR O    O  -71.393 -24.359  -66.635 1.00 . C C .  78 THR O    1 1 
        1   6873 3 3  78 THR OG1  O  -72.300 -27.156  -65.499 1.00 . C C .  78 THR OG1  1 1 
        1   6874 3 3  79 LEU C    C  -69.268 -24.324  -63.571 1.00 . C C .  79 LEU C    1 1 
        1   6875 3 3  79 LEU CA   C  -69.935 -23.301  -64.471 1.00 . C C .  79 LEU CA   1 1 
        1   6876 3 3  79 LEU CB   C  -69.743 -21.882  -63.927 1.00 . C C .  79 LEU CB   1 1 
        1   6877 3 3  79 LEU CD1  C  -67.426 -21.289  -64.753 1.00 . C C .  79 LEU CD1  1 1 
        1   6878 3 3  79 LEU CD2  C  -68.464 -20.038  -62.892 1.00 . C C .  79 LEU CD2  1 1 
        1   6879 3 3  79 LEU CG   C  -68.347 -21.377  -63.560 1.00 . C C .  79 LEU CG   1 1 
        1   6880 3 3  79 LEU H    H  -71.834 -23.632  -63.634 1.00 . C C .  79 LEU H    1 1 
        1   6881 3 3  79 LEU HA   H  -69.530 -23.374  -65.471 1.00 . C C .  79 LEU HA   1 1 
        1   6882 3 3  79 LEU HB2  H  -70.134 -21.202  -64.663 1.00 . C C .  79 LEU HB2  1 1 
        1   6883 3 3  79 LEU HB3  H  -70.369 -21.794  -63.047 1.00 . C C .  79 LEU HB3  1 1 
        1   6884 3 3  79 LEU HD11 H  -66.450 -20.960  -64.430 1.00 . C C .  79 LEU HD11 1 1 
        1   6885 3 3  79 LEU HD12 H  -67.827 -20.583  -65.465 1.00 . C C .  79 LEU HD12 1 1 
        1   6886 3 3  79 LEU HD13 H  -67.343 -22.261  -65.216 1.00 . C C .  79 LEU HD13 1 1 
        1   6887 3 3  79 LEU HD21 H  -68.828 -20.169  -61.884 1.00 . C C .  79 LEU HD21 1 1 
        1   6888 3 3  79 LEU HD22 H  -69.154 -19.419  -63.447 1.00 . C C .  79 LEU HD22 1 1 
        1   6889 3 3  79 LEU HD23 H  -67.495 -19.562  -62.865 1.00 . C C .  79 LEU HD23 1 1 
        1   6890 3 3  79 LEU HG   H  -67.914 -22.071  -62.853 1.00 . C C .  79 LEU HG   1 1 
        1   6891 3 3  79 LEU N    N  -71.346 -23.663  -64.483 1.00 . C C .  79 LEU N    1 1 
        1   6892 3 3  79 LEU O    O  -69.928 -24.912  -62.721 1.00 . C C .  79 LEU O    1 1 
        1   6893 3 3  80 TYR C    C  -65.979 -25.005  -62.354 1.00 . C C .  80 TYR C    1 1 
        1   6894 3 3  80 TYR CA   C  -67.304 -25.511  -62.880 1.00 . C C .  80 TYR CA   1 1 
        1   6895 3 3  80 TYR CB   C  -67.045 -26.828  -63.606 1.00 . C C .  80 TYR CB   1 1 
        1   6896 3 3  80 TYR CD1  C  -69.180 -28.097  -63.194 1.00 . C C .  80 TYR CD1  1 1 
        1   6897 3 3  80 TYR CD2  C  -68.489 -27.713  -65.455 1.00 . C C .  80 TYR CD2  1 1 
        1   6898 3 3  80 TYR CE1  C  -70.296 -28.768  -63.638 1.00 . C C .  80 TYR CE1  1 1 
        1   6899 3 3  80 TYR CE2  C  -69.601 -28.388  -65.915 1.00 . C C .  80 TYR CE2  1 1 
        1   6900 3 3  80 TYR CG   C  -68.264 -27.550  -64.093 1.00 . C C .  80 TYR CG   1 1 
        1   6901 3 3  80 TYR CZ   C  -70.499 -28.915  -64.999 1.00 . C C .  80 TYR CZ   1 1 
        1   6902 3 3  80 TYR H    H  -67.478 -24.089  -64.449 1.00 . C C .  80 TYR H    1 1 
        1   6903 3 3  80 TYR HA   H  -67.948 -25.716  -62.039 1.00 . C C .  80 TYR HA   1 1 
        1   6904 3 3  80 TYR HB2  H  -66.416 -26.626  -64.458 1.00 . C C .  80 TYR HB2  1 1 
        1   6905 3 3  80 TYR HB3  H  -66.503 -27.481  -62.934 1.00 . C C .  80 TYR HB3  1 1 
        1   6906 3 3  80 TYR HD1  H  -69.017 -27.980  -62.133 1.00 . C C .  80 TYR HD1  1 1 
        1   6907 3 3  80 TYR HD2  H  -67.789 -27.295  -66.164 1.00 . C C .  80 TYR HD2  1 1 
        1   6908 3 3  80 TYR HE1  H  -71.001 -29.183  -62.933 1.00 . C C .  80 TYR HE1  1 1 
        1   6909 3 3  80 TYR HE2  H  -69.766 -28.510  -66.975 1.00 . C C .  80 TYR HE2  1 1 
        1   6910 3 3  80 TYR HH   H  -72.262 -29.588  -64.752 1.00 . C C .  80 TYR HH   1 1 
        1   6911 3 3  80 TYR N    N  -67.978 -24.563  -63.752 1.00 . C C .  80 TYR N    1 1 
        1   6912 3 3  80 TYR O    O  -65.225 -24.344  -63.074 1.00 . C C .  80 TYR O    1 1 
        1   6913 3 3  80 TYR OH   O  -71.604 -29.592  -65.452 1.00 . C C .  80 TYR OH   1 1 
        1   6914 3 3  81 LEU C    C  -63.850 -26.593  -60.127 1.00 . C C .  81 LEU C    1 1 
        1   6915 3 3  81 LEU CA   C  -64.330 -25.237  -60.631 1.00 . C C .  81 LEU CA   1 1 
        1   6916 3 3  81 LEU CB   C  -64.166 -24.140  -59.574 1.00 . C C .  81 LEU CB   1 1 
        1   6917 3 3  81 LEU CD1  C  -62.229 -22.788  -60.531 1.00 . C C .  81 LEU CD1  1 1 
        1   6918 3 3  81 LEU CD2  C  -62.430 -23.094  -58.061 1.00 . C C .  81 LEU CD2  1 1 
        1   6919 3 3  81 LEU CG   C  -62.693 -23.721  -59.411 1.00 . C C .  81 LEU CG   1 1 
        1   6920 3 3  81 LEU H    H  -66.329 -25.873  -60.594 1.00 . C C .  81 LEU H    1 1 
        1   6921 3 3  81 LEU HA   H  -63.713 -24.971  -61.479 1.00 . C C .  81 LEU HA   1 1 
        1   6922 3 3  81 LEU HB2  H  -64.746 -23.278  -59.868 1.00 . C C .  81 LEU HB2  1 1 
        1   6923 3 3  81 LEU HB3  H  -64.535 -24.506  -58.627 1.00 . C C .  81 LEU HB3  1 1 
        1   6924 3 3  81 LEU HD11 H  -61.470 -22.120  -60.151 1.00 . C C .  81 LEU HD11 1 1 
        1   6925 3 3  81 LEU HD12 H  -63.069 -22.211  -60.890 1.00 . C C .  81 LEU HD12 1 1 
        1   6926 3 3  81 LEU HD13 H  -61.821 -23.373  -61.341 1.00 . C C .  81 LEU HD13 1 1 
        1   6927 3 3  81 LEU HD21 H  -63.208 -23.384  -57.371 1.00 . C C .  81 LEU HD21 1 1 
        1   6928 3 3  81 LEU HD22 H  -62.418 -22.018  -58.160 1.00 . C C .  81 LEU HD22 1 1 
        1   6929 3 3  81 LEU HD23 H  -61.475 -23.432  -57.687 1.00 . C C .  81 LEU HD23 1 1 
        1   6930 3 3  81 LEU HG   H  -62.097 -24.622  -59.479 1.00 . C C .  81 LEU HG   1 1 
        1   6931 3 3  81 LEU N    N  -65.688 -25.335  -61.104 1.00 . C C .  81 LEU N    1 1 
        1   6932 3 3  81 LEU O    O  -64.409 -27.160  -59.183 1.00 . C C .  81 LEU O    1 1 
        1   6933 3 3  82 GLN C    C  -60.933 -28.160  -59.637 1.00 . C C .  82 GLN C    1 1 
        1   6934 3 3  82 GLN CA   C  -62.230 -28.383  -60.392 1.00 . C C .  82 GLN CA   1 1 
        1   6935 3 3  82 GLN CB   C  -61.976 -29.260  -61.623 1.00 . C C .  82 GLN CB   1 1 
        1   6936 3 3  82 GLN CD   C  -61.534 -31.406  -60.291 1.00 . C C .  82 GLN CD   1 1 
        1   6937 3 3  82 GLN CG   C  -62.313 -30.755  -61.426 1.00 . C C .  82 GLN CG   1 1 
        1   6938 3 3  82 GLN H    H  -62.422 -26.611  -61.529 1.00 . C C .  82 GLN H    1 1 
        1   6939 3 3  82 GLN HA   H  -62.924 -28.895  -59.742 1.00 . C C .  82 GLN HA   1 1 
        1   6940 3 3  82 GLN HB2  H  -62.571 -28.883  -62.440 1.00 . C C .  82 GLN HB2  1 1 
        1   6941 3 3  82 GLN HB3  H  -60.932 -29.174  -61.893 1.00 . C C .  82 GLN HB3  1 1 
        1   6942 3 3  82 GLN HE21 H  -63.081 -31.183  -59.019 1.00 . C C .  82 GLN HE21 1 1 
        1   6943 3 3  82 GLN HE22 H  -61.707 -31.925  -58.352 1.00 . C C .  82 GLN HE22 1 1 
        1   6944 3 3  82 GLN HG2  H  -63.369 -30.903  -61.298 1.00 . C C .  82 GLN HG2  1 1 
        1   6945 3 3  82 GLN HG3  H  -62.011 -31.249  -62.339 1.00 . C C .  82 GLN HG3  1 1 
        1   6946 3 3  82 GLN N    N  -62.814 -27.109  -60.781 1.00 . C C .  82 GLN N    1 1 
        1   6947 3 3  82 GLN NE2  N  -62.164 -31.515  -59.116 1.00 . C C .  82 GLN NE2  1 1 
        1   6948 3 3  82 GLN O    O  -59.905 -27.854  -60.251 1.00 . C C .  82 GLN O    1 1 
        1   6949 3 3  82 GLN OE1  O  -60.380 -31.815  -60.471 1.00 . C C .  82 GLN OE1  1 1 
        1   6950 3 3  83 MET C    C  -59.065 -29.389  -57.282 1.00 . C C .  83 MET C    1 1 
        1   6951 3 3  83 MET CA   C  -59.849 -28.104  -57.408 1.00 . C C .  83 MET CA   1 1 
        1   6952 3 3  83 MET CB   C  -60.329 -27.676  -56.007 1.00 . C C .  83 MET CB   1 1 
        1   6953 3 3  83 MET CE   C  -60.579 -25.178  -53.486 1.00 . C C .  83 MET CE   1 1 
        1   6954 3 3  83 MET CG   C  -61.108 -26.350  -55.967 1.00 . C C .  83 MET CG   1 1 
        1   6955 3 3  83 MET H    H  -61.857 -28.557  -57.914 1.00 . C C .  83 MET H    1 1 
        1   6956 3 3  83 MET HA   H  -59.211 -27.335  -57.814 1.00 . C C .  83 MET HA   1 1 
        1   6957 3 3  83 MET HB2  H  -60.965 -28.453  -55.613 1.00 . C C .  83 MET HB2  1 1 
        1   6958 3 3  83 MET HB3  H  -59.463 -27.588  -55.365 1.00 . C C .  83 MET HB3  1 1 
        1   6959 3 3  83 MET HE1  H  -60.070 -24.475  -54.130 1.00 . C C .  83 MET HE1  1 1 
        1   6960 3 3  83 MET HE2  H  -59.882 -25.932  -53.158 1.00 . C C .  83 MET HE2  1 1 
        1   6961 3 3  83 MET HE3  H  -60.980 -24.661  -52.625 1.00 . C C .  83 MET HE3  1 1 
        1   6962 3 3  83 MET HG2  H  -60.432 -25.549  -56.215 1.00 . C C .  83 MET HG2  1 1 
        1   6963 3 3  83 MET HG3  H  -61.872 -26.392  -56.734 1.00 . C C .  83 MET HG3  1 1 
        1   6964 3 3  83 MET N    N  -60.995 -28.314  -58.311 1.00 . C C .  83 MET N    1 1 
        1   6965 3 3  83 MET O    O  -59.667 -30.439  -57.096 1.00 . C C .  83 MET O    1 1 
        1   6966 3 3  83 MET SD   S  -61.904 -25.944  -54.383 1.00 . C C .  83 MET SD   1 1 
        1   6967 3 3  84 SER C    C  -55.911 -30.137  -55.976 1.00 . C C .  84 SER C    1 1 
        1   6968 3 3  84 SER CA   C  -56.879 -30.471  -57.109 1.00 . C C .  84 SER CA   1 1 
        1   6969 3 3  84 SER CB   C  -56.152 -30.943  -58.365 1.00 . C C .  84 SER CB   1 1 
        1   6970 3 3  84 SER H    H  -57.323 -28.443  -57.547 1.00 . C C .  84 SER H    1 1 
        1   6971 3 3  84 SER HA   H  -57.515 -31.277  -56.767 1.00 . C C .  84 SER HA   1 1 
        1   6972 3 3  84 SER HB2  H  -55.855 -31.970  -58.240 1.00 . C C .  84 SER HB2  1 1 
        1   6973 3 3  84 SER HB3  H  -56.826 -30.873  -59.209 1.00 . C C .  84 SER HB3  1 1 
        1   6974 3 3  84 SER HG   H  -54.818 -29.646  -57.816 1.00 . C C .  84 SER HG   1 1 
        1   6975 3 3  84 SER N    N  -57.739 -29.317  -57.390 1.00 . C C .  84 SER N    1 1 
        1   6976 3 3  84 SER O    O  -56.289 -29.411  -55.079 1.00 . C C .  84 SER O    1 1 
        1   6977 3 3  84 SER OG   O  -54.998 -30.161  -58.606 1.00 . C C .  84 SER OG   1 1 
        1   6978 3 3  85 SER C    C  -53.960 -29.620  -53.786 1.00 . C C .  85 SER C    1 1 
        1   6979 3 3  85 SER CA   C  -53.657 -30.574  -54.942 1.00 . C C .  85 SER CA   1 1 
        1   6980 3 3  85 SER CB   C  -52.272 -30.239  -55.509 1.00 . C C .  85 SER CB   1 1 
        1   6981 3 3  85 SER H    H  -54.462 -31.208  -56.806 1.00 . C C .  85 SER H    1 1 
        1   6982 3 3  85 SER HA   H  -53.587 -31.564  -54.517 1.00 . C C .  85 SER HA   1 1 
        1   6983 3 3  85 SER HB2  H  -52.205 -29.179  -55.680 1.00 . C C .  85 SER HB2  1 1 
        1   6984 3 3  85 SER HB3  H  -51.518 -30.526  -54.786 1.00 . C C .  85 SER HB3  1 1 
        1   6985 3 3  85 SER HG   H  -51.491 -31.676  -56.552 1.00 . C C .  85 SER HG   1 1 
        1   6986 3 3  85 SER N    N  -54.678 -30.647  -56.032 1.00 . C C .  85 SER N    1 1 
        1   6987 3 3  85 SER O    O  -53.254 -28.629  -53.594 1.00 . C C .  85 SER O    1 1 
        1   6988 3 3  85 SER OG   O  -52.045 -30.913  -56.732 1.00 . C C .  85 SER OG   1 1 
        1   6989 3 3  86 LEU C    C  -54.759 -28.520  -50.936 1.00 . C C .  86 LEU C    1 1 
        1   6990 3 3  86 LEU CA   C  -55.587 -28.941  -52.128 1.00 . C C .  86 LEU CA   1 1 
        1   6991 3 3  86 LEU CB   C  -57.002 -29.358  -51.715 1.00 . C C .  86 LEU CB   1 1 
        1   6992 3 3  86 LEU CD1  C  -59.082 -29.677  -53.110 1.00 . C C .  86 LEU CD1  1 1 
        1   6993 3 3  86 LEU CD2  C  -58.770 -27.600  -51.791 1.00 . C C .  86 LEU CD2  1 1 
        1   6994 3 3  86 LEU CG   C  -58.080 -28.681  -52.569 1.00 . C C .  86 LEU CG   1 1 
        1   6995 3 3  86 LEU H    H  -55.476 -30.763  -53.181 1.00 . C C .  86 LEU H    1 1 
        1   6996 3 3  86 LEU HA   H  -55.702 -28.055  -52.735 1.00 . C C .  86 LEU HA   1 1 
        1   6997 3 3  86 LEU HB2  H  -57.096 -30.428  -51.820 1.00 . C C .  86 LEU HB2  1 1 
        1   6998 3 3  86 LEU HB3  H  -57.157 -29.093  -50.679 1.00 . C C .  86 LEU HB3  1 1 
        1   6999 3 3  86 LEU HD11 H  -59.614 -30.135  -52.289 1.00 . C C .  86 LEU HD11 1 1 
        1   7000 3 3  86 LEU HD12 H  -58.563 -30.440  -53.673 1.00 . C C .  86 LEU HD12 1 1 
        1   7001 3 3  86 LEU HD13 H  -59.784 -29.169  -53.754 1.00 . C C .  86 LEU HD13 1 1 
        1   7002 3 3  86 LEU HD21 H  -58.163 -27.324  -50.942 1.00 . C C .  86 LEU HD21 1 1 
        1   7003 3 3  86 LEU HD22 H  -59.729 -27.961  -51.446 1.00 . C C .  86 LEU HD22 1 1 
        1   7004 3 3  86 LEU HD23 H  -58.915 -26.738  -52.423 1.00 . C C .  86 LEU HD23 1 1 
        1   7005 3 3  86 LEU HG   H  -57.587 -28.222  -53.414 1.00 . C C .  86 LEU HG   1 1 
        1   7006 3 3  86 LEU N    N  -54.978 -29.940  -52.994 1.00 . C C .  86 LEU N    1 1 
        1   7007 3 3  86 LEU O    O  -54.558 -29.299  -50.023 1.00 . C C .  86 LEU O    1 1 
        1   7008 3 3  87 LYS C    C  -54.720 -26.205  -48.804 1.00 . C C .  87 LYS C    1 1 
        1   7009 3 3  87 LYS CA   C  -53.671 -26.619  -49.827 1.00 . C C .  87 LYS CA   1 1 
        1   7010 3 3  87 LYS CB   C  -52.913 -25.360  -50.256 1.00 . C C .  87 LYS CB   1 1 
        1   7011 3 3  87 LYS CD   C  -50.850 -24.557  -51.406 1.00 . C C .  87 LYS CD   1 1 
        1   7012 3 3  87 LYS CE   C  -49.888 -24.864  -52.508 1.00 . C C .  87 LYS CE   1 1 
        1   7013 3 3  87 LYS CG   C  -51.996 -25.541  -51.442 1.00 . C C .  87 LYS CG   1 1 
        1   7014 3 3  87 LYS H    H  -54.500 -26.728  -51.759 1.00 . C C .  87 LYS H    1 1 
        1   7015 3 3  87 LYS HA   H  -52.976 -27.301  -49.362 1.00 . C C .  87 LYS HA   1 1 
        1   7016 3 3  87 LYS HB2  H  -53.633 -24.596  -50.502 1.00 . C C .  87 LYS HB2  1 1 
        1   7017 3 3  87 LYS HB3  H  -52.327 -25.015  -49.415 1.00 . C C .  87 LYS HB3  1 1 
        1   7018 3 3  87 LYS HD2  H  -51.233 -23.555  -51.531 1.00 . C C .  87 LYS HD2  1 1 
        1   7019 3 3  87 LYS HD3  H  -50.343 -24.632  -50.456 1.00 . C C .  87 LYS HD3  1 1 
        1   7020 3 3  87 LYS HE2  H  -49.912 -25.920  -52.737 1.00 . C C .  87 LYS HE2  1 1 
        1   7021 3 3  87 LYS HE3  H  -50.137 -24.289  -53.387 1.00 . C C .  87 LYS HE3  1 1 
        1   7022 3 3  87 LYS HG2  H  -51.607 -26.547  -51.450 1.00 . C C .  87 LYS HG2  1 1 
        1   7023 3 3  87 LYS HG3  H  -52.566 -25.376  -52.345 1.00 . C C .  87 LYS HG3  1 1 
        1   7024 3 3  87 LYS HZ1  H  -48.097 -25.301  -51.575 1.00 . C C .  87 LYS HZ1  1 1 
        1   7025 3 3  87 LYS HZ2  H  -48.642 -23.710  -51.331 1.00 . C C .  87 LYS HZ2  1 1 
        1   7026 3 3  87 LYS HZ3  H  -47.970 -24.162  -52.825 1.00 . C C .  87 LYS HZ3  1 1 
        1   7027 3 3  87 LYS N    N  -54.287 -27.276  -50.975 1.00 . C C .  87 LYS N    1 1 
        1   7028 3 3  87 LYS NZ   N  -48.551 -24.481  -52.024 1.00 . C C .  87 LYS NZ   1 1 
        1   7029 3 3  87 LYS O    O  -55.836 -25.812  -49.167 1.00 . C C .  87 LYS O    1 1 
        1   7030 3 3  88 SER C    C  -55.271 -24.247  -46.405 1.00 . C C .  88 SER C    1 1 
        1   7031 3 3  88 SER CA   C  -55.154 -25.777  -46.426 1.00 . C C .  88 SER CA   1 1 
        1   7032 3 3  88 SER CB   C  -54.505 -26.211  -45.143 1.00 . C C .  88 SER CB   1 1 
        1   7033 3 3  88 SER H    H  -53.424 -26.563  -47.336 1.00 . C C .  88 SER H    1 1 
        1   7034 3 3  88 SER HA   H  -56.138 -26.212  -46.487 1.00 . C C .  88 SER HA   1 1 
        1   7035 3 3  88 SER HB2  H  -55.092 -25.876  -44.302 1.00 . C C .  88 SER HB2  1 1 
        1   7036 3 3  88 SER HB3  H  -54.419 -27.289  -45.122 1.00 . C C .  88 SER HB3  1 1 
        1   7037 3 3  88 SER HG   H  -52.971 -25.518  -44.174 1.00 . C C .  88 SER HG   1 1 
        1   7038 3 3  88 SER N    N  -54.336 -26.263  -47.531 1.00 . C C .  88 SER N    1 1 
        1   7039 3 3  88 SER O    O  -55.947 -23.680  -45.543 1.00 . C C .  88 SER O    1 1 
        1   7040 3 3  88 SER OG   O  -53.220 -25.614  -45.096 1.00 . C C .  88 SER OG   1 1 
        1   7041 3 3  89 GLU C    C  -56.124 -22.041  -48.421 1.00 . C C .  89 GLU C    1 1 
        1   7042 3 3  89 GLU CA   C  -54.802 -22.187  -47.655 1.00 . C C .  89 GLU CA   1 1 
        1   7043 3 3  89 GLU CB   C  -53.658 -21.619  -48.499 1.00 . C C .  89 GLU CB   1 1 
        1   7044 3 3  89 GLU CD   C  -51.448 -22.517  -47.556 1.00 . C C .  89 GLU CD   1 1 
        1   7045 3 3  89 GLU CG   C  -52.373 -21.308  -47.727 1.00 . C C .  89 GLU CG   1 1 
        1   7046 3 3  89 GLU H    H  -54.011 -24.117  -47.941 1.00 . C C .  89 GLU H    1 1 
        1   7047 3 3  89 GLU HA   H  -54.869 -21.622  -46.737 1.00 . C C .  89 GLU HA   1 1 
        1   7048 3 3  89 GLU HB2  H  -53.420 -22.332  -49.272 1.00 . C C .  89 GLU HB2  1 1 
        1   7049 3 3  89 GLU HB3  H  -54.005 -20.710  -48.972 1.00 . C C .  89 GLU HB3  1 1 
        1   7050 3 3  89 GLU HG2  H  -51.833 -20.536  -48.253 1.00 . C C .  89 GLU HG2  1 1 
        1   7051 3 3  89 GLU HG3  H  -52.642 -20.934  -46.749 1.00 . C C .  89 GLU HG3  1 1 
        1   7052 3 3  89 GLU N    N  -54.561 -23.590  -47.324 1.00 . C C .  89 GLU N    1 1 
        1   7053 3 3  89 GLU O    O  -56.829 -21.052  -48.255 1.00 . C C .  89 GLU O    1 1 
        1   7054 3 3  89 GLU OE1  O  -51.145 -23.195  -48.573 1.00 . C C .  89 GLU OE1  1 1 
        1   7055 3 3  89 GLU OE2  O  -51.008 -22.775  -46.402 1.00 . C C .  89 GLU OE2  1 1 
        1   7056 3 3  90 ASP C    C  -58.943 -22.906  -49.352 1.00 . C C .  90 ASP C    1 1 
        1   7057 3 3  90 ASP CA   C  -57.634 -22.988  -50.123 1.00 . C C .  90 ASP CA   1 1 
        1   7058 3 3  90 ASP CB   C  -57.660 -24.216  -51.014 1.00 . C C .  90 ASP CB   1 1 
        1   7059 3 3  90 ASP CG   C  -56.533 -24.237  -52.001 1.00 . C C .  90 ASP CG   1 1 
        1   7060 3 3  90 ASP H    H  -55.853 -23.803  -49.319 1.00 . C C .  90 ASP H    1 1 
        1   7061 3 3  90 ASP HA   H  -57.554 -22.116  -50.753 1.00 . C C .  90 ASP HA   1 1 
        1   7062 3 3  90 ASP HB2  H  -57.596 -25.098  -50.396 1.00 . C C .  90 ASP HB2  1 1 
        1   7063 3 3  90 ASP HB3  H  -58.598 -24.236  -51.551 1.00 . C C .  90 ASP HB3  1 1 
        1   7064 3 3  90 ASP N    N  -56.458 -23.036  -49.245 1.00 . C C .  90 ASP N    1 1 
        1   7065 3 3  90 ASP O    O  -60.001 -22.537  -49.895 1.00 . C C .  90 ASP O    1 1 
        1   7066 3 3  90 ASP OD1  O  -55.921 -23.169  -52.265 1.00 . C C .  90 ASP OD1  1 1 
        1   7067 3 3  90 ASP OD2  O  -56.261 -25.331  -52.535 1.00 . C C .  90 ASP OD2  1 1 
        1   7068 3 3  91 THR C    C  -60.593 -21.795  -47.191 1.00 . C C .  91 THR C    1 1 
        1   7069 3 3  91 THR CA   C  -59.919 -23.175  -47.118 1.00 . C C .  91 THR CA   1 1 
        1   7070 3 3  91 THR CB   C  -59.302 -23.343  -45.739 1.00 . C C .  91 THR CB   1 1 
        1   7071 3 3  91 THR CG2  C  -60.371 -23.518  -44.697 1.00 . C C .  91 THR CG2  1 1 
        1   7072 3 3  91 THR H    H  -57.979 -23.597  -47.764 1.00 . C C .  91 THR H    1 1 
        1   7073 3 3  91 THR HA   H  -60.650 -23.950  -47.278 1.00 . C C .  91 THR HA   1 1 
        1   7074 3 3  91 THR HB   H  -58.735 -22.453  -45.508 1.00 . C C .  91 THR HB   1 1 
        1   7075 3 3  91 THR HG1  H  -57.724 -24.311  -45.098 1.00 . C C .  91 THR HG1  1 1 
        1   7076 3 3  91 THR HG21 H  -61.264 -22.993  -45.004 1.00 . C C .  91 THR HG21 1 1 
        1   7077 3 3  91 THR HG22 H  -60.025 -23.117  -43.755 1.00 . C C .  91 THR HG22 1 1 
        1   7078 3 3  91 THR HG23 H  -60.594 -24.568  -44.581 1.00 . C C .  91 THR HG23 1 1 
        1   7079 3 3  91 THR N    N  -58.854 -23.295  -48.086 1.00 . C C .  91 THR N    1 1 
        1   7080 3 3  91 THR O    O  -60.047 -20.806  -46.676 1.00 . C C .  91 THR O    1 1 
        1   7081 3 3  91 THR OG1  O  -58.401 -24.462  -45.761 1.00 . C C .  91 THR OG1  1 1 
        1   7082 3 3  92 ALA C    C  -63.931 -20.731  -48.391 1.00 . C C .  92 ALA C    1 1 
        1   7083 3 3  92 ALA CA   C  -62.517 -20.475  -47.916 1.00 . C C .  92 ALA CA   1 1 
        1   7084 3 3  92 ALA CB   C  -61.838 -19.529  -48.843 1.00 . C C .  92 ALA CB   1 1 
        1   7085 3 3  92 ALA H    H  -62.139 -22.534  -48.235 1.00 . C C .  92 ALA H    1 1 
        1   7086 3 3  92 ALA HA   H  -62.555 -20.030  -46.933 1.00 . C C .  92 ALA HA   1 1 
        1   7087 3 3  92 ALA HB1  H  -60.914 -19.966  -49.192 1.00 . C C .  92 ALA HB1  1 1 
        1   7088 3 3  92 ALA HB2  H  -61.626 -18.605  -48.324 1.00 . C C .  92 ALA HB2  1 1 
        1   7089 3 3  92 ALA HB3  H  -62.480 -19.329  -49.688 1.00 . C C .  92 ALA HB3  1 1 
        1   7090 3 3  92 ALA N    N  -61.761 -21.722  -47.838 1.00 . C C .  92 ALA N    1 1 
        1   7091 3 3  92 ALA O    O  -64.273 -21.862  -48.710 1.00 . C C .  92 ALA O    1 1 
        1   7092 3 3  93 MET C    C  -65.909 -19.416  -50.519 1.00 . C C .  93 MET C    1 1 
        1   7093 3 3  93 MET CA   C  -66.082 -19.699  -49.044 1.00 . C C .  93 MET CA   1 1 
        1   7094 3 3  93 MET CB   C  -66.933 -18.595  -48.446 1.00 . C C .  93 MET CB   1 1 
        1   7095 3 3  93 MET CE   C  -69.501 -19.662  -46.932 1.00 . C C .  93 MET CE   1 1 
        1   7096 3 3  93 MET CG   C  -68.280 -18.416  -49.101 1.00 . C C .  93 MET CG   1 1 
        1   7097 3 3  93 MET H    H  -64.391 -18.809  -48.153 1.00 . C C .  93 MET H    1 1 
        1   7098 3 3  93 MET HA   H  -66.552 -20.660  -48.895 1.00 . C C .  93 MET HA   1 1 
        1   7099 3 3  93 MET HB2  H  -67.092 -18.814  -47.402 1.00 . C C .  93 MET HB2  1 1 
        1   7100 3 3  93 MET HB3  H  -66.385 -17.666  -48.519 1.00 . C C .  93 MET HB3  1 1 
        1   7101 3 3  93 MET HE1  H  -68.778 -18.944  -46.569 1.00 . C C .  93 MET HE1  1 1 
        1   7102 3 3  93 MET HE2  H  -69.310 -20.621  -46.478 1.00 . C C .  93 MET HE2  1 1 
        1   7103 3 3  93 MET HE3  H  -70.500 -19.336  -46.674 1.00 . C C .  93 MET HE3  1 1 
        1   7104 3 3  93 MET HG2  H  -68.732 -17.504  -48.742 1.00 . C C .  93 MET HG2  1 1 
        1   7105 3 3  93 MET HG3  H  -68.149 -18.350  -50.172 1.00 . C C .  93 MET HG3  1 1 
        1   7106 3 3  93 MET N    N  -64.750 -19.676  -48.433 1.00 . C C .  93 MET N    1 1 
        1   7107 3 3  93 MET O    O  -65.104 -18.561  -50.871 1.00 . C C .  93 MET O    1 1 
        1   7108 3 3  93 MET SD   S  -69.361 -19.801  -48.717 1.00 . C C .  93 MET SD   1 1 
        1   7109 3 3  94 TYR C    C  -67.540 -19.409  -53.699 1.00 . C C .  94 TYR C    1 1 
        1   7110 3 3  94 TYR CA   C  -66.431 -20.023  -52.828 1.00 . C C .  94 TYR CA   1 1 
        1   7111 3 3  94 TYR CB   C  -66.016 -21.397  -53.357 1.00 . C C .  94 TYR CB   1 1 
        1   7112 3 3  94 TYR CD1  C  -63.967 -21.964  -52.019 1.00 . C C .  94 TYR CD1  1 1 
        1   7113 3 3  94 TYR CD2  C  -63.697 -21.438  -54.328 1.00 . C C .  94 TYR CD2  1 1 
        1   7114 3 3  94 TYR CE1  C  -62.583 -22.147  -51.894 1.00 . C C .  94 TYR CE1  1 1 
        1   7115 3 3  94 TYR CE2  C  -62.319 -21.618  -54.219 1.00 . C C .  94 TYR CE2  1 1 
        1   7116 3 3  94 TYR CG   C  -64.537 -21.615  -53.235 1.00 . C C .  94 TYR CG   1 1 
        1   7117 3 3  94 TYR CZ   C  -61.766 -21.971  -52.998 1.00 . C C .  94 TYR CZ   1 1 
        1   7118 3 3  94 TYR H    H  -67.308 -20.751  -51.031 1.00 . C C .  94 TYR H    1 1 
        1   7119 3 3  94 TYR HA   H  -65.571 -19.384  -52.955 1.00 . C C .  94 TYR HA   1 1 
        1   7120 3 3  94 TYR HB2  H  -66.536 -22.166  -52.808 1.00 . C C .  94 TYR HB2  1 1 
        1   7121 3 3  94 TYR HB3  H  -66.293 -21.462  -54.400 1.00 . C C .  94 TYR HB3  1 1 
        1   7122 3 3  94 TYR HD1  H  -64.601 -22.107  -51.157 1.00 . C C .  94 TYR HD1  1 1 
        1   7123 3 3  94 TYR HD2  H  -64.121 -21.163  -55.283 1.00 . C C .  94 TYR HD2  1 1 
        1   7124 3 3  94 TYR HE1  H  -62.155 -22.418  -50.941 1.00 . C C .  94 TYR HE1  1 1 
        1   7125 3 3  94 TYR HE2  H  -61.685 -21.481  -55.082 1.00 . C C .  94 TYR HE2  1 1 
        1   7126 3 3  94 TYR HH   H  -60.029 -21.338  -52.520 1.00 . C C .  94 TYR HH   1 1 
        1   7127 3 3  94 TYR N    N  -66.667 -20.096  -51.377 1.00 . C C .  94 TYR N    1 1 
        1   7128 3 3  94 TYR O    O  -68.457 -20.107  -54.106 1.00 . C C .  94 TYR O    1 1 
        1   7129 3 3  94 TYR OH   O  -60.403 -22.149  -52.874 1.00 . C C .  94 TYR OH   1 1 
        1   7130 3 3  95 TYR C    C  -68.250 -17.616  -56.300 1.00 . C C .  95 TYR C    1 1 
        1   7131 3 3  95 TYR CA   C  -68.478 -17.451  -54.814 1.00 . C C .  95 TYR CA   1 1 
        1   7132 3 3  95 TYR CB   C  -68.571 -15.959  -54.485 1.00 . C C .  95 TYR CB   1 1 
        1   7133 3 3  95 TYR CD1  C  -67.723 -15.581  -52.163 1.00 . C C .  95 TYR CD1  1 1 
        1   7134 3 3  95 TYR CD2  C  -70.088 -15.567  -52.517 1.00 . C C .  95 TYR CD2  1 1 
        1   7135 3 3  95 TYR CE1  C  -67.913 -15.355  -50.827 1.00 . C C .  95 TYR CE1  1 1 
        1   7136 3 3  95 TYR CE2  C  -70.291 -15.330  -51.174 1.00 . C C .  95 TYR CE2  1 1 
        1   7137 3 3  95 TYR CG   C  -68.799 -15.691  -53.032 1.00 . C C .  95 TYR CG   1 1 
        1   7138 3 3  95 TYR CZ   C  -69.192 -15.231  -50.333 1.00 . C C .  95 TYR CZ   1 1 
        1   7139 3 3  95 TYR H    H  -66.668 -17.606  -53.702 1.00 . C C .  95 TYR H    1 1 
        1   7140 3 3  95 TYR HA   H  -69.426 -17.906  -54.570 1.00 . C C .  95 TYR HA   1 1 
        1   7141 3 3  95 TYR HB2  H  -67.653 -15.479  -54.784 1.00 . C C .  95 TYR HB2  1 1 
        1   7142 3 3  95 TYR HB3  H  -69.386 -15.531  -55.053 1.00 . C C .  95 TYR HB3  1 1 
        1   7143 3 3  95 TYR HD1  H  -66.718 -15.675  -52.548 1.00 . C C .  95 TYR HD1  1 1 
        1   7144 3 3  95 TYR HD2  H  -70.937 -15.645  -53.180 1.00 . C C .  95 TYR HD2  1 1 
        1   7145 3 3  95 TYR HE1  H  -67.065 -15.272  -50.164 1.00 . C C .  95 TYR HE1  1 1 
        1   7146 3 3  95 TYR HE2  H  -71.292 -15.231  -50.781 1.00 . C C .  95 TYR HE2  1 1 
        1   7147 3 3  95 TYR HH   H  -68.475 -14.863  -48.607 1.00 . C C .  95 TYR HH   1 1 
        1   7148 3 3  95 TYR N    N  -67.437 -18.122  -54.022 1.00 . C C .  95 TYR N    1 1 
        1   7149 3 3  95 TYR O    O  -67.110 -17.716  -56.753 1.00 . C C .  95 TYR O    1 1 
        1   7150 3 3  95 TYR OH   O  -69.345 -15.014  -48.983 1.00 . C C .  95 TYR OH   1 1 
        1   7151 3 3  96 CYS C    C  -69.896 -16.395  -58.963 1.00 . C C .  96 CYS C    1 1 
        1   7152 3 3  96 CYS CA   C  -69.359 -17.721  -58.477 1.00 . C C .  96 CYS CA   1 1 
        1   7153 3 3  96 CYS CB   C  -70.260 -18.887  -58.903 1.00 . C C .  96 CYS CB   1 1 
        1   7154 3 3  96 CYS H    H  -70.216 -17.536  -56.580 1.00 . C C .  96 CYS H    1 1 
        1   7155 3 3  96 CYS HA   H  -68.354 -17.872  -58.843 1.00 . C C .  96 CYS HA   1 1 
        1   7156 3 3  96 CYS HB2  H  -69.660 -19.781  -58.905 1.00 . C C .  96 CYS HB2  1 1 
        1   7157 3 3  96 CYS HB3  H  -71.023 -19.005  -58.144 1.00 . C C .  96 CYS HB3  1 1 
        1   7158 3 3  96 CYS N    N  -69.355 -17.630  -57.038 1.00 . C C .  96 CYS N    1 1 
        1   7159 3 3  96 CYS O    O  -71.014 -16.025  -58.643 1.00 . C C .  96 CYS O    1 1 
        1   7160 3 3  96 CYS SG   S  -71.091 -18.783  -60.551 1.00 . C C .  96 CYS SG   1 1 
        1   7161 3 3  97 ALA C    C  -69.616 -14.035  -61.614 1.00 . C C .  97 ALA C    1 1 
        1   7162 3 3  97 ALA CA   C  -69.459 -14.297  -60.102 1.00 . C C .  97 ALA CA   1 1 
        1   7163 3 3  97 ALA CB   C  -68.488 -13.308  -59.478 1.00 . C C .  97 ALA CB   1 1 
        1   7164 3 3  97 ALA H    H  -68.201 -16.001  -59.947 1.00 . C C .  97 ALA H    1 1 
        1   7165 3 3  97 ALA HA   H  -70.424 -14.104  -59.657 1.00 . C C .  97 ALA HA   1 1 
        1   7166 3 3  97 ALA HB1  H  -69.036 -12.582  -58.896 1.00 . C C .  97 ALA HB1  1 1 
        1   7167 3 3  97 ALA HB2  H  -67.937 -12.802  -60.258 1.00 . C C .  97 ALA HB2  1 1 
        1   7168 3 3  97 ALA HB3  H  -67.798 -13.837  -58.836 1.00 . C C .  97 ALA HB3  1 1 
        1   7169 3 3  97 ALA N    N  -69.095 -15.664  -59.727 1.00 . C C .  97 ALA N    1 1 
        1   7170 3 3  97 ALA O    O  -69.175 -14.829  -62.458 1.00 . C C .  97 ALA O    1 1 
        1   7171 3 3  98 ARG C    C  -70.006 -11.143  -63.634 1.00 . C C .  98 ARG C    1 1 
        1   7172 3 3  98 ARG CA   C  -70.547 -12.527  -63.303 1.00 . C C .  98 ARG CA   1 1 
        1   7173 3 3  98 ARG CB   C  -72.046 -12.488  -63.479 1.00 . C C .  98 ARG CB   1 1 
        1   7174 3 3  98 ARG CD   C  -73.909 -12.516  -65.016 1.00 . C C .  98 ARG CD   1 1 
        1   7175 3 3  98 ARG CG   C  -72.449 -12.333  -64.906 1.00 . C C .  98 ARG CG   1 1 
        1   7176 3 3  98 ARG CZ   C  -75.317 -10.801  -66.030 1.00 . C C .  98 ARG CZ   1 1 
        1   7177 3 3  98 ARG H    H  -70.555 -12.322  -61.211 1.00 . C C .  98 ARG H    1 1 
        1   7178 3 3  98 ARG HA   H  -70.129 -13.253  -63.982 1.00 . C C .  98 ARG HA   1 1 
        1   7179 3 3  98 ARG HB2  H  -72.466 -13.405  -63.098 1.00 . C C .  98 ARG HB2  1 1 
        1   7180 3 3  98 ARG HB3  H  -72.442 -11.659  -62.909 1.00 . C C .  98 ARG HB3  1 1 
        1   7181 3 3  98 ARG HD2  H  -74.134 -13.035  -65.936 1.00 . C C .  98 ARG HD2  1 1 
        1   7182 3 3  98 ARG HD3  H  -74.260 -13.105  -64.181 1.00 . C C .  98 ARG HD3  1 1 
        1   7183 3 3  98 ARG HE   H  -74.485 -10.659  -64.229 1.00 . C C .  98 ARG HE   1 1 
        1   7184 3 3  98 ARG HG2  H  -72.181 -11.345  -65.252 1.00 . C C .  98 ARG HG2  1 1 
        1   7185 3 3  98 ARG HG3  H  -71.946 -13.076  -65.507 1.00 . C C .  98 ARG HG3  1 1 
        1   7186 3 3  98 ARG HH11 H  -75.047 -12.476  -67.140 1.00 . C C .  98 ARG HH11 1 1 
        1   7187 3 3  98 ARG HH12 H  -76.035 -11.256  -67.871 1.00 . C C .  98 ARG HH12 1 1 
        1   7188 3 3  98 ARG HH21 H  -75.798  -9.045  -65.138 1.00 . C C .  98 ARG HH21 1 1 
        1   7189 3 3  98 ARG HH22 H  -76.467  -9.280  -66.718 1.00 . C C .  98 ARG HH22 1 1 
        1   7190 3 3  98 ARG N    N  -70.242 -12.904  -61.935 1.00 . C C .  98 ARG N    1 1 
        1   7191 3 3  98 ARG NE   N  -74.580 -11.235  -65.017 1.00 . C C .  98 ARG NE   1 1 
        1   7192 3 3  98 ARG NH1  N  -75.480 -11.576  -67.103 1.00 . C C .  98 ARG NH1  1 1 
        1   7193 3 3  98 ARG NH2  N  -75.910  -9.610  -65.956 1.00 . C C .  98 ARG NH2  1 1 
        1   7194 3 3  98 ARG O    O  -70.347 -10.179  -62.947 1.00 . C C .  98 ARG O    1 1 
        1   7195 3 3  99 PRO C    C  -69.162  -9.396  -66.599 1.00 . C C .  99 PRO C    1 1 
        1   7196 3 3  99 PRO CA   C  -68.667  -9.762  -65.187 1.00 . C C .  99 PRO CA   1 1 
        1   7197 3 3  99 PRO CB   C  -67.146  -9.963  -65.181 1.00 . C C .  99 PRO CB   1 1 
        1   7198 3 3  99 PRO CD   C  -68.245 -12.141  -65.023 1.00 . C C .  99 PRO CD   1 1 
        1   7199 3 3  99 PRO CG   C  -66.909 -11.473  -65.022 1.00 . C C .  99 PRO CG   1 1 
        1   7200 3 3  99 PRO HA   H  -68.912  -8.972  -64.498 1.00 . C C .  99 PRO HA   1 1 
        1   7201 3 3  99 PRO HB2  H  -66.723  -9.614  -66.113 1.00 . C C .  99 PRO HB2  1 1 
        1   7202 3 3  99 PRO HB3  H  -66.704  -9.435  -64.351 1.00 . C C .  99 PRO HB3  1 1 
        1   7203 3 3  99 PRO HD2  H  -68.471 -12.525  -66.009 1.00 . C C .  99 PRO HD2  1 1 
        1   7204 3 3  99 PRO HD3  H  -68.293 -12.923  -64.283 1.00 . C C .  99 PRO HD3  1 1 
        1   7205 3 3  99 PRO HG2  H  -66.313 -11.840  -65.845 1.00 . C C .  99 PRO HG2  1 1 
        1   7206 3 3  99 PRO HG3  H  -66.404 -11.669  -64.087 1.00 . C C .  99 PRO HG3  1 1 
        1   7207 3 3  99 PRO N    N  -69.157 -11.042  -64.672 1.00 . C C .  99 PRO N    1 1 
        1   7208 3 3  99 PRO O    O  -69.684 -10.259  -67.300 1.00 . C C .  99 PRO O    1 1 
        1   7209 3 3 100 ASP C    C  -68.527  -7.552  -69.464 1.00 . C C . 100 ASP C    1 1 
        1   7210 3 3 100 ASP CA   C  -69.514  -7.586  -68.279 1.00 . C C . 100 ASP CA   1 1 
        1   7211 3 3 100 ASP CB   C  -70.092  -6.188  -68.036 1.00 . C C . 100 ASP CB   1 1 
        1   7212 3 3 100 ASP CG   C  -71.016  -6.138  -66.820 1.00 . C C . 100 ASP CG   1 1 
        1   7213 3 3 100 ASP H    H  -68.508  -7.520  -66.403 1.00 . C C . 100 ASP H    1 1 
        1   7214 3 3 100 ASP HA   H  -70.335  -8.223  -68.569 1.00 . C C . 100 ASP HA   1 1 
        1   7215 3 3 100 ASP HB2  H  -69.279  -5.495  -67.883 1.00 . C C . 100 ASP HB2  1 1 
        1   7216 3 3 100 ASP HB3  H  -70.649  -5.885  -68.912 1.00 . C C . 100 ASP HB3  1 1 
        1   7217 3 3 100 ASP N    N  -68.960  -8.138  -67.014 1.00 . C C . 100 ASP N    1 1 
        1   7218 3 3 100 ASP O    O  -68.738  -6.866  -70.485 1.00 . C C . 100 ASP O    1 1 
        1   7219 3 3 100 ASP OD1  O  -71.026  -7.108  -66.016 1.00 . C C . 100 ASP OD1  1 1 
        1   7220 3 3 100 ASP OD2  O  -71.735  -5.120  -66.652 1.00 . C C . 100 ASP OD2  1 1 
        1   7221 3 3 105 ALA C    C  -68.117  -7.036  -62.330 1.00 . C C . 105 ALA C    1 1 
        1   7222 3 3 105 ALA CA   C  -66.950  -6.127  -62.695 1.00 . C C . 105 ALA CA   1 1 
        1   7223 3 3 105 ALA CB   C  -67.452  -4.846  -63.349 1.00 . C C . 105 ALA CB   1 1 
        1   7224 3 3 105 ALA H    H  -66.029  -7.844  -63.375 1.00 . C C . 105 ALA H    1 1 
        1   7225 3 3 105 ALA HA   H  -66.443  -5.858  -61.780 1.00 . C C . 105 ALA HA   1 1 
        1   7226 3 3 105 ALA HB1  H  -66.962  -3.996  -62.899 1.00 . C C . 105 ALA HB1  1 1 
        1   7227 3 3 105 ALA HB2  H  -68.520  -4.764  -63.207 1.00 . C C . 105 ALA HB2  1 1 
        1   7228 3 3 105 ALA HB3  H  -67.231  -4.870  -64.406 1.00 . C C . 105 ALA HB3  1 1 
        1   7229 3 3 105 ALA N    N  -65.982  -6.822  -63.555 1.00 . C C . 105 ALA N    1 1 
        1   7230 3 3 105 ALA O    O  -69.173  -7.007  -62.961 1.00 . C C . 105 ALA O    1 1 
        1   7231 3 3 106 MET C    C  -70.165  -8.278  -60.425 1.00 . C C . 106 MET C    1 1 
        1   7232 3 3 106 MET CA   C  -68.815  -8.867  -60.810 1.00 . C C . 106 MET CA   1 1 
        1   7233 3 3 106 MET CB   C  -68.205  -9.545  -59.587 1.00 . C C . 106 MET CB   1 1 
        1   7234 3 3 106 MET CE   C  -64.323 -10.984  -60.108 1.00 . C C . 106 MET CE   1 1 
        1   7235 3 3 106 MET CG   C  -66.690  -9.612  -59.559 1.00 . C C . 106 MET CG   1 1 
        1   7236 3 3 106 MET H    H  -67.022  -7.773  -60.851 1.00 . C C . 106 MET H    1 1 
        1   7237 3 3 106 MET HA   H  -68.956  -9.605  -61.584 1.00 . C C . 106 MET HA   1 1 
        1   7238 3 3 106 MET HB2  H  -68.532  -9.016  -58.707 1.00 . C C . 106 MET HB2  1 1 
        1   7239 3 3 106 MET HB3  H  -68.593 -10.554  -59.536 1.00 . C C . 106 MET HB3  1 1 
        1   7240 3 3 106 MET HE1  H  -64.018 -10.486  -61.018 1.00 . C C . 106 MET HE1  1 1 
        1   7241 3 3 106 MET HE2  H  -63.834 -11.943  -60.044 1.00 . C C . 106 MET HE2  1 1 
        1   7242 3 3 106 MET HE3  H  -64.047 -10.383  -59.253 1.00 . C C . 106 MET HE3  1 1 
        1   7243 3 3 106 MET HG2  H  -66.288  -8.845  -60.203 1.00 . C C . 106 MET HG2  1 1 
        1   7244 3 3 106 MET HG3  H  -66.346  -9.443  -58.549 1.00 . C C . 106 MET HG3  1 1 
        1   7245 3 3 106 MET N    N  -67.897  -7.835  -61.289 1.00 . C C . 106 MET N    1 1 
        1   7246 3 3 106 MET O    O  -70.290  -7.634  -59.386 1.00 . C C . 106 MET O    1 1 
        1   7247 3 3 106 MET SD   S  -66.109 -11.218  -60.124 1.00 . C C . 106 MET SD   1 1 
        1   7248 3 3 107 ASP C    C  -73.546  -8.644  -60.429 1.00 . C C . 107 ASP C    1 1 
        1   7249 3 3 107 ASP CA   C  -72.430  -7.802  -61.027 1.00 . C C . 107 ASP CA   1 1 
        1   7250 3 3 107 ASP CB   C  -72.891  -7.052  -62.286 1.00 . C C . 107 ASP CB   1 1 
        1   7251 3 3 107 ASP CG   C  -73.291  -7.972  -63.418 1.00 . C C . 107 ASP CG   1 1 
        1   7252 3 3 107 ASP H    H  -71.044  -9.024  -62.065 1.00 . C C . 107 ASP H    1 1 
        1   7253 3 3 107 ASP HA   H  -72.213  -7.041  -60.291 1.00 . C C . 107 ASP HA   1 1 
        1   7254 3 3 107 ASP HB2  H  -73.737  -6.433  -62.031 1.00 . C C . 107 ASP HB2  1 1 
        1   7255 3 3 107 ASP HB3  H  -72.085  -6.414  -62.622 1.00 . C C . 107 ASP HB3  1 1 
        1   7256 3 3 107 ASP N    N  -71.179  -8.500  -61.247 1.00 . C C . 107 ASP N    1 1 
        1   7257 3 3 107 ASP O    O  -74.456  -8.086  -59.806 1.00 . C C . 107 ASP O    1 1 
        1   7258 3 3 107 ASP OD1  O  -72.904  -9.160  -63.400 1.00 . C C . 107 ASP OD1  1 1 
        1   7259 3 3 107 ASP OD2  O  -73.998  -7.496  -64.333 1.00 . C C . 107 ASP OD2  1 1 
        1   7260 3 3 108 TYR C    C  -73.555 -12.043  -59.260 1.00 . C C . 108 TYR C    1 1 
        1   7261 3 3 108 TYR CA   C  -74.363 -10.923  -59.910 1.00 . C C . 108 TYR CA   1 1 
        1   7262 3 3 108 TYR CB   C  -75.484 -11.473  -60.806 1.00 . C C . 108 TYR CB   1 1 
        1   7263 3 3 108 TYR CD1  C  -77.179  -9.724  -60.181 1.00 . C C . 108 TYR CD1  1 1 
        1   7264 3 3 108 TYR CD2  C  -76.669 -10.019  -62.510 1.00 . C C . 108 TYR CD2  1 1 
        1   7265 3 3 108 TYR CE1  C  -78.072  -8.707  -60.499 1.00 . C C . 108 TYR CE1  1 1 
        1   7266 3 3 108 TYR CE2  C  -77.565  -8.998  -62.844 1.00 . C C . 108 TYR CE2  1 1 
        1   7267 3 3 108 TYR CG   C  -76.471 -10.400  -61.175 1.00 . C C . 108 TYR CG   1 1 
        1   7268 3 3 108 TYR CZ   C  -78.265  -8.347  -61.825 1.00 . C C . 108 TYR CZ   1 1 
        1   7269 3 3 108 TYR H    H  -72.732 -10.328  -61.143 1.00 . C C . 108 TYR H    1 1 
        1   7270 3 3 108 TYR HA   H  -74.834 -10.371  -59.107 1.00 . C C . 108 TYR HA   1 1 
        1   7271 3 3 108 TYR HB2  H  -75.045 -11.868  -61.710 1.00 . C C . 108 TYR HB2  1 1 
        1   7272 3 3 108 TYR HB3  H  -75.998 -12.269  -60.287 1.00 . C C . 108 TYR HB3  1 1 
        1   7273 3 3 108 TYR HD1  H  -77.033  -9.999  -59.147 1.00 . C C . 108 TYR HD1  1 1 
        1   7274 3 3 108 TYR HD2  H  -76.130 -10.531  -63.294 1.00 . C C . 108 TYR HD2  1 1 
        1   7275 3 3 108 TYR HE1  H  -78.616  -8.200  -59.716 1.00 . C C . 108 TYR HE1  1 1 
        1   7276 3 3 108 TYR HE2  H  -77.709  -8.713  -63.875 1.00 . C C . 108 TYR HE2  1 1 
        1   7277 3 3 108 TYR HH   H  -78.925  -6.578  -61.556 1.00 . C C . 108 TYR HH   1 1 
        1   7278 3 3 108 TYR N    N  -73.483  -9.970  -60.626 1.00 . C C . 108 TYR N    1 1 
        1   7279 3 3 108 TYR O    O  -72.976 -12.889  -59.948 1.00 . C C . 108 TYR O    1 1 
        1   7280 3 3 108 TYR OH   O  -79.158  -7.334  -62.100 1.00 . C C . 108 TYR OH   1 1 
        1   7281 3 3 109 TRP C    C  -73.547 -14.092  -56.645 1.00 . C C . 109 TRP C    1 1 
        1   7282 3 3 109 TRP CA   C  -72.692 -12.967  -57.167 1.00 . C C . 109 TRP CA   1 1 
        1   7283 3 3 109 TRP CB   C  -72.087 -12.254  -55.981 1.00 . C C . 109 TRP CB   1 1 
        1   7284 3 3 109 TRP CD1  C  -71.106 -10.146  -57.047 1.00 . C C . 109 TRP CD1  1 1 
        1   7285 3 3 109 TRP CD2  C  -69.651 -11.382  -55.884 1.00 . C C . 109 TRP CD2  1 1 
        1   7286 3 3 109 TRP CE2  C  -68.979 -10.267  -56.402 1.00 . C C . 109 TRP CE2  1 1 
        1   7287 3 3 109 TRP CE3  C  -68.938 -12.308  -55.111 1.00 . C C . 109 TRP CE3  1 1 
        1   7288 3 3 109 TRP CG   C  -71.004 -11.296  -56.314 1.00 . C C . 109 TRP CG   1 1 
        1   7289 3 3 109 TRP CH2  C  -66.951 -10.975  -55.419 1.00 . C C . 109 TRP CH2  1 1 
        1   7290 3 3 109 TRP CZ2  C  -67.625 -10.048  -56.179 1.00 . C C . 109 TRP CZ2  1 1 
        1   7291 3 3 109 TRP CZ3  C  -67.598 -12.098  -54.888 1.00 . C C . 109 TRP CZ3  1 1 
        1   7292 3 3 109 TRP H    H  -73.979 -11.316  -57.450 1.00 . C C . 109 TRP H    1 1 
        1   7293 3 3 109 TRP HA   H  -71.905 -13.362  -57.790 1.00 . C C . 109 TRP HA   1 1 
        1   7294 3 3 109 TRP HB2  H  -72.869 -11.713  -55.473 1.00 . C C . 109 TRP HB2  1 1 
        1   7295 3 3 109 TRP HB3  H  -71.694 -12.999  -55.302 1.00 . C C . 109 TRP HB3  1 1 
        1   7296 3 3 109 TRP HD1  H  -72.011  -9.785  -57.514 1.00 . C C . 109 TRP HD1  1 1 
        1   7297 3 3 109 TRP HE1  H  -69.684  -8.690  -57.575 1.00 . C C . 109 TRP HE1  1 1 
        1   7298 3 3 109 TRP HE3  H  -69.433 -13.176  -54.699 1.00 . C C . 109 TRP HE3  1 1 
        1   7299 3 3 109 TRP HH2  H  -65.897 -10.835  -55.228 1.00 . C C . 109 TRP HH2  1 1 
        1   7300 3 3 109 TRP HZ2  H  -67.121  -9.184  -56.586 1.00 . C C . 109 TRP HZ2  1 1 
        1   7301 3 3 109 TRP HZ3  H  -67.038 -12.806  -54.296 1.00 . C C . 109 TRP HZ3  1 1 
        1   7302 3 3 109 TRP N    N  -73.505 -12.027  -57.930 1.00 . C C . 109 TRP N    1 1 
        1   7303 3 3 109 TRP NE1  N  -69.891  -9.526  -57.107 1.00 . C C . 109 TRP NE1  1 1 
        1   7304 3 3 109 TRP O    O  -74.746 -13.923  -56.443 1.00 . C C . 109 TRP O    1 1 
        1   7305 3 3 110 GLY C    C  -74.048 -16.258  -54.457 1.00 . C C . 110 GLY C    1 1 
        1   7306 3 3 110 GLY CA   C  -73.667 -16.390  -55.916 1.00 . C C . 110 GLY CA   1 1 
        1   7307 3 3 110 GLY H    H  -71.966 -15.310  -56.555 1.00 . C C . 110 GLY H    1 1 
        1   7308 3 3 110 GLY HA2  H  -74.566 -16.500  -56.504 1.00 . C C . 110 GLY HA2  1 1 
        1   7309 3 3 110 GLY HA3  H  -73.056 -17.272  -56.039 1.00 . C C . 110 GLY HA3  1 1 
        1   7310 3 3 110 GLY N    N  -72.930 -15.236  -56.396 1.00 . C C . 110 GLY N    1 1 
        1   7311 3 3 110 GLY O    O  -74.729 -15.302  -54.051 1.00 . C C . 110 GLY O    1 1 
        1   7312 3 3 111 GLN C    C  -72.927 -18.113  -51.524 1.00 . C C . 111 GLN C    1 1 
        1   7313 3 3 111 GLN CA   C  -73.988 -17.333  -52.271 1.00 . C C . 111 GLN CA   1 1 
        1   7314 3 3 111 GLN CB   C  -75.329 -18.060  -52.170 1.00 . C C . 111 GLN CB   1 1 
        1   7315 3 3 111 GLN CD   C  -76.539 -20.217  -52.842 1.00 . C C . 111 GLN CD   1 1 
        1   7316 3 3 111 GLN CG   C  -75.222 -19.567  -52.470 1.00 . C C . 111 GLN CG   1 1 
        1   7317 3 3 111 GLN H    H  -73.047 -17.932  -54.056 1.00 . C C . 111 GLN H    1 1 
        1   7318 3 3 111 GLN HA   H  -74.081 -16.347  -51.840 1.00 . C C . 111 GLN HA   1 1 
        1   7319 3 3 111 GLN HB2  H  -75.718 -17.934  -51.171 1.00 . C C . 111 GLN HB2  1 1 
        1   7320 3 3 111 GLN HB3  H  -76.020 -17.613  -52.870 1.00 . C C . 111 GLN HB3  1 1 
        1   7321 3 3 111 GLN HE21 H  -75.718 -22.050  -52.731 1.00 . C C . 111 GLN HE21 1 1 
        1   7322 3 3 111 GLN HE22 H  -77.362 -22.027  -53.150 1.00 . C C . 111 GLN HE22 1 1 
        1   7323 3 3 111 GLN HG2  H  -74.531 -19.707  -53.287 1.00 . C C . 111 GLN HG2  1 1 
        1   7324 3 3 111 GLN HG3  H  -74.823 -20.063  -51.596 1.00 . C C . 111 GLN HG3  1 1 
        1   7325 3 3 111 GLN N    N  -73.590 -17.218  -53.663 1.00 . C C . 111 GLN N    1 1 
        1   7326 3 3 111 GLN NE2  N  -76.540 -21.549  -52.914 1.00 . C C . 111 GLN NE2  1 1 
        1   7327 3 3 111 GLN O    O  -72.871 -18.083  -50.293 1.00 . C C . 111 GLN O    1 1 
        1   7328 3 3 111 GLN OE1  O  -77.547 -19.534  -53.069 1.00 . C C . 111 GLN OE1  1 1 
        1   7329 3 3 112 GLY C    C  -71.239 -21.076  -51.488 1.00 . C C . 112 GLY C    1 1 
        1   7330 3 3 112 GLY CA   C  -71.000 -19.594  -51.723 1.00 . C C . 112 GLY CA   1 1 
        1   7331 3 3 112 GLY H    H  -72.229 -18.822  -53.253 1.00 . C C . 112 GLY H    1 1 
        1   7332 3 3 112 GLY HA2  H  -70.160 -19.499  -52.392 1.00 . C C . 112 GLY HA2  1 1 
        1   7333 3 3 112 GLY HA3  H  -70.728 -19.141  -50.780 1.00 . C C . 112 GLY HA3  1 1 
        1   7334 3 3 112 GLY N    N  -72.107 -18.833  -52.281 1.00 . C C . 112 GLY N    1 1 
        1   7335 3 3 112 GLY O    O  -72.345 -21.513  -51.183 1.00 . C C . 112 GLY O    1 1 
        1   7336 3 3 113 THR C    C  -68.843 -22.947  -50.224 1.00 . C C . 113 THR C    1 1 
        1   7337 3 3 113 THR CA   C  -70.069 -23.140  -51.069 1.00 . C C . 113 THR CA   1 1 
        1   7338 3 3 113 THR CB   C  -69.743 -24.222  -52.064 1.00 . C C . 113 THR CB   1 1 
        1   7339 3 3 113 THR CG2  C  -70.357 -25.550  -51.626 1.00 . C C . 113 THR CG2  1 1 
        1   7340 3 3 113 THR H    H  -69.358 -21.419  -51.978 1.00 . C C . 113 THR H    1 1 
        1   7341 3 3 113 THR HA   H  -70.935 -23.383  -50.470 1.00 . C C . 113 THR HA   1 1 
        1   7342 3 3 113 THR HB   H  -68.671 -24.335  -52.122 1.00 . C C . 113 THR HB   1 1 
        1   7343 3 3 113 THR HG1  H  -70.142 -22.890  -53.428 1.00 . C C . 113 THR HG1  1 1 
        1   7344 3 3 113 THR HG21 H  -69.837 -25.916  -50.753 1.00 . C C . 113 THR HG21 1 1 
        1   7345 3 3 113 THR HG22 H  -70.267 -26.269  -52.426 1.00 . C C . 113 THR HG22 1 1 
        1   7346 3 3 113 THR HG23 H  -71.400 -25.404  -51.389 1.00 . C C . 113 THR HG23 1 1 
        1   7347 3 3 113 THR N    N  -70.187 -21.852  -51.687 1.00 . C C . 113 THR N    1 1 
        1   7348 3 3 113 THR O    O  -67.799 -22.535  -50.739 1.00 . C C . 113 THR O    1 1 
        1   7349 3 3 113 THR OG1  O  -70.240 -23.841  -53.343 1.00 . C C . 113 THR OG1  1 1 
        1   7350 3 3 114 SER C    C  -66.994 -24.475  -48.411 1.00 . C C . 114 SER C    1 1 
        1   7351 3 3 114 SER CA   C  -67.812 -23.233  -48.069 1.00 . C C . 114 SER CA   1 1 
        1   7352 3 3 114 SER CB   C  -68.258 -23.271  -46.619 1.00 . C C . 114 SER CB   1 1 
        1   7353 3 3 114 SER H    H  -69.835 -23.492  -48.577 1.00 . C C . 114 SER H    1 1 
        1   7354 3 3 114 SER HA   H  -67.212 -22.351  -48.238 1.00 . C C . 114 SER HA   1 1 
        1   7355 3 3 114 SER HB2  H  -68.460 -22.269  -46.282 1.00 . C C . 114 SER HB2  1 1 
        1   7356 3 3 114 SER HB3  H  -69.167 -23.855  -46.548 1.00 . C C . 114 SER HB3  1 1 
        1   7357 3 3 114 SER HG   H  -66.966 -23.166  -45.173 1.00 . C C . 114 SER HG   1 1 
        1   7358 3 3 114 SER N    N  -68.968 -23.198  -48.927 1.00 . C C . 114 SER N    1 1 
        1   7359 3 3 114 SER O    O  -67.548 -25.541  -48.655 1.00 . C C . 114 SER O    1 1 
        1   7360 3 3 114 SER OG   O  -67.259 -23.840  -45.790 1.00 . C C . 114 SER OG   1 1 
        1   7361 3 3 115 VAL C    C  -63.676 -25.379  -47.611 1.00 . C C . 115 VAL C    1 1 
        1   7362 3 3 115 VAL CA   C  -64.789 -25.472  -48.647 1.00 . C C . 115 VAL CA   1 1 
        1   7363 3 3 115 VAL CB   C  -64.162 -25.514  -50.072 1.00 . C C . 115 VAL CB   1 1 
        1   7364 3 3 115 VAL CG1  C  -63.244 -26.721  -50.237 1.00 . C C . 115 VAL CG1  1 1 
        1   7365 3 3 115 VAL CG2  C  -65.231 -25.511  -51.140 1.00 . C C . 115 VAL CG2  1 1 
        1   7366 3 3 115 VAL H    H  -65.290 -23.448  -48.281 1.00 . C C . 115 VAL H    1 1 
        1   7367 3 3 115 VAL HA   H  -65.348 -26.381  -48.481 1.00 . C C . 115 VAL HA   1 1 
        1   7368 3 3 115 VAL HB   H  -63.559 -24.623  -50.192 1.00 . C C . 115 VAL HB   1 1 
        1   7369 3 3 115 VAL HG11 H  -62.242 -26.456  -49.933 1.00 . C C . 115 VAL HG11 1 1 
        1   7370 3 3 115 VAL HG12 H  -63.237 -27.030  -51.272 1.00 . C C . 115 VAL HG12 1 1 
        1   7371 3 3 115 VAL HG13 H  -63.603 -27.533  -49.622 1.00 . C C . 115 VAL HG13 1 1 
        1   7372 3 3 115 VAL HG21 H  -66.186 -25.280  -50.693 1.00 . C C . 115 VAL HG21 1 1 
        1   7373 3 3 115 VAL HG22 H  -65.277 -26.485  -51.606 1.00 . C C . 115 VAL HG22 1 1 
        1   7374 3 3 115 VAL HG23 H  -64.993 -24.766  -51.886 1.00 . C C . 115 VAL HG23 1 1 
        1   7375 3 3 115 VAL N    N  -65.678 -24.330  -48.460 1.00 . C C . 115 VAL N    1 1 
        1   7376 3 3 115 VAL O    O  -62.933 -24.386  -47.578 1.00 . C C . 115 VAL O    1 1 
        1   7377 3 3 116 THR C    C  -61.483 -27.587  -46.000 1.00 . C C . 116 THR C    1 1 
        1   7378 3 3 116 THR CA   C  -62.430 -26.415  -45.816 1.00 . C C . 116 THR CA   1 1 
        1   7379 3 3 116 THR CB   C  -62.778 -26.170  -44.314 1.00 . C C . 116 THR CB   1 1 
        1   7380 3 3 116 THR CG2  C  -64.250 -26.436  -44.001 1.00 . C C . 116 THR CG2  1 1 
        1   7381 3 3 116 THR H    H  -64.182 -27.149  -46.797 1.00 . C C . 116 THR H    1 1 
        1   7382 3 3 116 THR HA   H  -61.839 -25.555  -46.106 1.00 . C C . 116 THR HA   1 1 
        1   7383 3 3 116 THR HB   H  -62.562 -25.135  -44.087 1.00 . C C . 116 THR HB   1 1 
        1   7384 3 3 116 THR HG1  H  -61.324 -26.409  -43.028 1.00 . C C . 116 THR HG1  1 1 
        1   7385 3 3 116 THR HG21 H  -64.487 -26.040  -43.025 1.00 . C C . 116 THR HG21 1 1 
        1   7386 3 3 116 THR HG22 H  -64.434 -27.500  -44.014 1.00 . C C . 116 THR HG22 1 1 
        1   7387 3 3 116 THR HG23 H  -64.868 -25.954  -44.744 1.00 . C C . 116 THR HG23 1 1 
        1   7388 3 3 116 THR N    N  -63.565 -26.390  -46.749 1.00 . C C . 116 THR N    1 1 
        1   7389 3 3 116 THR O    O  -61.872 -28.667  -46.434 1.00 . C C . 116 THR O    1 1 
        1   7390 3 3 116 THR OG1  O  -61.927 -26.987  -43.501 1.00 . C C . 116 THR OG1  1 1 
        1   7391 3 3 117 VAL C    C  -58.380 -28.349  -44.624 1.00 . C C . 117 VAL C    1 1 
        1   7392 3 3 117 VAL CA   C  -59.137 -28.229  -45.931 1.00 . C C . 117 VAL CA   1 1 
        1   7393 3 3 117 VAL CB   C  -58.223 -27.736  -47.046 1.00 . C C . 117 VAL CB   1 1 
        1   7394 3 3 117 VAL CG1  C  -57.117 -28.748  -47.320 1.00 . C C . 117 VAL CG1  1 1 
        1   7395 3 3 117 VAL CG2  C  -59.025 -27.515  -48.291 1.00 . C C . 117 VAL CG2  1 1 
        1   7396 3 3 117 VAL H    H  -60.006 -26.414  -45.381 1.00 . C C . 117 VAL H    1 1 
        1   7397 3 3 117 VAL HA   H  -59.539 -29.197  -46.197 1.00 . C C . 117 VAL HA   1 1 
        1   7398 3 3 117 VAL HB   H  -57.775 -26.801  -46.743 1.00 . C C . 117 VAL HB   1 1 
        1   7399 3 3 117 VAL HG11 H  -56.596 -28.475  -48.226 1.00 . C C . 117 VAL HG11 1 1 
        1   7400 3 3 117 VAL HG12 H  -57.549 -29.731  -47.436 1.00 . C C . 117 VAL HG12 1 1 
        1   7401 3 3 117 VAL HG13 H  -56.422 -28.755  -46.493 1.00 . C C . 117 VAL HG13 1 1 
        1   7402 3 3 117 VAL HG21 H  -58.590 -26.709  -48.861 1.00 . C C . 117 VAL HG21 1 1 
        1   7403 3 3 117 VAL HG22 H  -60.041 -27.261  -48.024 1.00 . C C . 117 VAL HG22 1 1 
        1   7404 3 3 117 VAL HG23 H  -59.023 -28.417  -48.885 1.00 . C C . 117 VAL HG23 1 1 
        1   7405 3 3 117 VAL N    N  -60.222 -27.317  -45.694 1.00 . C C . 117 VAL N    1 1 
        1   7406 3 3 117 VAL O    O  -57.879 -27.356  -44.072 1.00 . C C . 117 VAL O    1 1 
        1   7407 3 3 118 SER C    C  -57.856 -31.478  -42.794 1.00 . C C . 118 SER C    1 1 
        1   7408 3 3 118 SER CA   C  -57.985 -29.953  -42.782 1.00 . C C . 118 SER CA   1 1 
        1   7409 3 3 118 SER CB   C  -59.147 -29.538  -41.865 1.00 . C C . 118 SER CB   1 1 
        1   7410 3 3 118 SER H    H  -58.725 -30.292  -44.704 1.00 . C C . 118 SER H    1 1 
        1   7411 3 3 118 SER HA   H  -57.060 -29.491  -42.469 1.00 . C C . 118 SER HA   1 1 
        1   7412 3 3 118 SER HB2  H  -59.691 -28.733  -42.327 1.00 . C C . 118 SER HB2  1 1 
        1   7413 3 3 118 SER HB3  H  -59.815 -30.383  -41.744 1.00 . C C . 118 SER HB3  1 1 
        1   7414 3 3 118 SER HG   H  -58.177 -28.306  -40.728 1.00 . C C . 118 SER HG   1 1 
        1   7415 3 3 118 SER N    N  -58.305 -29.595  -44.159 1.00 . C C . 118 SER N    1 1 
        1   7416 3 3 118 SER O    O  -58.157 -32.121  -43.813 1.00 . C C . 118 SER O    1 1 
        1   7417 3 3 118 SER OG   O  -58.695 -29.105  -40.600 1.00 . C C . 118 SER OG   1 1 
        1   7418 3 3 119 SER C    C  -58.326 -34.060  -40.472 1.00 . C C . 119 SER C    1 1 
        1   7419 3 3 119 SER CA   C  -57.391 -33.526  -41.564 1.00 . C C . 119 SER CA   1 1 
        1   7420 3 3 119 SER CB   C  -55.957 -33.993  -41.318 1.00 . C C . 119 SER CB   1 1 
        1   7421 3 3 119 SER H    H  -57.217 -31.510  -40.895 1.00 . C C . 119 SER H    1 1 
        1   7422 3 3 119 SER HA   H  -57.722 -33.938  -42.506 1.00 . C C . 119 SER HA   1 1 
        1   7423 3 3 119 SER HB2  H  -55.733 -33.921  -40.268 1.00 . C C . 119 SER HB2  1 1 
        1   7424 3 3 119 SER HB3  H  -55.862 -35.026  -41.630 1.00 . C C . 119 SER HB3  1 1 
        1   7425 3 3 119 SER HG   H  -54.884 -32.384  -41.533 1.00 . C C . 119 SER HG   1 1 
        1   7426 3 3 119 SER N    N  -57.432 -32.061  -41.677 1.00 . C C . 119 SER N    1 1 
        1   7427 3 3 119 SER O    O  -59.413 -34.561  -40.755 1.00 . C C . 119 SER O    1 1 
        1   7428 3 3 119 SER OG   O  -55.039 -33.184  -42.042 1.00 . C C . 119 SER OG   1 1 
        1   7429 3 3 121 LYS C    C  -63.887 -34.806  -39.238 1.00 . C C . 121 LYS C    1 1 
        1   7430 3 3 121 LYS CA   C  -62.485 -35.408  -39.399 1.00 . C C . 121 LYS CA   1 1 
        1   7431 3 3 121 LYS CB   C  -61.735 -35.482  -38.058 1.00 . C C . 121 LYS CB   1 1 
        1   7432 3 3 121 LYS CD   C  -60.392 -33.280  -37.998 1.00 . C C . 121 LYS CD   1 1 
        1   7433 3 3 121 LYS CE   C  -59.725 -32.348  -36.994 1.00 . C C . 121 LYS CE   1 1 
        1   7434 3 3 121 LYS CG   C  -61.489 -34.136  -37.339 1.00 . C C . 121 LYS CG   1 1 
        1   7435 3 3 121 LYS H    H  -61.153 -35.383  -40.963 1.00 . C C . 121 LYS H    1 1 
        1   7436 3 3 121 LYS HA   H  -62.614 -36.422  -39.753 1.00 . C C . 121 LYS HA   1 1 
        1   7437 3 3 121 LYS HB2  H  -62.301 -36.113  -37.392 1.00 . C C . 121 LYS HB2  1 1 
        1   7438 3 3 121 LYS HB3  H  -60.779 -35.954  -38.236 1.00 . C C . 121 LYS HB3  1 1 
        1   7439 3 3 121 LYS HD2  H  -59.644 -33.933  -38.422 1.00 . C C . 121 LYS HD2  1 1 
        1   7440 3 3 121 LYS HD3  H  -60.833 -32.691  -38.789 1.00 . C C . 121 LYS HD3  1 1 
        1   7441 3 3 121 LYS HE2  H  -58.907 -31.840  -37.481 1.00 . C C . 121 LYS HE2  1 1 
        1   7442 3 3 121 LYS HE3  H  -60.447 -31.612  -36.671 1.00 . C C . 121 LYS HE3  1 1 
        1   7443 3 3 121 LYS HG2  H  -62.409 -33.572  -37.335 1.00 . C C . 121 LYS HG2  1 1 
        1   7444 3 3 121 LYS HG3  H  -61.205 -34.339  -36.316 1.00 . C C . 121 LYS HG3  1 1 
        1   7445 3 3 121 LYS HZ1  H  -58.466 -32.485  -35.333 1.00 . C C . 121 LYS HZ1  1 1 
        1   7446 3 3 121 LYS HZ2  H  -58.775 -33.974  -36.091 1.00 . C C . 121 LYS HZ2  1 1 
        1   7447 3 3 121 LYS HZ3  H  -59.968 -33.246  -35.124 1.00 . C C . 121 LYS HZ3  1 1 
        1   7448 3 3 121 LYS N    N  -61.704 -34.700  -40.407 1.00 . C C . 121 LYS N    1 1 
        1   7449 3 3 121 LYS NZ   N  -59.193 -33.068  -35.794 1.00 . C C . 121 LYS NZ   1 1 
        1   7450 3 3 121 LYS O    O  -64.177 -34.066  -38.281 1.00 . C C . 121 LYS O    1 1 
        1   7451 3 3 122 THR C    C  -66.939 -35.204  -39.019 1.00 . C C . 122 THR C    1 1 
        1   7452 3 3 122 THR CA   C  -66.144 -34.695  -40.224 1.00 . C C . 122 THR CA   1 1 
        1   7453 3 3 122 THR CB   C  -66.822 -35.150  -41.523 1.00 . C C . 122 THR CB   1 1 
        1   7454 3 3 122 THR CG2  C  -68.250 -34.699  -41.577 1.00 . C C . 122 THR CG2  1 1 
        1   7455 3 3 122 THR H    H  -64.437 -35.730  -40.917 1.00 . C C . 122 THR H    1 1 
        1   7456 3 3 122 THR HA   H  -66.153 -33.616  -40.202 1.00 . C C . 122 THR HA   1 1 
        1   7457 3 3 122 THR HB   H  -66.783 -36.227  -41.589 1.00 . C C . 122 THR HB   1 1 
        1   7458 3 3 122 THR HG1  H  -65.217 -34.424  -42.363 1.00 . C C . 122 THR HG1  1 1 
        1   7459 3 3 122 THR HG21 H  -68.366 -33.801  -40.989 1.00 . C C . 122 THR HG21 1 1 
        1   7460 3 3 122 THR HG22 H  -68.888 -35.475  -41.181 1.00 . C C . 122 THR HG22 1 1 
        1   7461 3 3 122 THR HG23 H  -68.524 -34.495  -42.602 1.00 . C C . 122 THR HG23 1 1 
        1   7462 3 3 122 THR N    N  -64.749 -35.141  -40.198 1.00 . C C . 122 THR N    1 1 
        1   7463 3 3 122 THR O    O  -66.689 -36.297  -38.514 1.00 . C C . 122 THR O    1 1 
        1   7464 3 3 122 THR OG1  O  -66.125 -34.582  -42.632 1.00 . C C . 122 THR OG1  1 1 
        1   7465 3 3 123 THR C    C  -70.117 -34.150  -37.577 1.00 . C C . 123 THR C    1 1 
        1   7466 3 3 123 THR CA   C  -68.715 -34.747  -37.412 1.00 . C C . 123 THR CA   1 1 
        1   7467 3 3 123 THR CB   C  -68.070 -34.224  -36.108 1.00 . C C . 123 THR CB   1 1 
        1   7468 3 3 123 THR CG2  C  -68.634 -34.951  -34.893 1.00 . C C . 123 THR CG2  1 1 
        1   7469 3 3 123 THR H    H  -68.040 -33.540  -39.006 1.00 . C C . 123 THR H    1 1 
        1   7470 3 3 123 THR HA   H  -68.798 -35.823  -37.353 1.00 . C C . 123 THR HA   1 1 
        1   7471 3 3 123 THR HB   H  -68.294 -33.171  -36.014 1.00 . C C . 123 THR HB   1 1 
        1   7472 3 3 123 THR HG1  H  -66.243 -33.664  -35.674 1.00 . C C . 123 THR HG1  1 1 
        1   7473 3 3 123 THR HG21 H  -68.972 -35.934  -35.187 1.00 . C C . 123 THR HG21 1 1 
        1   7474 3 3 123 THR HG22 H  -69.464 -34.390  -34.491 1.00 . C C . 123 THR HG22 1 1 
        1   7475 3 3 123 THR HG23 H  -67.864 -35.045  -34.141 1.00 . C C . 123 THR HG23 1 1 
        1   7476 3 3 123 THR N    N  -67.893 -34.401  -38.562 1.00 . C C . 123 THR N    1 1 
        1   7477 3 3 123 THR O    O  -70.298 -32.930  -37.498 1.00 . C C . 123 THR O    1 1 
        1   7478 3 3 123 THR OG1  O  -66.643 -34.385  -36.166 1.00 . C C . 123 THR OG1  1 1 
        1   7479 3 3 124 ALA C    C  -72.930 -33.778  -36.706 1.00 . C C . 124 ALA C    1 1 
        1   7480 3 3 124 ALA CA   C  -72.497 -34.586  -37.935 1.00 . C C . 124 ALA CA   1 1 
        1   7481 3 3 124 ALA CB   C  -73.388 -35.788  -38.113 1.00 . C C . 124 ALA CB   1 1 
        1   7482 3 3 124 ALA H    H  -70.892 -35.967  -37.886 1.00 . C C . 124 ALA H    1 1 
        1   7483 3 3 124 ALA HA   H  -72.592 -33.956  -38.807 1.00 . C C . 124 ALA HA   1 1 
        1   7484 3 3 124 ALA HB1  H  -72.782 -36.677  -38.200 1.00 . C C . 124 ALA HB1  1 1 
        1   7485 3 3 124 ALA HB2  H  -73.980 -35.667  -39.009 1.00 . C C . 124 ALA HB2  1 1 
        1   7486 3 3 124 ALA HB3  H  -74.042 -35.881  -37.259 1.00 . C C . 124 ALA HB3  1 1 
        1   7487 3 3 124 ALA N    N  -71.103 -35.012  -37.823 1.00 . C C . 124 ALA N    1 1 
        1   7488 3 3 124 ALA O    O  -72.601 -34.137  -35.583 1.00 . C C . 124 ALA O    1 1 
        1   7489 3 3 125 PRO C    C  -75.239 -32.421  -34.995 1.00 . C C . 125 PRO C    1 1 
        1   7490 3 3 125 PRO CA   C  -74.040 -31.863  -35.757 1.00 . C C . 125 PRO CA   1 1 
        1   7491 3 3 125 PRO CB   C  -74.392 -30.508  -36.382 1.00 . C C . 125 PRO CB   1 1 
        1   7492 3 3 125 PRO CD   C  -74.272 -32.174  -38.158 1.00 . C C . 125 PRO CD   1 1 
        1   7493 3 3 125 PRO CG   C  -74.856 -30.828  -37.762 1.00 . C C . 125 PRO CG   1 1 
        1   7494 3 3 125 PRO HA   H  -73.199 -31.742  -35.096 1.00 . C C . 125 PRO HA   1 1 
        1   7495 3 3 125 PRO HB2  H  -75.181 -30.029  -35.818 1.00 . C C . 125 PRO HB2  1 1 
        1   7496 3 3 125 PRO HB3  H  -73.519 -29.875  -36.423 1.00 . C C . 125 PRO HB3  1 1 
        1   7497 3 3 125 PRO HD2  H  -75.052 -32.838  -38.505 1.00 . C C . 125 PRO HD2  1 1 
        1   7498 3 3 125 PRO HD3  H  -73.511 -32.051  -38.914 1.00 . C C . 125 PRO HD3  1 1 
        1   7499 3 3 125 PRO HG2  H  -75.936 -30.875  -37.781 1.00 . C C . 125 PRO HG2  1 1 
        1   7500 3 3 125 PRO HG3  H  -74.511 -30.070  -38.448 1.00 . C C . 125 PRO HG3  1 1 
        1   7501 3 3 125 PRO N    N  -73.671 -32.679  -36.910 1.00 . C C . 125 PRO N    1 1 
        1   7502 3 3 125 PRO O    O  -76.197 -32.908  -35.607 1.00 . C C . 125 PRO O    1 1 
        1   7503 3 3 126 SER C    C  -77.223 -31.524  -32.698 1.00 . C C . 126 SER C    1 1 
        1   7504 3 3 126 SER CA   C  -76.284 -32.726  -32.808 1.00 . C C . 126 SER CA   1 1 
        1   7505 3 3 126 SER CB   C  -75.765 -33.150  -31.433 1.00 . C C . 126 SER CB   1 1 
        1   7506 3 3 126 SER H    H  -74.371 -31.954  -33.259 1.00 . C C . 126 SER H    1 1 
        1   7507 3 3 126 SER HA   H  -76.816 -33.551  -33.260 1.00 . C C . 126 SER HA   1 1 
        1   7508 3 3 126 SER HB2  H  -75.391 -32.284  -30.914 1.00 . C C . 126 SER HB2  1 1 
        1   7509 3 3 126 SER HB3  H  -76.585 -33.570  -30.864 1.00 . C C . 126 SER HB3  1 1 
        1   7510 3 3 126 SER HG   H  -74.312 -34.202  -30.675 1.00 . C C . 126 SER HG   1 1 
        1   7511 3 3 126 SER N    N  -75.169 -32.349  -33.668 1.00 . C C . 126 SER N    1 1 
        1   7512 3 3 126 SER O    O  -76.763 -30.400  -32.490 1.00 . C C . 126 SER O    1 1 
        1   7513 3 3 126 SER OG   O  -74.715 -34.105  -31.541 1.00 . C C . 126 SER OG   1 1 
        1   7514 3 3 127 VAL C    C  -80.632 -30.895  -31.889 1.00 . C C . 127 VAL C    1 1 
        1   7515 3 3 127 VAL CA   C  -79.529 -30.684  -32.916 1.00 . C C . 127 VAL CA   1 1 
        1   7516 3 3 127 VAL CB   C  -80.188 -30.562  -34.315 1.00 . C C . 127 VAL CB   1 1 
        1   7517 3 3 127 VAL CG1  C  -81.280 -29.488  -34.320 1.00 . C C . 127 VAL CG1  1 1 
        1   7518 3 3 127 VAL CG2  C  -79.152 -30.271  -35.387 1.00 . C C . 127 VAL CG2  1 1 
        1   7519 3 3 127 VAL H    H  -78.816 -32.678  -33.050 1.00 . C C . 127 VAL H    1 1 
        1   7520 3 3 127 VAL HA   H  -79.033 -29.751  -32.695 1.00 . C C . 127 VAL HA   1 1 
        1   7521 3 3 127 VAL HB   H  -80.657 -31.510  -34.543 1.00 . C C . 127 VAL HB   1 1 
        1   7522 3 3 127 VAL HG11 H  -82.173 -29.881  -33.857 1.00 . C C . 127 VAL HG11 1 1 
        1   7523 3 3 127 VAL HG12 H  -81.498 -29.201  -35.338 1.00 . C C . 127 VAL HG12 1 1 
        1   7524 3 3 127 VAL HG13 H  -80.938 -28.625  -33.767 1.00 . C C . 127 VAL HG13 1 1 
        1   7525 3 3 127 VAL HG21 H  -78.703 -29.307  -35.202 1.00 . C C . 127 VAL HG21 1 1 
        1   7526 3 3 127 VAL HG22 H  -79.629 -30.266  -36.357 1.00 . C C . 127 VAL HG22 1 1 
        1   7527 3 3 127 VAL HG23 H  -78.388 -31.034  -35.366 1.00 . C C . 127 VAL HG23 1 1 
        1   7528 3 3 127 VAL N    N  -78.526 -31.760  -32.867 1.00 . C C . 127 VAL N    1 1 
        1   7529 3 3 127 VAL O    O  -81.469 -31.786  -32.032 1.00 . C C . 127 VAL O    1 1 
        1   7530 3 3 128 TYR C    C  -82.563 -28.940  -29.870 1.00 . C C . 128 TYR C    1 1 
        1   7531 3 3 128 TYR CA   C  -81.644 -30.157  -29.818 1.00 . C C . 128 TYR CA   1 1 
        1   7532 3 3 128 TYR CB   C  -80.975 -30.261  -28.442 1.00 . C C . 128 TYR CB   1 1 
        1   7533 3 3 128 TYR CD1  C  -79.661 -32.436  -28.439 1.00 . C C . 128 TYR CD1  1 1 
        1   7534 3 3 128 TYR CD2  C  -78.447 -30.365  -28.322 1.00 . C C . 128 TYR CD2  1 1 
        1   7535 3 3 128 TYR CE1  C  -78.454 -33.151  -28.407 1.00 . C C . 128 TYR CE1  1 1 
        1   7536 3 3 128 TYR CE2  C  -77.236 -31.064  -28.289 1.00 . C C . 128 TYR CE2  1 1 
        1   7537 3 3 128 TYR CG   C  -79.672 -31.035  -28.405 1.00 . C C . 128 TYR CG   1 1 
        1   7538 3 3 128 TYR CZ   C  -77.242 -32.457  -28.332 1.00 . C C . 128 TYR CZ   1 1 
        1   7539 3 3 128 TYR H    H  -79.957 -29.355  -30.810 1.00 . C C . 128 TYR H    1 1 
        1   7540 3 3 128 TYR HA   H  -82.234 -31.046  -29.987 1.00 . C C . 128 TYR HA   1 1 
        1   7541 3 3 128 TYR HB2  H  -80.779 -29.263  -28.086 1.00 . C C . 128 TYR HB2  1 1 
        1   7542 3 3 128 TYR HB3  H  -81.674 -30.730  -27.763 1.00 . C C . 128 TYR HB3  1 1 
        1   7543 3 3 128 TYR HD1  H  -80.596 -32.973  -28.496 1.00 . C C . 128 TYR HD1  1 1 
        1   7544 3 3 128 TYR HD2  H  -78.436 -29.285  -28.295 1.00 . C C . 128 TYR HD2  1 1 
        1   7545 3 3 128 TYR HE1  H  -78.461 -34.231  -28.440 1.00 . C C . 128 TYR HE1  1 1 
        1   7546 3 3 128 TYR HE2  H  -76.301 -30.527  -28.225 1.00 . C C . 128 TYR HE2  1 1 
        1   7547 3 3 128 TYR HH   H  -75.386 -32.579  -27.885 1.00 . C C . 128 TYR HH   1 1 
        1   7548 3 3 128 TYR N    N  -80.640 -30.056  -30.864 1.00 . C C . 128 TYR N    1 1 
        1   7549 3 3 128 TYR O    O  -82.077 -27.817  -30.023 1.00 . C C . 128 TYR O    1 1 
        1   7550 3 3 128 TYR OH   O  -76.042 -33.147  -28.294 1.00 . C C . 128 TYR OH   1 1 
        1   7551 3 3 129 PRO C    C  -84.880 -27.355  -28.381 1.00 . C C . 129 PRO C    1 1 
        1   7552 3 3 129 PRO CA   C  -84.821 -28.027  -29.746 1.00 . C C . 129 PRO CA   1 1 
        1   7553 3 3 129 PRO CB   C  -86.167 -28.675  -30.095 1.00 . C C . 129 PRO CB   1 1 
        1   7554 3 3 129 PRO CD   C  -84.584 -30.446  -29.557 1.00 . C C . 129 PRO CD   1 1 
        1   7555 3 3 129 PRO CG   C  -86.051 -30.095  -29.660 1.00 . C C . 129 PRO CG   1 1 
        1   7556 3 3 129 PRO HA   H  -84.553 -27.315  -30.508 1.00 . C C . 129 PRO HA   1 1 
        1   7557 3 3 129 PRO HB2  H  -86.960 -28.184  -29.547 1.00 . C C . 129 PRO HB2  1 1 
        1   7558 3 3 129 PRO HB3  H  -86.354 -28.622  -31.156 1.00 . C C . 129 PRO HB3  1 1 
        1   7559 3 3 129 PRO HD2  H  -84.363 -30.860  -28.582 1.00 . C C . 129 PRO HD2  1 1 
        1   7560 3 3 129 PRO HD3  H  -84.302 -31.136  -30.337 1.00 . C C . 129 PRO HD3  1 1 
        1   7561 3 3 129 PRO HG2  H  -86.525 -30.218  -28.696 1.00 . C C . 129 PRO HG2  1 1 
        1   7562 3 3 129 PRO HG3  H  -86.525 -30.738  -30.384 1.00 . C C . 129 PRO HG3  1 1 
        1   7563 3 3 129 PRO N    N  -83.890 -29.155  -29.745 1.00 . C C . 129 PRO N    1 1 
        1   7564 3 3 129 PRO O    O  -84.805 -28.028  -27.364 1.00 . C C . 129 PRO O    1 1 
        1   7565 3 3 130 LEU C    C  -86.468 -24.767  -26.791 1.00 . C C . 130 LEU C    1 1 
        1   7566 3 3 130 LEU CA   C  -85.064 -25.304  -27.100 1.00 . C C . 130 LEU CA   1 1 
        1   7567 3 3 130 LEU CB   C  -84.048 -24.159  -27.109 1.00 . C C . 130 LEU CB   1 1 
        1   7568 3 3 130 LEU CD1  C  -82.040 -25.683  -26.646 1.00 . C C . 130 LEU CD1  1 1 
        1   7569 3 3 130 LEU CD2  C  -81.721 -23.326  -27.464 1.00 . C C . 130 LEU CD2  1 1 
        1   7570 3 3 130 LEU CG   C  -82.595 -24.267  -26.632 1.00 . C C . 130 LEU CG   1 1 
        1   7571 3 3 130 LEU H    H  -85.061 -25.544  -29.207 1.00 . C C . 130 LEU H    1 1 
        1   7572 3 3 130 LEU HA   H  -84.788 -25.985  -26.309 1.00 . C C . 130 LEU HA   1 1 
        1   7573 3 3 130 LEU HB2  H  -83.989 -23.821  -28.126 1.00 . C C . 130 LEU HB2  1 1 
        1   7574 3 3 130 LEU HB3  H  -84.508 -23.351  -26.548 1.00 . C C . 130 LEU HB3  1 1 
        1   7575 3 3 130 LEU HD11 H  -81.203 -25.748  -25.967 1.00 . C C . 130 LEU HD11 1 1 
        1   7576 3 3 130 LEU HD12 H  -81.713 -25.932  -27.645 1.00 . C C . 130 LEU HD12 1 1 
        1   7577 3 3 130 LEU HD13 H  -82.810 -26.374  -26.336 1.00 . C C . 130 LEU HD13 1 1 
        1   7578 3 3 130 LEU HD21 H  -81.152 -23.902  -28.179 1.00 . C C . 130 LEU HD21 1 1 
        1   7579 3 3 130 LEU HD22 H  -81.045 -22.793  -26.812 1.00 . C C . 130 LEU HD22 1 1 
        1   7580 3 3 130 LEU HD23 H  -82.348 -22.621  -27.988 1.00 . C C . 130 LEU HD23 1 1 
        1   7581 3 3 130 LEU HG   H  -82.564 -23.920  -25.610 1.00 . C C . 130 LEU HG   1 1 
        1   7582 3 3 130 LEU N    N  -85.008 -26.036  -28.361 1.00 . C C . 130 LEU N    1 1 
        1   7583 3 3 130 LEU O    O  -86.856 -23.692  -27.266 1.00 . C C . 130 LEU O    1 1 
        1   7584 3 3 131 ALA C    C  -88.400 -24.186  -24.292 1.00 . C C . 131 ALA C    1 1 
        1   7585 3 3 131 ALA CA   C  -88.540 -25.088  -25.532 1.00 . C C . 131 ALA CA   1 1 
        1   7586 3 3 131 ALA CB   C  -89.378 -26.288  -25.218 1.00 . C C . 131 ALA CB   1 1 
        1   7587 3 3 131 ALA H    H  -86.859 -26.366  -25.657 1.00 . C C . 131 ALA H    1 1 
        1   7588 3 3 131 ALA HA   H  -89.018 -24.524  -26.319 1.00 . C C . 131 ALA HA   1 1 
        1   7589 3 3 131 ALA HB1  H  -90.397 -26.106  -25.525 1.00 . C C . 131 ALA HB1  1 1 
        1   7590 3 3 131 ALA HB2  H  -89.351 -26.478  -24.155 1.00 . C C . 131 ALA HB2  1 1 
        1   7591 3 3 131 ALA HB3  H  -88.992 -27.146  -25.747 1.00 . C C . 131 ALA HB3  1 1 
        1   7592 3 3 131 ALA N    N  -87.225 -25.523  -25.997 1.00 . C C . 131 ALA N    1 1 
        1   7593 3 3 131 ALA O    O  -87.528 -24.443  -23.449 1.00 . C C . 131 ALA O    1 1 
        1   7594 3 3 132 PRO C    C  -89.412 -22.835  -21.660 1.00 . C C . 132 PRO C    1 1 
        1   7595 3 3 132 PRO CA   C  -89.090 -22.213  -23.036 1.00 . C C . 132 PRO CA   1 1 
        1   7596 3 3 132 PRO CB   C  -90.050 -21.061  -23.375 1.00 . C C . 132 PRO CB   1 1 
        1   7597 3 3 132 PRO CD   C  -90.424 -22.791  -24.994 1.00 . C C . 132 PRO CD   1 1 
        1   7598 3 3 132 PRO CG   C  -91.040 -21.622  -24.285 1.00 . C C . 132 PRO CG   1 1 
        1   7599 3 3 132 PRO HA   H  -88.083 -21.831  -23.030 1.00 . C C . 132 PRO HA   1 1 
        1   7600 3 3 132 PRO HB2  H  -90.529 -20.699  -22.477 1.00 . C C . 132 PRO HB2  1 1 
        1   7601 3 3 132 PRO HB3  H  -89.513 -20.259  -23.861 1.00 . C C . 132 PRO HB3  1 1 
        1   7602 3 3 132 PRO HD2  H  -91.122 -23.616  -25.039 1.00 . C C . 132 PRO HD2  1 1 
        1   7603 3 3 132 PRO HD3  H  -90.102 -22.508  -25.984 1.00 . C C . 132 PRO HD3  1 1 
        1   7604 3 3 132 PRO HG2  H  -91.906 -21.947  -23.725 1.00 . C C . 132 PRO HG2  1 1 
        1   7605 3 3 132 PRO HG3  H  -91.333 -20.877  -25.009 1.00 . C C . 132 PRO HG3  1 1 
        1   7606 3 3 132 PRO N    N  -89.256 -23.140  -24.162 1.00 . C C . 132 PRO N    1 1 
        1   7607 3 3 132 PRO O    O  -89.732 -24.022  -21.578 1.00 . C C . 132 PRO O    1 1 
        1   7608 3 3 133 VAL C    C  -90.932 -23.323  -19.201 1.00 . C C . 133 VAL C    1 1 
        1   7609 3 3 133 VAL CA   C  -89.653 -22.468  -19.229 1.00 . C C . 133 VAL CA   1 1 
        1   7610 3 3 133 VAL CB   C  -89.840 -21.228  -18.303 1.00 . C C . 133 VAL CB   1 1 
        1   7611 3 3 133 VAL CG1  C  -88.494 -20.658  -17.899 1.00 . C C . 133 VAL CG1  1 1 
        1   7612 3 3 133 VAL CG2  C  -90.707 -20.141  -18.978 1.00 . C C . 133 VAL CG2  1 1 
        1   7613 3 3 133 VAL H    H  -88.996 -21.120  -20.730 1.00 . C C . 133 VAL H    1 1 
        1   7614 3 3 133 VAL HA   H  -88.844 -23.062  -18.832 1.00 . C C . 133 VAL HA   1 1 
        1   7615 3 3 133 VAL HB   H  -90.344 -21.558  -17.404 1.00 . C C . 133 VAL HB   1 1 
        1   7616 3 3 133 VAL HG11 H  -87.767 -21.454  -17.847 1.00 . C C . 133 VAL HG11 1 1 
        1   7617 3 3 133 VAL HG12 H  -88.580 -20.183  -16.933 1.00 . C C . 133 VAL HG12 1 1 
        1   7618 3 3 133 VAL HG13 H  -88.178 -19.929  -18.631 1.00 . C C . 133 VAL HG13 1 1 
        1   7619 3 3 133 VAL HG21 H  -91.745 -20.440  -18.950 1.00 . C C . 133 VAL HG21 1 1 
        1   7620 3 3 133 VAL HG22 H  -90.396 -20.018  -20.005 1.00 . C C . 133 VAL HG22 1 1 
        1   7621 3 3 133 VAL HG23 H  -90.586 -19.206  -18.452 1.00 . C C . 133 VAL HG23 1 1 
        1   7622 3 3 133 VAL N    N  -89.285 -22.046  -20.592 1.00 . C C . 133 VAL N    1 1 
        1   7623 3 3 133 VAL O    O  -91.964 -22.876  -19.713 1.00 . C C . 133 VAL O    1 1 
        1   7624 3 3 134 CYS C    C  -93.265 -24.850  -17.778 1.00 . C C . 134 CYS C    1 1 
        1   7625 3 3 134 CYS CA   C  -92.093 -25.406  -18.584 1.00 . C C . 134 CYS CA   1 1 
        1   7626 3 3 134 CYS CB   C  -91.828 -26.886  -18.221 1.00 . C C . 134 CYS CB   1 1 
        1   7627 3 3 134 CYS H    H  -90.040 -24.850  -18.229 1.00 . C C . 134 CYS H    1 1 
        1   7628 3 3 134 CYS HA   H  -92.446 -25.420  -19.608 1.00 . C C . 134 CYS HA   1 1 
        1   7629 3 3 134 CYS HB2  H  -92.769 -27.313  -17.927 1.00 . C C . 134 CYS HB2  1 1 
        1   7630 3 3 134 CYS HB3  H  -91.525 -27.385  -19.135 1.00 . C C . 134 CYS HB3  1 1 
        1   7631 3 3 134 CYS N    N  -90.881 -24.533  -18.621 1.00 . C C . 134 CYS N    1 1 
        1   7632 3 3 134 CYS O    O  -94.365 -25.420  -17.794 1.00 . C C . 134 CYS O    1 1 
        1   7633 3 3 134 CYS SG   S  -90.636 -27.328  -16.920 1.00 . C C . 134 CYS SG   1 1 
        1   7634 3 3 135 GLY C    C  -94.974 -22.352  -17.507 1.00 . C C . 135 GLY C    1 1 
        1   7635 3 3 135 GLY CA   C  -94.055 -22.941  -16.453 1.00 . C C . 135 GLY CA   1 1 
        1   7636 3 3 135 GLY H    H  -92.110 -23.357  -17.139 1.00 . C C . 135 GLY H    1 1 
        1   7637 3 3 135 GLY HA2  H  -94.628 -23.569  -15.785 1.00 . C C . 135 GLY HA2  1 1 
        1   7638 3 3 135 GLY HA3  H  -93.601 -22.140  -15.891 1.00 . C C . 135 GLY HA3  1 1 
        1   7639 3 3 135 GLY N    N  -93.013 -23.736  -17.089 1.00 . C C . 135 GLY N    1 1 
        1   7640 3 3 135 GLY O    O  -94.516 -21.924  -18.574 1.00 . C C . 135 GLY O    1 1 
        1   7641 3 3 136 ASP C    C  -97.288 -20.361  -18.262 1.00 . C C . 136 ASP C    1 1 
        1   7642 3 3 136 ASP CA   C  -97.308 -21.884  -18.129 1.00 . C C . 136 ASP CA   1 1 
        1   7643 3 3 136 ASP CB   C  -98.676 -22.397  -17.673 1.00 . C C . 136 ASP CB   1 1 
        1   7644 3 3 136 ASP CG   C  -98.679 -23.911  -17.433 1.00 . C C . 136 ASP CG   1 1 
        1   7645 3 3 136 ASP H    H  -96.550 -22.705  -16.334 1.00 . C C . 136 ASP H    1 1 
        1   7646 3 3 136 ASP HA   H  -97.096 -22.306  -19.101 1.00 . C C . 136 ASP HA   1 1 
        1   7647 3 3 136 ASP HB2  H  -98.952 -21.896  -16.757 1.00 . C C . 136 ASP HB2  1 1 
        1   7648 3 3 136 ASP HB3  H  -99.406 -22.162  -18.434 1.00 . C C . 136 ASP HB3  1 1 
        1   7649 3 3 136 ASP N    N  -96.272 -22.342  -17.201 1.00 . C C . 136 ASP N    1 1 
        1   7650 3 3 136 ASP O    O  -97.840 -19.801  -19.224 1.00 . C C . 136 ASP O    1 1 
        1   7651 3 3 136 ASP OD1  O  -98.202 -24.659  -18.318 1.00 . C C . 136 ASP OD1  1 1 
        1   7652 3 3 136 ASP OD2  O  -99.142 -24.355  -16.354 1.00 . C C . 136 ASP OD2  1 1 
        1   7653 3 3 137 THR C    C  -96.231 -17.618  -18.638 1.00 . C C . 137 THR C    1 1 
        1   7654 3 3 137 THR CA   C  -96.334 -18.274  -17.258 1.00 . C C . 137 THR CA   1 1 
        1   7655 3 3 137 THR CB   C  -95.034 -17.976  -16.458 1.00 . C C . 137 THR CB   1 1 
        1   7656 3 3 137 THR CG2  C  -95.295 -18.036  -14.944 1.00 . C C . 137 THR CG2  1 1 
        1   7657 3 3 137 THR H    H  -96.227 -20.272  -16.585 1.00 . C C . 137 THR H    1 1 
        1   7658 3 3 137 THR HA   H  -97.147 -17.793  -16.734 1.00 . C C . 137 THR HA   1 1 
        1   7659 3 3 137 THR HB   H  -94.689 -16.984  -16.713 1.00 . C C . 137 THR HB   1 1 
        1   7660 3 3 137 THR HG1  H  -93.180 -18.610  -16.466 1.00 . C C . 137 THR HG1  1 1 
        1   7661 3 3 137 THR HG21 H  -96.189 -17.477  -14.711 1.00 . C C . 137 THR HG21 1 1 
        1   7662 3 3 137 THR HG22 H  -94.455 -17.610  -14.417 1.00 . C C . 137 THR HG22 1 1 
        1   7663 3 3 137 THR HG23 H  -95.425 -19.065  -14.643 1.00 . C C . 137 THR HG23 1 1 
        1   7664 3 3 137 THR N    N  -96.629 -19.721  -17.288 1.00 . C C . 137 THR N    1 1 
        1   7665 3 3 137 THR O    O  -95.143 -17.537  -19.234 1.00 . C C . 137 THR O    1 1 
        1   7666 3 3 137 THR OG1  O  -94.016 -18.925  -16.815 1.00 . C C . 137 THR OG1  1 1 
        1   7667 3 3 138 THR C    C  -96.949 -15.027  -20.297 1.00 . C C . 138 THR C    1 1 
        1   7668 3 3 138 THR CA   C  -97.424 -16.485  -20.429 1.00 . C C . 138 THR CA   1 1 
        1   7669 3 3 138 THR CB   C  -98.818 -16.635  -21.133 1.00 . C C . 138 THR CB   1 1 
        1   7670 3 3 138 THR CG2  C  -99.940 -15.890  -20.379 1.00 . C C . 138 THR CG2  1 1 
        1   7671 3 3 138 THR H    H  -98.203 -17.262  -18.620 1.00 . C C . 138 THR H    1 1 
        1   7672 3 3 138 THR HA   H  -96.698 -16.984  -21.059 1.00 . C C . 138 THR HA   1 1 
        1   7673 3 3 138 THR HB   H  -99.064 -17.651  -21.230 1.00 . C C . 138 THR HB   1 1 
        1   7674 3 3 138 THR HG1  H  -98.602 -15.220  -22.467 1.00 . C C . 138 THR HG1  1 1 
        1   7675 3 3 138 THR HG21 H -100.753 -16.573  -20.179 1.00 . C C . 138 THR HG21 1 1 
        1   7676 3 3 138 THR HG22 H -100.298 -15.071  -20.984 1.00 . C C . 138 THR HG22 1 1 
        1   7677 3 3 138 THR HG23 H  -99.554 -15.507  -19.446 1.00 . C C . 138 THR HG23 1 1 
        1   7678 3 3 138 THR N    N  -97.378 -17.161  -19.139 1.00 . C C . 138 THR N    1 1 
        1   7679 3 3 138 THR O    O  -97.411 -14.278  -19.430 1.00 . C C . 138 THR O    1 1 
        1   7680 3 3 138 THR OG1  O  -98.732 -16.171  -22.487 1.00 . C C . 138 THR OG1  1 1 
        1   7681 3 3 139 GLY C    C  -96.324 -12.685  -22.411 1.00 . C C . 139 GLY C    1 1 
        1   7682 3 3 139 GLY CA   C  -95.518 -13.294  -21.281 1.00 . C C . 139 GLY CA   1 1 
        1   7683 3 3 139 GLY H    H  -95.612 -15.348  -21.738 1.00 . C C . 139 GLY H    1 1 
        1   7684 3 3 139 GLY HA2  H  -95.689 -12.744  -20.365 1.00 . C C . 139 GLY HA2  1 1 
        1   7685 3 3 139 GLY HA3  H  -94.469 -13.272  -21.533 1.00 . C C . 139 GLY HA3  1 1 
        1   7686 3 3 139 GLY N    N  -95.963 -14.674  -21.120 1.00 . C C . 139 GLY N    1 1 
        1   7687 3 3 139 GLY O    O  -97.554 -12.623  -22.328 1.00 . C C . 139 GLY O    1 1 
        1   7688 3 3 140 SER C    C  -95.676 -12.065  -25.968 1.00 . C C . 140 SER C    1 1 
        1   7689 3 3 140 SER CA   C  -96.330 -11.679  -24.635 1.00 . C C . 140 SER CA   1 1 
        1   7690 3 3 140 SER CB   C  -96.392 -10.152  -24.481 1.00 . C C . 140 SER CB   1 1 
        1   7691 3 3 140 SER H    H  -94.671 -12.366  -23.499 1.00 . C C . 140 SER H    1 1 
        1   7692 3 3 140 SER HA   H  -97.344 -12.052  -24.644 1.00 . C C . 140 SER HA   1 1 
        1   7693 3 3 140 SER HB2  H  -96.701  -9.907  -23.480 1.00 . C C . 140 SER HB2  1 1 
        1   7694 3 3 140 SER HB3  H  -95.404  -9.741  -24.652 1.00 . C C . 140 SER HB3  1 1 
        1   7695 3 3 140 SER HG   H  -97.299  -8.630  -25.271 1.00 . C C . 140 SER HG   1 1 
        1   7696 3 3 140 SER N    N  -95.645 -12.268  -23.480 1.00 . C C . 140 SER N    1 1 
        1   7697 3 3 140 SER O    O  -96.347 -12.534  -26.894 1.00 . C C . 140 SER O    1 1 
        1   7698 3 3 140 SER OG   O  -97.312  -9.582  -25.393 1.00 . C C . 140 SER OG   1 1 
        1   7699 3 3 141 SER C    C  -92.689 -13.335  -26.876 1.00 . C C . 141 SER C    1 1 
        1   7700 3 3 141 SER CA   C  -93.550 -12.143  -27.214 1.00 . C C . 141 SER CA   1 1 
        1   7701 3 3 141 SER CB   C  -92.644 -10.967  -27.566 1.00 . C C . 141 SER CB   1 1 
        1   7702 3 3 141 SER H    H  -93.921 -11.443  -25.265 1.00 . C C . 141 SER H    1 1 
        1   7703 3 3 141 SER HA   H  -94.187 -12.378  -28.054 1.00 . C C . 141 SER HA   1 1 
        1   7704 3 3 141 SER HB2  H  -92.191 -10.586  -26.667 1.00 . C C . 141 SER HB2  1 1 
        1   7705 3 3 141 SER HB3  H  -91.863 -11.312  -28.232 1.00 . C C . 141 SER HB3  1 1 
        1   7706 3 3 141 SER HG   H  -92.861  -9.120  -28.101 1.00 . C C . 141 SER HG   1 1 
        1   7707 3 3 141 SER N    N  -94.366 -11.834  -26.045 1.00 . C C . 141 SER N    1 1 
        1   7708 3 3 141 SER O    O  -91.566 -13.180  -26.364 1.00 . C C . 141 SER O    1 1 
        1   7709 3 3 141 SER OG   O  -93.372  -9.929  -28.182 1.00 . C C . 141 SER OG   1 1 
        1   7710 3 3 142 VAL C    C  -91.363 -16.043  -27.746 1.00 . C C . 142 VAL C    1 1 
        1   7711 3 3 142 VAL CA   C  -92.573 -15.794  -26.860 1.00 . C C . 142 VAL CA   1 1 
        1   7712 3 3 142 VAL CB   C  -93.544 -16.957  -27.049 1.00 . C C . 142 VAL CB   1 1 
        1   7713 3 3 142 VAL CG1  C  -92.961 -18.236  -26.448 1.00 . C C . 142 VAL CG1  1 1 
        1   7714 3 3 142 VAL CG2  C  -94.880 -16.615  -26.416 1.00 . C C . 142 VAL CG2  1 1 
        1   7715 3 3 142 VAL H    H  -94.121 -14.540  -27.563 1.00 . C C . 142 VAL H    1 1 
        1   7716 3 3 142 VAL HA   H  -92.252 -15.783  -25.830 1.00 . C C . 142 VAL HA   1 1 
        1   7717 3 3 142 VAL HB   H  -93.689 -17.113  -28.109 1.00 . C C . 142 VAL HB   1 1 
        1   7718 3 3 142 VAL HG11 H  -93.700 -18.707  -25.816 1.00 . C C . 142 VAL HG11 1 1 
        1   7719 3 3 142 VAL HG12 H  -92.088 -17.992  -25.860 1.00 . C C . 142 VAL HG12 1 1 
        1   7720 3 3 142 VAL HG13 H  -92.682 -18.913  -27.242 1.00 . C C . 142 VAL HG13 1 1 
        1   7721 3 3 142 VAL HG21 H  -95.613 -16.446  -27.190 1.00 . C C . 142 VAL HG21 1 1 
        1   7722 3 3 142 VAL HG22 H  -94.777 -15.722  -25.817 1.00 . C C . 142 VAL HG22 1 1 
        1   7723 3 3 142 VAL HG23 H  -95.202 -17.433  -25.789 1.00 . C C . 142 VAL HG23 1 1 
        1   7724 3 3 142 VAL N    N  -93.227 -14.520  -27.162 1.00 . C C . 142 VAL N    1 1 
        1   7725 3 3 142 VAL O    O  -91.471 -16.000  -28.967 1.00 . C C . 142 VAL O    1 1 
        1   7726 3 3 143 THR C    C  -88.675 -18.124  -27.642 1.00 . C C . 143 THR C    1 1 
        1   7727 3 3 143 THR CA   C  -89.028 -16.650  -27.902 1.00 . C C . 143 THR CA   1 1 
        1   7728 3 3 143 THR CB   C  -87.794 -15.679  -27.696 1.00 . C C . 143 THR CB   1 1 
        1   7729 3 3 143 THR CG2  C  -88.215 -14.276  -27.224 1.00 . C C . 143 THR CG2  1 1 
        1   7730 3 3 143 THR H    H  -90.176 -16.301  -26.153 1.00 . C C . 143 THR H    1 1 
        1   7731 3 3 143 THR HA   H  -89.312 -16.584  -28.945 1.00 . C C . 143 THR HA   1 1 
        1   7732 3 3 143 THR HB   H  -87.299 -15.573  -28.652 1.00 . C C . 143 THR HB   1 1 
        1   7733 3 3 143 THR HG1  H  -86.146 -15.611  -26.652 1.00 . C C . 143 THR HG1  1 1 
        1   7734 3 3 143 THR HG21 H  -88.668 -14.347  -26.246 1.00 . C C . 143 THR HG21 1 1 
        1   7735 3 3 143 THR HG22 H  -88.927 -13.860  -27.921 1.00 . C C . 143 THR HG22 1 1 
        1   7736 3 3 143 THR HG23 H  -87.345 -13.638  -27.173 1.00 . C C . 143 THR HG23 1 1 
        1   7737 3 3 143 THR N    N  -90.211 -16.288  -27.132 1.00 . C C . 143 THR N    1 1 
        1   7738 3 3 143 THR O    O  -88.695 -18.584  -26.500 1.00 . C C . 143 THR O    1 1 
        1   7739 3 3 143 THR OG1  O  -86.853 -16.246  -26.783 1.00 . C C . 143 THR OG1  1 1 
        1   7740 3 3 144 LEU C    C  -86.589 -20.319  -29.206 1.00 . C C . 144 LEU C    1 1 
        1   7741 3 3 144 LEU CA   C  -87.984 -20.248  -28.625 1.00 . C C . 144 LEU CA   1 1 
        1   7742 3 3 144 LEU CB   C  -88.915 -21.184  -29.405 1.00 . C C . 144 LEU CB   1 1 
        1   7743 3 3 144 LEU CD1  C  -90.748 -21.888  -30.912 1.00 . C C . 144 LEU CD1  1 1 
        1   7744 3 3 144 LEU CD2  C  -91.237 -20.170  -29.205 1.00 . C C . 144 LEU CD2  1 1 
        1   7745 3 3 144 LEU CG   C  -90.185 -20.726  -30.129 1.00 . C C . 144 LEU CG   1 1 
        1   7746 3 3 144 LEU H    H  -88.445 -18.439  -29.602 1.00 . C C . 144 LEU H    1 1 
        1   7747 3 3 144 LEU HA   H  -87.957 -20.546  -27.587 1.00 . C C . 144 LEU HA   1 1 
        1   7748 3 3 144 LEU HB2  H  -88.309 -21.652  -30.158 1.00 . C C . 144 LEU HB2  1 1 
        1   7749 3 3 144 LEU HB3  H  -89.203 -21.969  -28.713 1.00 . C C . 144 LEU HB3  1 1 
        1   7750 3 3 144 LEU HD11 H  -91.379 -22.484  -30.269 1.00 . C C . 144 LEU HD11 1 1 
        1   7751 3 3 144 LEU HD12 H  -89.938 -22.497  -31.286 1.00 . C C . 144 LEU HD12 1 1 
        1   7752 3 3 144 LEU HD13 H  -91.331 -21.515  -31.741 1.00 . C C . 144 LEU HD13 1 1 
        1   7753 3 3 144 LEU HD21 H  -91.824 -20.272  -30.172 1.00 . C C . 144 LEU HD21 1 1 
        1   7754 3 3 144 LEU HD22 H  -90.237 -19.846  -28.923 1.00 . C C . 144 LEU HD22 1 1 
        1   7755 3 3 144 LEU HD23 H  -91.389 -21.090  -28.597 1.00 . C C . 144 LEU HD23 1 1 
        1   7756 3 3 144 LEU HG   H  -89.903 -19.955  -30.835 1.00 . C C . 144 LEU HG   1 1 
        1   7757 3 3 144 LEU N    N  -88.406 -18.862  -28.719 1.00 . C C . 144 LEU N    1 1 
        1   7758 3 3 144 LEU O    O  -86.110 -19.357  -29.808 1.00 . C C . 144 LEU O    1 1 
        1   7759 3 3 145 GLY C    C  -84.330 -22.949  -30.258 1.00 . C C . 145 GLY C    1 1 
        1   7760 3 3 145 GLY CA   C  -84.586 -21.637  -29.535 1.00 . C C . 145 GLY CA   1 1 
        1   7761 3 3 145 GLY H    H  -86.372 -22.195  -28.550 1.00 . C C . 145 GLY H    1 1 
        1   7762 3 3 145 GLY HA2  H  -84.369 -20.829  -30.217 1.00 . C C . 145 GLY HA2  1 1 
        1   7763 3 3 145 GLY HA3  H  -83.903 -21.568  -28.700 1.00 . C C . 145 GLY HA3  1 1 
        1   7764 3 3 145 GLY N    N  -85.938 -21.461  -29.033 1.00 . C C . 145 GLY N    1 1 
        1   7765 3 3 145 GLY O    O  -85.177 -23.856  -30.285 1.00 . C C . 145 GLY O    1 1 
        1   7766 3 3 146 CYS C    C  -81.130 -24.300  -31.118 1.00 . C C . 146 CYS C    1 1 
        1   7767 3 3 146 CYS CA   C  -82.617 -24.243  -31.452 1.00 . C C . 146 CYS CA   1 1 
        1   7768 3 3 146 CYS CB   C  -82.831 -24.239  -32.963 1.00 . C C . 146 CYS CB   1 1 
        1   7769 3 3 146 CYS H    H  -82.547 -22.250  -30.792 1.00 . C C . 146 CYS H    1 1 
        1   7770 3 3 146 CYS HA   H  -83.115 -25.098  -31.017 1.00 . C C . 146 CYS HA   1 1 
        1   7771 3 3 146 CYS HB2  H  -83.886 -24.131  -33.158 1.00 . C C . 146 CYS HB2  1 1 
        1   7772 3 3 146 CYS HB3  H  -82.311 -23.393  -33.390 1.00 . C C . 146 CYS HB3  1 1 
        1   7773 3 3 146 CYS N    N  -83.145 -23.024  -30.858 1.00 . C C . 146 CYS N    1 1 
        1   7774 3 3 146 CYS O    O  -80.432 -23.289  -31.262 1.00 . C C . 146 CYS O    1 1 
        1   7775 3 3 146 CYS SG   S  -82.268 -25.737  -33.750 1.00 . C C . 146 CYS SG   1 1 
        1   7776 3 3 147 LEU C    C  -78.497 -26.669  -31.068 1.00 . C C . 147 LEU C    1 1 
        1